2CU7A

Solution structure of the sant domain of human kiaa1915 protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
GSSGSSGYSVKWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVKCGLDKETPNQKTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Differences of SWIRM Domain Subtypes
pubmed doi rcsb
molecule keywords KIAA1915 protein
molecule tags Transcription
source organism Homo sapiens
total genus 13
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2005-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2cu7A01
2HYJA 5FKKA 2ECCA 5FLVA 2DMPA 4X6AJ 1ZR2A 1PUFA 2R5ZB 3I4MJ 1JKRC 1ETXA 2JA8J 2LVSA 5GP9A 4EEFG 2D5VA 1F43A 1POGA 3SDGA 3A02A 1LE8A 5M5WJ 5E3NA 3W6VA 3A01A 1IDZA 1ETQA 2O8KA 3BG9A 4D5CA 1BA5A 2IBDA 2DA2A 1Y1VJ 2DA1A 5EDNA 1TWFJ 4NDLA 5EG0B 1AHDP 3GTJJ 1HCRA 1RETA 4C3JJ 2O7OA 2AHQA 5IP9J 1B72B 2L0KA 5F0HA 3Q0WA 2E2JJ 1LFUP 2TRTA 3RQIA 1IG7A 3BR0A 2R0QC 3GTKJ 1AKHB 3WHCA 4XICA 3K2AA 1JKQC 1TC3C 5IYBJ 1Z0XA 2LK2A 5C4JJ 1E3OC 1VF9A 1QVUA 5F08A 3RZOJ 1IDYA 1HLVA 4DYQA 4IHWA 2E2IJ 4JYKA 3HOYJ 1SANA 5IPAA 1K83J 4FE7A 1RKWA 4QSHA 1UG2A 3G1LA 3BTJA 1B8IB 2L7ZA 3TP3A 2OPTA 5IOZA 1JT0A 1RKTA 3MVPA 1T33A 1LE8B 1I6HJ 2KT0A 1O4XA 4W97A 2DA6A 3QPSA 2GM4A 1HF0A 2X6OA 2DMQA 2X48A 3M3YJ 5FKOA 3O8HA 1VI0A 1MSEC 1VNDA 1ZQ3P 2JMWA 3NAUA 4C2MJ 1U9NA 1TWCJ 2Y2ZA 3HOVJ 2E2HJ 3WHBA 3FIWA 3S14J 1TWAJ 3HGYA 1RR7A 2KDZA 1JJ8C 2R92J 2MGQA 2XPWA 1ITYA 3MKLA 9ANTA 4M6VA 5M5YJ 1IGNA 1FTZA 4QIWN 3G1MA 2HXOA 5M3FJ 1GUUA 4XRMA 4BXXJ 1WH7A 2K40A 3GTGJ 2HDDA 5IP7J 3MN2A 1NK3P 4M3DA 4IHVA 3PO2J 1ORKA 1ZK8A 2R5YB 3LOCA 1GV2A 1YRNA 2CQQA 2VUMJ 1DU6A 4M3FA 1OCPA 1U9OA 5IYDJ 3ZQFA 4A3JJ 5F0CA 5IOYA 1X2NA 3GTOJ 5C44J 5FKNA 3BR3A 5FLMJ 4CYCB 1ETVA 2EZLA 2FJ1A 2ID3A 4LOCA 3BTIA 1JUPA 5IP6A 1IC8A 1GDTA 1JT6A 3GTQJ 1XC5A 2JJ7A 3PM1A 5K7FA 2DA5A 1OCTC 2O9LA 3H3VK 2L9RA 4AYBN 4M3EA 2LTPA 2LR8A 1MH3A 2DTZA 3DEWA 3OIOA 3ZQGA 4JX4A 3JRHA 4G12A 1X58A 3TEDA 5E3OA 4IHYA 3HDDA 1NTCA 2HQ5A 2W48A 1VFCA 1UMQA 2ZB9A 4FE4A 2K9QA 3NARA 1JUSA 2XPUA 2QF7A 3DCFA 5J1RA 4BY1J 5DS9A 3BR5A 1BL0A 2EH3A 3Q3SA 3BQYA 1JTYA 3HKZN 4XRSG 1BJZA 2LD5A 4A93J 4RDUA 3HOWJ 5IYCJ 2CUFA 4BBRJ 2OF7A 5JLXA 2QCOA 1HDPA 1MBKA 3Q0VA 2MSYA 3S15J 1SFOJ 2XPVA 3HB9A 2PMZN 1Q1VA 1GVDA 4C3IJ 3HOZJ 3BT9A 3QQAA 2L7MP 3OOUA 1ZGWA 1QRYA 4XK4A 1WH5A 1JGGA 3S1RJ 2VPRA 3TW7A 3BR6A 2NOGA 3LSGA 3PO3J 3SFIA 4DW6A 2JK3A 4GFBA 1I3QJ 1BW5A 5FKMA 2Y31A 2JA6J 2X9DA 3IV5A 2HOSA 2JA5J 4RBOA 1FIAA 1I50J 3IH4A 1W0UA 2K9SA 1Y1WJ 3IH2A 5DTDA 4UUSA 1PUFB 1DU0A 2EZHA 2ME6A 4D7NA 2XGCA 1U78A 2L7FP 1A6IA 4D5FA 2XB0X 2FX0A 5EYRA 1IUFA 2VKVA 1FEXA 1XS9A 3OSFA 1W0TA 3BR1A 3A01B 3ZOBA 2LP0A 4A3BJ 4A3GJ 3Q0UA 1H88C 2ID6A 5HODA 2CQXA 2GLOA 4BY7J 2M8GX 5EGOA 5E3LA 1RPWA 1GT0C 5F1JA 2LLKA 1P7IA 1TWGJ 5EF6A 1MBEA 2R93J 2WV1A 4I76A 1ETOA 3JRIA 2DMUA 2FQ4A 2WAQN 2K9NA 2M2EA 5EZHA 1XG1A 2M0CA 2ELKA 1JTXA 3S2DJ 3A03A 2YS9A 4MFDA 4MO7A 1MNMC 2YUSA 3UKGA 2R5ZA 3JRCA 2XSDC 1HOMA 3HOXJ 1ZTRA 4I6ZA 3ZQCA 4C3HJ 3LSPA 2RAEA 2NS8A 2G0EA 1A5JA 1H8AC 5FKLA 5J3LA 2DA7A 2DN0A 1F36A 4AC0A 1H89C 4QTRA 3G1OA 5EG0A 3BR2A 4B1RA 3JRBA 1MH4A 5JLWA 3I4NJ 3FISA 3FK7A 1JKPC 3ZQIA 3S16J 1B72A 3S1MJ 1K61A 1ENHA 5E3MA 3S1QJ 3JRGA 1AKHA 1D5YA 3JREA 5J1YA 4D7MA 1MBJA 1IJWC 1G2HA 3TW6A 2VI6A 1R9TJ 1MBFA 2H1KA 1CQTA 2LKXA 1APLC 2JWTA 5GPCA 3LSJA 3CQZJ 4JX5A 5F04A 3LSRA 1T56A 1YRNB 1IV6A 1JJ6C 3S17J 4B3AA 2LFBA 1UHSA 2I10A 1OFCX 4BKXA 3GTPJ 5BNGA 1B8IA 1ZKGA 2NVXJ 2B63J 2DJNA 1MBHA 1ZR4A 3BG3A 4Y7NJ 4S0HB 2Y9ZA 2R7ZJ 3CMYA 2TCTA 3GBGA 2YU9J 5K7HA 5EEAA 3E7LA 3B6CA 3IH3A 4Y52J 4UUTA 4A3IJ 4JX6A 1P7JA 5EZGA 4DYRA 2XB5A 4DYCA 3RZDJ 3BTCA 4JP0A 1WPKA 1QVTA 3ZQLA 2CJJA 2N8GA 2JA7J 4A69C 5F0FA 5C3EJ 2XRLA 4MIMA 3TP0A 3BG5A 4L5EA 4XRSA 4V2GA 2WB1N 3O8GA 2P81A 4FISA 2E19A 3F0CA 2HOTA 4MFEA 1TWHJ 3B6AA 3JR9A 4DZPA 2VKEA 4ABZA 1S7EA 3BTLA 2NVQJ 2Y30A 5M5XJ 2IAIA 1GV5A 3CCYA 2R5YA 4A3CJ 4A3FJ 2GBYA 1FJLA 5F27A 3HBLA 4HNVA 1EF4A 3GTLJ 2MW8A 3C2BA 3QPLA 2COBA 1OJLA 2Y0SN 1RESA 3HEFA 2M9HA 5M3MJ 1LFBA 4CYCA 2XGDA 3H0GJ 2DMNA 5J1UA 4MLOA 2MG4A 3M4OJ 2E1OA 2XGEA 1JKOC 3SJMA 3D1NI 3GTMJ 4M3GA 5C4XJ 1ETYA 4DZJA 2HXIA 4W1UA 2IEKA 4BBSJ 3FK6A 4IHXA 1FIPA 4X1EA 2EZKA 1U8BA 1JUMA 4M3BA 3RKQA 2HOAA 2DA3A 3JRDA 4AUXA 2H8RA 2EBIA 2LY9A 4A3MJ 1FTTA 4UUSB 1HDDC 3CDLA 1BW6A 2NS7A 4FTHA 3BQZA 4A3EJ 1WI3A 3ZQHA 2Y9YA 3HOUJ 2EQRA 2ECBA 4A3LJ 2DA4A 2M34A 2EZIA 3K7AJ 3VPRA 1ETWA 4FCYA 3OSGA 3S1NJ 2HI3A 5FJ8J 5K7ZA 2AO9A 4V2FA 5EGOB 1AU7A 3L1PA 3HGGA 2DMTA 1ETKA 3FKIJ 1MBGA 3JRFA 2NVTJ 2JN6A 4J19A 2CRGA 4B4CA 1QPIA 3JRAA 2CU7A 2CUEA 2FD5A 1WGXA 1X2MA 4A3KJ 3LNQA 3HM5A 4A3DJ 5GPAA 1IRZA 4XIDA 1WCMJ 1Z77A 2ME0A 3S2HJ 2NVYJ 1NK2P 4IEJA 1MSFC
chains in the Genus database with same CATH superfamily
1RR8C 3OMYA 2EFQA 4HYEA 4XM3A 2IGOA 4RGRA 2GXGA 1ZR2A 2M3AA 4E7IA 2R5ZB 5H6QA 3I4MJ 1R7JA 1JKRC 4EEFG 3SDGA 1LE8A 5M5WJ 4M9XA 1YS7A 1ETQA 5DYMA 4D5CA 1Z6TA 4Y17A 1BA5A 3FWEA 4AM3A 1A6QA 1ERDA 4XSXF 2DA1A 5EDNA 1R00A 2DT6A 2LBFA 1I1GA 2CV0A 1TWFJ 5EG0B 3MKZA 3GTJJ 3HRSA 1RETA 4G8XA 1FYKA 5B5EC 2XHKA 5AIQA 2L0KA 3Q0WA 1BN5A 2O5RA 2D1HA 4HX8A 1IG7A 2QENA 4UVCA 4RS8A 3KYLA 4XICA 5H20A 1K78B 1JKQC 1YFHA 2YX7A 1Z0XA 2DT7B 3E5QA 2H27A 3OYGA 1A04A 3W2WA 3RYPA 3K70D 4LLNA 3CO7C 3OYMA 5E8IA 4BACA 4X0GA 5B3SH 1E2XA 2XRNA 1OYIA 1MDMA 3AG1H 2M1BA 2AQEA 1SMTA 3GO5A 3LSTA 1L3LA 3TP3A 2Z9OA 5LLQA 1R1VA 3HSFA 2OPTA 1DPRA 1RI7A 2P5KA 5FROA 4B43A 3MVPA 5FFXA 3K1PA 4DNCA 2M30A 2GM4A 1WJAA 4NQWA 4LITA 1V54H 1KGSA 2JMWA 3NAUA 2E7XA 2VBZA 1U5TB 2PFBA 3WU0A 3HOVJ 2E2HJ 3WHBA 3CLQA 3SZPA 3MAJA 5KK1A 4K2EA 1SVMA 1TWAJ 3HGYA 1RR7A 2KDZA 4BHPA 1JJ8C 4I2OA 3J7AO 2RQPA 3ZQ7A 2EINH 4R1HA 2MGQA 1UB9A 1G3WA 2M0MA 4ZZDA 3KEOA 2XPWA 3DTKA 5GADJ 1FX7A 3LFUA 4BS9A 9ANTA 5M5YJ 1KU3A 1IGNA 5JHUA 5M3FJ 2HXOA 2VE9A 3DFGA 1TT5B 5E8GA 5D5UB 2O8XA 3K4MA 4WWCA 2HDDA 2LREA 2DOEA 5IP7J 1ZELA 4IOCF 1Z05A 4RMNA 1YRNA 1SD5A 1MNEA 1FT9A 2HYGD 4L9TA 5LHIA 2FSWA 3M8EA 3K70C 3DU5A 2XKPA 1T6SA 2M87A 2RDPA 4UB8C 5C44J 1S72I 2XF6A 1B6AA 2CS3A 3BR3A 3CUQC 3OYFA 3I9V2 1WJDA 3M1CA 4HG2A 4M9ZA 4EJTA 1ETVA 2BXZA 2XAJA 3TQNA 1LNWA 3BROA 4PJ0C 1K79A 2CUZA 4D1QA 1JHFA 2ZXHA 5K5RA 2QM3A 1USSA 3SQNA 2L4MA 3EPZA 4PZJA 2Z33A 3IUOA 3PM1A 2DA5A 1BBYA 2CWEA 1G8XA 4MNUA 2Y48A 4KISA 2DYRH 3ZPLA 1XCBA 3OIOA 3DF8A 1TP4A 3JRHA 3OYHA 1SEUA 4G9YA 1X58A 3GVAA 5E3OA 2VQGA 3MZ8A 4IHYA 3EQLF 3HDDA 4P9UA 1VFCA 1UMQA 2ZB9A 2K9QA 2TDXA 3GMEA 1VQ6I 1BIAA 1TTYA 5B1AH 1BL0A 1JI8A 2HZDA 4BE0A 1UHWA 4D0PA 3HOWJ 1WJEA 4BBRJ 4BYYA 3F9KA 3RDIA 2QCOA 1MBKA 3FZVA 2XPVA 4EATA 4BDYA 1Q1VA 3HOZJ 3QQAA 3FHNA 2K9MA 2L7MP 4RLQA 4XK4A 3VDXA 2A68F 1JGGA 3S1RJ 2B7EA 2VPRA 2M5WA 4BHBA 1WQ2A 4BL0B 3R0AA 3LSGA 1X19A 4GFBA 3AL0C 2MD0A 3GYHX 1BW5A 2Y31A 5FD5A 3SZGA 1SMYF 1OR7C 1EKEA 2VKDA 2V26A 2HOSA 2JA5J 1YYVA 2JUCA 5LEJA 1Y1WJ 5DTDA 4UUSA 2ISZA 1DU0A 1G4DA 2F5VA 5FO5A 3LL7A 1GXQA 1A6IA 1Y0UA 5EYRA 1A35A 4CCJA 2BZTA 3ZOBA 2KRHA 2EA2A 1RC9A 1T98A 1V3FA 5DUKA 4Y3OA 4FX4A 2EJRA 3FDYA 4HDUA 2ID6A 4ENMA 3E6BA 2LBFB 2E36A 3L7WA 1HW5A 2M8GX 3CCLI 4U88A 2DI3A 1RUNA 3ERMA 5LEKA 3SDBA 3S3OA 1R49A 5DV5A 2ESHA 4NC7A 5EF6A 2OTLI 4I76A 3CC7I 5F1RA 2IGMA 2MFZA 2OQGA 2FQ4A 3E6DA 5TGTA 3W2AA 4EVIA 2EV5A 4H4KC 2AXLA 2VOOA 2K9NA 3W6KB 5J4YA 5EZHA 4F3QA 1BI0A 1HSTA 3JTHA 2ELKA 3CMMA 1MZBA 1R4MB 1YITI 3A03A 1FY7A 3L2QA 2Y75A 3GWZA 4MO7A 3JAMZ 2YUSA 1MNMC 5DCFA 3UKGA 3GF2A 5BPIA 1BJAA 2H94A 3HL2A 2A5YB 3VOEA 2VBYA 5A2QK 2IS4A 2XSDC 4OAZA 3OYCA 1FMWA 1HOMA 2WY7Q 1Y56A 3CP8A 5LRRA 4BDZA 1LDKB 4ZDPA 4C3HJ 2LF8A 2LRDA 1D8KA 1NG7A 2HVRA 2G0EA 5J47A 3V7SA 4U87A 3G71I 4MHGA 4GGGA 4NQWB 4HQEA 3TOAA 1WFXA 1MH4A 3FK7A 1JKPC 2EIKH 3ZQIA 5LGNA 3HZJA 2ZSIB 1ENHA 3PFIA 5IT9Z 2A05A 4A2UA 2BY3A 5J1YA 5DM7F 2UXXA 1MBJA 3ZMUA 3L00A 1D1BA 4E7SA 2VASA 2DBBA 1G2HA 1R9TJ 1MBFA 2ZFWA 1OCOH 3TOBA 5GTHC 3I58A 4NUBA 2D45A 1G3TA 2JVGA 1QHGA 4JX5A 3AG4H 4HA8A 3LSRA 2LG4A 1XN7A 1O57A 1ACIA 2WAEA 1YRNB 1O7FA 2XF7A 2R3SA 2LFBA 5HLGA 2I10A 3HC7A 3CMAI 1WJFA 1PP8F 5LGTA 1LDJA 2VN2A 3I53A 5LGUA 1E0EA 1RIOH 2QWWA 3BG3A 4Y7NJ 2R7ZJ 1HW2A 4UUVA 3CMYA 3I5UA 2TCTA 2E1NA 4CYDA 2YU9J 3E6MA 4DJAA 5IT3A 1T38A 3LA2A 1P7JA 2P6SA 2XB5A 1RRJA 4XN3A 1CGPA 1FOYA 5L3GA 1QVTA 2VJIA 4Q4ZF 4ZDLA 4A69C 4EJVA 3IL2A 3RPUD 1MMSA 2XRLA 4MIMA 2V9PA 1G59A 4G6TB 1EJ9A 1DDNA 1XDUA 3Q9VA 1MKMA 2VBWA 3B6AA 2W7NA 4HLYA 3LFKA 2VKEA 2UV1A 4ABZA 1S7EA 1H9GA 2ZC2A 4MTEA 5M5XJ 3DPLC 3C2HA 4EQQA 2IAIA 2DFIA 4HPQA 3F6OA 1ON2A 2QQAA 2KRFA 4KIFA 2W57A 4HNVA 1IN7A 2NS0A 4IRGA 3HSEA 1UHMA 1ZARA 3C3WA 3GTLJ 2CV2A 2J5PA 2ZNZA 1IN4A 3HEFA 5CQGA 3DKYA 5HDNA 4NC8A 1LFBA 3B73A 2BV6A 3CP2A 1TLHB 2H09A 3FMSA 3HOTA 3H0GJ 2DMNA 1ZLJA 