2CU3A

Crystal structure of tt1568 from thermus thermophilus hb8
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
63
structure length
63
Chain Sequence
MVWLNGEPRPLEGKTLKEVLEEMGVELKGVAVLLNEEAFLGLEVPDRPLRDGDVVEVVALMQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TT1568 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords unknown function protein
total genus 13
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2cu3A00
3B9JA 2BS4B 1FXAA 1ZXIA 3DWGC 1XLQA 1DGJA 1QOBA 2BS2B 1NVID 3AE2B 1KF6B 3AMZA 1VLBA 2WU5B 3B2GA 3P63A 1L5PA 4US8A 1E0ZA 1DOIA 2K9XA 1NENB 2H89B 2N0SB 4ITKA 5C2TB 2BS3B 2W54A 1JALA 3W9CB 1FRRA 1F0ZA 2W55A 1JROA 2QIEB 2EKIA 2H88B 1FFVA 1NYQA 4JX1C 1JW9D 1J7AA 4KX6B 1GAQB 1TKGA 1UWMA 3P4QB 4C80A 3W5VB 3CWIA 1L6UA 3SR6A 1FM0D 1QOGA 2DBYA 3P4PB 3AE6B 1PDXA 1RWSA 3AE7B 3AN1A 1JRPA 3NVWA 5EE9A 1VJKA 2WDQB 4YXDB 1JWBD 1B9RA 1ZP0B 1V97A 1CZPA 1XO3A 1YQ3B 1RM6C 1N63A 1R7SA 2Q5WD 1XLNA 1J7CA 2QJLA 5AUIA 1XLOA 3FC4A 1FMAD 2K5PA 5EE3A 1JQ4A 1QOAA 3WCQA 1E6EB 2L52A 3AB5A 5H8YE 2PVGC 1NEKB 3ABVB 2KMMA 1YJJA 3AEFB 3BIID 3P1MA 3P4SB 2MJ3A 3VRAB 4YSZB 5H92C 4US9A 1KRHA 3DWMA 4LTUA 2Y5CA 2WQYB 1DOXA 1NI3A 4YTNB 4C7ZA 2AX5A 3W5UB 2LEKA 5EE1A 2DWQA 3P4RB 3AEDB 3AM9A 5G5HA 1N5XA 4JWSC 2WDRB 1ROEA 3AEAB 3ZYYX 3NS1A 1V8CA 3SFDB 1PUTA 3B2FA 4A9AA 3AE3B 1QF6A 3VR9B 4YTPB 4FXCA 2CJOA 3HVZA 1NYRA 3FAHA 3NVVA 3VRBB 1FO4A 1L6VA 1SF0A 1TYGB 3ETRA 1OQRA 3NRZA 3L4PA 1GPXA 3AEBB 4YSYB 1PFDA 4P6VF 4YSXB 3AV8A 2B76B 1TKEA 5G5GA 5GXGB 1FFUA 4WWMA 1J7BA 2FBWB 2PIAA 3AE8B 1N60A 3KWLA 4JWUC 2CJNA 2M19A 4ZHOA 2CU3A 4ZHPA 1OFFA 1YQ4B 1T3QA 1AWDA 2HTME 2MH7A 3AECB 1SIJA 1WXQA 4N59A 3HUIA 3RPFC 4C7YA 5C3JB 1E10A 2MJDA 2PKOA 4YT0B 3AE9B 4N58A 1I7HA 1RYJA 1N62A 3AE4B 1FRDA 1XLPA 1SB3C 1N61A 2OHFA 2KAJA 3AE5B 2WS3B 4IDIA 3NVZA 4N6EB 1IUEA 1E9MA 1EWYC 1TJEA 1WGKA 2G1EA 2JX5A 1OQQA 3AH7A 1E7PB 3AE1B 4HROA 1DOYA 1FIQA 3NVYA 1FXIA 2JQRB 2WLBA 1KFYB 3CIRB 4HRSA 2L83A 2WU2B 3LXFA 1YJIA 1QOFA 2ACZB 1JWAD 1A70A 2W3RA 3EUB2 2W3SA 1VDVA 2E3TA 4YTMB 4USAA 1WWTA 3HRDD 5EE0A 1QT9A 1CJEA 2M56B 2MJEA 1AYFA 3LB8C 1ZOYB 5AUKA 5MPOA 1TKYA 1RFKA 2K22A 1QLBB 2WDVB 3AEEB 4WQMA 2PVOD 1WYGA 1WRIA 3VR8B 2WP9B 1L0VB 3AEGB 1N5WA 3PO0A 3SFEB 1ZUD2 4ZOHC 2BT6A
chains in the Genus database with same CATH superfamily
1SE2A 2NS5A 4ZRJA 3W2DA 5TSSA 4KVGB 2H89B 1Z2MA 1MHHE 3RZWC 2RDBC 1UBQA 2WXFA 1LGRA 1V1PB 2KZRA 1TKGA 3P4QB 1PGXA 1L6UA 3TJPA 1D5ZC 2KC2A 1VJKA 4PYZA 2J0MA 4GGQA 1B9RA 1GB4A 1XO3A 1HQRD 5FR3A 1CMXB 1XLNA 3A4RA 2R2QA 1WR1A 4WH4A 1QOAA 2I1JA 2N1VA 3PRMB 4BBNC 3LYYA 4LTUA 2VZKB 2WNMA 3DHGC 2AX5A 3ZIMA 3C8YA 2O6VD 4WWOA 2ASQA 2O2VB 3NS1A 3WAOA 2AQ1B 2LXCA 4YTPB 3VR9B 3DVGX 4FJZA 4AWJA 2WDTB 2O6VB 4WJNA 2UWQA 3BK2A 3DHIC 3L4PA 1F2RI 1WYWB 2BQQA 2FBWB 2BKRB 1N60A 4II3B 2Y3AA 4W9HA 3U30A 4OVUA 1SIJA 2G45B 3GZNB 2RMMA 3O13A 3AE5B 2BKFA 2AYOB 2D5GA 5DPSA 4RGTA 4KZCA 4ZRIA 4NJCA 3LXFA 3Q2AC 1V9JA 3EUB2 2W3SA 1V6EA 4RMAA 2PMVA 1K51A 4MM3A 5MPOA 2HJ1A 2WDVB 2I38A 1L0VB 3U4EG 1J19A 1T0YA 4BKSD 2M17A 5LXHA 2DYMA 1G6JA 2DENB 5JH5C 2K9XA 2N0SB 1N6ZA 2KFKB 3UF8A 4JL9A 2C9WB 2WXPA 3VH4B 1EF5A 4ICUA 1XCTL 3GP7A 1FM0D 1QOGA 5AZFA 3FKYA 3GE8C 2KQSA 5KHOA 3URYA 1NBFC 1V97A 2KDIA 1JRUA 2K8HA 1HTQA 4XWTA 3DOWA 1IBXA 4YL8A 2M8SA 3PLUA 1CQVA 3P1MA 5IAAC 2KTRB 2KWDA 2C7HA 1DOXA 4A90A 4KDIC 3GOEA 2EMSA 4P7IA 3ZW3A 3HIZA 1HEZE 2K39A 3Q6BA 2IO1B 3A1QA 1SF0A 3KH0A 3PV1A 1F77A 4MM3B 3L08A 4YSYB 3B1LX 3Q8AA 3ZJTA 1V5OA 2AL3A 4RGOS 4J3OD 4OVVA 2PIAA 5LNK1 2KVZA 3AECB 1WXQA 4HPPA 4FADA 1E9MA 4IM0A 2G4SA 2ZCBA 3WAPA 3Q3MC 5EDSA 4ANXA 2LUEA 1DOYA 2GBNA 2ZCCA 4NQKE 3V60A 4L1BA 2CKHB 4USAA 4X57B 1LFDA 4WQMA 2ZJDA 2IGGA 1FPYA 3DPDA 2PPHA 3PHWB 2LI5A 5T8IA 1MHXA 2DYBA 5J18A 3AE2B 4AQ7A 2V3PA 3TUOA 4US8A 5DPWA 1ENFA 4OZAA 2ZVNA 1NENB 5C2TB 2DZKA 2MBQA 2INPE 4XGAB 2NMQA 2KN5A 2KX0A 3Q8BA 3PRZA 3Q8EA 3N32A 2FCNA 3VUYA 2JWZA 2V4IB 3BYYB 5LXIB 4K7SA 3T3OA 2MBOA 3TBLD 3ZKJC 4HK2A 3QCAA 1MI0A 2KKCA 3ALBA 4C4VA 5J2RA 4KZ0A 2WXGA 5BMGA 4MGIE 4FN2A 1TY0A 3H6NA 1XXGA 3B0AA 1L0YB 3A33B 4IWQA 3Q14C 2B3AA 2RSUA 4HJKA 1I4HA 1T0SC 4PS7A 3HVZA 2FCQA 3UQBA 1VZ8A 2BB6A 4J6IA 3BY4B 1GPXA 4MSQB 2V3NA 2NBVB 4MH8A 5G5GA 2V1YA 1WH3A 2CJNA 5BMIA 2HTME 4NJ6A 3X23A 1UNSA 3HVDA 3MTNB 2OHFA 4IDIA 2ZPNA 3DBHI 2KNBA 4HRSA 4P1BC 2WU2B 2AL6A 1SBBB 1QOFA 1EU4A 1YIWA 2D2QA 2KLCA 4DDID 1E8XA 4AP4C 1YN5A 3HRDD 1UELA 2MJEA 2RPVA 3V3XA 1FCLA 3ZXRA 1H4RA 1N5WA 3PO0A 3APDA 4TUUA 3APFA 4PS8A 1WGRA 2QSDA 3DVNV 1FNUA 3NZ3A 4WJOA 2RPQA 3WA0A 2L0FA 3W9CB 2XK5B 2IY1B 4QAYA 1Q1OA 4IWPA 3RUIB 3NVWA 2JWUA 1ISNA 2JRIB 1C77A 3T3NA 4RF1A 1E7VA 1C9FA 1JMLA 5IP4D 1YMHE 1TS2A 1WE6A 2LUMA 4XZ4A 5IOIA 2J53A 3DBLB 2KD0A 2L52A 3AB5A 4NQLB 2PVGC 5D3IB 3V6EB 3AEFB 4A3OA 4IM3A 4A8XC 3IHPC 5LLIA 2D07B 3DWMA 4KIKB 1TS3A 1V49A 1ACCA 1YNTE 2D10A 3ML8A 2GI9A 2DAJA 1Q10A 3APCA 3NVVA 4RF0A 2J0JA 1SGHA 4OHJA 4G50A 1TKEA 3PRPB 2NBUA 4WWMA 1QQRA 2IO2B 4JWUC 3U2SC 1PGBA 3W1SC 1WX7A 5JXVA 2KOXA 1GJZA 4FLHA 3ZRCA 5DPRA 2PLPA 2CHXA 4WJPA 1KM7A 4YWGG 3UI3A 4NAWA 4ARIA 2CHZA 1IPGA 2LMCA 4URKA 3V61A 2JF5A 2BBCA 3GE3C 4DHJB 1Z5SB 3P2BA 2Z0EB 1WYGA 2WP9B 3K9PB 4K7UA 1V1PA 2NTTA 3Q8FA 3U7DA 3DWGC 2G4DB 1DGJA 1QOBA 3V05A 1AW7A 1TS4A 2DZIA 4W9IA 3NG0A 2KJ6A 2KYWA 2EKIA 3E9SA 1NYQA 2KDFB 2LASA 1V81A 2DNFA 3QX1A 4ZRKA 3P4PB 2C7MB 3AE7B 1JRPA 3DVGY 2L8JA 4IC7B 1RAXA 3ZJVA 4C56C 1J7CA 2IJ0A 5DCNA 1C4PA 1T0RC 3RN9C 2KHWB 2KANA 1NEKB 4F8CB 4DHZE 2MX2A 3BIID 3GZNI 4GDKB 2ZZPB 1WXMA 2AQ3B 2KFJA 2OEDA 2N9XA 3GS2A 3RNCC 2BPSA 4I6NB 2KQ7A 3AM9A 1I4PA 3RCZA 1V8CA 3C0RB 4KSLC 