2CU7A

Solution structure of the sant domain of human kiaa1915 protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
GSSGSSGYSVKWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVKCGLDKETPNQKTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Differences of SWIRM Domain Subtypes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords KIAA1915 protein
total genus 13
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2005-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2cu7A01
4Y7NJ 1JT0A 3Q3SA 1ETKA 3HM5A 3HOZJ 1A5JA 3H3VK 2ID3A 2VKVA 3BG3A 3S16J 2HI3A 4JP0A 5EDNA 4Y52J 2DTZA 1QVTA 3MVPA 4A69C 5IOYA 1TWAJ 2P81A 1TWGJ 4EEFG 5IYDJ 5FJ8J 3PO3J 4J19A 3ZQHA 2XPUA 1X2NA 1TWFJ 2NVXJ 3HB9A 4D5CA 5GP9A 1GV2A 4CYCB 1OCPA 5E3OA 1NTCA 2K9QA 4IHYA 1D5YA 1ZGWA 3TW6A 4BBSJ 2Y0SN 1ZTRA 4FISA 5GPAA 1I3QJ 1UMQA 1ORKA 1JTYA 3QQAA 5HODA 1UHSA 2YU9J 3SJMA 1Z77A 3TEDA 2ZB9A 1WGXA 1RKTA 3HKZN 2NS7A 1OFCX 3CMYA 2LK2A 1DU6A 3O8GA 5M5XJ 1BW6A 2GLOA 1B72A 3S2HJ 5BNGA 5E3NA 5F04A 4A3IJ 1T33A 1GV5A 1APLC 1JUPA 3RQIA 2DJNA 4FE7A 2CQXA 1ZKGA 1JJ6C 2JWTA 1U9OA 2R7ZJ 2LVSA 3ZOBA 5EZGA 1U78A 3B6CA 1A6IA 5FKNA 2ME6A 1FIPA 2E2HJ 1O4XA 4JX6A 2L0KA 3IH2A 2NVYJ 2VUMJ 2AHQA 1XC5A 2JA6J 5EYRA 1VI0A 5IP6A 5J3LA 3G1MA 1B8IA 3BTIA 1BA5A 4BXXJ 4C3JJ 1BW5A 4IHWA 3BTLA 2X6OA 1CQTA 1ETVA 5GPCA 3BR6A 4DZPA 3BR1A 4V2FA 1HF0A 1IDZA 1FEXA 2H8RA 1ETQA 1Y1VJ 3S17J 2M0CA 2R5ZB 2LTPA 1H88C 2JK3A 1IGNA 4XIDA 3BR5A 2COBA 1POGA 2K9SA 1JTXA 3SFIA 3D1NI 4B4CA 2TCTA 4AUXA 1MH3A 2L7MP 1ETWA 5JLWA 3HGYA 2M9HA 4NDLA 2XSDC 1MSFC 2NS8A 1LFBA 2DA4A 2L7ZA 2R5YA 2EBIA 5F08A 2DMTA 1QPIA 4S0HB 2DMNA 4A3FJ 1F36A 4DYCA 4A3JJ 4QTRA 2NOGA 5JLXA 2CJJA 4GFBA 2EH3A 2DA6A 3FIWA 3LSJA 4I76A 1MSEC 5C3EJ 2N8GA 2QCOA 3WHBA 9ANTA 5E3MA 2R0QC 2HDDA 1BL0A 1AKHB 3GTMJ 5C4JJ 3HOVJ 5EGOA 5C4XJ 3JRFA 1B72B 1ZQ3P 2D5VA 3K2AA 1LE8A 1I50J 3ZQFA 2XRLA 3JRBA 1MBFA 2LFBA 3A01B 3JRDA 2EZIA 1VNDA 2L9RA 4X6AJ 2HXOA 3TP3A 5FKKA 2Y2ZA 4C2MJ 2I10A 3OSGA 2JJ7A 4V2GA 3BTCA 3S1NJ 4MIMA 2LLKA 3BR0A 1XG1A 3M4OJ 5E3LA 1OJLA 4I6ZA 5EEAA 5IP7J 2O7OA 1FTZA 1RR7A 4M3DA 4XRSA 3HOWJ 4M3BA 4CYCA 1JGGA 2M8GX 2H1KA 1X58A 1ZR2A 5EZHA 1E3OC 1RETA 3PM1A 3Q0UA 1P7JA 2R92J 3IH4A 2EZKA 1GVDA 2LP0A 2KDZA 2EQRA 3OSFA 4X1EA 2KT0A 1JUMA 1IRZA 2DMPA 3OIOA 3I4NJ 2EZHA 4BKXA 2RAEA 1VF9A 3HOYJ 3JRIA 2R5ZA 5IOZA 4A3KJ 1X2MA 5IP9J 2R93J 3OOUA 3S2DJ 1WH7A 2M34A 3HDDA 2NVTJ 4B1RA 2O8KA 1ITYA 1TWCJ 4M3FA 4AC0A 2ME0A 3NARA 2DA1A 2MSYA 1PUFB 1HDDC 2XPWA 2GBYA 1B8IB 2L7FP 2CU7A 4MFDA 1DU0A 2HXIA 1XS9A 1G2HA 5F0FA 1RESA 3BT9A 2DA5A 3DCFA 1LE8B 2LKXA 2OPTA 1Y1WJ 2HOSA 2O9LA 3GTKJ 2ECBA 4L5EA 5M3FJ 2ELKA 2X9DA 1MH4A 3A01A 3F0CA 3G1OA 2LY9A 1JKOC 3W6VA 3GBGA 4A3EJ 1AKHA 2JA7J 1H8AC 4W1UA 3A03A 3SDGA 2IBDA 4BBRJ 5M5WJ 2QF7A 3QPSA 3HEFA 3HGGA 4G12A 5K7FA 4M3EA 2FJ1A 1WI3A 4DW6A 3GTOJ 1RPWA 4A3BJ 4IHVA 3CDLA 4RDUA 1AU7A 1H89C 2R5YB 1WH5A 3HOXJ 5K7HA 5F0CA 1LFUP 2XGEA 2VI6A 2GM4A 1JJ8C 2JA8J 2PMZN 4BY7J 1WCMJ 3UKGA 3S1RJ 1ZR4A 1FJLA 2EZLA 3JRGA 4IEJA 1SANA 4A3MJ 1TC3C 1K61A 2DMUA 4UUSB 3FKIJ 2E1OA 3MKLA 2XGCA 2DA7A 1MBJA 2DMQA 5EF6A 3M3YJ 4MFEA 4QIWN 2CUEA 4FE4A 2E2JJ 1JKRC 1NK3P 4D7MA 1MBKA 1ETXA 3RZOJ 4XRSG 4M6VA 2JA5J 3E7LA 1GDTA 4UUTA 4ABZA 1NK2P 2DA3A 1JKQC 4XK4A 3G1LA 5DS9A 3LSRA 5EGOB 5J1YA 1T56A 3LNQA 3CCYA 1MNMC 1FTTA 3TP0A 4A3DJ 3I4MJ 1P7IA 2JN6A 5IPAA 3GTPJ 1QVUA 4A3LJ 1W0TA 3Q0VA 5EG0A 4A93J 4IHXA 2YUSA 2IEKA 3ZQCA 5IYBJ 1HCRA 3GTLJ 4M3GA 3LSPA 2MG4A 1JT6A 1UG2A 3H0GJ 4XRMA 5FKOA 3B6AA 2VPRA 2M2EA 3DEWA 2FX0A 1RKWA 2Y30A 1HDPA 2G0EA 4AYBN 1HLVA 1ETYA 3O8HA 3BG9A 2K9NA 3CQZJ 3TW7A 3QPLA 5FLVA 1QRYA 3GTQJ 3HOUJ 3BR3A 2Y9ZA 1F43A 3A02A 3GTGJ 2DA2A 4A3GJ 5F27A 2E2IJ 2W48A 2K40A 2ECCA 3Q0WA 2CQQA 3FISA 3BG5A 4LOCA 1U9NA 5FKLA 1SFOJ 4A3CJ 3WHCA 4D7NA 2WAQN 4DZJA 5F1JA 1YRNB 2XGDA 3GTJJ 2XB5A 1PUFA 3S15J 2DN0A 2OF7A 1R9TJ 5IYCJ 4JX4A 4UUSA 3JR9A 2MW8A 1VFCA 3JREA 2NVQJ 1GUUA 5F0HA 1I6HJ 1WPKA 3NAUA 4JYKA 3RKQA 4DYRA 1MBGA 3IH3A 1ZK8A 2HOAA 2XPVA 4RBOA 4HNVA 1JKPC 1ENHA 2VKEA 2HQ5A 2ID6A 2HYJA 1FIAA 4W97A 3C2BA 5DTDA 1K83J 3JRCA 2FQ4A 1Z0XA 4MO7A 3MN2A 1EF4A 3BQYA 2WV1A 5FKMA 2Y31A 3LSGA 3LOCA 4FCYA 2X48A 3JRAA 2JMWA 3ZQGA 1IUFA 1IV6A 2WB1N 5J1RA 1Q1VA 2MGQA 2IAIA 2CRGA 5J1UA 1HOMA 1TWHJ 3BR2A 4MLOA 4D5FA 4JX5A 2HOTA 1BJZA 3K7AJ 1JUSA 2CUFA 1IJWC 2XB0X 3RZDJ 2E19A 1W0UA 3FK7A 1IDYA 3JRHA 3FK6A 1GT0C 2B63J 3L1PA 2YS9A 3HBLA 1S7EA 4QSHA 5K7ZA 2AO9A 1ETOA 1AHDP 1YRNA 1MBEA 4DYQA 4BY1J 1U8BA 3S14J 3ZQIA 5M3MJ 3ZQLA 1MBHA 5FLMJ 5C44J 5EG0B 2LR8A 4C3IJ 3S1MJ 5M5YJ 2FD5A 4FTHA 2Y9YA 4XICA 1IC8A 2LD5A 3S1QJ 2TRTA 3BTJA 1OCTC 3PO2J 1IG7A 4C3HJ 3VPRA 3IV5A 3BQZA 4B3AA
chains in the Genus database with same CATH superfamily
2MLKA 1QBJA 3CUQC 5BPDA 3Q3SA 2FBIA 1BI0A 3ZCOA 3CMMA 2ID3A 2X0LA 3BG3A 3LSMA 1XN7A 2HI3A 1FY7A 2FU4A 3IL2A 1D8KA 1U3EM 3R0JA 4BXUA 1VQMI 3H35A 3EETA 2LRDA 2CH0A 3HUGA 3OS2A 2CFOA 1X2NA 1W7PD 1GV2A 5GP9A 6PAXA 1OCPA 1R5HA 3FMRA 4KIBA 2E35A 3TW6A 1U8RA 3Q9SA 1N75A 4RAYA 3DBLB 1KU9A 2QBYA 1JTYA 3HHGA 1HSJA 1UHSA 3MQ0A 3QQAA 4MNUA 5H2FC 3VODA 4ZH4F 3SJMA 1W36D 3CDIA 3PSIA 5HS9A 4AD9A 3IAS2 2ZB9A 1WGXA 1CGPA 1G6NA 4I2OA 2IGKA 3KP4A 3OYJA 4BHCA 2KLOA 1BW6A 2GLOA 1K7AA 1T98A 1L3LA 5E3NA 4FX0A 1T33A 4RAFA 4L5JA 1GV5A 1VZ0A 5AIPA 1JUPA 4B48A 4HDVA 1DP3A 3K4BA 3ELKA 5DCMA 2DJNA 2EV5A 3GWZA 4BGDA 2JWTA 2JUCA 2H6CA 3J7YJ 2KZGA 1ZARA 3B6CA 2KRCA 1EH6A 5IYDJ 1O4XA 1ZH5A 1TT5B 2Z2SB 2VUMJ 5IT3A 4BE0A 2ACJA 4LMYA 1L0OC 1FBSA 1XC5A 3DTIA 3N05A 4HSTA 1TTYA 2OJED 2NNNA 5IP6A 2YSRA 5CVUA 1B59A 3S3MA 1WJDA 1UAAA 4XM3A 1OISA 2FEZA 4C3JJ 5EEHA 4IHWA 3BTLA 4G94A 1ZRFA 5ERIA 4IQJA 1ETVA 3K4LA 4EJTA 1TP4A 1OYYA 1Z6RA 2QENA 4U0WA 2E5NA 1Y39A 2PI0A 2H8RA 1WKMA 2JA2A 3B02A 1H88C 2XC7A 2BYVE 4FX4A 2KDOA 3QPHA 3V8KA 1LDJA 3SFIA 4B4CA 4AUXA 1MH3A 3CJNA 2R7DA 2L7MP 3FDYA 3CMAI 2JSPA 4MEYF 3HRTA 3HGYA 1I39A 3VSKA 3ZXSA 5JLWA 2BW3A 2V79A 3DPTA 5F1RA 4M72A 2AS5F 4GDFA 2NS8A 2JZYA 2M45A 3FXJA 2XAFA 3DU5A 2Y69H 2DMTA 3KLNA 1HW5A 4HNUA 2DMNA 4R8HA 4BUPA 3F8BA 5JLXA 5JVTA 2PG4A 4GFBA 2M7AA 5LHGA 5FFZA 3F8MA 3ZN1A 3JSOA 4AM3A 1QU3A 2HDDA 4X0GA 1K6OA 1BL0A 1QO0D 2PBIA 1T38A 3GTMJ 1G3TA 4L0ZB 4IHSA 4M6YA 4BU2A 4EJUA 2EFNA 4DOZA 2XAJA 1I50J 2J5PA 3QYEA 1HQCA 1YJWI 1OCRH 2CFXA 2CSOA 1MDMA 4KJZA 2XRLA 3JRBA 1HBXG 2W7NA 1W5CC 1WJAA 5HLGA 5CKTA 1S6LA 3K1NA 2E34A 3JRDA 1VNDA 2WV0A 3K9TA 3M9AA 5LEKA 1D0YA 2OQRA 4L5IA 5IT9Z 2UV1A 1SD6A 2Y2ZA 4C2MJ 1R1TA 3F9KA 4UVBA 4V2GA 5DUIA 1J09A 1C0WA 1XB4A 4AIDA 4MIMA 2LLKA 3BR0A 2JQ7A 1FX7A 1OJLA 2XHKA 1RI7A 4I6ZA 4QLCU 5CQEA 2QQ8A 3CJQB 4M3DA 2P6TA 3ERMA 2WBMA 3L7WA 2H1KA 5E8IA 4BH9A 2M8EA 2BZTA 2O5RA 1RETA 2PJRB 4LLLA 2IPQX 2Y75A 2DFIA 3DQVC 2F4IA 3OOPA 2EZKA 1KONA 2KDZA 4NQWA 2ZXWH 3K70C 2KT0A 5GTIC 1JUMA 2A5YB 3U2RA 1IRZA 2KZVA 5HS8A 5HNHA 2DMPA 4BEHA 3P9IA 3TO6A 3I4NJ 4JOMA 2BY0A 4RAZA 1LNWA 2KRFA 1XSXA 5CJ9A 1X2MA 4BHBA 2VQHA 2R5ZA 1OCCH 3K4MA 2M34A 2EWNA 5ICFA 1OPCA 3NRVA 1RC9A 5L3EA 2WAQA 3LAJA 4E7KA 3SDBA 4M6XA 4KIFA 5LFAA 2W4SA 4IKFA 4I0AA 2VE9A 4A5MA 4MFDA 2H27A 3PFIA 1MNEA 1MKMA 3E6MA 2W84A 5GAEJ 5F0FA 1RESA 3BT9A 4Y33A 4Y13A 2LKXA 2IS6A 2HOSA 2ECBA 1DUXC 3V7CA 2QZ8A 1IRXA 4B09A 3F0CA 1GHCA 2GIZA 5BOXA 2UZKA 2R7WA 5B3SH 4L0YB 3H5NA 2RKHA 3FXOA 4W1UA 3A03A 1YIJI 4BBRJ 5M5WJ 2PX9A 3QPSA 1RUNA 2L3DA 3HEFA 4G12A 2GA1A 4HX4A 4MGRA 1WI3A 1V55H 4DW6A 3GTOJ 4IHVA 2DYSH 3I59A 3OR2C 4BJTA 2XUBA 3MWMA 1V3FA 1BN5A 2R5YB 1WH5A 5TGTA 3MZ8A 4B47A 4IOCF 1YG2A 1KGSA 4RB1A 1LFUP 5HOOA 2XGEA 3RDIA 2A3SA 2VI6A 4LLGF 3ULQB 3CCQI 1XD7A 2WB1A 4HX7A 3S32A 2PMZN 2XAHA 3ERED 1O3TA 3RYPA 4PZJA 1ZR4A 3SQNA 3LFKA 5J8CA 2GA2A 2LREA 3WTYC 3JRGA 1K61A 2DMUA 4LG0A 1BIAA 1J9IA 3FKIJ 1R4NB 3MKLA 3KP3A 4DIQA 1I6XA 1IXCA 2X1CA 1AOYA 3V7SA 2H1LA 3VYSB 4QIWN 4NBQA 2BXZA 1JKRC 3K2ZA 4PSWA 1NK3P 1R00A 3FX3A 1FOXA 1LQ1A 1I1SA 1XDSA 2BY2A 2HZTA 2O3FA 2MH9A 1JHHA 3M8FA 1GDTA 3CZ6A 4ABZA 3G4SI 1W4MA 3GFJA 3G1LA 4XK4A 5EGOB 2DK8A 4EV0A 3CCYA 2ESHA 3EYIA 3U9GA 1TQIA 3AL0B 2LNBA 3I4MJ 3KLOA 3FBIB 2V1DA 3DFGA 4EM1A 5IPAA 3J81Z 3LA3A 2NS0A 4A93J 2G7HA 2IEKA 3CDHA 4U87A 5IYBJ 1R1UA 2BEOA 4Z6YA 4BACA 2K4JA 2XV4S 1W7PA 5FD6A 2FXAA 4R79A 1OCOH 3EUKL 1UG2A 2VQLA 4I99C 4ENMA 2F5VA 4XRMA 4HYEA 1K79A 2E1MC 2L9SA 1QHHD 4IF4A 2VB6A 1O57A 4AIJA 3HOTA 2B9SA 1HDPA 5D5UB 4AYBN 1R71A 3IRRA 1YS6A 2IS2A 3V7RA 3DEEA 3F6VA 1EA3A 2GXAA 1QRYA 3PNVA 2QWWA 4ZYGA 3JW4A 3PQJA 1WSUA 1OQYA 2Y9ZA 2K27A 3EPZA 3KCCA 3GTGJ 2DA2A 2E2IJ 3F3XA 2W48A 2LMDA 4XBFA 2F48A 1X19A 2COMA 3CO7C 2L9NA 2CQQA 3MKYB 2VT2A 3FISA 1TBXA 1N78A 3BCAA 3WTVC 4U7DA 1H9TA 4A3CJ 2L01A 2HKOA 5CVJA 1UB9A 1YW8A 3ESWB 5F1JA 2XAQA 3L2UA 3OYMA 1O3RA 4HQEA 2HPIA 