4I09A 4IRIA 2Q0OA 4AIHA 3KE2A 5J1UA 2VT3A 3KETA 1ZREA 3T1BA 1W5TA 2VPLA 4BUPA 2MG4A 1B9NA 1JKOC 3OR2C 3D1NI 3QOEA 3GTMJ 5C4XJ 5FFZA 3OL3A 1ETYA 3H35A 5TJJA 1FIPA 4WXDA 1MGTA 3OYJA 1JUMA 1P2FA 1Y6IA 1MJ9A 2COMA 4M3BA 2E1CA 2I8DA 3FXRA 4AUXA 1SAXA 1PJRA 1JGSA 2LY9A 3LSKA 4XL9A 1FTTA 4XLEA 2BHYA 4UUSB 4I7HA 3LAJA 1YO5C 3CC4I 5DD4A 1S7OA 2BVMA 2HU9A 4E7KA 1FWZA 2NS7A 4LLGF 5D4SA 4S04A 4OIPF 1Z91A 3FXMA 4A3EJ 1LUJB 4PJJA 2FEZA 3R6SA 1KZHA 1U3EM 1TT0A 2E1MB 2DA4A 2IA2A 1ETWA 4MQ9F 2CH0A 2IXSA 3JCUC 2HGCA 5L3BA 4PSXA 2AO9A 4V2FA 5K7ZA 4UNOA 2DMTA 1ETKA 4CCLA 1O3SA 2HNHA 4ZYAA 4XRFA 3I0TA 3BJOA 3JRFA 3G4SI 2NVTJ 2JN6A 2CRGA 4FQGA 2MLGA 3DKXA 3NWTA 3LA7A 4HZFA 3HM5A 1IRZA 4XIDA 1QO0D 3P9KA 3U1KA 3M1EA 3RJPA 5LHHA 2X4HA 1GXPA 2Q1ZB 2GA1A 1NG6A 1NK2P 3CESA 4L9NA 4OINF 2HYJA 1N75A 4M73A 2FBKA 1PUFA 2IJLA 5IY5H 4RB1A 3CF5F 1BR2A 2YSRA 3L2WA 2JA8J 2LVSA 2D5VA 3I3LA 4U0VA 2VIXA 3CD6I 4M6YA 2QYOA 3L2RA 1T2KA 2BHZA 3A01A 4IX7A 2FNAA 1PUEE 1VQKI 2O8KA 3BG9A 1IDZA 3JAMK 1R22A 2IBDA 1Y1VJ 3TO9A 2DK8A 2ZXIA 4NDLA 2DO7A 4J01A 2Z2SB 2HPMA 5F0HA 4FT8A 2DU9A 4P96A 4IHTA 3K1MA 4NHJA 2TRTA 4A0XA 4LD5A 2R0QC 4C2UA 2JPCA 4IKFA 1WZ2A 5IYBJ 5JVTA 2LK2A 4LMYA 1V5FA 5C4JJ 3CDIA 2E60A 3IRRA 1MW7A 1LKXA 3L2VA 1IAWA 3D5SC 3VSLA 4RB2C 1Y39A 4IHWA 4JYKA 3GXOA 4CCKA 2VJ5A 4CA0A 1L0OC 1K83J 3ML6A 1WSUA 4ZYEA 3OYAA 2NYXA 4FE7A 5DDGA 2PMZA 1RKWA 1B1BA 1OPCA 2XAUA 4LB5A 4E7LA 1WKMA 2QQBA 3RQ4A 1Z1DA 3SFZA 3VSKA 1VQ9I 2ZXJA 3V8LA 2X1CA 1D0YA 3FM5A 1X1BA 3ASNH 3QPSA 4PJLA 4YFNF 5L3DA 3MCZA 2QGUA 4XLHA 2LY2A 2X6OA 3CMEI 2DMQA 2JZYA 3MZYA 4U7BA 5CVIA 3Q5FA 1MSEC 2WA0A 1HKQA 1J75A 4C2MJ 3M8FA 2DCEA 4IQ4A 4OMZA 2K5CA 1G6NA 2LF7A 5HLHA 2CO5A 3S14J 4G94A 3ZR8X 1FC3A 4PCQA 1ZH5A 1F5TA 4Q48A 3T0YA 2I5UA 4I01A 1XCVA 4M6VA 3L9FA 1FTZA 4QIWN 3G1MA 4OWRB 4XORA 1GUUA 2B0LA 3BOQA 3Q9SA 1I27A 1R5ID 1SFEA 5HS7A 1FBSA 4BEHA 1YX3A 3CJQB 2K86A 2OU2A 2V6CA 3LMMA 1NK3P 4M3DA 3PO2J 2KJBA 3LOCA 3WGGA 2CQQA 3ONQA 3QPHA 3F6VA 4M3FA 4ZYGA 1PYVA 5HS9A 1WJBA 4KA4A 3ZXSA 4L18B 4RM2A 1PDNC 1S8NA 1YW7A 4YIRX 4L5IA 2EPFA 4XKWA 1HKTA 4II2A 2M4KA 2EZLA 1KA8A 2DDBA 5KVRA 2ID3A 3I59A 2ELHA 3BTIA 5DCMA 2WBMA 2KQRA 2AS5F 1TW2A 2FE3A 1JT6A 4L0ZB 3VODA 2VBXA 3KP7A 3ZQQA 1XC5A 4XLPF 2KIUA 1AWCA 3CCQI 1OCTC 3J80K 4KFCA 2LY1A 3C18A 3BG6A 3CUQB 4BXFA 1K6YA 2LR8A 3BY6A 4U0YA 4UV8A 3R4KA 2GXAA 2CUJA 2LOOA 5CYVA 1Z9CA 4HV6A 1O3TA 1W7PD 4ZZLA 3NWSA 1JUSA 3GW2A 2QF7A 1VQ7I 2DQLA 3DCFA 4I99C 4GDFA 1FNNA 5DS9A 3BR5A 4XNFA 2M7BA 4YELA 3HRUA 3Q3SA 1OISA 2KRCA 1JTYA 2X1EA 2BEOA 3MWMA 2LYCA 3A0HC 2LD5A 4A93J 3K4BA 5IYCJ 4J00A 1J2XA 2CUFA 2CYYA 3RKWA 1ZN2A 2L9NA 3E5XA 3H5AA 1I5ZA 2PMZN 4BJTA 3EDPA 1UFMA 4C3IJ 3BT9A 5FRMA 1I6XA 2IS2A 4IOAF 5E1ZB 3FXQA 3OOUA 3GZ5A 1WH5A 2EV6A 2IVMA 2W25A 3KEYA 4BE2A 3CCMI 2OQRA 3BR6A 2M8EA 3I4PA 1D5VA 2XAHA 4RLFA 4XLNF 1Z7LA 2C6YA 1LJ9A 1I3QJ 5FKMA 1I1SA 1ZG3A 3CDHA 3E3VA 3S93A 2JA6J 2UUZA 3IV5A 3HHGA 3ABLH 4RBOA 1FIAA 1G3YA 2E5ZA 3S32A 4N4NB 1XGMA 4XOPA 3RKYA 5BOXA 2ELJA 3IH2A 1W0UA 1KQ9A 1PUFB 2Z3YA 4ITVA 2CFOA 4PFPA 4Z2YA 2PI0A 3FXJA 5CLSA 2BE5F 4MEXF 3AG3H 4D5FA 2FX0A 4HQMA 4UVAA 1IUFA 3P7NA 4Y33A 1XS9A 3KPHA 2HEOA 3A01B 1R1TA 3AL0B 2LP0A 3R61A 4E6KG 2ZJPF 2FMLA 3Q0UA 1H88C 5HODA 2FU4A 4Q5SF 4L9JA 1HBXG 2MBFA 3LSIA 2A61A 4CHUA 1W5SA 5E79C 2IGKA 2F5EA 2QQ8A 3A2KA 1GLNA 1RPWA 3ESWB 1P7IA 4XR6A 1R58A 1MBEA 2WV1A 4KICA 2ESNA 3GLXA 1YI2I 2IRFG 1K4TA 2A3SA 2BVLA 4CGZA 4HSTA 1R5HA 2VJJA 1JTXA 3P9IA 2E34A 3BWGA 3LWFA 3M8JA 3KFWX 1VQ4I 1IXCA 2YS9A 3HRMA 4MFDA 1STZA 3PSIA 2DW4A 3EETA 3GTOJ 2HZTA 3E0JB 3HOXJ 3CC2I 1WJCA 4BHCA 4AIKA 4ZDOA 2RAEA 4XLAA 2NS8A 4MQVA 1ZG1A 1RZ4A 2FA5A 1X1DA 3EUHA 3NEUA 1H8AC 2DA7A 1H89C 1F36A 1HSJA 1O7LA 4Y4RA 1V4RA 4QTRA 1LEBA 3M7GA 2VODA 3T8TA 4D9JA 4IF4A 3DLLF 1RNLA 4B1RA 5ICGA 5JLWA 3I4NJ 2KLOA 3S16J 1U0JA 2HPIA 1EA3A 2F2EA 4FETA 3S1MJ 4FASD 3CF2A 4KIBA 3PNVA 3OR1C 3H9QA 1AKHA 1D5YA 4CICA 1GVJA 3IRQA 4D7MA 4AIDA 4GO1A 1DUXC 5D5VB 2BW3A 3PQKA 2VI6A 3QYEA 3PIPF 3VFZA 4BEHB 3K1NA 1DQUA 2LKXA 2JWTA 4C9YA 4CO8A 2HOEA 3CQZJ 4I02A 3G73A 1IV6A 2R7XA 4BAYA 2KISA 4BKXA 1U2WA 1KONA 2ICWG 2XVCA 3S3NA 5FLXK 1D1CA 1B8IA 1X3WB 1ZYRF 1Z6RA 3IAM2 4BNCA 1USTA 3J7ZI 2Z1DA 1SFXA 4XKVA 3I59B 5DCMB 5EEAA 2XUBA 4HOBA 3E7LA 3H5NA 4Y52J 4UUTA 3TMOA 2VJ4A 4DYRA 1FP1D 1IRFA 4GYIA 3SEZA 2XGXA 3EYIA 4JP0A 4M9SA 3BLYA 1BR4A 4MGRA 2JA7J 2DPUA 2JUGA 4LG3A 3J81Z 4XKCA 4HNUA 3BG5A 2R7WA 1FOXA 2HVQA 4V2GA 1ZRCA 1U6GA 2CQNA 3H3UA 4P55A 2VQLA 3K4KA 2Y0MA 1TWHJ 3JR9A 3BG7A 2CW8A 1GV5A 2R5YA 4F93B 2Y69H 4ZTJA 1ZRDA 4M6XA 4A3FJ 2EFPA 3NRVA 5F27A 2KHMA 4OAYA 2HR3A 1E3PA 1R1UA 3WU2C 1U5TC 1LQ1A 2MW8A 3C2BA 3QPLA 4KT5C 2ISYA 2O61A 3PFYA 4N4OB 4XN0A 1RESA 1R5GA 4KDPA 2M9HA 3D0SA 1Y0NA 2XGDA 2V9KA 3L2CA 2PMUA 5HLIA 3F23A 3AG2H 2EWNA 3IWZA 3PJRA 2MH2A 3BZKA 2OJED 4CSWA 2IW5A 2BY1A 2HKOA 5H2FC 3SJMA 4M3GA 1MMDA 3R0JA 2IEKA 3U1DA 3FK6A 3QU3A 3QOPA 3VEPA 1U8BA 4KJZA 4B44A 2OV7A 3QU6A 4CCMA 3RKQA 2G7UA 4MTDA 1FYLA 4ZH4F 2G7HA 1XGOA 2QLZA 3CDLA 2WTEA 1VQOI 1CF7A 3EUKL 4EV0A 3OYLA 1G3SA 3JW4A 3SZTA 2Z16A 5D4RA 1WWXA 1TQIA 3PIOF 3K4NA 4BJ6C 1WI3A 1SAUA 5ILUA 2PMHA 2ECBA 1BI3A 3DQVC 3P9CA 2F4MB 1X4OA 3G3ZA 1EH6A 3VPRA 2HI3A 5D8LB 5FJ8J 2UXNA 2ACJA 4CDGA 2R7FA 4MEYF 3L1PA 3T8RA 1XB4A 3ZN1A 3QP6A 2A6HF 4CCNA 2LKSA 3FKIJ 2NXNB 2BY2A 1MBGA 1TBXA 2HVSA 2F5FA 2CU7A 2CUEA 2R4GA 1X2MA 1UCRA 2L54A 3V7CA 2QBYA 1XDSA 2RGVA 4BGDA 2V1DA 4Y15A 3H1CA 4R8HA 3I54A 2DTRA 2CFXA 1IRXA 1P92A 1Z77A 3X2QH 2NVUB 2JPBA 2MA3A 4M71A 4H0EA 2KDOA 1S7AA 1TQMA 5JVGF 5FKKA 2QKMB 1HA8A 2ECCA 3PSFA 5FLVA 1DGWY 4X6AJ 2L2OA 3JSOA 3BZCA 2V7FA 2VC0A 4G6QA 3RSNA 3W6JB 1S6LA 2F48A 1ETXA 3EUAA 5GP9A 3I71A 3KP4A 1YQAA 4LG0A 1POGA 1FMVA 2VE8A 3A02A 3FXUA 3ZP5A 3QPTA 1XGNA 2K3FA 5HOOA 3TKYA 1W4MA 4PSWA 1A36A 1ZRFA 2HQAA 2W84A 1VQPI 1SFUA 1BM9A 3SXYA 3K4LA 2ZFUA 4AYBA 1S29A 3BJ6A 2QUFA 1HCRA 3DXJF 4AVZA 4C3JJ 3BPVA 1P9QC 3DBLB 1LFUP 5CPRB 2XKOA 3RQIA 1R23A 3GTKJ 1WJ5A 4LK1F 1AKHB 3K2AA 3W2VA 3ZCOA 3DP7A 1TC3C 3KLOA 4OU0A 1QVUA 2M45A 2BW3B 4KMUX 1FOKA 2RKHA 3RZOJ 1IDYA 3OYEA 1HLVA 4HF1A 3DEUA 2DYSH 3HKZA 2E2IJ 1W7PA 1SD7A 2W85A 1SANA 2R7TA 5IPAA 2D2WA 2ZO4A 2WC2A 2A07F 1VTNC 1BIBA 1IW7F 2PJPA 2O3FA 1OCZH 3QP5A 2WY8Q 1IXRC 3G1LA 1B8IB 1QNTA 5BQTA 3AKZA 5JI6A 5IOZA 4EJWA 1JT0A 1RKTA 3BZ6A 1I6HJ 1HXDA 2V9VA 5D6FA 2DA6A 3J7AY 2ZMEC 4RGUA 4LLLA 5FKOA 3A0BC 1BOAA 1VNDA 2R7QA 1ZQ3P 2DPDA 2WV0A 2BGCA 1TWCJ 4ZC3A 1D0XA 3K10A 3WGIA 4FX0A 3FIWA 4BXUA 3ZRGA 4A6DA 2YR2A 4A12A 3H0DA 3CUQA 4II3A 1KU2A 1QZYA 1MNDA 2ETHA 3OYIA 1K4SA 2OUMA 1OYYA 4LJZF 1ITYA 1LPQA 2GAUA 3IWFA 4WK8F 1BC8C 3U21A 5L3EA 4M74A 2STTA 1SFKA 1XD7A 2K40A 4YIIA 3DU6A 2X85A 4IL6C 4IHVA 3J81K 1X1AA 4ASNA 5TISC 2EB7A 1ORKA 3D5RC 1BR1A 4M72A 2R5YB 1GV2A 3PQJA 2JTVA 4JQFA 1XSDA 1EH8A 1O3QA 1U9OA 1WVRA 1YTYA 5IYDJ 3HPGA 4A3JJ 2CW0F 1QZEA 3H9JA 5IOYA 1SD4A 5FKNA 2VOPA 3BCBA 3OL4A 4F52A 1KU7A 1D8JA 3WE2A 2KIFA 4TV7A 3GFMA 2FJ1A 2Q8KA 4LOCA 1BI1A 1B59A 3GFJA 1UJ8A 4AU7A 1GDTA 5DD8A 3GTQJ 2M4GA 5ILVA 3AFHA 5K7FA 4N9IA 1WI9A 2L9RA 4AYBN 2RVCA 3VWBA 3SEQA 2LTPA 2VC1A 3PNTA 3V8KA 1MH3A 2DTZA 3ERED 3ZQGA 2VT2A 2B9SA 4PJNA 4XONA 3WG9A 5D5XB 4XMYA 1Z3YA 4G12A 3TEDA 2EV0A 1CF7B 4HX4A 5ED4A 4HRIA 4JBAA 1NTCA 2HQ5A 3K69A 4QLCU 4FE4A 3CCSI 3DTIA 3HG9A 5J1RA 2EFOA 4BY1J 1OR7A 2EH3A 2Q2EA 1DGRM 3CJRB 5CVVA 5FB2A 1J09A 1XSXA 3BQYA 3HKZN 1BJZA 4NBQA 2ZXWH 5LRSA 4RDUA 4ESFA 2ZSHB 3FBIB 3DPTA 3V4GA 3Q0VA 3S15J 2DODA 3HB9A 2W00A 2FBHA 2L7KA 2A69F 1GVDA 4UVBA 4IZZA 3F8MA 4GYGA 1MJAA 2HTSA 1IZ1A 4XOTA 3D5LA 4I0BA 1N25A 3KIOA 4BQOA 3VYUB 1ZGWA 3H3ZA 4PGGA 1QRYA 1IN6A 4QWQA 3FXKA 3F72A 1ULYA 1YW8A 4P1WA 3FHZA 1J0RA 3TW7A 2DLLA 2QBYB 3V42A 2Z99A 3ZN0A 2FQ3A 3VB2A 3SFIA 1QU3A 1TZLA 3OS2A 2AXTC 3QODA 2FMYA 3EYYA 5IT9K 3OS1A 2E7WA 1H9TA 1I50J 3OIQA 4HW0A 4KUMA 3AAFA 2YX4A 2ME6A 3VYRB 3HPHA 1REPC 1HKSA 3RYRA 3WTTC 1U78A 1TNSA 2R7OA 1QA6A 2EIMH 4LG0B 2XB0X 2CQKA 4UV9A 1P6RA 1FEXA 3OSFA 1YIOA 2HQRA 4HEA2 5KNLA 2IS6A 4A3BJ 2FOKA 1ON1A 4A3GJ 2HWVA 1AA7A 4Z6YA 5JR3A 2KJCA 2GLOA 3WU1B 4BY7J 1P4WA 5EGOA 1YLFA 4V19K 3HTUA 4IHSA 2JT1A 2XSJC 4EM2A 2JRTA 3H36A 3GZNB 4IXAA 4FHTA 1TWGJ 2P0WA 4RAGA 3FF5A 1ETOA 3JRIA 4S05A 1P4AA 4AD9A 5AONA 1J7KA 4IJAA 4AWXB 1D0ZA 2HDWA 1XG1A 2M0CA 4XKBA 1YX5A 1W7PB 2GIZA 3S2DJ 3PNYA 1YG2A 2L4AA 3GFLA 4RGXA 1SVLA 3BPXA 2Y0SA 2A5WA 1XMAA 4ZJZA 4AIJA 3ECOA 3IKTA 3JRCA 5K1YA 4I6ZA 2KP6A 5L3CA 3I56I 4ON0A 1IUYA 2KIQA 1R6RA 1TNTA 3DKWA 4WF2A 2CQ7A 1MD0A 3C1DA 1FSEA 2OCCH 4A5NA 2GXBA 2VXZA 3LAPA 1T39A 2DN0A 4AC0A 1ZAOA 3OYNA 2PJRA 1D3YA 3BR2A 3JRBA 4IVNA 3FISA 1B72A 4NNJA 1E3HA 1BC7C 2RC4A 4O5VA 1FBUA 3CO6C 4EJUA 3JRGA 5ICFA 2PN6A 1R36A 2XF5A 3E1SA 