2C5LC 1P1AA 4W9LA 1MVKA 2WXHA 4M00A 4LJOB 3BYTB 4ACFA 3PVLA 4HXDA 1FFUA 1A5RA 4MGZE 4MJSA 4XC2A 2MJDA 2PKOA 1Q5WB 1FRDA 3K9OB 4EZKA 1P3QU 2GB1A 4B0MA 1IUEA 3KYDD 1FIQA 4MGKE 4AOFA 4JGHB 4GOCA 3JYUA 1CJEA 1ZOYB 5AUKA 2BYVE 1D5XC 2D3GA 2BYEA 1ZDVA 2BT6A 2JVCA 3JSVA 1XLQA 3KVFB 3I9V1 1QZEA 1L4ZB 1K50A 1FXTB 2PW9A 4K3BA 5D6JB 2MHJA 4ICVA 2BS3B 1T6BX 4PYUA 4PK1A 1HA5A 2R61A 3R7RA 2LD9A 4O1NA 4WQOB 5CHWA 3U8ZA 4XE0A 4MJSB 1WMHA 4W9JA 1V5TA 4A3PA 2GRIA 1E7UA 3ONSA 3H9DA 4PT5A 4GLSC 2LFIA 4GU2A 1JQ4A 5GMVA 3BVMA 1GC7A 4OZBA 1UBIA 2NVUI 2PE6B 3VRAB 1I4RA 1YX5B 1GOZA 1VZ6A 1NI3A 3L17A 2HE7A 1F1HA 2WXNA 2N9EB 3W5UB 2IO0B 3ZXVA 2V3SA 3PZ7A 5DPTA 3NUHB 1EF1A 2BGFA 3GB1A 4AS1A 2K0PA 2LGSA 2HD5B 3N3KB 4NJ7A 5IA7A 1FO4A 1SEBD 4II2B 3ETRA 3R2TA 2WXQA 4AJWA 5HKHA 2LRUA 4GB9A 4I6LB 5L83A 2V9HA 2G3QB 2M19A 4BKSA 2WXLA 4C7YA 4W9DA 1E10A 1R4NI 2RD0A 2LRWA 4W9CA 1QKZA 2QDFA 4FULA 4HKQA 1WJUA 1L7YA 2X38A 1AN8A 4FHJA 4G3XB 1YJIA 5FK9C 2EKEC 1VRAB 3PHXB 1XD3B 2JUOA 5I4DA 5JZEB 4W9FA 3UIPB 3KLSX 1FXAA 5AZGA 3KWVA 4MH0E 1C76A 4WJQA 2GMIC 3FILA 3ML9A 1MJDA 1TZOA 1J7AA 2FIDA 4KX6B 1GAQB 2MSED 3PREA 1WI0A 4TSSA 1TTNA 4TV3A 2WDQB 1SXTA 5KHQA 5E6OA 2KTFA 1WGGA 2RDGA 5BYQA 2QJLA 1F52A 1K52A 3ZNHB 4S0RA 1ZKHA 2WGSA 2J52A 2LVOA 1C4CA 4HVBA 2INDC 4LNOA 3BWUD 4C7ZA 1YN4A 3H8HA 2D3AA 4HLEA 2PEAA 1GUAB 4FBJB 1PUTA 4WAFA 2J0KA 4WWNA 4GDLA 2TSSA 2X8XX 4DXFA 3MC8A 1GB1A 4ANWA 2ZW0A 3R2IA 3T9LA 1P9DU 2L3ZA 1ESFA 4GDLB 3MJ5A 4ZHOA 3L0WB 3OLMD 2IBIB 1RRBA 1KLVA 4HKZE 5FR6A 2WX0A 2J7QB 2G1EA 5E6JA 2V0GA 1E7PB 1LQBA 3QAQA 3ZNZB 1C3TA 3CIRB 1KFYB 4M8MA 3BVZA 3VH3B 3VTWA 3ZRFA 1ZE3D 2KTRA 2WXKA 3EHVA 3L13A 1WXVA 2CR5A 3VR8B 4KGTA 4BVUC 5CTRC 1ZUD2 3AEBB 1L0XB 4EZLA 1P0RA 3UGBB 4EKUA 3B2GA 2ONQA 1WSPA 1WE7A 4JE3B 4HPLB 3WIMA 4ITKA 2W54A 1C78A 2M0XA 1UZXB 4CO7A 4UDUC 1UWMA 2KX3A 2M0AA 4B6WA 3A9KB 3DBRB 4EEWA 5D2MB 3IAS1 3KUZA 1R4MB 4YXDB 1SE4A 2DYOA 4DBGA 2SEBD 5G55A 1BMLC 2NTSA 4RH6A 3TEXA 2LJIA 3MC9A 3P4SB 2NCNA 1FD6A 4BZAA 3RULA 1MG4A 5IKCM 4YTNB 3IAM1 4XDCA 1I4XA 1PYWD 2UYZB 4M0WA 1N5XA 4DK5A 1OTRB 3NS8A 3B2FA 1B1ZA 4L23A 4RM8A 1KTKA 1YQBA 2W9NA 2N9KA 3ZVVA 4DDGD 3CSFA 4HEA1 5GXGB 4MSMB 3LJ3A 1P7FA 2GBRA 1WMHB 3HUIA 1KH0A 1E5WA 4ZYSA 1RYJA 3IG3A 1N62A 3DBLI 3A1QB 4XX5A 1WRDB 1WY8A 3RD2A 2LHDA 2WX1A 3OG5A 1I4GA 1QILA 4KV2A 1UF0A 2JZPA 2LVQA 2QC8A 2N9PC 1VDVA 3WAMA 3N20C 1QT9A 2D3BA 4B0EA 4BAXA 4BFRA 1FCCC 1VZ7A 4RM9A 2KFKA 1VCBA 3QIJA 4M0WB 5D3DA 3ZQ4A 2J42A 3OAWA 3UIOB 4ZOHC 3VUWA 4TKNA 3VTVA 1KF6B 1L5PA 3NHEB 1IYFA 1CK1A 2KT7A 1F0ZA 5FKAC 3RZFA 5IO9A 2N1WA 3NJTA 2JZZA 3PTFC 2GOWA 4TMAB 1PDXA 2KDMA 2FE8A 2MLBA 2DLBA 1SIFA 3WANA 1CZPA 4JIOU 1HTOA 2MP2A 1K8RB 3FC4A 4IW0A 3NZUA 3HK0A 1PQSA 5CHFA 5H8YE 2MBHA 2D3CA 2LHEA 4FHKA 4XDDA 1JWSD 3ZNGC 1SSNA 4MEMA 2JU6X 2LEKA 3C19A 4E74A 1Y56A 3P4RB 3VFKA 2G9HD 1EU3A 2WXOA 2NR2A 1NYRA 3FAHA 2PTLA 1EO6A 4HJGE 3A4SC 3KUDB 2BYFA 1UD7A 2GLSA 3EFUA 4W9KA 3A9JB 1EM7A 2KO3A 3RNGC 4XWWA 2KJHB 4IOIE 2NPTA 2MP2B 1VR9A 5E6NA 1IBXB 2JPHA 4C00A 1OQQA 2Z8LA 3AE1B 1LXDA 1WJNA 1YX6B 3DDCB 3NVYA 1F2RC 2WLBA 2M4NA 2L1AA 3JSVB 1JWAD 3EC8A 1GG3A 1RFKA 3Q3FA 1OGWA 3AEGB 1U4AA 3SFEB 3B9JA 3ZGZA 5D94A 3Q3OC 2R2OA 3KUCB 3L54A 3KW5B 3RFZB 5IN7A 3BVGA 2W55A 2YLMA 1NDDA 1P7EA 2QEJC 1JW9D 3MP9A 3JVZX 1BXTA 3RMKC 3Q8CA 1L4DB 4LCDE 1YQ3B 3DBRI 2Q5WD 4XYCA 4CHKA 1XLOA 1D4BA 2MWSB 3VUXA 4DHJD 2RR9A 3ZLZA 4HPMB 4KKJA 4NAWB 2WXRA 2WYQA 4WURA 4JQWC 4US9A 1KRHA 5E6PA 2FCSA 2DHZA 4MACA 2QHOA 2K6QA 4I6PA 3M95A 1WX8A 1AARA 2EELA 3DCGA 4FXCA 1X1MA 2EMTA 2KJRA 4KGSA 4E3CA 1XT9B 4MGYE 3AV8A 2KK8A 4AJYB 4EZJA 3KYCD 1YJ1A 4WAAA 1OFFA 3MFGA 3A9KA 4IUMB 1I7HA 3AE4B 2XBBC 1YD8U 2YVCA 3NVZA 2OJWA 2VRRB 3VXWA 1TJEA 2M1MA 1XCQL 3RNFC 4D2KA 3VVWB 4RCOA 2ZW1A 4RNAA 1ZW7A 2W3RA 1I42A 4YTMB 2O6VA 1DYQA 3QA8A 1V86A 2SAKA 2A4ZA 3W1YA 3I63C 3Q69A 1KJTA 4ZYNA 3H1UA 3IBEA 1JWUD 1ZXIA 1UGJA 5BYSA 1NVID 3AMZA 1VLBA 2WU5B 2LJ5A 3IT6B 2VH2A 1DOIA 2LGYA 2V4LA 2HJ8A 1JALA 3EA6A 4WWPA 3WALA 3HM6X 4ZRQA 1E8WA 3H7PB 4C80A 2N4FA 2MBBB 3O65B 3SR6A 1XEEA 1HZ6A 3TEZA 2JZ3B 4TQ0A 4LJPB 2OJRA 4BOSC 3MJWA 5G2NA 1GNUA 2KWVB 3VQIA 5AUIA 3AULA 3P42A 1M94A 5AEKB 5HHDG 4K1RB 2MJ3A 1KOTA 2XNAC 2K25A 1WM2A 1TY2A 1Y8RC 4HWIB 3QQ8B 2FCMA 1WGYA 1OQYA 2JYEA 4HDQA 2FIFA 2C7NB 3SD5A 3ZTCA 1YOVB 4LLGM 2HDEA 4MELA 4EUTA 2XEWA 4IG7B 4TQ1A 1SJED 3JW0X 2A5UA 2L32A 1XLPA 3OWEB 4DXGA 1SJHD 2KAJA 4MDKE 2WS3B 5L95C 2JX5A 1WGDA 4RFBA 4AUQC 2K8CA 2JT4B 2QILA 2VH1A 4P1CC 1R4MI 3AU5A 2BTEA 4A55A 2KDEB 1AYFA 3LB8C 3IXSA 1TKYA 2KLGA 2LXAA 3PS6A 1NI2A 2KACA 1MFWA 2MBEA 1UUPA 3IT4B 4B95A 1PGAA 2VZKD 1ZDXA 3M62B 3TSSA 1KLGD 1FNVA 4GN1A 3U52E 3CWIA 2L00B 3AN1A 4DHZB 2JRHA 4KDLB 5EE9A 1WJ6A 2LZ6A 2IDYA 5TR5A 2AWTA 1RM6C 3MHSD 2Y5PA 1TZ1A 3NOBA 1MPEA 2UU7A 1D6EC 2K5PA 5EE3A 3UINB 3ABVB 1WZ0A 4NNJB 3L10B 1ET6A 4CYEA 1FNWA 3PGEA 2XN9C 2LGDA 3SFDB 2L0TA 3R8BA 3QK0A 1H8CA 4OVZA 4M02A 2KC1A 3T8MA 4PS3A 4W9GA 4P6VF 1HE8A 1IGDA 1J7BA 5HI1A 4ZHPA 2JXXA 4EOYA 1YQ4B 2IO3B 1AWDA 5C3JB 2IYDB 4ASWC 3V6CB 3AE9B 4JLCA 1N61A 2W82A 4KGRA 3EFCA 4LK0M 4KKIA 1D3ZA 2BYTA 1WM3A 2QCZA 2K3UA 2L83A 1LO5D 1TIFA 2ACZB 1A70A 1C1YB 2ZVOA 3R7QA 1QLBB 2N7DA 3UQAA 3I3TB 2KWUB 3H7SA 2KMAA 2BVCA 2IY0B 4FA6A 4LNKA 4G0NB 3BINA 1UWXA 3P63A 1WIAA 3M3JA 2K8BA 3AU4A 1JROA 2QIEB 4IM2A 1T0QC 1FFVA 5HFYA 1STEA 3ENEA 1OEYA 2BB5A 5C1ZA 4F1SA 4JPSA 3AE6B 3NZSA 1F9JA 4GSWA 4NPNA 3TEYA 1JWBD 2KXJA 4P16A 2AQ2B 2MRPA 4S17A 3RNAC 5J17A 1WR6E 5AZHA 1FMAD 2DX5B 2L7RA 3M63B 1UGMA 3R3MA 2KMMA 2N7JA 1XF5L 3PPAA 1R4NB 4R3DA 3E56A 2N9LA 4F7ZA 2NPTB 1RFAA 4MT5A 3Q3JA 1L2NA 