3GTJJ 1FBQA 2M5WA 4XKWA 1BI2A 4E7SA 4JX4A 3LL7A 2MW8A 1VFCA 2A5WA 3IWZA 2NVQJ 1GUUA 2HQAA 2UWMA 3FXRA 4IJAA 4ZJZA 3E5UA 2UXNA 2M3AA 3T1BA 1NHAA 2XPVA 3D5RC 3J7AO 5D5WB 3R0AA 4KICA 2KIFA 1ENHA 2KQRA 4P5OA 1XSDA 2JVHA 2ID6A 1ZELA 2FE3A 2HYJA 5CYVA 3CD6I 2DK5A 1FYKA 5ILUA 1K83J 2M4GA 2QBYB 1W1WE 5KHDA 1WVRA 3HZJA 4KITB 2A07F 2MYSA 1IN7A 2HNHA 4PGGA 3MD2A 3LSGA 5LGUA 1SMTA 3T8TA 3HPHA 4FCYA 2X48A 3D5SC 2VOOA 2Q8KA 5HS7A 3H1CA 3HYIA 2F2EA 1ZG5A 2C6YA 3ZQGA 2LF7A 5J1RA 2DAOA 3PJRA 2IAIA 3KYCB 2CRGA 3K10A 3RIRA 3L00A 1TWHJ 3G2BA 3KYLA 2RDPA 2ZMEA 4MLOA 4JX5A 2MC3A 1IJWC 5E1XA 2XB0X 4K2EA 1LPQA 2VONA 2OUMA 1R7JA 1S7AA 1IDYA 1Z21A 1GT0C 1XPXA 4QSHA 3HKZA 4NNJA 4NC7A 1G4DA 3KPHA 3S3NA 3HRUA 1U8BA 3WU1B 5LGNA 1QHGA 5EG0B 4GO1A 2BOLA 1YIOA 3W2AA 2X6YA 3RKWA 2FD5A 2EINH 4OIQF 4BYYA 1IC8A 4AVZA 1TNTA 1MJ9A 2LD5A 2TRTA 3BTJA 1OCTC 2RN7A 4C3HJ 3IV5A 1ZAOA 4B3AA 4Y7NJ 4PFOA 1ETKA 3MEXA 1A5JA 3E5XA 4LIVA 4UVAA 5LRSA 2EFWA 3BY6A 3ABUA 2HQRA 5HDNA 4Q5SF 2RV8A 2Q2EA 2HYFA 5J4VA 4A69C 1VQOI 1TWAJ 2P4WA 1PP8F 2DODA 2KIMA 5EEGA 2QQAA 3BPVA 2P6SA 3IC7A 3ZQHA 2Y0SA 2XPUA 1TWFJ 2NVXJ 3HB9A 2VODA 2M1BA 3P7NA 1D5YA 1ZGWA 5FRNA 4BBSJ 3DBHB 2Y0SN 3L2VA 1ZTRA 1U5TC 1Y6IA 4P9UA 4FISA 5GPAA 1E2XA 2HTJA 1ORKA 4XQFA 3WTTC 2Z9OA 3HXLA 5DD4A 2DLLA 2CW0F 5HODA 2YU9J 4KISA 3M1CA 3QP6A 3K70D 4E7LA 4PUSA 1V54H 2ZCWA 3O3KA 4ON0A 1T95A 3ZMUA 5KAIC 3SEQA 2HS5A 3RQ4A 4XN3A 3SHFA 2E71A 2LK2A 2XGXA 2XRNA 3GCMA 2K7LA 3O8GA 4BS9A 4ZYEA 3I71A 5M5XJ 4F55A 2PLYA 1B72A 3K1PA 4HW0A 4HF1A 2EV6A 5TJJA 5BS6A 3GXOA 2R7XA 4BL0B 4FE7A 2CQXA 1ZKGA 2BE5F 1UZCA 1U9OA 3ABKH 1MW7A 2R7ZJ 5L3FA 4BEHB 5EZGA 4XOTA 5FKNA 2CMPA 2ME6A 3DKYA 1M1EB 1W5TA 3TL4X 1KA8A 3ZMSA 1U0JA 3PNTA 4JX6A 2H8WA 4LD5A 3EUHC 3H36A 3WG9A 3BJAA 2WAEA 2JTVA 3DLAA 2NVYJ 1DGWY 5AIQA 5EYRA 3HRMA 2FSWA 4U7BA 2AXTC 1I3AA 1VI0A 2CQ7A 5H6QA 1RIOH 2FNPA 2F4MB 1B8IA 4S04A 3LAPA 2W82A 2F5DA 1R22A 2XF5A 3VFZA 4BXXJ 3PIPF 3EUAA 3F23A 1A6QA 2V7FA 3S2WA 3TKYA 2MD0A 3P9KA 1YW7A 4XLHA 2X6OA 2GXBA 1XGSA 2Z1DA 5GPCA 1X1CA 3BR6A 1Z1DA 1PUEE 4I09A 1R5ID 4V2FA 3ML6A 3M7GA 1FYMA 1IDZA 1ETQA 5GTHC 1Y1VJ 4B44A 3S17J 4HA8A 2DFFA 3NWTA 2EIMH 2O0YA 3CP8A 2R5ZB 2LTPA 1SVLA 2FMYA 4CCLA 1MZBA 1IGNA 1OCZH 3BZKA 1PJRA 2K9SA 1JTXA 3D1NI 4BQOA 2PJRA 3H3UA 4I98B 3WTWC 3BDDA 2F5FA 1ZLKA 1P4XA 3JSPA 2O6GE 1E0EA 4DBQA 4H0EA 2M0MA 3I5UA 5E1WA 2WY8Q 5DCFA 5E18F 1GXPA 3RJPA 2L7ZA 2IS1A 1NG6A 2OZUA 5BMZA 4S0HB 4A3FJ 4DYCA 1R1VA 4A3JJ 5J8FA 4QTRA 2ISYA 1JGSA 4E7IA 1K4SA 2CJJA 2QLZA 2EH3A 2WWYA 1IZ1A 5JFRA 3S3OA 3QWLA 2P7VB 2WC2A 1K78A 2A6EF 2ISZA 9ANTA 3WHBA 4BJ5C 3IAM2 5E3MA 4YELA 3RPQA 1AKHB 1KYZA 2O61A 5J6XA 5C4JJ 1WHUA 2P7CB 2IA1A 5TISC 2XAGA 5C4XJ 1LE8A 3V8JA 2HQNA 4G7ZF 3ZQFA 3AL0C 2L4AA 1MBFA 3EUHA 1QZZA 1YOVB 4OINF 2R7FA 3AKZA 2V26A 3F8CA 2PMHA 2K86A 2E7XA 2EZIA 2JRMA 2L9RA 3ZN0A 1H0MA 1ZRCA 2BXYA 2Q1ZB 1XSVA 2G9WA 2QEXI 2Z33A 3TP3A 1DPRA 1HC8A 2I10A 5DM6F 3OSGA 4J01A 4BJ6C 3HTSB 1XX5A 3BTCA 3VDXA 4OIRF 4BQQA 1XG1A 1Y56A 2P5KA 3TO9A 2XASA 1I1GA 2ZNZA 3IKVA 4FQGA 4CYCA 3KP7A 5LGTA 5J40A 3F21A 1YQAA 5EZHA 4CCKA 4CSWA 1E3OC 2BY1A 2KL4A 1OR7A 3Q0UA 3FMQA 3IUOA 4XKCA 4A6EA 5LBQA 3DEUA 2ZFUA 4Q4ZF 1SFKA 3TMOA 3CLQA 2EQRA 2BW3B 3CESA 1IRFA 1V4RA 2MLGA 2UXXA 3GW2A 1YHQI 3FKJA 3OIOA 4FT8A 4BKXA 4LG0B 1VF9A 4B43A 5IOZA 2R7SA 2BVLA 5IP9J 2X6WA 3DKXA 3W2WA 1IN8A 2JRTA 2ZO4A 1MNDA 4E7ZA 1R4MB 5CQGA 3HDDA 1ITYA 4B1RA 3GMEA 4I01A 3K69A 5GAHJ 1TWCJ 2IGOA 2ME0A 3U1KA 3NARA 2DA1A 1XGOA 1HDDC 1FSHA 1YE9A 1YFHA 2GBYA 2CU7A 4IRHA 1YW9A 3CJTB 3QP5A 4P55A 1G2HA 5D4SA 3HL2A 1J75A 2DA5A 2X1DA 2CGPA 4M9ZA 2Y48A 5E79C 4ANJA 1Y1WJ 3GTKJ 3TDZC 5M3FJ 1ON2A 1S72I 3G1OA 3QPTA 2MC4A 3ZQ7A 1FMVA 5DV5A 3GBGA 3TBIA 1MMNA 2JA7J 4PDKA 4HRIA 3H9JA 1B1BA 3FXKA 2EK5A 2QF7A 4ETSA 3LFUA 3HGGA 5K7FA 4M3EA 4CZCA 1LUJB 3LSIA 2MA3A 3TQNA 2BY3A 3DP7A 4RS8A 4B8XA 2VXZA 4TV7A 4A3BJ 2QQ9A 1WJ5A 2XIGA 4HLYA 1AU7A 3WE3A 2D1VA 3OS1A 2J5OA 3DXJF 1BC8C 4E6KG 2FUG2 3PQKA 4F93B 2RVCA 3ABTA 1RUOA 2VBWA 1D8JA 4OIPF 2BHYA 3LQRA 1ULYA 2V9VA 2BVMA 2VKDA 4UUSB 5K5QA 4L9JA 1FP2A 2XGCA 3FXLA 2DA7A 5FGMA 4IL6C 5EF6A 3MAJA 3M3YJ 2DT7B 2LG4A 4H4KC 3KIOA 4MFEA 3I9V2 4Y15A 4EJWA 2VC0A 2E2JJ 2W25A 4KNYA 4D7MA 2PMUA 1ETXA 2RQQA 3DU6A 2L9VA 5D5XB 2DU9A 3A0HC 1JHFA 3PSFA 3VOEA 4XRSG 2NVUB 3J7ZI 4E7HA 2PQ8A 3KZYA 3G6EI 2M30A 2HWVA 2K9LA 4O5VA 2LH9A 3H0DA 2R7VA 4U0YA 4ZTJA 1T56A 2X6XA 3N97A 3W6JB 1YS7A 3C2HA 1X1PA 3OL3A 4A3DJ 2OTJI 1UJ8A 1ZLJA 3GTPJ 1XCBA 1XMXA 3HSFA 1P92A 1W0TA 1HSTA 4O3MA 1OYIA 2ZXHA 2TDXA 4IHXA 3GZ5A 2YUSA 3OL4A 2RQPA 3OY9A 3ZP5A 4F3QA 2R7TA 4XLNF 2DYRH 4CCMA 4II2A 4IOAF 2X1EA 1STZA 2VASA 4CCOA 3A0BC 3RCOA 3H0GJ 1X3ZB 1HA8A 1I5ZA 3B6AA 1BOBA 2VPRA 1RKWA 4YIRX 1HLVA 4RB3C 4M74A 1K4TA 3OYHA 3G73A 5GADJ 3TW7A 2DDBA 2CW7A 3A01B 5FLVA 3CCSI 3LQQA 3MKWB 3A02A 2YPRA 2HR3A 5F27A 3GF2A 5D4RA 2QM3A 2ECCA 2ZMEB 5ILSA 3SEZA 2STWA 3GZNB 3DBRB 1FZPB 4PJ0C 4HV5A 2LF8A 3FMSA 1HXDA 2ZC2A 5DM7F 1U9NA 5FKLA 3WHCA 2YX7A 3C7JA 4G6QA 1Y8QB 1IV8A 2XGDA 1G8XA 3BZCA 4A2UA 1VQLI 1BI3A 2XB5A 2AQFA 2OF7A 1R9TJ 2OU2A 3GX4X 1A31A 4ENKA 3ZGKA 2MH2A 3HTUA 1XDUA 4KMUX 3FHNA 3JREA 4RM3A 4ENJA 2DT6A 1WPKA 3NAUA 4N4OB 1UCRA 3SXYA 4II3A 3KP6A 2GXGA 4RGXA 1LVAA 2HOAA 1BJAA 2ZJRF 4HNVA 3M07A 3SYTA 3J81K 1Q1HA 4M71A 1ZYRF 4C9YA 2EB7A 4CUGA 4UVCA 4KYWA 1FIAA 2K85A 3WGHA 4BQAA 3C2BA 1BOAA 4N4NB 5TRDA 2FQ4A 4RM2A 4UY8I 1K6YA 4MO7A 3NQOA 1DPUA 2HTSA 4LK0F 2VJIA 2R3SA 3K4CA 1EF4A 3BQYA 3WGGA 4EQQA 5FKMA 3QOEA 3COAC 3LOCA 1YX5A 2Q0OA 4IHTA 1YITI 2CUZA 1KU3A 2XKOA 3MZHA 2JT1A 1SFXA 1W7PB 2MBFA 2LKSA 4UUVA 5J1UA 1HOMA 2CUJA 2WADA 3LA7A 3ASNH 1BJZA 1JUSA 4C2UA 3AAFA 3CP2A 4BE2A 2W1OA 2E19A 3KETA 1W0UA 4G6TB 1IN6A 4NC8A 1S7EA 5K7ZA 2AO9A 2OCEA 2DXIA 5E1ZB 1W36C 1YRNA 1MBEA 3BWGA 4BY1J 1IF1A 3QYFA 4WXCA 3ZQIA 2DCEA 1MBHA 2L54A 2P5VA 3E0JB 5E17F 4RB2C 2XKPA 4BQNA 3CUQA 2EA2A 5M5YJ 2Y9YA 4XICA 2VQCA 2QYOA 3S1QJ 1Z05A 4YFNF 1IG7A 3BR2A 2GWRA 4HDUA 1BBYA 3QU3A 1JT0A 2BGCA 2KMUA 1K78B 2VJ5A 2F4OB 2XSJC 3HOZJ 3H3VK 4YIFA 3OYIA 4OAZA 5EDNA 1R5GA 2G7UA 2DTZA 4C2TA 3K1MA 1E17A 3C1DA 2JPCA 1U5TB 2QVOA 3PO3J 3E3VA 4CZZA 5ICGA 3TGNA 1OMIA 1NTCA 5ICEA 5E8GA 4DGWB 3QOPA 3Q5FA 2ADUA 2IA2A 1EJ9A 3QAHA 3AG2H 4RMNA 1I3QJ 1UMQA 4MHGA 4OIOF 3ABMH 4E7JA 4XKBA 4BAYA 2WA0A 4PK4A 1Z77A 2F5CA 2ZJPF 2WY7Q 1RKTA 3OYNA 3CO6C 5DYMA 3RTRA 3CCMI 4XLFA 1OFCX 1D5VA 1DU6A 1T0FC 4EGZA 1Z67A 3KEOA 4N9HA 2CV1A 1PVEA 5LRRA 5F04A 4A3IJ 2DQRA 1S9HA 1APLC 3T0YA 1TNSA 4YG2F 3RQIA 1B6AA 2R7RA 1YLFA 4PCQA 2PMZA 3UNGC 4I02A 4ENNA 3O2PE 4C30A 3IKTA 2LVSA 2JSCA 1Z7UA 4LK1F 2FF4A 1FIPA 2E2HJ 4I7HA 1T2KA 1MJBA 2KP6A 2L0KA 4XKVA 1QNTA 3IH2A 4OWRB 1SVMA 3WTUC 4BE1A 3S93A 2JA6J 3RI4A 2MABA 1SD7A 2KKOA 1IN4A 2QQBA 2GOMA 3G1MA 4P96A 1MMSA 3BTIA 1BA5A 4LB6B 2F5EA 2HU9A 3CF5F 2A6HF 2XAUA 1CF7B 5HLHA 3I54A 4DZPA 1BR2A 3BR1A 3L2WA 3VWBA 3LSTA 3LMMA 3I59B 4QPOA 3LWFA 4JQFA 4M73A 3E1SA 3V4GA 1U2WA 2JK3A 4EMSA 1J59A 3BR5A 2CQNA 2COBA 1POGA 2V1NA 4LIUA 4CDGA 2ZXIA 1EH8A 4DQ2A 1ETWA 3ROUA 4FETA 2M9HA 2CO5A 1KU7A 1WJCA 3F8NA 4I0BA 2E7WA 4ITVA 4NDLA 1ON1A 4UV8A 1Y0UA 3GFLA 3I56I 3L09A 2Y0MA 4P9FA 1LFBA 2EBIA 1QPIA 2I8DA 3IRQA 5HLIA 4E70A 2NOGA 1IO2A 1MMAA 2HDCA 1T0FA 3FIWA 1V5FA 4I76A 3TOAA 3E6DA 3K4KA 2QCOA 3PUBA 2R0QC 3KFWX 1QPMA 1HKTA 3WTXC 3AG3H 5EGOA 5CVRA 1B72B 1ZQ3P 2D5VA 5FRMA 2YU3A 3JAMZ 1MJAA 2LFBA 5DEQA 1Z7LA 2ZBKA 3RPUA 4NC6A 2K3PA 1GXQA 2E36A 4X6AJ 2DFHA 4QWQA 1X1AA 4Y3OA 5ILVA 3S1NJ 3FXUA 2H6BA 2X4HA 2B7EA 4LITA 4DNCA 5D5VB 2KPMA 2O7OA 5IP7J 3DPLC 1RR7A 3QYBA 4XRSA 3GLXA 1QQIA 3HOWJ 3J80Z 1JGGA 4CGZA 5B1BH 3NWSA 2GIVA 2IP2A 3I55I 1ZR2A 5F64A 1B9MA 3WG7H 4IZZA 4Q47A 2E60A 3PM1A 1P7JA 4R1HA 5ICCA 4GYGA 4IQ4A 3AG1H 3IH4A 4HF2A 4OAYA 3K4NA 2LP0A 3OSFA 4YEJA 1Z91A 2L4MA 4XLPF 4LGWA 3I58A 1AA7A 2EZHA 2RAEA 3ECOA 3HOYJ 3CUOA 1J2XA 3JRIA 2R93J 3S2DJ 1WH7A 1LDKB 2HVQA 4AU7A 3GYHX 2OD5A 4ZZLA 2DOAA 2FQ3A 1LJ9A 2HYGD 2O8KA 3REOA 2RNGA 1RZ4A 1P6RA 2MSYA 3VYUB 4IO9F 1EKEA 2QKMB 2WTEA 2LOOA 3FXMA 4HEA2 1A35A 2BBYA 1B8IB 2L7FP 3K6GA 5LHHA 4HX8A 2XVCA 4G7OF 2D1HA 1LE8B 2LYCA 1UFMA 3F72A 2OPTA 1MMDA 3F8FA 2YX4A 4L5EA 4XMYA 5B1AH 5KVRA 1MH4A 1T08B 4RGUA 2D2WA 5CVVA 3A01A 2DW4A 2LY9A 1JKOC 3HIFA 2RNJA 1FWZA 3PL8A 5HDGA 1IXRC 3CCLI 4A3EJ 1AKHA 1PDNC 3AFHA 2R7QA 3RPUD 2OTLI 2IS4A 4PJMA 3TDUC 4OOIA 1DP7P 2IBDA 3G71I 4A0YA 4G6DA 3SZPA 2FJ1A 1FOYA 3X2QH 1X3WB 3A4CA 4D9JA 1DDNA 3CC2I 1RPWA 3AG4H 3CDLA 4RDUA 4HBLA 4OMZA 5H20A 1FPQA 1O7LA 4CA0A 4XRFA 1LDDA 3HOXJ 3GFIA 2KIUA 1EV7A 3T5XA 2ZNYA 5K7HA 5F0CA 4ZYHA 1JJ8C 2JA8J 4CXFA 3UKGA 1WCMJ 3CCVI 1S3JA 1FJLA 3U1DA 1LEAA 2FA5A 5J47A 2FNAA 4IEJA 1TC3C 3ECHA 5FD5A 4HZFA 2BV6A 2CWEA 2VJJA 1VQNI 3EYYA 2VXDA 