3KP2A 5D8KB 3JREA 1MIJA 4KNYA 2KKOA 3KYCB 3A1YA 1HQCA 3PUFA 4QPOA 4E7JA 4DBQA 2E35A 4NB5A 4DGWB 4ENJA 2GZWA 2P6TA 1EV7A 2BOLA 2BYVE 2DT5A 2KZGA 5F04A 3DLAA 3IKVA 3V8JA 2HQNA 1FOWA 1BI2A 2DOAA 4BQNA 2O0YA 1E17A 1OFCX 4UB6C 3M9AA 3TGNA 4CZZA 3GTPJ 5BNGA 3S2WA 3FM3A 1ZKGA 2ZBKA 2NVXJ 3GCMA 2B63J 3TL4X 3DTEA 1I3AA 2DJNA 1ZR4A 2Y9ZA 4S0HB 2VLAA 1U8RA 4WXHA 3KP3A 3GBGA 2HDCA 2VONA 4LB6B 2V6EA 5CKTA 4HF2A 2W24A 3B6CA 3CCRI 3MKWB 4EM1A 1W5CC 5EZGA 5KAIC 3IP4B 5K5OA 3OYDA 2OC6A 3BTCA 5FD6A 2JSCA 2P7CB 1WPKA 2CJJA 2N8GA 5E1XA 4AVPA 1KU9A 3F8CA 5D6EA 1Z67A 4XRSA 3K4CA 3SYTA 2IGNA 3O8GA 2P81A 1ZGAA 3BDDA 3RPQA 2R7SA 2JQ7A 2BBYA 2ZMEA 3N4MA 1NHAA 4L9VA 4MFEA 1FP2A 4PK4A 5A2QZ 1S9HA 3BTLA 2Z5UA 1F4KA 2NRAC 4HX7A 2P5VA 3ABMH 3CCYA 2STWA 3KZIC 3F21A 2GBYA 1FJLA 3DBRB 2Q2EB 2DK5A 3FBNB 4LGWA 1ZHFA 3GLLA 2OCEA 2P8TA 3RKXA 3F8BA 1DP3A 4CH7A 3O6BB 2COBA 1OJLA 2Y0SN 4F92B 5JFRA 3TO7A 5M3MJ 2MABA 2E5NA 4B47A 1IN5A 3BJAA 3M07A 4CYCA 5LD2C 3V7RA 2XASA 4WX9A 5D5WB 3RPUA 2L9VA 3ZGKA 3GFIA 1B4AA 2IP2A 4CCOA 1VQ5I 4PGHA 2E1OA 2XGEA 4UHTA 2CGPA 2CV1A 2HXIA 3RTRA 2ZJRF 4BH9A 2X0LA 1IN8A 3NQOA 3OOPA 4X1EA 1XSVA 3KZYA 3K6GA 2RNGA 1Z21A 2DA3A 2HOAA 4YG2F 3JRDA 2F4OB 1WHUA 2EBIA 2A6EF 4BQQA 3QAHA 4A3MJ 2NAZA 2OZUA 3S8PA 1XX5A 2E71A 3WTYC 2F5CA 3KEQA 1VQ8I 1WRJA 1X1CA 2JA2A 3DBHB 1Z3XA 3WTSC 2MC4A 4I98B 4FTHA 4A5MA 2F6CA 2P5LC 4RB3C 2R7VA 3BQZA 1GHCA 2HTJA 2KL4A 1SVOA 2F5DA 2ZKZA 1YOVB 2EQRA 4A3LJ 3WTUC 3ZMTA 2M34A 2EZIA 2V79A 3K7AJ 4ZYDA 1FPQA 3OSGA 1MMAA 3PUBA 4B8XA 1F9NA 2V1NA 5EGOB 3H5RA 5E1WA 3ZMDA 3CCJI 3SHFA 3N05A 3CCUI 5GAEJ 3LA3A 5HNHA 1W36D 4RAYA 5B66C 4JOMA 2QEXI 3TDZC 4OMYA 4B4CA 5DM6F 3WTZA 3P5JA 3JRAA 2PEXA 5LBQA 3LNQA 1HC8A 2KMUA 2L5QA 3C7JA 5GPAA 3TO6A 4A3DJ 2VXDA 3F3XA 2LMDA 3F8FA 3ZMSA 4E4HA 1VQLI 2ME0A 4O6JA 1A31A 4HDVA 2X51A 1X3ZB 1R71A 1MSFC 1UZCA 2LSOA 2DMPA 1JXSA 5AIPA 2DFFA 4A0YA 1M1EB 1YJNI 3LQRA 3QRFF 2L9SA 1OYWA 2K9LA 3KP5A 1F43A 2H8WA 3MMYB 5E3NA 1Y8RB 5CQEA 3W6VA 1ZG5A 1ZLKA 1PVEA 3U9GA 3CJTB 4B48A 2DA2A 1T0FC 3PL8A 1XMXA 2V1XA 3VYTB 1T8IA 3K4JA 2PLYA 2EK5A 2PJRB 3BP8A 4EMSA 2ZJQF 1AHDP 4EGZA 2O7OA 1B9MA 1IV8A 2AHQA 2DOFA 4LK0F 5IP9J 1B72B 1Z7UA 2UZKA 3IC7A 2E2JJ 2DXIA 2K02A 1P4XA 3BR0A 3HUGB 4E7HA 2PX9A 3WHCA 4RAFA 4R79A 1KQ8A 2QZ8A 1E3OC 1MMGA 1QGPA 1VF9A 3LQQA 4KMFA 1Y8QB 5F08A 3E6CC 3WODF 1I39A 3LSMA 5HDKA 4DYQA 4P5OA 5DEQA 1PP7U 4ESBA 1QPMA 3HOYJ 1FSHA 4L5JA 1W36C 5H6RA 2XIGA 3OY9A 5JHFA 3W3CA 2MD5A 4ANJA 2XAGA 1VZ0A 4QSHA 2OD5A 3B02A 1UG2A 3WE3A 3BTJA 2WAFA 5ERIA 3OS0A 2OAZA 3DEEA 1W1WE 1UAAA 2L7ZA 1QZZA 1V5GA 3JTGA 2NOJB 5J6XA 1SD6A 1IXSB 1T33A 2K4BA 4P9FA 1LE8B 1X3UA 2KT0A 3FMRA 5CVUA 4BJ5C 1O4XA 3ZMZA 4W97A 2X6WA 5E18F 3DV8A 3FX3A 1HF0A 3C2GA 2X48A 3M3YJ 1OKRA 3ELKA 2DAOA 3O8HA 1VI0A 3FKJA 4XQFA 1NH3A 3CJNA 1YW9A 1LVKA 1U9NA 2WADA 1BOBA 2EFNA 2Y2ZA 2OZ6A 2V4JC 3L09A 2R92J 4O3MA 2K85A 5J8FA 1MMNA 5KAFC 1FYMA 1TL8A 4DIQA 3MKLA 1N78A 1ONVA 2XROA 2M7AA 4XRMA 1OCCH 1D1AA 2ZMEB 3RCOA 1WH7A 2QSFX 4BXXJ 3GTGJ 3WTVC 2CW7A 3REOA 3QYBA 3MN2A 2GA2A 5K5QA 5F6FA 4BU2A 4YFKF 4F7ZA 1ZK8A 3CLOA 5F64A 2VUMJ 1DU6A 2KZVA 5FGMA 1OCPA 1MDMB 4DOZA 2HKXA 3ZQFA 1ZGJA 2OA4A 3JSPA 5F0CA 1V55H 5ICCA 1X2NA 1H0MA 2DJIA 4IPAA 4PFOA 5KHDA 1FBQA 2FOWA 5FLMJ 4CYCB 4KN7X 2WAQA 2ZCWA 2IPQX 3O3KA 2IT0A 1V5EA 1JUPA 3WG7H 5IP6A 4ZTFA 1IC8A 2MLKA 2JVHA 3HTSB 2X6YA 4XSZF 4WCGA 4ZYHA 2JJ7A 3DPUA 1X1PA 1TW3A 2O9LA 2IA1A 2R7UA 1TQPA 3H3VK 2G9WA 5FRNA 5ILSA 2MC3A 4M3EA 1ODDA 3DEWA 4JX4A 1UELB 5LHGA 3KP6A 5GAGJ 4GXOA 2KPMA 3GEZA 1YS6A 2ADUA 2W48A 1OQYA 3NARA 2K27A 2YU3A 2XPUA 3O2PE 3HYIA 2PQ8A 4RAZA 2XC7A 3U2RA 5J8CA 2RNJA 4XRSG 1OLTA 3WGHA 2AQFA 2MH9A 4Y13A 2OF7A 5JLXA 1HDPA 1IRGA 2XDVA 2MSYA 5HNFA 1SFOJ 3DWLE 2ZNYA 4XBFA 4F55A 1FZPB 5E17F 3ABTA 3K2ZA 4A6EA 1OCRH 5BPDA 2QA4I 2CSOA 3BC8A 2HS5A 4PJMA 2UWMA 2NOGA 3PO3J 1JE8A 4DW6A 2JK3A 4LFUA 5BMZA 3OV8A 4BE1A 3K9TA 2VQCA 4KN4X 2RV8A 2KIMA 2W4SA 2X9DA 2VB6A 3IH4A 3KYDB 2K9SA 3FXOA 4DQ2A 2J5OA 4G7OF 2EZHA 4D7NA 4WXCA 4LIVA 2XGCA 2L7FP 3J7YJ 2VKVA 2FRHA 3MFKA 1W0TA 3BR1A 4OOIA 5DUIA 4JK1X 4OIOF 4C2TA 2L02A 1DP7P 2XAQA 4N9HA 4YEJA 2X6XA 2CQXA 2IA0A 2ZJ2A 2K4JA 5EEHA 2GOMA 5E3LA 3HJEA 3UNGC 2WB1A 3ZMVA 4N0BA 4NC6A 1GT0C 3WTWC 5F1JA 2LLKA 1EH7A 2PBIA 3MQ0A 1FLIA 2GOXB 3J80Z 1T95A 4IO9F 3FXLA 2R93J 4HLXA 3TBIA 2VKHA 2DMUA 3MD2A 4C30A 4RB0A 4HAMA 4U0WA 2WAQN 3OYBA 3CTAA 5KCMA 5TRDA 3QWLA 2M2EA 3K0LA 2VQHA 3H9GA 3MKYB 2W1OA 4PDKA 4KT6A 1J9IA 4RA2A 2A6TA 6PAXA 1XGSA 2CG4A 3ABUA 2QSGX 2R7DA 3S3MA 1VQMI 3E97A 1LVAA 2H6BA 5B1BH 2R5ZA 4RGSA 1ZTRA 4XLCA 2EILH 3VYSB 1N77A 3ZQCA 4CXFA 5EJCA 2JRMA 4G7HF 2FUG2 3UR3C 3LSPA 4E70A 1O3RA 4B09A 1A5JA 5FKLA 5J3LA 3QYFA 4ENKA 4EJOA 4ENNA 3G1OA 2EFWA 5EG0A 1JHHA 1MJBA 1XMKA 5E20A 4OIQF 5HVQC 1S3JA 2RN7A 4EM0B 1SC7A 2D1VA 3HIFA 1K61A 1K7AA 5E3MA 4UY8I 3HSRA 1YIJI 3S1QJ 3R60A 2LNBA 4YRVA 5CVJA 1T08B 2L01A 4B3XA 1K78A 2LH9A 3ISPA 2BY0A 4HV5A 2LKPA 1XTAA 3MZHA 3IHUA 3I55I 1IJWC 2LC2A 1T0FA 4U7DA 1QHHD 3TW6A 2KFDA 2H1KA 1CQTA 5CJ9A 3G6EI 2OBPA 1APLC 4GRIA 5GPCA 3LSJA 1XPXA 4OIRF 4ESJA 5CVRA 4HNTA 3EUHC 5HDGA 4IRHA 1T56A 4LIUA 1JJ6C 1VQNI 2F4IA 2HFHA 3BCAA 2H1LA 3S17J 4B3AA 1UHSA 2GWRA 2MYSA 2K7LA 4CUGA 4KITB 1YHQI 3GX4X 2X1DA 5GAHJ 1MBHA 2OTJI 4ETSA 5L3FA 1IF1A 5J4VA 5HS8A 1RUOA 1DPUA 5K7HA 1LDDA 2BXYA 3IH3A 4A3IJ 4JX6A 3HOSA 1UG0A 4DYCA 1U5TA 3RZDJ 2L3DA 4BQAA 3WTXC 3ZQLA 2PG4A 4A0ZA 5F0FA 2YPRA 5C3EJ 3CCVI 2XV4S 3TP0A 2NNNA 4L5EA 3OYKA 3T5XA 2WB1N 4FISA 2E19A 3F0CA 4G6DA 2LDUA 3F22A 2HOTA 1KYWA 1X4PA 3H92A 2EIJH 4DZPA 3MEXA 2NVQJ 2Y30A 3N97A 1J5YA 3E5UA 4A3CJ 2QQ9A 3GZ6A 3HXLA 4CZCA 2O6GE 4G7ZF 3ROUA 2R7RA 3HBLA 2RREA 4UXNA 1R4NB 5HLTA 3CCEI 1EF4A 1KQ0A 3TDUC 1IO2A 3KCCA 5EEGA 3HRTA 1QBJA 2HYFA 3FMQA 2FNPA 2FXAA 1LEAA 3HHHA 2DFHA 4PUSA 4MLOA 3M4OJ 3ECHA 5LFAA 4IQJA 1YJWI 2IS1A 2FBIA 1OMIA 2XAFA 2H6CA 1LB2A 2GIVA 4W1UA 4DZJA 2GQQA 3LSHA 5GTIC 1K6OA 2K3PA 1LFPA 4BBSJ 2EA4A 4IHXA 1AOYA 4RM3A 2EZKA 1J59A 2DFEA 4EGYA 2E1MC 4QPQA 2V1UA 4HBLA 4DBRA 3RIRA 2H8RA 3RI4A 4HSRA 2QSHX 3KX2A 2DQRA 3GUDA 2W82A 1HDDC 1BW6A 1YE9A 5BS6A 4F91B 2P7VB 4I0AA 4YFXF 5FLXZ 2P4WA 5ICEA 3COAC 1QQIA 4XLFA 2Y9YA 3ZQHA 4E7ZA 1C0WA 3HOUJ 2QKLB 2NNYA 2JSPA 2O03A 3I64A 4FCYA 3KLNA 3S1NJ 3ASOH 5J40A 4KYWA 3CUOA 1AU7A 3ABKH 1S5LC 3HGGA 3OWTA 4HF0A 3HUGA 4KIGA 2WWYA 2VL8A 2DDAA 4GCVA 4J19A 1QPIA 3CZ6A 3KZZA 2QVOA 1KYZA 2FD5A 1WGXA 3ULQB 4A3KJ 1YJ9I 2CMPA 1Q1HA 3IAS2 3L2UA 4L0YB 2FF4A 3F8NA 3G2BA 3OIPA 1WCMJ 3A4CA 2RQQA 1F1ZA 1HW1A 3S2HJ 2NVYJ 4IEJA 4YIFA 4Q47A
chains in the Genus database with same CATH topology
2HYJA 5FKKA 2ECCA 5FLVA 2DMPA 4X6AJ 1ZR2A 1PUFA 2R5ZB 3I4MJ 1JKRC 1ETXA 2JA8J 2LVSA 5GP9A 4EEFG 2D5VA 1F43A 1POGA 3SDGA 3A02A 1LE8A 5M5WJ 5E3NA 3W6VA 3A01A 1IDZA 1ETQA 2O8KA 3BG9A 4D5CA 1BA5A 2IBDA 2DA2A 1Y1VJ 2DA1A 5EDNA 1TWFJ 4NDLA 5EG0B 1AHDP 3GTJJ 1HCRA 1RETA 4C3JJ 2O7OA 2AHQA 5IP9J 1B72B 2L0KA 5F0HA 3Q0WA 2E2JJ 1LFUP 2TRTA 3RQIA 1IG7A 3BR0A 2R0QC 3GTKJ 1AKHB 3WHCA 4XICA 3K2AA 1JKQC 1TC3C 5IYBJ 1Z0XA 2LK2A 5C4JJ 1E3OC 1VF9A 1QVUA 5F08A 3RZOJ 1IDYA 1HLVA 4DYQA 4IHWA 2E2IJ 4JYKA 3HOYJ 1SANA 5IPAA 1K83J 4FE7A 1RKWA 4QSHA 1UG2A 3G1LA 3BTJA 1B8IB 2L7ZA 3TP3A 2OPTA 5IOZA 1JT0A 1RKTA 3MVPA 1T33A 1LE8B 1I6HJ 2KT0A 1O4XA 4W97A 2DA6A 3QPSA 2GM4A 1HF0A 2X6OA 2DMQA 2X48A 3M3YJ 5FKOA 3O8HA 1VI0A 1MSEC 1VNDA 1ZQ3P 2JMWA 3NAUA 4C2MJ 1U9NA 1TWCJ 2Y2ZA 3HOVJ 2E2HJ 3WHBA 3FIWA 3S14J 1TWAJ 3HGYA 1RR7A 2KDZA 1JJ8C 2R92J 2MGQA 2XPWA 1ITYA 3MKLA 9ANTA 4M6VA 5M5YJ 1IGNA 1FTZA 4QIWN 3G1MA 2HXOA 5M3FJ 1GUUA 4XRMA 4BXXJ 1WH7A 2K40A 3GTGJ 2HDDA 5IP7J 3MN2A 1NK3P 4M3DA 4IHVA 3PO2J 1ORKA 1ZK8A 2R5YB 3LOCA 1GV2A 1YRNA 2CQQA 2VUMJ 1DU6A 4M3FA 1OCPA 1U9OA 5IYDJ 3ZQFA 4A3JJ 5F0CA 5IOYA 1X2NA 3GTOJ 5C44J 5FKNA 3BR3A 5FLMJ 4CYCB 1ETVA 2EZLA 2FJ1A 2ID3A 4LOCA 3BTIA 1JUPA 5IP6A 1IC8A 1GDTA 1JT6A 3GTQJ 1XC5A 2JJ7A 3PM1A 5K7FA 2DA5A 1OCTC 2O9LA 3H3VK 2L9RA 4AYBN 4M3EA 2LTPA 2LR8A 1MH3A 2DTZA 3DEWA 3OIOA 3ZQGA 4JX4A 3JRHA 4G12A 1X58A 3TEDA 5E3OA 4IHYA 3HDDA 1NTCA 2HQ5A 2W48A 1VFCA 1UMQA 2ZB9A 4FE4A 2K9QA 3NARA 1JUSA 2XPUA 2QF7A 3DCFA 5J1RA 4BY1J 5DS9A 3BR5A 1BL0A 2EH3A 3Q3SA 3BQYA 1JTYA 3HKZN 4XRSG 1BJZA 2LD5A 4A93J 4RDUA 3HOWJ 5IYCJ 2CUFA 4BBRJ 2OF7A 5JLXA 2QCOA 1HDPA 1MBKA 3Q0VA 2MSYA 3S15J 1SFOJ 2XPVA 3HB9A 2PMZN 1Q1VA 1GVDA 4C3IJ 3HOZJ 3BT9A 3QQAA 2L7MP 3OOUA 1ZGWA 1QRYA 4XK4A 1WH5A 1JGGA 3S1RJ 2VPRA 3TW7A 3BR6A 2NOGA 3LSGA 3PO3J 3SFIA 4DW6A 2JK3A 4GFBA 1I3QJ 1BW5A 5FKMA 2Y31A 2JA6J 2X9DA 3IV5A 2HOSA 2JA5J 4RBOA 1FIAA 1I50J 3IH4A 1W0UA 2K9SA 1Y1WJ 3IH2A 5DTDA 4UUSA 1PUFB 1DU0A 2EZHA 2ME6A 4D7NA 2XGCA 1U78A 2L7FP 1A6IA 4D5FA 2XB0X 2FX0A 5EYRA 1IUFA 2VKVA 1FEXA 1XS9A 3OSFA 1W0TA 