2CU3A

Crystal structure of tt1568 from thermus thermophilus hb8
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
63
structure length
63
Chain Sequence
MVWLNGEPRPLEGKTLKEVLEEMGVELKGVAVLLNEEAFLGLEVPDRPLRDGDVVEVVALMQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unknown function protein
publication title Crystal structure of TT1568 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 13
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2cu3A00
1AWDA 4FXCA 2L83A 1R7SA 3B9JA 1DOXA 1L5PA 3SR6A 1J7AA 1E6EB 1YJJA 4YTNB 2WS3B 1FXIA 4LTUA 1JWBD 5EE0A 1V97A 2JQRB 1NYQA 5C2TB 2QJLA 1B9RA 2K22A 4YXDB 3P1MA 3AB5A 3AH7A 2BS4B 3FAHA 1E7PB 1OFFA 1TKEA 4KX6B 1XLPA 1L6VA 1XO3A 2B76B 4ZHPA 4A9AA 3FC4A 2G1EA 3NRZA 3SFEB 4YSYB 2HTME 1GAQB 1N5WA 3ETRA 3AEBB 1ZP0B 3AE1B 1KRHA 2LEKA 4YSXB 1GPXA 1E10A 2WP9B 1TKYA 1WRIA 2N0SB 1J7BA 1DOYA 1QOAA 1JQ4A 2WU5B 2MJ3A 3BIID 1KF6B 1FRDA 1E0ZA 1WYGA 4ZOHC 3NS1A 1PUTA 3VR8B 4JWSC 1RYJA 1YQ4B 1NI3A 3NVZA 3DWMA 1OQRA 2OHFA 3HRDD 3AEGB 1PDXA 4USAA 2PIAA 1J7CA 3AE6B 1QOGA 2W3SA 2WDRB 1JRPA 1T3QA 2CJOA 3P4PB 2ACZB 1WXQA 3HUIA 2H89B 3L4PA 3W5UB 3AE8B 1CJEA 1FFUA 1FRRA 1N63A 1SIJA 2BS2B 2PVOD 2WQYB 1FXAA 3CWIA 5EE9A 2Q5WD 2FBWB 3LB8C 2CJNA 5C3JB 3P4SB 1UWMA 4P6VF 1IUEA 1JROA 3VRBB 1QT9A 2PVGC 2MH7A 1NEKB 3KWLA 2WU2B 3AE2B 3VRAB 4N58A 1FM0D 2BT6A 1DGJA 4C7ZA 1I7HA 4YTPB 2W3RA 2DBYA 1YQ3B 2MJDA 1EWYC 3DWGC 5AUIA 4N59A 1NENB 1VDVA 1CZPA 2E3TA 4JX1C 4N6EB 3AEEB 1SF0A 1A70A 1E9MA 1TKGA 1V8CA 4ZHOA 1VJKA 1OQQA 1XLOA 5H92C 2AX5A 3AM9A 3NVWA 1WWTA 2M19A 1FIQA 4HRSA 4US8A 1JALA 2W54A 1ZXIA 1N61A 2PKOA 1VLBA 3NVYA 3P63A 1FMAD 3RPFC 1N60A 3AE7B 2WDQB 4US9A 1N5XA 4YSZB 3W5VB 4YT0B 1QF6A 1L6UA 3AEAB 3CIRB 3NVVA 3HVZA 1TYGB 1RFKA 1XLQA 2W55A 3AE9B 1WGKA 4WWMA 2JX5A 3AEDB 1FFVA 4ITKA 3LXFA 1QOFA 3AMZA 1XLNA 2L52A 1DOIA 2K9XA 1JWAD 3AV8A 5EE1A 5MPOA 1N62A 2CU3A 2M56B 4JWUC 1AYFA 1PFDA 1TJEA 1JW9D 2Y5CA 2QIEB 1F0ZA 3P4QB 2BS3B 3B2GA 5EE3A 4C80A 1NYRA 5AUKA 4YTMB 1KFYB 3W9CB 4WQMA 2WDVB 3ABVB 2KAJA 1ZUD2 1L0VB 3AN1A 5GXGB 1ROEA 1SB3C 3ZYYX 1QLBB 2MJEA 3AEFB 3EUB2 4IDIA 3PO0A 1NVID 1RWSA 4HROA 3VR9B 2KMMA 2K5PA 2H88B 2WLBA 3AE3B 5H8YE 1YJIA 2EKIA 3SFDB 2DWQA 5G5GA 1FO4A 1ZOYB 3AE5B 5G5HA 3B2FA 3WCQA 4C7YA 3AE4B 3P4RB 1QOBA 3AECB 1RM6C
chains in the Genus database with same CATH superfamily
3PHWB 2KDMA 2ZCBA 1M94A 2WS3B 2J0JA 4ZRPA 1C1YB 2PTLA 2EMTA 4LJOB 2BWFA 3V62A 1WSPA 3L13A 4DBGA 2KLCA 4YXDB 3P1MA 4AJYB 4KX6B 2K6DB 3QJZA 2D07B 3MP9A 2G1EA 4C56C 2NTSA 3I5JC 2MHJA 4GXBA 1AN8A 2KDIA 1FNUA 2L76A 4MGYE 5IOIA 3PS6A 3E9SA 3PRMB 2KACA 3PLUA 1DYQA 3ZJUA 4MH8A 5BMHA 5CX3A 4ZRIA 3RNFC 1PDXA 4KSLC 4W9DA 4MM3A 1T0QC 3T3NA 2N1WA 3ZIMA 1YD8U 4HVBA 2WXJA 4HWIB 3CWIA 3LB8C 4PS8A 2R61A 1ISNA 1NEKB 3KWLA 4FHKA 3VTVA 4UDUC 4TQ0A 1L2NA 1YQ3B 4ARIA 2FAZA 3GB1A 2ZPNA 3SHQA 2M19A 1TGZB 3A4SC 1HTOA 2ZVNA 3DVGY 4K3BA 5HFYA 1YQBA 3AEAB 3DVNV 2YEPF 2KWCA 1XQQA 2PEAA 4KGTA 2KHWB 4FJZA 1WXMA 2OJWA 1JW9D 2A5UA 3NG0A 3PTFC 3NJTA 2XBBC 4IG7B 3H7PB 5JHBA 1GUAB 4IWOA 4W9EA 1OEYA 3RD2A 3ZYYX 1WJ6A 4B0EA 1P0RA 4PS7A 4OVZA 1I4GA 2LD9A 3I57A 4FHJA 5G5HA 2JF5A 3DVGX 2R2QA 3H6NA 1EU4A 2L83A 5L95C 3ZXVA 1BMLC 4LTUA 4EZJA 3CF6E 4GMVA 2YLMA 5C2TB 3PT2B 5IP4D 3UF8A 4YSYB 2QC8A 1C4CA 3ZXRA 5IN7A 2JYTA 2BW2A 4GN1A 1ZGUB 3Q3JA 3DHGC 3O13A 3VR8B 4TQ1A 2MBEA 1L7YA 1R4MB 3NVZA 4MGZE 1V5OA 1F52A 1WX7A 4RCOA 3JSVB 3DVNU 5DPTA 2N9PC 3A9JA 2CJNA 2QEJC 3VRBB 3VRAB 1WM2A 4OZBA 3PZDA 1I7HA 2N9EB 2WXLA 2OOBB 3AM9A 5BMGA 2IGHA 1N61A 1VLBA 1FMAD 4TSSA 3GZNI 1LO5D 4K1RB 4YT0B 3CIRB 3NVVA 4A20A 3H7PA 4KKIA 2LGYA 4MGIE 1FFVA 2O6VA 1XLNA 2JPHA 2K9XA 4DDID 2KN4A 2JXTA 1V2YA 3BY4B 2NVUI 2WXRA 1HZ6A 2O2VA 2D3AA 4NAWB 1T0SC 2KDBA 5T8IA 3IAM1 4HJGE 4S0RA 2L7RA 4OVVA 2I1KA 2KMAA 2H88B 2IBIB 2VH1A 4LK0M 1V5TA 2AWTA 2KDEB 2KNBA 1WE7A 1YOVB 3RNBC 4J3OD 2KJRA 3RNCC 1B9RA 2D10A 1E7PB 2BBCA 1L6VA 3ZO5B 4JGHB 4CQNA 1FXTB 3ETRA 3AEBB 1HE8A 5IA7A 3JSVA 1WRIA 3IAS1 1F2RI 1FEHA 2KTRB 4EUTA 4WAFA 1VZ6A 3ZKJC 3DWMA 1OQRA 1V86A 3ZUNA 3Q6BA 2Z0EB 5IKCM 4PYUA 2ZW0A 3SEBA 2FNJB 3HUIA 3AE8B 4BVUC 4DWFA 3N3KB 5DCNA 1WXVA 4DXGA 2K8HA 4P7IA 2K8CA 2WX0A 4FADA 5TR5A 4MEMA 3EECA 1WRDB 4E3CA 1VRAB 2W9NA 5AZGA 1L0XB 4HEA1 2GMIC 4US8A 3RI7C 1GC7A 1QQRA 4HJKA 3HM6X 2DZMA 2MRPA 2GBJA 3M62B 3HVZA 1RFKA 1XLQA 2JYEA 3AE9B 4TKNA 4JIOU 3NZSA 5HG2A 1K51A 3ZNID 4NAWA 2L52A 3V6EB 4KV2A 4EEWA 3K9PB 4LNIA 2KJ6A 1F0ZA 1TT5B 1MVKA 1LXDA 2J53A 5BMIA 2X38A 3EHVA 3NHEB 2K25A 5D3DA 5GMVA 1MJDA 3HK0A 2HDEA 3S2AA 3MTNB 1XCQL 3BWUD 1I4HA 4WWOA 3LJ3A 1KLUD 2MA9B 5C23A 1DOXA 1SE3A 3OJ3A 1YJJA 3MC9A 1RRBA 1MG4A 5LXIB 4W9KA 4NAMA 5EE0A 2J4XA 1R4MI 2Y5BB 2MX2A 2WXMA 5KHQA 4A9AA 2JY6A 2IZVB 4LDTD 4BBNF 1YNTE 1ZP0B 3AE1B 1WJUA 4FJVB 2JSVX 3ZVVA 2C5LC 3V61A 3TIXA 2OJRA 2K0PA 3BIID 2IGGA 3VDZA 4G50A 1KLGD 1JWMD 2N9LA 1T6BX 1JMLA 2NMQA 1QOGA 2WDRB 1MHXA 2CHZA 2CJOA 1WXQA 4BKTA 2WQYB 3MHZA 3ZW3A 1E8WA 2ZCCA 4N9F4 2DHZA 2LVPA 3V6CB 3VUWA 1L0YB 3SDLC 2JU6X 2G9HD 3KUCB 4JL9A 1I35A 4RMAA 2EMSA 1SF0A 4AP4C 4HPMB 4ZHOA 2AX5A 3H9DA 4NJ7A 1UBQA 2MBOA 4HRSA 3Q69A 4XYCA 2C7HA 4HDQA 1WMHB 3A9KA 3OWEB 5HI1A 4AS1A 2MWSB 1E8XA 3V60A 5CHWA 5EE1A 2GRIA 1QKZA 1TJEA 2VZKB 3UQBA 2RMMA 1WH3A 1TZ1A 3WIMA 1WGYA 2ZJDA 4K7UA 1KFYB 1E8YA 4MH0E 3K9OB 2KWVB 2ZVOA 1L0VB 1FD6A 2L8JA 2DAFA 4IWPA 2HD5B 1KOTA 2LZ6A 2XK5B 4MDKE 2KMMA 1VZ8A 4FULA 3MHSD 1QZEA 4NNJB 1ZOYB 2WDTB 4MELA 3IVFA 2HE7A 3DDCB 2MEKA 1L5PA 5E6NA 2V3SA 4LNOA 1VZ7A 1ZXHA 2CR5A 4GDLB 3EGRA 4M8NA 4HCPB 4GDKA 3QC8B 3PRZA 4AUQC 4ANUA 2KO3A 1XT9B 1J19A 4ASWC 1WR1A 2BYEA 3PPAA 2BPSA 4P1CC 2ICIA 