2CU7A

Solution structure of the sant domain of human kiaa1915 protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
b'GSSGSSGYSVKWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVKCGLDKETPNQKTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA1915 protein
molecule tags Transcription
source organism Homo sapiens
publication title Structural and Functional Differences of SWIRM Domain Subtypes
pubmed doi rcsb
total genus 13
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2005-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2cu7A01
3HOZJ 4XICA 1SANA 1QPIA 3B6CA 1ETKA 3S16J 1JJ6C 4C3JJ 4DZJA 2JMWA 2E1OA 4JX6A 2H1KA 2WB1N 2NVXJ 2CQXA 2HI3A 5EF6A 2MG4A 1HCRA 2GLOA 3BR5A 1TWCJ 2OF7A 2MW8A 1ETOA 1BA5A 2JJ7A 4I76A 5E3NA 5F0FA 3HOWJ 2DMTA 2ECBA 3BR3A 2ME6A 2DMNA 2HXOA 4EEFG 1IG7A 3GTPJ 4FISA 1GV5A 3QPSA 4FTHA 2NVQJ 1GUUA 5K7ZA 1CQTA 4I6ZA 4M3BA 3BTLA 2XRLA 4IHYA 3NARA 5E3LA 1OFCX 3IH2A 3TW6A 3WHBA 4MFEA 5GP9A 2WV1A 2ELKA 1JUPA 1RKTA 5F0HA 2K9QA 4DYRA 3SFIA 3K2AA 1U9NA 2N8GA 3TW7A 3HOUJ 4AUXA 2XB5A 3BG9A 2VKEA 4D5CA 2DA1A 1UHSA 2DA2A 2IBDA 2DA6A 1H88C 5IOYA 3I4MJ 2HYJA 3S17J 1WH7A 1MBJA 4A3EJ 1NK2P 4M3GA 2NS8A 4JX5A 4S0HB 5EZHA 4A3DJ 3HGGA 5GPAA 3ZQFA 5E3OA 2O9LA 1WI3A 2L9RA 2CJJA 3IH3A 4AC0A 5GPCA 1HLVA 5EZGA 3MN2A 2I10A 3S15J 2XB0X 4XRSA 4MIMA 2LP0A 4IEJA 1ZKGA 2R92J 4LOCA 3M3YJ 1MSFC 3Q0VA 2QF7A 3ZQIA 4JYKA 1BW5A 2DA4A 2GM4A 3JRBA 1APLC 1QVTA 2X48A 1AHDP 3M4OJ 5EEAA 4DW6A 1WGXA 1HDPA 3K7AJ 4A3MJ 3TEDA 2R5ZB 2MGQA 1K61A 3L1PA 3GTJJ 1Y1VJ 4NDLA 3IH4A 2EZIA 4W1UA 4BXXJ 4C3HJ 4QTRA 2ID6A 5IOZA 1U78A 4IHWA 2HOAA 2LFBA 4A3KJ 4M3DA 1ETYA 4Y7NJ 2Y9YA 2TCTA 3BG5A 1JUSA 2NVYJ 2YU9J 1VF9A 2IEKA 4Y52J 2XSDC 5M5WJ 1X2NA 1MH3A 5JLXA 2B63J 3JR9A 5HODA 4V2FA 4UUSA 1JJ8C 3PO2J 2LVSA 2K40A 4BY1J 2ID3A 5IYBJ 2TRTA 3ZOBA 2KT0A 2EH3A 2M34A 2R5ZA 2E19A 1W0UA 1YRNA 2NS7A 2R5YA 4A3CJ 1FIPA 1MNMC 1AKHB 1I3QJ 3BQZA 4RDUA 2AHQA 3NAUA 1VI0A 2W48A 4CYCA 2LY9A 1IDYA 4D7MA 1U9OA 1F36A 2HXIA 4V2GA 3HOYJ 3JRGA 2K9SA 5J3LA 1S7EA 1Q1VA 5IP9J 2R0QC 2L7ZA 9ANTA 3C2BA 2Y31A 2ME0A 3Q0UA 5C3EJ 1JT6A 4C3IJ 3S1RJ 1IUFA 2JA7J 3D1NI 5IPAA 3S1NJ 3LSGA 5FKKA 2L7FP 2G0EA 2DMPA 5DS9A 3MVPA 1JKPC 2FQ4A 3HEFA 5F27A 1PUFA 3HGYA 5F04A 4FCYA 5J1UA 5M3FJ 3BR0A 1LFBA 4JX4A 1ETXA 3H3VK 2EQRA 1ZR4A 1K83J 1D5YA 1POGA 3HBLA 1MBKA 1TWAJ 4ABZA 5FKLA 2M0CA 1PUFB 1IGNA 1R9TJ 3RKQA 1BW6A 2DA7A 3O8HA 3UKGA 2VUMJ 2HOSA 1TWGJ 3CQZJ 4XK4A 1I6HJ 2OPTA 5F0CA 4JP0A 2HDDA 5EG0B 1P7IA 4BY7J 3BT9A 5M5YJ 5EGOB 1ETWA 3FK7A 1DU0A 1ETQA 3OSFA 2GBYA 3CDLA 5IP6A 4G12A 1IDZA 5FKNA 2EBIA 3SDGA 5IP7J 1JKQC 5C4XJ 1TWFJ 3HOVJ 5F1JA 3FK6A 4A3JJ 3BQYA 2HOTA 1TWHJ 1DU6A 2EZLA 2XPVA 4QSHA 1JUMA 2CUFA 3BTJA 3B6AA 2DA3A 1I50J 1UMQA 1AU7A 1GT0C 4BBSJ 1GV2A 3DCFA 4J19A 1BL0A 2R5YB 2DMUA 1RKWA 3BR1A 3GTQJ 2ECCA 3BR2A 2LLKA 3DEWA 3WHCA 4XRMA 1B8IA 2L7MP 4XIDA 1IJWC 4D5FA 1E3OC 3ZQLA 2X9DA 1NTCA 5IYDJ 5FJ8J 1IC8A 1ZK8A 1ITYA 3Q3SA 3G1LA 4FE4A 2HQ5A 5E3MA 2CUEA 2AO9A 2O7OA 1TC3C 1LE8B 1OCPA 1ETVA 4GFBA 4UUTA 1FTTA 3LNQA 3TP3A 4M3EA 3GTMJ 2QCOA 3RZOJ 4CYCB 2KDZA 2XGDA 4HNVA 2CRGA 3QQAA 1MSEC 4X1EA 2D5VA 3A01A 3E7LA 5FLMJ 1BJZA 4QIWN 1F43A 3JRDA 1A5JA 2P81A 1MBFA 5J1YA 5C4JJ 3PO3J 1IRZA 1X2MA 3O8GA 3JRCA 2VKVA 4A3IJ 2YUSA 1JT0A 2NVTJ 2DTZA 3GBGA 2DMQA 2NOGA 3LOCA 5C44J 3FIWA 1P7JA 4A93J 1AKHA 2COBA 1H8AC 3BR6A 1GVDA 3HOXJ 1T33A 2XPWA 1HF0A 3I4NJ 1MBHA 1ENHA 1ORKA 2CQQA 1HDDC 1QRYA 1IV6A 4FE7A 1FJLA 5IYCJ 1Z77A 1FEXA 3S2HJ 1JGGA 2PMZN 2YS9A 4A3LJ 4AYBN 4MO7A 1Y1WJ 3GTLJ 4X6AJ 4B4CA 3RQIA 3GTOJ 1NK3P 1U8BA 3OOUA 1ZR2A 2XGEA 2XPUA 3JRAA 2XGCA 4IHXA 3GTKJ 2Y0SN 4MLOA 1FIAA 4XRSG 2LR8A 3W6VA 4BBRJ 3S14J 3CMYA 1B72B 2Y30A 2DJNA 1UG2A 4DYCA 3LSPA 3G1MA 2ZB9A 4W97A 2JN6A 2L0KA 5FKMA 1B8IB 3ZQCA 2LTPA 2JA5J 3HKZN 5FKOA 2M9HA 2Y9ZA 1OJLA 1EF4A 1OCTC 3SJMA 5FLVA 1B72A 3IV5A 3JRIA 4RBOA 5EG0A 3BG3A 1RETA 2IAIA 2WAQN 3PM1A 1GDTA 1JKRC 4DZPA 1JTXA 1MBEA 5DTDA 2E2JJ 4IHVA 3BTCA 3RZDJ 1W0TA 1XG1A 3GTGJ 3HM5A 3LSRA 1X58A 1XS9A 2M8GX 3Q0WA 5JLWA 2R7ZJ 3MKLA 1VFCA 5EDNA 3F0CA 3VPRA 3A03A 3HB9A 3BTIA 1A6IA 2JA8J 1XC5A 3JRFA 1MBGA 3S1MJ 1VNDA 5J1RA 1WH5A 1WPKA 2RAEA 2LD5A 2X6OA 2EZHA 4M6VA 1JTYA 2LK2A 3H0GJ 1JKOC 1T56A 1LE8A 4A3FJ 4B3AA 2E2IJ 5M3MJ 5M5XJ 3JRHA 2Y2ZA 2FD5A 3OSGA 2DN0A 4C2MJ 4D7NA 2LKXA 1MH4A 3LSJA 4DYQA 2FJ1A 3ZQHA 2FX0A 2JWTA 1ZTRA 1RPWA 5F08A 2EZKA 5BNGA 3G1OA 1O4XA 3QPLA 3HDDA 1YRNB 3A01B 4A3GJ 4M3FA 2K9NA 2M2EA 4MFDA 1Z0XA 1LFUP 2JK3A 1SFOJ 1WCMJ 3A02A 5EGOA 1G2HA 4L5EA 4A3BJ 1RESA 3FKIJ 2VI6A 4BKXA 5K7HA 4A69C 1QVUA 1FTZA 2MSYA 1ZGWA 4B1RA 3S2DJ 3TP0A 4UUSB 2H8RA 3ZQGA 3S1QJ 1H89C 1RR7A 2O8KA 2CU7A 3CCYA 2E2HJ 2DA5A 3FISA 2JA6J 2R93J 3OIOA 1ZQ3P 5EYRA 3JREA 2VPRA 1HOMA 5K7FA
chains in the Genus database with same CATH superfamily
1V5FA 3OYEA 4BEHB 1OCRH 3TO7A 1HW1A 3V7CA 5D4RA 2H1KA 2Z2SB 4RMNA 5J8FA 2CQXA 2EIMH 5K5QA 2CV0A 2MG4A 3CP8A 1MMGA 2GLOA 1I27A 1Q1HA 2JQ7A 6PAXA 2V9PA 3BR5A 1YTYA 4RB0A 2VQHA 4XLAA 1W5TA 2MW8A 2KRHA 4HBLA 1IN8A 3HSRA 3QOEA 3KP5A 4YIFA 3GWZA 3C18A 5DM6F 2CW0F 4UV8A 3PFYA 4KIBA 4X0GA 3M7GA 2DMTA 2ZFUA 4EEFG 3WODF 1YW9A 3WTVC 4KISA 1GUUA 1A35A 1S6LA 2WBMA 3TQNA 2VQLA 2WY7Q 4I6ZA 3N97A 2MYSA 1S7AA 4C9YA 2VXDA 3NARA 3DU5A 1OFCX 2DDBA 3IH2A 1DGWY 4M72A 4MFEA 5GP9A 3CP2A 3ZQ7A 2WV1A 2ELKA 2K7LA 2E1MB 4DYRA 3FKJA 1CF7A 3K2ZA 1R1VA 3KLOA 2XB5A 4AUXA 1DQUA 2Z16A 4P55A 3WGHA 4M9XA 2IBDA 3J80K 5CVVA 5F6FA 2L3DA 2PMZA 3S17J 1ZGJA 1WH7A 2ELHA 3GEZA 3KP4A 4I0AA 1XPXA 4A3EJ 3LSIA 1C0WA 3G2BA 2JTVA 5K5RA 2VKDA 3V8KA 2O9LA 3M8EA 1S29A 2HU9A 2LF8A 4BAYA 2L9RA 4CHUA 3FXJA 2JVGA 3IH3A 4AC0A 3MN2A 2MH2A 3S15J 4XRSA 2VBWA 1VTNC 2ISZA 2QM3A 2CMPA 1IRFA 2A07F 1R36A 4E4HA 1I1SA 1X3WB 1TQMA 1MSFC 5J8CA 5FLXK 1Z6RA 2DA4A 1APLC 2CUZA 3G3ZA 5EEAA 2O5RA 4DW6A 5A2QK 3R61A 1HDPA 2G7UA 2W85A 1YHQI 5JHUA 1BC8C 1BI3A 3J81K 3I64A 3EPZA 3S93A 3C2GA 3R0JA 1I3AA 3SQNA 3CCQI 4PDKA 4NDLA 4H0EA 4KDPA 3IH4A 2EZIA 2HYFA 2K3PA 1RI7A 3GZ6A 2ICWG 1ZELA 5K5OA 1ZREA 1UJ8A 3CCJI 1X4OA 2OUMA 2Q2EA 2YX4A 4A3KJ 3OYDA 1T08B 1FBQA 5IT9K 4YG2F 1BOAA 2YU9J 1VF9A 3CF5F 3TOBA 3GFJA 4L5JA 4PGHA 2EPFA 3G73A 3L9FA 4ZYDA 4NC6A 3SHFA 1HSJA 4U0YA 4RA2A 3OYFA 4F3QA 5HNFA 3OYLA 1BR4A 2LG4A 1Y0NA 1YS6A 2DFHA 1JJ8C 3M07A 4L0YB 4G7HF 2DBBA 4QWQA 4XBFA 2E19A 1O3QA 1QZYA 2XV4S 2NS7A 3TBIA 4A3CJ 4RGRA 1MNMC 2EFQA 1I3QJ 2X51A 1AKHB 3BQZA 4RDUA 3NAUA 1VI0A 2E71A 2LY9A 4KICA 4D7MA 1U9OA 1F36A 2XROA 4Y4RA 4ZH4F 2P6TA 3EQLF 4V2GA 4GXOA 1S7EA 3CCSI 2EWNA 2HZTA 1JGSA 3Q9VA 1YFHA 1X1AA 3FZVA 5LRRA 3VYSB 3TDZC 1JT6A 4WWCA 2CW7A 1S9HA 3H36A 2IGNA 2CO5A 4ZZDA 5F27A 3RJPA 3PNYA 5HS8A 2M0MA 3FF5A 4A6EA 3BR0A 3VFZA 2QEXI 2VJJA 1ETXA 2OC6A 3PNTA 2EQRA 1D5YA 1IXCA 3SYTA 3KP2A 3C7JA 1OYIA 4PJMA 1IGNA 4F93B 4CCKA 3F6VA 3QYBA 2DA7A 1MKMA 3IKVA 3I3LA 4XK4A 4ZYGA 3WU1B 3BP8A 4WCGA 2F4OB 2IVMA 1HQCA 4FETA 5FRNA 4JOMA 4KT5C 3F8MA 3SZPA 3EDPA 3FMSA 5EGOB 3MKZA 4IOAF 2F5EA 1MD0A 2FUG2 3T5XA 3CLQA 3IC7A 2P7VB 2X1EA 2E1MC 4BDYA 3CDLA 1R5HA 1S7OA 2O3FA 3T0YA 2HWVA 2OQGA 4DOZA 2E1NA 4AU7A 5F1JA 2C6YA 4A3JJ 2VJ4A 3ONQA 4Y15A 3ROUA 4CCOA 1DU6A 1X3ZB 1RC9A 3SXYA 1K79A 4DIQA 1QQIA 4QSHA 2EFNA 2BVLA 2HQAA 3WTWC 3WTUC 4BBSJ 1GV2A 1T0FA 3F3XA 1X3UA 1RKWA 4J00A 2HQNA 1QZZA 2GOXB 5F64A 1DP3A 3F8CA 2R7RA 2NAZA 2IJLA 2JZYA 3ZQLA 1YJNI 1ZHFA 2X9DA 4NQWA 5IYDJ 1VQ4I 5E1XA 4CCNA 2QGUA 1MMAA 5FJ8J 4IOCF 1ZLKA 3IWFA 2P7CB 5E1WA 4UUVA 5HOOA 3QODA 2JUGA 2VASA 1ZK8A 2HKOA 3WTYC 3HRTA 2DT5A 2Q0OA 2HQ5A 5CVRA 2AO9A 2LY2A 2KIUA 2RREA 2KL4A 1OCPA 4MEXF 4P96A 3U1DA 1ZH5A 5D8LB 4GFBA 2IT0A 4PFOA 3WE2A 1K4TA 2GA2A 2EV5A 3GTMJ 2W00A 4RAYA 5TRDA 1OCOH 4CYCB 2MLGA 1Y8QB 2CRGA 1YI2I 2ZJPF 1MSEC 1D8JA 4EATA 1PYVA 1UFMA 4EM1A 4QIWN 1E17A 1MNDA 1U2WA 3RPUA 1R4MB 4LMYA 1MBFA 1R7JA 1IXRC 5F1RA 4N9HA 2QQ8A 2Y0SA 4YEJA 2P5LC 1Y8RB 3BJ6A 3KYCB 1FWZA 4A3IJ 3GBGA 5C44J 2HNHA 1BM9A 3RPQA 2X85A 1WQ2A 3ECOA 3PUFA 2COBA 2BY0A 3K6GA 4F52A 4RGXA 2B7EA 2VC1A 2Q8KA 2V1XA 2XPWA 3I4NJ 4R8HA 2BEOA 1KU3A 3MKYB 3LMMA 5AIQA 2WTEA 2L4AA 2IW5A 5ICCA 2OCEA 1HDDC 1O7FA 4FE7A 3D5SC 1FJLA 2PMZN 2RQQA 2YS9A 1B4AA 5GTIC 4A3LJ 3WU0A 4MO7A 4AYBN 4B4CA 2VE9A 1T39A 3RIRA 3G71I 2HVRA 4EJTA 3W6KB 4G8XA 3QOPA 1U8BA 1W36C 3OOUA 2XGEA 2XPUA 2FMYA 2FNAA 3LSKA 4KUMA 3JRAA 2XGCA 2GXBA 1LKXA 1FIAA 2LR8A 3W6VA 4M9ZA 1DDNA 2DJNA 3BWGA 3N05A 4LG0B 1S3JA 3LSPA 5LGUA 5E17F 4KMFA 4WXCA 1B8IB 3ZQCA 1L0OC 2JA2A 1XDUA 2Z3YA 2Y9ZA 3F23A 2HVQA 1OJLA 1F9NA 2XF7A 3MZYA 1O7LA 3HKZA 2XC7A 2MA3A 1B72A 2KPMA 3LAJA 3IV5A 5EG0A 3BG3A 4D9JA 4ENJA 1SFKA 4L18B 1RETA 4QPQA 2PLYA 1QO0D 3L2UA 1JKRC 4N0BA 4Q48A 1G3YA 2QZ8A 2EV6A 4E7IA 4BUPA 5D4SA 3HM5A 3U9GA 1T2KA 5JLWA 3K4JA 1R5GA 4P5OA 4XSZF 5EDNA 