3BR1A 3A01B 3ZOBA 2LP0A 4A3BJ 4A3GJ 3Q0UA 1H88C 2ID6A 5HODA 2CQXA 2GLOA 4BY7J 2M8GX 5EGOA 5E3LA 1RPWA 1GT0C 5F1JA 2LLKA 1P7IA 1TWGJ 5EF6A 1MBEA 2R93J 2WV1A 4I76A 1ETOA 3JRIA 2DMUA 2FQ4A 2WAQN 2K9NA 2M2EA 5EZHA 1XG1A 2M0CA 2ELKA 1JTXA 3S2DJ 3A03A 2YS9A 4MFDA 4MO7A 1MNMC 2YUSA 3UKGA 2R5ZA 3JRCA 2XSDC 1HOMA 3HOXJ 1ZTRA 4I6ZA 3ZQCA 4C3HJ 3LSPA 2RAEA 2NS8A 2G0EA 1A5JA 1H8AC 5FKLA 5J3LA 2DA7A 2DN0A 1F36A 4AC0A 1H89C 4QTRA 3G1OA 5EG0A 3BR2A 4B1RA 3JRBA 1MH4A 5JLWA 3I4NJ 3FISA 3FK7A 1JKPC 3ZQIA 3S16J 1B72A 3S1MJ 1K61A 1ENHA 5E3MA 3S1QJ 3JRGA 1AKHA 1D5YA 3JREA 5J1YA 4D7MA 1MBJA 1IJWC 1G2HA 3TW6A 2VI6A 1R9TJ 1MBFA 2H1KA 1CQTA 2LKXA 1APLC 2JWTA 5GPCA 3LSJA 3CQZJ 4JX5A 5F04A 3LSRA 1T56A 1YRNB 1IV6A 1JJ6C 3S17J 4B3AA 2LFBA 1UHSA 2I10A 1OFCX 4BKXA 3GTPJ 5BNGA 1B8IA 1ZKGA 2NVXJ 2B63J 2DJNA 1MBHA 1ZR4A 3BG3A 4Y7NJ 4S0HB 2Y9ZA 2R7ZJ 3CMYA 2TCTA 3GBGA 2YU9J 5K7HA 5EEAA 3E7LA 3B6CA 3IH3A 4Y52J 4UUTA 4A3IJ 4JX6A 1P7JA 5EZGA 4DYRA 2XB5A 4DYCA 3RZDJ 3BTCA 4JP0A 1WPKA 1QVTA 3ZQLA 2CJJA 2N8GA 2JA7J 4A69C 5F0FA 5C3EJ 2XRLA 4MIMA 3TP0A 3BG5A 4L5EA 4XRSA 4V2GA 2WB1N 3O8GA 2P81A 4FISA 2E19A 3F0CA 2HOTA 4MFEA 1TWHJ 3B6AA 3JR9A 4DZPA 2VKEA 4ABZA 1S7EA 3BTLA 2NVQJ 2Y30A 5M5XJ 2IAIA 1GV5A 3CCYA 2R5YA 4A3CJ 4A3FJ 2GBYA 1FJLA 5F27A 3HBLA 4HNVA 1EF4A 3GTLJ 2MW8A 3C2BA 3QPLA 2COBA 1OJLA 2Y0SN 1RESA 3HEFA 2M9HA 5M3MJ 1LFBA 4CYCA 2XGDA 3H0GJ 2DMNA 5J1UA 4MLOA 2MG4A 3M4OJ 2E1OA 2XGEA 1JKOC 3SJMA 3D1NI 3GTMJ 4M3GA 5C4XJ 1ETYA 4DZJA 2HXIA 4W1UA 2IEKA 4BBSJ 3FK6A 4IHXA 1FIPA 4X1EA 2EZKA 1U8BA 1JUMA 4M3BA 3RKQA 2HOAA 2DA3A 3JRDA 4AUXA 2H8RA 2EBIA 2LY9A 4A3MJ 1FTTA 4UUSB 1HDDC 3CDLA 1BW6A 2NS7A 4FTHA 3BQZA 4A3EJ 1WI3A 3ZQHA 2Y9YA 3HOUJ 2EQRA 2ECBA 4A3LJ 2DA4A 2M34A 2EZIA 3K7AJ 3VPRA 1ETWA 4FCYA 3OSGA 3S1NJ 2HI3A 5FJ8J 5K7ZA 2AO9A 4V2FA 5EGOB 1AU7A 3L1PA 3HGGA 2DMTA 1ETKA 3FKIJ 1MBGA 3JRFA 2NVTJ 2JN6A 4J19A 2CRGA 4B4CA 1QPIA 3JRAA 2CU7A 2CUEA 2FD5A 1WGXA 1X2MA 4A3KJ 3LNQA 3HM5A 4A3DJ 5GPAA 1IRZA 4XIDA 1WCMJ 1Z77A 2ME0A 3S2HJ 2NVYJ 1NK2P 4IEJA 1MSFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HYJ A;  5FKK A;  2ECC A;  5FLV A;  2DMP A;  4X6A J;  1ZR2 A;  1PUF A;  2R5Z B;  3I4M J;  1JKR C;  1ETX A;  2JA8 J;  2LVS A;  5GP9 A;  4EEF G;  2D5V A;  1F43 A;  1POG A;  3SDG A;  3A02 A;  1LE8 A;  5M5W J;  5E3N A;  3W6V A;  3A01 A;  1IDZ A;  1ETQ A;  2O8K A;  3BG9 A;  4D5C A;  1BA5 A;  2IBD A;  2DA2 A;  1Y1V J;  2DA1 A;  5EDN A;  1TWF J;  4NDL A;  5EG0 B;  1AHD P;  3GTJ J;  1HCR A;  1RET A;  4C3J J;  2O7O A;  2AHQ A;  5IP9 J;  1B72 B;  2L0K A;  5F0H A;  3Q0W A;  2E2J J;  1LFU P;  2TRT A;  3RQI A;  1IG7 A;  3BR0 A;  2R0Q C;  3GTK J;  1AKH B;  3WHC A;  4XIC A;  3K2A A;  1JKQ C;  1TC3 C;  5IYB J;  1Z0X A;  2LK2 A;  5C4J J;  1E3O C;  1VF9 A;  1QVU A;  5F08 A;  3RZO J;  1IDY A;  1HLV A;  4DYQ A;  4IHW A;  2E2I J;  4JYK A;  3HOY J;  1SAN A;  5IPA A;  1K83 J;  4FE7 A;  1RKW A;  4QSH A;  1UG2 A;  3G1L A;  3BTJ A;  1B8I B;  2L7Z A;  3TP3 A;  2OPT A;  5IOZ A;  1JT0 A;  1RKT A;  3MVP A;  1T33 A;  1LE8 B;  1I6H J;  2KT0 A;  1O4X A;  4W97 A;  2DA6 A;  3QPS A;  2GM4 A;  1HF0 A;  2X6O A;  2DMQ A;  2X48 A;  3M3Y J;  5FKO A;  3O8H A;  1VI0 A;  1MSE C;  1VND A;  1ZQ3 P;  2JMW A;  3NAU A;  4C2M J;  1U9N A;  1TWC J;  2Y2Z A;  3HOV J;  2E2H J;  3WHB A;  3FIW A;  3S14 J;  1TWA J;  3HGY A;  1RR7 A;  2KDZ A;  1JJ8 C;  2R92 J;  2MGQ A;  2XPW A;  1ITY A;  3MKL A;  9ANT A;  4M6V A;  5M5Y J;  1IGN A;  1FTZ A;  4QIW N;  3G1M A;  2HXO A;  5M3F J;  1GUU A;  4XRM A;  4BXX J;  1WH7 A;  2K40 A;  3GTG J;  2HDD A;  5IP7 J;  3MN2 A;  1NK3 P;  4M3D A;  4IHV A;  3PO2 J;  1ORK A;  1ZK8 A;  2R5Y B;  3LOC A;  1GV2 A;  1YRN A;  2CQQ A;  2VUM J;  1DU6 A;  4M3F A;  1OCP A;  1U9O A;  5IYD J;  3ZQF A;  4A3J J;  5F0C A;  5IOY A;  1X2N A;  3GTO J;  5C44 J;  5FKN A;  3BR3 A;  5FLM J;  4CYC B;  1ETV A;  2EZL A;  2FJ1 A;  2ID3 A;  4LOC A;  3BTI A;  1JUP A;  5IP6 A;  1IC8 A;  1GDT A;  1JT6 A;  3GTQ J;  1XC5 A;  2JJ7 A;  3PM1 A;  5K7F A;  2DA5 A;  1OCT C;  2O9L A;  3H3V K;  2L9R A;  4AYB N;  4M3E A;  2LTP A;  2LR8 A;  1MH3 A;  2DTZ A;  3DEW A;  3OIO A;  3ZQG A;  4JX4 A;  3JRH A;  4G12 A;  1X58 A;  3TED A;  5E3O A;  4IHY A;  3HDD A;  1NTC A;  2HQ5 A;  2W48 A;  1VFC A;  1UMQ A;  2ZB9 A;  4FE4 A;  2K9Q A;  3NAR A;  1JUS A;  2XPU A;  2QF7 A;  3DCF A;  5J1R A;  4BY1 J;  5DS9 A;  3BR5 A;  1BL0 A;  2EH3 A;  3Q3S A;  3BQY A;  1JTY A;  3HKZ N;  4XRS G;  1BJZ A;  2LD5 A;  4A93 J;  4RDU A;  3HOW J;  5IYC J;  2CUF A;  4BBR J;  2OF7 A;  5JLX A;  2QCO A;  1HDP A;  1MBK A;  3Q0V A;  2MSY A;  3S15 J;  1SFO J;  2XPV A;  3HB9 A;  2PMZ N;  1Q1V A;  1GVD A;  4C3I J;  3HOZ J;  3BT9 A;  3QQA A;  2L7M P;  3OOU A;  1ZGW A;  1QRY A;  4XK4 A;  1WH5 A;  1JGG A;  3S1R J;  2VPR A;  3TW7 A;  3BR6 A;  2NOG A;  3LSG A;  3PO3 J;  3SFI A;  4DW6 A;  2JK3 A;  4GFB A;  1I3Q J;  1BW5 A;  5FKM A;  2Y31 A;  2JA6 J;  2X9D A;  3IV5 A;  2HOS A;  2JA5 J;  4RBO A;  1FIA A;  1I50 J;  3IH4 A;  1W0U A;  2K9S A;  1Y1W J;  3IH2 A;  5DTD A;  4UUS A;  1PUF B;  1DU0 A;  2EZH A;  2ME6 A;  4D7N A;  2XGC A;  1U78 A;  2L7F P;  1A6I A;  4D5F A;  2XB0 X;  2FX0 A;  5EYR A;  1IUF A;  2VKV A;  1FEX A;  1XS9 A;  3OSF A;  1W0T A;  3BR1 A;  3A01 B;  3ZOB A;  2LP0 A;  4A3B J;  4A3G J;  3Q0U A;  1H88 C;  2ID6 A;  5HOD A;  2CQX A;  2GLO A;  4BY7 J;  2M8G X;  5EGO A;  5E3L A;  1RPW A;  1GT0 C;  5F1J A;  2LLK A;  1P7I A;  1TWG J;  5EF6 A;  1MBE A;  2R93 J;  2WV1 A;  4I76 A;  1ETO A;  3JRI A;  2DMU A;  2FQ4 A;  2WAQ N;  2K9N A;  2M2E A;  5EZH A;  1XG1 A;  2M0C A;  2ELK A;  1JTX A;  3S2D J;  3A03 A;  2YS9 A;  4MFD A;  4MO7 A;  1MNM C;  2YUS A;  3UKG A;  2R5Z A;  3JRC A;  2XSD C;  1HOM A;  3HOX J;  1ZTR A;  4I6Z A;  3ZQC A;  4C3H J;  3LSP A;  2RAE A;  2NS8 A;  2G0E A;  1A5J A;  1H8A C;  5FKL A;  5J3L A;  2DA7 A;  2DN0 A;  1F36 A;  4AC0 A;  1H89 C;  4QTR A;  3G1O A;  5EG0 A;  3BR2 A;  4B1R A;  3JRB A;  1MH4 A;  5JLW A;  3I4N J;  3FIS A;  3FK7 A;  1JKP C;  3ZQI A;  3S16 J;  1B72 A;  3S1M J;  1K61 A;  1ENH A;  5E3M A;  3S1Q J;  3JRG A;  1AKH A;  1D5Y A;  3JRE A;  5J1Y A;  4D7M A;  1MBJ A;  1IJW C;  1G2H A;  3TW6 A;  2VI6 A;  1R9T J;  1MBF A;  2H1K A;  1CQT A;  2LKX A;  1APL C;  2JWT A;  5GPC A;  3LSJ A;  3CQZ J;  4JX5 A;  5F04 A;  3LSR A;  1T56 A;  1YRN B;  1IV6 A;  1JJ6 C;  3S17 J;  4B3A A;  2LFB A;  1UHS A;  2I10 A;  1OFC X;  4BKX A;  3GTP J;  5BNG A;  1B8I A;  1ZKG A;  2NVX J;  2B63 J;  2DJN A;  1MBH A;  1ZR4 A;  3BG3 A;  4Y7N J;  4S0H B;  2Y9Z A;  2R7Z J;  3CMY A;  2TCT A;  3GBG A;  2YU9 J;  5K7H A;  5EEA A;  3E7L A;  3B6C A;  3IH3 A;  4Y52 J;  4UUT A;  4A3I J;  4JX6 A;  1P7J A;  5EZG A;  4DYR A;  2XB5 A;  4DYC A;  3RZD J;  3BTC A;  4JP0 A;  1WPK A;  1QVT A;  3ZQL A;  2CJJ A;  2N8G A;  2JA7 J;  4A69 C;  5F0F A;  5C3E J;  2XRL A;  4MIM A;  3TP0 A;  3BG5 A;  4L5E A;  4XRS A;  4V2G A;  2WB1 N;  3O8G A;  2P81 A;  4FIS A;  2E19 A;  3F0C A;  2HOT A;  4MFE A;  1TWH J;  3B6A A;  3JR9 A;  4DZP A;  2VKE A;  4ABZ A;  1S7E A;  3BTL A;  2NVQ J;  2Y30 A;  5M5X J;  2IAI A;  1GV5 A;  3CCY A;  2R5Y A;  4A3C J;  4A3F J;  2GBY A;  1FJL A;  5F27 A;  3HBL A;  4HNV A;  1EF4 A;  3GTL J;  2MW8 A;  3C2B A;  3QPL A;  2COB A;  1OJL A;  2Y0S N;  1RES A;  3HEF A;  2M9H A;  5M3M J;  1LFB A;  4CYC A;  2XGD A;  3H0G J;  2DMN A;  5J1U A;  4MLO A;  2MG4 A;  3M4O J;  2E1O A;  2XGE A;  1JKO C;  3SJM A;  3D1N I;  3GTM J;  4M3G A;  5C4X J;  1ETY A;  4DZJ A;  2HXI A;  4W1U A;  2IEK A;  4BBS J;  3FK6 A;  4IHX A;  1FIP A;  4X1E A;  2EZK A;  1U8B A;  1JUM A;  4M3B A;  3RKQ A;  2HOA A;  2DA3 A;  3JRD A;  4AUX A;  2H8R A;  2EBI A;  2LY9 A;  4A3M J;  1FTT A;  4UUS B;  1HDD C;  3CDL A;  1BW6 A;  2NS7 A;  4FTH A;  3BQZ A;  4A3E J;  1WI3 A;  3ZQH A;  2Y9Y A;  3HOU J;  2EQR A;  2ECB A;  4A3L J;  2DA4 A;  2M34 A;  2EZI A;  3K7A J;  3VPR A;  1ETW A;  4FCY A;  3OSG A;  3S1N J;  2HI3 A;  5FJ8 J;  5K7Z A;  2AO9 A;  4V2F A;  5EGO B;  1AU7 A;  3L1P A;  3HGG A;  2DMT A;  1ETK A;  3FKI J;  1MBG A;  3JRF A;  2NVT J;  2JN6 A;  4J19 A;  2CRG A;  4B4C A;  1QPI A;  3JRA A;  2CU7 A;  2CUE A;  2FD5 A;  1WGX A;  1X2M A;  4A3K J;  3LNQ A;  3HM5 A;  4A3D J;  5GPA A;  1IRZ A;  4XID A;  1WCM J;  1Z77 A;  2ME0 A;  3S2H J;  2NVY J;  1NK2 P;  4IEJ A;  1MSF C; 
#chains in the Genus database with same CATH topology