5JHAA 1ROEA 4A9AA 2IGHA 3AE3B 1QF6A 4RGMA 2CHWA 3VRBB 3ZDMC 4NY0A 3OJ4B 3RI7C 2MQJA 1TGZB 1PFDA 2B76B 3QJZA 2K6DB 1T3QA 3ECIA 4N59A 3BZDB 3RPFC 4OZCA 4KIKA 1SB3C 4HCPB 4N6EB 1S1QB 1FXIA 2JQRB 2O2VA 1JCKB 2K1FA 2MA9B 4DWFA 4Q2JA 3DBHB 5EE0A 2D11A 1P98A 3N1XC 2GBMA 3SU8X 3VAWA 3TIXA 4LNFA 2BS4B 2ICIA 2BS2B 2QMTA 2XK5A 4W9EA 3NY5A 4HCNB 2H88B 5CX3A 2BWES 1J8CA 4KSKC 4N9F4 2FUG1 2DBYA 4ANVA 4A20A 5CHVC 2N7EA 1N63A 3ZUNA 1GC6A 2INCC 1TS5A 3WCQA 1E6EB 3ZTDA 2YEPB 4IKGA 2LVPA 3B08A 2KDBA 5BO4B 4YSZB 3MHZA 4LNNA 2KVRA 5H92C 3TEWA 2FUHB 2KQ4X 2WQYB 1V1OA 3X0WA 3VDZA 1ZXHA 2MCNB 3ZJUA 3AXCA 4E71A 2ZPYA 3PT2B 3SHQA 2MW5A 4JWSC 4WIPA 1WJ4A 2WDRB 3AEAB 3ZYYX 4GDKA 1HZ5A 4M8NA 4BKTA 1L6VA 1TBEA 1LM8B 1OQRA 4FJVB 3QHTA 4NAMA 2ZEQA 4YSXB 3KWLA 3N30A 3TMPB 2CU3A 3R66C 2MH7A 2LGXA 3L16A 4YT0B 4N58A 3DVNU 2I1KA 1V80A 3AH7A 1I4QA 1OEYJ 1WZ3A 3SDLC 2DAFA 1J0GA 2E3TA 1XQQA 1TT5B 3DHHC 1SE9A 4L2YA 3H7PA 3QWZB 4LDTD 3U7ZA 1YN3A 3ZNID 4CQNA 1I35A 2RDHA 5BYRA 3HM3A 1E0ZA 2JXTA 2DZJA 3I57A 3J9CA 1FRRA 2Z0DB 2WXMA 1WXSA 4GIVA 2INNE 2YEPF 1M4VA 2PE9A 4JX1C 2MEKA 2WXJA 4H2AA 4GXBA 2GBKA 4A6QA 3EECA 3PLVA 5C23A 2CU1A 4LNIA 2FNJB 1HXYD 3V62A 1ZP0B 3AI5A 1S3SG 2KWCA 3SEBA 1SE3A 2J4XA 3S2AA 3VTUA 3LDZE 4ZRPA 3CF6E 3CMMB 2OOBB 3RNEC 2ON8A 5BMHA 2AEHA 2DWQA 1WFYA 4OW0A 3TCAA 3AEDB 3W1SA 1E8YA 3RT3B 1T5XD 4DXAB 1D5MC 3CSTA 1TYGB 3NRZA 3BK1A 1KLUD 3MC0B 2FAZA 1ZGUB 3AE8B 2RGFA 4BBNF 1WGHA 3IVFA 3N1YC 4K7WA 1C79A 3A9JA 1C4AA 3ZO5B 2L76A 3D32A 3N1ZC 2Z59B 4DQOC 4HDOA 1IP9A 1UH6A 1WWTA 2WXIA 2M56B 2WHIA 4EE2A 2K22A 2NBWB 2PVOD 1WRIA 1WX9A 3QARA 2LWPA 4G11A 2ZNVB 4B9KA 3OJ3A 3DQVA 1E8ZA 1JWMD 4BKGA 4IWOA 2KMCA 5JHBA 4EFOA 4M01A 1WXAA 1Q0WB 1ZPSA 3VHTC 3PZDA 3W5VB 4FJYA 2LGIA 3KQ4A 1RWSA 2BWFA 2L05A 4GMVA 1MG8A 4K3CA 2BW2A 3RYTA 4LDTB 2HTHA 3Q3NC 1R7SA 4ANUA 2BF8B 4C4VB 1BT0A 3ZDTA 2IGDA 3PSEB 5HG2A 1BUIC 1YJJA 4REZA 4RGNA 2Y5CA 3N9YC 2WWZA 4BOZB 1IGCA 5EE1A 5G5HA 3HHMA 2C60A 1FEHA 2IPKD 2JSVX 2Y5BB 2CJOA 2CS4A 1EUVB 1RLFA 4ARCA 2PJHA 2IZVB 2REXA 2KN4A 4NZLB 1EWYC 1WGKA 1E90A 3PZ8A 4HROA 2JY6A 3TL5A 2I2YA 1VD2A 3QC8B 2JYTA 2GBJA 1V2YA 2ZNVC 3RNBC 5D7GA 3EGRA 2E6XA 2DZMA 3IFWB 3DBSA 4K81A 1ET9A 3AEEB 3I5JC 4ZDVA 1EWCA 1WF9A 3FILB 1K53A
chains in the Genus database with same CATH topology
1SE2A 2NTTA 3Q8FA 3DWGC 1DGJA 1QOBA 3V05A 1KF6B 1UWXA 1AW7A 3P63A 1L5PA 1TS4A 3W2DA 5TSSA 1CK1A 2H89B 1MHHE 1F0ZA 1JROA 2QIEB 2EKIA 5FKAC 3E9SA 1FFVA 2WXFA 5HFYA 1NYQA 1STEA 1V1PB 1TKGA 3P4QB 2BB5A 1PGXA 1L6UA 4JPSA 1D5ZC 3P4PB 4TMAB 3AE6B 1PDXA 2KDMA 2FE8A 3AE7B 1JRPA 1VJKA 2DLBA 3TEYA 1JWBD 1B9RA 1GB4A 4P16A 3ZJVA 1CZPA 1XO3A 2AQ2B 1HQRD 5FR3A 1XLNA 4C56C 1J7CA 2IJ0A 3FC4A 1FMAD 4WH4A 1C4PA 1QOAA 5H8YE 1NEKB 2KMMA 2N7JA 3BIID 1XF5L 3TEWA 3LYYA 4R3DA 4GDKB 4LTUA 2LHEA 2VZKB 2AQ3B 2OEDA 3E56A 4XDDA 2N9LA 1JWSD 2WNMA 1SSNA 2AX5A 2JU6X 3GS2A 2LEKA 1Y56A 3P4RB 3C8YA 4MT5A 3AM9A 1I4PA 2G9HD 1EU3A 1ROEA 3NS1A 1V8CA 2WXOA 4A9AA 2IGHA 3AE3B 1QF6A 2AQ1B 4RGMA 4YTPB 3VR9B 1NYRA 3FAHA 2PTLA 3VRBB 4HJGE 1MVKA 2WXHA 3BK2A 3L4PA 1PFDA 3BYTB 1F2RI 2B76B 1FFUA 2FBWB 1N60A 2Y3AA 1EM7A 1T3QA 4N59A 1SIJA 3BZDB 3RPFC 4OZCA 2RMMA 4XWWA 2MJDA 2PKOA 4IOIE 1FRDA 1SB3C 3O13A 1VR9A 3AE5B 2GB1A 4N6EB 4B0MA 1IUEA 2D5GA 1IBXB 1OQQA 4RGTA 2Z8LA 3AE1B 1FIQA 3NVYA 1FXIA 1F2RC 2JQRB 2WLBA 1JCKB 4NJCA 3LXFA 2L1AA 4Q2JA 1JWAD 3EUB2 2W3SA 5EE0A 1CJEA 2PMVA 1ZOYB 1K51A 5AUKA 5MPOA 1RFKA 2WDVB 2I38A 1D5XC 1L0VB 3AEGB 3SFEB 3U4EG 1ZDVA 2BT6A 3B9JA 3ZGZA 2BS4B 2ICIA 1XLQA 2BS2B 2QMTA 3I9V1 2DYMA 1L4ZB 1K50A 2PW9A 3RFZB 2K9XA 2N0SB 2BS3B 1T6BX 3BVGA 2W55A 2H88B 1HA5A 2R61A 1P7EA 2QEJC 1JW9D 2WXPA 4O1NA 3MP9A 1XCTL 4XE0A 3GP7A 1BXTA 1FM0D 1QOGA 2DBYA 2FUG1 3Q8CA 2GRIA 1L4DB 3URYA 1V97A 1YQ3B 1N63A 2Q5WD 1XLOA 4XWTA 1D4BA 4PT5A 1IBXA 4GLSC 2LFIA 1JQ4A 1TS5A 3WCQA 1E6EB 2YEPB 3BVMA 4IKGA 1CQVA 4KKJA 4NAWB 2WXRA 4OZBA 4WURA 3P1MA 3VRAB 3MHZA 4YSZB 2KWDA 5H92C 1I4RA 1KRHA 2KQ4X 4US9A 1GOZA 2WQYB 1V1OA 1VZ6A 4A90A 1DOXA 1ZXHA 1NI3A 2WXNA 3ZJUA 4MACA 3W5UB 3PZ7A 3NUHB 4JWSC 4WIPA 2WDRB 3AEAB 3ZYYX 3GB1A 2EELA 4AS1A 2K0PA 1HEZE 4FXCA 1HZ5A 1FO4A 1SEBD 1L6VA 1SF0A 3ETRA 4KGSA 3R2TA 1OQRA 1F77A 2WXQA 4MM3B 4YSYB 4NAMA 3Q8AA 3ZJTA 4YSXB 3AV8A 4RGOS 4J3OD 3KWLA 2PIAA 2M19A 2CU3A 1OFFA 5LNK1 3MFGA 3AECB 2WXLA 2MH7A 1WXQA 4C7YA 1E10A 4YT0B 4N58A 1I7HA 3AE4B 1QKZA 4HKQA 3NVZA 1E9MA 1TJEA 3AH7A 1I4QA 1XCQL 1DOYA 4D2KA 2X38A 1AN8A 4RCOA 2ZW1A 4RNAA 1YJIA 5FK9C 1VRAB 2W3RA 4L1BA 2E3TA 4YTMB 4USAA 1DYQA 2SAKA 4WQMA 3Q69A 2IGGA 5I4DA 4L2YA 3U7ZA 3KLSX 5T8IA 1FXAA 1JWUD 1YN3A 1ZXIA 1MHXA 1UGJA 5BYSA 1NVID 3AE2B 3AMZA 4CQNA 1VLBA 2WU5B 2V3PA 3TUOA 4US8A 4AQ7A 3IT6B 1ENFA 2RDHA 3KWVA 4OZAA 5BYRA 1DOIA 1E0ZA 2JXTA 1NENB 1C76A 5C2TB 3I57A 1JALA 3J9CA 1FRRA 3EA6A 2WXMA 2INPE 2INNE 2YEPF 1M4VA 3FILA 4ZRQA 1TZOA 4JX1C 1J7AA 2MEKA 2NMQA 4KX6B 1GAQB 2WXJA 4H2AA 4C80A 4A6QA 3SR6A 1XEEA 3Q8BA 1HZ6A 4TSSA 3Q8EA 3TEZA 2WDQB 4TQ0A 1SXTA 1HXYD 1ZP0B 2V4IB 3BYYB 2RDGA 3VQIA 5BYQA 2QJLA 5AUIA 3SEBA 3T3OA 1SE3A 1K52A 2J4XA 3P42A 2J52A 1MI0A 4ZRPA 5HHDG 1C4CA 2MJ3A 2XNAC 2WXGA 3BWUD 2ON8A 5BMGA 5BMHA 4C7ZA 1YN4A 1TY2A 3H8HA 1TY0A 2DWQA 4OW0A 1XXGA 3AEDB 1L0YB 3W1SA 1T5XD 1PUTA 4WAFA 1I4HA 2JYEA 2TSSA 3HVZA 1D5MC 1VZ8A 2BB6A 4DXFA 1GB1A 1TYGB 2ZW0A 3R2IA 3NRZA 1GPXA 2V3NA 1ESFA 4LLGM 3BK1A 1KLUD 4GDLB 2HDEA 4MH8A 3MC0B 5G5GA 3AE8B 3MJ5A 4TQ1A 4ZHOA 1SJED 2CJNA 5BMIA 2HTME 1UNSA 2L32A 3HVDA 1C79A 1XLPA 2OHFA 3OWEB 1SJHD 2KAJA 4HKZE 4DXGA 2WS3B 4IDIA 1C4AA 5E6JA 2G1EA 2JX5A 2V0GA 1E7PB 4RFBA 3CIRB 1KFYB 4HRSA 3BVZA 4DQOC 2WU2B 1SBBB 2QILA 1QOFA 1EU4A 