1VQ5I 3DTKA 1UELB 1J7KA 2CUEA 1TLHB 4FE4A 4UB6C 2KFDA 4BNCA 1R58A 3CTAA 4NHJA 1RRJA 3I64A 4UHTA 1XGNA 2W85A 3E7LA 1XTAA 2JVGA 4UUTA 1JKQC 4EM0B 1F9NA 2E5ZA 3LSRA 5KK1A 2LBFA 1KQ0A 5J1YA 3H3ZA 3LNQA 1MNMC 5K1YA 3TP0A 1SEUA 3BLYA 2JN6A 4CYDA 1QVUA 4A3LJ 3Q0VA 1BI1A 3H5AA 2Q2EB 1HCRA 4A0ZA 3LSPA 1OKRA 4PJNA 5D8LB 2GQQA 2OAZA 1YX3A 2PN6A 3DF8A 2E1CA 3RSNA 3V42A 3OR1C 3BROA 3JTGA 2OC6A 1TQMA 3DEWA 3ABLH 2R4GA 2FX0A 1N25A 4YIIA 3VYTB 3PIOF 4XL9A 2Y30A 4EM2A 2IXSA 4PJJA 3O8HA 3BG9A 1OYWA 2DPUA 2H94A 3QPLA 3CMEI 2FOKA 3KX2A 3HOUJ 4M9XA 3BR3A 4LFUA 3L2RA 3ASOH 2V1UA 1F43A 3K0LA 1R49A 3CJRB 4A3GJ 4CCNA 4ESJA 3GO5A 3HSEA 4ZDPA 2FRHA 1OLTA 3Q0WA 2Z5UA 1ZGAA 2IVMA 3OYKA 1HKSA 3KP2A 4N0BA 3BG7A 4HG2A 4ASNA 2V6CA 3BJOA 1SFOJ 4GCVA 5IT9K 2WAQN 3F6OA 4WCGA 3FM3A 4DZJA 2QKLB 1QZEA 2L7KA 2ZSHB 2HPMA 1YRNB 1X4PA 2QSHX 1R23A 1S29A 3CC7I 4RGSA 2WAFA 3GLLA 3OS0A 3OYGA 3S15J 2VN2A 4L9NA 5D8KB 4NB5A 5LEJA 5IYCJ 2P5LC 3JAMK 3JR9A 4UUSA 1X4OA 3BZ6A 4Z2YA 2OQGA 1WZ2A 3BG6A 1VTNC 4JYKA 3WODF 4MTEA 3SZTA 4PJLA 2MD5A 3IH3A 1ZK8A 5JR3A 3R61A 4RBOA 3UR3C 1JKPC 1LVKA 4IVNA 1SD5A 1V5GA 4A12A 2OZ6A 2JPBA 1PYVA 1TZLA 5HVQC 2EIKH 5DTDA 2ZKZA 4HAMA 5F6FA 3IHUA 2DOEA 1Z0XA 2ZSIB 5JVGF 3F22A 4G7HF 1YTYA 3V8LA 2IJLA 3HUGB 3DTEA 3KZIC 1GLNA 2LKPA 3JRAA 1RR8C 3BOQA 2IT0A 4HNTA 5A2QZ 2LC2A 4F7ZA 1D1AA 1X1DA 3MZYA 1IV6A 2EILH 2WB1N 4XNFA 2MGQA 1H9GA 5FROA 2ELJA 3M8EA 1A36A 5DCMB 1Z6TA 3FBNB 2ESNA 4KUMA 4XN0A 2CUFA 3HC7A 3KZZA 2EPFA 4O6JA 2CQKA 2VLAA 1MMGA 2V9PA 4RA2A 3FK7A 3FK6A 4IRGA 2YS9A 3HBLA 3L1PA 4ZDLA 1MD0A 1QGPA 4WF2A 4ZYAA 1AHDP 1JI8A 4HOBA 1J0RA 2K02A 3CCJI 2MFZA 1O7FA 4XLAA 1XMAA 3ZQLA 2EIJH 5C44J 2LY1A 2FBKA 1S5LC 1IW7F 1LB2A 4C3IJ 1FMWA 4FHTA 2HKXA 3I0TA 5J4YA 3JCUC 3PO2J 2EV0A 2EJRA 4KT6A 3BQZA 2A6TA 1ONVA 5JHUA 2DPDA 4PFPA 4AIHA 3HM5A 2DBBA 1IRGA 3FHZA 2VKVA 3S16J 1TW3A 2Z16A 4JP0A 1DQUA 1ZG1A 4Y52J 1USTA 4AVPA 5B5EC 2Z99A 1QVTA 3MVPA 1F5TA 3WE2A 5IOYA 1CF7A 2P81A 1TWGJ 2ZMEC 4IXAA 4EEFG 3S8PA 4YFKF 5FB2A 3HOSA 5FJ8J 4J19A 2HFHA 3LA2A 4D5CA 4CO8A 4DBRA 1OR7C 4CYCB 5E3OA 2K9QA 1USSA 4IHYA 4OU0A 4AIKA 4HQMA 3HPGA 4NUBA 1O3QA 2AQEA 1ZREA 5FO5A 1SAXA 1D1BA 3CF2A 3C2GA 2L2OA 3OYEA 2NOJB 1WJEA 2RGVA 4LG3A 3TEDA 2QSFX 2VC1A 3HKZN 2NNYA 2FOWA 2NS7A 1S8NA 5D6EA 1SFEA 5H6RA 3CMYA 3N4MA 4HV6A 1VQKI 3B73A 4GYIA 1XGMA 1FP1D 3OMYA 4A0XA 3S2HJ 5BNGA 1LEBA 1GVJA 4EATA 1SD4A 2M7BA 2VJ4A 2R7UA 5K5OA 2XROA 3DWLE 4HF0A 2O8XA 2YR2A 1JJ6C 1KQ9A 3WTSC 1BR4A 3FF5A 3K4JA 4UXNA 2IGNA 2VPLA 3ZOBA 1G3SA 1U78A 2LDUA 4M9SA 1A6IA 4UV9A 4MQVA 1P4WA 5AONA 1IAWA 4L18B 1VQ8I 2OCCH 3E6BA 3CLOA 2QA4I 1SFUA 1B4AA 1BM9A 2I5UA 2VT3A 4L9TA 4KIGA 2AHQA 3NEUA 4ESFA 1MDMB 2EFPA 1WFXA 5DDGA 3QU6A 3W3CA 1WQ2A 1YO5C 5J3LA 3OYLA 4JK1X 1KU2A 1FOKA 2KJBA 1D0ZA 2W24A 4S05A 1Y0NA 1WI9A 1BW5A 2OA4A 2DQLA 3PUFA 3Q9VA 1CQTA 3I53A 4RGRA 2W57A 4XSXF 2RREA 5FLXK 2KHMA 1HF0A 2K9MA 3ZMDA 1FEXA 2EFOA 2M0CA 1KZHA 3KE2A 4XIDA 1LFPA 4BDZA 2ZXJA 3WGIA 3WTZA 2ZJQF 1LKXA 2FMLA 2PEXA 2TCTA 3ISPA 3M1EA 4U0VA 3ZMVA 4L9VA 3JTHA 4J00A 2XSDC 4HPQA 1MSFC 3U21A 4ZZDA 3KP5A 1F1ZA 3OV8A 3OYDA 2DA4A 3VB2A 2R5YA 5F08A 2DI3A 3HSRA 5BPIA 4HLXA 3BJ6A 3TOBA 1TW2A 1X3UA 5CLSA 1F36A 3H92A 5DD8A 5LLQA 1YYVA 1T6SA 2BHZA 1D0XA 1Z3YA 4IX7A 2ZJ2A 2DA6A 3LSJA 2PJPA 2X51A 3CCRI 1MSEC 3R6SA 5C3EJ 4KN4X 1G59A 2N8GA 4XR6A 2EA4A 2QUFA 2IA0A 3GVAA 3OYAA 1JXSA 3H5RA 4UNOA 5FLXZ 3BCBA 3HOVJ 1FBUA 2P0WA 2DFEA 3CCUI 2DT5A 3JRFA 5A2QK 1UHMA 3K2AA 4F92B 4RB0A 1XCVA 3MFKA 1U5TA 2M87A 1ZG3A 1TT0A 4OMYA 1G3YA 1U6GA 1FYLA 3QRFF 2X85A 2NXNB 2HXOA 1HKQA 2DOFA 2VBZA 5FKKA 3GFMA 3ZRGA 2JJ7A 1YJ9I 3TO7A 2IW5A 3W6KB 2R7OA 5E3LA 3M4OJ 4EGYA 4ZYDA 3SFZA 2KISA 5EEAA 1FTZA 2GZWA 1BC7C 1YJNI 4M3BA 1XMKA 2M8GX 4BXFA 4EVIA 1X58A 1VQ7I 4KT5C 1WWXA 2ZFWA 4IPAA 4A6DA 3I3LA 2R92J 4XONA 1R36A 4D1QA 3KEQA 3J7AY 1GVDA 3HJEA 1YI2I 4X1EA 4EJOA 4PGHA 2IGMA 5L3BA 4JBAA 3KYDB 3VYRB 4GRIA 1IN5A 5GAGJ 3EQLF 4A3KJ 2OBPA 4GXOA 3OOUA 5FFXA 4MEXF 1ODDA 2NVTJ 2A68F 2RC4A 2HGCA 4M3FA 4AC0A 5L3GA 4XSZF 5BQTA 1X1BA 1PUFB 2XPWA 3FXQA 3FZVA 1E3HA 2KRHA 1DU0A 2QGUA 2HXIA 4PSXA 1XS9A 4IRIA 4B3XA 1KQ8A 2CS3A 3DCFA 2AXLA 5DUKA 2O9LA 3EDPA 2ELKA 2X9DA 4KN7X 5B66C 1VQ9I 2VL8A 4WX9A 4D0PA 3W6VA 1ZGJA 5KAFC 3D0SA 4WXDA 4AWXB 3IWFA 3P5JA 1H8AC 2EFQA 2JUGA 4LB5A 3LSKA 1UG0A 1DGRM 2VBXA 3SDGA 2P8TA 2ICWG 2ETHA 1QZYA 4UB8C 3A1YA 2B0LA 4KA4A 2PFBA 4WK8F 2QSGX 3ZPLA 4U88A 1N77A 1H89C 1MGTA 2O03A 2KIQA 4ZDOA 2K3FA 1FT9A 3C3WA 2A69F 2GM4A 3BPXA 4CCJA 2M4KA 2LY2A 4BY7J 3S1RJ 4WXHA 4NQWB 3DPUA 1TL8A 2DTRA 2EZLA 4XLCA 4A3MJ 4KDPA 1SANA 1V5EA 3R60A 5K5RA 3OYBA 2E1OA 1P9QC 5KNLA 3DLLF 3G3ZA 4P1WA 1MBJA 2DMQA 4ZTFA 2D45A 4CICA 3WU2C 1BIBA 2XF6A 5E20A 5L3DA 1IUYA 1WJFA 1KYWA 3CCEI 1MBKA 5CPRB 1AWCA 1NH3A 2NAZA 3RZOJ 2HZDA 5IY5H 3MMYB 4M6VA 2JA5J 2E1NA 1NK2P 2DA3A 2GOXB 3CUQB 4EJVA 3MKZA 5HNFA 3KEYA 4CH7A 5DS9A 2L5QA 2DDAA 4A5NA 1T39A 3CC4I 1A04A 2VE8A 2CV0A 4AYBA 1FTTA 2XDVA 4HSRA 1P2FA 3RKYA 1P7IA 3HHHA 5LHIA 2HOEA 3R4KA 5CVIA 5EG0A 3E6CC 3PNYA 3ZQCA 1VQ6I 2A61A 3GTLJ 2IRFG 4F91B 4M3GA 2MG4A 1JT6A 3ZMZA 4YFXF 5FKOA 4RAGA 3T8RA 2M2EA 4MQ9F 3FWEA 3OYCA 3GZ6A 4BHPA 1Z3XA 2G0EA 3FM5A 1NG7A 4FASD 1ETYA 3GEZA 2A05A 2K9NA 4V19K 1ZRDA 3CQZJ 5JHFA 4CHUA 2GAUA 2V9KA 2V4JC 1VQ4I 3GTQJ 2F6CA 1SC7A 3ONQA 1ZN2A 1WJBA 3OYFA 2K40A 3RYRA 2UUZA 1W5SA 2DJIA 3WU0A 1B9NA 2LSOA 4G9YA 2V1XA 3BG5A 3OWTA 4LOCA 2CV2A 4DJAA 2NYXA 3I4PA 1RNLA 1Y8RB 5JI6A 4D7NA 1SMYF 3HRSA 1FSEA 5EJCA 2W00A 4RLFA 4F52A 1UHWA 3HG9A 3L2QA 4BDYA 3W2VA 2HEOA 1PUFA 5L3CA 3L2CA 1HW2A 2DN0A 2HVRA 3H9GA 4Y17A 1FOWA 2DO7A 3C18A 1Z9CA 1JE8A 2VKHA 4GGGA 5HLTA 4QPQA 3MCZA 5F0HA 1I6HJ 3ZMTA 1E3PA 3RKQA 4DYRA 3J80K 1ZHFA 1MBGA 3E97A 3IP4B 2VOPA 4ESBA 2CW8A 2H09A 4YRVA 3RKXA 1D3YA 2VKEA 1G3WA 1S7OA 1J5YA 3DV8A 2HQ5A 3QODA 4N9IA 1P4AA 2VBYA 1REPC 3SZGA 4W97A 3OIPA 1O3SA 1IXSB 3JRCA 4ZC3A 4G8XA 2LBFB 3O6BB 3MN2A 3ZQQA 1ERDA 2K4BA 2WV1A 1SAUA 1FLIA 2Y31A 2VIXA 1R6RA 2JMWA 3H9QA 1EH7A 1QA6A 2K5CA 1IUFA 1D1CA 2XF7A 4XLEA 2V6EA 1Q1VA 2FBHA 4LJZF 4XOPA 2Z3YA 4XORA 4RLQA 2HVSA 3E5QA 3A2KA 3VSLA 1T8IA 4KFCA 4D5FA 2STTA 2HOTA 1PP7U 1I27A 4MTDA 3K7AJ 1F4KA 1VQPI 1HW1A 3VEPA 4LLNA 3RZDJ 1WRJA 2ELHA 2OV7A 3JRHA 4E4HA 4KMFA 2B63J 2CG4A 1ETOA 4DYQA 4WWCA 3S14J 1MIJA 1ACIA 3PFYA 5M3MJ 5FLMJ 3ZR8X 3BC8A 3L9FA 3P9CA 2LR8A 2VQGA 1FC3A 3BP8A 3DKWA 3GUDA 3M8JA 5KCMA 5ED4A 3S1MJ 4FTHA 2E1MB 2L02A 5D6FA 5HDKA 2NRAC 1TQPA 2CYYA 3D5LA 4Y4RA 1FNNA 4Q48A 1SVOA 3OIQA 3LSHA 2HDWA 3VPRA 1BR1A 2KJCA 5LD2C
chains in the Genus database with same CATH topology
4Y7NJ 1JT0A 3Q3SA 1ETKA 3HM5A 3HOZJ 1A5JA 3H3VK 2ID3A 2VKVA 3BG3A 3S16J 2HI3A 4JP0A 5EDNA 4Y52J 2DTZA 1QVTA 3MVPA 4A69C 5IOYA 1TWAJ 2P81A 1TWGJ 4EEFG 5IYDJ 5FJ8J 3PO3J 4J19A 3ZQHA 2XPUA 1X2NA 1TWFJ 2NVXJ 3HB9A 4D5CA 5GP9A 1GV2A 4CYCB 1OCPA 5E3OA 1NTCA 2K9QA 4IHYA 1D5YA 1ZGWA 3TW6A 4BBSJ 2Y0SN 1ZTRA 4FISA 5GPAA 1I3QJ 1UMQA 1ORKA 1JTYA 3QQAA 5HODA 1UHSA 2YU9J 3SJMA 1Z77A 3TEDA 2ZB9A 1WGXA 1RKTA 3HKZN 2NS7A 1OFCX 3CMYA 2LK2A 1DU6A 3O8GA 5M5XJ 1BW6A 2GLOA 1B72A 3S2HJ 5BNGA 5E3NA 5F04A 4A3IJ 1T33A 1GV5A 1APLC 1JUPA 3RQIA 2DJNA 4FE7A 2CQXA 1ZKGA 1JJ6C 2JWTA 1U9OA 2R7ZJ 2LVSA 3ZOBA 5EZGA 1U78A 3B6CA 1A6IA 5FKNA 2ME6A 1FIPA 2E2HJ 1O4XA 4JX6A 2L0KA 3IH2A 2NVYJ 2VUMJ 2AHQA 1XC5A 2JA6J 5EYRA 1VI0A 5IP6A 5J3LA 3G1MA 1B8IA 3BTIA 1BA5A 4BXXJ 4C3JJ 1BW5A 4IHWA 3BTLA 2X6OA 1CQTA 1ETVA 5GPCA 3BR6A 4DZPA 3BR1A 4V2FA 1HF0A 1IDZA 1FEXA 2H8RA 1ETQA 1Y1VJ 3S17J 2M0CA 2R5ZB 2LTPA 1H88C 2JK3A 1IGNA 4XIDA 3BR5A 2COBA 1POGA 2K9SA 1JTXA 3SFIA 3D1NI 4B4CA 2TCTA 4AUXA 1MH3A 2L7MP 1ETWA 5JLWA 3HGYA 2M9HA 4NDLA 2XSDC 1MSFC 2NS8A 1LFBA 2DA4A 2L7ZA 2R5YA 2EBIA 5F08A 2DMTA 1QPIA 4S0HB 2DMNA 4A3FJ 1F36A 4DYCA 4A3JJ 4QTRA 2NOGA 5JLXA 2CJJA 4GFBA 2EH3A 2DA6A 3FIWA 3LSJA 4I76A 1MSEC 5C3EJ 2N8GA 2QCOA 3WHBA 9ANTA 5E3MA 2R0QC 2HDDA 1BL0A 1AKHB 3GTMJ 5C4JJ 3HOVJ 5EGOA 5C4XJ 3JRFA 1B72B 1ZQ3P 2D5VA 3K2AA 1LE8A 1I50J 3ZQFA 2XRLA 3JRBA 1MBFA 2LFBA 3A01B 3JRDA 2EZIA 1VNDA 2L9RA 4X6AJ 2HXOA 3TP3A 5FKKA 2Y2ZA 4C2MJ 2I10A 3OSGA 2JJ7A 4V2GA 3BTCA 3S1NJ 4MIMA 2LLKA 3BR0A 1XG1A 3M4OJ 5E3LA 1OJLA 4I6ZA 5EEAA 5IP7J 2O7OA 1FTZA 1RR7A 4M3DA 4XRSA 3HOWJ 4M3BA 4CYCA 1JGGA 2M8GX 2H1KA 1X58A 1ZR2A 5EZHA 1E3OC 1RETA 3PM1A 3Q0UA 1P7JA 2R92J 3IH4A 2EZKA 1GVDA 2LP0A 2KDZA 2EQRA 3OSFA 4X1EA 2KT0A 1JUMA 1IRZA 2DMPA 3OIOA 3I4NJ 2EZHA 4BKXA 2RAEA 1VF9A 3HOYJ 3JRIA 2R5ZA 5IOZA 4A3KJ 1X2MA 5IP9J 2R93J 3OOUA 3S2DJ 1WH7A 2M34A 3HDDA 2NVTJ 4B1RA 2O8KA 1ITYA 1TWCJ 4M3FA 4AC0A 2ME0A 3NARA 2DA1A 2MSYA 1PUFB 1HDDC 2XPWA 2GBYA 1B8IB 2L7FP 2CU7A 4MFDA 1DU0A 2HXIA 1XS9A 1G2HA 5F0FA 1RESA 3BT9A 2DA5A 3DCFA 1LE8B 2LKXA 2OPTA 1Y1WJ 2HOSA 2O9LA 