 1RR8 C;  3OMY A;  2EFQ A;  4HYE A;  4XM3 A;  2IGO A;  4RGR A;  2GXG A;  1ZR2 A;  2M3A A;  4E7I A;  2R5Z B;  5H6Q A;  3I4M J;  1R7J A;  1JKR C;  4EEF G;  3SDG A;  1LE8 A;  5M5W J;  4M9X A;  1YS7 A;  1ETQ A;  5DYM A;  4D5C A;  1Z6T A;  4Y17 A;  1BA5 A;  3FWE A;  4AM3 A;  1A6Q A;  1ERD A;  4XSX F;  2DA1 A;  5EDN A;  1R00 A;  2DT6 A;  2LBF A;  1I1G A;  2CV0 A;  1TWF J;  5EG0 B;  3MKZ A;  3GTJ J;  3HRS A;  1RET A;  4G8X A;  1FYK A;  5B5E C;  2XHK A;  5AIQ A;  2L0K A;  3Q0W A;  1BN5 A;  2O5R A;  2D1H A;  4HX8 A;  1IG7 A;  2QEN A;  4UVC A;  4RS8 A;  3KYL A;  4XIC A;  5H20 A;  1K78 B;  1JKQ C;  1YFH A;  2YX7 A;  1Z0X A;  2DT7 B;  3E5Q A;  2H27 A;  3OYG A;  1A04 A;  3W2W A;  3RYP A;  3K70 D;  4LLN A;  3CO7 C;  3OYM A;  5E8I A;  4BAC A;  4X0G A;  5B3S H;  1E2X A;  2XRN A;  1OYI A;  1MDM A;  3AG1 H;  2M1B A;  2AQE A;  1SMT A;  3GO5 A;  3LST A;  1L3L A;  3TP3 A;  2Z9O A;  5LLQ A;  1R1V A;  3HSF A;  2OPT A;  1DPR A;  1RI7 A;  2P5K A;  5FRO A;  4B43 A;  3MVP A;  5FFX A;  3K1P A;  4DNC A;  2M30 A;  2GM4 A;  1WJA A;  4NQW A;  4LIT A;  1V54 H;  1KGS A;  2JMW A;  3NAU A;  2E7X A;  2VBZ A;  1U5T B;  2PFB A;  3WU0 A;  3HOV J;  2E2H J;  3WHB A;  3CLQ A;  3SZP A;  3MAJ A;  5KK1 A;  4K2E A;  1SVM A;  1TWA J;  3HGY A;  1RR7 A;  2KDZ A;  4BHP A;  1JJ8 C;  4I2O A;  3J7A O;  2RQP A;  3ZQ7 A;  2EIN H;  4R1H A;  2MGQ A;  1UB9 A;  1G3W A;  2M0M A;  4ZZD A;  3KEO A;  2XPW A;  3DTK A;  5GAD J;  1FX7 A;  3LFU A;  4BS9 A;  9ANT A;  5M5Y J;  1KU3 A;  1IGN A;  5JHU A;  5M3F J;  2HXO A;  2VE9 A;  3DFG A;  1TT5 B;  5E8G A;  5D5U B;  2O8X A;  3K4M A;  4WWC A;  2HDD A;  2LRE A;  2DOE A;  5IP7 J;  1ZEL A;  4IOC F;  1Z05 A;  4RMN A;  1YRN A;  1SD5 A;  1MNE A;  1FT9 A;  2HYG D;  4L9T A;  5LHI A;  2FSW A;  3M8E A;  3K70 C;  3DU5 A;  2XKP A;  1T6S A;  2M87 A;  2RDP A;  4UB8 C;  5C44 J;  1S72 I;  2XF6 A;  1B6A A;  2CS3 A;  3BR3 A;  3CUQ C;  3OYF A;  3I9V 2;  1WJD A;  3M1C A;  4HG2 A;  4M9Z A;  4EJT A;  1ETV A;  2BXZ A;  2XAJ A;  3TQN A;  1LNW A;  3BRO A;  4PJ0 C;  1K79 A;  2CUZ A;  4D1Q A;  1JHF A;  2ZXH A;  5K5R A;  2QM3 A;  1USS A;  3SQN A;  2L4M A;  3EPZ A;  4PZJ A;  2Z33 A;  3IUO A;  3PM1 A;  2DA5 A;  1BBY A;  2CWE A;  1G8X A;  4MNU A;  2Y48 A;  4KIS A;  2DYR H;  3ZPL A;  1XCB A;  3OIO A;  3DF8 A;  1TP4 A;  3JRH A;  3OYH A;  1SEU A;  4G9Y A;  1X58 A;  3GVA A;  5E3O A;  2VQG A;  3MZ8 A;  4IHY A;  3EQL F;  3HDD A;  4P9U A;  1VFC A;  1UMQ A;  2ZB9 A;  2K9Q A;  2TDX A;  3GME A;  1VQ6 I;  1BIA A;  1TTY A;  5B1A H;  1BL0 A;  1JI8 A;  2HZD A;  4BE0 A;  1UHW A;  4D0P A;  3HOW J;  1WJE A;  4BBR J;  4BYY A;  3F9K A;  3RDI A;  2QCO A;  1MBK A;  3FZV A;  2XPV A;  4EAT A;  4BDY A;  1Q1V A;  3HOZ J;  3QQA A;  3FHN A;  2K9M A;  2L7M P;  4RLQ A;  4XK4 A;  3VDX A;  2A68 F;  1JGG A;  3S1R J;  2B7E A;  2VPR A;  2M5W A;  4BHB A;  1WQ2 A;  4BL0 B;  3R0A A;  3LSG A;  1X19 A;  4GFB A;  3AL0 C;  2MD0 A;  3GYH X;  1BW5 A;  2Y31 A;  5FD5 A;  3SZG A;  1SMY F;  1OR7 C;  1EKE A;  2VKD A;  2V26 A;  2HOS A;  2JA5 J;  1YYV A;  2JUC A;  5LEJ A;  1Y1W J;  5DTD A;  4UUS A;  2ISZ A;  1DU0 A;  1G4D A;  2F5V A;  5FO5 A;  3LL7 A;  1GXQ A;  1A6I A;  1Y0U A;  5EYR A;  1A35 A;  4CCJ A;  2BZT A;  3ZOB A;  2KRH A;  2EA2 A;  1RC9 A;  1T98 A;  1V3F A;  5DUK A;  4Y3O A;  4FX4 A;  2EJR A;  3FDY A;  4HDU A;  2ID6 A;  4ENM A;  3E6B A;  2LBF B;  2E36 A;  3L7W A;  1HW5 A;  2M8G X;  3CCL I;  4U88 A;  2DI3 A;  1RUN A;  3ERM A;  5LEK A;  3SDB A;  3S3O A;  1R49 A;  5DV5 A;  2ESH A;  4NC7 A;  5EF6 A;  2OTL I;  4I76 A;  3CC7 I;  5F1R A;  2IGM A;  2MFZ A;  2OQG A;  2FQ4 A;  3E6D A;  5TGT A;  3W2A A;  4EVI A;  2EV5 A;  4H4K C;  2AXL A;  2VOO A;  2K9N A;  3W6K B;  5J4Y A;  5EZH A;  4F3Q A;  1BI0 A;  1HST A;  3JTH A;  2ELK A;  3CMM A;  1MZB A;  1R4M B;  1YIT I;  3A03 A;  1FY7 A;  3L2Q A;  2Y75 A;  3GWZ A;  4MO7 A;  3JAM Z;  2YUS A;  1MNM C;  5DCF A;  3UKG A;  3GF2 A;  5BPI A;  1BJA A;  2H94 A;  3HL2 A;  2A5Y B;  3VOE A;  2VBY A;  5A2Q K;  2IS4 A;  2XSD C;  4OAZ A;  3OYC A;  1FMW A;  1HOM A;  2WY7 Q;  1Y56 A;  3CP8 A;  5LRR A;  4BDZ A;  1LDK B;  4ZDP A;  4C3H J;  2LF8 A;  2LRD A;  1D8K A;  1NG7 A;  2HVR A;  2G0E A;  5J47 A;  3V7S A;  4U87 A;  3G71 I;  4MHG A;  4GGG A;  4NQW B;  4HQE A;  3TOA A;  1WFX A;  1MH4 A;  3FK7 A;  1JKP C;  2EIK H;  3ZQI A;  5LGN A;  3HZJ A;  2ZSI B;  1ENH A;  3PFI A;  5IT9 Z;  2A05 A;  4A2U A;  2BY3 A;  5J1Y A;  5DM7 F;  2UXX A;  1MBJ A;  3ZMU A;  3L00 A;  1D1B A;  4E7S A;  2VAS A;  2DBB A;  1G2H A;  1R9T J;  1MBF A;  2ZFW A;  1OCO H;  3TOB A;  5GTH C;  3I58 A;  4NUB A;  2D45 A;  1G3T A;  2JVG A;  1QHG A;  4JX5 A;  3AG4 H;  4HA8 A;  3LSR A;  2LG4 A;  1XN7 A;  1O57 A;  1ACI A;  2WAE A;  1YRN B;  1O7F A;  2XF7 A;  2R3S A;  2LFB A;  5HLG A;  2I10 A;  3HC7 A;  3CMA I;  1WJF A;  1PP8 F;  5LGT A;  1LDJ A;  2VN2 A;  3I53 A;  5LGU A;  1E0E A;  1RIO H;  2QWW A;  3BG3 A;  4Y7N J;  2R7Z J;  1HW2 A;  4UUV A;  3CMY A;  3I5U A;  2TCT A;  2E1N A;  4CYD A;  2YU9 J;  3E6M A;  4DJA A;  5IT3 A;  1T38 A;  3LA2 A;  1P7J A;  2P6S A;  2XB5 A;  1RRJ A;  4XN3 A;  1CGP A;  1FOY A;  5L3G A;  1QVT A;  2VJI A;  4Q4Z F;  4ZDL A;  4A69 C;  4EJV A;  3IL2 A;  3RPU D;  1MMS A;  2XRL A;  4MIM A;  2V9P A;  1G59 A;  4G6T B;  1EJ9 A;  1DDN A;  1XDU A;  3Q9V A;  1MKM A;  2VBW A;  3B6A A;  2W7N A;  4HLY A;  3LFK A;  2VKE A;  2UV1 A;  4ABZ A;  1S7E A;  1H9G A;  2ZC2 A;  4MTE A;  5M5X J;  3DPL C;  3C2H A;  4EQQ A;  2IAI A;  2DFI A;  4HPQ A;  3F6O A;  1ON2 A;  2QQA A;  2KRF A;  4KIF A;  2W57 A;  4HNV A;  1IN7 A;  2NS0 A;  4IRG A;  3HSE A;  1UHM A;  1ZAR A;  3C3W A;  3GTL J;  2CV2 A;  2J5P A;  2ZNZ A;  1IN4 A;  3HEF A;  5CQG A;  3DKY A;  5HDN A;  4NC8 A;  1LFB A;  3B73 A;  2BV6 A;  3CP2 A;  1TLH B;  2H09 A;  3FMS A;  3HOT A;  3H0G J;  2DMN A;  1ZLJ A;  4I09 A;  4IRI A;  2Q0O A;  4AIH A;  3KE2 A;  5J1U A;  2VT3 A;  3KET A;  1ZRE A;  3T1B A;  1W5T A;  2VPL A;  4BUP A;  2MG4 A;  1B9N A;  1JKO C;  3OR2 C;  3D1N I;  3QOE A;  3GTM J;  5C4X J;  5FFZ A;  3OL3 A;  1ETY A;  3H35 A;  5TJJ A;  1FIP A;  4WXD A;  1MGT A;  3OYJ A;  1JUM A;  1P2F A;  1Y6I A;  1MJ9 A;  2COM A;  4M3B A;  2E1C A;  2I8D A;  3FXR A;  4AUX A;  1SAX A;  1PJR A;  1JGS A;  2LY9 A;  3LSK A;  4XL9 A;  1FTT A;  4XLE A;  2BHY A;  4UUS B;  4I7H A;  3LAJ A;  1YO5 C;  3CC4 I;  5DD4 A;  1S7O A;  2BVM A;  2HU9 A;  4E7K A;  1FWZ A;  2NS7 A;  4LLG F;  5D4S A;  4S04 A;  4OIP F;  1Z91 A;  3FXM A;  4A3E J;  1LUJ B;  4PJJ A;  2FEZ A;  3R6S A;  1KZH A;  1U3E M;  1TT0 A;  2E1M B;  2DA4 A;  2IA2 A;  1ETW A;  4MQ9 F;  2CH0 A;  2IXS A;  3JCU C;  2HGC A;  5L3B A;  4PSX A;  2AO9 A;  4V2F A;  5K7Z A;  4UNO A;  2DMT A;  1ETK A;  4CCL A;  1O3S A;  2HNH A;  4ZYA A;  4XRF A;  3I0T A;  3BJO A;  3JRF A;  3G4S I;  2NVT J;  2JN6 A;  2CRG A;  4FQG A;  2MLG A;  3DKX A;  3NWT A;  3LA7 A;  4HZF A;  3HM5 A;  1IRZ A;  4XID A;  1QO0 D;  3P9K A;  3U1K A;  3M1E A;  3RJP A;  5LHH A;  2X4H A;  1GXP A;  2Q1Z B;  2GA1 A;  1NG6 A;  1NK2 P;  3CES A;  4L9N A;  4OIN F;  2HYJ A;  1N75 A;  4M73 A;  2FBK A;  1PUF A;  2IJL A;  5IY5 H;  4RB1 A;  3CF5 F;  1BR2 A;  2YSR A;  3L2W A;  2JA8 J;  2LVS A;  2D5V A;  3I3L A;  4U0V A;  2VIX A;  3CD6 I;  4M6Y A;  2QYO A;  3L2R A;  1T2K A;  2BHZ A;  3A01 A;  4IX7 A;  2FNA A;  1PUE E;  1VQK I;  2O8K A;  3BG9 A;  1IDZ A;  3JAM K;  1R22 A;  2IBD A;  1Y1V J;  3TO9 A;  2DK8 A;  2ZXI A;  4NDL A;  2DO7 A;  4J01 A;  2Z2S B;  2HPM A;  5F0H A;  4FT8 A;  2DU9 A;  4P96 A;  4IHT A;  3K1M A;  4NHJ A;  2TRT A;  4A0X A;  4LD5 A;  2R0Q C;  4C2U A;  2JPC A;  4IKF A;  1WZ2 A;  5IYB J;  5JVT A;  2LK2 A;  4LMY A;  1V5F A;  5C4J J;  3CDI A;  2E60 A;  3IRR A;  1MW7 A;  1LKX A;  3L2V A;  1IAW A;  3D5S C;  3VSL A;  4RB2 C;  1Y39 A;  4IHW A;  4JYK A;  3GXO A;  4CCK A;  2VJ5 A;  4CA0 A;  1L0O C;  1K83 J;  3ML6 A;  1WSU A;  4ZYE A;  3OYA A;  2NYX A;  4FE7 A;  5DDG A;  2PMZ A;  1RKW A;  1B1B A;  1OPC A;  2XAU A;  4LB5 A;  4E7L A;  1WKM A;  2QQB A;  3RQ4 A;  1Z1D A;  3SFZ A;  3VSK A;  1VQ9 I;  2ZXJ A;  3V8L A;  2X1C A;  1D0Y A;  3FM5 A;  1X1B A;  3ASN H;  3QPS A;  4PJL A;  4YFN F;  5L3D A;  3MCZ A;  2QGU A;  4XLH A;  2LY2 A;  2X6O A;  3CME I;  2DMQ A;  2JZY A;  3MZY A;  4U7B A;  5CVI A;  3Q5F A;  1MSE C;  2WA0 A;  1HKQ A;  1J75 A;  4C2M J;  3M8F A;  2DCE A;  4IQ4 A;  4OMZ A;  2K5C A;  1G6N A;  2LF7 A;  5HLH A;  2CO5 A;  3S14 J;  4G94 A;  3ZR8 X;  1FC3 A;  4PCQ A;  1ZH5 A;  1F5T A;  4Q48 A;  3T0Y A;  2I5U A;  4I01 A;  1XCV A;  4M6V A;  3L9F A;  1FTZ A;  4QIW N;  3G1M A;  4OWR B;  4XOR A;  1GUU A;  2B0L A;  3BOQ A;  3Q9S A;  1I27 A;  1R5I D;  1SFE A;  5HS7 A;  1FBS A;  4BEH A;  1YX3 A;  3CJQ B;  2K86 A;  2OU2 A;  2V6C A;  3LMM A;  1NK3 P;  4M3D A;  3PO2 J;  2KJB A;  3LOC A;  3WGG A;  2CQQ A;  3ONQ A;  3QPH A;  3F6V A;  4M3F A;  4ZYG A;  1PYV A;  5HS9 A;  1WJB A;  4KA4 A;  3ZXS A;  4L18 B;  4RM2 A;  1PDN C;  1S8N A;  1YW7 