1WWTA 1YN5A 2WXIA 3HRDD 2M56B 1ZE3D 4A55A 2MJEA 2BTEA 1AYFA 2WXKA 3LB8C 2RPVA 3IXSA 3V3XA 1TKYA 4EE2A 2K22A 1FCLA 2PVOD 1WRIA 3VR8B 4KGTA 1N5WA 3PO0A 1ZUD2 3AEBB 1L0XB 2KACA 1JWMD 1UUPA 3IT4B 3B2GA 2ONQA 1WSPA 2QSDA 1PGAA 4JE3B 1FNUA 3NZ3A 2VZKD 1ZDXA 4ITKA 2W54A 3W9CB 1C78A 3TSSA 1KLGD 4UDUC 1FNVA 1UWMA 3U52E 1ZPSA 3W5VB 3CWIA 2M0AA 2LGIA 3AN1A 1RWSA 3KQ4A 2JWUA 3NVWA 5EE9A 3IAS1 2BW2A 4YXDB 1C77A 1SE4A 2DYOA 4RF1A 2IDYA 3T3NA 1C9FA 1JMLA 1RM6C 1YMHE 2Y5PA 1R7SA 1TS2A 2LUMA 1MPEA 2SEBD 1BMLC 1D6EC 2J53A 2K5PA 2NTSA 4RH6A 3TEXA 2LJIA 5EE3A 2IGDA 2L52A 3AB5A 5HG2A 1BUIC 2PVGC 5D3IB 3ABVB 3AEFB 1YJJA 3P4SB 4REZA 4A8XC 4RGNA 3DWMA 1FD6A 2Y5CA 3N9YC 4YTNB 1ET6A 3IAM1 4XDCA 1TS3A 1IGCA 5EE1A 1I4XA 1ACCA 1YNTE 1FNWA 1PYWD 4M0WA 1N5XA 5G5HA 2XN9C 1FEHA 2GI9A 2IPKD 3SFDB 3B2FA 1B1ZA 2JSVX 1Q10A 3R8BA 4L23A 2CJOA 4OVZA 1KTKA 3NVVA 4RF0A 2N9KA 4P6VF 4ARCA 4OHJA 1TKEA 4HEA1 5GXGB 1IGDA 4WWMA 1QQRA 1J7BA 5HI1A 4ZHPA 4JWUC 3U2SC 1YQ4B 1PGBA 1AWDA 1P7FA 3HUIA 5JXVA 5C3JB 1KH0A 3AE9B 4ZYSA 1RYJA 1N62A 2KN4A 1N61A 2W82A 2PLPA 4NZLB 2LHDA 1EWYC 1WGKA 4KGRA 4KKIA 4LK0M 1I4GA 1QILA 3PZ8A 4HROA 2BYTA 2I2YA 4YWGG 2K3UA 3UI3A 2L83A 4ARIA 2JYTA 2JZPA 1LO5D 2ACZB 1A70A 2LMCA 5D7GA 1VDVA 3EGRA 2E6XA 1QT9A 2BBCA 4B0EA 1QLBB 1ET9A 3AEEB 1FCCC 1VZ7A 1WYGA 2WP9B 1EWCA 5D3DA 3FILB 3ZQ4A 1K53A 2J42A 1V1PA 4ZOHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B9J A;  2BS4 B;  1FXA A;  1ZXI A;  3DWG C;  1XLQ A;  1DGJ A;  1QOB A;  2BS2 B;  1NVI D;  3AE2 B;  1KF6 B;  3AMZ A;  1VLB A;  2WU5 B;  3B2G A;  3P63 A;  1L5P A;  4US8 A;  1E0Z A;  1DOI A;  2K9X A;  1NEN B;  2H89 B;  2N0S B;  4ITK A;  5C2T B;  2BS3 B;  2W54 A;  1JAL A;  3W9C B;  1FRR A;  1F0Z A;  2W55 A;  1JRO A;  2QIE B;  2EKI A;  2H88 B;  1FFV A;  1NYQ A;  4JX1 C;  1JW9 D;  1J7A A;  4KX6 B;  1GAQ B;  1TKG A;  1UWM A;  3P4Q B;  4C80 A;  3W5V B;  3CWI A;  1L6U A;  3SR6 A;  1FM0 D;  1QOG A;  2DBY A;  3P4P B;  3AE6 B;  1PDX A;  1RWS A;  3AE7 B;  3AN1 A;  1JRP A;  3NVW A;  5EE9 A;  1VJK A;  2WDQ B;  4YXD B;  1JWB D;  1B9R A;  1ZP0 B;  1V97 A;  1CZP A;  1XO3 A;  1YQ3 B;  1RM6 C;  1N63 A;  1R7S A;  2Q5W D;  1XLN A;  1J7C A;  2QJL A;  5AUI A;  1XLO A;  3FC4 A;  1FMA D;  2K5P A;  5EE3 A;  1JQ4 A;  1QOA A;  3WCQ A;  1E6E B;  2L52 A;  3AB5 A;  5H8Y E;  2PVG C;  1NEK B;  3ABV B;  2KMM A;  1YJJ A;  3AEF B;  3BII D;  3P1M A;  3P4S B;  2MJ3 A;  3VRA B;  4YSZ B;  5H92 C;  4US9 A;  1KRH A;  3DWM A;  4LTU A;  2Y5C A;  2WQY B;  1DOX A;  1NI3 A;  4YTN B;  4C7Z A;  2AX5 A;  3W5U B;  2LEK A;  5EE1 A;  2DWQ A;  3P4R B;  3AED B;  3AM9 A;  5G5H A;  1N5X A;  4JWS C;  2WDR B;  1ROE A;  3AEA B;  3ZYY X;  3NS1 A;  1V8C A;  3SFD B;  1PUT A;  3B2F A;  4A9A A;  3AE3 B;  1QF6 A;  3VR9 B;  4YTP B;  4FXC A;  2CJO A;  3HVZ A;  1NYR A;  3FAH A;  3NVV A;  3VRB B;  1FO4 A;  1L6V A;  1SF0 A;  1TYG B;  3ETR A;  1OQR A;  3NRZ A;  3L4P A;  1GPX A;  3AEB B;  4YSY B;  1PFD A;  4P6V F;  4YSX B;  3AV8 A;  2B76 B;  1TKE A;  5G5G A;  5GXG B;  1FFU A;  4WWM A;  1J7B A;  2FBW B;  2PIA A;  3AE8 B;  1N60 A;  3KWL A;  4JWU C;  2CJN A;  2M19 A;  4ZHO A;  2CU3 A;  4ZHP A;  1OFF A;  1YQ4 B;  1T3Q A;  1AWD A;  2HTM E;  2MH7 A;  3AEC B;  1SIJ A;  1WXQ A;  4N59 A;  3HUI A;  3RPF C;  4C7Y A;  5C3J B;  1E10 A;  2MJD A;  2PKO A;  4YT0 B;  3AE9 B;  4N58 A;  1I7H A;  1RYJ A;  1N62 A;  3AE4 B;  1FRD A;  1XLP A;  1SB3 C;  1N61 A;  2OHF A;  2KAJ A;  3AE5 B;  2WS3 B;  4IDI A;  3NVZ A;  4N6E B;  1IUE A;  1E9M A;  1EWY C;  1TJE A;  1WGK A;  2G1E A;  2JX5 A;  1OQQ A;  3AH7 A;  1E7P B;  3AE1 B;  4HRO A;  1DOY A;  1FIQ A;  3NVY A;  1FXI A;  2JQR B;  2WLB A;  1KFY B;  3CIR B;  4HRS A;  2L83 A;  2WU2 B;  3LXF A;  1YJI A;  1QOF A;  2ACZ B;  1JWA D;  1A70 A;  2W3R A;  3EUB 2;  2W3S A;  1VDV A;  2E3T A;  4YTM B;  4USA A;  1WWT A;  3HRD D;  5EE0 A;  1QT9 A;  1CJE A;  2M56 B;  2MJE A;  1AYF A;  3LB8 C;  1ZOY B;  5AUK A;  5MPO A;  1TKY A;  1RFK A;  2K22 A;  1QLB B;  2WDV B;  3AEE B;  4WQM A;  2PVO D;  1WYG A;  1WRI A;  3VR8 B;  2WP9 B;  1L0V B;  3AEG B;  1N5W A;  3PO0 A;  3SFE B;  1ZUD 2;  4ZOH C;  2BT6 A; 
#chains in the Genus database with same CATH topology
 1SE2 A;  2NS5 A;  4ZRJ A;  3W2D A;  5TSS A;  4KVG B;  2H89 B;  1Z2M A;  1MHH E;  3RZW C;  2RDB C;  1UBQ A;  2WXF A;  1LGR A;  1V1P B;  2KZR A;  1TKG A;  3P4Q B;  1PGX A;  1L6U A;  3TJP A;  1D5Z C;  2KC2 A;  1VJK A;  4PYZ A;  2J0M A;  4GGQ A;  1B9R A;  1GB4 A;  1XO3 A;  1HQR D;  5FR3 A;  1CMX B;  1XLN A;  3A4R A;  2R2Q A;  1WR1 A;  4WH4 A;  1QOA A;  2I1J A;  2N1V A;  3PRM B;  4BBN C;  3LYY A;  4LTU A;  2VZK B;  2WNM A;  3DHG C;  2AX5 A;  3ZIM A;  3C8Y A;  2O6V D;  4WWO A;  2ASQ A;  2O2V B;  3NS1 A;  3WAO A;  2AQ1 B;  2LXC A;  4YTP B;  3VR9 B;  3DVG X;  4FJZ A;  4AWJ A;  2WDT B;  2O6V B;  4WJN A;  2UWQ A;  3BK2 A;  3DHI C;  3L4P A;  1F2R I;  1WYW B;  2BQQ A;  2FBW B;  2BKR B;  1N60 A;  4II3 B;  2Y3A A;  4W9H A;  3U30 A;  4OVU A;  1SIJ A;  2G45 B;  3GZN B;  2RMM A;  3O13 A;  3AE5 B;  2BKF A;  2AYO B;  2D5G A;  5DPS A;  4RGT A;  4KZC A;  4ZRI A;  4NJC A;  3LXF A;  3Q2A C;  1V9J A;  3EUB 2;  2W3S A;  1V6E A;  4RMA A;  2PMV A;  1K51 A;  4MM3 A;  5MPO A;  2HJ1 A;  2WDV B;  2I38 A;  1L0V B;  3U4E G;  1J19 A;  1T0Y A;  4BKS D;  2M17 A;  5LXH A;  2DYM A;  1G6J A;  2DEN B;  5JH5 C;  2K9X A;  2N0S B;  1N6Z A;  2KFK B;  3UF8 A;  4JL9 A;  2C9W B;  2WXP A;  3VH4 B;  1EF5 A;  4ICU A;  1XCT L;  3GP7 A;  1FM0 D;  1QOG A;  5AZF A;  3FKY A;  3GE8 C;  2KQS A;  5KHO A;  3URY A;  1NBF C;  1V97 A;  2KDI A;  1JRU A;  2K8H