3GTKJ 2ECBA 4L5EA 5M3FJ 2ELKA 2X9DA 1MH4A 3A01A 3F0CA 3G1OA 2LY9A 1JKOC 3W6VA 3GBGA 4A3EJ 1AKHA 2JA7J 1H8AC 4W1UA 3A03A 3SDGA 2IBDA 4BBRJ 5M5WJ 2QF7A 3QPSA 3HEFA 3HGGA 4G12A 5K7FA 4M3EA 2FJ1A 1WI3A 4DW6A 3GTOJ 1RPWA 4A3BJ 4IHVA 3CDLA 4RDUA 1AU7A 1H89C 2R5YB 1WH5A 3HOXJ 5K7HA 5F0CA 1LFUP 2XGEA 2VI6A 2GM4A 1JJ8C 2JA8J 2PMZN 4BY7J 1WCMJ 3UKGA 3S1RJ 1ZR4A 1FJLA 2EZLA 3JRGA 4IEJA 1SANA 4A3MJ 1TC3C 1K61A 2DMUA 4UUSB 3FKIJ 2E1OA 3MKLA 2XGCA 2DA7A 1MBJA 2DMQA 5EF6A 3M3YJ 4MFEA 4QIWN 2CUEA 4FE4A 2E2JJ 1JKRC 1NK3P 4D7MA 1MBKA 1ETXA 3RZOJ 4XRSG 4M6VA 2JA5J 3E7LA 1GDTA 4UUTA 4ABZA 1NK2P 2DA3A 1JKQC 4XK4A 3G1LA 5DS9A 3LSRA 5EGOB 5J1YA 1T56A 3LNQA 3CCYA 1MNMC 1FTTA 3TP0A 4A3DJ 3I4MJ 1P7IA 2JN6A 5IPAA 3GTPJ 1QVUA 4A3LJ 1W0TA 3Q0VA 5EG0A 4A93J 4IHXA 2YUSA 2IEKA 3ZQCA 5IYBJ 1HCRA 3GTLJ 4M3GA 3LSPA 2MG4A 1JT6A 1UG2A 3H0GJ 4XRMA 5FKOA 3B6AA 2VPRA 2M2EA 3DEWA 2FX0A 1RKWA 2Y30A 1HDPA 2G0EA 4AYBN 1HLVA 1ETYA 3O8HA 3BG9A 2K9NA 3CQZJ 3TW7A 3QPLA 5FLVA 1QRYA 3GTQJ 3HOUJ 3BR3A 2Y9ZA 1F43A 3A02A 3GTGJ 2DA2A 4A3GJ 5F27A 2E2IJ 2W48A 2K40A 2ECCA 3Q0WA 2CQQA 3FISA 3BG5A 4LOCA 1U9NA 5FKLA 1SFOJ 4A3CJ 3WHCA 4D7NA 2WAQN 4DZJA 5F1JA 1YRNB 2XGDA 3GTJJ 2XB5A 1PUFA 3S15J 2DN0A 2OF7A 1R9TJ 5IYCJ 4JX4A 4UUSA 3JR9A 2MW8A 1VFCA 3JREA 2NVQJ 1GUUA 5F0HA 1I6HJ 1WPKA 3NAUA 4JYKA 3RKQA 4DYRA 1MBGA 3IH3A 1ZK8A 2HOAA 2XPVA 4RBOA 4HNVA 1JKPC 1ENHA 2VKEA 2HQ5A 2ID6A 2HYJA 1FIAA 4W97A 3C2BA 5DTDA 1K83J 3JRCA 2FQ4A 1Z0XA 4MO7A 3MN2A 1EF4A 3BQYA 2WV1A 5FKMA 2Y31A 3LSGA 3LOCA 4FCYA 2X48A 3JRAA 2JMWA 3ZQGA 1IUFA 1IV6A 2WB1N 5J1RA 1Q1VA 2MGQA 2IAIA 2CRGA 5J1UA 1HOMA 1TWHJ 3BR2A 4MLOA 4D5FA 4JX5A 2HOTA 1BJZA 3K7AJ 1JUSA 2CUFA 1IJWC 2XB0X 3RZDJ 2E19A 1W0UA 3FK7A 1IDYA 3JRHA 3FK6A 1GT0C 2B63J 3L1PA 2YS9A 3HBLA 1S7EA 4QSHA 5K7ZA 2AO9A 1ETOA 1AHDP 1YRNA 1MBEA 4DYQA 4BY1J 1U8BA 3S14J 3ZQIA 5M3MJ 3ZQLA 1MBHA 5FLMJ 5C44J 5EG0B 2LR8A 4C3IJ 3S1MJ 5M5YJ 2FD5A 4FTHA 2Y9YA 4XICA 1IC8A 2LD5A 3S1QJ 2TRTA 3BTJA 1OCTC 3PO2J 1IG7A 4C3HJ 3VPRA 3IV5A 3BQZA 4B3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y7N J;  1JT0 A;  3Q3S A;  1ETK A;  3HM5 A;  3HOZ J;  1A5J A;  3H3V K;  2ID3 A;  2VKV A;  3BG3 A;  3S16 J;  2HI3 A;  4JP0 A;  5EDN A;  4Y52 J;  2DTZ A;  1QVT A;  3MVP A;  4A69 C;  5IOY A;  1TWA J;  2P81 A;  1TWG J;  4EEF G;  5IYD J;  5FJ8 J;  3PO3 J;  4J19 A;  3ZQH A;  2XPU A;  1X2N A;  1TWF J;  2NVX J;  3HB9 A;  4D5C A;  5GP9 A;  1GV2 A;  4CYC B;  1OCP A;  5E3O A;  1NTC A;  2K9Q A;  4IHY A;  1D5Y A;  1ZGW A;  3TW6 A;  4BBS J;  2Y0S N;  1ZTR A;  4FIS A;  5GPA A;  1I3Q J;  1UMQ A;  1ORK A;  1JTY A;  3QQA A;  5HOD A;  1UHS A;  2YU9 J;  3SJM A;  1Z77 A;  3TED A;  2ZB9 A;  1WGX A;  1RKT A;  3HKZ N;  2NS7 A;  1OFC X;  3CMY A;  2LK2 A;  1DU6 A;  3O8G A;  5M5X J;  1BW6 A;  2GLO A;  1B72 A;  3S2H J;  5BNG A;  5E3N A;  5F04 A;  4A3I J;  1T33 A;  1GV5 A;  1APL C;  1JUP A;  3RQI A;  2DJN A;  4FE7 A;  2CQX A;  1ZKG A;  1JJ6 C;  2JWT A;  1U9O A;  2R7Z J;  2LVS A;  3ZOB A;  5EZG A;  1U78 A;  3B6C A;  1A6I A;  5FKN A;  2ME6 A;  1FIP A;  2E2H J;  1O4X A;  4JX6 A;  2L0K A;  3IH2 A;  2NVY J;  2VUM J;  2AHQ A;  1XC5 A;  2JA6 J;  5EYR A;  1VI0 A;  5IP6 A;  5J3L A;  3G1M A;  1B8I A;  3BTI A;  1BA5 A;  4BXX J;  4C3J J;  1BW5 A;  4IHW A;  3BTL A;  2X6O A;  1CQT A;  1ETV A;  5GPC A;  3BR6 A;  4DZP A;  3BR1 A;  4V2F A;  1HF0 A;  1IDZ A;  1FEX A;  2H8R A;  1ETQ A;  1Y1V J;  3S17 J;  2M0C A;  2R5Z B;  2LTP A;  1H88 C;  2JK3 A;  1IGN A;  4XID A;  3BR5 A;  2COB A;  1POG A;  2K9S A;  1JTX A;  3SFI A;  3D1N I;  4B4C A;  2TCT A;  4AUX A;  1MH3 A;  2L7M P;  1ETW A;  5JLW A;  3HGY A;  2M9H A;  4NDL A;  2XSD C;  1MSF C;  2NS8 A;  1LFB A;  2DA4 A;  2L7Z A;  2R5Y A;  2EBI A;  5F08 A;  2DMT A;  1QPI A;  4S0H B;  2DMN A;  4A3F J;  1F36 A;  4DYC A;  4A3J J;  4QTR A;  2NOG A;  5JLX A;  2CJJ A;  4GFB A;  2EH3 A;  2DA6 A;  3FIW A;  3LSJ A;  4I76 A;  1MSE C;  5C3E J;  2N8G A;  2QCO A;  3WHB A;  9ANT A;  5E3M A;  2R0Q C;  2HDD A;  1BL0 A;  1AKH B;  3GTM J;  5C4J J;  3HOV J;  5EGO A;  5C4X J;  3JRF A;  1B72 B;  1ZQ3 P;  2D5V A;  3K2A A;  1LE8 A;  1I50 J;  3ZQF A;  2XRL A;  3JRB A;  1MBF A;  2LFB A;  3A01 B;  3JRD A;  2EZI A;  1VND A;  2L9R A;  4X6A J;  2HXO A;  3TP3 A;  5FKK A;  2Y2Z A;  4C2M J;  2I10 A;  3OSG A;  2JJ7 A;  4V2G A;  3BTC A;  3S1N J;  4MIM A;  2LLK A;  3BR0 A;  1XG1 A;  3M4O J;  5E3L A;  1OJL A;  4I6Z A;  5EEA A;  5IP7 J;  2O7O A;  1FTZ A;  1RR7 A;  4M3D A;  4XRS A;  3HOW J;  4M3B A;  4CYC A;  1JGG A;  2M8G X;  2H1K A;  1X58 A;  1ZR2 A;  5EZH A;  1E3O C;  1RET A;  3PM1 A;  3Q0U A;  1P7J A;  2R92 J;  3IH4 A;  2EZK A;  1GVD A;  2LP0 A;  2KDZ A;  2EQR A;  3OSF A;  4X1E A;  2KT0 A;  1JUM A;  1IRZ A;  2DMP A;  3OIO A;  3I4N J;  2EZH A;  4BKX A;  2RAE A;  1VF9 A;  3HOY J;  3JRI A;  2R5Z A;  5IOZ A;  4A3K J;  1X2M A;  5IP9 J;  2R93 J;  3OOU A;  3S2D J;  1WH7 A;  2M34 A;  3HDD A;  2NVT J;  4B1R A;  2O8K A;  1ITY A;  1TWC J;  4M3F A;  4AC0 A;  2ME0 A;  3NAR A;  2DA1 A;  2MSY A;  1PUF B;  1HDD C;  2XPW A;  2GBY A;  1B8I B;  2L7F P;  2CU7 A;  4MFD A;  1DU0 A;  2HXI A;  1XS9 A;  1G2H A;  5F0F A;  1RES A;  3BT9 A;  2DA5 A;  3DCF A;  1LE8 B;  2LKX A;  2OPT A;  1Y1W J;  2HOS A;  2O9L A;  3GTK J;  2ECB A;  4L5E A;  5M3F J;  2ELK A;  2X9D A;  1MH4 A;  3A01 A;  3F0C A;  3G1O A;  2LY9 A;  1JKO C;  3W6V A;  3GBG A;  4A3E J;  1AKH A;  2JA7 J;  1H8A C;  4W1U A;  3A03 A;  3SDG A;  2IBD A;  4BBR J;  5M5W J;  2QF7 A;  3QPS A;  3HEF A;  3HGG A;  4G12 A;  5K7F A;  4M3E A;  2FJ1 A;  1WI3 A;  4DW6 A;  3GTO J;  1RPW A;  4A3B J;  4IHV A;  3CDL A;  4RDU A;  1AU7 A;  1H89 C;  2R5Y B;  1WH5 A;  3HOX J;  5K7H A;  5F0C A;  1LFU P;  2XGE A;  2VI6 A;  2GM4 A;  1JJ8 C;  2JA8 J;  2PMZ N;  4BY7 J;  1WCM J;  3UKG A;  3S1R J;  1ZR4 A;  1FJL A;  2EZL A;  3JRG A;  4IEJ A;  1SAN A;  4A3M J;  1TC3 C;  1K61 A;  2DMU A;  4UUS B;  3FKI J;  2E1O A;  3MKL A;  2XGC A;  2DA7 A;  1MBJ A;  2DMQ A;  5EF6 A;  3M3Y J;  4MFE A;  4QIW N;  2CUE A;  4FE4 A;  2E2J J;  1JKR C;  1NK3 P;  4D7M A;  1MBK A;  1ETX A;  3RZO J;  4XRS G;  4M6V A;  2JA5 J;  3E7L A;  1GDT A;  4UUT A;  4ABZ A;  1NK2 P;  2DA3 A;  1JKQ C;  4XK4 A;  3G1L A;  5DS9 A;  3LSR A;  5EGO B;  5J1Y A;  1T56 A;  3LNQ A;  3CCY A;  1MNM C;  1FTT A;  3TP0 A;  4A3D J;  3I4M J;  1P7I A;  2JN6 A;  5IPA A;  3GTP J;  1QVU A;  4A3L J;  1W0T A;  3Q0V A;  5EG0 A;  4A93 J;  4IHX A;  2YUS A;  2IEK A;  3ZQC A;  5IYB J;  1HCR A;  3GTL J;  4M3G A;  3LSP A;  2MG4 A;  1JT6 A;  1UG2 A;  3H0G J;  4XRM A;  5FKO A;  3B6A A;  2VPR A;  2M2E A;  3DEW A;  2FX0 A;  1RKW A;  2Y30 A;  1HDP A;  2G0E A;  4AYB N;  1HLV A;  1ETY A;  3O8H A;  3BG9 A;  2K9N A;  3CQZ J;  3TW7 A;  3QPL A;  5FLV A;  1QRY A;  3GTQ J;  3HOU J;  3BR3 A;  2Y9Z A;  1F43 A;  3A02 A;  3GTG J;  2DA2 A;  4A3G J;  5F27 A;  2E2I J;  2W48 A;  2K40 A;  2ECC A;  3Q0W A;  2CQQ A;  3FIS A;  3BG5 A;  4LOC A;  1U9N A;  5FKL A;  1SFO J;  4A3C J;  3WHC A;  4D7N A;  2WAQ N;  4DZJ A;  5F1J A;  1YRN B;  2XGD A;  3GTJ J;  2XB5 A;  1PUF A;  3S15 J;  2DN0 A;  2OF7 A;  1R9T J;  5IYC J;  4JX4 A;  4UUS A;  3JR9 A;  2MW8 A;  1VFC A;  3JRE A;  2NVQ J;  1GUU A;  5F0H A;  1I6H J;  1WPK A;  3NAU A;  4JYK A;  3RKQ A;  4DYR A;  1MBG A;  3IH3 A;  1ZK8 A;  2HOA A;  2XPV A;  4RBO A;  4HNV A;  1JKP C;  1ENH A;  2VKE A;  2HQ5 A;  2ID6 A;  2HYJ A;  1FIA A;  4W97 A;  3C2B A;  5DTD A;  1K83 J;  3JRC A;  2FQ4 A;  1Z0X A;  4MO7 A;  3MN2 A;  1EF4 A;  3BQY A;  2WV1 A;  5FKM A;  2Y31 A;  3LSG A;  3LOC A;  4FCY A;  2X48 A;  3JRA A;  2JMW A;  3ZQG A;  1IUF A;  1IV6 A;  2WB1 N;  5J1R A;  1Q1V A;  2MGQ A;  2IAI A;  2CRG A;  5J1U A;  1HOM A;  1TWH J;  3BR2 A;  4MLO A;  4D5F A;  4JX5 A;  2HOT A;  1BJZ A;  3K7A J;  1JUS A;  2CUF A;  1IJW C;  2XB0 X;  3RZD J;  2E19 A;  1W0U A;  3FK7 A;  1IDY A;  3JRH A;  3FK6 A;  1GT0 C;  2B63 J;  3L1P A;  2YS9 A;  3HBL A;  1S7E A;  4QSH A;  5K7Z A;  2AO9 A;  1ETO A;  1AHD P;  1YRN A;  1MBE A;  4DYQ A;  4BY1 J;  1U8B A;  3S14 J;  3ZQI A;  5M3M J;  3ZQL A;  1MBH A;  5FLM J;  5C44 J;  5EG0 B;  2LR8 A;  4C3I J;  3S1M J;  5M5Y J;  2FD5 A;  4FTH A;  2Y9Y A;  4XIC A;  1IC8 A;  2LD5 A;  3S1Q J;  2TRT A;  3BTJ A;  1OCT C;  3PO2 J;  1IG7 A;  4C3H J;  3VPR A;  3IV5 A;  3BQZ A;  4B3A A; 
#chains in the Genus database with same CATH topology