3VPRA 3A03A 4PJNA 3LWFA 4XKBA 3NEUA 5D6EA 2JA8J 1V54H 4PGGA 4Q47A 3KZIC 1XC5A 2STTA 1MBGA 1DPUA 1P9QC 2GQQA 1WKMA 3E6BA 2HYGD 3HG9A 2RNJA 2X6XA 1JHFA 3MQ0A 2X6OA 2DK5A 2EINH 4ZZLA 1HSTA 4MGRA 3FBIB 4B43A 1LE8A 2E2IJ 5CVIA 2V79A 5M3MJ 4G9YA 5J47A 4BS9A 1G3SA 2GIZA 2RC4A 2X6WA 2QBYB 1FMWA 2DN0A 1Y0UA 4LD5A 1MH4A 2QENA 2FJ1A 2FX0A 3OR2C 3E5QA 1U3EM 5BNGA 1O4XA 2F4MB 1SD5A 2W4SA 1R00A 3A01B 1FPQA 3HHGA 4M3FA 2STWA 3TDUC 1Z0XA 3OS1A 4H4KC 4XLCA 1QHHD 2JK3A 1SFOJ 2FBIA 1G2HA 4LJZF 2LC2A 1I6XA 3JW4A 4I99C 3LSMA 3GUDA 3CMEI 1UHMA 1EKEA 2G7HA 3FKIJ 3JCUC 4BKXA 3CCEI 3KEQA 1MJAA 1FTZA 4CCJA 1E0EA 1FMVA 2MSYA 3AG3H 3MKWB 3PJRA 1FC3A 1ZGWA 3K4KA 3OIQA 5K1YA 3RI4A 1XN7A 4DJAA 3VYRB 3GVAA 4DQ2A 3L2RA 1K7AA 2ESHA 3WGGA 1P92A 4PK4A 2R7FA 2JA6J 2DCEA 3KEYA 2A05A 3OIOA 1RUOA 1ZQ3P 2BXYA 3ZMDA 2VOPA 2VIXA 3H5AA 5K7FA 1I1GA 3I55I 1H9GA 4IRGA 1W7PB 2HS5A 4PSWA 4HX4A 2PEXA 1QPIA 3L2WA 1E3PA 2E1OA 3FHNA 3CJNA 2D45A 2YR2A 3DFGA 3H3UA 3BY6A 5LHHA 3VODA 3DTKA 3GCMA 5EF6A 3GFLA 1OKRA 1E2XA 4I02A 1PP8F 1V5EA 3CCMI 4KIFA 4I98B 2OF7A 2H6CA 1UAAA 4A6DA 1ETOA 4UXNA 5DUIA 1UHWA 3D5RC 5E3NA 3HL2A 2ZSIB 3A4CA 1G3TA 4GGGA 5F0FA 4P1WA 2ME6A 2DMNA 2HXOA 3OYIA 3VSLA 1KU9A 2NVQJ 1KYWA 4AD9A 1MDMB 5LBQA 4NC7A 4M3BA 1O3TA 4LLNA 5E3LA 3CJQB 4XLPF 4NB5A 3WHBA 1XSXA 2M87A 2IPQX 1RKTA 1LQ1A 4IRHA 4L5IA 3TW7A 2KDOA 3CDHA 3DTEA 5HLTA 3BG9A 3HOUJ 5IT9Z 2YX7A 2DA2A 2ADUA 1H88C 1X1CA 2BV6A 5IOYA 3I4MJ 1Z6TA 2VOOA 1GLNA 3S8PA 3A1YA 3HYIA 5EZHA 3KETA 2LREA 5GPAA 5KAFC 3A0BC 1TNTA 2BW3B 1DGRM 5GPCA 1P4XA 4YRVA 2EK5A 4A0XA 2XB0X 2BGCA 4AIHA 4XOTA 4KFCA 5HDNA 3HOSA 2Y48A 1WJDA 3MWMA 3F22A 1MNEA 3CJTB 1WJEA 5IY5H 3N4MA 3ZQIA 1QNTA 2K3FA 3U21A 5ED4A 3OIPA 1QVTA 5DCMA 4ZYHA 1AHDP 2VBZA 2VL8A 1N75A 3A0HC 5ILUA 3WG9A 1V4RA 3K7AJ 4A3MJ 3CC7I 4IXAA 2PMUA 4PUSA 3TEDA 3OS0A 1TTYA 5DM7F 2OJED 4WK8F 3L00A 3R4KA 3GX4X 3ZXSA 2FBKA 2MGQA 4KMUX 5FFXA 1K61A 3DEEA 5L3EA 3S2WA 4CH7A 3Q5FA 4NC8A 5HNHA 4EVIA 2AQEA 5HLIA 2M5WA 4QTRA 2NRAC 4OIOF 2ID6A 2OTJI 5IOZA 1J59A 2LFBA 4UHTA 4BE1A 3KP7A 2AQFA 4AIJA 2YU3A 4JK1X 3AAFA 5HLGA 3BG5A 1JUSA 2NVYJ 1J7KA 4M6XA 1CGPA 2IEKA 2XSDC 1HW5A 5M5WJ 1X2NA 3ZPLA 3ESWB 5GADJ 1U5TB 3KFWX 4A12A 2B63J 2GXAA 3FXRA 2DI3A 3CTAA 3H9GA 3OMYA 5GAEJ 2KIQA 2WAQA 3M8FA 2DT7B 4V2FA 3RDIA 3PO2J 2LVSA 4BY1J 3HRUA 3OYKA 1OMIA 5IYBJ 5HLHA 1R6RA 2TRTA 3FXUA 3OYBA 1YO5C 3AFHA 4OMYA 1TBXA 3OR1C 5FO5A 3OYHA 3DBHB 2R5ZA 4BJ5C 1FIPA 2DODA 4XN3A 5B5EC 4Y13A 3T1BA 1PDNC 5ERIA 3IP4B 3QPTA 5LLQA 1VQLI 1IDYA 3W2WA 1MJBA 3U2RA 2V7FA 2L4MA 1TQPA 4AVZA 3HOYJ 2KZGA 3CMAI 2EFWA 2XAGA 1IN5A 3LA2A 4L9JA 3Q9SA 1W5CC 3O3KA 1IUFA 5IPAA 1RUNA 5FKKA 2G0EA 2HOEA 3HEFA 1TNSA 4FCYA 5F04A 5J4VA 3ERMA 5J1UA 3OY9A 5M3FJ 1FBSA 1G59A 4JX4A 2CSOA 1REPC 2RNGA 2EA4A 4O5VA 1ZR4A 2YPRA 4HF2A 5DV5A 4F7ZA 4E7LA 1K6OA 4DBQA 3ULQB 1TWAJ 4ABZA 2KKOA 4OWRB 2FQ3A 1TW3A 4OINF 1BW6A 3UKGA 3J7YJ 1EH6A 2HOSA 2VUMJ 4NUBA 3CQZJ 1B1BA 3ABTA 4XKWA 3SEQA 2K4BA 2R7DA 3SZTA 2FEZA 2KIFA 5FGMA 1XGMA 5A2QZ 4KN7X 5EG0B 3RCOA 5BOXA 4FX4A 2MFZA 4BY7J 3BT9A 5FLXZ 3DEUA 2W24A 1ETWA 2GIVA 3OWTA 3I4PA 1K6YA 4EM0B 3DBRB 2XAUA 2QYOA 2R7WA 5IP6A 3WTXC 4IQ4A 1USSA 4Y3OA 1YITI 2EBIA 1XGSA 3LFUA 2NS0A 5IP7J 3V42A 1JKQC 2JSCA 3F8FA 5C4XJ 1U8RA 3CESA 1TWFJ 1WJBA 1BBYA 1VQ5I 3P9KA 4IO9F 1O57A 1TWHJ 3M1CA 4PJJA 2BYVE 2NVUB 1TZLA 4XMYA 3T8TA 3FMRA 3M8JA 3H9JA 4CZCA 2CUFA 3BTJA 1PJRA 2OCCH 1SD7A 3ZQQA 3EUAA 1I50J 1AU7A 3LSTA 3JAMZ 5HS7A 2XAFA 2UWMA 3CD6I 4GCVA 2R5YB 5KVRA 2MC3A 4E7ZA 2K27A 3BR2A 2ECCA 2G9WA 3WHCA 1B8IA 4XRMA 2L7MP 3LL7A 2M45A 1Y56A 2PI0A 2XUBA 4XKCA 4D5FA 3WTTC 4L9VA 5D5VB 1KU2A 2JRMA 4YFNF 4YELA 1BR2A 4IZZA 2HDCA 3VEPA 3K4CA 5DEQA 4IJAA 4KIGA 2M8EA 1VQMI 3G1LA 2A6EF 2CUEA 3I9V2 2IS4A 1KA8A 4UNOA 2QSFX 4U7BA 3PIOF 3H9QA 1FTTA 2W7NA 3CUQA 1YJ9I 3LNQA 3K4MA 3TP3A 2QCOA 5ILVA 4G7ZF 1TLHB 1IN4A 2IA1A 5HVQC 3F8BA 3H3ZA 3ZP5A 3BOQA 2ZFWA 4X1EA 3ZGKA 4LFUA 4RM3A 4F55A 2WV0A 3P9CA 3FXMA 4U87A 1UELB 2BZTA 5DDGA 2XRNA 3J7ZI 1GXPA 1LUJB 1ZG3A 3E6DA 1SD4A 2VKVA 3LOCA 1KYZA 4A5NA 2H8WA 3E6MA 3OYMA 4A93J 3J7AO 3HXLA 3I59A 1A6QA 4L0ZB 1H8AC 2ZBKA 5BS6A 4BDZA 1NH3A 3E5UA 1R1UA 4O3MA 1HF0A 4N9IA 1ENHA 1OLTA 2LYCA 5EEGA 1ORKA 2Q1ZB 1WJ5A 2HTSA 1J2XA 1YS7A 3ZN1A 3L7WA 3HSFA 2ZJ2A 5D5XB 1Y1WJ 2OTLI 4BL0B 2H94A 2H27A 2F5DA 2VJIA 1NK3P 3K0LA 4GO1A 4DBRA 4IQJA 4IHXA 1AA7A 2DFEA 3GTKJ 2DQRA 2Y0SN 1UG0A 4MLOA 2EFPA 2TDXA 3WTSC 4XRSG 2RKHA 2A68F 2P6SA 4HPQA 4BBRJ 3EYIA 1YYVA 1WHUA 2CWEA 2K02A 2Y30A 1UG2A 4DYCA 3O2PE 1XD7A 3G1MA 2ZB9A 4W97A 1R49A 2JA5J 2LTPA 1SAXA 1MMDA 3ZMVA 1UB9A 3IHUA 2CYYA 1IF1A 1EF4A 1OCTC 2RDPA 5FLVA 4O6JA 3HUGB 4HG2A 5L3DA 1RR8C 1IV8A 2GWRA 2DT6A 4DZPA 4N4NB 5ICEA 2MC4A 2E2JJ 3OYGA 4E7HA 2K5CA 3K69A 1XG1A 3TGNA 2FOKA 5KK1A 3WTZA 1X58A 1G6NA 2XHKA 3DTIA 4AYBA 4PJ0C 2CV2A 3K4NA 3HB9A 1ZLJA 4HX7A 1GXQA 2K85A 5D6FA 1XTAA 4CA0A 1V55H 2OQRA 1FP2A 1VQNI 2X0LA 4HRIA 2PBIA 1P2FA 2WAEA 4IHTA 5BMZA 4HDUA 3I58A 1XCVA 3RPUD 2EZHA 2DXIA 4D0PA 2HPMA 4LK0F 4BQAA 2KP6A 4A3FJ 2LMDA 4HAMA 2KFDA 3CZ6A 3JRHA 3C3WA 3TKYA 2Y2ZA 2FD5A 2E34A 3CUQB 4EV0A 1D0XA 4C2MJ 4D7NA 4ESJA 2IRFG 3LSJA 1R1TA 4BJ6C 1IN6A 3PSFA 3HDDA 4A3GJ 1MMNA 2K9NA 2KQRA 3QYFA 4MFDA 1PP7U 1X1BA 3U1KA 1KZHA 3J81Z 1LJ9A 4II3A 4E7JA 5EGOA 3K4BA 4PCQA 3AG1H 1A31A 4XLFA 5H20A 2BY2A 4CZZA 2X1DA 2ZMEB 4CSWA 3GFMA 2R7XA 1D3YA 4Y17A 1WVRA 4B1RA 1BR1A 3LSHA 2AS5F 3S1QJ 3O6BB 1H89C 2O03A 1JXSA 2CU7A 4R79A 4PFPA 2OBPA 4RLQA 3OYNA 3KX2A 3PFIA 3FISA 4G6QA 5ILSA 4B47A 4HQMA 1ZRCA 2AXLA 2BHYA 3DPTA 4OIPF 2JVHA 3FX3A 1HC8A 1T8IA 3HOZJ 3AG4H 2W82A 4CCMA 1ETKA 3S16J 3HTUA 4P9FA 3BZCA 2L9VA 2ZXIA 3HPGA 4JX6A 2IGOA 1K78B 1X1DA 3E1SA 2NVXJ 2HI3A 3KE2A 1Z3YA 2O0YA 1GHCA 1HXDA 1HCRA 2MH9A 1TWCJ 5FD5A 1I5ZA 2DOFA 1YW8A 2AXTC 1BA5A 2VN2A 2ZXJA 3PUBA 4Q4ZF 4GRIA 4BXFA 4HDVA 3KP3A 1BIAA 3C2HA 3BCBA 4WF2A 3DKXA 4WXHA 1IG7A 4FISA 1GV5A 1KONA 4FTHA 1CQTA 1I39A 3DKWA 1V3FA 4IHYA 1ZRDA 1YIOA 3PSIA 2X1CA 1ZG5A 2CW8A 4A2UA 2K9QA 3ZN0A 3SFIA 3K2AA 4XLEA 3UNGC 2KMUA 3KP6A 2OZUA 2H6BA 4CYDA 2QSGX 2VKEA 4KA4A 2LBFB 4LK1F 5E1ZB 1UHSA 1G4DA 5D5WB 2DA6A 2E36A 2OZ6A 4A5MA 5B1AH 3V7RA 1FZPB 1ZARA 5B3SH 4BHPA 1MBJA 2EV0A 3QAHA 5LD2C 2A69F 2M7AA 4M3GA 2NS8A 4S0HB 4IF4A 1B9MA 4HEA2 1WWXA 3DWLE 3ZQFA 5E3OA 1WI3A 2ZCWA 2XKOA 4HYEA 2CJJA 5LGNA 2CH0A 4E70A 1OYWA 1SVLA 2ZMEA 4MEYF 1ACIA 1HLVA 2R7VA 1R5ID 3KZYA 5EZGA 3ABUA 4K2EA 2ZKZA 4MIMA 2GZWA 3BC8A 2X4HA 1FSHA 3PL8A 1ZKGA 3MZ8A 3QP6A 4IEJA 4LOCA 4OMZA 1FY7A 2VB6A 3OYAA 4AM3A 2LSOA 2A6HF 2QF7A 2XAHA 3Q0VA 2VLAA 3V8JA 4CUGA 2GM4A 4BHCA 2X48A 3I53A 3M4OJ 4HOBA 2R4GA 4RAGA 4YIRX 4LIVA 3GFIA 3G4SI 2F5CA 2WB1A 1SVOA 3VOEA 1SD6A 2R5ZB 4CICA 2D1VA 4IPAA 4E6KG 5H6RA 3CCLI 5JFRA 4IRIA 3L1PA 1VQ9I 2QKMB 1Y1VJ 4BU2A 1MDMA 2PG4A 3DPLC 2DPDA 2QQ9A 2BY1A 4EMSA 4BXXJ 1X4PA 1NG7A 2A6TA 1SEUA 1LVAA 2DLLA 3ABLH 4IHWA 1N77A 1ETYA 1FNNA 1YX3A 4Y7NJ 1WJFA 3L2CA 2TCTA 1MJ9A 4HQEA 1HKSA 4Y52J 1RZ4A 4QLCU 3F8NA 1MH3A 1T6SA 1VQPI 2R7OA 2RVCA 3GLLA 3JR9A 2P5KA 1YJWI 1SC7A 4R1HA 5LGTA 3LQQA 2CG4A 4UUSA 2UV1A 2ID3A 3ZOBA 2KT0A 2KRCA 2EH3A 2M34A 4HZFA 1LDDA 3DPUA 3FM5A 3DBLB 4HW0A 1W0UA 3QYEA 1YRNA 2R5YA 3IKTA 4XLHA 1OCZH 3H92A 4ANJA 2AHQA 2W48A 4CYCA 1MMSA 2PQ8A 1Z1DA 2HXIA 2FE3A 3WU2C 2DYSH 4Y33A 5J3LA 3MFKA 3JRGA 4LB5A 2R0QC 2QBYA 3F21A 2L7ZA 5E20A 3C2BA 4PSXA 3Q0UA 3PQJA 5C3EJ 3CUOA 3DLAA 2L02A 2COMA 2V26A 2XSJC 5TGTA 1DUXC 2DU9A 2BBYA 3LSGA 2L7FP 5E8IA 2DMPA 5DS9A 3MVPA 4A0YA 2FQ4A 2A3SA 3HGYA 3HUGA 5CYVA 1ZGAA 2FMLA 1TW2A 3FM3A 1FX7A 2RV8A 3F72A 5LEJA 3PNVA 3GO5A 4RB1A 1BC7C 4B48A 2Z5UA 2V9KA 3KEOA 3TMOA 1QHGA 3HBLA 3BPVA 3DU6A 5FKLA 5DYMA 4ASNA 4LG0A 4ENMA 1PUFB 5KNLA 1PVEA 5DD4A 1D8KA 2ELJA 3DKYA 3I71A 3JAMK 1TWGJ 4YFKF 1FOWA 1P4WA 3ZMZA 1XGOA 4BHBA 1T95A 3DLLF 4XORA 1A04A 2BHZA 3FXLA 1SMYF 1EJ9A 1P7IA 4I01A 4CO8A 5M5YJ 5CQEA 3HJEA 2V6EA 2GOMA 1U5TC 1YG2A 2WA0A 3VDXA 2ZJRF 2LF7A 1RRJA 4XKVA 4BQQA 3OSFA 4ZYAA 5IT3A 1O3SA 2HGCA 3MD2A 4G12A 4KT6A 1YE9A 4OU0A 5FKNA 2LNBA 2GA1A 3JTHA 1M1EB 1T98A 2V9VA 3FMQA 2CS3A 1W7PD 4BACA 3BJOA 1IO2A 3FK6A 1U5TA 5KHDA 3BQYA 2HOTA 3FXOA 3ECHA 2KIMA 3F9KA 1T38A 1JUMA 4XRFA 2P4WA 3CUQC 1CF7B 2F5VA 2V6CA 5LFAA 4BYYA 5GAHJ 4MTDA 2WAFA 2EB7A 3T8RA 2FOWA 2L2OA 3DCFA 4J19A 2W25A 4BNCA 1XSVA 3BR1A 3W2VA 3GTQJ 1FSEA 2X6YA 3DEWA 4C2UA 2KJCA 1KGSA 2ZC2A 3BJAA 1XX5A 4XIDA 4XQFA 1YOVB 2VBYA 3WGIA 5LHIA 4ENNA 3MZHA 1NTCA 1R4NB 3GF2A 2DK8A 2E60A 1KU7A 2JUCA 3BZ6A 4RLFA 5KAIC 4XLNF 2M4GA 4IL6C 2ZMEC 4IVNA 5JVGF 1ITYA 3S3MA 3E5XA 4BQOA 4C2TA 3Q3SA 1IXSB 1S5LC 3DV8A 3PIPF 4FE4A 5E3MA 2ZXWH 4JQFA 1DPRA 2O7OA 4NNJA 3HTSB 2QQBA 1P4AA 3I5UA 5TJJA 4UUTA 4ZC3A 2Y69H 3ZCOA 3CCRI 2LDUA 2L54A 4BE0A 4I2OA 3FWEA 2UXNA 2Z9OA 2LKSA 3K1NA 