A;  1HTQ A;  4XWT A;  3DOW A;  1IBX A;  4YL8 A;  2M8S A;  3PLU A;  1CQV A;  3P1M A;  5IAA C;  2KTR B;  2KWD A;  2C7H A;  1DOX A;  4A90 A;  4KDI C;  3GOE A;  2EMS A;  4P7I A;  3ZW3 A;  3HIZ A;  1HEZ E;  2K39 A;  3Q6B A;  2IO1 B;  3A1Q A;  1SF0 A;  3KH0 A;  3PV1 A;  1F77 A;  4MM3 B;  3L08 A;  4YSY B;  3B1L X;  3Q8A A;  3ZJT A;  1V5O A;  2AL3 A;  4RGO S;  4J3O D;  4OVV A;  2PIA A;  5LNK 1;  2KVZ A;  3AEC B;  1WXQ A;  4HPP A;  4FAD A;  1E9M A;  4IM0 A;  2G4S A;  2ZCB A;  3WAP A;  3Q3M C;  5EDS A;  4ANX A;  2LUE A;  1DOY A;  2GBN A;  2ZCC A;  4NQK E;  3V60 A;  4L1B A;  2CKH B;  4USA A;  4X57 B;  1LFD A;  4WQM A;  2ZJD A;  2IGG A;  1FPY A;  3DPD A;  2PPH A;  3PHW B;  2LI5 A;  5T8I A;  1MHX A;  2DYB A;  5J18 A;  3AE2 B;  4AQ7 A;  2V3P A;  3TUO A;  4US8 A;  5DPW A;  1ENF A;  4OZA A;  2ZVN A;  1NEN B;  5C2T B;  2DZK A;  2MBQ A;  2INP E;  4XGA B;  2NMQ A;  2KN5 A;  2KX0 A;  3Q8B A;  3PRZ A;  3Q8E A;  3N32 A;  2FCN A;  3VUY A;  2JWZ A;  2V4I B;  3BYY B;  5LXI B;  4K7S A;  3T3O A;  2MBO A;  3TBL D;  3ZKJ C;  4HK2 A;  3QCA A;  1MI0 A;  2KKC A;  3ALB A;  4C4V A;  5J2R A;  4KZ0 A;  2WXG A;  5BMG A;  4MGI E;  4FN2 A;  1TY0 A;  3H6N A;  1XXG A;  3B0A A;  1L0Y B;  3A33 B;  4IWQ A;  3Q14 C;  2B3A A;  2RSU A;  4HJK A;  1I4H A;  1T0S C;  4PS7 A;  3HVZ A;  2FCQ A;  3UQB A;  1VZ8 A;  2BB6 A;  4J6I A;  3BY4 B;  1GPX A;  4MSQ B;  2V3N A;  2NBV B;  4MH8 A;  5G5G A;  2V1Y A;  1WH3 A;  2CJN A;  5BMI A;  2HTM E;  4NJ6 A;  3X23 A;  1UNS A;  3HVD A;  3MTN B;  2OHF A;  4IDI A;  2ZPN A;  3DBH I;  2KNB A;  4HRS A;  4P1B C;  2WU2 B;  2AL6 A;  1SBB B;  1QOF A;  1EU4 A;  1YIW A;  2D2Q A;  2KLC A;  4DDI D;  1E8X A;  4AP4 C;  1YN5 A;  3HRD D;  1UEL A;  2MJE A;  2RPV A;  3V3X A;  1FCL A;  3ZXR A;  1H4R A;  1N5W A;  3PO0 A;  3APD A;  4TUU A;  3APF A;  4PS8 A;  1WGR A;  2QSD A;  3DVN V;  1FNU A;  3NZ3 A;  4WJO A;  2RPQ A;  3WA0 A;  2L0F A;  3W9C B;  2XK5 B;  2IY1 B;  4QAY A;  1Q1O A;  4IWP A;  3RUI B;  3NVW A;  2JWU A;  1ISN A;  2JRI B;  1C77 A;  3T3N A;  4RF1 A;  1E7V A;  1C9F A;  1JML A;  5IP4 D;  1YMH E;  1TS2 A;  1WE6 A;  2LUM A;  4XZ4 A;  5IOI A;  2J53 A;  3DBL B;  2KD0 A;  2L52 A;  3AB5 A;  4NQL B;  2PVG C;  5D3I B;  3V6E B;  3AEF B;  4A3O A;  4IM3 A;  4A8X C;  3IHP C;  5LLI A;  2D07 B;  3DWM A;  4KIK B;  1TS3 A;  1V49 A;  1ACC A;  1YNT E;  2D10 A;  3ML8 A;  2GI9 A;  2DAJ A;  1Q10 A;  3APC A;  3NVV A;  4RF0 A;  2J0J A;  1SGH A;  4OHJ A;  4G50 A;  1TKE A;  3PRP B;  2NBU A;  4WWM A;  1QQR A;  2IO2 B;  4JWU C;  3U2S C;  1PGB A;  3W1S C;  1WX7 A;  5JXV A;  2KOX A;  1GJZ A;  4FLH A;  3ZRC A;  5DPR A;  2PLP A;  2CHX A;  4WJP A;  1KM7 A;  4YWG G;  3UI3 A;  4NAW A;  4ARI A;  2CHZ A;  1IPG A;  2LMC A;  4URK A;  3V61 A;  2JF5 A;  2BBC A;  3GE3 C;  4DHJ B;  1Z5S B;  3P2B A;  2Z0E B;  1WYG A;  2WP9 B;  3K9P B;  4K7U A;  1V1P A;  2NTT A;  3Q8F A;  3U7D A;  3DWG C;  2G4D B;  1DGJ A;  1QOB A;  3V05 A;  1AW7 A;  1TS4 A;  2DZI A;  4W9I A;  3NG0 A;  2KJ6 A;  2KYW A;  2EKI A;  3E9S A;  1NYQ A;  2KDF B;  2LAS A;  1V81 A;  2DNF A;  3QX1 A;  4ZRK A;  3P4P B;  2C7M B;  3AE7 B;  1JRP A;  3DVG Y;  2L8J A;  4IC7 B;  1RAX A;  3ZJV A;  4C56 C;  1J7C A;  2IJ0 A;  5DCN A;  1C4P A;  1T0R C;  3RN9 C;  2KHW B;  2KAN A;  1NEK B;  4F8C B;  4DHZ E;  2MX2 A;  3BII D;  3GZN I;  4GDK B;  2ZZP B;  1WXM A;  2AQ3 B;  2KFJ A;  2OED A;  2N9X A;  3GS2 A;  3RNC C;  2BPS A;  4I6N B;  2KQ7 A;  3AM9 A;  1I4P A;  3RCZ A;  1V8C A;  3C0R B;  4KSL C;  2C5L C;  1P1A A;  4W9L A;  1MVK A;  2WXH A;  4M00 A;  4LJO B;  3BYT B;  4ACF A;  3PVL A;  4HXD A;  1FFU A;  1A5R A;  4MGZ E;  4MJS A;  4XC2 A;  2MJD A;  2PKO A;  1Q5W B;  1FRD A;  3K9O B;  4EZK A;  1P3Q U;  2GB1 A;  4B0M A;  1IUE A;  3KYD D;  1FIQ A;  4MGK E;  4AOF A;  4JGH B;  4GOC A;  3JYU A;  1CJE A;  1ZOY B;  5AUK A;  2BYV E;  1D5X C;  2D3G A;  2BYE A;  1ZDV A;  2BT6 A;  2JVC A;  3JSV A;  1XLQ A;  3KVF B;  3I9V 1;  1QZE A;  1L4Z B;  1K50 A;  1FXT B;  2PW9 A;  4K3B A;  5D6J B;  2MHJ A;  4ICV A;  2BS3 B;  1T6B X;  4PYU A;  4PK1 A;  1HA5 A;  2R61 A;  3R7R A;  2LD9 A;  4O1N A;  4WQO B;  5CHW A;  3U8Z A;  4XE0 A;  4MJS B;  1WMH A;  4W9J A;  1V5T A;  4A3P A;  2GRI A;  1E7U A;  3ONS A;  3H9D A;  4PT5 A;  4GLS C;  2LFI A;  4GU2 A;  1JQ4 A;  5GMV A;  3BVM A;  1GC7 A;  4OZB A;  1UBI A;  2NVU I;  2PE6 B;  3VRA B;  1I4R A;  1YX5 B;  1GOZ A;  1VZ6 A;  1NI3 A;  3L17 A;  2HE7 A;  1F1H A;  2WXN A;  2N9E B;  3W5U B;  2IO0 B;  3ZXV A;  2V3S A;  3PZ7 A;  5DPT A;  3NUH B;  1EF1 A;  2BGF A;  3GB1 A;  4AS1 A;  2K0P A;  2LGS A;  2HD5 B;  3N3K B;  4NJ7 A;  5IA7 A;  1FO4 A;  1SEB D;  4II2 B;  3ETR A;  3R2T A;  2WXQ A;  4AJW A;  5HKH A;  2LRU A;  4GB9 A;  4I6L B;  5L83 A;  2V9H A;  2G3Q B;  2M19 A;  4BKS A;  2WXL A;  4C7Y A;  4W9D A;  1E10 A;  1R4N I;  2RD0 A;  2LRW A;  4W9C A;  1QKZ A;  2QDF A;  4FUL A;  4HKQ A;  1WJU A;  1L7Y A;  2X38 A;  1AN8 A;  4FHJ A;  4G3X B;  1YJI A;  5FK9 C;  2EKE C;  1VRA B;  3PHX B;  1XD3 B;  2JUO A;  5I4D A;  5JZE B;  4W9F A;  3UIP B;  3KLS X;  1FXA A;  5AZG A;  3KWV A;  4MH0 E;  1C76 A;  4WJQ A;  2GMI C;  3FIL A;  3ML9 A;  1MJD A;  1TZO A;  1J7A A;  2FID A;  4KX6 B;  1GAQ B;  2MSE D;  3PRE A;  1WI0 A;  4TSS A;  1TTN A;  4TV3 A;  2WDQ B;  1SXT A;  5KHQ A;  5E6O A;  2KTF A;  1WGG A;  2RDG A;  5BYQ A;  2QJL A;  1F52 A;  1K52 A;  3ZNH B;  4S0R A;  1ZKH A;  2WGS A;  2J52 A;  2LVO A;  1C4C A;  4HVB A;  2IND C;  4LNO A;  3BWU D;  4C7Z A;  1YN4 A;  3H8H A;  2D3A A;  4HLE A;  2PEA A;  1GUA B;  4FBJ B;  1PUT A;  4WAF A;  2J0K A;  4WWN A;  4GDL A;  