4XGAB 4NJ6A 1Q0WB 2WXKA 1JRUA 2M0XA 1V6EA 1D3ZA 4USAA 3VHTC 4IM0A 2K39A 4L2YA 2LFIA 3RMKC 1SJHD 4L23A 5D3IB 3L08A 1C3TA 1SIJA 5DPWA 2V3NA 4RM8A 1T5XD 3AE2B 1FNWA 4ZYNA 1ACCA 3MJ5A 3W1SA 1S3SG 3DWGC 1NI2A 3N1YC 2GOWA 5H92C 4A90A 1RAXA 4IW0A 1MG8A 4NQLB 2D2QA 2IPKD 2RPVA 3RNAC 4WIPA 4BKSA 3IHPC 3PZ7A 2W55A 1UUPA 2WWZA 2JX5A 1WJ4A 3R66C 5JH5C 2KWDA 1DOIA 1N62A 4MM3B 1WX9A 1TZOA 1TIFA 3U8ZA 4CHKA 2CKHB 4B6WA 3ZTCA 4DHJB 2KKCA 3T8MA 5GXGB 1WGHA 4CO7A 2CHWA 2IO2B 1QLBB 2MJEA 3PO0A 4W9IA 4BOSC 4HROA 4NPNA 2K5PA 2WLBA 2AL3A 4IKGA 1PGBA 4KDIC 4K81A 2VZKD 2LWPA 3ALBA 2J0MA 2JQRB 4WH4A 3VTWA 1WX8A 1L4ZB 1NBFC 4O1NA 1YN3A 1KRHA 3IT6B 4XC2A 4HXDA 2GB1A 4LJPB 5E6PA 2WU5B 4GB9A 1J8CA 4MT5A 4LNKA 4JWSC 1F2RC 1NI3A 3MC0B 2QCZA 1J7CA 2N4FA 2ZPYA 2RD0A 3DHHC 1P98A 1CJEA 1FFUA 3PV1A 5KHOA 2LUMA 2WXPA 2FE8A 3CMMB 4WWNA 4A3OA 2MSED 3A1QA 4L1BA 4ZRKA 1SSNA 1UF0A 1XLOA 3QA8A 2LGXA 1WZ3A 3Q8BA 3PVLA 1P1AA 3C8YA 3P63A 2KJHB 3OG5A 3AE7B 2IO1B 1GJZA 4ITKA 5E6OA 4DK5A 3TMPB 4F1SA 4W9CA 2MLBA 4YTMB 3A9JB 2V1YA 3ABVB 1BXTA 2PW9A 3LYYA 3RZFA 2WHIA 1BT0A 1PQSA 1SB3C 4RH6A 1UGMA 2RR9A 4IDIA 2UU7A 1NVID 4W9LA 4ARCA 1OEYJ 2LXCA 2NCNA 2N7EA 1RM6C 1KH0A 4I6PA 3B9JA 5FK9C 5BO4B 4JE3B 1EF5A 1NYQA 3DOWA 4WURA 1FNVA 1XCTL 2FCSA 2G4DB 2O6VB 1A5RA 1WIAA 3KW5B 4REZA 1IGCA 2LJIA 2V4LA 4IUMB 2N0SB 1J7BA 2NS5A 4W9GA 3Q2AC 1U4AA 2XNAC 2O2VB 3DBLI 4J6IA 4BFRA 1HZ5A 2SAKA 5BYSA 3TEXA 1WYWB 1QILA 3TL5A 2KOXA 3P4PB 3BINA 1TS2A 4P1BC 4KZCA 3TEYA 1CK1A 3N1XC 3W5UB 1UZXB 3J9CA 2BB6A 4WJPA 2FIFA 3I3TB 1JROA 4GGQA 1YMHE 2L00B 3ZGZA 2LRUA 1FM0D 4N58A 2I38A 3HVDA 4YTPB 2LHDA 3X23A 1LGRA 4YWGG 2MP2B 3GE3C 2ZNVC 2Y3AA 2ONQA 3R7RA 2JUOA 1SXTA 1A70A 2LJ5A 4A8XC 1ZE3D 2AYOB 1WWTA 4C4VA 3RNGC 1N60A 1WZ0A 5TSSA 2BWES 2V9HA 3ZDMC 1WE6A 2DLBA 4XE0A 2C7NB 2WX1A 1PFDA 3MJWA 4A6QA 2QIEB 1RLFA 3P4QB 3PZ8A 2UYZB 4C80A 4DXAB 1I4XA 2EELA 4ICVA 2WDVB 3RYTA 3PREA 4WAAA 3Q8CA 1Y56A 4K7WA 3ML9A 3BK2A 4G3XB 2ZNVB 1RWSA 2DX5B 4HLEA 2DYMA 2DWQA 1V1OA 2IO0B 2DYOA 3SR6A 1J7AA 1E6EB 4YTNB 3U30A 3IXSA 2DENB 2ASQA 2KXJA 3VXWA 3WA0A 2INCC 2XEWA 4PK1A 1B1ZA 2KWUB 4MSMB 2MW5A 1VCBA 3MC8A 3TEZA 1WGRA 3NZ3A 1Q1OA 1WYGA 2WXOA 1IP9A 2KFKB 2M4NA 4IOIE 5D94A 1IBXB 2W3SA 5EDSA 3E56A 5LNK1 1STEA 4ZRQA 2MP2A 1GG3A 2AQ3B 5LXHA 3ZRCA 2Q5WD 1SIFA 3P4SB 3VH3B 5J2RA 1Z2MA 2PVGC 3H1UA 1OQYA 2BT6A 2K3UA 2WYQA 1HA5A 2N7DA 1KJTA 1F1HA 1V9JA 1ZXIA 1FPYA 1GB1A 3N1ZC 2AQ1B 2KT7A 2PE9A 2CHXA 2BYTA 3RCZA 3NS8A 5EE3A 4GOCA 1WF9A 2V3PA 3AN1A 2BQQA 2D3BA 4OZAA 1D5MC 4LLGM 4K7SA 3ZRFA 5G5GA 2JWUA 4HK2A 3AE4B 1Q10A 3AECB 2NTTA 3UGBB 4X57B 2PJHA 3TUOA 1Y8RC 4G0NB 2R2OA 1ESFA 1FXIA 3A9KB 4FBJB 2JZZA 3M63B 1VR9A 2K8BA 1TKEA 2L0TA 4JLCA 4RGOS 2MBBB 4IM2A 2KFKA 5JXVA 2L05A 2L1AA 4PS3A 3LDZE 1IBXA 4KVGB 1E7VA 3BYYB 1C79A 1OTRB 1ZW7A 1UBIA 1H8CA 3RUIB 4QAYA 3BK1A 2INPE 2KYWA 1AARA 1OGWA 1SEBD 2BYFA 2KD0A 3ONSA 2KX3A 2VH2A 2INDC 2E6XA 3GS2A 1YJ1A 1FXAA 3QK0A 2KZRA 3VVWB 4DHZB 5HHDG 3UQAA 3KYDD 4DXFA 1BUIC 4GDKB 1MHHE 3W1SC 5L83A 4N59A 1NENB 4JX1C 3AEEB 2PKOA 3EFUA 3NVYA 4FA6A 4US9A 2BGFA 3KWVA 1LQBA 3AEDB 3VTUA 3AV8A 4EOYA 3GE8C 1V1PA 2JT4B 3B2GA 4K3CA 3DBRB 2N9KA 4RF0A 1EWCA 4TMAB 3B2FA 1D6EC 2A4ZA 3P2BA 2KVZA 4HPLB 2K6QA 5LLIA 4KIKA 4G11A 2K22A 1JWUD 3FAHA 4MACA 4KGRA 1V49A 2CU1A 3FC4A 4B9KA 3SFEB 2ZEQA 1WGGA 1N5WA 1N6ZA 1UH6A 4IM3A 4XWTA 3TBLD 1JQ4A 3AXCA 3L10B 4R3DA 2JZ3B 1FRDA 1E0ZA 2DZJA 3NS1A 1PUTA 1UGJA 2PIAA 2G4SA 2WXNA 4I6LB 4ANXA 3RZWC 4XX5A 2I1JA 2FUG1 3B0AA 4P6VF 4BBNC 1WM3A 1SJED 2IY1B 3PLVA 4PT5A 3I9V1 4C7ZA 5FKAC 1LFDA 1HTQA 3N20C 3NY5A 5AUIA 5CHFA 5BYQA 3V05A 1L4DB 2PE6B 2MBHA 1TKGA 2WGSA 3FILA 1GOZA 1TTNA 2LUEA 1FIQA 3VAWA 3RPFC 2WDQB 1ZKHA 2B3AA 3QHTA 4HKZE 4RGTA 4WWMA 2Z0DB 3RNEC 3DBLB 3IG3A 1MPEA 3IFWB 1AYFA 2DNFA 4JWUC 1D5ZC 1P7FA 2GI9A 1WJNA 2N1VA 4XDCA 2DYBA 4RGNA 2EKEC 1JWSD 2IY0B 3APCA 3DHIC 4Q2JA 3KLSX 4XZ4A 1TY0A 4E71A 4RF1A 1PGAA 1E7UA 3EUB2 3A1QB 2EKIA 3SFDB 2GLSA 4LCDE 1XXGA 1PYWD 5G55A 4FXCA 5IO9A 1YX5B 3OJ4B 2AL6A 1G6JA 3AULA 5HKHA 3AB5A 2BTEA 1NDDA 1E5WA 3VQIA 4MJSA 1ET9A 2PLPA 2LEKA 3R2TA 4EE2A 3BVMA 3M3JA 1R4NI 2IO3B 1V80A 1TBEA 2JVCA 3HHMA 4S17A 1ZDVA 1T3QA 4BKSD 4W9HA 3L4PA 3AU5A 1N63A 2PVOD 5EE9A 2BS2B 1P9DU 2QSDA 1WXSA 2FBWB 4XDDA 4BKGA 1P7EA 2LXAA 4D2KA 1WXAA 2MH7A 3Q8AA 2X8XX 1HQRD 2MJDA 2IYDB 3C19A 4XWWA 1VDVA 3Q3OC 2RGFA 4LNNA 5D7GA 1FCLA 1E9MA 1V8CA 4M01A 4WQOB 2I2YA 5AZHA 4IWQA 2HTHA 1N5XA 1T0YA 4CYEA 2KC1A 1QF6A 4ANVA 3DBRI 1TS5A 1WGKA 4ACFA 4JQWC 4A55A 3TCAA 3M95A 3LXFA 2JZPA 3U4EG 2J52A 2M56B 3ZJVA 4BAXA 1F9JA 5AUKA 2DZKA 4HKQA 4ANWA 5E6JA 3WALA 2BVCA 3L16A 3Q14C 1Z5SB 3UI3A 3ML8A 1K52A 3Q8EA 1V81A 4HPPA 3P4RB 1QOBA 4WJNA 1AWDA 4C4VB 4F8CB 5CTRC 1S1QB 1P3QU 2JRHA 3QX1A 1OFFA 2AQ2B 3NRZA 3Q8FA 1J0GA 2JRIB 1D5XC 2OEDA 4DDGD 2VRRB 3WAPA 2N7JA 3ZQ4A 2L0FA 3VFKA 1QOAA 2DZIA 2MJ3A 1C4PA 3H8HA 2OHFA 3UIPB 4DHJD 5JZEB 3PSEB 4B95A 2KFJA 4KGSA 1WY8A 4JPSA 1FCCC 2W3RA 1PGXA 4M8MA 2BKRB 2TSSA 1CZPA 4M00A 4FJYA 2KLGA 2KQ4X 5G2NA 4LNFA 2J42A 3W2DA 3ZNHB 3GP7A 3N30A 2LGSA 4AOFA 3ZDTA 3AMZA 3DBHI 3JYUA 2CU3A 3KUDB 5IAAC 3KQ4A 2KC2A 2G45B 4C00A 3KH0A 2LRWA 3AU4A 4WJOA 3WAMA 1UNSA 5DPSA 3PHXB 3ZJTA 2L32A 3VR9B 3AE3B 3P42A 3N32A 1FO4A 3DCGA 2M1MA 3TEWA 1UELA 3R7QA 1V97A 3O65B 3KYCD 2QJLA 4RFBA 2LVQA 2ON8A 3WAOA 2LHEA 3VH4B 3T3OA 4GIVA 1GPXA 2WP9B 2PMVA 1TKYA 3A33B 3MFGA 2FCNA 4RGMA 2GBRA 2LASA 1WGDA 3CSTA 2AEHA 2V0GA 2IDYA 2LMCA 2INNE 3Q3NC 2ACZB 3SD5A 3D32A 1K50A 1FRRA 1SE9A 2GBKA 3PRPB 2JWZA 1M4VA 1EO6A 2D11A 2LI5A 4IC7B 5AZFA 3RT3B 1CQVA 1DGJA 4W9FA 3N9YC 1C77A 5BYRA 2J0KA 3H7SA 2E3TA 3WANA 1EF1A 