A;  4YIR X;  4L5I A;  2EPF A;  4XKW A;  1HKT A;  4II2 A;  2M4K A;  2EZL A;  1KA8 A;  2DDB A;  5KVR A;  2ID3 A;  3I59 A;  2ELH A;  3BTI A;  5DCM A;  2WBM A;  2KQR A;  2AS5 F;  1TW2 A;  2FE3 A;  1JT6 A;  4L0Z B;  3VOD A;  2VBX A;  3KP7 A;  3ZQQ A;  1XC5 A;  4XLP F;  2KIU A;  1AWC A;  3CCQ I;  1OCT C;  3J80 K;  4KFC A;  2LY1 A;  3C18 A;  3BG6 A;  3CUQ B;  4BXF A;  1K6Y A;  2LR8 A;  3BY6 A;  4U0Y A;  4UV8 A;  3R4K A;  2GXA A;  2CUJ A;  2LOO A;  5CYV A;  1Z9C A;  4HV6 A;  1O3T A;  1W7P D;  4ZZL A;  3NWS A;  1JUS A;  3GW2 A;  2QF7 A;  1VQ7 I;  2DQL A;  3DCF A;  4I99 C;  4GDF A;  1FNN A;  5DS9 A;  3BR5 A;  4XNF A;  2M7B A;  4YEL A;  3HRU A;  3Q3S A;  1OIS A;  2KRC A;  1JTY A;  2X1E A;  2BEO A;  3MWM A;  2LYC A;  3A0H C;  2LD5 A;  4A93 J;  3K4B A;  5IYC J;  4J00 A;  1J2X A;  2CUF A;  2CYY A;  3RKW A;  1ZN2 A;  2L9N A;  3E5X A;  3H5A A;  1I5Z A;  2PMZ N;  4BJT A;  3EDP A;  1UFM A;  4C3I J;  3BT9 A;  5FRM A;  1I6X A;  2IS2 A;  4IOA F;  5E1Z B;  3FXQ A;  3OOU A;  3GZ5 A;  1WH5 A;  2EV6 A;  2IVM A;  2W25 A;  3KEY A;  4BE2 A;  3CCM I;  2OQR A;  3BR6 A;  2M8E A;  3I4P A;  1D5V A;  2XAH A;  4RLF A;  4XLN F;  1Z7L A;  2C6Y A;  1LJ9 A;  1I3Q J;  5FKM A;  1I1S A;  1ZG3 A;  3CDH A;  3E3V A;  3S93 A;  2JA6 J;  2UUZ A;  3IV5 A;  3HHG A;  3ABL H;  4RBO A;  1FIA A;  1G3Y A;  2E5Z A;  3S32 A;  4N4N B;  1XGM A;  4XOP A;  3RKY A;  5BOX A;  2ELJ A;  3IH2 A;  1W0U A;  1KQ9 A;  1PUF B;  2Z3Y A;  4ITV A;  2CFO A;  4PFP A;  4Z2Y A;  2PI0 A;  3FXJ A;  5CLS A;  2BE5 F;  4MEX F;  3AG3 H;  4D5F A;  2FX0 A;  4HQM A;  4UVA A;  1IUF A;  3P7N A;  4Y33 A;  1XS9 A;  3KPH A;  2HEO A;  3A01 B;  1R1T A;  3AL0 B;  2LP0 A;  3R61 A;  4E6K G;  2ZJP F;  2FML A;  3Q0U A;  1H88 C;  5HOD A;  2FU4 A;  4Q5S F;  4L9J A;  1HBX G;  2MBF A;  3LSI A;  2A61 A;  4CHU A;  1W5S A;  5E79 C;  2IGK A;  2F5E A;  2QQ8 A;  3A2K A;  1GLN A;  1RPW A;  3ESW B;  1P7I A;  4XR6 A;  1R58 A;  1MBE A;  2WV1 A;  4KIC A;  2ESN A;  3GLX A;  1YI2 I;  2IRF G;  1K4T A;  2A3S A;  2BVL A;  4CGZ A;  4HST A;  1R5H A;  2VJJ A;  1JTX A;  3P9I A;  2E34 A;  3BWG A;  3LWF A;  3M8J A;  3KFW X;  1VQ4 I;  1IXC A;  2YS9 A;  3HRM A;  4MFD A;  1STZ A;  3PSI A;  2DW4 A;  3EET A;  3GTO J;  2HZT A;  3E0J B;  3HOX J;  3CC2 I;  1WJC A;  4BHC A;  4AIK A;  4ZDO A;  2RAE A;  4XLA A;  2NS8 A;  4MQV A;  1ZG1 A;  1RZ4 A;  2FA5 A;  1X1D A;  3EUH A;  3NEU A;  1H8A C;  2DA7 A;  1H89 C;  1F36 A;  1HSJ A;  1O7L A;  4Y4R A;  1V4R A;  4QTR A;  1LEB A;  3M7G A;  2VOD A;  3T8T A;  4D9J A;  4IF4 A;  3DLL F;  1RNL A;  4B1R A;  5ICG A;  5JLW A;  3I4N J;  2KLO A;  3S16 J;  1U0J A;  2HPI A;  1EA3 A;  2F2E A;  4FET A;  3S1M J;  4FAS D;  3CF2 A;  4KIB A;  3PNV A;  3OR1 C;  3H9Q A;  1AKH A;  1D5Y A;  4CIC A;  1GVJ A;  3IRQ A;  4D7M A;  4AID A;  4GO1 A;  1DUX C;  5D5V B;  2BW3 A;  3PQK A;  2VI6 A;  3QYE A;  3PIP F;  3VFZ A;  4BEH B;  3K1N A;  1DQU A;  2LKX A;  2JWT A;  4C9Y A;  4CO8 A;  2HOE A;  3CQZ J;  4I02 A;  3G73 A;  1IV6 A;  2R7X A;  4BAY A;  2KIS A;  4BKX A;  1U2W A;  1KON A;  2ICW G;  2XVC A;  3S3N A;  5FLX K;  1D1C A;  1B8I A;  1X3W B;  1ZYR F;  1Z6R A;  3IAM 2;  4BNC A;  1UST A;  3J7Z I;  2Z1D A;  1SFX A;  4XKV A;  3I59 B;  5DCM B;  5EEA A;  2XUB A;  4HOB A;  3E7L A;  3H5N A;  4Y52 J;  4UUT A;  3TMO A;  2VJ4 A;  4DYR A;  1FP1 D;  1IRF A;  4GYI A;  3SEZ A;  2XGX A;  3EYI A;  4JP0 A;  4M9S A;  3BLY A;  1BR4 A;  4MGR A;  2JA7 J;  2DPU A;  2JUG A;  4LG3 A;  3J81 Z;  4XKC A;  4HNU A;  3BG5 A;  2R7W A;  1FOX A;  2HVQ A;  4V2G A;  1ZRC A;  1U6G A;  2CQN A;  3H3U A;  4P55 A;  2VQL A;  3K4K A;  2Y0M A;  1TWH J;  3JR9 A;  3BG7 A;  2CW8 A;  1GV5 A;  2R5Y A;  4F93 B;  2Y69 H;  4ZTJ A;  1ZRD A;  4M6X A;  4A3F J;  2EFP A;  3NRV A;  5F27 A;  2KHM A;  4OAY A;  2HR3 A;  1E3P A;  1R1U A;  3WU2 C;  1U5T C;  1LQ1 A;  2MW8 A;  3C2B A;  3QPL A;  4KT5 C;  2ISY A;  2O61 A;  3PFY A;  4N4O B;  4XN0 A;  1RES A;  1R5G A;  4KDP A;  2M9H A;  3D0S A;  1Y0N A;  2XGD A;  2V9K A;  3L2C A;  2PMU A;  5HLI A;  3F23 A;  3AG2 H;  2EWN A;  3IWZ A;  3PJR A;  2MH2 A;  3BZK A;  2OJE D;  4CSW A;  2IW5 A;  2BY1 A;  2HKO A;  5H2F C;  3SJM A;  4M3G A;  1MMD A;  3R0J A;  2IEK A;  3U1D A;  3FK6 A;  3QU3 A;  3QOP A;  3VEP A;  1U8B A;  4KJZ A;  4B44 A;  2OV7 A;  3QU6 A;  4CCM A;  3RKQ A;  2G7U A;  4MTD A;  1FYL A;  4ZH4 F;  2G7H A;  1XGO A;  2QLZ A;  3CDL A;  2WTE A;  1VQO I;  1CF7 A;  3EUK L;  4EV0 A;  3OYL A;  1G3S A;  3JW4 A;  3SZT A;  2Z16 A;  5D4R A;  1WWX A;  1TQI A;  3PIO F;  3K4N A;  4BJ6 C;  1WI3 A;  1SAU A;  5ILU A;  2PMH A;  2ECB A;  1BI3 A;  3DQV C;  3P9C A;  2F4M B;  1X4O A;  3G3Z A;  1EH6 A;  3VPR A;  2HI3 A;  5D8L B;  5FJ8 J;  2UXN A;  2ACJ A;  4CDG A;  2R7F A;  4MEY F;  3L1P A;  3T8R A;  1XB4 A;  3ZN1 A;  3QP6 A;  2A6H F;  4CCN A;  2LKS A;  3FKI J;  2NXN B;  2BY2 A;  1MBG A;  1TBX A;  2HVS A;  2F5F A;  2CU7 A;  2CUE A;  2R4G A;  1X2M A;  1UCR A;  2L54 A;  3V7C A;  2QBY A;  1XDS A;  2RGV A;  4BGD A;  2V1D A;  4Y15 A;  3H1C A;  4R8H A;  3I54 A;  2DTR A;  2CFX A;  1IRX A;  1P92 A;  1Z77 A;  3X2Q H;  2NVU B;  2JPB A;  2MA3 A;  4M71 A;  4H0E A;  2KDO A;  1S7A A;  1TQM A;  5JVG F;  5FKK A;  2QKM B;  1HA8 A;  2ECC A;  3PSF A;  5FLV A;  1DGW Y;  4X6A J;  2L2O A;  3JSO A;  3BZC A;  2V7F A;  2VC0 A;  4G6Q A;  3RSN A;  3W6J B;  1S6L A;  2F48 A;  1ETX A;  3EUA A;  5GP9 A;  3I71 A;  3KP4 A;  1YQA A;  4LG0 A;  1POG A;  1FMV A;  2VE8 A;  3A02 A;  3FXU A;  3ZP5 A;  3QPT A;  1XGN A;  2K3F A;  5HOO A;  3TKY A;  1W4M A;  4PSW A;  1A36 A;  1ZRF A;  2HQA A;  2W84 A;  1VQP I;  1SFU A;  1BM9 A;  3SXY A;  3K4L A;  2ZFU A;  4AYB A;  1S29 A;  3BJ6 A;  2QUF A;  1HCR A;  3DXJ F;  4AVZ A;  4C3J J;  3BPV A;  1P9Q C;  3DBL B;  1LFU P;  5CPR B;  2XKO A;  3RQI A;  1R23 A;  3GTK J;  1WJ5 A;  4LK1 F;  1AKH B;  3K2A A;  3W2V A;  3ZCO A;  3DP7 A;  1TC3 C;  3KLO A;  4OU0 A;  1QVU A;  2M45 A;  2BW3 B;  4KMU X;  1FOK A;  2RKH A;  3RZO J;  1IDY A;  3OYE A;  1HLV A;  4HF1 A;  3DEU A;  2DYS H;  3HKZ A;  2E2I J;  1W7P A;  1SD7 A;  2W85 A;  1SAN A;  2R7T A;  5IPA A;  2D2W A;  2ZO4 A;  2WC2 A;  2A07 F;  1VTN C;  1BIB A;  1IW7 F;  2PJP A;  2O3F A;  1OCZ H;  3QP5 A;  2WY8 Q;  1IXR C;  3G1L A;  1B8I B;  1QNT A;  5BQT A;  3AKZ A;  5JI6 A;  5IOZ A;  4EJW A;  1JT0 A;  1RKT A;  3BZ6 A;  1I6H J;  1HXD A;  2V9V A;  5D6F A;  2DA6 A;  3J7A Y;  2ZME C;  4RGU A;  4LLL A;  5FKO A;  3A0B C;  1BOA A;  1VND A;  2R7Q A;  1ZQ3 P;  2DPD A;  2WV0 A;  2BGC A;  1TWC J;  4ZC3 A;  1D0X A;  3K10 A;  3WGI A;  4FX0 A;  3FIW A;  4BXU A;  3ZRG A;  4A6D A;  2YR2 A;  4A12 A;  3H0D A;  3CUQ A;  4II3 A;  1KU2 A;  1QZY A;  1MND A;  2ETH A;  3OYI A;  1K4S A;  2OUM A;  1OYY A;  4LJZ F;  1ITY A;  1LPQ A;  2GAU A;  3IWF A;  4WK8 F;  1BC8 C;  3U21 A;  5L3E A;  4M74 A;  2STT A;  1SFK A;  1XD7 A;  2K40 A;  4YII A;  3DU6 A;  2X85 A;  4IL6 C;  4IHV A;  3J81 K;  1X1A A;  4ASN A;  5TIS C;  2EB7 A;  1ORK A;  3D5R C;  1BR1 A;  4M72 A;  2R5Y B;  1GV2 A;  3PQJ A;  2JTV A;  4JQF A;  1XSD A;  1EH8 A;  1O3Q A;  1U9O A;  1WVR A;  1YTY A;  5IYD J;  3HPG A;  4A3J J;  2CW0 F;  1QZE A;  3H9J A;  5IOY A;  1SD4 A;  5FKN A;  2VOP A;  3BCB A;  3OL4 A;  4F52 A;  1KU7 A;  1D8J A;  3WE2 A;  2KIF A;  4TV7 A;  3GFM A;  2FJ1 A;  2Q8K A;  4LOC A;  1BI1 A;  1B59 A;  3GFJ A;  1UJ8 A;  4AU7 A;  1GDT A;  5DD8 A;  3GTQ J;  2M4G A;  5ILV A;  3AFH A;  5K7F A;  4N9I A;  1WI9 A;  2L9R A;  4AYB N;  2RVC A;  3VWB A;  3SEQ A;  2LTP A;  2VC1 A;  3PNT A;  3V8K A;  1MH3 A;  2DTZ A;  3ERE D;  3ZQG A;  2VT2 A;  2B9S A;  4PJN A;  4XON A;  3WG9 A;  5D5X B;  4XMY A;  1Z3Y A;  4G12 A;  3TED A;  2EV0 A;  1CF7 B;  4HX4 A;  5ED4 A;  4HRI A;  4JBA A;  1NTC A;  2HQ5 A;  3K69 A;  4QLC U;  4FE4 A;  3CCS I;  3DTI A;  3HG9 A;  5J1R A;  2EFO A;  4BY1 J;  1OR7 A;  2EH3 A;  2Q2E A;  1DGR M;  3CJR B;  5CVV A;  5FB2 A;  1J09 A;  1XSX A;  3BQY A;  3HKZ N;  1BJZ A;  4NBQ A;  2ZXW H;  5LRS A;  4RDU A;  4ESF A;  2ZSH B;  3FBI B;  3DPT A;  3V4G A;  3Q0V A;  3S15 J;  2DOD A;  3HB9 A;  2W00 A;  2FBH A;  2L7K A;  2A69 F;  1GVD A;  4UVB A;  4IZZ A;  3F8M A;  4GYG A;  1MJA A;  2HTS A;  1IZ1 A;  4XOT A;  3D5L A;  4I0B A;  1N25 A;  3KIO A;  4BQO A;  3VYU B;  1ZGW A;  3H3Z A;  4PGG A;  1QRY A;  1IN6 A;  4QWQ A;  3FXK A;  3F72 A;  1ULY A;  1YW8 A;  4P1W A;  3FHZ A;  1J0R A;  3TW7 A;  2DLL A;  2QBY B;  3V42 A;  2Z99 A;  3ZN0 A;  2FQ3 A;  3VB2 A;  3SFI A;  1QU3 A;  1TZL A;  3OS2 A;  2AXT C;  3QOD A;  2FMY A;  3EYY A;  5IT9 K;  3OS1 A;  2E7W A;  1H9T A;  1I50 J;  3OIQ A;  4HW0 A;  4KUM A;  3AAF A;  2YX4 A;  2ME6 A;  3VYR B;  3HPH A;  1REP C;  1HKS A;  3RYR A;  3WTT C;  1U78 A;  1TNS A;  2R7O A;  1QA6 A;  2EIM H;  4LG0 B;  2XB0 X;  2CQK A;  4UV9 A;  1P6R A;  1FEX A;  3OSF A;  1YIO A;  2HQR A;  4HEA 2;  5KNL A;  2IS6 A;  4A3B J;  2FOK A;  1ON1 A;  4A3G J;  2HWV A;  1AA7 A;  4Z6Y A;  5JR3 A;  2KJC A;  2GLO A;  3WU1 B;  4BY7 J;  1P4W A;  5EGO A;  1YLF A;  4V19 K;  3HTU A;  4IHS A;  2JT1 A;  2XSJ C;  4EM2 A;  2JRT A;  3H36 A;  3GZN B;  4IXA A;  4FHT A;  1TWG J;  2P0W A;  4RAG A;  3FF5 A;  1ETO A;  3JRI A;  4S05 A;  1P4A A;  4AD9 A;  5AON A;  1J7K A;  4IJA A;  4AWX B;  1D0Z A;  2HDW A;  1XG1 A;  2M0C A;  4XKB A;  1YX5 A;  1W7P B;  2GIZ A;  3S2D J;  3PNY A;  1YG2 A;  2L4A A;  3GFL A;  4RGX A;  1SVL A;  3BPX A;  2Y0S A;  2A5W A;  1XMA A;  4ZJZ A;  4AIJ A;  3ECO A;  3IKT A;  3JRC A;  5K1Y A;  4I6Z A;  2KP6 A;  5L3C A;  3I56 I;  4ON0 A;  1IUY A;  2KIQ A;  1R6R A;  1TNT A;  3DKW A;  4WF2 A;  2CQ7 A;  1MD0 A;  3C1D A;  1FSE A;  2OCC H;  4A5N A;  2GXB A;  2VXZ A;  3LAP A;  1T39 A;  2DN0 A;  4AC0 A;  1ZAO A;  3OYN A;  2PJR A;  1D3Y A;  3BR2 A;  3JRB A;  4IVN A;  3FIS A;  1B72 A;  4NNJ A;  1E3H A;  1BC7 C;  2RC4 A;  4O5V A;  1FBU A;  3CO6 C;  4EJU A;  3JRG A;  5ICF A;  2PN6 A;  1R36 A;  2XF5 A;  3E1S A;  3KP2 A;  5D8K B;  3JRE A;  1MIJ A;  4KNY A;  2KKO A;  3KYC B;  3A1Y A;  1HQC A;  3PUF A;  4QPO A;  4E7J A;  4DBQ A;  2E35 A;  4NB5 A;  4DGW B;  4ENJ A;  2GZW A;  2P6T A;  1EV7 A;  2BOL A;  2BYV E;  2DT5 A;  2KZG A;  5F04 A;  3DLA A;  3IKV A;  3V8J A;  2HQN A;  1FOW A;  1BI2 A;  2DOA A;  4BQN A;  2O0Y A;  1E17 A;  1OFC X;  4UB6 C;  3M9A A;  3TGN A;  4CZZ A;  3GTP J;  5BNG A;  3S2W A;  3FM3 A;  1ZKG A;  2ZBK A;  2NVX J;  3GCM A;  2B63 J;  3TL4 X;  3DTE A;  1I3A A;  2DJN A;  1ZR4 A;  2Y9Z A;  4S0H B;  2VLA A;  1U8R A;  4WXH A;  3KP3 A;  3GBG A;  2HDC A;  2VON A;  4LB6 B;  2V6E A;  5CKT A;  4HF2 A;  2W24 A;  3B6C A;  3CCR I;  3MKW B;  4EM1 A;  1W5C C;  5EZG A;  5KAI C;  3IP4 B;  5K5O A;  3OYD A;  2OC6 A;  3BTC A;  5FD6 A;  2JSC A;  2P7C B;  1WPK A;  2CJJ A;  2N8G A;  5E1X A;  4AVP A;  1KU9 A;  3F8C A;  5D6E A;  1Z67 A;  4XRS A;  3K4C A;  3SYT A;  2IGN A;  3O8G A;  2P81 A;  1ZGA A;  3BDD A;  3RPQ A;  2R7S A;  2JQ7 A;  2BBY A;  2ZME A;  3N4M A;  1NHA A;  4L9V A;  4MFE A;  1FP2 A;  4PK4 A;  5A2Q Z;  1S9H A;  3BTL A;  2Z5U A;  1F4K A;  2NRA C;  4HX7 A;  2P5V A;  3ABM H;  3CCY A;  2STW A;  3KZI C;  3F21 A;  2GBY A;  1FJL A;  3DBR B;  2Q2E B;  2DK5 A;  3FBN B;  4LGW A;  1ZHF A;  3GLL A;  2OCE A;  2P8T A;  3RKX A;  3F8B A;  1DP3 A;  4CH7 A;  3O6B B;  2COB A;  1OJL A;  2Y0S N;  4F92 B;  5JFR A;  3TO7 A;  5M3M J;  2MAB A;  2E5N A;  4B47 A;  1IN5 A;  3BJA A;  3M07 A;  4CYC A;  5LD2 C;  3V7R A;  2XAS A;  4WX9 A;  5D5W B;  3RPU A;  2L9V A;  3ZGK A;  3GFI A;  1B4A A;  2IP2 A;  4CCO A;  1VQ5 I;  4PGH A;  2E1O A;  2XGE A;  4UHT A;  2CGP A;  2CV1 A;  2HXI A;  3RTR A;  2ZJR F;  4BH9 A;  2X0L A;  1IN8 A;  3NQO A;  3OOP A;  4X1E A;  1XSV A;  3KZY A;  3K6G A;  2RNG A;  1Z21 A;  2DA3 A;  2HOA A;  4YG2 F;  3JRD A;  2F4O B;  1WHU A;  2EBI A;  2A6E F;  4BQQ A;  3QAH A;  4A3M J;  2NAZ A;  2OZU A;  3S8P A;  1XX5 A;  2E71 A;  3WTY C;  2F5C A;  3KEQ A;  1VQ8 I;  1WRJ A;  1X1C A;  2JA2 A;  3DBH B;  1Z3X A;  3WTS C;  2MC4 A;  4I98 B;  4FTH A;  4A5M A;  2F6C A;  2P5L C;  4RB3 C;  2R7V A;  3BQZ A;  1GHC A;  2HTJ A;  2KL4 A;  1SVO A;  2F5D A;  2ZKZ A;  1YOV B;  2EQR A;  4A3L J;  3WTU C;  3ZMT A;  2M34 A;  2EZI A;  2V79 A;  3K7A J;  4ZYD A;  1FPQ A;  3OSG A;  1MMA A;  3PUB A;  4B8X A;  1F9N A;  2V1N A;  5EGO B;  3H5R A;  5E1W A;  3ZMD A;  3CCJ I;  3SHF A;  3N05 A;  3CCU I;  5GAE J;  3LA3 A;  5HNH A;  1W36 D;  4RAY A;  5B66 C;  4JOM A;  2QEX I;  3TDZ C;  4OMY A;  4B4C A;  5DM6 F;  3WTZ A;  3P5J A;  3JRA A;  2PEX A;  5LBQ A;  3LNQ A;  1HC8 A;  2KMU A;  2L5Q A;  3C7J A;  5GPA A;  3TO6 A;  4A3D J;  2VXD A;  3F3X A;  2LMD A;  3F8F A;  3ZMS A;  4E4H A;  1VQL I;  2ME0 A;  4O6J A;  1A31 A;  4HDV A;  2X51 A;  1X3Z B;  1R71 A;  1MSF C;  1UZC A;  2LSO A;  2DMP A;  1JXS A;  5AIP A;  2DFF A;  4A0Y A;  1M1E B;  1YJN I;  3LQR A;  3QRF F;  2L9S A;  1OYW A;  2K9L A;  3KP5 A;  1F43 A;  2H8W A;  3MMY B;  5E3N A;  1Y8R B;  5CQE A;  3W6V A;  1ZG5 A;  1ZLK A;  1PVE A;  3U9G A;  3CJT B;  4B48 A;  2DA2 A;  1T0F C;  3PL8 A;  1XMX A;  2V1X A;  3VYT B;  1T8I A;  3K4J A;  2PLY A;  2EK5 A;  2PJR B;  3BP8 A;  4EMS A;  2ZJQ F;  1AHD P;  4EGZ A;  2O7O A;  1B9M A;  1IV8 A;  2AHQ A;  2DOF A;  4LK0 F;  5IP9 J;  1B72 B;  1Z7U A;  2UZK A;  3IC7 A;  2E2J J;  2DXI A;  2K02 A;  1P4X A;  3BR0 A;  3HUG B;  4E7H A;  2PX9 A;  3WHC A;  4RAF A;  4R79 A;  1KQ8 A;  2QZ8 A;  1E3O C;  1MMG A;  1QGP A;  1VF9 A;  3LQQ A;  4KMF A;  1Y8Q B;  5F08 A;  3E6C C;  3WOD F;  1I39 A;  3LSM A;  5HDK A;  4DYQ A;  4P5O A;  5DEQ A;  1PP7 U;  4ESB A;  1QPM A;  3HOY J;  1FSH A;  4L5J A;  1W36 C;  5H6R A;  2XIG A;  3OY9 A;  5JHF A;  3W3C A;  2MD5 A;  4ANJ A;  2XAG A;  1VZ0 A;  4QSH A;  2OD5 A;  3B02 A;  1UG2 A;  3WE3 A;  3BTJ A;  2WAF A;  5ERI A;  3OS0 A;  2OAZ A;  3DEE A;  1W1W E;  1UAA A;  2L7Z A;  1QZZ A;  1V5G A;  3JTG A;  2NOJ B;  5J6X A;  1SD6 A;  1IXS B;  1T33 A;  2K4B A;  4P9F A;  1LE8 B;  1X3U A;  2KT0 A;  3FMR A;  5CVU A;  4BJ5 C;  1O4X A;  3ZMZ A;  4W97 A;  2X6W A;  5E18 F;  3DV8 A;  3FX3 A;  1HF0 A;  3C2G A;  2X48 A;  3M3Y J;  1OKR A;  3ELK A;  2DAO A;  3O8H A;  1VI0 A;  3FKJ A;  4XQF A;  1NH3 A;  3CJN A;  1YW9 A;  1LVK A;  1U9N A;  2WAD A;  1BOB A;  2EFN A;  2Y2Z A;  2OZ6 A;  2V4J C;  3L09 A;  2R92 J;  4O3M A;  2K85 A;  5J8F A;  1MMN A;  5KAF C;  1FYM A;  1TL8 A;  4DIQ A;  3MKL A;  1N78 A;  1ONV A;  2XRO A;  2M7A A;  4XRM A;  1OCC H;  1D1A A;  2ZME B;  3RCO A;  1WH7 A;  2QSF X;  4BXX J;  3GTG J;  3WTV C;  2CW7 A;  3REO A;  3QYB A;  3MN2 A;  2GA2 A;  5K5Q A;  5F6F A;  4BU2 A;  4YFK F;  4F7Z A;  1ZK8 A;  3CLO A;  5F64 A;  2VUM J;  1DU6 A;  2KZV A;  5FGM A;  1OCP A;  1MDM B;  4DOZ A;  2HKX A;  3ZQF A;  1ZGJ A;  2OA4 A;  3JSP A;  5F0C A;  1V55 H;  5ICC A;  1X2N A;  1H0M A;  2DJI A;  4IPA A;  4PFO A;  5KHD A;  1FBQ A;  2FOW A;  5FLM J;  4CYC B;  4KN7 X;  2WAQ A;  2ZCW A;  2IPQ X;  3O3K A;  2IT0 A;  1V5E A;  1JUP A;  3WG7 H;  5IP6 A;  4ZTF A;  1IC8 A;  2MLK A;  2JVH A;  3HTS B;  2X6Y A;  4XSZ F;  4WCG A;  4ZYH A;  2JJ7 A;  3DPU A;  1X1P A;  1TW3 A;  2O9L A;  2IA1 A;  2R7U A;  1TQP A;  3H3V K;  2G9W A;  5FRN A;  5ILS A;  2MC3 A;  4M3E A;  1ODD A;  3DEW A;  4JX4 A;  1UEL B;  5LHG A;  3KP6 A;  5GAG J;  4GXO A;  2KPM A;  3GEZ A;  1YS6 A;  2ADU A;  2W48 A;  1OQY A;  3NAR A;  2K27 A;  2YU3 A;  2XPU A;  3O2P E;  3HYI A;  2PQ8 A;  4RAZ A;  2XC7 A;  3U2R A;  5J8C A;  2RNJ A;  4XRS G;  1OLT A;  3WGH A;  2AQF A;  2MH9 A;  4Y13 A;  2OF7 A;  5JLX A;  1HDP A;  1IRG A;  2XDV A;  2MSY A;  5HNF A;  1SFO J;  3DWL E;  2ZNY A;  4XBF A;  4F55 A;  1FZP B;  5E17 F;  3ABT A;  3K2Z A;  4A6E A;  1OCR H;  5BPD A;  2QA4 I;  2CSO A;  3BC8 A;  2HS5 A;  4PJM A;  2UWM A;  2NOG A;  3PO3 J;  1JE8 A;  4DW6 A;  2JK3 A;  4LFU A;  5BMZ A;  3OV8 A;  4BE1 A;  3K9T A;  2VQC A;  4KN4 X;  2RV8 A;  2KIM A;  2W4S A;  2X9D A;  2VB6 A;  3IH4 A;  3KYD B;  2K9S A;  3FXO A;  4DQ2 A;  2J5O A;  4G7O F;  2EZH A;  4D7N A;  4WXC A;  4LIV A;  2XGC A;  2L7F P;  3J7Y J;  2VKV A;  2FRH A;  3MFK A;  1W0T A;  3BR1 A;  4OOI A;  5DUI A;  4JK1 X;  4OIO F;  4C2T A;  2L02 A;  1DP7 P;  2XAQ A;  4N9H A;  4YEJ A;  2X6X A;  2CQX A;  2IA0 A;  2ZJ2 A;  2K4J A;  5EEH A;  2GOM A;  5E3L A;  3HJE A;  3UNG C;  2WB1 A;  3ZMV A;  4N0B A;  4NC6 A;  1GT0 C;  3WTW C;  5F1J A;  2LLK A;  1EH7 A;  2PBI A;  3MQ0 A;  1FLI A;  2GOX B;  3J80 Z;  1T95 A;  4IO9 F;  3FXL A;  2R93 J;  4HLX A;  3TBI A;  2VKH A;  2DMU A;  3MD2 A;  4C30 A;  4RB0 A;  4HAM A;  4U0W A;  2WAQ N;  3OYB A;  3CTA A;  5KCM A;  5TRD A;  3QWL A;  2M2E A;  3K0L A;  2VQH A;  3H9G A;  3MKY B;  2W1O A;  4PDK A;  4KT6 A;  1J9I A;  4RA2 A;  2A6T A;  6PAX A;  1XGS A;  2CG4 A;  3ABU A;  2QSG X;  2R7D A;  3S3M A;  1VQM I;  3E97 A;  1LVA A;  2H6B A;  5B1B H;  2R5Z A;  4RGS A;  1ZTR A;  4XLC A;  2EIL H;  3VYS B;  1N77 A;  3ZQC A;  4CXF A;  5EJC A;  2JRM A;  4G7H F;  2FUG 2;  3UR3 C;  3LSP A;  4E70 A;  1O3R A;  4B09 A;  1A5J A;  5FKL A;  5J3L A;  3QYF A;  4ENK A;  4EJO A;  4ENN A;  3G1O A;  2EFW A;  5EG0 A;  1JHH A;  1MJB A;  1XMK A;  5E20 A;  4OIQ F;  5HVQ C;  1S3J A;  2RN7 A;  4EM0 B;  1SC7 A;  2D1V A;  3HIF A;  1K61 A;  1K7A A;  5E3M A;  4UY8 I;  3HSR A;  1YIJ I;  3S1Q J;  3R60 A;  2LNB A;  4YRV A;  5CVJ A;  1T08 B;  2L01 A;  4B3X A;  1K78 A;  2LH9 A;  3ISP A;  2BY0 A;  4HV5 A;  2LKP A;  1XTA A;  3MZH A;  3IHU A;  3I55 I;  1IJW C;  