2TSS A;  2X8X X;  4DXF A;  3MC8 A;  1GB1 A;  4ANW A;  2ZW0 A;  3R2I A;  3T9L A;  1P9D U;  2L3Z A;  1ESF A;  4GDL B;  3MJ5 A;  4ZHO A;  3L0W B;  3OLM D;  2IBI B;  1RRB A;  1KLV A;  4HKZ E;  5FR6 A;  2WX0 A;  2J7Q B;  2G1E A;  5E6J A;  2V0G A;  1E7P B;  1LQB A;  3QAQ A;  3ZNZ B;  1C3T A;  3CIR B;  1KFY B;  4M8M A;  3BVZ A;  3VH3 B;  3VTW A;  3ZRF A;  1ZE3 D;  2KTR A;  2WXK A;  3EHV A;  3L13 A;  1WXV A;  2CR5 A;  3VR8 B;  4KGT A;  4BVU C;  5CTR C;  1ZUD 2;  3AEB B;  1L0X B;  4EZL A;  1P0R A;  3UGB B;  4EKU A;  3B2G A;  2ONQ A;  1WSP A;  1WE7 A;  4JE3 B;  4HPL B;  3WIM A;  4ITK A;  2W54 A;  1C78 A;  2M0X A;  1UZX B;  4CO7 A;  4UDU C;  1UWM A;  2KX3 A;  2M0A A;  4B6W A;  3A9K B;  3DBR B;  4EEW A;  5D2M B;  3IAS 1;  3KUZ A;  1R4M B;  4YXD B;  1SE4 A;  2DYO A;  4DBG A;  2SEB D;  5G55 A;  1BML C;  2NTS A;  4RH6 A;  3TEX A;  2LJI A;  3MC9 A;  3P4S B;  2NCN A;  1FD6 A;  4BZA A;  3RUL A;  1MG4 A;  5IKC M;  4YTN B;  3IAM 1;  4XDC A;  1I4X A;  1PYW D;  2UYZ B;  4M0W A;  1N5X A;  4DK5 A;  1OTR B;  3NS8 A;  3B2F A;  1B1Z A;  4L23 A;  4RM8 A;  1KTK A;  1YQB A;  2W9N A;  2N9K A;  3ZVV A;  4DDG D;  3CSF A;  4HEA 1;  5GXG B;  4MSM B;  3LJ3 A;  1P7F A;  2GBR A;  1WMH B;  3HUI A;  1KH0 A;  1E5W A;  4ZYS A;  1RYJ A;  3IG3 A;  1N62 A;  3DBL I;  3A1Q B;  4XX5 A;  1WRD B;  1WY8 A;  3RD2 A;  2LHD A;  2WX1 A;  3OG5 A;  1I4G A;  1QIL A;  4KV2 A;  1UF0 A;  2JZP A;  2LVQ A;  2QC8 A;  2N9P C;  1VDV A;  3WAM A;  3N20 C;  1QT9 A;  2D3B A;  4B0E A;  4BAX A;  4BFR A;  1FCC C;  1VZ7 A;  4RM9 A;  2KFK A;  1VCB A;  3QIJ A;  4M0W B;  5D3D A;  3ZQ4 A;  2J42 A;  3OAW A;  3UIO B;  4ZOH C;  3VUW A;  4TKN A;  3VTV A;  1KF6 B;  1L5P A;  3NHE B;  1IYF A;  1CK1 A;  2KT7 A;  1F0Z A;  5FKA C;  3RZF A;  5IO9 A;  2N1W A;  3NJT A;  2JZZ A;  3PTF C;  2GOW A;  4TMA B;  1PDX A;  2KDM A;  2FE8 A;  2MLB A;  2DLB A;  1SIF A;  3WAN A;  1CZP A;  4JIO U;  1HTO A;  2MP2 A;  1K8R B;  3FC4 A;  4IW0 A;  3NZU A;  3HK0 A;  1PQS A;  5CHF A;  5H8Y E;  2MBH A;  2D3C A;  2LHE A;  4FHK A;  4XDD A;  1JWS D;  3ZNG C;  1SSN A;  4MEM A;  2JU6 X;  2LEK A;  3C19 A;  4E74 A;  1Y56 A;  3P4R B;  3VFK A;  2G9H D;  1EU3 A;  2WXO A;  2NR2 A;  1NYR A;  3FAH A;  2PTL A;  1EO6 A;  4HJG E;  3A4S C;  3KUD B;  2BYF A;  1UD7 A;  2GLS A;  3EFU A;  4W9K A;  3A9J B;  1EM7 A;  2KO3 A;  3RNG C;  4XWW A;  2KJH B;  4IOI E;  2NPT A;  2MP2 B;  1VR9 A;  5E6N A;  1IBX B;  2JPH A;  4C00 A;  1OQQ A;  2Z8L A;  3AE1 B;  1LXD A;  1WJN A;  1YX6 B;  3DDC B;  3NVY A;  1F2R C;  2WLB A;  2M4N A;  2L1A A;  3JSV B;  1JWA D;  3EC8 A;  1GG3 A;  1RFK A;  3Q3F A;  1OGW A;  3AEG B;  1U4A A;  3SFE B;  3B9J A;  3ZGZ A;  5D94 A;  3Q3O C;  2R2O A;  3KUC B;  3L54 A;  3KW5 B;  3RFZ B;  5IN7 A;  3BVG A;  2W55 A;  2YLM A;  1NDD A;  1P7E A;  2QEJ C;  1JW9 D;  3MP9 A;  3JVZ X;  1BXT A;  3RMK C;  3Q8C A;  1L4D B;  4LCD E;  1YQ3 B;  3DBR I;  2Q5W D;  4XYC A;  4CHK A;  1XLO A;  1D4B A;  2MWS B;  3VUX A;  4DHJ D;  2RR9 A;  3ZLZ A;  4HPM B;  4KKJ A;  4NAW B;  2WXR A;  2WYQ A;  4WUR A;  4JQW C;  4US9 A;  1KRH A;  5E6P A;  2FCS A;  2DHZ A;  4MAC A;  2QHO A;  2K6Q A;  4I6P A;  3M95 A;  1WX8 A;  1AAR A;  2EEL A;  3DCG A;  4FXC A;  1X1M A;  2EMT A;  2KJR A;  4KGS A;  4E3C A;  1XT9 B;  4MGY E;  3AV8 A;  2KK8 A;  4AJY B;  4EZJ A;  3KYC D;  1YJ1 A;  4WAA A;  1OFF A;  3MFG A;  3A9K A;  4IUM B;  1I7H A;  3AE4 B;  2XBB C;  1YD8 U;  2YVC A;  3NVZ A;  2OJW A;  2VRR B;  3VXW A;  1TJE A;  2M1M A;  1XCQ L;  3RNF C;  4D2K A;  3VVW B;  4RCO A;  2ZW1 A;  4RNA A;  1ZW7 A;  2W3R A;  1I42 A;  4YTM B;  2O6V A;  1DYQ A;  3QA8 A;  1V86 A;  2SAK A;  2A4Z A;  3W1Y A;  3I63 C;  3Q69 A;  1KJT A;  4ZYN A;  3H1U A;  3IBE A;  1JWU D;  1ZXI A;  1UGJ A;  5BYS A;  1NVI D;  3AMZ A;  1VLB A;  2WU5 B;  2LJ5 A;  3IT6 B;  2VH2 A;  1DOI A;  2LGY A;  2V4L A;  2HJ8 A;  1JAL A;  3EA6 A;  4WWP A;  3WAL A;  3HM6 X;  4ZRQ A;  1E8W A;  3H7P B;  4C80 A;  2N4F A;  2MBB B;  3O65 B;  3SR6 A;  1XEE A;  1HZ6 A;  3TEZ A;  2JZ3 B;  4TQ0 A;  4LJP B;  2OJR A;  4BOS C;  3MJW A;  5G2N A;  1GNU A;  2KWV B;  3VQI A;  5AUI A;  3AUL A;  3P42 A;  1M94 A;  5AEK B;  5HHD G;  4K1R B;  2MJ3 A;  1KOT A;  2XNA C;  2K25 A;  1WM2 A;  1TY2 A;  1Y8R C;  4HWI B;  3QQ8 B;  2FCM A;  1WGY A;  1OQY A;  2JYE A;  4HDQ A;  2FIF A;  2C7N B;  3SD5 A;  3ZTC A;  1YOV B;  4LLG M;  2HDE A;  4MEL A;  4EUT A;  2XEW A;  4IG7 B;  4TQ1 A;  1SJE D;  3JW0 X;  2A5U A;  2L32 A;  1XLP A;  3OWE B;  4DXG A;  1SJH D;  2KAJ A;  4MDK E;  2WS3 B;  5L95 C;  2JX5 A;  1WGD A;  4RFB A;  4AUQ C;  2K8C A;  2JT4 B;  2QIL A;  2VH1 A;  4P1C C;  1R4M I;  3AU5 A;  2BTE A;  4A55 A;  2KDE B;  1AYF A;  3LB8 C;  3IXS A;  1TKY A;  2KLG A;  2LXA A;  3PS6 A;  1NI2 A;  2KAC A;  1MFW A;  2MBE A;  1UUP A;  3IT4 B;  4B95 A;  1PGA A;  2VZK D;  1ZDX A;  3M62 B;  3TSS A;  1KLG D;  1FNV A;  4GN1 A;  3U52 E;  3CWI A;  2L00 B;  3AN1 A;  4DHZ B;  2JRH A;  4KDL B;  5EE9 A;  1WJ6 A;  2LZ6 A;  2IDY A;  5TR5 A;  2AWT A;  1RM6 C;  3MHS D;  2Y5P A;  1TZ1 A;  3NOB A;  1MPE A;  2UU7 A;  1D6E C;  2K5P A;  5EE3 A;  3UIN B;  3ABV B;  1WZ0 A;  4NNJ B;  3L10 B;  1ET6 A;  4CYE A;  1FNW A;  3PGE A;  2XN9 C;  2LGD A;  3SFD B;  2L0T A;  3R8B A;  3QK0 A;  1H8C A;  4OVZ A;  4M02 A;  2KC1 A;  3T8M A;  4PS3 A;  4W9G A;  4P6V F;  1HE8 A;  1IGD A;  1J7B A;  5HI1 A;  4ZHP A;  2JXX A;  4EOY A;  1YQ4 B;  2IO3 B;  1AWD A;  5C3J B;  2IYD B;  4ASW C;  3V6C B;  3AE9 B;  4JLC A;  1N61 A;  2W82 A;  4KGR A;  3EFC A;  4LK0 M;  4KKI A;  1D3Z A;  2BYT A;  1WM3 A;  2QCZ A;  2K3U A;  2L83 A;  1LO5 D;  