1E8ZA 3EFCA 1YN5A 3NVWA 1LM8B 4LDTB 1JALA 3GOEA 2FCMA 2YEPB 1KLVA 3OAWA 4KDLB 4M0WB 2O6VD 2C7MB 5CHVC 1RFAA 4EZKA 4URKA 2Y5CA 1D4BA 5J17A 4B0MA 1EUVB 2BKFA 3W9CB 2KK8A 2UWQA 1YIWA 2KVRA 2RDGA 2NR2A 2FIDA 2K1FA 1WR6E 2FCQA 2RSUA 3BVZA 4RNAA 1YJIA 2Z8LA 3ZTDA 3U52E 1EM7A 4RM9A 3DPDA 1C78A 1R7SA 1SGHA 4PYZA 4NQKE 2WXFA 2REXA 1JWBD 4GSWA 2LGIA 1EU3A 1GC6A 1XLPA 4ZHPA 1XO3A 1I42A 4FLHA 3URYA 3KUZA 2HJ1A 1V1PB 1ET6A 3JW0X 2M8SA 1DOYA 4F7ZA 4ZRJA 1GNUA 2XN9C 4GLSC 1RYJA 2Y5PA 3A4RA 3HRDD 4EKUA 1JRPA 3EA6A 5J18A 1TS4A 2BYVE 4DHZE 4KIKB 1IUEA 4YL8A 1UWXA 2QHOA 1YX6B 1HXYD 2LVOA 1SBBB 3HM3A 1XEEA 2WXIA 1WI0A 2DBYA 4DQOC 3IT4B 2YVCA 4M0WA 1EWYC 4ICUA 3APDA 2V4IB 3B08A 2KQ7A 4E74A 2C9WB 4NZLB 1C4AA 4OW0A 3R2IA 1IGDA 3RN9C 1R4NB 3V3XA 3ZNGC 3ZNZB 2KTFA 2QDFA 2BF8B 1JWAD 3NUHB 4TUUA 1C76A 2ZW1A 4MGKE 2J7QB 2KTRA 4WQMA 2D5GA 3QWZB 2KANA 3UIOB 3PGEA 3TSSA 1IYFA 2WNMA 3FILB 4FN2A 4A3PA 4W9JA 3DBSA 3U2SC 4ZDVA 2NBWB 2W82A 2BS4B 2CS4A 2B76B 1YN4A 1I4QA 2M0AA 2HTME 3Q3FA 1GAQB 4OHJA 4YSXB 5FR3A 2IGDA 4HDOA 1GB4A 2MBQA 2QILA 3NOBA 2KN5A 2NPTB 1AW7A 1UD7A 1XD3B 3RULA 1ZPSA 3AEGB 2MQJA 3AE6B 3T9LA 3QIJA 2D3CA 1T0RC 2WXHA 1QT9A 1TY2A 1ZDXA 4AJWA 2WU2B 4HCNB 3ZLZA 4M02A 3X0WA 3APFA 2M17A 1H4RA 2HJ8A 2ZZPB 4MJSB 2QMTA 2KX0A 1VD2A 3UINB 2GBMA 1VJKA 1OQQA 3CSFA 3VUYA 2W54A 1TS3A 3I63C 3QARA 1K53A 3SU8X 3L54A 4ZYSA 4YSZB 3W5VB 1X1MA 2C60A 2BB5A 5MPOA 2D3GA 2LGDA 4II2B 5DPRA 1WFYA 3ECIA 1SE2A 2BS3B 3R3MA 4GU2A 1NYRA 1I4PA 2KAJA 1ZUD2 2RDHA 1C9FA 1ROEA 5JHAA 4KKJA 3BVGA 5AEKB 1ENFA 3FKYA 3QCAA 1XF5L 3AE5B 2RDBC 3KVFB 3WCQA 5I4DA 3EC8A 5D2MB 3L0WB 2NBVB 1SE4A 2N9XA 3B1LX 3AH7A 2NPTA 4WWPA 2WXQA 3R8BA 4TV3A 3VUXA 1F77A 3C0RB 2PPHA 5C1ZA 4BZAA 1E10A 3DBHB 4OZCA 2FUHB 1WMHA 3Q3MC 1KF6B 2KMCA 4ZOHC 3HIZA 1YQ4B 2IJ0A 1K8RB 4OVUA 4AWJA 3QAQA 4P16A 1E90A 1IPGA 3W1YA 2Z59B 2H89B 2L3ZA 2MCNB 3OLMD 3U7ZA 4NJCA 5C3JB 1UWMA 1HEZE 3DQVA 4WJQA 2KDFB 3NZUA 4EFOA 2XK5A 4N6EB 3QQ8B 4NY0A 3U7DA 2JXXA 2RPQA 3AI5A 3RFZB 1KM7A 2KQSA 4KSKC 1CMXB 4KZ0A 4AQ7A 4H2AA 3JVZX 1MI0A 4MSQB 4GDLA 1Q5WB 1L6UA 5D6JB 1TYGB 3IBEA 2GBNA 1KTKA 1QOFA 3L17A 5FR6A 2G3QB 2DAJA 2SEBD 4BOZB 4EZLA 3GZNB 3BYTB 1I4RA 3AEFB 1MFWA 3BZDB 5H8YE 4II3B 2NBUA 4I6NB 3TJPA 4C7YA 1JCKB 2WXGA 3ENEA
chains in the Genus database with same CATH topology
2NTTA 2KDMA 1L5PA 3TUOA 4ZRPA 1ESFA 1FXIA 2WS3B 2PTLA 1VZ7A 1ZXHA 1V97A 1WSPA 4RFBA 2QJLA 2ON8A 4GDLB 3P1MA 4YXDB 1VR9A 3EGRA 2LHEA 1TKEA 4KX6B 3MP9A 4RGOS 2G1EA 4C56C 2NTSA 5JXVA 2L1AA 3T3OA 1AN8A 1FNUA 1GPXA 1IBXA 3E9SA 2WP9B 2PMVA 1TKYA 2KACA 3MFGA 2ICIA 3BYYB 4RGMA 1DYQA 2WXKA 1C79A 3ZJUA 4MH8A 5BMHA 3BK1A 2V0GA 2INPE 4USAA 1PDXA 1SEBD 2IDYA 2LMCA 2INNE 3T3NA 4L2YA 2ACZB 2LFIA 1SJHD 2E6XA 1K50A 4L23A 5D3IB 2WXJA 3GS2A 1FRRA 1SIJA 3CWIA 1FXAA 3LB8C 2V3NA 1M4VA 2R61A 1T5XD 1NEKB 3KWLA 3AE2B 1FNWA 4UDUC 1ACCA 1CQVA 1DGJA 5HHDG 4TQ0A 3MJ5A 3N9YC 3W1SA 4DXFA 1BUIC 1C77A 1MHHE 4GDKB 1YQ3B 5BYRA 4ARIA 3DWGC 4N59A 1NENB 2E3TA 4JX1C 3AEEB 3GB1A 5H92C 1YN5A 3NVWA 4A90A 2M19A 1JALA 2PKOA 2YEPB 3NVYA 5HFYA 2IPKD 2RPVA 4US9A 4WIPA 3AEAB 3PZ7A 2YEPF 2W55A 1UUPA 3KWVA 2JX5A 3AEDB 4KGTA 2KWDA 1DOIA 3AV8A 1N62A 4MM3B 1V1PA 1TZOA 1JW9D 2Y5CA 1D4BA 3B2GA 4B0MA 3W9CB 2RDGA 5GXGB 2N9KA 3ZYYX 4B0EA 1QLBB 2MJEA 2WXGA 3PO0A 4OVZA 4HROA 4RF0A 2K5PA 2WLBA 1I4GA 3BVZA 3I57A 1YJIA 2Z8LA 4RNAA 1EWCA 4TMAB 3U52E 1EM7A 5G5HA 3B2FA 1D6EC 1EU4A 2L83A 1C78A 1R7SA 4IKGA 1BMLC 1PGBA 2WXFA 4LTUA 1JWBD 2VZKD 2LGIA 1EU3A 2JQRB 5C2TB 4WH4A 2K22A 1JWUD 1L4ZB 3FAHA 4MACA 4KGRA 1XLPA 4ZHPA 1XO3A 3FC4A 4O1NA 3SFEB 4YSYB 3URYA 1YN3A 1N5WA 1V1PB 1ET6A 1C4CA 1KRHA 3IT6B 2GB1A 4XWTA 2JYTA 2BW2A 1JQ4A 1DOYA 2WU5B 4R3DA 1E0ZA 1FRDA 4MT5A 3O13A 3NS1A 1PUTA 4TQ1A 2XN9C 3VR8B 4GLSC 4JWSC 1RYJA 1UGJA 2Y5PA 1F2RC 1NI3A 3MC0B 3NVZA 3HRDD 4RCOA 2PIAA 1J7CA 1JRPA 2WXNA 3EA6A 1TS4A 1CJEA 1FFUA 2FUG1 2CJNA 2QEJC 4P6VF 1IUEA 2LUMA 3VRBB 3VRAB 1UWXA 1SJED 1HXYD 2WXPA 2FE8A 1SBBB 4PT5A 1XEEA 3I9V1 4OZBA 4C7ZA 5FKAC 2WXIA 1I7HA 2DBYA 4DQOC 3IT4B 4M0WA 5BYQA 1EWYC 4L1BA 5AUIA 2WXLA 1L4DB 1SSNA 3V05A 1TKGA 1XLOA 2V4IB 1GOZA 3FILA 3AM9A 5BMGA 3Q8BA 4NZLB 1FIQA 2IGHA 1C4AA 3C8YA 1N61A 1VLBA 3RPFC 3P63A 1FMAD 4OW0A 3AE7B 4TSSA 2WDQB 1LO5D 3R2IA 1IGDA 4YT0B 3CIRB 3NVVA 3V3XA 4HKZE 4RGTA 4KKIA 4WWMA 1FFVA 4ITKA 1XLNA 2K9XA 1JWAD 1MPEA 4JWUC 1AYFA 1D5ZC 1P7FA 2GI9A 3NUHB 1C76A 2ZW1A 2KN4A 2JXTA 4XDCA 4RGNA 1JWSD 4Q2JA 4YTMB 3KLSX 4WQMA 2WXRA 3ABVB 1BXTA 1HZ6A 2D5GA 2PW9A 3LYYA 1TY0A 4NAWB 4RF1A 1PGAA 1SB3C 5T8IA 4RH6A 3IAM1 4HJGE 3EUB2 4IDIA 1NVID 4ARCA 3TSSA 2H88B 2WNMA 2EKIA 3SFDB 4LK0M 1XXGA 1PYWD 3FILB 1RM6C 1KH0A 4FXCA 3B9JA 5FK9C 4J3OD 4JE3B 3U2SC 1NYQA 1B9RA 4WURA 3AB5A 2BTEA 1FNVA 2BS4B 1XCTL 1E7PB 2W82A 2BBCA 2B76B 1L6VA 1YN4A 3VQIA 1I4QA 4CQNA 2M0AA 2HTME 1GAQB 1ET9A 3ETRA 3AEBB 2PLPA 4OHJA 2LEKA 1IGCA 2LJIA 3BVMA 3R2TA 4REZA 4EE2A 4YSXB 5FR3A 2IGDA 1WRIA 3IAS1 2N0SB 1J7BA 1F2RI 1FEHA 1GB4A 2QILA 1AW7A 2XNAC 4WAFA 1HZ5A 2SAKA 5BYSA 1VZ6A 3TEXA 3DWMA 1OQRA 1QILA 1ZPSA 3AEGB 3AE6B 1ZDVA 1T3QA 3P4PB 1TS2A 2ZW0A 3SEBA 3TEYA 1CK1A 3HUIA 3L4PA 3W5UB 3AE8B 1N63A 2BB6A 2PVOD 3J9CA 2BS2B 5EE9A 2QSDA 2WXHA 2FBWB 4XDDA 1P7EA 1JROA 4D2KA 1QT9A 1TY2A 1ZDXA 2MH7A 4DXGA 1YMHE 2WU2B 3ZGZA 4N58A 1FM0D 3Q8AA 2I38A 3HVDA 1HQRD 4YTPB 2LHDA 4YWGG 2MJDA 4XWWA 2QMTA 2Y3AA 1VDVA 2ONQA 1SXTA 5D7GA 1VRAB 1FCLA 1A70A 1E9MA 1V8CA 1VJKA 1OQQA 4A8XC 2I2YA 1ZE3D 1WWTA 1L0XB 4HEA1 4US8A 2W54A 1TS3A 1QQRA 1K53A 1N60A 4ZYSA 4YSZB 1N5XA 3W5VB 1QF6A 3HVZA 5TSSA 1RFKA 1XLQA 2JYEA 1TS5A 1WGKA 3AE9B 5HG2A 1K51A 2BB5A 2DLBA 4A55A 3LXFA 4XE0A 5MPOA 