2LC2 A;  1T0F A;  4U7D A;  1QHH D;  3TW6 A;  2KFD A;  2H1K A;  1CQT A;  5CJ9 A;  3G6E I;  2OBP A;  1APL C;  4GRI A;  5GPC A;  3LSJ A;  1XPX A;  4OIR F;  4ESJ A;  5CVR A;  4HNT A;  3EUH C;  5HDG A;  4IRH A;  1T56 A;  4LIU A;  1JJ6 C;  1VQN I;  2F4I A;  2HFH A;  3BCA A;  2H1L A;  3S17 J;  4B3A A;  1UHS A;  2GWR A;  2MYS A;  2K7L A;  4CUG A;  4KIT B;  1YHQ I;  3GX4 X;  2X1D A;  5GAH J;  1MBH A;  2OTJ I;  4ETS A;  5L3F A;  1IF1 A;  5J4V A;  5HS8 A;  1RUO A;  1DPU A;  5K7H A;  1LDD A;  2BXY A;  3IH3 A;  4A3I J;  4JX6 A;  3HOS A;  1UG0 A;  4DYC A;  1U5T A;  3RZD J;  2L3D A;  4BQA A;  3WTX C;  3ZQL A;  2PG4 A;  4A0Z A;  5F0F A;  2YPR A;  5C3E J;  3CCV I;  2XV4 S;  3TP0 A;  2NNN A;  4L5E A;  3OYK A;  3T5X A;  2WB1 N;  4FIS A;  2E19 A;  3F0C A;  4G6D A;  2LDU A;  3F22 A;  2HOT A;  1KYW A;  1X4P A;  3H92 A;  2EIJ H;  4DZP A;  3MEX A;  2NVQ J;  2Y30 A;  3N97 A;  1J5Y A;  3E5U A;  4A3C J;  2QQ9 A;  3GZ6 A;  3HXL A;  4CZC A;  2O6G E;  4G7Z F;  3ROU A;  2R7R A;  3HBL A;  2RRE A;  4UXN A;  1R4N B;  5HLT A;  3CCE I;  1EF4 A;  1KQ0 A;  3TDU C;  1IO2 A;  3KCC A;  5EEG A;  3HRT A;  1QBJ A;  2HYF A;  3FMQ A;  2FNP A;  2FXA A;  1LEA A;  3HHH A;  2DFH A;  4PUS A;  4MLO A;  3M4O J;  3ECH A;  5LFA A;  4IQJ A;  1YJW I;  2IS1 A;  2FBI A;  1OMI A;  2XAF A;  2H6C A;  1LB2 A;  2GIV A;  4W1U A;  4DZJ A;  2GQQ A;  3LSH A;  5GTI C;  1K6O A;  2K3P A;  1LFP A;  4BBS J;  2EA4 A;  4IHX A;  1AOY A;  4RM3 A;  2EZK A;  1J59 A;  2DFE A;  4EGY A;  2E1M C;  4QPQ A;  2V1U A;  4HBL A;  4DBR A;  3RIR A;  2H8R A;  3RI4 A;  4HSR A;  2QSH X;  3KX2 A;  2DQR A;  3GUD A;  2W82 A;  1HDD C;  1BW6 A;  1YE9 A;  5BS6 A;  4F91 B;  2P7V B;  4I0A A;  4YFX F;  5FLX Z;  2P4W A;  5ICE A;  3COA C;  1QQI A;  4XLF A;  2Y9Y A;  3ZQH A;  4E7Z A;  1C0W A;  3HOU J;  2QKL B;  2NNY A;  2JSP A;  2O03 A;  3I64 A;  4FCY A;  3KLN A;  3S1N J;  3ASO H;  5J40 A;  4KYW A;  3CUO A;  1AU7 A;  3ABK H;  1S5L C;  3HGG A;  3OWT A;  4HF0 A;  3HUG A;  4KIG A;  2WWY A;  2VL8 A;  2DDA A;  4GCV A;  4J19 A;  1QPI A;  3CZ6 A;  3KZZ A;  2QVO A;  1KYZ A;  2FD5 A;  1WGX A;  3ULQ B;  4A3K J;  1YJ9 I;  2CMP A;  1Q1H A;  3IAS 2;  3L2U A;  4L0Y B;  2FF4 A;  3F8N A;  3G2B A;  3OIP A;  1WCM J;  3A4C A;  2RQQ A;  1F1Z A;  1HW1 A;  3S2H J;  2NVY J;  4IEJ A;  4YIF A;  4Q47 A; 
#chains in the Genus database with same CATH homology
 2HYJ A;  5FKK A;  2ECC A;  5FLV A;  2DMP A;  4X6A J;  1ZR2 A;  1PUF A;  2R5Z B;  3I4M J;  1JKR C;  1ETX A;  2JA8 J;  2LVS A;  5GP9 A;  4EEF G;  2D5V A;  1F43 A;  1POG A;  3SDG A;  3A02 A;  1LE8 A;  5M5W J;  5E3N A;  3W6V A;  3A01 A;  1IDZ A;  1ETQ A;  2O8K A;  3BG9 A;  4D5C A;  1BA5 A;  2IBD A;  2DA2 A;  1Y1V J;  2DA1 A;  5EDN A;  1TWF J;  4NDL A;  5EG0 B;  1AHD P;  3GTJ J;  1HCR A;  1RET A;  4C3J J;  2O7O A;  2AHQ A;  5IP9 J;  1B72 B;  2L0K A;  5F0H A;  3Q0W A;  2E2J J;  1LFU P;  2TRT A;  3RQI A;  1IG7 A;  3BR0 A;  2R0Q C;  3GTK J;  1AKH B;  3WHC A;  4XIC A;  3K2A A;  1JKQ C;  1TC3 C;  5IYB J;  1Z0X A;  2LK2 A;  5C4J J;  1E3O C;  1VF9 A;  1QVU A;  5F08 A;  3RZO J;  1IDY A;  1HLV A;  4DYQ A;  4IHW A;  2E2I J;  4JYK A;  3HOY J;  1SAN A;  5IPA A;  1K83 J;  4FE7 A;  1RKW A;  4QSH A;  1UG2 A;  3G1L A;  3BTJ A;  1B8I B;  2L7Z A;  3TP3 A;  2OPT A;  5IOZ A;  1JT0 A;  1RKT A;  3MVP A;  1T33 A;  1LE8 B;  1I6H J;  2KT0 A;  1O4X A;  4W97 A;  2DA6 A;  3QPS A;  2GM4 A;  1HF0 A;  2X6O A;  2DMQ A;  2X48 A;  3M3Y J;  5FKO A;  3O8H A;  1VI0 A;  1MSE C;  1VND A;  1ZQ3 P;  2JMW A;  3NAU A;  4C2M J;  1U9N A;  1TWC J;  2Y2Z A;  3HOV J;  2E2H J;  3WHB A;  3FIW A;  3S14 J;  1TWA J;  3HGY A;  1RR7 A;  2KDZ A;  1JJ8 C;  2R92 J;  2MGQ A;  2XPW A;  1ITY A;  3MKL A;  9ANT A;  4M6V A;  5M5Y J;  1IGN A;  1FTZ A;  4QIW N;  3G1M A;  2HXO A;  5M3F J;  1GUU A;  4XRM A;  4BXX J;  1WH7 A;  2K40 A;  3GTG J;  2HDD A;  5IP7 J;  3MN2 A;  1NK3 P;  4M3D A;  4IHV A;  3PO2 J;  1ORK A;  1ZK8 A;  2R5Y B;  3LOC A;  1GV2 A;  1YRN A;  2CQQ A;  2VUM J;  1DU6 A;  4M3F A;  1OCP A;  1U9O A;  5IYD J;  3ZQF A;  4A3J J;  5F0C A;  5IOY A;  1X2N A;  3GTO J;  5C44 J;  5FKN A;  3BR3 A;  5FLM J;  4CYC B;  1ETV A;  2EZL A;  2FJ1 A;  2ID3 A;  4LOC A;  3BTI A;  1JUP A;  5IP6 A;  1IC8 A;  1GDT A;  1JT6 A;  3GTQ J;  1XC5 A;  2JJ7 A;  3PM1 A;  5K7F A;  2DA5 A;  1OCT C;  2O9L A;  3H3V K;  2L9R A;  4AYB N;  4M3E A;  2LTP A;  2LR8 A;  1MH3 A;  2DTZ A;  3DEW A;  3OIO A;  3ZQG A;  4JX4 A;  3JRH A;  4G12 A;  1X58 A;  3TED A;  5E3O A;  4IHY A;  3HDD A;  1NTC A;  2HQ5 A;  2W48 A;  1VFC A;  1UMQ A;  2ZB9 A;  4FE4 A;  2K9Q A;  3NAR A;  1JUS A;  2XPU A;  2QF7 A;  3DCF A;  5J1R A;  4BY1 J;  5DS9 A;  3BR5 A;  1BL0 A;  2EH3 A;  3Q3S A;  3BQY A;  1JTY A;  3HKZ N;  4XRS G;  1BJZ A;  2LD5 A;  4A93 J;  4RDU A;  3HOW J;  5IYC J;  2CUF A;  4BBR J;  2OF7 A;  5JLX A;  2QCO A;  1HDP A;  1MBK A;  3Q0V A;  2MSY A;  3S15 J;  1SFO J;  2XPV A;  3HB9 A;  2PMZ N;  1Q1V A;  1GVD A;  4C3I J;  3HOZ J;  3BT9 A;  3QQA A;  2L7M P;  3OOU A;  1ZGW A;  1QRY A;  4XK4 A;  1WH5 A;  1JGG A;  3S1R J;  2VPR A;  3TW7 A;  3BR6 A;  2NOG A;  3LSG A;  3PO3 J;  3SFI A;  4DW6 A;  2JK3 A;  4GFB A;  1I3Q J;  1BW5 A;  5FKM A;  2Y31 A;  2JA6 J;  2X9D A;  3IV5 A;  2HOS A;  2JA5 J;  4RBO A;  1FIA A;  1I50 J;  3IH4 A;  1W0U A;  2K9S A;  1Y1W J;  3IH2 A;  5DTD A;  4UUS A;  1PUF B;  1DU0 A;  2EZH A;  2ME6 A;  4D7N A;  2XGC A;  1U78 A;  2L7F P;  1A6I A;  4D5F A;  2XB0 X;  2FX0 A;  5EYR A;  1IUF A;  2VKV A;  1FEX A;  1XS9 A;  3OSF A;  1W0T A;  3BR1 A;  3A01 B;  3ZOB A;  2LP0 A;  4A3B J;  4A3G J;  3Q0U A;  1H88 C;  2ID6 A;  5HOD A;  2CQX A;  2GLO A;  4BY7 J;  2M8G X;  5EGO A;  5E3L A;  1RPW A;  1GT0 C;  5F1J A;  2LLK A;  1P7I A;  1TWG J;  5EF6 A;  1MBE A;  2R93 J;  2WV1 A;  4I76 A;  1ETO A;  3JRI A;  2DMU A;  2FQ4 A;  2WAQ N;  2K9N A;  2M2E A;  5EZH A;  1XG1 A;  2M0C A;  2ELK A;  1JTX A;  3S2D J;  3A03 A;  2YS9 A;  4MFD A;  4MO7 A;  1MNM C;  2YUS A;  3UKG A;  2R5Z A;  3JRC A;  2XSD C;  1HOM A;  3HOX J;  1ZTR A;  4I6Z A;  3ZQC A;  4C3H J;  3LSP A;  2RAE A;  2NS8 A;  2G0E A;  1A5J A;  1H8A C;  5FKL A;  5J3L A;  2DA7 A;  2DN0 A;  1F36 A;  4AC0 A;  1H89 C;  4QTR A;  3G1O A;  5EG0 A;  3BR2 A;  4B1R A;  3JRB A;  1MH4 A;  5JLW A;  3I4N J;  3FIS A;  3FK7 A;  1JKP C;  3ZQI A;  3S16 J;  1B72 A;  3S1M J;  1K61 A;  1ENH A;  5E3M A;  3S1Q J;  3JRG A;  1AKH A;  1D5Y A;  3JRE A;  5J1Y A;  4D7M A;  1MBJ A;  1IJW C;  1G2H A;  3TW6 A;  2VI6 A;  1R9T J;  1MBF A;  2H1K A;  1CQT A;  2LKX A;  1APL C;  2JWT A;  5GPC A;  3LSJ A;  3CQZ J;  4JX5 A;  5F04 A;  3LSR A;  1T56 A;  1YRN B;  1IV6 A;  1JJ6 C;  3S17 J;  4B3A A;  2LFB A;  1UHS A;  2I10 A;  1OFC X;  4BKX A;  3GTP J;  5BNG A;  1B8I A;  1ZKG A;  2NVX J;  2B63 J;  2DJN A;  1MBH A;  1ZR4 A;  3BG3 A;  4Y7N J;  4S0H B;  2Y9Z A;  2R7Z J;  3CMY A;  2TCT A;  3GBG A;  2YU9 J;  5K7H A;  5EEA A;  3E7L A;  3B6C A;  3IH3 A;  4Y52 J;  4UUT A;  4A3I J;  4JX6 A;  1P7J A;  5EZG A;  4DYR A;  2XB5 A;  4DYC A;  3RZD J;  3BTC A;  4JP0 A;  1WPK A;  1QVT A;  3ZQL A;  2CJJ A;  2N8G A;  2JA7 J;  4A69 C;  5F0F A;  5C3E J;  2XRL A;  4MIM A;  3TP0 A;  3BG5 A;  4L5E A;  4XRS A;  4V2G A;  2WB1 N;  3O8G A;  2P81 A;  4FIS A;  2E19 A;  3F0C A;  2HOT A;  4MFE A;  1TWH J;  3B6A A;  3JR9 A;  4DZP A;  2VKE A;  4ABZ A;  1S7E A;  3BTL A;  2NVQ J;  2Y30 A;  5M5X J;  2IAI A;  1GV5 A;  3CCY A;  2R5Y A;  4A3C J;  4A3F J;  2GBY A;  1FJL A;  5F27 A;  3HBL A;  4HNV A;  1EF4 A;  3GTL J;  2MW8 A;  3C2B A;  3QPL A;  2COB A;  1OJL A;  2Y0S N;  1RES A;  3HEF A;  2M9H A;  5M3M J;  1LFB A;  4CYC A;  2XGD A;  3H0G J;  2DMN A;  5J1U A;  4MLO A;  2MG4 A;  3M4O J;  2E1O A;  2XGE A;  1JKO C;  3SJM A;  3D1N I;  3GTM J;  4M3G A;  5C4X J;  1ETY A;  4DZJ A;  2HXI A;  4W1U A;  2IEK A;  4BBS J;  3FK6 A;  4IHX A;  1FIP A;  4X1E A;  2EZK A;  1U8B A;  1JUM A;  4M3B A;  3RKQ A;  2HOA A;  2DA3 A;  3JRD A;  4AUX A;  2H8R A;  2EBI A;  2LY9 A;  4A3M J;  1FTT A;  4UUS B;  1HDD C;  3CDL A;  1BW6 A;  2NS7 A;  4FTH A;  3BQZ A;  4A3E J;  1WI3 A;  3ZQH A;  2Y9Y A;  3HOU J;  2EQR A;  2ECB A;  4A3L J;  2DA4 A;  2M34 A;  2EZI A;  3K7A J;  3VPR A;  1ETW A;  4FCY A;  3OSG A;  3S1N J;  2HI3 A;  5FJ8 J;  5K7Z A;  2AO9 A;  4V2F A;  5EGO B;  1AU7 A;  3L1P A;  3HGG A;  2DMT A;  1ETK A;  3FKI J;  1MBG A;  3JRF A;  2NVT J;  2JN6 A;  4J19 A;  2CRG A;  4B4C A;  1QPI A;  3JRA A;  2CU7 A;  2CUE A;  2FD5 A;  1WGX A;  1X2M A;  4A3K J;  3LNQ A;  3HM5 A;  4A3D J;  5GPA A;  1IRZ A;  4XID A;  1WCM J;  1Z77 A;  2ME0 A;  3S2H J;  2NVY J;  1NK2 P;  4IEJ A;  1MSF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...