1TIF A;  2ACZ B;  1A70 A;  1C1Y B;  2ZVO A;  3R7Q A;  1QLB B;  2N7D A;  3UQA A;  3I3T B;  2KWU B;  3H7S A;  2KMA A;  2BVC A;  2IY0 B;  4FA6 A;  4LNK A;  4G0N B;  3BIN A;  1UWX A;  3P63 A;  1WIA A;  3M3J A;  2K8B A;  3AU4 A;  1JRO A;  2QIE B;  4IM2 A;  1T0Q C;  1FFV A;  5HFY A;  1STE A;  3ENE A;  1OEY A;  2BB5 A;  5C1Z A;  4F1S A;  4JPS A;  3AE6 B;  3NZS A;  1F9J A;  4GSW A;  4NPN A;  3TEY A;  1JWB D;  2KXJ A;  4P16 A;  2AQ2 B;  2MRP A;  4S17 A;  3RNA C;  5J17 A;  1WR6 E;  5AZH A;  1FMA D;  2DX5 B;  2L7R A;  3M63 B;  1UGM A;  3R3M A;  2KMM A;  2N7J A;  1XF5 L;  3PPA A;  1R4N B;  4R3D A;  3E56 A;  2N9L A;  4F7Z A;  2NPT B;  1RFA A;  4MT5 A;  3Q3J A;  1L2N A;  5JHA A;  1ROE A;  4A9A A;  2IGH A;  3AE3 B;  1QF6 A;  4RGM A;  2CHW A;  3VRB B;  3ZDM C;  4NY0 A;  3OJ4 B;  3RI7 C;  2MQJ A;  1TGZ B;  1PFD A;  2B76 B;  3QJZ A;  2K6D B;  1T3Q A;  3ECI A;  4N59 A;  3BZD B;  3RPF C;  4OZC A;  4KIK A;  1SB3 C;  4HCP B;  4N6E B;  1S1Q B;  1FXI A;  2JQR B;  2O2V A;  1JCK B;  2K1F A;  2MA9 B;  4DWF A;  4Q2J A;  3DBH B;  5EE0 A;  2D11 A;  1P98 A;  3N1X C;  2GBM A;  3SU8 X;  3VAW A;  3TIX A;  4LNF A;  2BS4 B;  2ICI A;  2BS2 B;  2QMT A;  2XK5 A;  4W9E A;  3NY5 A;  4HCN B;  2H88 B;  5CX3 A;  2BWE S;  1J8C A;  4KSK C;  4N9F 4;  2FUG 1;  2DBY A;  4ANV A;  4A20 A;  5CHV C;  2N7E A;  1N63 A;  3ZUN A;  1GC6 A;  2INC C;  1TS5 A;  3WCQ A;  1E6E B;  3ZTD A;  2YEP B;  4IKG A;  2LVP A;  3B08 A;  2KDB A;  5BO4 B;  4YSZ B;  3MHZ A;  4LNN A;  2KVR A;  5H92 C;  3TEW A;  2FUH B;  2KQ4 X;  2WQY B;  1V1O A;  3X0W A;  3VDZ A;  1ZXH A;  2MCN B;  3ZJU A;  3AXC A;  4E71 A;  2ZPY A;  3PT2 B;  3SHQ A;  2MW5 A;  4JWS C;  4WIP A;  1WJ4 A;  2WDR B;  3AEA B;  3ZYY X;  4GDK A;  1HZ5 A;  4M8N A;  4BKT A;  1L6V A;  1TBE A;  1LM8 B;  1OQR A;  4FJV B;  3QHT A;  4NAM A;  2ZEQ A;  4YSX B;  3KWL A;  3N30 A;  3TMP B;  2CU3 A;  3R66 C;  2MH7 A;  2LGX A;  3L16 A;  4YT0 B;  4N58 A;  3DVN U;  2I1K A;  1V80 A;  3AH7 A;  1I4Q A;  1OEY J;  1WZ3 A;  3SDL C;  2DAF A;  1J0G A;  2E3T A;  1XQQ A;  1TT5 B;  3DHH C;  1SE9 A;  4L2Y A;  3H7P A;  3QWZ B;  4LDT D;  3U7Z A;  1YN3 A;  3ZNI D;  4CQN A;  1I35 A;  2RDH A;  5BYR A;  3HM3 A;  1E0Z A;  2JXT A;  2DZJ A;  3I57 A;  3J9C A;  1FRR A;  2Z0D B;  2WXM A;  1WXS A;  4GIV A;  2INN E;  2YEP F;  1M4V A;  2PE9 A;  4JX1 C;  2MEK A;  2WXJ A;  4H2A A;  4GXB A;  2GBK A;  4A6Q A;  3EEC A;  3PLV A;  5C23 A;  2CU1 A;  4LNI A;  2FNJ B;  1HXY D;  3V62 A;  1ZP0 B;  3AI5 A;  1S3S G;  2KWC A;  3SEB A;  1SE3 A;  2J4X A;  3S2A A;  3VTU A;  3LDZ E;  4ZRP A;  3CF6 E;  3CMM B;  2OOB B;  3RNE C;  2ON8 A;  5BMH A;  2AEH A;  2DWQ A;  1WFY A;  4OW0 A;  3TCA A;  3AED B;  3W1S A;  1E8Y A;  3RT3 B;  1T5X D;  4DXA B;  1D5M C;  3CST A;  1TYG B;  3NRZ A;  3BK1 A;  1KLU D;  3MC0 B;  2FAZ A;  1ZGU B;  3AE8 B;  2RGF A;  4BBN F;  1WGH A;  3IVF A;  3N1Y C;  4K7W A;  1C79 A;  3A9J A;  1C4A A;  3ZO5 B;  2L76 A;  3D32 A;  3N1Z C;  2Z59 B;  4DQO C;  4HDO A;  1IP9 A;  1UH6 A;  1WWT A;  2WXI A;  2M56 B;  2WHI A;  4EE2 A;  2K22 A;  2NBW B;  2PVO D;  1WRI A;  1WX9 A;  3QAR A;  2LWP A;  4G11 A;  2ZNV B;  4B9K A;  3OJ3 A;  3DQV A;  1E8Z A;  1JWM D;  4BKG A;  4IWO A;  2KMC A;  5JHB A;  4EFO A;  4M01 A;  1WXA A;  1Q0W B;  1ZPS A;  3VHT C;  3PZD A;  3W5V B;  4FJY A;  2LGI A;  3KQ4 A;  1RWS A;  2BWF A;  2L05 A;  4GMV A;  1MG8 A;  4K3C A;  2BW2 A;  3RYT A;  4LDT B;  2HTH A;  3Q3N C;  1R7S A;  4ANU A;  2BF8 B;  4C4V B;  1BT0 A;  3ZDT A;  2IGD A;  3PSE B;  5HG2 A;  1BUI C;  1YJJ A;  4REZ A;  4RGN A;  2Y5C A;  3N9Y C;  2WWZ A;  4BOZ B;  1IGC A;  5EE1 A;  5G5H A;  3HHM A;  2C60 A;  1FEH A;  2IPK D;  2JSV X;  2Y5B B;  2CJO A;  2CS4 A;  1EUV B;  1RLF A;  4ARC A;  2PJH A;  2IZV B;  2REX A;  2KN4 A;  4NZL B;  1EWY C;  1WGK A;  1E90 A;  3PZ8 A;  4HRO A;  2JY6 A;  3TL5 A;  2I2Y A;  1VD2 A;  3QC8 B;  2JYT A;  2GBJ A;  1V2Y A;  2ZNV C;  3RNB C;  5D7G A;  3EGR A;  2E6X A;  2DZM A;  3IFW B;  3DBS A;  4K81 A;  1ET9 A;  3AEE B;  3I5J C;  4ZDV A;  1EWC A;  1WF9 A;  3FIL B;  1K53 A; 
#chains in the Genus database with same CATH homology
 1SE2 A;  2NTT A;  3Q8F A;  3DWG C;  1DGJ A;  1QOB A;  3V05 A;  1KF6 B;  1UWX A;  1AW7 A;  3P63 A;  1L5P A;  1TS4 A;  3W2D A;  5TSS A;  1CK1 A;  2H89 B;  1MHH E;  1F0Z A;  1JRO A;  2QIE B;  2EKI A;  5FKA C;  3E9S A;  1FFV A;  2WXF A;  5HFY A;  1NYQ A;  1STE A;  1V1P B;  1TKG A;  3P4Q B;  2BB5 A;  1PGX A;  1L6U A;  4JPS A;  1D5Z C;  3P4P B;  4TMA B;  3AE6 B;  1PDX A;  2KDM A;  2FE8 A;  3AE7 B;  1JRP A;  1VJK A;  2DLB A;  3TEY A;  1JWB D;  1B9R A;  1GB4 A;  4P16 A;  3ZJV A;  1CZP A;  1XO3 A;  2AQ2 B;  1HQR D;  5FR3 A;  1XLN A;  4C56 C;  1J7C A;  2IJ0 A;  3FC4 A;  1FMA D;  4WH4 A;  1C4P A;  1QOA A;  5H8Y E;  1NEK B;  2KMM A;  2N7J A;  3BII D;  1XF5 L;  3TEW A;  3LYY A;  4R3D A;  4GDK B;  4LTU A;  2LHE A;  2VZK B;  2AQ3 B;  2OED A;  3E56 A;  4XDD A;  2N9L A;  1JWS D;  2WNM A;  1SSN A;  2AX5 A;  2JU6 X;  3GS2 A;  2LEK A;  1Y56 A;  3P4R B;  3C8Y A;  4MT5 A;  3AM9 A;  1I4P A;  2G9H D;  1EU3 A;  1ROE A;  3NS1 A;  1V8C A;  2WXO A;  4A9A A;  2IGH A;  3AE3 B;  1QF6 A;  2AQ1 B;  4RGM A;  4YTP B;  3VR9 B;  1NYR A;  3FAH A;  2PTL A;  3VRB B;  4HJG E;  1MVK A;  2WXH A;  3BK2 A;  3L4P A;  1PFD A;  3BYT B;  1F2R I;  2B76 B;  1FFU A;  2FBW B;  1N60 A;  2Y3A A;  1EM7 A;  1T3Q A;  4N59 A;  1SIJ A;  3BZD B;  3RPF C;  4OZC A;  2RMM A;  4XWW A;  2MJD A;  2PKO A;  4IOI E;  1FRD A;  1SB3 C;  3O13 A;  1VR9 A;  3AE5 B;  2GB1 A;  4N6E B;  4B0M A;  1IUE A;  2D5G A;  1IBX B;  1OQQ A;  4RGT A;  2Z8L