 2MLK A;  1QBJ A;  3CUQ C;  5BPD A;  3Q3S A;  2FBI A;  1BI0 A;  3ZCO A;  3CMM A;  2ID3 A;  2X0L A;  3BG3 A;  3LSM A;  1XN7 A;  2HI3 A;  1FY7 A;  2FU4 A;  3IL2 A;  1D8K A;  1U3E M;  3R0J A;  4BXU A;  1VQM I;  3H35 A;  3EET A;  2LRD A;  2CH0 A;  3HUG A;  3OS2 A;  2CFO A;  1X2N A;  1W7P D;  1GV2 A;  5GP9 A;  6PAX A;  1OCP A;  1R5H A;  3FMR A;  4KIB A;  2E35 A;  3TW6 A;  1U8R A;  3Q9S A;  1N75 A;  4RAY A;  3DBL B;  1KU9 A;  2QBY A;  1JTY A;  3HHG A;  1HSJ A;  1UHS A;  3MQ0 A;  3QQA A;  4MNU A;  5H2F C;  3VOD A;  4ZH4 F;  3SJM A;  1W36 D;  3CDI A;  3PSI A;  5HS9 A;  4AD9 A;  3IAS 2;  2ZB9 A;  1WGX A;  1CGP A;  1G6N A;  4I2O A;  2IGK A;  3KP4 A;  3OYJ A;  4BHC A;  2KLO A;  1BW6 A;  2GLO A;  1K7A A;  1T98 A;  1L3L A;  5E3N A;  4FX0 A;  1T33 A;  4RAF A;  4L5J A;  1GV5 A;  1VZ0 A;  5AIP A;  1JUP A;  4B48 A;  4HDV A;  1DP3 A;  3K4B A;  3ELK A;  5DCM A;  2DJN A;  2EV5 A;  3GWZ A;  4BGD A;  2JWT A;  2JUC A;  2H6C A;  3J7Y J;  2KZG A;  1ZAR A;  3B6C A;  2KRC A;  1EH6 A;  5IYD J;  1O4X A;  1ZH5 A;  1TT5 B;  2Z2S B;  2VUM J;  5IT3 A;  4BE0 A;  2ACJ A;  4LMY A;  1L0O C;  1FBS A;  1XC5 A;  3DTI A;  3N05 A;  4HST A;  1TTY A;  2OJE D;  2NNN A;  5IP6 A;  2YSR A;  5CVU A;  1B59 A;  3S3M A;  1WJD A;  1UAA A;  4XM3 A;  1OIS A;  2FEZ A;  4C3J J;  5EEH A;  4IHW A;  3BTL A;  4G94 A;  1ZRF A;  5ERI A;  4IQJ A;  1ETV A;  3K4L A;  4EJT A;  1TP4 A;  1OYY A;  1Z6R A;  2QEN A;  4U0W A;  2E5N A;  1Y39 A;  2PI0 A;  2H8R A;  1WKM A;  2JA2 A;  3B02 A;  1H88 C;  2XC7 A;  2BYV E;  4FX4 A;  2KDO A;  3QPH A;  3V8K A;  1LDJ A;  3SFI A;  4B4C A;  4AUX A;  1MH3 A;  3CJN A;  2R7D A;  2L7M P;  3FDY A;  3CMA I;  2JSP A;  4MEY F;  3HRT A;  3HGY A;  1I39 A;  3VSK A;  3ZXS A;  5JLW A;  2BW3 A;  2V79 A;  3DPT A;  5F1R A;  4M72 A;  2AS5 F;  4GDF A;  2NS8 A;  2JZY A;  2M45 A;  3FXJ A;  2XAF A;  3DU5 A;  2Y69 H;  2DMT A;  3KLN A;  1HW5 A;  4HNU A;  2DMN A;  4R8H A;  4BUP A;  3F8B A;  5JLX A;  5JVT A;  2PG4 A;  4GFB A;  2M7A A;  5LHG A;  5FFZ A;  3F8M A;  3ZN1 A;  3JSO A;  4AM3 A;  1QU3 A;  2HDD A;  4X0G A;  1K6O A;  1BL0 A;  1QO0 D;  2PBI A;  1T38 A;  3GTM J;  1G3T A;  4L0Z B;  4IHS A;  4M6Y A;  4BU2 A;  4EJU A;  2EFN A;  4DOZ A;  2XAJ A;  1I50 J;  2J5P A;  3QYE A;  1HQC A;  1YJW I;  1OCR H;  2CFX A;  2CSO A;  1MDM A;  4KJZ A;  2XRL A;  3JRB A;  1HBX G;  2W7N A;  1W5C C;  1WJA A;  5HLG A;  5CKT A;  1S6L A;  3K1N A;  2E34 A;  3JRD A;  1VND A;  2WV0 A;  3K9T A;  3M9A A;  5LEK A;  1D0Y A;  2OQR A;  4L5I A;  5IT9 Z;  2UV1 A;  1SD6 A;  2Y2Z A;  4C2M J;  1R1T A;  3F9K A;  4UVB A;  4V2G A;  5DUI A;  1J09 A;  1C0W A;  1XB4 A;  4AID A;  4MIM A;  2LLK A;  3BR0 A;  2JQ7 A;  1FX7 A;  1OJL A;  2XHK A;  1RI7 A;  4I6Z A;  4QLC U;  5CQE A;  2QQ8 A;  3CJQ B;  4M3D A;  2P6T A;  3ERM A;  2WBM A;  3L7W A;  2H1K A;  5E8I A;  4BH9 A;  2M8E A;  2BZT A;  2O5R A;  1RET A;  2PJR B;  4LLL A;  2IPQ X;  2Y75 A;  2DFI A;  3DQV C;  2F4I A;  3OOP A;  2EZK A;  1KON A;  2KDZ A;  4NQW A;  2ZXW H;  3K70 C;  2KT0 A;  5GTI C;  1JUM A;  2A5Y B;  3U2R A;  1IRZ A;  2KZV A;  5HS8 A;  5HNH A;  2DMP A;  4BEH A;  3P9I A;  3TO6 A;  3I4N J;  4JOM A;  2BY0 A;  4RAZ A;  1LNW A;  2KRF A;  1XSX A;  5CJ9 A;  1X2M A;  4BHB A;  2VQH A;  2R5Z A;  1OCC H;  3K4M A;  2M34 A;  2EWN A;  5ICF A;  1OPC A;  3NRV A;  1RC9 A;  5L3E A;  2WAQ A;  3LAJ A;  4E7K A;  3SDB A;  4M6X A;  4KIF A;  5LFA A;  2W4S A;  4IKF A;  4I0A A;  2VE9 A;  4A5M A;  4MFD A;  2H27 A;  3PFI A;  1MNE A;  1MKM A;  3E6M A;  2W84 A;  5GAE J;  5F0F A;  1RES A;  3BT9 A;  4Y33 A;  4Y13 A;  2LKX A;  2IS6 A;  2HOS A;  2ECB A;  1DUX C;  3V7C A;  2QZ8 A;  1IRX A;  4B09 A;  3F0C A;  1GHC A;  2GIZ A;  5BOX A;  2UZK A;  2R7W A;  5B3S H;  4L0Y B;  3H5N A;  2RKH A;  3FXO A;  4W1U A;  3A03 A;  1YIJ I;  4BBR J;  5M5W J;  2PX9 A;  3QPS A;  1RUN A;  2L3D A;  3HEF A;  4G12 A;  2GA1 A;  4HX4 A;  4MGR A;  1WI3 A;  1V55 H;  4DW6 A;  3GTO J;  4IHV A;  2DYS H;  3I59 A;  3OR2 C;  4BJT A;  2XUB A;  3MWM A;  1V3F A;  1BN5 A;  2R5Y B;  1WH5 A;  5TGT A;  3MZ8 A;  4B47 A;  4IOC F;  1YG2 A;  1KGS A;  4RB1 A;  1LFU P;  5HOO A;  2XGE A;  3RDI A;  2A3S A;  2VI6 A;  4LLG F;  3ULQ B;  3CCQ I;  1XD7 A;  2WB1 A;  4HX7 A;  3S32 A;  2PMZ N;  2XAH A;  3ERE D;  1O3T A;  3RYP A;  4PZJ A;  1ZR4 A;  3SQN A;  3LFK A;  5J8C A;  2GA2 A;  2LRE A;  3WTY C;  3JRG A;  1K61 A;  2DMU A;  4LG0 A;  1BIA A;  1J9I A;  3FKI J;  1R4N B;  3MKL A;  3KP3 A;  4DIQ A;  1I6X A;  1IXC A;  2X1C A;  1AOY A;  3V7S A;  2H1L A;  3VYS B;  4QIW N;  4NBQ A;  2BXZ A;  1JKR C;  3K2Z A;  4PSW A;  1NK3 P;  1R00 A;  3FX3 A;  1FOX A;  1LQ1 A;  1I1S A;  1XDS A;  2BY2 A;  2HZT A;  2O3F A;  2MH9 A;  1JHH A;  3M8F A;  1GDT A;  3CZ6 A;  4ABZ A;  3G4S I;  1W4M A;  3GFJ A;  3G1L A;  4XK4 A;  5EGO B;  2DK8 A;  4EV0 A;  3CCY A;  2ESH A;  3EYI A;  3U9G A;  1TQI A;  3AL0 B;  2LNB A;  3I4M J;  3KLO A;  3FBI B;  2V1D A;  3DFG A;  4EM1 A;  5IPA A;  3J81 Z;  3LA3 A;  2NS0 A;  4A93 J;  2G7H A;  2IEK A;  3CDH A;  4U87 A;  5IYB J;  1R1U A;  2BEO A;  4Z6Y A;  4BAC A;  2K4J A;  2XV4 S;  1W7P A;  5FD6 A;  2FXA A;  4R79 A;  1OCO H;  3EUK L;  1UG2 A;  2VQL A;  4I99 C;  4ENM A;  2F5V A;  4XRM A;  4HYE A;  1K79 A;  2E1M C;  2L9S A;  1QHH D;  4IF4 A;  2VB6 A;  1O57 A;  4AIJ A;  3HOT A;  2B9S A;  1HDP A;  5D5U B;  4AYB N;  1R71 A;  3IRR A;  1YS6 A;  2IS2 A;  3V7R A;  3DEE A;  3F6V A;  1EA3 A;  2GXA A;  1QRY A;  3PNV A;  2QWW A;  4ZYG A;  3JW4 A;  3PQJ A;  1WSU A;  1OQY A;  2Y9Z A;  2K27 A;  3EPZ A;  3KCC A;  3GTG J;  2DA2 A;  2E2I J;  3F3X A;  2W48 A;  2LMD A;  4XBF A;  2F48 A;  1X19 A;  2COM A;  3CO7 C;  2L9N A;  2CQQ A;  3MKY B;  2VT2 A;  3FIS A;  1TBX A;  1N78 A;  3BCA A;  3WTV C;  4U7D A;  1H9T A;  4A3C J;  2L01 A;  2HKO A;  5CVJ A;  1UB9 A;  1YW8 A;  3ESW B;  5F1J A;  2XAQ A;  3L2U A;  3OYM A;  1O3R A;  4HQE A;  2HPI A;  3GTJ J;  1FBQ A;  2M5W A;  4XKW A;  1BI2 A;  4E7S A;  4JX4 A;  3LL7 A;  2MW8 A;  1VFC A;  2A5W A;  3IWZ A;  2NVQ J;  1GUU A;  2HQA A;  2UWM A;  3FXR A;  4IJA A;  4ZJZ A;  3E5U A;  2UXN A;  2M3A A;  3T1B A;  1NHA A;  2XPV A;  3D5R C;  3J7A O;  5D5W B;  3R0A A;  4KIC A;  2KIF A;  1ENH A;  2KQR A;  4P5O A;  1XSD A;  2JVH A;  2ID6 A;  1ZEL A;  2FE3 A;  2HYJ A;  5CYV A;  3CD6 I;  2DK5 A;  1FYK A;  5ILU A;  1K83 J;  2M4G A;  2QBY B;  1W1W E;  5KHD A;  1WVR A;  3HZJ A;  4KIT B;  2A07 F;  2MYS A;  1IN7 A;  2HNH A;  4PGG A;  3MD2 A;  3LSG A;  5LGU A;  1SMT A;  3T8T A;  3HPH A;  4FCY A;  2X48 A;  3D5S C;  2VOO A;  2Q8K A;  5HS7 A;  3H1C A;  3HYI A;  2F2E A;  1ZG5 A;  2C6Y A;  3ZQG A;  2LF7 A;  5J1R A;  2DAO A;  3PJR A;  2IAI A;  3KYC B;  2CRG A;  3K10 A;  3RIR A;  3L00 A;  1TWH J;  3G2B A;  3KYL A;  2RDP A;  2ZME A;  4MLO A;  4JX5 A;  2MC3 A;  1IJW C;  5E1X A;  2XB0 X;  4K2E A;  1LPQ A;  2VON A;  2OUM A;  1R7J A;  1S7A A;  1IDY A;  1Z21 A;  1GT0 C;  1XPX A;  4QSH A;  3HKZ A;  4NNJ A;  4NC7 A;  1G4D A;  3KPH A;  3S3N A;  3HRU A;  1U8B A;  3WU1 B;  5LGN A;  1QHG A;  5EG0 B;  4GO1 A;  2BOL A;  1YIO A;  3W2A A;  2X6Y A;  3RKW A;  2FD5 A;  2EIN H;  4OIQ F;  4BYY A;  1IC8 A;  4AVZ A;  1TNT A;  1MJ9 A;  2LD5 A;  2TRT A;  3BTJ A;  1OCT C;  2RN7 A;  4C3H J;  3IV5 A;  1ZAO A;  4B3A A;  4Y7N J;  4PFO A;  1ETK A;  3MEX A;  1A5J A;  3E5X A;  4LIV A;  4UVA A;  5LRS A;  2EFW A;  3BY6 A;  3ABU A;  2HQR A;  5HDN A;  4Q5S F;  2RV8 A;  2Q2E A;  2HYF A;  5J4V A;  4A69 C;  1VQO I;  1TWA J;  2P4W A;  1PP8 F;  2DOD A;  2KIM A;  5EEG A;  2QQA A;  3BPV A;  2P6S A;  3IC7 A;  3ZQH A;  2Y0S A;  2XPU A;  1TWF J;  2NVX J;  3HB9 A;  2VOD A;  2M1B A;  3P7N A;  1D5Y A;  1ZGW A;  5FRN A;  4BBS J;  3DBH B;  2Y0S N;  3L2V A;  1ZTR A;  1U5T C;  1Y6I A;  4P9U A;  4FIS A;  5GPA A;  1E2X A;  2HTJ A;  1ORK A;  4XQF A;  3WTT C;  2Z9O A;  3HXL A;  5DD4 A;  2DLL A;  2CW0 F;  5HOD A;  2YU9 J;  4KIS A;  3M1C A;  3QP6 A;  3K70 D;  4E7L A;  4PUS A;  1V54 H;  2ZCW A;  3O3K A;  4ON0 A;  1T95 A;  3ZMU A;  5KAI C;  3SEQ A;  2HS5 A;  3RQ4 A;  4XN3 A;  3SHF A;  2E71 A;  2LK2 A;  2XGX A;  2XRN A;  3GCM A;  2K7L A;  3O8G A;  4BS9 A;  4ZYE A;  3I71 A;  5M5X J;  4F55 A;  2PLY A;  1B72 A;  3K1P A;  4HW0 A;  4HF1 A;  2EV6 A;  5TJJ A;  5BS6 A;  3GXO A;  2R7X A;  4BL0 B;  4FE7 A;  2CQX A;  1ZKG A;  2BE5 F;  1UZC A;  1U9O A;  3ABK H;  1MW7 A;  2R7Z J;  5L3F A;  4BEH B;  5EZG A;  4XOT A;  5FKN A;  2CMP A;  2ME6 A;  3DKY A;  1M1E B;  1W5T A;  3TL4 X;  1KA8 A;  3ZMS A;  1U0J A;  3PNT A;  4JX6 A;  2H8W A;  4LD5 A;  3EUH C;  3H36 A;  3WG9 A;  3BJA A;  2WAE A;  2JTV A;  3DLA A;  2NVY J;  1DGW Y;  5AIQ A;  5EYR A;  3HRM A;  2FSW A;  4U7B A;  2AXT C;  1I3A A;  1VI0 A;  2CQ7 A;  5H6Q A;  1RIO H;  2FNP A;  2F4M B;  1B8I A;  4S04 A;  3LAP A;  2W82 A;  2F5D A;  1R22 A;  2XF5 A;  3VFZ A;  4BXX J;  3PIP F;  3EUA A;  3F23 A;  1A6Q A;  2V7F A;  3S2W A;  3TKY A;  2MD0 A;  3P9K A;  1YW7 A;  4XLH A;  2X6O A;  2GXB A;  1XGS A;  2Z1D A;  5GPC A;  