2XAQA 4EQQA 2JT1A 4HNVA 3QQAA 2IS6A 1OR7C 3E7LA 5FLMJ 1PUEE 4N4OB 4HLYA 4TV7A 2P81A 1A5JA 5J1YA 1ULYA 4F91B 3PO3J 2OAZA 1F4KA 1VQKI 3WE3A 1JHHA 5BPDA 1J5YA 3O8GA 2BOLA 1JT0A 3RKXA 2DMQA 2NOGA 4GYGA 1P7JA 5AIPA 3P9IA 1AKHA 1BJAA 2KJBA 4EM2A 3HOXJ 4S04A 2D1HA 1MBHA 1WRJA 3QU3A 2O6GE 4CXFA 2PX9A 2MBFA 4EJWA 5L3CA 2GXGA 3B02A 1SFEA 5IYCJ 1L3LA 1B9NA 1Z77A 5J4YA 1HBXG 2ZNZA 1FEXA 1P6RA 4HV6A 2UUZA 2Z33A 2EJRA 1K4SA 2QSHX 3GTLJ 4I09A 4J01A 4UV9A 4XNFA 3GTOJ 3HRSA 4RB2C 4D1QA 5DCMB 1R23A 1ZYRF 3CF2A 2KZVA 3RQ4A 4HSTA 1VQ6I 3S14J 1XDSA 3E97A 3S3NA 3HRMA 1B72B 3H5NA 2MLKA 2NNYA 2VODA 1H0MA 2F2EA 2L0KA 2JSPA 4XR6A 3HKZN 2A61A 5FKOA 5JVTA 2QA4I 1Z91A 3GLXA 2J5PA 3COAC 3EYYA 3OOPA 3I54A 3IAM2 1WFXA 1W7PA 3ASNH 2I8DA 3KPHA 2IP2A 3F6OA 3R60A 1V5GA 4HNTA 3JRIA 3HC7A 2QLZA 2WAQN 2HDWA 5E79C 1GDTA 1IAWA 1JTXA 2E35A 1MBEA 4IHVA 3BTCA 5ICFA 4YFXF 2OD5A 3GTGJ 2E5NA 2M8GX 1DP7P 4ESBA 3ERED 3F0CA 2F4IA 3E3VA 3SEZA 1AWCA 1A6IA 3QRFF 2Y0MA 1TP4A 2NOJB 3JRFA 4E7KA 3S1MJ 4MTEA 1VNDA 3JSPA 4OIRF 2E1CA 5J1RA 4RGUA 1XMKA 2XKPA 2RAEA 2LD5A 2IS1A 4GDFA 1QGPA 3W2AA 1SAUA 4BGDA 4ENKA 4KJZA 1T0FC 1T56A 2D2WA 3FBNB 3RYPA 2VJ5A 4B3AA 1D5VA 3PQKA 5M5XJ 2VONA 2ZO4A 3V8LA 5J6XA 4U88A 2LKXA 1W36D 2WWYA 3ZQHA 2V1DA 4RAZA 1RPWA 5F08A 2IXSA 5LRSA 3C1DA 2EA2A 3G1OA 4FX0A 1SMTA 4Z6YA 1YRNB 1VQOI 2M2EA 5EJCA 3AG2H 4PZJA 2LRDA 2HR3A 3OV8A 1LFUP 2V1NA 1J9IA 4L5EA 3HZJA 1IN7A 3IUOA 4A3BJ 4UVBA 2BE5F 3B73A 1BN5A 1LNWA 1U0JA 2VI6A 3HHHA 5K7HA 4A69C 1QVUA 3KLNA 2FXAA 3OYCA 3L2VA 5E8GA 3ZMTA 4NHJA 2LOOA 3QPHA 4G6TB 1Z21A 3TP0A 4UUSB 2FBHA 2H8RA 1YX5A 3ZQGA 2LBFA 2NNNA 1WI9A 3FXQA 1RR7A 2O8KA 1WZ2A 4M74A 1OISA 2XVCA 3CCYA 1LEBA 2LKPA 2DA5A 4LLLA 3H0DA 4DGWB 3H1CA 2R93J 4MQ9F 1XGNA 2B9SA 4UVAA 1FBUA 2CUJA 2L9SA 4NBQA 1FT9A 1MZBA 2E7XA 3GYHX 1XSDA 1HOMA 2O8XA 4UB6C 4OAZA 4CDGA 5KCMA 4XICA 1SANA 4KN4X 3B6CA 2ETHA 1W1WE 2QKLB 2VT2A 1JJ6C 3DXJF 4C3JJ 4WX9A 4DZJA 2JMWA 3BCAA 3ABMH 3I59B 2DJIA 2ACJA 4L9NA 2WB1N 5D5UB 1WJAA 1Y39A 2VE8A 1HA8A 1J0RA 2Y75A 1EH8A 3GXOA 1ODDA 3FHZA 3D0SA 4HF1A 5J40A 1IZ1A 5CKTA 4HA8A 4RS8A 2JJ7A 2M4KA 4I76A 3TL4X 2MD5A 1MIJA 1B6AA 2MABA 3NRVA 1VZ0A 2R7QA 4B8XA 3HOWJ 2ECBA 2RQPA 3BR3A 3GTPJ 3QPSA 2FNPA 4B09A 5K7ZA 4UVCA 2KHMA 3OL4A 3BTLA 2XRLA 4LLGF 1USTA 2Z1DA 3FXKA 3TW6A 3AKZA 3RSNA 2W1OA 1JUPA 3RTRA 5F0HA 3CC2I 5DUKA 4KNYA 2F5FA 1U9NA 2N8GA 3R0AA 3HIFA 2DPUA 2V1UA 2O61A 4D5CA 2DA1A 4BH9A 3GZ5A 4HX8A 2HYJA 2ZXHA 4RM2A 2MD0A 3GZNB 1NK2P 1WSUA 4JX5A 1FLIA 3E6CC 4A3DJ 5B1BH 3HGGA 1Z7LA 1S8NA 1NHAA 1JE8A 1FOYA 4EGZA 1QBJA 3W3CA 2I10A 3EUKL 3P5JA 2DQLA 5EEHA 2EFOA 4YIIA 4MQVA 2LP0A 3SDBA 2IGMA 2P0WA 2WC2A 3CO6C 2R92J 1ONVA 1TT0A 4EGYA 2H1LA 3M3YJ 2CQ7A 2HVSA 3ASOH 2BY3A 4JYKA 4ESFA 1BW5A 2V4JC 3DQVC 3IWZA 3JRBA 5DCFA 2L5QA 2P8TA 2BXZA 3M9AA 1WGXA 3BLYA 3ML6A 4FHTA 1QZEA 5HS9A 4AWXB 2ISYA 3V7SA 2IGKA 4HF0A 3K9TA 2L7KA 4CGZA 2DW4A 1YW7A 1KQ9A 1VQ8I 2DTRA 3GTJJ 3K70D 3MCZA 3UR3C 3L2QA 1BOBA 4ZTFA 2XF5A 4W1UA 1K78A 3E0JB 4C3HJ 5D8KB 4IX7A 1ON1A 1F5TA 2IA0A 1QPMA 1U78A 2HOAA 3EUHC 1FYMA 4M3DA 1ZG1A 2Y9YA 3NQOA 4HNUA 2M7BA 4XOPA 3K1MA 3CO7C 3REOA 2K4JA 4EJOA 1LFPA 5JLXA 2Q2EB 2KRFA 2VBXA 2YSRA 3HSEA 4B3XA 2GAUA 3JTGA 1HW2A 1N78A 3V4GA 5HODA 2H09A 2K40A 1R58A 2R7SA 2FA5A 2J5OA 5H2FC 2ZNYA 1R22A 3P7NA 4ZJZA 1BIBA 4G7OF 3H5RA 2PMHA 2Z99A 3DF8A 2VKHA 4OIQF 4U0VA 3EETA 2L9NA 4BQNA 1MW7A 1OR7A 4ITVA 4RB3C 1F1ZA 1BI0A 2ZSHB 4II2A 5HDGA 2K9SA 5IP9J 1SFXA 1Q1VA 5JHFA 4KITB 2CGPA 9ANTA 1D1CA 2Y31A 2ME0A 1XMAA 2R7TA 3VB2A 2ESNA 3MAJA 4C3IJ 1Z7UA 3S1RJ 3QWLA 2JA7J 3D1NI 3S1NJ 2VPLA 1JKPC 1PUFA 4C30A 5FD6A 3J7AY 2R7UA 4S05A 1LFBA 2P5VA 4MNUA 3H3VK 2DDAA 1W5SA 2HFHA 1K83J 1POGA 1MBKA 5GTHC 2XGXA 2M0CA 1OYYA 4ON0A 1R9TJ 3RKQA 1J75A 4ZDPA 3O8HA 1IRXA 2K9LA 2FU4A 1LB2A 4DNCA 3ZMSA 1I6HJ 3OYJA 2OPTA 1JI8A 5F0CA 5BQTA 2EIJH 4JP0A 2HDDA 3QU6A 2PN6A 2W84A 3RYRA 5FB2A 1IW7F 1B59A 3FK7A 5LEKA 4G6DA 1E3HA 1S72I 1FYKA 1DU0A 3ELKA 5L3GA 1ETQA 3NWTA 2EIKH 2GBYA 4QPOA 5FFZA 2HZDA 2QWWA 3OS2A 1IDZA 3CMMA 2PJPA 1J09A 3SDGA 2LY1A 4FQGA 2WY8Q 5TISC 3HOVJ 1AOYA 2VXZA 1FYLA 4GYIA 4WXDA 4EJUA 2EZLA 2XPVA 4I7HA 4KYWA 2PJRA 1IRGA 4FT8A 3K4LA 2E5ZA 3B6AA 2DA3A 3GW2A 1UMQA 3LA7A 1D1AA 1FOKA 1GT0C 1TL8A 3JSOA 4IHSA 2CQKA 4ZDLA 4BE2A 3KZZA 1BL0A 2XASA 2DMUA 4LIUA 4XSXF 2K86A 2F48A 2LLKA 2NXNB 2OV7A 2HEOA 3DP7A 2FSWA 1UCRA 2QVOA 4AIDA 1IJWC 3BROA 2HPIA 3RKYA 1E3OC 4B44A 2DO7A 2LH9A 1OQYA 1IC8A 2A5YB 2I5UA 4CCLA 2M30A 4LITA 3TOAA 4Z2YA 3SZGA 2K9MA 4UY8I 5CVUA 1G3WA 3RKWA 2JRTA 1KQ0A 1U6GA 1TC3C 1LE8B 3AL0B 1ETVA 4U7DA 1D0ZA 5B66C 4HV5A 4PJLA 2KISA 4AVPA 4M3EA 4XONA 5JI6A 3HOTA 1FOXA 1Z05A 3IRRA 3LQRA 5CVJA 2IA2A 3RZOJ 2R3SA 2QQAA 1G8XA 1OCCH 2VT3A 3BDDA 3KCCA 4G94A 5FROA 2KDZA 2XGDA 4M9SA 1XCBA 2DOAA 2BW3A 2JPBA 3K70C 3A01A 2D5VA 4OAYA 1BJZA 1GVJA 1QA6A 1F43A 5AONA 3BG7A 5GAGJ 3JRDA 5H6QA 5C4JJ 3CDIA 1Y6IA 5DD8A 1IRZA 4L9TA 1X2MA 3CCVI 3JRCA 2YUSA 2NVTJ 2DTZA 2CV1A 2OA4A 3VYTB 2CQNA 5CLSA 4I0BA 3FIWA 3W6JB 2CFOA 5L3FA 2W57A 4XL9A 5HDKA 3SFZA 1SFUA 3BR6A 4M71A 2IS2A 1GVDA 1T33A 5E18F 2DFIA 2JPCA 3CC4I 4XM3A 2UZKA 3TO9A 2DOEA 3BG6A 2CQQA 4HLXA 2VC0A 1QRYA 1Z67A 1IV6A 1ZRFA 3KYDB 2DFFA 4HSRA 4MHGA 3S2HJ 1JGGA 4X6AJ 3S32A 4RAFA 3RQIA 3I0TA 4A0ZA 4E7SA 4OOIA 1VQ7I 2PJRB 1TT5B 1ZR2A 1Z9CA 5CPRB 2RGVA 4FASD 1MGTA 3TO6A 5JR3A 3ZRGA 3CMYA 3VWBA 4ZDOA 1HKTA 3ISPA 5CQGA 1IUYA 1KQ8A 3ABKH 2JN6A 5FKMA 2M3AA 1RIOH 1LEAA 1RNLA 1Z3XA 2M9HA 5CJ9A 1OPCA 3LAPA 3SJMA 4ZYEA 5FRMA 4BEHA 1BI1A 2HKXA 2VQCA 1SVMA 3VYUB 3K10A 3A2KA 4RBOA 3ZMUA 3FDYA 2IAIA 3PM1A 1O3RA 4M73A 4EJVA 2UXXA 3CJRB 2PFBA 5DTDA 2XDVA 3OL3A 1XMXA 4LGWA 3RZDJ 1EV7A 1W0TA 4LG3A 4XN0A 2QUFA 2XF6A 1STZA 4U0WA 3LSRA 4AIKA 1XB4A 1XS9A 1H9TA 2E7WA 3Q0WA 2HTJA 3BPXA 3MKLA 4V19K 2R7ZJ 3S3OA 1VFCA 2ZJQF 1LVKA 3J80Z 3ZR8X 3HPHA 3BTIA 5ICGA 1ON2A 4M6YA 3CLOA 4LB6B 2F6CA 3QP5A 1ZN2A 1WH5A 1WPKA 1R71A 3IRQA 1N25A 2DYRH 2XAJA 2FRHA 5L3BA 4BXUA 3LFKA 4M6VA 1JTYA 2LK2A 1QU3A 4F92B 3H0GJ 2KLOA 2EILH 1JKOC 4RGSA 2RN7A 1YLFA 1YQAA 1HKQA 2XIGA 4ZTJA 2DAOA 5BPIA 1LPQA 3OSGA 4BJTA 3IAS2 4DYQA 1LDKB 3H35A 1FP1D 3I56I 2JWTA 1ZTRA 2BVMA 3G6EI 3NWSA 2EZKA 2NYXA 5LHGA 3KYLA 2FF4A 4NQWB 3QPLA 3WG7H 3VSKA 4IKFA 2M1BA 2VQGA 3X2QH 3MMYB 3D5LA 3GMEA 2OU2A 2HQRA 1WCMJ 3A02A 4UB8C 1YIJI 1EA3A 1RESA 1D0YA 1WJCA 3K1PA 3MEXA 2A5WA 1TQIA 3IL2A 3CCUI 3S2DJ 3KIOA 3AL0C 3EUHA 4ETSA 4Q5SF 2CFXA 3R6SA 1A36A 1UZCA 2B0LA 4P9UA 3LA3A 2E2HJ 1NG6A 3M1EA 1BI2A 1ERDA 3BZKA 1LDJA 2L01A 1X19A 5EYRA 1EH7A 1D1BA 2WADA 1W4MA 3JREA 2VPRA 3L09A 4JBAA 1ZAOA 1X1PA
chains in the Genus database with same CATH topology
3HOZJ 4XICA 1SANA 1QPIA 3B6CA 1ETKA 3S16J 1JJ6C 4C3JJ 4DZJA 2JMWA 2E1OA 4JX6A 2H1KA 2WB1N 2NVXJ 2CQXA 2HI3A 5EF6A 2MG4A 1HCRA 2GLOA 3BR5A 1TWCJ 2OF7A 2MW8A 1ETOA 1BA5A 2JJ7A 4I76A 5E3NA 5F0FA 3HOWJ 2DMTA 2ECBA 3BR3A 2ME6A 2DMNA 2HXOA 4EEFG 1IG7A 3GTPJ 4FISA 1GV5A 3QPSA 4FTHA 2NVQJ 1GUUA 5K7ZA 1CQTA 4I6ZA 4M3BA 3BTLA 2XRLA 4IHYA 3NARA 5E3LA 1OFCX 3IH2A 3TW6A 3WHBA 4MFEA 5GP9A 2WV1A 2ELKA 1JUPA 1RKTA 5F0HA 2K9QA 4DYRA 3SFIA 3K2AA 1U9NA 2N8GA 3TW7A 3HOUJ 4AUXA 2XB5A 3BG9A 2VKEA 4D5CA 2DA1A 1UHSA 2DA2A 2IBDA 2DA6A 1H88C 5IOYA 3I4MJ 2HYJA 3S17J 1WH7A 1MBJA 4A3EJ 1NK2P 4M3GA 2NS8A 4JX5A 4S0HB 5EZHA 4A3DJ 3HGGA 5GPAA 3ZQFA 5E3OA 2O9LA 1WI3A 2L9RA 2CJJA 3IH3A 4AC0A 5GPCA 1HLVA 5EZGA 3MN2A 2I10A 3S15J 2XB0X 4XRSA 4MIMA 2LP0A 4IEJA 1ZKGA 2R92J 4LOCA 3M3YJ 1MSFC 3Q0VA 2QF7A 3ZQIA 4JYKA 1BW5A 2DA4A 2GM4A 3JRBA 1APLC 1QVTA 2X48A 1AHDP 3M4OJ 5EEAA 4DW6A 1WGXA 1HDPA 3K7AJ 4A3MJ 3TEDA 2R5ZB 2MGQA 1K61A 3L1PA 3GTJJ 1Y1VJ 4NDLA 3IH4A 2EZIA 4W1UA 4BXXJ 4C3HJ 4QTRA 2ID6A 5IOZA 1U78A 4IHWA 2HOAA 2LFBA 4A3KJ 4M3DA 1ETYA 4Y7NJ 2Y9YA 2TCTA 3BG5A 1JUSA 2NVYJ 2YU9J 1VF9A 2IEKA 4Y52J 2XSDC 5M5WJ 1X2NA 1MH3A 5JLXA 2B63J 3JR9A 5HODA 4V2FA 4UUSA 1JJ8C 3PO2J 2LVSA 2K40A 4BY1J 2ID3A 5IYBJ 2TRTA 3ZOBA 2KT0A 2EH3A 2M34A 2R5ZA 2E19A 1W0UA 1YRNA 2NS7A 2R5YA 4A3CJ 1FIPA 1MNMC 1AKHB 1I3QJ 3BQZA 4RDUA 2AHQA 3NAUA 1VI0A 2W48A 4CYCA 2LY9A 1IDYA 4D7MA 1U9OA 1F36A 2HXIA 4V2GA 3HOYJ 3JRGA 2K9SA 5J3LA 1S7EA 1Q1VA 5IP9J 2R0QC 2L7ZA 9ANTA 3C2BA 2Y31A 2ME0A 3Q0UA 5C3EJ 1JT6A 4C3IJ 3S1RJ 1IUFA 2JA7J 3D1NI 5IPAA 3S1NJ 3LSGA 5FKKA 2L7FP 2G0EA 2DMPA 5DS9A 3MVPA 1JKPC 2FQ4A 3HEFA 5F27A 1PUFA 3HGYA 5F04A 4FCYA 5J1UA 5M3FJ 3BR0A 1LFBA 4JX4A 1ETXA 3H3VK 2EQRA 1ZR4A 1K83J 1D5YA 1POGA 3HBLA 1MBKA 1TWAJ 4ABZA 5FKLA 2M0CA 1PUFB 1IGNA 1R9TJ 3RKQA 1BW6A 2DA7A 3O8HA 3UKGA 2VUMJ 2HOSA 1TWGJ 3CQZJ 4XK4A 1I6HJ 2OPTA 5F0CA 4JP0A 2HDDA 5EG0B 1P7IA 4BY7J 3BT9A 5M5YJ 5EGOB 1ETWA 3FK7A 1DU0A 1ETQA 3OSFA 2GBYA 3CDLA 5IP6A 4G12A 1IDZA 5FKNA 2EBIA 3SDGA 5IP7J 1JKQC 5C4XJ 1TWFJ 3HOVJ 5F1JA 3FK6A 4A3JJ 