2L52A 2JZPA 3U4EG 2J52A 2M56B 1PFDA 3ZJVA 4A6QA 2QIEB 1F0ZA 3P4QB 1SE2A 2BS3B 3PZ8A 1MVKA 4C80A 1NYRA 5AUKA 1I4XA 4HKQA 2EELA 2J53A 2WDVB 1I4PA 5BMIA 5E6JA 2KAJA 1ZUD2 2X38A 3Q8CA 1Y56A 2RDHA 1C9FA 1ROEA 4KKJA 5D3DA 3BK2A 3BVGA 1ENFA 1RWSA 1XF5L 2HDEA 3UI3A 2DYMA 2DWQA 1K52A 3AE5B 1XCQL 3BWUD 1V1OA 3Q8EA 3WCQA 1I4HA 3P4RB 1QOBA 5I4DA 1AWDA 1KLUD 1DOXA 2DYOA 3SR6A 1J7AA 1E6EB 1SE3A 1YJJA 4YTNB 3IXSA 4NAMA 5EE0A 1SE4A 2J4XA 3AH7A 1OFFA 2WXQA 2AQ2B 2WXMA 4A9AA 3R8BA 3NRZA 3Q8FA 1D5XC 1B1ZA 1YNTE 1F77A 1ZP0B 2OEDA 3AE1B 2JSVX 1E10A 4OZCA 2N7JA 3ZQ4A 3TEZA 1QOAA 3NZ3A 2K0PA 2MJ3A 3BIID 2IGGA 1KF6B 1WYGA 2WXOA 4ZOHC 1KLGD 1C4PA 1YQ4B 2IJ0A 3H8HA 4IOIE 1JWMD 2N9LA 1T6BX 1JMLA 2OHFA 2NMQA 1IBXB 1QOGA 2W3SA 1MHXA 2WDRB 2CJOA 4P16A 1WXQA 3E56A 5LNK1 1STEA 4ZRQA 2H89B 2AQ3B 2WQYB 3MHZA 3U7ZA 2Q5WD 4NJCA 5C3JB 3P4SB 1UWMA 1HEZE 2PVGC 4KGSA 2BT6A 4JPSA 2K3UA 1L0YB 1FCCC 1HA5A 2W3RA 2JU6X 2G9HD 1PGXA 2TSSA 1CZPA 4N6EB 1SF0A 4ZHOA 2AX5A 3RFZB 2KQ4X 3Q69A 4HRSA 1ZXIA 2J42A 3W2DA 4AQ7A 4H2AA 3OWEB 1MI0A 1GB1A 3GP7A 1L6UA 5HI1A 4AS1A 1TYGB 2AQ1B 1KTKA 1QOFA 3AMZA 5EE1A 2BYTA 2CU3A 2GRIA 1QKZA 1TJEA 2VZKB 3KQ4A 2RMMA 5EE3A 1KFYB 2SEBD 3BYTB 2V3PA 1L0VB 3AN1A 1FD6A 1UNSA 1I4RA 3AEFB 3ZJTA 2L32A 4OZAA 1D5MC 4LLGM 3VR9B 2KMMA 3AE3B 1VZ8A 3BZDB 3P42A 5H8YE 5G5GA 1FO4A 1ZOYB 2JWUA 4C7YA 1JCKB 3AE4B 1Q10A 3AECB 3TEWA 2MEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWD A;  4FXC A;  2L83 A;  1R7S A;  3B9J A;  1DOX A;  1L5P A;  3SR6 A;  1J7A A;  1E6E B;  1YJJ A;  4YTN B;  2WS3 B;  1FXI A;  4LTU A;  1JWB D;  5EE0 A;  1V97 A;  2JQR B;  1NYQ A;  5C2T B;  2QJL A;  1B9R A;  2K22 A;  4YXD B;  3P1M A;  3AB5 A;  3AH7 A;  2BS4 B;  3FAH A;  1E7P B;  1OFF A;  1TKE A;  4KX6 B;  1XLP A;  1L6V A;  1XO3 A;  2B76 B;  4ZHP A;  4A9A A;  3FC4 A;  2G1E A;  3NRZ A;  3SFE B;  4YSY B;  2HTM E;  1GAQ B;  1N5W A;  3ETR A;  3AEB B;  1ZP0 B;  3AE1 B;  1KRH A;  2LEK A;  4YSX B;  1GPX A;  1E10 A;  2WP9 B;  1TKY A;  1WRI A;  2N0S B;  1J7B A;  1DOY A;  1QOA A;  1JQ4 A;  2WU5 B;  2MJ3 A;  3BII D;  1KF6 B;  1FRD A;  1E0Z A;  1WYG A;  4ZOH C;  3NS1 A;  1PUT A;  3VR8 B;  4JWS C;  1RYJ A;  1YQ4 B;  1NI3 A;  3NVZ A;  3DWM A;  1OQR A;  2OHF A;  3HRD D;  3AEG B;  1PDX A;  4USA A;  2PIA A;  1J7C A;  3AE6 B;  1QOG A;  2W3S A;  2WDR B;  1JRP A;  1T3Q A;  2CJO A;  3P4P B;  2ACZ B;  1WXQ A;  3HUI A;  2H89 B;  3L4P A;  3W5U B;  3AE8 B;  1CJE A;  1FFU A;  1FRR A;  1N63 A;  1SIJ A;  2BS2 B;  2PVO D;  2WQY B;  1FXA A;  3CWI A;  5EE9 A;  2Q5W D;  2FBW B;  3LB8 C;  2CJN A;  5C3J B;  3P4S B;  1UWM A;  4P6V F;  1IUE A;  1JRO A;  3VRB B;  1QT9 A;  2PVG C;  2MH7 A;  1NEK B;  3KWL A;  2WU2 B;  3AE2 B;  3VRA B;  4N58 A;  1FM0 D;  2BT6 A;  1DGJ A;  4C7Z A;  1I7H A;  4YTP B;  2W3R A;  2DBY A;  1YQ3 B;  2MJD A;  1EWY C;  3DWG C;  5AUI A;  4N59 A;  1NEN B;  1VDV A;  1CZP A;  2E3T A;  4JX1 C;  4N6E B;  3AEE B;  1SF0 A;  1A70 A;  1E9M A;  1TKG A;  1V8C A;  4ZHO A;  1VJK A;  1OQQ A;  1XLO A;  5H92 C;  2AX5 A;  3AM9 A;  3NVW A;  1WWT A;  2M19 A;  1FIQ A;  4HRS A;  4US8 A;  1JAL A;  2W54 A;  1ZXI A;  1N61 A;  2PKO A;  1VLB A;  3NVY A;  3P63 A;  1FMA D;  3RPF C;  1N60 A;  3AE7 B;  2WDQ B;  4US9 A;  1N5X A;  4YSZ B;  3W5V B;  4YT0 B;  1QF6 A;  1L6U A;  3AEA B;  3CIR B;  3NVV A;  3HVZ A;  1TYG B;  1RFK A;  1XLQ A;  2W55 A;  3AE9 B;  1WGK A;  4WWM A;  2JX5 A;  3AED B;  1FFV A;  4ITK A;  3LXF A;  1QOF A;  3AMZ A;  1XLN A;  2L52 A;  1DOI A;  2K9X A;  1JWA D;  3AV8 A;  5EE1 A;  5MPO A;  1N62 A;  2CU3 A;  2M56 B;  4JWU C;  1AYF A;  1PFD A;  1TJE A;  1JW9 D;  2Y5C A;  2QIE B;  1F0Z A;  3P4Q B;  2BS3 B;  3B2G A;  5EE3 A;  4C80 A;  1NYR A;  5AUK A;  4YTM B;  1KFY B;  3W9C B;  4WQM A;  2WDV B;  3ABV B;  2KAJ A;  1ZUD 2;  1L0V B;  3AN1 A;  5GXG B;  1ROE A;  1SB3 C;  3ZYY X;  1QLB B;  2MJE A;  3AEF B;  3EUB 2;  4IDI A;  3PO0 A;  1NVI D;  1RWS A;  4HRO A;  3VR9 B;  2KMM A;  2K5P A;  2H88 B;  2WLB A;  3AE3 B;  5H8Y E;  1YJI A;  2EKI A;  3SFD B;  2DWQ A;  5G5G A;  1FO4 A;  1ZOY B;  3AE5 B;  5G5H A;  3B2F A;  3WCQ A;  4C7Y A;  3AE4 B;  3P4R B;  1QOB A;  3AEC B;  1RM6 C; 
#chains in the Genus database with same CATH topology
 3PHW B;  2KDM A;  2ZCB A;  1M94 A;  2WS3 B;  2J0J A;  4ZRP A;  1C1Y B;  2PTL A;  2EMT A;  4LJO B;  2BWF A;  3V62 A;  1WSP A;  3L13 A;  4DBG A;  2KLC A;  4YXD B;  3P1M A;  4AJY B;  4KX6 B;  2K6D B;  3QJZ A;  2D07 B;  3MP9 A;  2G1E A;  4C56 C;  2NTS A;  3I5J C;  2MHJ A;  4GXB A;  1AN8 A;  2KDI A;  1FNU A;  2L76 A;  4MGY E;  5IOI A;  3PS6 A;  3E9S A;  3PRM B;  2KAC A;  3PLU A;  1DYQ A;  3ZJU A;  4MH8 A;  5BMH A;  5CX3 A;  4ZRI A;  3RNF C;  1PDX A;  4KSL C;  4W9D A;  4MM3 A;  1T0Q C;  3T3N A;  2N1W A;  3ZIM A;  1YD8 U;  4HVB A;  2WXJ A;  4HWI B;  3CWI A;  3LB8 C;  4PS8 A;  2R61 A;  1ISN A;  1NEK B;  3KWL A;  4FHK A;  3VTV A;  4UDU C;  4TQ0 A;  1L2N A;  1YQ3 B;  4ARI A;  2FAZ A;  3GB1 A;  2ZPN A;  3SHQ A;  2M19 A;  1TGZ B;  3A4S C;  1HTO A;  2ZVN A;  3DVG Y;  4K3B A;  5HFY A;  1YQB A;  3AEA B;  3DVN V;  2YEP F;  2KWC A;  1XQQ A;  2PEA A;  4KGT A;  2KHW B;  4FJZ A;  1WXM A;  2OJW A;  1JW9 D;  2A5U A;  3NG0 A;  3PTF C;  3NJT A;  2XBB C;  4IG7 B;  3H7P B;  5JHB A;  1GUA B;  4IWO A;  4W9E A;  1OEY A;  3RD2 A;  3ZYY X;  1WJ6 A;  4B0E A;  1P0R A;  4PS7 A;  4OVZ A;  1I4G A;  2LD9 A;  3I57 A;  4FHJ A;  5G5H A;  2JF5 A;  3DVG X;  2R2Q A;  3H6N A;  1EU4 A;  2L83 A;  5L95 C;  3ZXV A;  1BML C;  4LTU A;  4EZJ A;  3CF6 E;  4GMV A;  2YLM A;  5C2T B;  3PT2 B;  5IP4 D;  3UF8 A;  4YSY B;  2QC8 A;  1C4C A;  3ZXR