1X1C A;  3BR6 A;  1Z1D A;  1PUE E;  4I09 A;  1R5I D;  4V2F A;  3ML6 A;  3M7G A;  1FYM A;  1IDZ A;  1ETQ A;  5GTH C;  1Y1V J;  4B44 A;  3S17 J;  4HA8 A;  2DFF A;  3NWT A;  2EIM H;  2O0Y A;  3CP8 A;  2R5Z B;  2LTP A;  1SVL A;  2FMY A;  4CCL A;  1MZB A;  1IGN A;  1OCZ H;  3BZK A;  1PJR A;  2K9S A;  1JTX A;  3D1N I;  4BQO A;  2PJR A;  3H3U A;  4I98 B;  3WTW C;  3BDD A;  2F5F A;  1ZLK A;  1P4X A;  3JSP A;  2O6G E;  1E0E A;  4DBQ A;  4H0E A;  2M0M A;  3I5U A;  5E1W A;  2WY8 Q;  5DCF A;  5E18 F;  1GXP A;  3RJP A;  2L7Z A;  2IS1 A;  1NG6 A;  2OZU A;  5BMZ A;  4S0H B;  4A3F J;  4DYC A;  1R1V A;  4A3J J;  5J8F A;  4QTR A;  2ISY A;  1JGS A;  4E7I A;  1K4S A;  2CJJ A;  2QLZ A;  2EH3 A;  2WWY A;  1IZ1 A;  5JFR A;  3S3O A;  3QWL A;  2P7V B;  2WC2 A;  1K78 A;  2A6E F;  2ISZ A;  9ANT A;  3WHB A;  4BJ5 C;  3IAM 2;  5E3M A;  4YEL A;  3RPQ A;  1AKH B;  1KYZ A;  2O61 A;  5J6X A;  5C4J J;  1WHU A;  2P7C B;  2IA1 A;  5TIS C;  2XAG A;  5C4X J;  1LE8 A;  3V8J A;  2HQN A;  4G7Z F;  3ZQF A;  3AL0 C;  2L4A A;  1MBF A;  3EUH A;  1QZZ A;  1YOV B;  4OIN F;  2R7F A;  3AKZ A;  2V26 A;  3F8C A;  2PMH A;  2K86 A;  2E7X A;  2EZI A;  2JRM A;  2L9R A;  3ZN0 A;  1H0M A;  1ZRC A;  2BXY A;  2Q1Z B;  1XSV A;  2G9W A;  2QEX I;  2Z33 A;  3TP3 A;  1DPR A;  1HC8 A;  2I10 A;  5DM6 F;  3OSG A;  4J01 A;  4BJ6 C;  3HTS B;  1XX5 A;  3BTC A;  3VDX A;  4OIR F;  4BQQ A;  1XG1 A;  1Y56 A;  2P5K A;  3TO9 A;  2XAS A;  1I1G A;  2ZNZ A;  3IKV A;  4FQG A;  4CYC A;  3KP7 A;  5LGT A;  5J40 A;  3F21 A;  1YQA A;  5EZH A;  4CCK A;  4CSW A;  1E3O C;  2BY1 A;  2KL4 A;  1OR7 A;  3Q0U A;  3FMQ A;  3IUO A;  4XKC A;  4A6E A;  5LBQ A;  3DEU A;  2ZFU A;  4Q4Z F;  1SFK A;  3TMO A;  3CLQ A;  2EQR A;  2BW3 B;  3CES A;  1IRF A;  1V4R A;  2MLG A;  2UXX A;  3GW2 A;  1YHQ I;  3FKJ A;  3OIO A;  4FT8 A;  4BKX A;  4LG0 B;  1VF9 A;  4B43 A;  5IOZ A;  2R7S A;  2BVL A;  5IP9 J;  2X6W A;  3DKX A;  3W2W A;  1IN8 A;  2JRT A;  2ZO4 A;  1MND A;  4E7Z A;  1R4M B;  5CQG A;  3HDD A;  1ITY A;  4B1R A;  3GME A;  4I01 A;  3K69 A;  5GAH J;  1TWC J;  2IGO A;  2ME0 A;  3U1K A;  3NAR A;  2DA1 A;  1XGO A;  1HDD C;  1FSH A;  1YE9 A;  1YFH A;  2GBY A;  2CU7 A;  4IRH A;  1YW9 A;  3CJT B;  3QP5 A;  4P55 A;  1G2H A;  5D4S A;  3HL2 A;  1J75 A;  2DA5 A;  2X1D A;  2CGP A;  4M9Z A;  2Y48 A;  5E79 C;  4ANJ A;  1Y1W J;  3GTK J;  3TDZ C;  5M3F J;  1ON2 A;  1S72 I;  3G1O A;  3QPT A;  2MC4 A;  3ZQ7 A;  1FMV A;  5DV5 A;  3GBG A;  3TBI A;  1MMN A;  2JA7 J;  4PDK A;  4HRI A;  3H9J A;  1B1B A;  3FXK A;  2EK5 A;  2QF7 A;  4ETS A;  3LFU A;  3HGG A;  5K7F A;  4M3E A;  4CZC A;  1LUJ B;  3LSI A;  2MA3 A;  3TQN A;  2BY3 A;  3DP7 A;  4RS8 A;  4B8X A;  2VXZ A;  4TV7 A;  4A3B J;  2QQ9 A;  1WJ5 A;  2XIG A;  4HLY A;  1AU7 A;  3WE3 A;  2D1V A;  3OS1 A;  2J5O A;  3DXJ F;  1BC8 C;  4E6K G;  2FUG 2;  3PQK A;  4F93 B;  2RVC A;  3ABT A;  1RUO A;  2VBW A;  1D8J A;  4OIP F;  2BHY A;  3LQR A;  1ULY A;  2V9V A;  2BVM A;  2VKD A;  4UUS B;  5K5Q A;  4L9J A;  1FP2 A;  2XGC A;  3FXL A;  2DA7 A;  5FGM A;  4IL6 C;  5EF6 A;  3MAJ A;  3M3Y J;  2DT7 B;  2LG4 A;  4H4K C;  3KIO A;  4MFE A;  3I9V 2;  4Y15 A;  4EJW A;  2VC0 A;  2E2J J;  2W25 A;  4KNY A;  4D7M A;  2PMU A;  1ETX A;  2RQQ A;  3DU6 A;  2L9V A;  5D5X B;  2DU9 A;  3A0H C;  1JHF A;  3PSF A;  3VOE A;  4XRS G;  2NVU B;  3J7Z I;  4E7H A;  2PQ8 A;  3KZY A;  3G6E I;  2M30 A;  2HWV A;  2K9L A;  4O5V A;  2LH9 A;  3H0D A;  2R7V A;  4U0Y A;  4ZTJ A;  1T56 A;  2X6X A;  3N97 A;  3W6J B;  1YS7 A;  3C2H A;  1X1P A;  3OL3 A;  4A3D J;  2OTJ I;  1UJ8 A;  1ZLJ A;  3GTP J;  1XCB A;  1XMX A;  3HSF A;  1P92 A;  1W0T A;  1HST A;  4O3M A;  1OYI A;  2ZXH A;  2TDX A;  4IHX A;  3GZ5 A;  2YUS A;  3OL4 A;  2RQP A;  3OY9 A;  3ZP5 A;  4F3Q A;  2R7T A;  4XLN F;  2DYR H;  4CCM A;  4II2 A;  4IOA F;  2X1E A;  1STZ A;  2VAS A;  4CCO A;  3A0B C;  3RCO A;  3H0G J;  1X3Z B;  1HA8 A;  1I5Z A;  3B6A A;  1BOB A;  2VPR A;  1RKW A;  4YIR X;  1HLV A;  4RB3 C;  4M74 A;  1K4T A;  3OYH A;  3G73 A;  5GAD J;  3TW7 A;  2DDB A;  2CW7 A;  3A01 B;  5FLV A;  3CCS I;  3LQQ A;  3MKW B;  3A02 A;  2YPR A;  2HR3 A;  5F27 A;  3GF2 A;  5D4R A;  2QM3 A;  2ECC A;  2ZME B;  5ILS A;  3SEZ A;  2STW A;  3GZN B;  3DBR B;  1FZP B;  4PJ0 C;  4HV5 A;  2LF8 A;  3FMS A;  1HXD A;  2ZC2 A;  5DM7 F;  1U9N A;  5FKL A;  3WHC A;  2YX7 A;  3C7J A;  4G6Q A;  1Y8Q B;  1IV8 A;  2XGD A;  1G8X A;  3BZC A;  4A2U A;  1VQL I;  1BI3 A;  2XB5 A;  2AQF A;  2OF7 A;  1R9T J;  2OU2 A;  3GX4 X;  1A31 A;  4ENK A;  3ZGK A;  2MH2 A;  3HTU A;  1XDU A;  4KMU X;  3FHN A;  3JRE A;  4RM3 A;  4ENJ A;  2DT6 A;  1WPK A;  3NAU A;  4N4O B;  1UCR A;  3SXY A;  4II3 A;  3KP6 A;  2GXG A;  4RGX A;  1LVA A;  2HOA A;  1BJA A;  2ZJR F;  4HNV A;  3M07 A;  3SYT A;  3J81 K;  1Q1H A;  4M71 A;  1ZYR F;  4C9Y A;  2EB7 A;  4CUG A;  4UVC A;  4KYW A;  1FIA A;  2K85 A;  3WGH A;  4BQA A;  3C2B A;  1BOA A;  4N4N B;  5TRD A;  2FQ4 A;  4RM2 A;  4UY8 I;  1K6Y A;  4MO7 A;  3NQO A;  1DPU A;  2HTS A;  4LK0 F;  2VJI A;  2R3S A;  3K4C A;  1EF4 A;  3BQY A;  3WGG A;  4EQQ A;  5FKM A;  3QOE A;  3COA C;  3LOC A;  1YX5 A;  2Q0O A;  4IHT A;  1YIT I;  2CUZ A;  1KU3 A;  2XKO A;  3MZH A;  2JT1 A;  1SFX A;  1W7P B;  2MBF A;  2LKS A;  4UUV A;  5J1U A;  1HOM A;  2CUJ A;  2WAD A;  3LA7 A;  3ASN H;  1BJZ A;  1JUS A;  4C2U A;  3AAF A;  3CP2 A;  4BE2 A;  2W1O A;  2E19 A;  3KET A;  1W0U A;  4G6T B;  1IN6 A;  4NC8 A;  1S7E A;  5K7Z A;  2AO9 A;  2OCE A;  2DXI A;  5E1Z B;  1W36 C;  1YRN A;  1MBE A;  3BWG A;  4BY1 J;  1IF1 A;  3QYF A;  4WXC A;  3ZQI A;  2DCE A;  1MBH A;  2L54 A;  2P5V A;  3E0J B;  5E17 F;  4RB2 C;  2XKP A;  4BQN A;  3CUQ A;  2EA2 A;  5M5Y J;  2Y9Y A;  4XIC A;  2VQC A;  2QYO A;  3S1Q J;  1Z05 A;  4YFN F;  1IG7 A;  3BR2 A;  2GWR A;  4HDU A;  1BBY A;  3QU3 A;  1JT0 A;  2BGC A;  2KMU A;  1K78 B;  2VJ5 A;  2F4O B;  2XSJ C;  3HOZ J;  3H3V K;  4YIF A;  3OYI A;  4OAZ A;  5EDN A;  1R5G A;  2G7U A;  2DTZ A;  4C2T A;  3K1M A;  1E17 A;  3C1D A;  2JPC A;  1U5T B;  2QVO A;  3PO3 J;  3E3V A;  4CZZ A;  5ICG A;  3TGN A;  1OMI A;  1NTC A;  5ICE A;  5E8G A;  4DGW B;  3QOP A;  3Q5F A;  2ADU A;  2IA2 A;  1EJ9 A;  3QAH A;  3AG2 H;  4RMN A;  1I3Q J;  1UMQ A;  4MHG A;  4OIO F;  3ABM H;  4E7J A;  4XKB A;  4BAY A;  2WA0 A;  4PK4 A;  1Z77 A;  2F5C A;  2ZJP F;  2WY7 Q;  1RKT A;  3OYN A;  3CO6 C;  5DYM A;  3RTR A;  3CCM I;  4XLF A;  1OFC X;  1D5V A;  1DU6 A;  1T0F C;  4EGZ A;  1Z67 A;  3KEO A;  4N9H A;  2CV1 A;  1PVE A;  5LRR A;  5F04 A;  4A3I J;  2DQR A;  1S9H A;  1APL C;  3T0Y A;  1TNS A;  4YG2 F;  3RQI A;  1B6A A;  2R7R A;  1YLF A;  4PCQ A;  2PMZ A;  3UNG C;  4I02 A;  4ENN A;  3O2P E;  4C30 A;  3IKT A;  2LVS A;  2JSC A;  1Z7U A;  4LK1 F;  2FF4 A;  1FIP A;  2E2H J;  4I7H A;  1T2K A;  1MJB A;  2KP6 A;  2L0K A;  4XKV A;  1QNT A;  3IH2 A;  4OWR B;  1SVM A;  3WTU C;  4BE1 A;  3S93 A;  2JA6 J;  3RI4 A;  2MAB A;  1SD7 A;  2KKO A;  1IN4 A;  2QQB A;  2GOM A;  3G1M A;  4P96 A;  1MMS A;  3BTI A;  1BA5 A;  4LB6 B;  2F5E A;  2HU9 A;  3CF5 F;  2A6H F;  2XAU A;  1CF7 B;  5HLH A;  3I54 A;  4DZP A;  1BR2 A;  3BR1 A;  3L2W A;  3VWB A;  3LST A;  3LMM A;  3I59 B;  4QPO A;  3LWF A;  4JQF A;  4M73 A;  3E1S A;  3V4G A;  1U2W A;  2JK3 A;  4EMS A;  1J59 A;  3BR5 A;  2CQN A;  2COB A;  1POG A;  2V1N A;  4LIU A;  4CDG A;  2ZXI A;  1EH8 A;  4DQ2 A;  1ETW A;  3ROU A;  4FET A;  2M9H A;  2CO5 A;  1KU7 A;  1WJC A;  3F8N A;  4I0B A;  2E7W A;  4ITV A;  4NDL A;  1ON1 A;  4UV8 A;  1Y0U A;  3GFL A;  3I56 I;  3L09 A;  2Y0M A;  4P9F A;  1LFB A;  2EBI A;  1QPI A;  2I8D A;  3IRQ A;  5HLI A;  4E70 A;  2NOG A;  1IO2 A;  1MMA A;  2HDC A;  1T0F A;  3FIW A;  1V5F A;  4I76 A;  3TOA A;  3E6D A;  3K4K A;  2QCO A;  3PUB A;  2R0Q C;  3KFW X;  1QPM A;  1HKT A;  3WTX C;  3AG3 H;  5EGO A;  5CVR A;  1B72 B;  1ZQ3 P;  2D5V A;  5FRM A;  2YU3 A;  3JAM Z;  1MJA A;  2LFB A;  5DEQ A;  1Z7L A;  2ZBK A;  3RPU A;  4NC6 A;  2K3P A;  1GXQ A;  2E36 A;  4X6A J;  2DFH A;  4QWQ A;  1X1A A;  4Y3O A;  5ILV A;  3S1N J;  3FXU A;  2H6B A;  2X4H A;  2B7E A;  4LIT A;  4DNC A;  5D5V B;  2KPM A;  2O7O A;  5IP7 J;  3DPL C;  1RR7 A;  3QYB A;  4XRS A;  3GLX A;  1QQI A;  3HOW J;  3J80 Z;  1JGG A;  4CGZ A;  5B1B H;  3NWS A;  2GIV A;  2IP2 A;  3I55 I;  1ZR2 A;  5F64 A;  1B9M A;  3WG7 H;  4IZZ A;  4Q47 A;  2E60 A;  3PM1 A;  1P7J A;  4R1H A;  5ICC A;  4GYG A;  4IQ4 A;  3AG1 H;  3IH4 A;  4HF2 A;  4OAY A;  3K4N A;  2LP0 A;  3OSF A;  4YEJ A;  1Z91 A;  2L4M A;  4XLP F;  4LGW A;  3I58 A;  1AA7 A;  2EZH A;  2RAE A;  3ECO A;  3HOY J;  3CUO A;  1J2X A;  3JRI A;  2R93 J;  3S2D J;  