3BQYA 2HOTA 1TWHJ 1DU6A 2EZLA 2XPVA 4QSHA 1JUMA 2CUFA 3BTJA 3B6AA 2DA3A 1I50J 1UMQA 1AU7A 1GT0C 4BBSJ 1GV2A 3DCFA 4J19A 1BL0A 2R5YB 2DMUA 1RKWA 3BR1A 3GTQJ 2ECCA 3BR2A 2LLKA 3DEWA 3WHCA 4XRMA 1B8IA 2L7MP 4XIDA 1IJWC 4D5FA 1E3OC 3ZQLA 2X9DA 1NTCA 5IYDJ 5FJ8J 1IC8A 1ZK8A 1ITYA 3Q3SA 3G1LA 4FE4A 2HQ5A 5E3MA 2CUEA 2AO9A 2O7OA 1TC3C 1LE8B 1OCPA 1ETVA 4GFBA 4UUTA 1FTTA 3LNQA 3TP3A 4M3EA 3GTMJ 2QCOA 3RZOJ 4CYCB 2KDZA 2XGDA 4HNVA 2CRGA 3QQAA 1MSEC 4X1EA 2D5VA 3A01A 3E7LA 5FLMJ 1BJZA 4QIWN 1F43A 3JRDA 1A5JA 2P81A 1MBFA 5J1YA 5C4JJ 3PO3J 1IRZA 1X2MA 3O8GA 3JRCA 2VKVA 4A3IJ 2YUSA 1JT0A 2NVTJ 2DTZA 3GBGA 2DMQA 2NOGA 3LOCA 5C44J 3FIWA 1P7JA 4A93J 1AKHA 2COBA 1H8AC 3BR6A 1GVDA 3HOXJ 1T33A 2XPWA 1HF0A 3I4NJ 1MBHA 1ENHA 1ORKA 2CQQA 1HDDC 1QRYA 1IV6A 4FE7A 1FJLA 5IYCJ 1Z77A 1FEXA 3S2HJ 1JGGA 2PMZN 2YS9A 4A3LJ 4AYBN 4MO7A 1Y1WJ 3GTLJ 4X6AJ 4B4CA 3RQIA 3GTOJ 1NK3P 1U8BA 3OOUA 1ZR2A 2XGEA 2XPUA 3JRAA 2XGCA 4IHXA 3GTKJ 2Y0SN 4MLOA 1FIAA 4XRSG 2LR8A 3W6VA 4BBRJ 3S14J 3CMYA 1B72B 2Y30A 2DJNA 1UG2A 4DYCA 3LSPA 3G1MA 2ZB9A 4W97A 2JN6A 2L0KA 5FKMA 1B8IB 3ZQCA 2LTPA 2JA5J 3HKZN 5FKOA 2M9HA 2Y9ZA 1OJLA 1EF4A 1OCTC 3SJMA 5FLVA 1B72A 3IV5A 3JRIA 4RBOA 5EG0A 3BG3A 1RETA 2IAIA 2WAQN 3PM1A 1GDTA 1JKRC 4DZPA 1JTXA 1MBEA 5DTDA 2E2JJ 4IHVA 3BTCA 3RZDJ 1W0TA 1XG1A 3GTGJ 3HM5A 3LSRA 1X58A 1XS9A 2M8GX 3Q0WA 5JLWA 2R7ZJ 3MKLA 1VFCA 5EDNA 3F0CA 3VPRA 3A03A 3HB9A 3BTIA 1A6IA 2JA8J 1XC5A 3JRFA 1MBGA 3S1MJ 1VNDA 5J1RA 1WH5A 1WPKA 2RAEA 2LD5A 2X6OA 2EZHA 4M6VA 1JTYA 2LK2A 3H0GJ 1JKOC 1T56A 1LE8A 4A3FJ 4B3AA 2E2IJ 5M3MJ 5M5XJ 3JRHA 2Y2ZA 2FD5A 3OSGA 2DN0A 4C2MJ 4D7NA 2LKXA 1MH4A 3LSJA 4DYQA 2FJ1A 3ZQHA 2FX0A 2JWTA 1ZTRA 1RPWA 5F08A 2EZKA 5BNGA 3G1OA 1O4XA 3QPLA 3HDDA 1YRNB 3A01B 4A3GJ 4M3FA 2K9NA 2M2EA 4MFDA 1Z0XA 1LFUP 2JK3A 1SFOJ 1WCMJ 3A02A 5EGOA 1G2HA 4L5EA 4A3BJ 1RESA 3FKIJ 2VI6A 4BKXA 5K7HA 4A69C 1QVUA 1FTZA 2MSYA 1ZGWA 4B1RA 3S2DJ 3TP0A 4UUSB 2H8RA 3ZQGA 3S1QJ 1H89C 1RR7A 2O8KA 2CU7A 3CCYA 2E2HJ 2DA5A 3FISA 2JA6J 2R93J 3OIOA 1ZQ3P 5EYRA 3JREA 2VPRA 1HOMA 5K7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOZ J;  4XIC A;  1SAN A;  1QPI A;  3B6C A;  1ETK A;  3S16 J;  1JJ6 C;  4C3J J;  4DZJ A;  2JMW A;  2E1O A;  4JX6 A;  2H1K A;  2WB1 N;  2NVX J;  2CQX A;  2HI3 A;  5EF6 A;  2MG4 A;  1HCR A;  2GLO A;  3BR5 A;  1TWC J;  2OF7 A;  2MW8 A;  1ETO A;  1BA5 A;  2JJ7 A;  4I76 A;  5E3N A;  5F0F A;  3HOW J;  2DMT A;  2ECB A;  3BR3 A;  2ME6 A;  2DMN A;  2HXO A;  4EEF G;  1IG7 A;  3GTP J;  4FIS A;  1GV5 A;  3QPS A;  4FTH A;  2NVQ J;  1GUU A;  5K7Z A;  1CQT A;  4I6Z A;  4M3B A;  3BTL A;  2XRL A;  4IHY A;  3NAR A;  5E3L A;  1OFC X;  3IH2 A;  3TW6 A;  3WHB A;  4MFE A;  5GP9 A;  2WV1 A;  2ELK A;  1JUP A;  1RKT A;  5F0H A;  2K9Q A;  4DYR A;  3SFI A;  3K2A A;  1U9N A;  2N8G A;  3TW7 A;  3HOU J;  4AUX A;  2XB5 A;  3BG9 A;  2VKE A;  4D5C A;  2DA1 A;  1UHS A;  2DA2 A;  2IBD A;  2DA6 A;  1H88 C;  5IOY A;  3I4M J;  2HYJ A;  3S17 J;  1WH7 A;  1MBJ A;  4A3E J;  1NK2 P;  4M3G A;  2NS8 A;  4JX5 A;  4S0H B;  5EZH A;  4A3D J;  3HGG A;  5GPA A;  3ZQF A;  5E3O A;  2O9L A;  1WI3 A;  2L9R A;  2CJJ A;  3IH3 A;  4AC0 A;  5GPC A;  1HLV A;  5EZG A;  3MN2 A;  2I10 A;  3S15 J;  2XB0 X;  4XRS A;  4MIM A;  2LP0 A;  4IEJ A;  1ZKG A;  2R92 J;  4LOC A;  3M3Y J;  1MSF C;  3Q0V A;  2QF7 A;  3ZQI A;  4JYK A;  1BW5 A;  2DA4 A;  2GM4 A;  3JRB A;  1APL C;  1QVT A;  2X48 A;  1AHD P;  3M4O J;  5EEA A;  4DW6 A;  1WGX A;  1HDP A;  3K7A J;  4A3M J;  3TED A;  2R5Z B;  2MGQ A;  1K61 A;  3L1P A;  3GTJ J;  1Y1V J;  4NDL A;  3IH4 A;  2EZI A;  4W1U A;  4BXX J;  4C3H J;  4QTR A;  2ID6 A;  5IOZ A;  1U78 A;  4IHW A;  2HOA A;  2LFB A;  4A3K J;  4M3D A;  1ETY A;  4Y7N J;  2Y9Y A;  2TCT A;  3BG5 A;  1JUS A;  2NVY J;  2YU9 J;  1VF9 A;  2IEK A;  4Y52 J;  2XSD C;  5M5W J;  1X2N A;  1MH3 A;  5JLX A;  2B63 J;  3JR9 A;  5HOD A;  4V2F A;  4UUS A;  1JJ8 C;  3PO2 J;  2LVS A;  2K40 A;  4BY1 J;  2ID3 A;  5IYB J;  2TRT A;  3ZOB A;  2KT0 A;  2EH3 A;  2M34 A;  2R5Z A;  2E19 A;  1W0U A;  1YRN A;  2NS7 A;  2R5Y A;  4A3C J;  1FIP A;  1MNM C;  1AKH B;  1I3Q J;  3BQZ A;  4RDU A;  2AHQ A;  3NAU A;  1VI0 A;  2W48 A;  4CYC A;  2LY9 A;  1IDY A;  4D7M A;  1U9O A;  1F36 A;  2HXI A;  4V2G A;  3HOY J;  3JRG A;  2K9S A;  5J3L A;  1S7E A;  1Q1V A;  5IP9 J;  2R0Q C;  2L7Z A;  9ANT A;  3C2B A;  2Y31 A;  2ME0 A;  3Q0U A;  5C3E J;  1JT6 A;  4C3I J;  3S1R J;  1IUF A;  2JA7 J;  3D1N I;  5IPA A;  3S1N J;  3LSG A;  5FKK A;  2L7F P;  2G0E A;  2DMP A;  5DS9 A;  3MVP A;  1JKP C;  2FQ4 A;  3HEF A;  5F27 A;  1PUF A;  3HGY A;  5F04 A;  4FCY A;  5J1U A;  5M3F J;  3BR0 A;  1LFB A;  4JX4 A;  1ETX A;  3H3V K;  2EQR A;  1ZR4 A;  1K83 J;  1D5Y A;  1POG A;  3HBL A;  1MBK A;  1TWA J;  4ABZ A;  5FKL A;  2M0C A;  1PUF B;  1IGN A;  1R9T J;  3RKQ A;  1BW6 A;  2DA7 A;  3O8H A;  3UKG A;  2VUM J;  2HOS A;  1TWG J;  3CQZ J;  4XK4 A;  1I6H J;  2OPT A;  5F0C A;  4JP0 A;  2HDD A;  5EG0 B;  1P7I A;  4BY7 J;  3BT9 A;  5M5Y J;  5EGO B;  1ETW A;  3FK7 A;  1DU0 A;  1ETQ A;  3OSF A;  2GBY A;  3CDL A;  5IP6 A;  4G12 A;  1IDZ A;  5FKN A;  2EBI A;  3SDG A;  5IP7 J;  1JKQ C;  5C4X J;  1TWF J;  3HOV J;  5F1J A;  3FK6 A;  4A3J J;  3BQY A;  2HOT A;  1TWH J;  1DU6 A;  2EZL A;  2XPV A;  4QSH A;  1JUM A;  2CUF A;  3BTJ A;  3B6A A;  2DA3 A;  1I50 J;  1UMQ A;  1AU7 A;  1GT0 C;  4BBS J;  1GV2 A;  3DCF A;  4J19 A;  1BL0 A;  2R5Y B;  2DMU A;  1RKW A;  3BR1 A;  3GTQ J;  2ECC A;  3BR2 A;  2LLK A;  3DEW A;  3WHC A;  4XRM A;  1B8I A;  2L7M P;  4XID A;  1IJW C;  4D5F A;  1E3O C;  3ZQL A;  2X9D A;  1NTC A;  5IYD J;  5FJ8 J;  1IC8 A;  1ZK8 A;  1ITY A;  3Q3S A;  3G1L A;  4FE4 A;  2HQ5 A;  5E3M A;  2CUE A;  2AO9 A;  2O7O A;  1TC3 C;  1LE8 B;  1OCP A;  1ETV A;  4GFB A;  4UUT A;  1FTT A;  3LNQ A;  3TP3 A;  4M3E A;  3GTM J;  2QCO A;  3RZO J;  4CYC B;  2KDZ A;  2XGD A;  4HNV A;  2CRG A;  3QQA A;  1MSE C;  4X1E A;  2D5V A;  3A01 A;  3E7L A;  5FLM J;  1BJZ A;  4QIW N;  1F43 A;  3JRD A;  1A5J A;  2P81 A;  1MBF A;  5J1Y A;  5C4J J;  3PO3 J;  1IRZ A;  1X2M A;  3O8G A;  3JRC A;  2VKV A;  4A3I J;  2YUS A;  1JT0 A;  2NVT J;  2DTZ A;  3GBG A;  2DMQ A;  2NOG A;  3LOC A;  5C44 J;  3FIW A;  1P7J A;  4A93 J;  1AKH A;  2COB A;  1H8A C;  3BR6 A;  1GVD A;  3HOX J;  1T33 A;  2XPW A;  1HF0 A;  3I4N J;  1MBH A;  1ENH A;  1ORK A;  2CQQ A;  1HDD C;  1QRY A;  1IV6 A;  4FE7 A;  1FJL A;  5IYC J;  1Z77 A;  1FEX A;  3S2H J;  1JGG A;  2PMZ N;  2YS9 A;  4A3L J;  4AYB N;  4MO7 A;  1Y1W J;  3GTL J;  4X6A J;  4B4C A;  3RQI A;  3GTO J;  1NK3 P;  1U8B A;  3OOU A;  1ZR2 A;  2XGE A;  2XPU A;  3JRA A;  2XGC A;  4IHX A;  3GTK J;  2Y0S N;  4MLO A;  1FIA A;  4XRS G;  2LR8 A;  3W6V A;  4BBR J;  3S14 J;  3CMY A;  1B72 B;  2Y30 A;  2DJN A;  1UG2 A;  4DYC A;  3LSP A;  3G1M A;  2ZB9 A;  4W97 A;  2JN6 A;  2L0K A;  5FKM A;  1B8I B;  3ZQC A;  2LTP A;  2JA5 J;  3HKZ N;  5FKO A;  2M9H A;  2Y9Z A;  1OJL A;  1EF4 A;  1OCT C;  3SJM A;  5FLV A;  1B72 A;  3IV5 A;  3JRI A;  4RBO A;  5EG0 A;  3BG3 A;  1RET A;  2IAI A;  2WAQ N;  3PM1 A;  1GDT A;  1JKR C;  4DZP A;  1JTX A;  1MBE A;  5DTD A;  2E2J J;  4IHV A;  3BTC A;  3RZD J;  1W0T A;  1XG1 A;  3GTG J;  3HM5 A;  3LSR A;  1X58 A;  1XS9 A;  2M8G X;  3Q0W A;  5JLW A;  2R7Z J;  3MKL A;  1VFC A;  5EDN A;  3F0C A;  3VPR A;  3A03 A;  3HB9 A;  3BTI A;  1A6I A;  2JA8 J;  1XC5 A;  3JRF A;  1MBG A;  3S1M J;  1VND A;  5J1R A;  1WH5 A;  1WPK A;  2RAE A;  2LD5 A;  2X6O A;  2EZH A;  4M6V A;  1JTY A;  2LK2 A;  3H0G J;  1JKO C;  1T56 A;  1LE8 A;  4A3F J;  4B3A A;  2E2I J;  5M3M J;  5M5X J;  3JRH A;  2Y2Z A;  2FD5 A;  3OSG A;  2DN0 A;  4C2M J;  4D7N A;  2LKX A;  1MH4 A;  3LSJ A;  4DYQ A;  2FJ1 A;  3ZQH A;  2FX0 A;  2JWT A;  1ZTR A;  1RPW A;  5F08 A;  2EZK A;  5BNG A;  3G1O A;  1O4X A;  3QPL A;  3HDD A;  1YRN B;  3A01 B;  4A3G J;  4M3F A;  2K9N A;  2M2E A;  4MFD A;  1Z0X A;  1LFU P;  2JK3 A;  1SFO J;  1WCM J;  3A02 A;  5EGO A;  1G2H A;  4L5E A;  4A3B J;  1RES A;  3FKI J;  2VI6 A;  4BKX A;  5K7H A;  4A69 C;  1QVU A;  1FTZ A;  2MSY A;  1ZGW A;  4B1R A;  3S2D J;  3TP0 A;  4UUS B;  2H8R A;  3ZQG A;  3S1Q J;  1H89 C;  1RR7 A;  2O8K A;  2CU7 A;  3CCY A;  2E2H J;  2DA5 A;  3FIS A;  2JA6 J;  2R93 J;  3OIO A;  1ZQ3 P;  5EYR A;  3JRE A;  2VPR A;  1HOM A;  5K7F A; 
#chains in the Genus database with same CATH topology