A;  5IN7 A;  2JYT A;  2BW2 A;  4GN1 A;  1ZGU B;  3Q3J A;  3DHG C;  3O13 A;  3VR8 B;  4TQ1 A;  2MBE A;  1L7Y A;  1R4M B;  3NVZ A;  4MGZ E;  1V5O A;  1F52 A;  1WX7 A;  4RCO A;  3JSV B;  3DVN U;  5DPT A;  2N9P C;  3A9J A;  2CJN A;  2QEJ C;  3VRB B;  3VRA B;  1WM2 A;  4OZB A;  3PZD A;  1I7H A;  2N9E B;  2WXL A;  2OOB B;  3AM9 A;  5BMG A;  2IGH A;  1N61 A;  1VLB A;  1FMA D;  4TSS A;  3GZN I;  1LO5 D;  4K1R B;  4YT0 B;  3CIR B;  3NVV A;  4A20 A;  3H7P A;  4KKI A;  2LGY A;  4MGI E;  1FFV A;  2O6V A;  1XLN A;  2JPH A;  2K9X A;  4DDI D;  2KN4 A;  2JXT A;  1V2Y A;  3BY4 B;  2NVU I;  2WXR A;  1HZ6 A;  2O2V A;  2D3A A;  4NAW B;  1T0S C;  2KDB A;  5T8I A;  3IAM 1;  4HJG E;  4S0R A;  2L7R A;  4OVV A;  2I1K A;  2KMA A;  2H88 B;  2IBI B;  2VH1 A;  4LK0 M;  1V5T A;  2AWT A;  2KDE B;  2KNB A;  1WE7 A;  1YOV B;  3RNB C;  4J3O D;  2KJR A;  3RNC C;  1B9R A;  2D10 A;  1E7P B;  2BBC A;  1L6V A;  3ZO5 B;  4JGH B;  4CQN A;  1FXT B;  3ETR A;  3AEB B;  1HE8 A;  5IA7 A;  3JSV A;  1WRI A;  3IAS 1;  1F2R I;  1FEH A;  2KTR B;  4EUT A;  4WAF A;  1VZ6 A;  3ZKJ C;  3DWM A;  1OQR A;  1V86 A;  3ZUN A;  3Q6B A;  2Z0E B;  5IKC M;  4PYU A;  2ZW0 A;  3SEB A;  2FNJ B;  3HUI A;  3AE8 B;  4BVU C;  4DWF A;  3N3K B;  5DCN A;  1WXV A;  4DXG A;  2K8H A;  4P7I A;  2K8C A;  2WX0 A;  4FAD A;  5TR5 A;  4MEM A;  3EEC A;  1WRD B;  4E3C A;  1VRA B;  2W9N A;  5AZG A;  1L0X B;  4HEA 1;  2GMI C;  4US8 A;  3RI7 C;  1GC7 A;  1QQR A;  4HJK A;  3HM6 X;  2DZM A;  2MRP A;  2GBJ A;  3M62 B;  3HVZ A;  1RFK A;  1XLQ A;  2JYE A;  3AE9 B;  4TKN A;  4JIO U;  3NZS A;  5HG2 A;  1K51 A;  3ZNI D;  4NAW A;  2L52 A;  3V6E B;  4KV2 A;  4EEW A;  3K9P B;  4LNI A;  2KJ6 A;  1F0Z A;  1TT5 B;  1MVK A;  1LXD A;  2J53 A;  5BMI A;  2X38 A;  3EHV A;  3NHE B;  2K25 A;  5D3D A;  5GMV A;  1MJD A;  3HK0 A;  2HDE A;  3S2A A;  3MTN B;  1XCQ L;  3BWU D;  1I4H A;  4WWO A;  3LJ3 A;  1KLU D;  2MA9 B;  5C23 A;  1DOX A;  1SE3 A;  3OJ3 A;  1YJJ A;  3MC9 A;  1RRB A;  1MG4 A;  5LXI B;  4W9K A;  4NAM A;  5EE0 A;  2J4X A;  1R4M I;  2Y5B B;  2MX2 A;  2WXM A;  5KHQ A;  4A9A A;  2JY6 A;  2IZV B;  4LDT D;  4BBN F;  1YNT E;  1ZP0 B;  3AE1 B;  1WJU A;  4FJV B;  2JSV X;  3ZVV A;  2C5L C;  3V61 A;  3TIX A;  2OJR A;  2K0P A;  3BII D;  2IGG A;  3VDZ A;  4G50 A;  1KLG D;  1JWM D;  2N9L A;  1T6B X;  1JML A;  2NMQ A;  1QOG A;  2WDR B;  1MHX A;  2CHZ A;  2CJO A;  1WXQ A;  4BKT A;  2WQY B;  3MHZ A;  3ZW3 A;  1E8W A;  2ZCC A;  4N9F 4;  2DHZ A;  2LVP A;  3V6C B;  3VUW A;  1L0Y B;  3SDL C;  2JU6 X;  2G9H D;  3KUC B;  4JL9 A;  1I35 A;  4RMA A;  2EMS A;  1SF0 A;  4AP4 C;  4HPM B;  4ZHO A;  2AX5 A;  3H9D A;  4NJ7 A;  1UBQ A;  2MBO A;  4HRS A;  3Q69 A;  4XYC A;  2C7H A;  4HDQ A;  1WMH B;  3A9K A;  3OWE B;  5HI1 A;  4AS1 A;  2MWS B;  1E8X A;  3V60 A;  5CHW A;  5EE1 A;  2GRI A;  1QKZ A;  1TJE A;  2VZK B;  3UQB A;  2RMM A;  1WH3 A;  1TZ1 A;  3WIM A;  1WGY A;  2ZJD A;  4K7U A;  1KFY B;  1E8Y A;  4MH0 E;  3K9O B;  2KWV B;  2ZVO A;  1L0V B;  1FD6 A;  2L8J A;  2DAF A;  4IWP A;  2HD5 B;  1KOT A;  2LZ6 A;  2XK5 B;  4MDK E;  2KMM A;  1VZ8 A;  4FUL A;  3MHS D;  1QZE A;  4NNJ B;  1ZOY B;  2WDT B;  4MEL A;  3IVF A;  2HE7 A;  3DDC B;  2MEK A;  1L5P A;  5E6N A;  2V3S A;  4LNO A;  1VZ7 A;  1ZXH A;  2CR5 A;  4GDL B;  3EGR A;  4M8N A;  4HCP B;  4GDK A;  3QC8 B;  3PRZ A;  4AUQ C;  4ANU A;  2KO3 A;  1XT9 B;  1J19 A;  4ASW C;  1WR1 A;  2BYE A;  3PPA A;  2BPS A;  4P1C C;  2ICI A;  4XGA B;  4NJ6 A;  1Q0W B;  2WXK A;  1JRU A;  2M0X A;  1V6E A;  1D3Z A;  4USA A;  3VHT C;  4IM0 A;  2K39 A;  4L2Y A;  2LFI A;  3RMK C;  1SJH D;  4L23 A;  5D3I B;  3L08 A;  1C3T A;  1SIJ A;  5DPW A;  2V3N A;  4RM8 A;  1T5X D;  3AE2 B;  1FNW A;  4ZYN A;  1ACC A;  3MJ5 A;  3W1S A;  1S3S G;  3DWG C;  1NI2 A;  3N1Y C;  2GOW A;  5H92 C;  4A90 A;  1RAX A;  4IW0 A;  1MG8 A;  4NQL B;  2D2Q A;  2IPK D;  2RPV A;  3RNA C;  4WIP A;  4BKS A;  3IHP C;  3PZ7 A;  2W55 A;  1UUP A;  2WWZ A;  2JX5 A;  1WJ4 A;  3R66 C;  5JH5 C;  2KWD A;  1DOI A;  1N62 A;  4MM3 B;  1WX9 A;  1TZO A;  1TIF A;  3U8Z A;  4CHK A;  2CKH B;  4B6W A;  3ZTC A;  4DHJ B;  2KKC A;  3T8M A;  5GXG B;  1WGH A;  4CO7 A;  2CHW A;  2IO2 B;  1QLB B;  2MJE A;  3PO0 A;  4W9I A;  4BOS C;  4HRO A;  4NPN A;  2K5P A;  2WLB A;  2AL3 A;  4IKG A;  1PGB A;  4KDI C;  4K81 A;  2VZK D;  2LWP A;  3ALB A;  2J0M A;  2JQR B;  4WH4 A;  3VTW A;  1WX8 A;  1L4Z B;  1NBF C;  4O1N A;  1YN3 A;  1KRH A;  3IT6 B;  4XC2 A;  4HXD A;  2GB1 A;  4LJP B;  5E6P A;  2WU5 B;  4GB9 A;  1J8C A;  4MT5 A;  4LNK A;  4JWS C;  1F2R C;  1NI3 A;  3MC0 B;  2QCZ A;  1J7C A;  2N4F A;  2ZPY A;  2RD0 A;  3DHH C;  1P98 A;  1CJE A;  1FFU A;  3PV1 A;  5KHO A;  2LUM A;  2WXP A;  2FE8 A;  3CMM B;  4WWN A;  4A3O A;  2MSE D;  3A1Q A;  4L1B A;  4ZRK A;  1SSN A;  1UF0 A;  1XLO A;  3QA8 A;  2LGX A;  1WZ3 A;  3Q8B A;  3PVL A;  1P1A A;  3C8Y A;  3P63 A;  2KJH B;  3OG5 A;  3AE7 B;  2IO1 B;  1GJZ A;  4ITK A;  5E6O A;  4DK5 A;  3TMP B;  4F1S A;  4W9C A;  2MLB A;  4YTM B;  3A9J B;  2V1Y A;  3ABV B;  1BXT A;  2PW9 A;  3LYY A;  3RZF A;  2WHI A;  1BT0 A;  1PQS A;  1SB3 C;  4RH6 A;  1UGM A;  2RR9 A;  4IDI A;  2UU7 A;  1NVI D;  4W9L A;  4ARC A;  1OEY J;  2LXC A;  2NCN A;  2N7E A;  1RM6 C;  1KH0 A;  4I6P A;  3B9J A;  5FK9 C;  5BO4 B;  4JE3 B;  1EF5 A;  1NYQ A;  3DOW A;  4WUR A;  1FNV A;  1XCT L;  2FCS A;  2G4D B;  2O6V B;  1A5R A;  1WIA A;  3KW5 B;  4REZ A;  1IGC A;  2LJI A;  2V4L A;  4IUM B;  2N0S B;  1J7B A;  2NS5 A;  4W9G A;  3Q2A C;  1U4A A;  2XNA C;  2O2V B;  3DBL I;  4J6I A;  4BFR A;  1HZ5 A;  