1WH7 A;  1LDK B;  2HVQ A;  4AU7 A;  3GYH X;  2OD5 A;  4ZZL A;  2DOA A;  2FQ3 A;  1LJ9 A;  2HYG D;  2O8K A;  3REO A;  2RNG A;  1RZ4 A;  1P6R A;  2MSY A;  3VYU B;  4IO9 F;  1EKE A;  2QKM B;  2WTE A;  2LOO A;  3FXM A;  4HEA 2;  1A35 A;  2BBY A;  1B8I B;  2L7F P;  3K6G A;  5LHH A;  4HX8 A;  2XVC A;  4G7O F;  2D1H A;  1LE8 B;  2LYC A;  1UFM A;  3F72 A;  2OPT A;  1MMD A;  3F8F A;  2YX4 A;  4L5E A;  4XMY A;  5B1A H;  5KVR A;  1MH4 A;  1T08 B;  4RGU A;  2D2W A;  5CVV A;  3A01 A;  2DW4 A;  2LY9 A;  1JKO C;  3HIF A;  2RNJ A;  1FWZ A;  3PL8 A;  5HDG A;  1IXR C;  3CCL I;  4A3E J;  1AKH A;  1PDN C;  3AFH A;  2R7Q A;  3RPU D;  2OTL I;  2IS4 A;  4PJM A;  3TDU C;  4OOI A;  1DP7 P;  2IBD A;  3G71 I;  4A0Y A;  4G6D A;  3SZP A;  2FJ1 A;  1FOY A;  3X2Q H;  1X3W B;  3A4C A;  4D9J A;  1DDN A;  3CC2 I;  1RPW A;  3AG4 H;  3CDL A;  4RDU A;  4HBL A;  4OMZ A;  5H20 A;  1FPQ A;  1O7L A;  4CA0 A;  4XRF A;  1LDD A;  3HOX J;  3GFI A;  2KIU A;  1EV7 A;  3T5X A;  2ZNY A;  5K7H A;  5F0C A;  4ZYH A;  1JJ8 C;  2JA8 J;  4CXF A;  3UKG A;  1WCM J;  3CCV I;  1S3J A;  1FJL A;  3U1D A;  1LEA A;  2FA5 A;  5J47 A;  2FNA A;  4IEJ A;  1TC3 C;  3ECH A;  5FD5 A;  4HZF A;  2BV6 A;  2CWE A;  2VJJ A;  1VQN I;  3EYY A;  2VXD A;  1VQ5 I;  3DTK A;  1UEL B;  1J7K A;  2CUE A;  1TLH B;  4FE4 A;  4UB6 C;  2KFD A;  4BNC A;  1R58 A;  3CTA A;  4NHJ A;  1RRJ A;  3I64 A;  4UHT A;  1XGN A;  2W85 A;  3E7L A;  1XTA A;  2JVG A;  4UUT A;  1JKQ C;  4EM0 B;  1F9N A;  2E5Z A;  3LSR A;  5KK1 A;  2LBF A;  1KQ0 A;  5J1Y A;  3H3Z A;  3LNQ A;  1MNM C;  5K1Y A;  3TP0 A;  1SEU A;  3BLY A;  2JN6 A;  4CYD A;  1QVU A;  4A3L J;  3Q0V A;  1BI1 A;  3H5A A;  2Q2E B;  1HCR A;  4A0Z A;  3LSP A;  1OKR A;  4PJN A;  5D8L B;  2GQQ A;  2OAZ A;  1YX3 A;  2PN6 A;  3DF8 A;  2E1C A;  3RSN A;  3V42 A;  3OR1 C;  3BRO A;  3JTG A;  2OC6 A;  1TQM A;  3DEW A;  3ABL H;  2R4G A;  2FX0 A;  1N25 A;  4YII A;  3VYT B;  3PIO F;  4XL9 A;  2Y30 A;  4EM2 A;  2IXS A;  4PJJ A;  3O8H A;  3BG9 A;  1OYW A;  2DPU A;  2H94 A;  3QPL A;  3CME I;  2FOK A;  3KX2 A;  3HOU J;  4M9X A;  3BR3 A;  4LFU A;  3L2R A;  3ASO H;  2V1U A;  1F43 A;  3K0L A;  1R49 A;  3CJR B;  4A3G J;  4CCN A;  4ESJ A;  3GO5 A;  3HSE A;  4ZDP A;  2FRH A;  1OLT A;  3Q0W A;  2Z5U A;  1ZGA A;  2IVM A;  3OYK A;  1HKS A;  3KP2 A;  4N0B A;  3BG7 A;  4HG2 A;  4ASN A;  2V6C A;  3BJO A;  1SFO J;  4GCV A;  5IT9 K;  2WAQ N;  3F6O A;  4WCG A;  3FM3 A;  4DZJ A;  2QKL B;  1QZE A;  2L7K A;  2ZSH B;  2HPM A;  1YRN B;  1X4P A;  2QSH X;  1R23 A;  1S29 A;  3CC7 I;  4RGS A;  2WAF A;  3GLL A;  3OS0 A;  3OYG A;  3S15 J;  2VN2 A;  4L9N A;  5D8K B;  4NB5 A;  5LEJ A;  5IYC J;  2P5L C;  3JAM K;  3JR9 A;  4UUS A;  1X4O A;  3BZ6 A;  4Z2Y A;  2OQG A;  1WZ2 A;  3BG6 A;  1VTN C;  4JYK A;  3WOD F;  4MTE A;  3SZT A;  4PJL A;  2MD5 A;  3IH3 A;  1ZK8 A;  5JR3 A;  3R61 A;  4RBO A;  3UR3 C;  1JKP C;  1LVK A;  4IVN A;  1SD5 A;  1V5G A;  4A12 A;  2OZ6 A;  2JPB A;  1PYV A;  1TZL A;  5HVQ C;  2EIK H;  5DTD A;  2ZKZ A;  4HAM A;  5F6F A;  3IHU A;  2DOE A;  1Z0X A;  2ZSI B;  5JVG F;  3F22 A;  4G7H F;  1YTY A;  3V8L A;  2IJL A;  3HUG B;  3DTE A;  3KZI C;  1GLN A;  2LKP A;  3JRA A;  1RR8 C;  3BOQ A;  2IT0 A;  4HNT A;  5A2Q Z;  2LC2 A;  4F7Z A;  1D1A A;  1X1D A;  3MZY A;  1IV6 A;  2EIL H;  2WB1 N;  4XNF A;  2MGQ A;  1H9G A;  5FRO A;  2ELJ A;  3M8E A;  1A36 A;  5DCM B;  1Z6T A;  3FBN B;  2ESN A;  4KUM A;  4XN0 A;  2CUF A;  3HC7 A;  3KZZ A;  2EPF A;  4O6J A;  2CQK A;  2VLA A;  1MMG A;  2V9P A;  4RA2 A;  3FK7 A;  3FK6 A;  4IRG A;  2YS9 A;  3HBL A;  3L1P A;  4ZDL A;  1MD0 A;  1QGP A;  4WF2 A;  4ZYA A;  1AHD P;  1JI8 A;  4HOB A;  1J0R A;  2K02 A;  3CCJ I;  2MFZ A;  1O7F A;  4XLA A;  1XMA A;  3ZQL A;  2EIJ H;  5C44 J;  2LY1 A;  2FBK A;  1S5L C;  1IW7 F;  1LB2 A;  4C3I J;  1FMW A;  4FHT A;  2HKX A;  3I0T A;  5J4Y A;  3JCU C;  3PO2 J;  2EV0 A;  2EJR A;  4KT6 A;  3BQZ A;  2A6T A;  1ONV A;  5JHU A;  2DPD A;  4PFP A;  4AIH A;  3HM5 A;  2DBB A;  1IRG A;  3FHZ A;  2VKV A;  3S16 J;  1TW3 A;  2Z16 A;  4JP0 A;  1DQU A;  1ZG1 A;  4Y52 J;  1UST A;  4AVP A;  5B5E C;  2Z99 A;  1QVT A;  3MVP A;  1F5T A;  3WE2 A;  5IOY A;  1CF7 A;  2P81 A;  1TWG J;  2ZME C;  4IXA A;  4EEF G;  3S8P A;  4YFK F;  5FB2 A;  3HOS A;  5FJ8 J;  4J19 A;  2HFH A;  3LA2 A;  4D5C A;  4CO8 A;  4DBR A;  1OR7 C;  4CYC B;  5E3O A;  2K9Q A;  1USS A;  4IHY A;  4OU0 A;  4AIK A;  4HQM A;  3HPG A;  4NUB A;  1O3Q A;  2AQE A;  1ZRE A;  5FO5 A;  1SAX A;  1D1B A;  3CF2 A;  3C2G A;  2L2O A;  3OYE A;  2NOJ B;  1WJE A;  2RGV A;  4LG3 A;  3TED A;  2QSF X;  2VC1 A;  3HKZ N;  2NNY A;  2FOW A;  2NS7 A;  1S8N A;  5D6E A;  1SFE A;  5H6R A;  3CMY A;  3N4M A;  4HV6 A;  1VQK I;  3B73 A;  4GYI A;  1XGM A;  1FP1 D;  3OMY A;  4A0X A;  3S2H J;  5BNG A;  1LEB A;  1GVJ A;  4EAT A;  1SD4 A;  2M7B A;  2VJ4 A;  2R7U A;  5K5O A;  2XRO A;  3DWL E;  4HF0 A;  2O8X A;  2YR2 A;  1JJ6 C;  1KQ9 A;  3WTS C;  1BR4 A;  3FF5 A;  3K4J A;  4UXN A;  2IGN A;  2VPL A;  3ZOB A;  1G3S A;  1U78 A;  2LDU A;  4M9S A;  1A6I A;  4UV9 A;  4MQV A;  1P4W A;  5AON A;  1IAW A;  4L18 B;  1VQ8 I;  2OCC H;  3E6B A;  3CLO A;  2QA4 I;  1SFU A;  1B4A A;  1BM9 A;  2I5U A;  2VT3 A;  4L9T A;  4KIG A;  2AHQ A;  3NEU A;  4ESF A;  1MDM B;  2EFP A;  1WFX A;  5DDG A;  3QU6 A;  3W3C A;  1WQ2 A;  1YO5 C;  5J3L A;  3OYL A;  4JK1 X;  1KU2 A;  1FOK A;  2KJB A;  1D0Z A;  2W24 A;  4S05 A;  1Y0N A;  1WI9 A;  1BW5 A;  2OA4 A;  2DQL A;  3PUF A;  3Q9V A;  1CQT A;  3I53 A;  4RGR A;  2W57 A;  4XSX F;  2RRE A;  5FLX K;  2KHM A;  1HF0 A;  2K9M A;  3ZMD A;  1FEX A;  2EFO A;  2M0C A;  1KZH A;  3KE2 A;  4XID A;  1LFP A;  4BDZ A;  2ZXJ A;  3WGI A;  3WTZ A;  2ZJQ F;  1LKX A;  2FML A;  2PEX A;  2TCT A;  3ISP A;  3M1E A;  4U0V A;  3ZMV A;  4L9V A;  3JTH A;  4J00 A;  2XSD C;  4HPQ A;  1MSF C;  3U21 A;  4ZZD A;  3KP5 A;  1F1Z A;  3OV8 A;  3OYD A;  2DA4 A;  3VB2 A;  2R5Y A;  5F08 A;  2DI3 A;  3HSR A;  5BPI A;  4HLX A;  3BJ6 A;  3TOB A;  1TW2 A;  1X3U A;  5CLS A;  1F36 A;  3H92 A;  5DD8 A;  5LLQ A;  1YYV A;  1T6S A;  2BHZ A;  1D0X A;  1Z3Y A;  4IX7 A;  2ZJ2 A;  2DA6 A;  3LSJ A;  2PJP A;  2X51 A;  3CCR I;  1MSE C;  3R6S A;  5C3E J;  4KN4 X;  1G59 A;  2N8G A;  4XR6 A;  2EA4 A;  2QUF A;  2IA0 A;  3GVA A;  3OYA A;  1JXS A;  3H5R A;  4UNO A;  5FLX Z;  3BCB A;  3HOV J;  1FBU A;  2P0W A;  2DFE A;  3CCU I;  2DT5 A;  3JRF A;  5A2Q K;  1UHM A;  3K2A A;  4F92 B;  4RB0 A;  1XCV A;  3MFK A;  1U5T A;  2M87 A;  1ZG3 A;  1TT0 A;  4OMY A;  1G3Y A;  1U6G A;  1FYL A;  3QRF F;  2X85 A;  2NXN B;  2HXO A;  1HKQ A;  2DOF A;  2VBZ A;  5FKK A;  3GFM A;  3ZRG A;  2JJ7 A;  1YJ9 I;  3TO7 A;  2IW5 A;  3W6K B;  2R7O A;  5E3L A;  3M4O J;  4EGY A;  4ZYD A;  3SFZ A;  2KIS A;  5EEA A;  1FTZ A;  2GZW A;  1BC7 C;  1YJN I;  4M3B A;  1XMK A;  2M8G X;  4BXF A;  4EVI A;  1X58 A;  1VQ7 I;  4KT5 C;  1WWX A;  2ZFW A;  4IPA A;  4A6D A;  3I3L A;  2R92 J;  4XON A;  1R36 A;  4D1Q A;  3KEQ A;  3J7A Y;  1GVD A;  3HJE A;  1YI2 I;  4X1E A;  4EJO A;  4PGH A;  2IGM A;  5L3B A;  4JBA A;  3KYD B;  3VYR B;  4GRI A;  1IN5 A;  5GAG J;  3EQL F;  4A3K J;  2OBP A;  4GXO A;  3OOU A;  5FFX A;  4MEX F;  1ODD A;  2NVT J;  2A68 F;  2RC4 A;  2HGC A;  4M3F A;  4AC0 A;  5L3G A;  4XSZ F;  5BQT A;  1X1B A;  1PUF B;  2XPW A;  3FXQ A;  3FZV A;  1E3H A;  2KRH A;  1DU0 A;  2QGU A;  2HXI A;  4PSX A;  1XS9 A;  4IRI A;  4B3X A;  1KQ8 A;  2CS3 A;  3DCF A;  2AXL A;  5DUK A;  2O9L A;  3EDP A;  2ELK A;  2X9D A;  4KN7 X;  5B66 C;  1VQ9 I;  2VL8 A;  4WX9 A;  4D0P A;  3W6V A;  1ZGJ A;  5KAF C;  3D0S A;  4WXD A;  4AWX B;  3IWF A;  3P5J A;  1H8A C;  2EFQ A;  2JUG A;  4LB5 A;  3LSK A;  1UG0 A;  1DGR M;  2VBX A;  3SDG A;  2P8T A;  2ICW G;  2ETH A;  1QZY A;  4UB8 C;  3A1Y A;  2B0L A;  4KA4 A;  2PFB A;  4WK8 F;  2QSG X;  3ZPL A;  4U88 A;  1N77 A;  1H89 C;  1MGT A;  2O03 A;  2KIQ A;  4ZDO A;  2K3F A;  1FT9 A;  3C3W A;  2A69 F;  2GM4 A;  3BPX A;  4CCJ A;  2M4K A;  2LY2 A;  4BY7 J;  3S1R J;  4WXH A;  4NQW B;  3DPU A;  1TL8 A;  2DTR A;  2EZL A;  4XLC A;  4A3M J;  4KDP A;  1SAN A;  1V5E A;  3R60 A;  5K5R A;  3OYB A;  2E1O A;  1P9Q C;  5KNL A;  3DLL F;  3G3Z A;  4P1W A;  1MBJ A;  2DMQ A;  4ZTF A;  2D45 A;  4CIC A;  3WU2 C;  1BIB A;  2XF6 A;  5E20 A;  5L3D A;  1IUY A;  1WJF A;  1KYW A;  3CCE I;  1MBK A;  5CPR B;  1AWC A;  1NH3 A;  2NAZ A;  3RZO J;  2HZD A;  5IY5 H;  3MMY B;  4M6V A;  2JA5 J;  2E1N A;  1NK2 P;  2DA3 A;  2GOX B;  3CUQ B;  4EJV A;  3MKZ A;  5HNF A;  3KEY A;  4CH7 A;  5DS9 A;  2L5Q A;  2DDA A;  4A5N A;  1T39 A;  3CC4 I;  1A04 A;  2VE8 A;  2CV0 A;  4AYB A;  1FTT A;  2XDV