 1V5F A;  3OYE A;  4BEH B;  1OCR H;  3TO7 A;  1HW1 A;  3V7C A;  5D4R A;  2H1K A;  2Z2S B;  4RMN A;  5J8F A;  2CQX A;  2EIM H;  5K5Q A;  2CV0 A;  2MG4 A;  3CP8 A;  1MMG A;  2GLO A;  1I27 A;  1Q1H A;  2JQ7 A;  6PAX A;  2V9P A;  3BR5 A;  1YTY A;  4RB0 A;  2VQH A;  4XLA A;  1W5T A;  2MW8 A;  2KRH A;  4HBL A;  1IN8 A;  3HSR A;  3QOE A;  3KP5 A;  4YIF A;  3GWZ A;  3C18 A;  5DM6 F;  2CW0 F;  4UV8 A;  3PFY A;  4KIB A;  4X0G A;  3M7G A;  2DMT A;  2ZFU A;  4EEF G;  3WOD F;  1YW9 A;  3WTV C;  4KIS A;  1GUU A;  1A35 A;  1S6L A;  2WBM A;  3TQN A;  2VQL A;  2WY7 Q;  4I6Z A;  3N97 A;  2MYS A;  1S7A A;  4C9Y A;  2VXD A;  3NAR A;  3DU5 A;  1OFC X;  2DDB A;  3IH2 A;  1DGW Y;  4M72 A;  4MFE A;  5GP9 A;  3CP2 A;  3ZQ7 A;  2WV1 A;  2ELK A;  2K7L A;  2E1M B;  4DYR A;  3FKJ A;  1CF7 A;  3K2Z A;  1R1V A;  3KLO A;  2XB5 A;  4AUX A;  1DQU A;  2Z16 A;  4P55 A;  3WGH A;  4M9X A;  2IBD A;  3J80 K;  5CVV A;  5F6F A;  2L3D A;  2PMZ A;  3S17 J;  1ZGJ A;  1WH7 A;  2ELH A;  3GEZ A;  3KP4 A;  4I0A A;  1XPX A;  4A3E J;  3LSI A;  1C0W A;  3G2B A;  2JTV A;  5K5R A;  2VKD A;  3V8K A;  2O9L A;  3M8E A;  1S29 A;  2HU9 A;  2LF8 A;  4BAY A;  2L9R A;  4CHU A;  3FXJ A;  2JVG A;  3IH3 A;  4AC0 A;  3MN2 A;  2MH2 A;  3S15 J;  4XRS A;  2VBW A;  1VTN C;  2ISZ A;  2QM3 A;  2CMP A;  1IRF A;  2A07 F;  1R36 A;  4E4H A;  1I1S A;  1X3W B;  1TQM A;  1MSF C;  5J8C A;  5FLX K;  1Z6R A;  2DA4 A;  1APL C;  2CUZ A;  3G3Z A;  5EEA A;  2O5R A;  4DW6 A;  5A2Q K;  3R61 A;  1HDP A;  2G7U A;  2W85 A;  1YHQ I;  5JHU A;  1BC8 C;  1BI3 A;  3J81 K;  3I64 A;  3EPZ A;  3S93 A;  3C2G A;  3R0J A;  1I3A A;  3SQN A;  3CCQ I;  4PDK A;  4NDL A;  4H0E A;  4KDP A;  3IH4 A;  2EZI A;  2HYF A;  2K3P A;  1RI7 A;  3GZ6 A;  2ICW G;  1ZEL A;  5K5O A;  1ZRE A;  1UJ8 A;  3CCJ I;  1X4O A;  2OUM A;  2Q2E A;  2YX4 A;  4A3K J;  3OYD A;  1T08 B;  1FBQ A;  5IT9 K;  4YG2 F;  1BOA A;  2YU9 J;  1VF9 A;  3CF5 F;  3TOB A;  3GFJ A;  4L5J A;  4PGH A;  2EPF A;  3G73 A;  3L9F A;  4ZYD A;  4NC6 A;  3SHF A;  1HSJ A;  4U0Y A;  4RA2 A;  3OYF A;  4F3Q A;  5HNF A;  3OYL A;  1BR4 A;  2LG4 A;  1Y0N A;  1YS6 A;  2DFH A;  1JJ8 C;  3M07 A;  4L0Y B;  4G7H F;  2DBB A;  4QWQ A;  4XBF A;  2E19 A;  1O3Q A;  1QZY A;  2XV4 S;  2NS7 A;  3TBI A;  4A3C J;  4RGR A;  1MNM C;  2EFQ A;  1I3Q J;  2X51 A;  1AKH B;  3BQZ A;  4RDU A;  3NAU A;  1VI0 A;  2E71 A;  2LY9 A;  4KIC A;  4D7M A;  1U9O A;  1F36 A;  2XRO A;  4Y4R A;  4ZH4 F;  2P6T A;  3EQL F;  4V2G A;  4GXO A;  1S7E A;  3CCS I;  2EWN A;  2HZT A;  1JGS A;  3Q9V A;  1YFH A;  1X1A A;  3FZV A;  5LRR A;  3VYS B;  3TDZ C;  1JT6 A;  4WWC A;  2CW7 A;  1S9H A;  3H36 A;  2IGN A;  2CO5 A;  4ZZD A;  5F27 A;  3RJP A;  3PNY A;  5HS8 A;  2M0M A;  3FF5 A;  4A6E A;  3BR0 A;  3VFZ A;  2QEX I;  2VJJ A;  1ETX A;  2OC6 A;  3PNT A;  2EQR A;  1D5Y A;  1IXC A;  3SYT A;  3KP2 A;  3C7J A;  1OYI A;  4PJM A;  1IGN A;  4F93 B;  4CCK A;  3F6V A;  3QYB A;  2DA7 A;  1MKM A;  3IKV A;  3I3L A;  4XK4 A;  4ZYG A;  3WU1 B;  3BP8 A;  4WCG A;  2F4O B;  2IVM A;  1HQC A;  4FET A;  5FRN A;  4JOM A;  4KT5 C;  3F8M A;  3SZP A;  3EDP A;  3FMS A;  5EGO B;  3MKZ A;  4IOA F;  2F5E A;  1MD0 A;  2FUG 2;  3T5X A;  3CLQ A;  3IC7 A;  2P7V B;  2X1E A;  2E1M C;  4BDY A;  3CDL A;  1R5H A;  1S7O A;  2O3F A;  3T0Y A;  2HWV A;  2OQG A;  4DOZ A;  2E1N A;  4AU7 A;  5F1J A;  2C6Y A;  4A3J J;  2VJ4 A;  3ONQ A;  4Y15 A;  3ROU A;  4CCO A;  1DU6 A;  1X3Z B;  1RC9 A;  3SXY A;  1K79 A;  4DIQ A;  1QQI A;  4QSH A;  2EFN A;  2BVL A;  2HQA A;  3WTW C;  3WTU C;  4BBS J;  1GV2 A;  1T0F A;  3F3X A;  1X3U A;  1RKW A;  4J00 A;  2HQN A;  1QZZ A;  2GOX B;  5F64 A;  1DP3 A;  3F8C A;  2R7R A;  2NAZ A;  2IJL A;  2JZY A;  3ZQL A;  1YJN I;  1ZHF A;  2X9D A;  4NQW A;  5IYD J;  1VQ4 I;  5E1X A;  4CCN A;  2QGU A;  1MMA A;  5FJ8 J;  4IOC F;  1ZLK A;  3IWF A;  2P7C B;  5E1W A;  4UUV A;  5HOO A;  3QOD A;  2JUG A;  2VAS A;  1ZK8 A;  2HKO A;  3WTY C;  3HRT A;  2DT5 A;  2Q0O A;  2HQ5 A;  5CVR A;  2AO9 A;  2LY2 A;  2KIU A;  2RRE A;  2KL4 A;  1OCP A;  4MEX F;  4P96 A;  3U1D A;  1ZH5 A;  5D8L B;  4GFB A;  2IT0 A;  4PFO A;  3WE2 A;  1K4T A;  2GA2 A;  2EV5 A;  3GTM J;  2W00 A;  4RAY A;  5TRD A;  1OCO H;  4CYC B;  2MLG A;  1Y8Q B;  2CRG A;  1YI2 I;  2ZJP F;  1MSE C;  1D8J A;  4EAT A;  1PYV A;  1UFM A;  4EM1 A;  4QIW N;  1E17 A;  1MND A;  1U2W A;  3RPU A;  1R4M B;  4LMY A;  1MBF A;  1R7J A;  1IXR C;  5F1R A;  4N9H A;  2QQ8 A;  2Y0S A;  4YEJ A;  2P5L C;  1Y8R B;  3BJ6 A;  3KYC B;  1FWZ A;  4A3I J;  3GBG A;  5C44 J;  2HNH A;  1BM9 A;  3RPQ A;  2X85 A;  1WQ2 A;  3ECO A;  3PUF A;  2COB A;  2BY0 A;  3K6G A;  4F52 A;  4RGX A;  2B7E A;  2VC1 A;  2Q8K A;  2V1X A;  2XPW A;  3I4N J;  4R8H A;  2BEO A;  1KU3 A;  3MKY B;  3LMM A;  5AIQ A;  2WTE A;  2L4A A;  2IW5 A;  5ICC A;  2OCE A;  1HDD C;  1O7F A;  4FE7 A;  3D5S C;  1FJL A;  2PMZ N;  2RQQ A;  2YS9 A;  1B4A A;  5GTI C;  4A3L J;  3WU0 A;  4MO7 A;  4AYB N;  4B4C A;  2VE9 A;  1T39 A;  3RIR A;  3G71 I;  2HVR A;  4EJT A;  3W6K B;  4G8X A;  3QOP A;  1U8B A;  1W36 C;  3OOU A;  2XGE A;  2XPU A;  2FMY A;  2FNA A;  3LSK A;  4KUM A;  3JRA A;  2XGC A;  2GXB A;  1LKX A;  1FIA A;  2LR8 A;  3W6V A;  4M9Z A;  1DDN A;  2DJN A;  3BWG A;  3N05 A;  4LG0 B;  1S3J A;  3LSP A;  5LGU A;  5E17 F;  4KMF A;  4WXC A;  1B8I B;  3ZQC A;  1L0O C;  2JA2 A;  1XDU A;  2Z3Y A;  2Y9Z A;  3F23 A;  2HVQ A;  1OJL A;  1F9N A;  2XF7 A;  3MZY A;  1O7L A;  3HKZ A;  2XC7 A;  2MA3 A;  1B72 A;  2KPM A;  3LAJ A;  3IV5 A;  5EG0 A;  3BG3 A;  4D9J A;  4ENJ A;  1SFK A;  4L18 B;  1RET A;  4QPQ A;  2PLY A;  1QO0 D;  3L2U A;  1JKR C;  4N0B A;  4Q48 A;  1G3Y A;  2QZ8 A;  2EV6 A;  4E7I A;  4BUP A;  5D4S A;  3HM5 A;  3U9G A;  1T2K A;  5JLW A;  3K4J A;  1R5G A;  4P5O A;  4XSZ F;  5EDN A;  3VPR A;  3A03 A;  4PJN A;  3LWF A;  4XKB A;  3NEU A;  5D6E A;  2JA8 J;  1V54 H;  4PGG A;  4Q47 A;  3KZI C;  1XC5 A;  2STT A;  1MBG A;  1DPU A;  1P9Q C;  2GQQ A;  1WKM A;  3E6B A;  2HYG D;  3HG9 A;  2RNJ A;  2X6X A;  1JHF A;  3MQ0 A;  2X6O A;  2DK5 A;  2EIN H;  4ZZL A;  1HST A;  4MGR A;  3FBI B;  4B43 A;  1LE8 A;  2E2I J;  5CVI A;  2V79 A;  5M3M J;  4G9Y A;  5J47 A;  4BS9 A;  1G3S A;  2GIZ A;  2RC4 A;  2X6W A;  2QBY B;  1FMW A;  2DN0 A;  1Y0U A;  4LD5 A;  1MH4 A;  2QEN A;  2FJ1 A;  2FX0 A;  3OR2 C;  3E5Q A;  1U3E M;  5BNG A;  1O4X A;  2F4M B;  1SD5 A;  2W4S A;  1R00 A;  3A01 B;  1FPQ A;  3HHG A;  4M3F A;  2STW A;  3TDU C;  1Z0X A;  3OS1 A;  4H4K C;  4XLC A;  1QHH D;  2JK3 A;  1SFO J;  2FBI A;  1G2H A;  4LJZ F;  2LC2 A;  1I6X A;  3JW4 A;  4I99 C;  3LSM A;  3GUD A;  3CME I;  1UHM A;  1EKE A;  2G7H A;  3FKI J;  3JCU C;  4BKX A;  3CCE I;  3KEQ A;  1MJA A;  1FTZ A;  4CCJ A;  1E0E A;  1FMV A;  2MSY A;  3AG3 H;  3MKW B;  3PJR A;  1FC3 A;  1ZGW A;  3K4K A;  3OIQ A;  5K1Y A;  3RI4 A;  1XN7 A;  4DJA A;  3VYR B;  3GVA A;  4DQ2 A;  3L2R A;  1K7A A;  2ESH A;  3WGG A;  1P92 A;  4PK4 A;  2R7F A;  2JA6 J;  2DCE A;  3KEY A;  2A05 A;  3OIO A;  1RUO A;  1ZQ3 P;  2BXY A;  3ZMD A;  2VOP A;  2VIX A;  3H5A A;  5K7F A;  1I1G A;  3I55 I;  1H9G A;  4IRG A;  1W7P B;  2HS5 A;  4PSW A;  4HX4 A;  2PEX A;  1QPI A;  3L2W A;  1E3P A;  2E1O A;  3FHN A;  3CJN A;  2D45 A;  2YR2 A;  3DFG A;  3H3U A;  3BY6 A;  5LHH A;  3VOD A;  3DTK A;  3GCM A;  5EF6 A;  3GFL A;  1OKR A;  1E2X A;  4I02 A;  1PP8 F;  1V5E A;  3CCM I;  4KIF A;  4I98 B;  2OF7 A;  2H6C A;  1UAA A;  4A6D A;  1ETO A;  4UXN A;  5DUI A;  1UHW A;  3D5R C;  5E3N A;  3HL2 A;  2ZSI B;  3A4C A;  1G3T A;  4GGG A;  5F0F A;  4P1W A;  2ME6 A;  2DMN A;  2HXO A;  3OYI A;  3VSL A;  1KU9 A;  2NVQ J;  1KYW A;  4AD9 A;  1MDM B;  5LBQ A;  4NC7 A;  4M3B A;  1O3T A;  4LLN A;  5E3L A;  3CJQ B;  4XLP F;  4NB5 A;  3WHB A;  1XSX A;  2M87 A;  2IPQ X;  1RKT A;  1LQ1 A;  4IRH A;  4L5I A;  3TW7 A;  2KDO A;  3CDH A;  3DTE A;  5HLT A;  3BG9 A;  3HOU J;  5IT9 Z;  2YX7 A;  2DA2 A;  2ADU A;  1H88 C;  1X1C A;  2BV6 A;  5IOY A;  3I4M J;  1Z6T A;  2VOO A;  1GLN A;  3S8P A;  3A1Y A;  3HYI A;  5EZH A;  3KET A;  2LRE A;  5GPA A;  5KAF C;  3A0B C;  1TNT A;  2BW3 B;  1DGR M;  5GPC A;  1P4X A;  4YRV A;  2EK5 A;  4A0X A;  2XB0 X;  2BGC A;  4AIH A;  4XOT A;  4KFC A;  5HDN A;  3HOS A;  2Y48 A;  1WJD A;  3MWM A;  3F22 A;  1MNE A;  3CJT B;  1WJE A;  5IY5 H;  3N4M A;  3ZQI A;  1QNT A;  2K3F A;  3U21 A;  5ED4 A;  3OIP A;  1QVT A;  5DCM A;  4ZYH A;  1AHD P;  2VBZ A;  2VL8 A;  1N75 A;  3A0H C;  5ILU A;  3WG9 A;  1V4R A;  3K7A J;  4A3M J;  3CC7 I;  4IXA A;  2PMU A;  4PUS A;  3TED A;  3OS0 A;  1TTY A;  5DM7 F;  2OJE D;  4WK8 F;  3L00 A;  3R4K A;  3GX4 X;  3ZXS A;  2FBK A;  2MGQ A;  4KMU X;  5FFX A;  1K61 A;  3DEE A;  5L3E A;  3S2W A;  4CH7 A;  3Q5F A;  4NC8 A;  5HNH A;  4EVI A;  2AQE A;  5HLI A;  2M5W A;  4QTR A;  2NRA C;  4OIO F;  2ID6 A;  2OTJ I;  5IOZ A;  1J59 A;  2LFB A;  4UHT A;  4BE1 A;  3KP7 A;  2AQF A;  4AIJ A;  2YU3 A;  4JK1 X;  3AAF