2SAK A;  5BYS A;  3TEX A;  1WYW B;  1QIL A;  3TL5 A;  2KOX A;  3P4P B;  3BIN A;  1TS2 A;  4P1B C;  4KZC A;  3TEY A;  1CK1 A;  3N1X C;  3W5U B;  1UZX B;  3J9C A;  2BB6 A;  4WJP A;  2FIF A;  3I3T B;  1JRO A;  4GGQ A;  1YMH E;  2L00 B;  3ZGZ A;  2LRU A;  1FM0 D;  4N58 A;  2I38 A;  3HVD A;  4YTP B;  2LHD A;  3X23 A;  1LGR A;  4YWG G;  2MP2 B;  3GE3 C;  2ZNV C;  2Y3A A;  2ONQ A;  3R7R A;  2JUO A;  1SXT A;  1A70 A;  2LJ5 A;  4A8X C;  1ZE3 D;  2AYO B;  1WWT A;  4C4V A;  3RNG C;  1N60 A;  1WZ0 A;  5TSS A;  2BWE S;  2V9H A;  3ZDM C;  1WE6 A;  2DLB A;  4XE0 A;  2C7N B;  2WX1 A;  1PFD A;  3MJW A;  4A6Q A;  2QIE B;  1RLF A;  3P4Q B;  3PZ8 A;  2UYZ B;  4C80 A;  4DXA B;  1I4X A;  2EEL A;  4ICV A;  2WDV B;  3RYT A;  3PRE A;  4WAA A;  3Q8C A;  1Y56 A;  4K7W A;  3ML9 A;  3BK2 A;  4G3X B;  2ZNV B;  1RWS A;  2DX5 B;  4HLE A;  2DYM A;  2DWQ A;  1V1O A;  2IO0 B;  2DYO A;  3SR6 A;  1J7A A;  1E6E B;  4YTN B;  3U30 A;  3IXS A;  2DEN B;  2ASQ A;  2KXJ A;  3VXW A;  3WA0 A;  2INC C;  2XEW A;  4PK1 A;  1B1Z A;  2KWU B;  4MSM B;  2MW5 A;  1VCB A;  3MC8 A;  3TEZ A;  1WGR A;  3NZ3 A;  1Q1O A;  1WYG A;  2WXO A;  1IP9 A;  2KFK B;  2M4N A;  4IOI E;  5D94 A;  1IBX B;  2W3S A;  5EDS A;  3E56 A;  5LNK 1;  1STE A;  4ZRQ A;  2MP2 A;  1GG3 A;  2AQ3 B;  5LXH A;  3ZRC A;  2Q5W D;  1SIF A;  3P4S B;  3VH3 B;  5J2R A;  1Z2M A;  2PVG C;  3H1U A;  1OQY A;  2BT6 A;  2K3U A;  2WYQ A;  1HA5 A;  2N7D A;  1KJT A;  1F1H A;  1V9J A;  1ZXI A;  1FPY A;  1GB1 A;  3N1Z C;  2AQ1 B;  2KT7 A;  2PE9 A;  2CHX A;  2BYT A;  3RCZ A;  3NS8 A;  5EE3 A;  4GOC A;  1WF9 A;  2V3P A;  3AN1 A;  2BQQ A;  2D3B A;  4OZA A;  1D5M C;  4LLG M;  4K7S A;  3ZRF A;  5G5G A;  2JWU A;  4HK2 A;  3AE4 B;  1Q10 A;  3AEC B;  2NTT A;  3UGB B;  4X57 B;  2PJH A;  3TUO A;  1Y8R C;  4G0N B;  2R2O A;  1ESF A;  1FXI A;  3A9K B;  4FBJ B;  2JZZ A;  3M63 B;  1VR9 A;  2K8B A;  1TKE A;  2L0T A;  4JLC A;  4RGO S;  2MBB B;  4IM2 A;  2KFK A;  5JXV A;  2L05 A;  2L1A A;  4PS3 A;  3LDZ E;  1IBX A;  4KVG B;  1E7V A;  3BYY B;  1C79 A;  1OTR B;  1ZW7 A;  1UBI A;  1H8C A;  3RUI B;  4QAY A;  3BK1 A;  2INP E;  2KYW A;  1AAR A;  1OGW A;  1SEB D;  2BYF A;  2KD0 A;  3ONS A;  2KX3 A;  2VH2 A;  2IND C;  2E6X A;  3GS2 A;  1YJ1 A;  1FXA A;  3QK0 A;  2KZR A;  3VVW B;  4DHZ B;  5HHD G;  3UQA A;  3KYD D;  4DXF A;  1BUI C;  4GDK B;  1MHH E;  3W1S C;  5L83 A;  4N59 A;  1NEN B;  4JX1 C;  3AEE B;  2PKO A;  3EFU A;  3NVY A;  4FA6 A;  4US9 A;  2BGF A;  3KWV A;  1LQB A;  3AED B;  3VTU A;  3AV8 A;  4EOY A;  3GE8 C;  1V1P A;  2JT4 B;  3B2G A;  4K3C A;  3DBR B;  2N9K A;  4RF0 A;  1EWC A;  4TMA B;  3B2F A;  1D6E C;  2A4Z A;  3P2B A;  2KVZ A;  4HPL B;  2K6Q A;  5LLI A;  4KIK A;  4G11 A;  2K22 A;  1JWU D;  3FAH A;  4MAC A;  4KGR A;  1V49 A;  2CU1 A;  3FC4 A;  4B9K A;  3SFE B;  2ZEQ A;  1WGG A;  1N5W A;  1N6Z A;  1UH6 A;  4IM3 A;  4XWT A;  3TBL D;  1JQ4 A;  3AXC A;  3L10 B;  4R3D A;  2JZ3 B;  1FRD A;  1E0Z A;  2DZJ A;  3NS1 A;  1PUT A;  1UGJ A;  2PIA A;  2G4S A;  2WXN A;  4I6L B;  4ANX A;  3RZW C;  4XX5 A;  2I1J A;  2FUG 1;  3B0A A;  4P6V F;  4BBN C;  1WM3 A;  1SJE D;  2IY1 B;  3PLV A;  4PT5 A;  3I9V 1;  4C7Z A;  5FKA C;  1LFD A;  1HTQ A;  3N20 C;  3NY5 A;  5AUI A;  5CHF A;  5BYQ A;  3V05 A;  1L4D B;  2PE6 B;  2MBH A;  1TKG A;  2WGS A;  3FIL A;  1GOZ A;  1TTN A;  2LUE A;  1FIQ A;  3VAW A;  3RPF C;  2WDQ B;  1ZKH A;  2B3A A;  3QHT A;  4HKZ E;  4RGT A;  4WWM A;  2Z0D B;  3RNE C;  3DBL B;  3IG3 A;  1MPE A;  3IFW B;  1AYF A;  2DNF A;  4JWU C;  1D5Z C;  1P7F A;  2GI9 A;  1WJN A;  2N1V A;  4XDC A;  2DYB A;  4RGN A;  2EKE C;  1JWS D;  2IY0 B;  3APC A;  3DHI C;  4Q2J A;  3KLS X;  4XZ4 A;  1TY0 A;  4E71 A;  4RF1 A;  1PGA A;  1E7U A;  3EUB 2;  3A1Q B;  2EKI A;  3SFD B;  2GLS A;  4LCD E;  1XXG A;  1PYW D;  5G55 A;  4FXC A;  5IO9 A;  1YX5 B;  3OJ4 B;  2AL6 A;  1G6J A;  3AUL A;  5HKH A;  3AB5 A;  2BTE A;  1NDD A;  1E5W A;  3VQI A;  4MJS A;  1ET9 A;  2PLP A;  2LEK A;  3R2T A;  4EE2 A;  3BVM A;  3M3J A;  1R4N I;  2IO3 B;  1V80 A;  1TBE A;  2JVC A;  3HHM A;  4S17 A;  1ZDV A;  1T3Q A;  4BKS D;  4W9H A;  3L4P A;  3AU5 A;  1N63 A;  2PVO D;  5EE9 A;  2BS2 B;  1P9D U;  2QSD A;  1WXS A;  2FBW B;  4XDD A;  4BKG A;  1P7E A;  2LXA A;  4D2K A;  1WXA A;  2MH7 A;  3Q8A A;  2X8X X;  1HQR D;  2MJD A;  2IYD B;  3C19 A;  4XWW A;  1VDV A;  3Q3O C;  2RGF A;  4LNN A;  5D7G A;  1FCL A;  1E9M A;  1V8C A;  4M01 A;  4WQO B;  2I2Y A;  5AZH A;  4IWQ A;  2HTH A;  1N5X A;  1T0Y A;  4CYE A;  2KC1 A;  1QF6 A;  4ANV A;  3DBR I;  1TS5 A;  1WGK A;  4ACF A;  4JQW C;  4A55 A;  3TCA A;  3M95 A;  3LXF A;  2JZP A;  3U4E G;  2J52 A;  2M56 B;  3ZJV A;  4BAX A;  1F9J A;  5AUK A;  2DZK A;  4HKQ A;  4ANW A;  5E6J A;  3WAL A;  2BVC A;  3L16 A;  3Q14 C;  1Z5S B;  3UI3 A;  3ML8 A;  1K52 A;  3Q8E A;  1V81 A;  4HPP A;  3P4R B;  1QOB A;  4WJN A;  1AWD A;  4C4V B;  4F8C B;  5CTR C;  1S1Q B;  1P3Q U;  2JRH A;  3QX1 A;  1OFF A;  2AQ2 B;  3NRZ A;  3Q8F A;  1J0G A;  2JRI B;  1D5X C;  2OED A;  4DDG D;  2VRR B;  3WAP A;  2N7J A;  3ZQ4 A;  2L0F A;  3VFK A;  1QOA A;  2DZI A;  2MJ3 A;  1C4P A;  3H8H A;  2OHF A;  3UIP B;  4DHJ D;  5JZE B;  3PSE B;  4B95 A;  2KFJ A;  4KGS A;  1WY8 A;  4JPS A;  1FCC C;  2W3R A;  1PGX A;  4M8M A;  2BKR B;  2TSS A;  1CZP A;  4M00 A;  4FJY A;  2KLG A;  2KQ4 X;  5G2N A;  4LNF A;  2J42 A;  3W2D A;  3ZNH B;  3GP7 A;  3N30 A;  2LGS A;  4AOF A;  3ZDT A;  3AMZ A;  3DBH I;  3JYU A;  2CU3 A;  3KUD B;  5IAA C;  3KQ4 A;  2KC2 A;  2G45 B;  4C00 A;  3KH0 A;  2LRW A;  3AU4 A;  4WJO A;  3WAM A;  1UNS