A;  4HSR A;  1P2F A;  3RKY A;  1P7I A;  3HHH A;  5LHI A;  2HOE A;  3R4K A;  5CVI A;  5EG0 A;  3E6C C;  3PNY A;  3ZQC A;  1VQ6 I;  2A61 A;  3GTL J;  2IRF G;  4F91 B;  4M3G A;  2MG4 A;  1JT6 A;  3ZMZ A;  4YFX F;  5FKO A;  4RAG A;  3T8R A;  2M2E A;  4MQ9 F;  3FWE A;  3OYC A;  3GZ6 A;  4BHP A;  1Z3X A;  2G0E A;  3FM5 A;  1NG7 A;  4FAS D;  1ETY A;  3GEZ A;  2A05 A;  2K9N A;  4V19 K;  1ZRD A;  3CQZ J;  5JHF A;  4CHU A;  2GAU A;  2V9K A;  2V4J C;  1VQ4 I;  3GTQ J;  2F6C A;  1SC7 A;  3ONQ A;  1ZN2 A;  1WJB A;  3OYF A;  2K40 A;  3RYR A;  2UUZ A;  1W5S A;  2DJI A;  3WU0 A;  1B9N A;  2LSO A;  4G9Y A;  2V1X A;  3BG5 A;  3OWT A;  4LOC A;  2CV2 A;  4DJA A;  2NYX A;  3I4P A;  1RNL A;  1Y8R B;  5JI6 A;  4D7N A;  1SMY F;  3HRS A;  1FSE A;  5EJC A;  2W00 A;  4RLF A;  4F52 A;  1UHW A;  3HG9 A;  3L2Q A;  4BDY A;  3W2V A;  2HEO A;  1PUF A;  5L3C A;  3L2C A;  1HW2 A;  2DN0 A;  2HVR A;  3H9G A;  4Y17 A;  1FOW A;  2DO7 A;  3C18 A;  1Z9C A;  1JE8 A;  2VKH A;  4GGG A;  5HLT A;  4QPQ A;  3MCZ A;  5F0H A;  1I6H J;  3ZMT A;  1E3P A;  3RKQ A;  4DYR A;  3J80 K;  1ZHF A;  1MBG A;  3E97 A;  3IP4 B;  2VOP A;  4ESB A;  2CW8 A;  2H09 A;  4YRV A;  3RKX A;  1D3Y A;  2VKE A;  1G3W A;  1S7O A;  1J5Y A;  3DV8 A;  2HQ5 A;  3QOD A;  4N9I A;  1P4A A;  2VBY A;  1REP C;  3SZG A;  4W97 A;  3OIP A;  1O3S A;  1IXS B;  3JRC A;  4ZC3 A;  4G8X A;  2LBF B;  3O6B B;  3MN2 A;  3ZQQ A;  1ERD A;  2K4B A;  2WV1 A;  1SAU A;  1FLI A;  2Y31 A;  2VIX A;  1R6R A;  2JMW A;  3H9Q A;  1EH7 A;  1QA6 A;  2K5C A;  1IUF A;  1D1C A;  2XF7 A;  4XLE A;  2V6E A;  1Q1V A;  2FBH A;  4LJZ F;  4XOP A;  2Z3Y A;  4XOR A;  4RLQ A;  2HVS A;  3E5Q A;  3A2K A;  3VSL A;  1T8I A;  4KFC A;  4D5F A;  2STT A;  2HOT A;  1PP7 U;  1I27 A;  4MTD A;  3K7A J;  1F4K A;  1VQP I;  1HW1 A;  3VEP A;  4LLN A;  3RZD J;  1WRJ A;  2ELH A;  2OV7 A;  3JRH A;  4E4H A;  4KMF A;  2B63 J;  2CG4 A;  1ETO A;  4DYQ A;  4WWC A;  3S14 J;  1MIJ A;  1ACI A;  3PFY A;  5M3M J;  5FLM J;  3ZR8 X;  3BC8 A;  3L9F A;  3P9C A;  2LR8 A;  2VQG A;  1FC3 A;  3BP8 A;  3DKW A;  3GUD A;  3M8J A;  5KCM A;  5ED4 A;  3S1M J;  4FTH A;  2E1M B;  2L02 A;  5D6F A;  5HDK A;  2NRA C;  1TQP A;  2CYY A;  3D5L A;  4Y4R A;  1FNN A;  4Q48 A;  1SVO A;  3OIQ A;  3LSH A;  2HDW A;  3VPR A;  1BR1 A;  2KJC A;  5LD2 C; 
#chains in the Genus database with same CATH homology
 4Y7N J;  1JT0 A;  3Q3S A;  1ETK A;  3HM5 A;  3HOZ J;  1A5J A;  3H3V K;  2ID3 A;  2VKV A;  3BG3 A;  3S16 J;  2HI3 A;  4JP0 A;  5EDN A;  4Y52 J;  2DTZ A;  1QVT A;  3MVP A;  4A69 C;  5IOY A;  1TWA J;  2P81 A;  1TWG J;  4EEF G;  5IYD J;  5FJ8 J;  3PO3 J;  4J19 A;  3ZQH A;  2XPU A;  1X2N A;  1TWF J;  2NVX J;  3HB9 A;  4D5C A;  5GP9 A;  1GV2 A;  4CYC B;  1OCP A;  5E3O A;  1NTC A;  2K9Q A;  4IHY A;  1D5Y A;  1ZGW A;  3TW6 A;  4BBS J;  2Y0S N;  1ZTR A;  4FIS A;  5GPA A;  1I3Q J;  1UMQ A;  1ORK A;  1JTY A;  3QQA A;  5HOD A;  1UHS A;  2YU9 J;  3SJM A;  1Z77 A;  3TED A;  2ZB9 A;  1WGX A;  1RKT A;  3HKZ N;  2NS7 A;  1OFC X;  3CMY A;  2LK2 A;  1DU6 A;  3O8G A;  5M5X J;  1BW6 A;  2GLO A;  1B72 A;  3S2H J;  5BNG A;  5E3N A;  5F04 A;  4A3I J;  1T33 A;  1GV5 A;  1APL C;  1JUP A;  3RQI A;  2DJN A;  4FE7 A;  2CQX A;  1ZKG A;  1JJ6 C;  2JWT A;  1U9O A;  2R7Z J;  2LVS A;  3ZOB A;  5EZG A;  1U78 A;  3B6C A;  1A6I A;  5FKN A;  2ME6 A;  1FIP A;  2E2H J;  1O4X A;  4JX6 A;  2L0K A;  3IH2 A;  2NVY J;  2VUM J;  2AHQ A;  1XC5 A;  2JA6 J;  5EYR A;  1VI0 A;  5IP6 A;  5J3L A;  3G1M A;  1B8I A;  3BTI A;  1BA5 A;  4BXX J;  4C3J J;  1BW5 A;  4IHW A;  3BTL A;  2X6O A;  1CQT A;  1ETV A;  5GPC A;  3BR6 A;  4DZP A;  3BR1 A;  4V2F A;  1HF0 A;  1IDZ A;  1FEX A;  2H8R A;  1ETQ A;  1Y1V J;  3S17 J;  2M0C A;  2R5Z B;  2LTP A;  1H88 C;  2JK3 A;  1IGN A;  4XID A;  3BR5 A;  2COB A;  1POG A;  2K9S A;  1JTX A;  3SFI A;  3D1N I;  4B4C A;  2TCT A;  4AUX A;  1MH3 A;  2L7M P;  1ETW A;  5JLW A;  3HGY A;  2M9H A;  4NDL A;  2XSD C;  1MSF C;  2NS8 A;  1LFB A;  2DA4 A;  2L7Z A;  2R5Y A;  2EBI A;  5F08 A;  2DMT A;  1QPI A;  4S0H B;  2DMN A;  4A3F J;  1F36 A;  4DYC A;  4A3J J;  4QTR A;  2NOG A;  5JLX A;  2CJJ A;  4GFB A;  2EH3 A;  2DA6 A;  3FIW A;  3LSJ A;  4I76 A;  1MSE C;  5C3E J;  2N8G A;  2QCO A;  3WHB A;  9ANT A;  5E3M A;  2R0Q C;  2HDD A;  1BL0 A;  1AKH B;  3GTM J;  5C4J J;  3HOV J;  5EGO A;  5C4X J;  3JRF A;  1B72 B;  1ZQ3 P;  2D5V A;  3K2A A;  1LE8 A;  1I50 J;  3ZQF A;  2XRL A;  3JRB A;  1MBF A;  2LFB A;  3A01 B;  3JRD A;  2EZI A;  1VND A;  2L9R A;  4X6A J;  2HXO A;  3TP3 A;  5FKK A;  2Y2Z A;  4C2M J;  2I10 A;  3OSG A;  2JJ7 A;  4V2G A;  3BTC A;  3S1N J;  4MIM A;  2LLK A;  3BR0 A;  1XG1 A;  3M4O J;  5E3L A;  1OJL A;  4I6Z A;  5EEA A;  5IP7 J;  2O7O A;  1FTZ A;  1RR7 A;  4M3D A;  4XRS A;  3HOW J;  4M3B A;  4CYC A;  1JGG A;  2M8G X;  2H1K A;  1X58 A;  1ZR2 A;  5EZH A;  1E3O C;  1RET A;  3PM1 A;  3Q0U A;  1P7J A;  2R92 J;  3IH4 A;  2EZK A;  1GVD A;  2LP0 A;  2KDZ A;  2EQR A;  3OSF A;  4X1E A;  2KT0 A;  1JUM A;  1IRZ A;  2DMP A;  3OIO A;  3I4N J;  2EZH A;  4BKX A;  2RAE A;  1VF9 A;  3HOY J;  3JRI A;  2R5Z A;  5IOZ A;  4A3K J;  1X2M A;  5IP9 J;  2R93 J;  3OOU A;  3S2D J;  1WH7 A;  2M34 A;  3HDD A;  2NVT J;  4B1R A;  2O8K A;  1ITY A;  1TWC J;  4M3F A;  4AC0 A;  2ME0 A;  3NAR A;  2DA1 A;  2MSY A;  1PUF B;  1HDD C;  2XPW A;  2GBY A;  1B8I B;  2L7F P;  2CU7 A;  4MFD A;  1DU0 A;  2HXI A;  1XS9 A;  1G2H A;  5F0F A;  1RES A;  3BT9 A;  2DA5 A;  3DCF A;  1LE8 B;  2LKX A;  2OPT A;  1Y1W J;  2HOS A;  2O9L A;  3GTK J;  2ECB A;  4L5E A;  5M3F J;  2ELK A;  2X9D A;  1MH4 A;  3A01 A;  3F0C A;  3G1O A;  2LY9 A;  1JKO C;  3W6V A;  3GBG A;  4A3E J;  1AKH A;  2JA7 J;  1H8A C;  4W1U A;  3A03 A;  3SDG A;  2IBD A;  4BBR J;  5M5W J;  2QF7 A;  3QPS A;  3HEF A;  3HGG A;  4G12 A;  5K7F A;  4M3E A;  2FJ1 A;  1WI3 A;  4DW6 A;  3GTO J;  1RPW A;  4A3B J;  4IHV A;  3CDL A;  4RDU A;  1AU7 A;  1H89 C;  2R5Y B;  1WH5 A;  3HOX J;  5K7H A;  5F0C A;  1LFU P;  2XGE A;  2VI6 A;  2GM4 A;  1JJ8 C;  2JA8 J;  2PMZ N;  4BY7 J;  1WCM J;  3UKG A;  3S1R J;  1ZR4 A;  1FJL A;  2EZL A;  3JRG A;  4IEJ A;  1SAN A;  4A3M J;  1TC3 C;  1K61 A;  2DMU A;  4UUS B;  3FKI J;  2E1O A;  3MKL A;  2XGC A;  2DA7 A;  1MBJ A;  2DMQ A;  5EF6 A;  3M3Y J;  4MFE A;  4QIW N;  2CUE A;  4FE4 A;  2E2J J;  1JKR C;  1NK3 P;  4D7M A;  1MBK A;  1ETX A;  3RZO J;  4XRS G;  4M6V A;  2JA5 J;  3E7L A;  1GDT A;  4UUT A;  4ABZ A;  1NK2 P;  2DA3 A;  1JKQ C;  4XK4 A;  3G1L A;  5DS9 A;  3LSR A;  5EGO B;  5J1Y A;  1T56 A;  3LNQ A;  3CCY A;  1MNM C;  1FTT A;  3TP0 A;  4A3D J;  3I4M J;  1P7I A;  2JN6 A;  5IPA A;  3GTP J;  1QVU A;  4A3L J;  1W0T A;  3Q0V A;  5EG0 A;  4A93 J;  4IHX A;  2YUS A;  2IEK A;  3ZQC A;  5IYB J;  1HCR A;  3GTL J;  4M3G A;  3LSP A;  2MG4 A;  1JT6 A;  1UG2 A;  3H0G J;  4XRM A;  5FKO A;  3B6A A;  2VPR A;  2M2E A;  3DEW A;  2FX0 A;  1RKW A;  2Y30 A;  1HDP A;  2G0E A;  4AYB N;  1HLV A;  1ETY A;  3O8H A;  3BG9 A;  2K9N A;  3CQZ J;  3TW7 A;  3QPL A;  5FLV A;  1QRY A;  3GTQ J;  3HOU J;  3BR3 A;  2Y9Z A;  1F43 A;  3A02 A;  3GTG J;  2DA2 A;  4A3G J;  5F27 A;  2E2I J;  2W48 A;  2K40 A;  2ECC A;  3Q0W A;  2CQQ A;  3FIS A;  3BG5 A;  4LOC A;  1U9N A;  5FKL A;  1SFO J;  4A3C J;  3WHC A;  4D7N A;  2WAQ N;  4DZJ A;  5F1J A;  1YRN B;  2XGD A;  3GTJ J;  2XB5 A;  1PUF A;  3S15 J;  2DN0 A;  2OF7 A;  1R9T J;  5IYC J;  4JX4 A;  4UUS A;  3JR9 A;  2MW8 A;  1VFC A;  3JRE A;  2NVQ J;  1GUU A;  5F0H A;  1I6H J;  1WPK A;  3NAU A;  4JYK A;  3RKQ A;  4DYR A;  1MBG A;  3IH3 A;  1ZK8 A;  2HOA A;  2XPV A;  4RBO A;  4HNV A;  1JKP C;  1ENH A;  2VKE A;  2HQ5 A;  2ID6 A;  2HYJ A;  1FIA A;  4W97 A;  3C2B A;  5DTD A;  1K83 J;  3JRC A;  2FQ4 A;  1Z0X A;  4MO7 A;  3MN2 A;  1EF4 A;  3BQY A;  2WV1 A;  5FKM A;  2Y31 A;  3LSG A;  3LOC A;  4FCY A;  2X48 A;  3JRA A;  2JMW A;  3ZQG A;  1IUF A;  1IV6 A;  2WB1 N;  5J1R A;  1Q1V A;  2MGQ A;  2IAI A;  2CRG A;  5J1U A;  1HOM A;  1TWH J;  3BR2 A;  4MLO A;  4D5F A;  4JX5 A;  2HOT A;  1BJZ A;  3K7A J;  1JUS A;  2CUF A;  1IJW C;  2XB0 X;  3RZD J;  2E19 A;  1W0U A;  3FK7 A;  1IDY A;  3JRH A;  3FK6 A;  1GT0 C;  2B63 J;  3L1P A;  2YS9 A;  3HBL A;  1S7E A;  4QSH A;  5K7Z A;  2AO9 A;  1ETO A;  1AHD P;  1YRN A;  1MBE A;  4DYQ A;  4BY1 J;  1U8B A;  3S14 J;  3ZQI A;  5M3M J;  3ZQL A;  1MBH A;  5FLM J;  5C44 J;  5EG0 B;  2LR8 A;  4C3I J;  3S1M J;  5M5Y J;  2FD5 A;  4FTH A;  2Y9Y A;  4XIC A;  1IC8 A;  2LD5 A;  3S1Q J;  2TRT A;  3BTJ A;  1OCT C;  3PO2 J;  1IG7 A;  4C3H J;  3VPR A;  3IV5 A;  3BQZ A;  4B3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...