A;  5HLG A;  3BG5 A;  1JUS A;  2NVY J;  1J7K A;  4M6X A;  1CGP A;  2IEK A;  2XSD C;  1HW5 A;  5M5W J;  1X2N A;  3ZPL A;  3ESW B;  5GAD J;  1U5T B;  3KFW X;  4A12 A;  2B63 J;  2GXA A;  3FXR A;  2DI3 A;  3CTA A;  3H9G A;  3OMY A;  5GAE J;  2KIQ A;  2WAQ A;  3M8F A;  2DT7 B;  4V2F A;  3RDI A;  3PO2 J;  2LVS A;  4BY1 J;  3HRU A;  3OYK A;  1OMI A;  5IYB J;  5HLH A;  1R6R A;  2TRT A;  3FXU A;  3OYB A;  1YO5 C;  3AFH A;  4OMY A;  1TBX A;  3OR1 C;  5FO5 A;  3OYH A;  3DBH B;  2R5Z A;  4BJ5 C;  1FIP A;  2DOD A;  4XN3 A;  5B5E C;  4Y13 A;  3T1B A;  1PDN C;  5ERI A;  3IP4 B;  3QPT A;  5LLQ A;  1VQL I;  1IDY A;  3W2W A;  1MJB A;  3U2R A;  2V7F A;  2L4M A;  1TQP A;  4AVZ A;  3HOY J;  2KZG A;  3CMA I;  2EFW A;  2XAG A;  1IN5 A;  3LA2 A;  4L9J A;  3Q9S A;  1W5C C;  3O3K A;  1IUF A;  5IPA A;  1RUN A;  5FKK A;  2G0E A;  2HOE A;  3HEF A;  1TNS A;  4FCY A;  5F04 A;  5J4V A;  3ERM A;  5J1U A;  3OY9 A;  5M3F J;  1FBS A;  1G59 A;  4JX4 A;  2CSO A;  1REP C;  2RNG A;  2EA4 A;  4O5V A;  1ZR4 A;  2YPR A;  4HF2 A;  5DV5 A;  4F7Z A;  4E7L A;  1K6O A;  4DBQ A;  3ULQ B;  1TWA J;  4ABZ A;  2KKO A;  4OWR B;  2FQ3 A;  1TW3 A;  4OIN F;  1BW6 A;  3UKG A;  3J7Y J;  1EH6 A;  2HOS A;  2VUM J;  4NUB A;  3CQZ J;  1B1B A;  3ABT A;  4XKW A;  3SEQ A;  2K4B A;  2R7D A;  3SZT A;  2FEZ A;  2KIF A;  5FGM A;  1XGM A;  5A2Q Z;  4KN7 X;  5EG0 B;  3RCO A;  5BOX A;  4FX4 A;  2MFZ A;  4BY7 J;  3BT9 A;  5FLX Z;  3DEU A;  2W24 A;  1ETW A;  2GIV A;  3OWT A;  3I4P A;  1K6Y A;  4EM0 B;  3DBR B;  2XAU A;  2QYO A;  2R7W A;  5IP6 A;  3WTX C;  4IQ4 A;  1USS A;  4Y3O A;  1YIT I;  2EBI A;  1XGS A;  3LFU A;  2NS0 A;  5IP7 J;  3V42 A;  1JKQ C;  2JSC A;  3F8F A;  5C4X J;  1U8R A;  3CES A;  1TWF J;  1WJB A;  1BBY A;  1VQ5 I;  3P9K A;  4IO9 F;  1O57 A;  1TWH J;  3M1C A;  4PJJ A;  2BYV E;  2NVU B;  1TZL A;  4XMY A;  3T8T A;  3FMR A;  3M8J A;  3H9J A;  4CZC A;  2CUF A;  3BTJ A;  1PJR A;  2OCC H;  1SD7 A;  3ZQQ A;  3EUA A;  1I50 J;  1AU7 A;  3LST A;  3JAM Z;  5HS7 A;  2XAF A;  2UWM A;  3CD6 I;  4GCV A;  2R5Y B;  5KVR A;  2MC3 A;  4E7Z A;  2K27 A;  3BR2 A;  2ECC A;  2G9W A;  3WHC A;  1B8I A;  4XRM A;  2L7M P;  3LL7 A;  2M45 A;  1Y56 A;  2PI0 A;  2XUB A;  4XKC A;  4D5F A;  3WTT C;  4L9V A;  5D5V B;  1KU2 A;  2JRM A;  4YFN F;  4YEL A;  1BR2 A;  4IZZ A;  2HDC A;  3VEP A;  3K4C A;  5DEQ A;  4IJA A;  4KIG A;  2M8E A;  1VQM I;  3G1L A;  2A6E F;  2CUE A;  3I9V 2;  2IS4 A;  1KA8 A;  4UNO A;  2QSF X;  4U7B A;  3PIO F;  3H9Q A;  1FTT A;  2W7N A;  3CUQ A;  1YJ9 I;  3LNQ A;  3K4M A;  3TP3 A;  2QCO A;  5ILV A;  4G7Z F;  1TLH B;  1IN4 A;  2IA1 A;  5HVQ C;  3F8B A;  3H3Z A;  3ZP5 A;  3BOQ A;  2ZFW A;  4X1E A;  3ZGK A;  4LFU A;  4RM3 A;  4F55 A;  2WV0 A;  3P9C A;  3FXM A;  4U87 A;  1UEL B;  2BZT A;  5DDG A;  2XRN A;  3J7Z I;  1GXP A;  1LUJ B;  1ZG3 A;  3E6D A;  1SD4 A;  2VKV A;  3LOC A;  1KYZ A;  4A5N A;  2H8W A;  3E6M A;  3OYM A;  4A93 J;  3J7A O;  3HXL A;  3I59 A;  1A6Q A;  4L0Z B;  1H8A C;  2ZBK A;  5BS6 A;  4BDZ A;  1NH3 A;  3E5U A;  1R1U A;  4O3M A;  1HF0 A;  4N9I A;  1ENH A;  1OLT A;  2LYC A;  5EEG A;  1ORK A;  2Q1Z B;  1WJ5 A;  2HTS A;  1J2X A;  1YS7 A;  3ZN1 A;  3L7W A;  3HSF A;  2ZJ2 A;  5D5X B;  1Y1W J;  2OTL I;  4BL0 B;  2H94 A;  2H27 A;  2F5D A;  2VJI A;  1NK3 P;  3K0L A;  4GO1 A;  4DBR A;  4IQJ A;  4IHX A;  1AA7 A;  2DFE A;  3GTK J;  2DQR A;  2Y0S N;  1UG0 A;  4MLO A;  2EFP A;  2TDX A;  3WTS C;  4XRS G;  2RKH A;  2A68 F;  2P6S A;  4HPQ A;  4BBR J;  3EYI A;  1YYV A;  1WHU A;  2CWE A;  2K02 A;  2Y30 A;  1UG2 A;  4DYC A;  3O2P E;  1XD7 A;  3G1M A;  2ZB9 A;  4W97 A;  1R49 A;  2JA5 J;  2LTP A;  1SAX A;  1MMD A;  3ZMV A;  1UB9 A;  3IHU A;  2CYY A;  1IF1 A;  1EF4 A;  1OCT C;  2RDP A;  5FLV A;  4O6J A;  3HUG B;  4HG2 A;  5L3D A;  1RR8 C;  1IV8 A;  2GWR A;  2DT6 A;  4DZP A;  4N4N B;  5ICE A;  2MC4 A;  2E2J J;  3OYG A;  4E7H A;  2K5C A;  3K69 A;  1XG1 A;  3TGN A;  2FOK A;  5KK1 A;  3WTZ A;  1X58 A;  1G6N A;  2XHK A;  3DTI A;  4AYB A;  4PJ0 C;  2CV2 A;  3K4N A;  3HB9 A;  1ZLJ A;  4HX7 A;  1GXQ A;  2K85 A;  5D6F A;  1XTA A;  4CA0 A;  1V55 H;  2OQR A;  1FP2 A;  1VQN I;  2X0L A;  4HRI A;  2PBI A;  1P2F A;  2WAE A;  4IHT A;  5BMZ A;  4HDU A;  3I58 A;  1XCV A;  3RPU D;  2EZH A;  2DXI A;  4D0P A;  2HPM A;  4LK0 F;  4BQA A;  2KP6 A;  4A3F J;  2LMD A;  4HAM A;  2KFD A;  3CZ6 A;  3JRH A;  3C3W A;  3TKY A;  2Y2Z A;  2FD5 A;  2E34 A;  3CUQ B;  4EV0 A;  1D0X A;  4C2M J;  4D7N A;  4ESJ A;  2IRF G;  3LSJ A;  1R1T A;  4BJ6 C;  1IN6 A;  3PSF A;  3HDD A;  4A3G J;  1MMN A;  2K9N A;  2KQR A;  3QYF A;  4MFD A;  1PP7 U;  1X1B A;  3U1K A;  1KZH A;  3J81 Z;  1LJ9 A;  4II3 A;  4E7J A;  5EGO A;  3K4B A;  4PCQ A;  3AG1 H;  1A31 A;  4XLF A;  5H20 A;  2BY2 A;  4CZZ A;  2X1D A;  2ZME B;  4CSW A;  3GFM A;  2R7X A;  1D3Y A;  4Y17 A;  1WVR A;  4B1R A;  1BR1 A;  3LSH A;  2AS5 F;  3S1Q J;  3O6B B;  1H89 C;  2O03 A;  1JXS A;  2CU7 A;  4R79 A;  4PFP A;  2OBP A;  4RLQ A;  3OYN A;  3KX2 A;  3PFI A;  3FIS A;  4G6Q A;  5ILS A;  4B47 A;  4HQM A;  1ZRC A;  2AXL A;  2BHY A;  3DPT A;  4OIP F;  2JVH A;  3FX3 A;  1HC8 A;  1T8I A;  3HOZ J;  3AG4 H;  2W82 A;  4CCM A;  1ETK A;  3S16 J;  3HTU A;  4P9F A;  3BZC A;  2L9V A;  2ZXI A;  3HPG A;  4JX6 A;  2IGO A;  1K78 B;  1X1D A;  3E1S A;  2NVX J;  2HI3 A;  3KE2 A;  1Z3Y A;  2O0Y A;  1GHC A;  1HXD A;  1HCR A;  2MH9 A;  1TWC J;  5FD5 A;  1I5Z A;  2DOF A;  1YW8 A;  2AXT C;  1BA5 A;  2VN2 A;  2ZXJ A;  3PUB A;  4Q4Z F;  4GRI A;  4BXF A;  4HDV A;  3KP3 A;  1BIA A;  3C2H A;  3BCB A;  4WF2 A;  3DKX A;  4WXH A;  1IG7 A;  4FIS A;  1GV5 A;  1KON A;  4FTH A;  1CQT A;  1I39 A;  3DKW A;  1V3F A;  4IHY A;  1ZRD A;  1YIO A;  3PSI A;  2X1C A;  1ZG5 A;  2CW8 A;  4A2U A;  2K9Q A;  3ZN0 A;  3SFI A;  3K2A A;  4XLE A;  3UNG C;  2KMU A;  3KP6 A;  2OZU A;  2H6B A;  4CYD A;  2QSG X;  2VKE A;  4KA4 A;  2LBF B;  4LK1 F;  5E1Z B;  1UHS A;  1G4D A;  5D5W B;  2DA6 A;  2E36 A;  2OZ6 A;  4A5M A;  5B1A H;  3V7R A;  1FZP B;  1ZAR A;  5B3S H;  4BHP A;  1MBJ A;  2EV0 A;  3QAH A;  5LD2 C;  2A69 F;  2M7A A;  4M3G A;  2NS8 A;  4S0H B;  4IF4 A;  1B9M A;  4HEA 2;  1WWX A;  3DWL E;  3ZQF A;  5E3O A;  1WI3 A;  2ZCW A;  2XKO A;  4HYE A;  2CJJ A;  5LGN A;  2CH0 A;  4E70 A;  1OYW A;  1SVL A;  2ZME A;  4MEY F;  1ACI A;  1HLV A;  2R7V A;  1R5I D;  3KZY A;  5EZG A;  3ABU A;  4K2E A;  2ZKZ A;  4MIM A;  2GZW A;  3BC8 A;  2X4H A;  1FSH A;  3PL8 A;  1ZKG A;  3MZ8 A;  3QP6 A;  4IEJ A;  4LOC A;  4OMZ A;  1FY7 A;  2VB6 A;  3OYA A;  4AM3 A;  2LSO A;  2A6H F;  2QF7 A;  2XAH A;  3Q0V A;  2VLA A;  3V8J A;  4CUG A;  2GM4 A;  4BHC A;  2X48 A;  3I53 A;  3M4O J;  4HOB A;  2R4G A;  4RAG A;  4YIR X;  4LIV A;  3GFI A;  3G4S I;  2F5C A;  2WB1 A;  1SVO A;  3VOE A;  1SD6 A;  2R5Z B;  4CIC A;  2D1V A;  4IPA A;  4E6K G;  5H6R A;  3CCL I;  5JFR A;  4IRI A;  3L1P A;  1VQ9 I;  2QKM B;  1Y1V J;  4BU2 A;  1MDM A;  2PG4 A;  3DPL C;  2DPD A;  2QQ9 A;  2BY1 A;  4EMS A;  4BXX J;  1X4P A;  1NG7 A;  2A6T A;  1SEU A;  1LVA A;  2DLL A;  3ABL H;  4IHW A;  1N77 A;  1ETY A;  1FNN A;  1YX3 A;  4Y7N J;  1WJF A;  3L2C A;  2TCT A;  1MJ9 A;  4HQE A;  1HKS A;  4Y52 J;  1RZ4 A;  4QLC U;  3F8N A;  1MH3 A;  1T6S A;  1VQP I;  2R7O A;  2RVC A;  3GLL A;  3JR9 A;  2P5K A;  1YJW I;  1SC7 A;  4R1H A;  5LGT A;  3LQQ A;  2CG4 A;  4UUS A;  2UV1 A;  2ID3 A;  3ZOB A;  2KT0 A;  2KRC A;  2EH3 A;  2M34 A;  4HZF A;  1LDD A;  3DPU A;  3FM5 A;  3DBL B;  4HW0 A;  1W0U A;  3QYE A;  1YRN A;  2R5Y A;  3IKT A;  4XLH A;  1OCZ H;  3H92 A;  4ANJ A;  2AHQ A;  2W48 A;  4CYC A;  1MMS A;  2PQ8 A;  1Z1D A;  2HXI A;  2FE3 A;  3WU2 C;  2DYS H;  4Y33 A;  5J3L A;  3MFK A;  3JRG A;  4LB5 A;  2R0Q C;  2QBY A;  3F21 A;  2L7Z A;  5E20 A;  3C2B A;  4PSX A;  3Q0U A;  3PQJ A;  5C3E J;  3CUO A;  3DLA A;  2L02 A;  2COM A;  2V26 A;  2XSJ C;  5TGT A;  1DUX C;  2DU9 A;  2BBY A;  3LSG A;  2L7F P;  5E8I A;  2DMP A;  5DS9 A;  3MVP A;  4A0Y A;  2FQ4 A;  2A3S A;  3HGY A;  3HUG A;  5CYV A;  1ZGA A;  2FML A;  1TW2 A;  3FM3 A;  1FX7 A;  2RV8 A;  3F72 A;  5LEJ A;  3PNV A;  3GO5 A;  4RB1 A;  1BC7 C;  4B48 A;  2Z5U A;  2V9K A;  3KEO A;  3TMO A;  1QHG A;  3HBL A;  3BPV A;  3DU6 A;  5FKL A;  5DYM A;  4ASN A;  4LG0 A;  4ENM A;  1PUF B;  5KNL A;  1PVE A;  5DD4 A;  1D8K A;  2ELJ A;  3DKY A;  3I71 A;  3JAM K;  1TWG J;  4YFK F;  1FOW A;  1P4W A;  3ZMZ A;  1XGO A;  4BHB A;  1T95 A;  3DLL F;  4XOR A;  1A04 A;  2BHZ A;  3FXL A;  1SMY F;  1EJ9 A;  1P7I A;  4I01 A;  4CO8 A;  5M5Y J;  5CQE A;  3HJE A;  2V6E A;  2GOM A;  1U5T C;  1YG2 A;  2WA0 A;  3VDX A;  2ZJR F;  2LF7 A;  1RRJ A;  4XKV A;  4BQQ A;  3OSF A;  4ZYA A;  5IT3 A;  1O3S A;  2HGC A;  3MD2 A;  4G12 A;  4KT6 A;  1YE9 A;  4OU0 A;  5FKN A;  2LNB A;  2GA1 A;  3JTH A;  1M1E B;  1T98 A;  2V9V A;  3FMQ A;  2CS3 A;  1W7P D;  4BAC A;  3BJO A;  1IO2 A;  3FK6 A;  1U5T A;  5KHD A;  3BQY A;  2HOT A;  3FXO A;  3ECH A;  2KIM A;  3F9K A;  1T38 A;  1JUM A;  4XRF A;  2P4W A;  3CUQ C;  1CF7 B;  2F5V A;  2V6C A;  5LFA A;  4BYY A;  5GAH J;  4MTD A;  2WAF A;  2EB7 A;  3T8R A;  2FOW A;  2L2O A;  3DCF A;  4J19 A;  2W25 A;  4BNC A;  1XSV A;  3BR1 A;  3W2V A;  3GTQ J;  1FSE A;  2X6Y A;  3DEW A;  4C2U A;  2KJC A;  1KGS A;  2ZC2 A;  3BJA A;  1XX5 A;  4XID A;  4XQF A;  1YOV B;  2VBY A;  3WGI A;  5LHI A;  4ENN A;  3MZH A;  1NTC A;  1R4N B;  3GF2 A;  2DK8 A;  2E60 A;  1KU7 A;  2JUC A;  3BZ6 A;  4RLF A;  5KAI C;  4XLN F;  2M4G A;  4IL6 C;  2ZME C;  4IVN A;  5JVG F;  1ITY A;  3S3M A;  3E5X A;  4BQO A;  4C2T A;  3Q3S A;  1IXS B;  1S5L C;  3DV8 A;  3PIP F;  4FE4 A;  5E3M A;  2ZXW H;  4JQF A;  1DPR A;  2O7O A;  4NNJ A;  3HTS B;  2QQB A;  1P4A A;  3I5U A;  5TJJ A;  4UUT A;  4ZC3 A;  2Y69 H;  3ZCO A;  3CCR I;  2LDU A;  2L54 A;  4BE0 A;  4I2O A;  3FWE A;  2UXN A;  2Z9O A;  2LKS A;  3K1N A;  2XAQ A;  4EQQ A;  2JT1 A;  4HNV A;  3QQA A;  2IS6 A;  1OR7 C;  3E7L A;  5FLM J;  1PUE E;  4N4O B;  4HLY A;  4TV7 A;  2P81 A;  1A5J A;  5J1Y A;  1ULY A;  4F91 B;  3PO3 J;  2OAZ A;  1F4K A;  1VQK I;  3WE3 A;  1JHH A;  5BPD A;  1J5Y A;  3O8G A;  2BOL A;  1JT0 A;  3RKX A;  2DMQ A;  2NOG A;  4GYG A;  1P7J A;  5AIP A;  3P9I A;  1AKH A;  1BJA A;  2KJB A;  4EM2 A;  3HOX J;  4S04 A;  2D1H A;  1MBH A;  1WRJ A;  3QU3 A;  2O6G E;  4CXF A;  2PX9 A;  2MBF A;  4EJW A;  5L3C A;  2GXG A;  3B02 A;  1SFE A;  5IYC J;  1L3L A;  1B9N A;  1Z77 A;  5J4Y A;  1HBX G;  2ZNZ A;  1FEX A;  1P6R A;  4HV6 A;  2UUZ A;  2Z33 A;  2EJR A;  1K4S A;  2QSH X;  3GTL J;  4I09 A;  4J01 A;  4UV9 A;  4XNF A;  3GTO J;  3HRS A;  4RB2 C;  4D1Q A;  5DCM B;  1R23 A;  1ZYR F;  3CF2 A;  2KZV A;  3RQ4 A;  4HST A;  1VQ6 I;  3S14 J;  1XDS A;  3E97 A;  3S3N A;  3HRM A;  1B72 B;  3H5N A;  2MLK A;  2NNY A;  2VOD A;  1H0M A;  2F2E A;  2L0K A;  2JSP A;  4XR6 A;  3HKZ N;  2A61 A;  5FKO A;  5JVT A;  2QA4 I;  1Z91 A;  3GLX A;  2J5P A;  3COA C;  3EYY A;  3OOP A;  3I54 A;  3IAM 2;  1WFX A;  1W7P A;  3ASN H;  2I8D A;  3KPH A;  2IP2 A;  3F6O A;  3R60 A;  1V5G A;  4HNT A;  3JRI A;  3HC7 A;  2QLZ A;  2WAQ N;  2HDW A;  5E79 C;  1GDT A;  1IAW A;  1JTX A;  2E35 A;  1MBE A;  4IHV A;  3BTC A;  5ICF A;  4YFX F;  2OD5 A;  3GTG J;  2E5N A;  2M8G X;  1DP7 P;  4ESB A;  3ERE D;  3F0C A;  2F4I A;  3E3V A;  3SEZ A;  1AWC A;  1A6I A;  3QRF F;  2Y0M A;  1TP4 A;  2NOJ B;  3JRF A;  4E7K A;  3S1M J;  4MTE A;  1VND A;  3JSP A;  4OIR F;  2E1C A;  5J1R A;  4RGU A;  1XMK A;  2XKP A;  2RAE A;  2LD5 A;  2IS1 A;  4GDF A;  1QGP A;  3W2A A;  1SAU A;  4BGD A;  4ENK A;  4KJZ A;  1T0F C;  1T56 A;  2D2W A;  3FBN B;  3RYP A;  2VJ5 A;  4B3A A;  1D5V A;  3PQK A;  5M5X J;  2VON A;  2ZO4 A;  3V8L A;  5J6X A;  4U88 A;  2LKX A;  1W36 D;  2WWY A;  3ZQH A;  2V1D A;  4RAZ A;  1RPW A;  5F08 A;  2IXS A;  5LRS A;  3C1D A;  2EA2 A;  3G1O A;  4FX0 A;  1SMT A;  4Z6Y A;  1YRN B;  1VQO I;  2M2E A;  5EJC A;  3AG2 H;  4PZJ A;  2LRD A;  2HR3 A;  3OV8 A;  1LFU P;  2V1N A;  1J9I A;  4L5E A;  3HZJ A;  1IN7 A;  3IUO A;  4A3B J;  4UVB A;  2BE5 F;  3B73 A;  1BN5 A;  1LNW A;  1U0J A;  2VI6 A;  3HHH A;  5K7H A;  4A69 C;  1QVU A;  3KLN A;  2FXA A;  3OYC A;  3L2V A;  5E8G A;  3ZMT A;  4NHJ A;  2LOO A;  3QPH A;  4G6T B;  1Z21 A;  3TP0 A;  4UUS B;  2FBH A;  2H8R A;  1YX5 A;  3ZQG A;  2LBF A;  2NNN A;  1WI9 A;  3FXQ A;  1RR7 A;  2O8K A;  1WZ2 A;  4M74 A;  1OIS A;  2XVC A;  3CCY A;  1LEB A;  2LKP A;  2DA5 A;  4LLL A;  3H0D A;  4DGW B;  3H1C A;  2R93 J;  4MQ9 F;  1XGN A;  2B9S A;  4UVA A;  1FBU A;  2CUJ A;  2L9S A;  4NBQ A;  1FT9 A;  1MZB A;  2E7X A;  3GYH X;  1XSD A;  1HOM A;  2O8X A;  4UB6 C;  4OAZ A;  4CDG A;  5KCM A;  4XIC A;  1SAN A;  4KN4 X;  3B6C A;  2ETH A;  1W1W E;  2QKL B;  2VT2 A;  1JJ6 C;  3DXJ F;  4C3J J;  4WX9 A;  4DZJ A;  2JMW A;  3BCA A;  3ABM H;  3I59 B;  2DJI A;  2ACJ A;  4L9N A;  2WB1 N;  5D5U B;  1WJA A;  1Y39 A;  2VE8 A;  1HA8 A;  1J0R A;  2Y75 A;  1EH8 A;  3GXO A;  1ODD A;  3FHZ A;  3D0S A;  4HF1 A;  5J40 A;  1IZ1 A;  5CKT A;  4HA8 A;  4RS8 A;  2JJ7 A;  2M4K A;  4I76 A;  3TL4 X;  2MD5 A;  1MIJ A;  1B6A A;  2MAB A;  3NRV A;  1VZ0 A;  2R7Q A;  4B8X A;  3HOW J;  2ECB A;  2RQP A;  3BR3 A;  3GTP J;  3QPS A;  2FNP A;  4B09 A;  5K7Z A;  4UVC A;  2KHM A;  3OL4 A;  3BTL A;  2XRL A;  4LLG F;  1UST A;  2Z1D A;  3FXK A;  3TW6 A;  3AKZ A;  3RSN A;  2W1O A;  1JUP A;  3RTR A;  5F0H A;  3CC2 I;  5DUK A;  4KNY A;  2F5F A;  1U9N A;  2N8G A;  3R0A A;  3HIF A;  2DPU A;  2V1U A;  2O61 A;  4D5C A;  2DA1 A;  4BH9 A;  3GZ5 A;  4HX8 A;  2HYJ A;  2ZXH A;  4RM2 A;  2MD0 A;  3GZN B;  1NK2 P;  1WSU A;  4JX5 A;  1FLI A;  3E6C C;  4A3D J;  5B1B H;  3HGG A;  1Z7L A;  1S8N A;  1NHA A;  1JE8 A;  1FOY A;  4EGZ A;  1QBJ A;  3W3C A;  2I10 A;  3EUK L;  3P5J A;  2DQL A;  5EEH A;  2EFO A;  4YII A;  4MQV A;  2LP0 A;  3SDB A;  2IGM A;  2P0W A;  2WC2 A;  3CO6 C;  2R92 J;  1ONV A;  1TT0 A;  4EGY A;  2H1L A;  3M3Y J;  2CQ7 A;  2HVS A;  3ASO H;  2BY3 A;  4JYK A;  4ESF A;  1BW5 A;  2V4J C;  3DQV C;  3IWZ A;  3JRB A;  5DCF A;  2L5Q A;  2P8T A;  2BXZ A;  3M9A A;  1WGX A;  3BLY A;  3ML6 A;  4FHT A;  1QZE A;  5HS9 A;  4AWX B;  2ISY A;  3V7S A;  2IGK A;  4HF0 A;  3K9T A;  2L7K A;  4CGZ A;  2DW4 A;  1YW7 A;  1KQ9 A;  1VQ8 I;  2DTR A;  3GTJ J;  3K70 D;  3MCZ A;  3UR3 C;  3L2Q A;  1BOB A;  4ZTF A;  2XF5 A;  4W1U A;  1K78 A;  3E0J B;  4C3H J;  5D8K B;  4IX7 A;  1ON1 A;  1F5T A;  2IA0 A;  1QPM A;  1U78 A;  2HOA A;  3EUH C;  1FYM A;  4M3D A;  1ZG1 A;  2Y9Y A;  3NQO A;  4HNU A;  2M7B A;  4XOP A;  3K1M A;  3CO7 C;  3REO A;  2K4J A;  4EJO A;  1LFP A;  5JLX A;  2Q2E B;  2KRF A;  2VBX A;  2YSR A;  3HSE A;  4B3X A;  2GAU A;  3JTG A;  1HW2 A;  1N78 A;  3V4G A;  5HOD A;  2H09 A;  2K40 A;  1R58 A;  2R7S A;  2FA5 A;  2J5O A;  5H2F C;  2ZNY A;  1R22 A;  3P7N A;  4ZJZ A;  1BIB A;  4G7O F;  3H5R A;  2PMH A;  2Z99 A;  3DF8 A;  2VKH A;  4OIQ F;  4U0V A;  3EET A;  2L9N A;  4BQN A;  1MW7 A;  1OR7 A;  4ITV A;  4RB3 C;  1F1Z A;  1BI0 A;  2ZSH B;  4II2 A;  5HDG A;  2K9S A;  5IP9 J;  1SFX A;  1Q1V A;  5JHF A;  4KIT B;  2CGP A;  9ANT A;  1D1C A;  2Y31 A;  2ME0 A;  1XMA A;  2R7T A;  3VB2 A;  2ESN A;  3MAJ A;  4C3I J;  1Z7U A;  3S1R J;  3QWL A;  2JA7 J;  3D1N I;  3S1N J;  2VPL A;  1JKP C;  1PUF A;  4C30 A;  5FD6 A;  3J7A Y;  2R7U A;  4S05 A;  1LFB A;  2P5V A;  4MNU A;  3H3V K;  2DDA A;  1W5S A;  2HFH A;  1K83 J;  1POG A;  1MBK A;  5GTH C;  2XGX A;  2M0C A;  1OYY A;  4ON0 A;  1R9T J;  3RKQ A;  1J75 A;  4ZDP A;  3O8H A;  1IRX A;  2K9L A;  2FU4 A;  1LB2 A;  4DNC A;  3ZMS A;  1I6H J;  3OYJ A;  2OPT A;  1JI8 A;  5F0C A;  5BQT A;  2EIJ H;  4JP0 A;  2HDD A;  3QU6 A;  2PN6 A;  2W84 A;  3RYR A;  5FB2 A;  1IW7 F;  1B59 A;  3FK7 A;  5LEK A;  4G6D A;  1E3H A;  1S72 I;  1FYK A;  1DU0 A;  3ELK A;  5L3G A;  1ETQ A;  3NWT A;  2EIK H;  2GBY A;  4QPO A;  5FFZ A;  2HZD A;  2QWW A;  3OS2 A;  1IDZ A;  3CMM A;  2PJP A;  1J09 A;  3SDG A;  2LY1 A;  4FQG A;  2WY8 Q;  5TIS C;  3HOV J;  1AOY A;  2VXZ A;  1FYL A;  4GYI A;  4WXD A;  4EJU A;  2EZL A;  2XPV A;  4I7H A;  4KYW A;  2PJR A;  1IRG A;  4FT8 A;  3K4L A;  2E5Z A;  3B6A A;  2DA3 A;  3GW2 A;  1UMQ A;  3LA7 A;  1D1A A;  1FOK A;  1GT0 C;  1TL8 A;  3JSO A;  4IHS A;  2CQK A;  4ZDL A;  4BE2 A;  3KZZ A;  1BL0 A;  2XAS A;  2DMU A;  4LIU A;  4XSX F;  2K86 A;  2F48 A;  2LLK A;  2NXN B;  2OV7 A;  2HEO A;  3DP7 A;  2FSW A;  1UCR A;  2QVO A;  4AID A;  1IJW C;  3BRO A;  2HPI A;  3RKY A;  1E3O C;  4B44 A;  2DO7 A;  2LH9 A;  1OQY A;  1IC8 A;  2A5Y B;  2I5U A;  4CCL A;  2M30 A;  4LIT A;  3TOA A;  4Z2Y A;  3SZG A;  2K9M A;  4UY8 I;  5CVU A;  1G3W A;  3RKW A;  2JRT A;  1KQ0 A;  1U6G A;  1TC3 C;  1LE8 B;  3AL0 B;  1ETV A;  4U7D A;  1D0Z A;  5B66 C;  4HV5 A;  4PJL A;  2KIS A;  4AVP A;  4M3E A;  4XON A;  5JI6 A;  3HOT A;  1FOX A;  1Z05 A;  3IRR A;  3LQR A;  5CVJ A;  2IA2 A;  3RZO J;  2R3S A;  2QQA A;  1G8X A;  1OCC H;  2VT3 A;  3BDD A;  3KCC A;  4G94 A;  5FRO A;  2KDZ A;  2XGD A;  4M9S A;  1XCB A;  2DOA A;  2BW3 A;  2JPB A;  3K70 C;  3A01 A;  2D5V A;  4OAY A;  1BJZ A;  1GVJ A;  1QA6 A;  1F43 A;  5AON A;  3BG7 A;  5GAG J;  3JRD A;  5H6Q A;  5C4J J;  3CDI A;  1Y6I A;  5DD8 A;  1IRZ A;  4L9T A;  1X2M A;  3CCV I;  3JRC A;  2YUS A;  2NVT J;  2DTZ A;  2CV1 A;  2OA4 A;  3VYT B;  2CQN A;  5CLS A;  4I0B A;  3FIW A;  3W6J