A;  5DPS A;  3PHX B;  3ZJT A;  2L32 A;  3VR9 B;  3AE3 B;  3P42 A;  3N32 A;  1FO4 A;  3DCG A;  2M1M A;  3TEW A;  1UEL A;  3R7Q A;  1V97 A;  3O65 B;  3KYC D;  2QJL A;  4RFB A;  2LVQ A;  2ON8 A;  3WAO A;  2LHE A;  3VH4 B;  3T3O A;  4GIV A;  1GPX A;  2WP9 B;  2PMV A;  1TKY A;  3A33 B;  3MFG A;  2FCN A;  4RGM A;  2GBR A;  2LAS A;  1WGD A;  3CST A;  2AEH A;  2V0G A;  2IDY A;  2LMC A;  2INN E;  3Q3N C;  2ACZ B;  3SD5 A;  3D32 A;  1K50 A;  1FRR A;  1SE9 A;  2GBK A;  3PRP B;  2JWZ A;  1M4V A;  1EO6 A;  2D11 A;  2LI5 A;  4IC7 B;  5AZF A;  3RT3 B;  1CQV A;  1DGJ A;  4W9F A;  3N9Y C;  1C77 A;  5BYR A;  2J0K A;  3H7S A;  2E3T A;  3WAN A;  1EF1 A;  1E8Z A;  3EFC A;  1YN5 A;  3NVW A;  1LM8 B;  4LDT B;  1JAL A;  3GOE A;  2FCM A;  2YEP B;  1KLV A;  3OAW A;  4KDL B;  4M0W B;  2O6V D;  2C7M B;  5CHV C;  1RFA A;  4EZK A;  4URK A;  2Y5C A;  1D4B A;  5J17 A;  4B0M A;  1EUV B;  2BKF A;  3W9C B;  2KK8 A;  2UWQ A;  1YIW A;  2KVR A;  2RDG A;  2NR2 A;  2FID A;  2K1F A;  1WR6 E;  2FCQ A;  2RSU A;  3BVZ A;  4RNA A;  1YJI A;  2Z8L A;  3ZTD A;  3U52 E;  1EM7 A;  4RM9 A;  3DPD A;  1C78 A;  1R7S A;  1SGH A;  4PYZ A;  4NQK E;  2WXF A;  2REX A;  1JWB D;  4GSW A;  2LGI A;  1EU3 A;  1GC6 A;  1XLP A;  4ZHP A;  1XO3 A;  1I42 A;  4FLH A;  3URY A;  3KUZ A;  2HJ1 A;  1V1P B;  1ET6 A;  3JW0 X;  2M8S A;  1DOY A;  4F7Z A;  4ZRJ A;  1GNU A;  2XN9 C;  4GLS C;  1RYJ A;  2Y5P A;  3A4R A;  3HRD D;  4EKU A;  1JRP A;  3EA6 A;  5J18 A;  1TS4 A;  2BYV E;  4DHZ E;  4KIK B;  1IUE A;  4YL8 A;  1UWX A;  2QHO A;  1YX6 B;  1HXY D;  2LVO A;  1SBB B;  3HM3 A;  1XEE A;  2WXI A;  1WI0 A;  2DBY A;  4DQO C;  3IT4 B;  2YVC A;  4M0W A;  1EWY C;  4ICU A;  3APD A;  2V4I B;  3B08 A;  2KQ7 A;  4E74 A;  2C9W B;  4NZL B;  1C4A A;  4OW0 A;  3R2I A;  1IGD A;  3RN9 C;  1R4N B;  3V3X A;  3ZNG C;  3ZNZ B;  2KTF A;  2QDF A;  2BF8 B;  1JWA D;  3NUH B;  4TUU A;  1C76 A;  2ZW1 A;  4MGK E;  2J7Q B;  2KTR A;  4WQM A;  2D5G A;  3QWZ B;  2KAN A;  3UIO B;  3PGE A;  3TSS A;  1IYF A;  2WNM A;  3FIL B;  4FN2 A;  4A3P A;  4W9J A;  3DBS A;  3U2S C;  4ZDV A;  2NBW B;  2W82 A;  2BS4 B;  2CS4 A;  2B76 B;  1YN4 A;  1I4Q A;  2M0A A;  2HTM E;  3Q3F A;  1GAQ B;  4OHJ A;  4YSX B;  5FR3 A;  2IGD A;  4HDO A;  1GB4 A;  2MBQ A;  2QIL A;  3NOB A;  2KN5 A;  2NPT B;  1AW7 A;  1UD7 A;  1XD3 B;  3RUL A;  1ZPS A;  3AEG B;  2MQJ A;  3AE6 B;  3T9L A;  3QIJ A;  2D3C A;  1T0R C;  2WXH A;  1QT9 A;  1TY2 A;  1ZDX A;  4AJW A;  2WU2 B;  4HCN B;  3ZLZ A;  4M02 A;  3X0W A;  3APF A;  2M17 A;  1H4R A;  2HJ8 A;  2ZZP B;  4MJS B;  2QMT A;  2KX0 A;  1VD2 A;  3UIN B;  2GBM A;  1VJK A;  1OQQ A;  3CSF A;  3VUY A;  2W54 A;  1TS3 A;  3I63 C;  3QAR A;  1K53 A;  3SU8 X;  3L54 A;  4ZYS A;  4YSZ B;  3W5V B;  1X1M A;  2C60 A;  2BB5 A;  5MPO A;  2D3G A;  2LGD A;  4II2 B;  5DPR A;  1WFY A;  3ECI A;  1SE2 A;  2BS3 B;  3R3M A;  4GU2 A;  1NYR A;  1I4P A;  2KAJ A;  1ZUD 2;  2RDH A;  1C9F A;  1ROE A;  5JHA A;  4KKJ A;  3BVG A;  5AEK B;  1ENF A;  3FKY A;  3QCA A;  1XF5 L;  3AE5 B;  2RDB C;  3KVF B;  3WCQ A;  5I4D A;  3EC8 A;  5D2M B;  3L0W B;  2NBV B;  1SE4 A;  2N9X A;  3B1L X;  3AH7 A;  2NPT A;  4WWP A;  2WXQ A;  3R8B A;  4TV3 A;  3VUX A;  1F77 A;  3C0R B;  2PPH A;  5C1Z A;  4BZA A;  1E10 A;  3DBH B;  4OZC A;  2FUH B;  1WMH A;  3Q3M C;  1KF6 B;  2KMC A;  4ZOH C;  3HIZ A;  1YQ4 B;  2IJ0 A;  1K8R B;  4OVU A;  4AWJ A;  3QAQ A;  4P16 A;  1E90 A;  1IPG A;  3W1Y A;  2Z59 B;  2H89 B;  2L3Z A;  2MCN B;  3OLM D;  3U7Z A;  4NJC A;  5C3J B;  1UWM A;  1HEZ E;  3DQV A;  4WJQ A;  2KDF B;  3NZU A;  4EFO A;  2XK5 A;  4N6E B;  3QQ8 B;  4NY0 A;  3U7D A;  2JXX A;  2RPQ A;  3AI5 A;  3RFZ B;  1KM7 A;  2KQS A;  4KSK C;  1CMX B;  4KZ0 A;  4AQ7 A;  4H2A A;  3JVZ X;  1MI0 A;  4MSQ B;  4GDL A;  1Q5W B;  1L6U A;  5D6J B;  1TYG B;  3IBE A;  2GBN A;  1KTK A;  1QOF A;  3L17 A;  5FR6 A;  2G3Q B;  2DAJ A;  2SEB D;  4BOZ B;  4EZL A;  3GZN B;  3BYT B;  1I4R A;  3AEF B;  1MFW A;  3BZD B;  5H8Y E;  4II3 B;  2NBU A;  4I6N B;  3TJP A;  4C7Y A;  1JCK B;  2WXG A;  3ENE A; 
#chains in the Genus database with same CATH homology
 2NTT A;  2KDM A;  1L5P A;  3TUO A;  4ZRP A;  1ESF A;  1FXI A;  2WS3 B;  2PTL A;  1VZ7 A;  1ZXH A;  1V97 A;  1WSP A;  4RFB A;  2QJL A;  2ON8 A;  4GDL B;  3P1M A;  4YXD B;  1VR9 A;  3EGR A;  2LHE A;  1TKE A;  4KX6 B;  3MP9 A;  4RGO S;  2G1E A;  4C56 C;  2NTS A;  5JXV A;  2L1A A;  3T3O A;  1AN8 A;  1FNU A;  1GPX A;  1IBX A;  3E9S A;  2WP9 B;  2PMV A;  1TKY A;  2KAC A;  3MFG A;  2ICI A;  3BYY B;  4RGM A;  1DYQ A;  2WXK A;  1C79 A;  3ZJU A;  4MH8 A;  5BMH A;  3BK1 A;  2V0G A;  2INP E;  4USA A;  1PDX A;  1SEB D;  2IDY A;  2LMC A;  2INN E;  3T3N A;  4L2Y A;  2ACZ B;  2LFI A;  1SJH D;  2E6X A;  1K50 A;  4L23 A;  5D3I B;  2WXJ A;  3GS2 A;  1FRR A;  1SIJ A;  3CWI A;  1FXA A;  3LB8 C;  2V3N A;  1M4V A;  2R61 A;  1T5X D;  1NEK B;  3KWL A;  3AE2 B;  1FNW A;  4UDU C;  1ACC A;  1CQV A;  1DGJ A;  5HHD G;  4TQ0 A;  3MJ5 A;  3N9Y C;  3W1S A;  4DXF A;  1BUI C;  1C77 A;  1MHH E;  4GDK B;  1YQ3 B;  5BYR A;  4ARI A;  3DWG C;  4N59 A;  1NEN B;  2E3T A;  4JX1 C;  3AEE B;  3GB1 A;  5H92 C;  1YN5 A;  3NVW A;  4A90 A;  2M19 A;  1JAL A;  2PKO A;  2YEP B;  3NVY A;  5HFY A;  2IPK D;  2RPV A;  4US9 A;  4WIP A;  3AEA B;  3PZ7 A;  2YEP F;  2W55 A;  1UUP A;  3KWV A;  2JX5 A;  3AED B;  4KGT A;  2KWD A;  1DOI A;  3AV8 A;  1N62 A;  4MM3 B;  1V1P A;  1TZO A;  1JW9 D;  2Y5C A;  1D4B A;  3B2G A;  4B0M A;  3W9C B;  2RDG A;  5GXG B;  2N9K A;  3ZYY X;  4B0E A;  1QLB B;  2MJE A;  2WXG A;  3PO0 A;  4OVZ A;  