A;  3AE1 B;  1FIQ A;  3NVY A;  1FXI A;  1F2R C;  2JQR B;  2WLB A;  1JCK B;  4NJC A;  3LXF A;  2L1A A;  4Q2J A;  1JWA D;  3EUB 2;  2W3S A;  5EE0 A;  1CJE A;  2PMV A;  1ZOY B;  1K51 A;  5AUK A;  5MPO A;  1RFK A;  2WDV B;  2I38 A;  1D5X C;  1L0V B;  3AEG B;  3SFE B;  3U4E G;  1ZDV A;  2BT6 A;  3B9J A;  3ZGZ A;  2BS4 B;  2ICI A;  1XLQ A;  2BS2 B;  2QMT A;  3I9V 1;  2DYM A;  1L4Z B;  1K50 A;  2PW9 A;  3RFZ B;  2K9X A;  2N0S B;  2BS3 B;  1T6B X;  3BVG A;  2W55 A;  2H88 B;  1HA5 A;  2R61 A;  1P7E A;  2QEJ C;  1JW9 D;  2WXP A;  4O1N A;  3MP9 A;  1XCT L;  4XE0 A;  3GP7 A;  1BXT A;  1FM0 D;  1QOG A;  2DBY A;  2FUG 1;  3Q8C A;  2GRI A;  1L4D B;  3URY A;  1V97 A;  1YQ3 B;  1N63 A;  2Q5W D;  1XLO A;  4XWT A;  1D4B A;  4PT5 A;  1IBX A;  4GLS C;  2LFI A;  1JQ4 A;  1TS5 A;  3WCQ A;  1E6E B;  2YEP B;  3BVM A;  4IKG A;  1CQV A;  4KKJ A;  4NAW B;  2WXR A;  4OZB A;  4WUR A;  3P1M A;  3VRA B;  3MHZ A;  4YSZ B;  2KWD A;  5H92 C;  1I4R A;  1KRH A;  2KQ4 X;  4US9 A;  1GOZ A;  2WQY B;  1V1O A;  1VZ6 A;  4A90 A;  1DOX A;  1ZXH A;  1NI3 A;  2WXN A;  3ZJU A;  4MAC A;  3W5U B;  3PZ7 A;  3NUH B;  4JWS C;  4WIP A;  2WDR B;  3AEA B;  3ZYY X;  3GB1 A;  2EEL A;  4AS1 A;  2K0P A;  1HEZ E;  4FXC A;  1HZ5 A;  1FO4 A;  1SEB D;  1L6V A;  1SF0 A;  3ETR A;  4KGS A;  3R2T A;  1OQR A;  1F77 A;  2WXQ A;  4MM3 B;  4YSY B;  4NAM A;  3Q8A A;  3ZJT A;  4YSX B;  3AV8 A;  4RGO S;  4J3O D;  3KWL A;  2PIA A;  2M19 A;  2CU3 A;  1OFF A;  5LNK 1;  3MFG A;  3AEC B;  2WXL A;  2MH7 A;  1WXQ A;  4C7Y A;  1E10 A;  4YT0 B;  4N58 A;  1I7H A;  3AE4 B;  1QKZ A;  4HKQ A;  3NVZ A;  1E9M A;  1TJE A;  3AH7 A;  1I4Q A;  1XCQ L;  1DOY A;  4D2K A;  2X38 A;  1AN8 A;  4RCO A;  2ZW1 A;  4RNA A;  1YJI A;  5FK9 C;  1VRA B;  2W3R A;  4L1B A;  2E3T A;  4YTM B;  4USA A;  1DYQ A;  2SAK A;  4WQM A;  3Q69 A;  2IGG A;  5I4D A;  4L2Y A;  3U7Z A;  3KLS X;  5T8I A;  1FXA A;  1JWU D;  1YN3 A;  1ZXI A;  1MHX A;  1UGJ A;  5BYS A;  1NVI D;  3AE2 B;  3AMZ A;  4CQN A;  1VLB A;  2WU5 B;  2V3P A;  3TUO A;  4US8 A;  4AQ7 A;  3IT6 B;  1ENF A;  2RDH A;  3KWV A;  4OZA A;  5BYR A;  1DOI A;  1E0Z A;  2JXT A;  1NEN B;  1C76 A;  5C2T B;  3I57 A;  1JAL A;  3J9C A;  1FRR A;  3EA6 A;  2WXM A;  2INP E;  2INN E;  2YEP F;  1M4V A;  3FIL A;  4ZRQ A;  1TZO A;  4JX1 C;  1J7A A;  2MEK A;  2NMQ A;  4KX6 B;  1GAQ B;  2WXJ A;  4H2A A;  4C80 A;  4A6Q A;  3SR6 A;  1XEE A;  3Q8B A;  1HZ6 A;  4TSS A;  3Q8E A;  3TEZ A;  2WDQ B;  4TQ0 A;  1SXT A;  1HXY D;  1ZP0 B;  2V4I B;  3BYY B;  2RDG A;  3VQI A;  5BYQ A;  2QJL A;  5AUI A;  3SEB A;  3T3O A;  1SE3 A;  1K52 A;  2J4X A;  3P42 A;  2J52 A;  1MI0 A;  4ZRP A;  5HHD G;  1C4C A;  2MJ3 A;  2XNA C;  2WXG A;  3BWU D;  2ON8 A;  5BMG A;  5BMH A;  4C7Z A;  1YN4 A;  1TY2 A;  3H8H A;  1TY0 A;  2DWQ A;  4OW0 A;  1XXG A;  3AED B;  1L0Y B;  3W1S A;  1T5X D;  1PUT A;  4WAF A;  1I4H A;  2JYE A;  2TSS A;  3HVZ A;  1D5M C;  1VZ8 A;  2BB6 A;  4DXF A;  1GB1 A;  1TYG B;  2ZW0 A;  3R2I A;  3NRZ A;  1GPX A;  2V3N A;  1ESF A;  4LLG M;  3BK1 A;  1KLU D;  4GDL B;  2HDE A;  4MH8 A;  3MC0 B;  5G5G A;  3AE8 B;  3MJ5 A;  4TQ1 A;  4ZHO A;  1SJE D;  2CJN A;  5BMI A;  2HTM E;  1UNS A;  2L32 A;  3HVD A;  1C79 A;  1XLP A;  2OHF A;  3OWE B;  1SJH D;  2KAJ A;  4HKZ E;  4DXG A;  2WS3 B;  4IDI A;  1C4A A;  5E6J A;  2G1E A;  2JX5 A;  2V0G A;  1E7P B;  4RFB A;  3CIR B;  1KFY B;  4HRS A;  3BVZ A;  4DQO C;  2WU2 B;  1SBB B;  2QIL A;  1QOF A;  1EU4 A;  1WWT A;  1YN5 A;  2WXI A;  3HRD D;  2M56 B;  1ZE3 D;  4A55 A;  2MJE A;  2BTE A;  1AYF A;  2WXK A;  3LB8 C;  2RPV A;  3IXS A;  3V3X A;  1TKY A;  4EE2 A;  2K22 A;  1FCL A;  2PVO D;  1WRI A;  3VR8 B;  4KGT A;  1N5W A;  3PO0 A;  1ZUD 2;  3AEB B;  1L0X B;  2KAC A;  1JWM D;  1UUP A;  3IT4 B;  3B2G A;  2ONQ A;  1WSP A;  2QSD A;  1PGA A;  4JE3 B;  1FNU A;  3NZ3 A;  2VZK D;  1ZDX A;  4ITK A;  2W54 A;  3W9C B;  1C78 A;  3TSS A;  1KLG D;  4UDU C;  1FNV A;  1UWM A;  3U52 E;  1ZPS A;  3W5V B;  3CWI A;  2M0A A;  2LGI A;  3AN1 A;  1RWS A;  3KQ4 A;  2JWU A;  3NVW A;  5EE9 A;  3IAS 1;  2BW2 A;  4YXD B;  1C77 A;  1SE4 A;  2DYO A;  4RF1 A;  2IDY A;  3T3N A;  1C9F A;  1JML A;  1RM6 C;  1YMH E;  2Y5P A;  1R7S A;  1TS2 A;  2LUM A;  1MPE A;  2SEB D;  1BML C;  1D6E C;  2J53 A;  2K5P A;  2NTS A;  4RH6 A;  3TEX A;  2LJI A;  5EE3 A;  2IGD A;  2L52 A;  3AB5 A;  5HG2 A;  1BUI C;  2PVG C;  5D3I B;  3ABV B;  3AEF B;  1YJJ A;  3P4S B;  4REZ A;  4A8X C;  4RGN A;  3DWM A;  1FD6 A;  2Y5C A;  3N9Y C;  4YTN B;  1ET6 A;  3IAM 1;  4XDC A;  1TS3 A;  1IGC A;  5EE1 A;  1I4X A;  1ACC A;  1YNT E;  1FNW A;  1PYW D;  4M0W A;  1N5X A;  5G5H A;  2XN9 C;  1FEH A;  2GI9 A;  2IPK D;  3SFD B;  3B2F A;  1B1Z A;  2JSV X;  1Q10 A;  3R8B A;  4L23 A;  2CJO A;  4OVZ A;  1KTK A;  3NVV A;  4RF0 A;  2N9K A;  4P6V F;  4ARC A;  4OHJ A;  1TKE A;  4HEA 1;  5GXG B;  1IGD A;  4WWM A;  1QQR A;  1J7B A;  5HI1 A;  4ZHP A;  4JWU C;  3U2S C;  1YQ4 B;  1PGB A;  1AWD A;  1P7F A;  3HUI A;  5JXV A;  5C3J B;  1KH0 A;  3AE9 B;  4ZYS A;  1RYJ A;  1N62 A;  2KN4 A;  1N61 A;  2W82 A;  2PLP A;  4NZL B;  2LHD A;  1EWY C;  1WGK A;  4KGR A;  4KKI A;  4LK0 M;  1I4G A;  1QIL A;  3PZ8 A;  4HRO A;  2BYT A;  2I2Y A;  4YWG G;  2K3U A;  3UI3 A;  2L83 A;  4ARI A;  2JYT A;  2JZP A;  1LO5 D;  2ACZ B;  1A70 A;  2LMC A;  5D7G A;  1VDV A;  3EGR A;  2E6X A;  1QT9 A;  2BBC A;  4B0E A;  1QLB B;  1ET9 A;  3AEE B;  1FCC C;  1VZ7 A;  1WYG A;  2WP9 B;  1EWC A;  5D3D A;  3FIL B;  3ZQ4 A;  1K53 A;  2J42 A;  1V1P A;  4ZOH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...