B;  2CFO A;  5L3F A;  2W57 A;  4XL9 A;  5HDK A;  3SFZ A;  1SFU A;  3BR6 A;  4M71 A;  2IS2 A;  1GVD A;  1T33 A;  5E18 F;  2DFI A;  2JPC A;  3CC4 I;  4XM3 A;  2UZK A;  3TO9 A;  2DOE A;  3BG6 A;  2CQQ A;  4HLX A;  2VC0 A;  1QRY A;  1Z67 A;  1IV6 A;  1ZRF A;  3KYD B;  2DFF A;  4HSR A;  4MHG A;  3S2H J;  1JGG A;  4X6A J;  3S32 A;  4RAF A;  3RQI A;  3I0T A;  4A0Z A;  4E7S A;  4OOI A;  1VQ7 I;  2PJR B;  1TT5 B;  1ZR2 A;  1Z9C A;  5CPR B;  2RGV A;  4FAS D;  1MGT A;  3TO6 A;  5JR3 A;  3ZRG A;  3CMY A;  3VWB A;  4ZDO A;  1HKT A;  3ISP A;  5CQG A;  1IUY A;  1KQ8 A;  3ABK H;  2JN6 A;  5FKM A;  2M3A A;  1RIO H;  1LEA A;  1RNL A;  1Z3X A;  2M9H A;  5CJ9 A;  1OPC A;  3LAP A;  3SJM A;  4ZYE A;  5FRM A;  4BEH A;  1BI1 A;  2HKX A;  2VQC A;  1SVM A;  3VYU B;  3K10 A;  3A2K A;  4RBO A;  3ZMU A;  3FDY A;  2IAI A;  3PM1 A;  1O3R A;  4M73 A;  4EJV A;  2UXX A;  3CJR B;  2PFB A;  5DTD A;  2XDV A;  3OL3 A;  1XMX A;  4LGW A;  3RZD J;  1EV7 A;  1W0T A;  4LG3 A;  4XN0 A;  2QUF A;  2XF6 A;  1STZ A;  4U0W A;  3LSR A;  4AIK A;  1XB4 A;  1XS9 A;  1H9T A;  2E7W A;  3Q0W A;  2HTJ A;  3BPX A;  3MKL A;  4V19 K;  2R7Z J;  3S3O A;  1VFC A;  2ZJQ F;  1LVK A;  3J80 Z;  3ZR8 X;  3HPH A;  3BTI A;  5ICG A;  1ON2 A;  4M6Y A;  3CLO A;  4LB6 B;  2F6C A;  3QP5 A;  1ZN2 A;  1WH5 A;  1WPK A;  1R71 A;  3IRQ A;  1N25 A;  2DYR H;  2XAJ A;  2FRH A;  5L3B A;  4BXU A;  3LFK A;  4M6V A;  1JTY A;  2LK2 A;  1QU3 A;  4F92 B;  3H0G J;  2KLO A;  2EIL H;  1JKO C;  4RGS A;  2RN7 A;  1YLF A;  1YQA A;  1HKQ A;  2XIG A;  4ZTJ A;  2DAO A;  5BPI A;  1LPQ A;  3OSG A;  4BJT A;  3IAS 2;  4DYQ A;  1LDK B;  3H35 A;  1FP1 D;  3I56 I;  2JWT A;  1ZTR A;  2BVM A;  3G6E I;  3NWS A;  2EZK A;  2NYX A;  5LHG A;  3KYL A;  2FF4 A;  4NQW B;  3QPL A;  3WG7 H;  3VSK A;  4IKF A;  2M1B A;  2VQG A;  3X2Q H;  3MMY B;  3D5L A;  3GME A;  2OU2 A;  2HQR A;  1WCM J;  3A02 A;  4UB8 C;  1YIJ I;  1EA3 A;  1RES A;  1D0Y A;  1WJC A;  3K1P A;  3MEX A;  2A5W A;  1TQI A;  3IL2 A;  3CCU I;  3S2D J;  3KIO A;  3AL0 C;  3EUH A;  4ETS A;  4Q5S F;  2CFX A;  3R6S A;  1A36 A;  1UZC A;  2B0L A;  4P9U A;  3LA3 A;  2E2H J;  1NG6 A;  3M1E A;  1BI2 A;  1ERD A;  3BZK A;  1LDJ A;  2L01 A;  1X19 A;  5EYR A;  1EH7 A;  1D1B A;  2WAD A;  1W4M A;  3JRE A;  2VPR A;  3L09 A;  4JBA A;  1ZAO A;  1X1P A; 
#chains in the Genus database with same CATH homology
 3HOZ J;  4XIC A;  1SAN A;  1QPI A;  3B6C A;  1ETK A;  3S16 J;  1JJ6 C;  4C3J J;  4DZJ A;  2JMW A;  2E1O A;  4JX6 A;  2H1K A;  2WB1 N;  2NVX J;  2CQX A;  2HI3 A;  5EF6 A;  2MG4 A;  1HCR A;  2GLO A;  3BR5 A;  1TWC J;  2OF7 A;  2MW8 A;  1ETO A;  1BA5 A;  2JJ7 A;  4I76 A;  5E3N A;  5F0F A;  3HOW J;  2DMT A;  2ECB A;  3BR3 A;  2ME6 A;  2DMN A;  2HXO A;  4EEF G;  1IG7 A;  3GTP J;  4FIS A;  1GV5 A;  3QPS A;  4FTH A;  2NVQ J;  1GUU A;  5K7Z A;  1CQT A;  4I6Z A;  4M3B A;  3BTL A;  2XRL A;  4IHY A;  3NAR A;  5E3L A;  1OFC X;  3IH2 A;  3TW6 A;  3WHB A;  4MFE A;  5GP9 A;  2WV1 A;  2ELK A;  1JUP A;  1RKT A;  5F0H A;  2K9Q A;  4DYR A;  3SFI A;  3K2A A;  1U9N A;  2N8G A;  3TW7 A;  3HOU J;  4AUX A;  2XB5 A;  3BG9 A;  2VKE A;  4D5C A;  2DA1 A;  1UHS A;  2DA2 A;  2IBD A;  2DA6 A;  1H88 C;  5IOY A;  3I4M J;  2HYJ A;  3S17 J;  1WH7 A;  1MBJ A;  4A3E J;  1NK2 P;  4M3G A;  2NS8 A;  4JX5 A;  4S0H B;  5EZH A;  4A3D J;  3HGG A;  5GPA A;  3ZQF A;  5E3O A;  2O9L A;  1WI3 A;  2L9R A;  2CJJ A;  3IH3 A;  4AC0 A;  5GPC A;  1HLV A;  5EZG A;  3MN2 A;  2I10 A;  3S15 J;  2XB0 X;  4XRS A;  4MIM A;  2LP0 A;  4IEJ A;  1ZKG A;  2R92 J;  4LOC A;  3M3Y J;  1MSF C;  3Q0V A;  2QF7 A;  3ZQI A;  4JYK A;  1BW5 A;  2DA4 A;  2GM4 A;  3JRB A;  1APL C;  1QVT A;  2X48 A;  1AHD P;  3M4O J;  5EEA A;  4DW6 A;  1WGX A;  1HDP A;  3K7A J;  4A3M J;  3TED A;  2R5Z B;  2MGQ A;  1K61 A;  3L1P A;  3GTJ J;  1Y1V J;  4NDL A;  3IH4 A;  2EZI A;  4W1U A;  4BXX J;  4C3H J;  4QTR A;  2ID6 A;  5IOZ A;  1U78 A;  4IHW A;  2HOA A;  2LFB A;  4A3K J;  4M3D A;  1ETY A;  4Y7N J;  2Y9Y A;  2TCT A;  3BG5 A;  1JUS A;  2NVY J;  2YU9 J;  1VF9 A;  2IEK A;  4Y52 J;  2XSD C;  5M5W J;  1X2N A;  1MH3 A;  5JLX A;  2B63 J;  3JR9 A;  5HOD A;  4V2F A;  4UUS A;  1JJ8 C;  3PO2 J;  2LVS A;  2K40 A;  4BY1 J;  2ID3 A;  5IYB J;  2TRT A;  3ZOB A;  2KT0 A;  2EH3 A;  2M34 A;  2R5Z A;  2E19 A;  1W0U A;  1YRN A;  2NS7 A;  2R5Y A;  4A3C J;  1FIP A;  1MNM C;  1AKH B;  1I3Q J;  3BQZ A;  4RDU A;  2AHQ A;  3NAU A;  1VI0 A;  2W48 A;  4CYC A;  2LY9 A;  1IDY A;  4D7M A;  1U9O A;  1F36 A;  2HXI A;  4V2G A;  3HOY J;  3JRG A;  2K9S A;  5J3L A;  1S7E A;  1Q1V A;  5IP9 J;  2R0Q C;  2L7Z A;  9ANT A;  3C2B A;  2Y31 A;  2ME0 A;  3Q0U A;  5C3E J;  1JT6 A;  4C3I J;  3S1R J;  1IUF A;  2JA7 J;  3D1N I;  5IPA A;  3S1N J;  3LSG A;  5FKK A;  2L7F P;  2G0E A;  2DMP A;  5DS9 A;  3MVP A;  1JKP C;  2FQ4 A;  3HEF A;  5F27 A;  1PUF A;  3HGY A;  5F04 A;  4FCY A;  5J1U A;  5M3F J;  3BR0 A;  1LFB A;  4JX4 A;  1ETX A;  3H3V K;  2EQR A;  1ZR4 A;  1K83 J;  1D5Y A;  1POG A;  3HBL A;  1MBK A;  1TWA J;  4ABZ A;  5FKL A;  2M0C A;  1PUF B;  1IGN A;  1R9T J;  3RKQ A;  1BW6 A;  2DA7 A;  3O8H A;  3UKG A;  2VUM J;  2HOS A;  1TWG J;  3CQZ J;  4XK4 A;  1I6H J;  2OPT A;  5F0C A;  4JP0 A;  2HDD A;  5EG0 B;  1P7I A;  4BY7 J;  3BT9 A;  5M5Y J;  5EGO B;  1ETW A;  3FK7 A;  1DU0 A;  1ETQ A;  3OSF A;  2GBY A;  3CDL A;  5IP6 A;  4G12 A;  1IDZ A;  5FKN A;  2EBI A;  3SDG A;  5IP7 J;  1JKQ C;  5C4X J;  1TWF J;  3HOV J;  5F1J A;  3FK6 A;  4A3J J;  3BQY A;  2HOT A;  1TWH J;  1DU6 A;  2EZL A;  2XPV A;  4QSH A;  1JUM A;  2CUF A;  3BTJ A;  3B6A A;  2DA3 A;  1I50 J;  1UMQ A;  1AU7 A;  1GT0 C;  4BBS J;  1GV2 A;  3DCF A;  4J19 A;  1BL0 A;  2R5Y B;  2DMU A;  1RKW A;  3BR1 A;  3GTQ J;  2ECC A;  3BR2 A;  2LLK A;  3DEW A;  3WHC A;  4XRM A;  1B8I A;  2L7M P;  4XID A;  1IJW C;  4D5F A;  1E3O C;  3ZQL A;  2X9D A;  1NTC A;  5IYD J;  5FJ8 J;  1IC8 A;  1ZK8 A;  1ITY A;  3Q3S A;  3G1L A;  4FE4 A;  2HQ5 A;  5E3M A;  2CUE A;  2AO9 A;  2O7O A;  1TC3 C;  1LE8 B;  1OCP A;  1ETV A;  4GFB A;  4UUT A;  1FTT A;  3LNQ A;  3TP3 A;  4M3E A;  3GTM J;  2QCO A;  3RZO J;  4CYC B;  2KDZ A;  2XGD A;  4HNV A;  2CRG A;  3QQA A;  1MSE C;  4X1E A;  2D5V A;  3A01 A;  3E7L A;  5FLM J;  1BJZ A;  4QIW N;  1F43 A;  3JRD A;  1A5J A;  2P81 A;  1MBF A;  5J1Y A;  5C4J J;  3PO3 J;  1IRZ A;  1X2M A;  3O8G A;  3JRC A;  2VKV A;  4A3I J;  2YUS A;  1JT0 A;  2NVT J;  2DTZ A;  3GBG A;  2DMQ A;  2NOG A;  3LOC A;  5C44 J;  3FIW A;  1P7J A;  4A93 J;  1AKH A;  2COB A;  1H8A C;  3BR6 A;  1GVD A;  3HOX J;  1T33 A;  2XPW A;  1HF0 A;  3I4N J;  1MBH A;  1ENH A;  1ORK A;  2CQQ A;  1HDD C;  1QRY A;  1IV6 A;  4FE7 A;  1FJL A;  5IYC J;  1Z77 A;  1FEX A;  3S2H J;  1JGG A;  2PMZ N;  2YS9 A;  4A3L J;  4AYB N;  4MO7 A;  1Y1W J;  3GTL J;  4X6A J;  4B4C A;  3RQI A;  3GTO J;  1NK3 P;  1U8B A;  3OOU A;  1ZR2 A;  2XGE A;  2XPU A;  3JRA A;  2XGC A;  4IHX A;  3GTK J;  2Y0S N;  4MLO A;  1FIA A;  4XRS G;  2LR8 A;  3W6V A;  4BBR J;  3S14 J;  3CMY A;  1B72 B;  2Y30 A;  2DJN A;  1UG2 A;  4DYC A;  3LSP A;  3G1M A;  2ZB9 A;  4W97 A;  2JN6 A;  2L0K A;  5FKM A;  1B8I B;  3ZQC A;  2LTP A;  2JA5 J;  3HKZ N;  5FKO A;  2M9H A;  2Y9Z A;  1OJL A;  1EF4 A;  1OCT C;  3SJM A;  5FLV A;  1B72 A;  3IV5 A;  3JRI A;  4RBO A;  5EG0 A;  3BG3 A;  1RET A;  2IAI A;  2WAQ N;  3PM1 A;  1GDT A;  1JKR C;  4DZP A;  1JTX A;  1MBE A;  5DTD A;  2E2J J;  4IHV A;  3BTC A;  3RZD J;  1W0T A;  1XG1 A;  3GTG J;  3HM5 A;  3LSR A;  1X58 A;  1XS9 A;  2M8G X;  3Q0W A;  5JLW A;  2R7Z J;  3MKL A;  1VFC A;  5EDN A;  3F0C A;  3VPR A;  3A03 A;  3HB9 A;  3BTI A;  1A6I A;  2JA8 J;  1XC5 A;  3JRF A;  1MBG A;  3S1M J;  1VND A;  5J1R A;  1WH5 A;  1WPK A;  2RAE A;  2LD5 A;  2X6O A;  2EZH A;  4M6V A;  1JTY A;  2LK2 A;  3H0G J;  1JKO C;  1T56 A;  1LE8 A;  4A3F J;  4B3A A;  2E2I J;  5M3M J;  5M5X J;  3JRH A;  2Y2Z A;  2FD5 A;  3OSG A;  2DN0 A;  4C2M J;  4D7N A;  2LKX A;  1MH4 A;  3LSJ A;  4DYQ A;  2FJ1 A;  3ZQH A;  2FX0 A;  2JWT A;  1ZTR A;  1RPW A;  5F08 A;  2EZK A;  5BNG A;  3G1O A;  1O4X A;  3QPL A;  3HDD A;  1YRN B;  3A01 B;  4A3G J;  4M3F A;  2K9N A;  2M2E A;  4MFD A;  1Z0X A;  1LFU P;  2JK3 A;  1SFO J;  1WCM J;  3A02 A;  5EGO A;  1G2H A;  4L5E A;  4A3B J;  1RES A;  3FKI J;  2VI6 A;  4BKX A;  5K7H A;  4A69 C;  1QVU A;  1FTZ A;  2MSY A;  1ZGW A;  4B1R A;  3S2D J;  3TP0 A;  4UUS B;  2H8R A;  3ZQG A;  3S1Q J;  1H89 C;  1RR7 A;  2O8K A;  2CU7 A;  3CCY A;  2E2H J;  2DA5 A;  3FIS A;  2JA6 J;  2R93 J;  3OIO A;  1ZQ3 P;  5EYR A;  3JRE A;  2VPR A;  1HOM A;  5K7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...