4HRO A;  4RF0 A;  2K5P A;  2WLB A;  1I4G A;  3BVZ A;  3I57 A;  1YJI A;  2Z8L A;  4RNA A;  1EWC A;  4TMA B;  3U52 E;  1EM7 A;  5G5H A;  3B2F A;  1D6E C;  1EU4 A;  2L83 A;  1C78 A;  1R7S A;  4IKG A;  1BML C;  1PGB A;  2WXF A;  4LTU A;  1JWB D;  2VZK D;  2LGI A;  1EU3 A;  2JQR B;  5C2T B;  4WH4 A;  2K22 A;  1JWU D;  1L4Z B;  3FAH A;  4MAC A;  4KGR A;  1XLP A;  4ZHP A;  1XO3 A;  3FC4 A;  4O1N A;  3SFE B;  4YSY B;  3URY A;  1YN3 A;  1N5W A;  1V1P B;  1ET6 A;  1C4C A;  1KRH A;  3IT6 B;  2GB1 A;  4XWT A;  2JYT A;  2BW2 A;  1JQ4 A;  1DOY A;  2WU5 B;  4R3D A;  1E0Z A;  1FRD A;  4MT5 A;  3O13 A;  3NS1 A;  1PUT A;  4TQ1 A;  2XN9 C;  3VR8 B;  4GLS C;  4JWS C;  1RYJ A;  1UGJ A;  2Y5P A;  1F2R C;  1NI3 A;  3MC0 B;  3NVZ A;  3HRD D;  4RCO A;  2PIA A;  1J7C A;  1JRP A;  2WXN A;  3EA6 A;  1TS4 A;  1CJE A;  1FFU A;  2FUG 1;  2CJN A;  2QEJ C;  4P6V F;  1IUE A;  2LUM A;  3VRB B;  3VRA B;  1UWX A;  1SJE D;  1HXY D;  2WXP A;  2FE8 A;  1SBB B;  4PT5 A;  1XEE A;  3I9V 1;  4OZB A;  4C7Z A;  5FKA C;  2WXI A;  1I7H A;  2DBY A;  4DQO C;  3IT4 B;  4M0W A;  5BYQ A;  1EWY C;  4L1B A;  5AUI A;  2WXL A;  1L4D B;  1SSN A;  3V05 A;  1TKG A;  1XLO A;  2V4I B;  1GOZ A;  3FIL A;  3AM9 A;  5BMG A;  3Q8B A;  4NZL B;  1FIQ A;  2IGH A;  1C4A A;  3C8Y A;  1N61 A;  1VLB A;  3RPF C;  3P63 A;  1FMA D;  4OW0 A;  3AE7 B;  4TSS A;  2WDQ B;  1LO5 D;  3R2I A;  1IGD A;  4YT0 B;  3CIR B;  3NVV A;  3V3X A;  4HKZ E;  4RGT A;  4KKI A;  4WWM A;  1FFV A;  4ITK A;  1XLN A;  2K9X A;  1JWA D;  1MPE A;  4JWU C;  1AYF A;  1D5Z C;  1P7F A;  2GI9 A;  3NUH B;  1C76 A;  2ZW1 A;  2KN4 A;  2JXT A;  4XDC A;  4RGN A;  1JWS D;  4Q2J A;  4YTM B;  3KLS X;  4WQM A;  2WXR A;  3ABV B;  1BXT A;  1HZ6 A;  2D5G A;  2PW9 A;  3LYY A;  1TY0 A;  4NAW B;  4RF1 A;  1PGA A;  1SB3 C;  5T8I A;  4RH6 A;  3IAM 1;  4HJG E;  3EUB 2;  4IDI A;  1NVI D;  4ARC A;  3TSS A;  2H88 B;  2WNM A;  2EKI A;  3SFD B;  4LK0 M;  1XXG A;  1PYW D;  3FIL B;  1RM6 C;  1KH0 A;  4FXC A;  3B9J A;  5FK9 C;  4J3O D;  4JE3 B;  3U2S C;  1NYQ A;  1B9R A;  4WUR A;  3AB5 A;  2BTE A;  1FNV A;  2BS4 B;  1XCT L;  1E7P B;  2W82 A;  2BBC A;  2B76 B;  1L6V A;  1YN4 A;  3VQI A;  1I4Q A;  4CQN A;  2M0A A;  2HTM E;  1GAQ B;  1ET9 A;  3ETR A;  3AEB B;  2PLP A;  4OHJ A;  2LEK A;  1IGC A;  2LJI A;  3BVM A;  3R2T A;  4REZ A;  4EE2 A;  4YSX B;  5FR3 A;  2IGD A;  1WRI A;  3IAS 1;  2N0S B;  1J7B A;  1F2R I;  1FEH A;  1GB4 A;  2QIL A;  1AW7 A;  2XNA C;  4WAF A;  1HZ5 A;  2SAK A;  5BYS A;  1VZ6 A;  3TEX A;  3DWM A;  1OQR A;  1QIL A;  1ZPS A;  3AEG B;  3AE6 B;  1ZDV A;  1T3Q A;  3P4P B;  1TS2 A;  2ZW0 A;  3SEB A;  3TEY A;  1CK1 A;  3HUI A;  3L4P A;  3W5U B;  3AE8 B;  1N63 A;  2BB6 A;  2PVO D;  3J9C A;  2BS2 B;  5EE9 A;  2QSD A;  2WXH A;  2FBW B;  4XDD A;  1P7E A;  1JRO A;  4D2K A;  1QT9 A;  1TY2 A;  1ZDX A;  2MH7 A;  4DXG A;  1YMH E;  2WU2 B;  3ZGZ A;  4N58 A;  1FM0 D;  3Q8A A;  2I38 A;  3HVD A;  1HQR D;  4YTP B;  2LHD A;  4YWG G;  2MJD A;  4XWW A;  2QMT A;  2Y3A A;  1VDV A;  2ONQ A;  1SXT A;  5D7G A;  1VRA B;  1FCL A;  1A70 A;  1E9M A;  1V8C A;  1VJK A;  1OQQ A;  4A8X C;  2I2Y A;  1ZE3 D;  1WWT A;  1L0X B;  4HEA 1;  4US8 A;  2W54 A;  1TS3 A;  1QQR A;  1K53 A;  1N60 A;  4ZYS A;  4YSZ B;  1N5X A;  3W5V B;  1QF6 A;  3HVZ A;  5TSS A;  1RFK A;  1XLQ A;  2JYE A;  1TS5 A;  1WGK A;  3AE9 B;  5HG2 A;  1K51 A;  2BB5 A;  2DLB A;  4A55 A;  3LXF A;  4XE0 A;  5MPO A;  2L52 A;  2JZP A;  3U4E G;  2J52 A;  2M56 B;  1PFD A;  3ZJV A;  4A6Q A;  2QIE B;  1F0Z A;  3P4Q B;  1SE2 A;  2BS3 B;  3PZ8 A;  1MVK A;  4C80 A;  1NYR A;  5AUK A;  1I4X A;  4HKQ A;  2EEL A;  2J53 A;  2WDV B;  1I4P A;  5BMI A;  5E6J A;  2KAJ A;  1ZUD 2;  2X38 A;  3Q8C A;  1Y56 A;  2RDH A;  1C9F A;  1ROE A;  4KKJ A;  5D3D A;  3BK2 A;  3BVG A;  1ENF A;  1RWS A;  1XF5 L;  2HDE A;  3UI3 A;  2DYM A;  2DWQ A;  1K52 A;  3AE5 B;  1XCQ L;  3BWU D;  1V1O A;  3Q8E A;  3WCQ A;  1I4H A;  3P4R B;  1QOB A;  5I4D A;  1AWD A;  1KLU D;  1DOX A;  2DYO A;  3SR6 A;  1J7A A;  1E6E B;  1SE3 A;  1YJJ A;  4YTN B;  3IXS A;  4NAM A;  5EE0 A;  1SE4 A;  2J4X A;  3AH7 A;  1OFF A;  2WXQ A;  2AQ2 B;  2WXM A;  4A9A A;  3R8B A;  3NRZ A;  3Q8F A;  1D5X C;  1B1Z A;  1YNT E;  1F77 A;  1ZP0 B;  2OED A;  3AE1 B;  2JSV X;  1E10 A;  4OZC A;  2N7J A;  3ZQ4 A;  3TEZ A;  1QOA A;  3NZ3 A;  2K0P A;  2MJ3 A;  3BII D;  2IGG A;  1KF6 B;  1WYG A;  2WXO A;  4ZOH C;  1KLG D;  1C4P A;  1YQ4 B;  2IJ0 A;  3H8H A;  4IOI E;  1JWM D;  2N9L A;  1T6B X;  1JML A;  2OHF A;  2NMQ A;  1IBX B;  1QOG A;  2W3S A;  1MHX A;  2WDR B;  2CJO A;  4P16 A;  1WXQ A;  3E56 A;  5LNK 1;  1STE A;  4ZRQ A;  2H89 B;  2AQ3 B;  2WQY B;  3MHZ A;  3U7Z A;  2Q5W D;  4NJC A;  5C3J B;  3P4S B;  1UWM A;  1HEZ E;  2PVG C;  4KGS A;  2BT6 A;  4JPS A;  2K3U A;  1L0Y B;  1FCC C;  1HA5 A;  2W3R A;  2JU6 X;  2G9H D;  1PGX A;  2TSS A;  1CZP A;  4N6E B;  1SF0 A;  4ZHO A;  2AX5 A;  3RFZ B;  2KQ4 X;  3Q69 A;  4HRS A;  1ZXI A;  2J42 A;  3W2D A;  4AQ7 A;  4H2A A;  3OWE B;  1MI0 A;  1GB1 A;  3GP7 A;  1L6U A;  5HI1 A;  4AS1 A;  1TYG B;  2AQ1 B;  1KTK A;  1QOF A;  3AMZ A;  5EE1 A;  2BYT A;  2CU3 A;  2GRI A;  1QKZ A;  1TJE A;  2VZK B;  3KQ4 A;  2RMM A;  5EE3 A;  1KFY B;  2SEB D;  3BYT B;  2V3P A;  1L0V B;  3AN1 A;  1FD6 A;  1UNS A;  1I4R A;  3AEF B;  3ZJT A;  2L32 A;  4OZA A;  1D5M C;  4LLG M;  3VR9 B;  2KMM A;  3AE3 B;  1VZ8 A;  3BZD B;  3P42 A;  5H8Y E;  5G5G A;  1FO4 A;  1ZOY B;  2JWU A;  4C7Y A;  1JCK B;  3AE4 B;  1Q10 A;  3AEC B;  3TEW A;  2MEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...