2CUAA

The cua domain of cytochrome ba3 from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
122
structure length
122
Chain Sequence
b'AGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CUA)
publication title The CuA domain of Thermus thermophilus ba3-type cytochrome c oxidase at 1.6 A resolution.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Electron transport
total genus 30
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 1999-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2cuaA00
3H4FA 2W8CA 1AACA 1A3ZA 4W1TA 1EHKB 1MG3C 3ABLB 4G7SB 1J9SA 1A4AA 2BHFA 4A2FA 4KNTA 3ZIYA 2PPAA 1SHXA 3T6XA 4GP8B 4GXFA 4KNUA 3X1FA 3QJQB 1PLCA 3G5WA 5I26A 3TASA 1SJMA 1BXVA 4DP9X 2H5UA 3GXUB 2XU9A 1UATA 1YLBB 2YXVA 4DP1X 4DP7X 1NIDA 2HZHA 1IUZA 4KO9A 2IWFA 4HIPA 5TK2A 4K9JA 3JTBA 5PCYA 4NB7A 4HCGA 3NYKA 3X2QB 3N55A 1F56A 3OM3B 5ANHA 1MDAA 3UAAA 2DY2A 4GP4B 3CDZB 3N2JA 5IY5B 2IH9A 3FPXA 3DTUB 2TSBA 3ZX1A 4F7KA 9PCYA 1TU2A 1WA1X 1AIZA 2XV3A 3FSWA 1V55B 2FNWA 4AZUA 1VLXA 2PP7A 1NZRA 2NRDA 1HFUA 4A68A 1PNCA 4MFHA 4BWWA 2GSMB 1BQRA 2Y1AA 1V10A 3OMAB 2J57A 2XYBA 1PZAA 4YVNA 1JZEA 2HXAA 5B1JC 1RZPA 1ILSA 8PAZA 1T5KA 1QHQA 1E5ZA 1WA2X 2XUWA 3HEIB 3IN0A 3S3DB 6PAZA 1KBVA 2J55A 4E9WA 1L9RA 3ZDWA 4HALA 1RZQA 2FTAA 1IBYA 4Q89A 4YSAA 2PPFA 2AZUA 1OCZB 3D12B 4TXVB 2CAKA 1KGYE 1OF0A 3L45A 4ENZA 1JZGA 2IDSA 3ZBMA 1ZV2A 4X4KA 3V9CA 1AZRA 4CSPA 4KO7A 3FQ2A 3WKQA 3T6ZA 4A67A 1NIBA 4G7RB 2LLNA 2IAAC 1A8ZA 3PXLA 2IWKA 2FQFA 3FSZA 3NSDA 2GI0A 4YSUA 3FSAA 2Q9OA 2VM4A 4KOBA 1L9OA 1CC3A 4AKOA 1NICA 2VSKB 1JZFA 1RKRA 3NT0A 5D4HA 2BZCA 2YAPA 1NPNA 2ZOOA 3FSVA 4HAKA 4YSSA 3UACA 1KDIA 3NJKA 1PF3A 1ZIAA 1ADWA 2BWDA 1ID2A 2GIMA 2UXVA 1BQ5A 1PLAA 2CUAA 2ZXWB 3X1EA 3IBOA 1JZIA 2P80D 2HX7A 1NIAA 2EILB 1M9WA 5I5JA 1PAZA 3OD3A 1R1CA 4Q8BA 1SF5A 4YSPA 5B7MA 5D4IA 2CJ3A 4DPAX 3WKPA 5I6PA 2YAOA 1PCSA 4E9QA 3ABGA 2VN3A 5I6KA 3AG3B 1NINA 5B3SB 1WS8A 4GYBA 1ET7A 4DP0X 2XWZA 4E9XA 1ETJA 2DYRB 3BVDB 3FU7A 1KV7A 4G70B 4N4YB 2I7SA 1OE3A 1ZDSA 2UX6A 1CURA 4DP2X 1KDJA 4AKQA 3KW7A 3CZUB 3FU8A 1E65A 1AAJA 2YAQA 4P5SA 3IEAA 3FQYA 2PP9A 1ASQA 3X1GA 1CYXA 2QDVA 3AY2A 3CG8A 1GS8A 2PCYA 3U25A 2CBPA 3SBRA 4E9SA 4DP4X 1AS7A 5B1KA 3OMNB 1HAWA 1EZLA 2UXGA 4E9TA 3RYMA 2CCWA 3EH5B 3CVCA 2YARA 2PPCA 1IBZA 2PP8A 3PLYA 2DWSA 4WTQA 2GHZA 3AG4B 4G72B 6PCYA 1SDDB 7PAZA 1JXFA 2QDWA 1OOWA 2IDFA 2XX0A 4HCIA 4HCFA 4A2EA 1IC0A 3EF4A 4UF7C 2UXFA 3S3BB 1ASOA 2BP8B 1GS7A 2XLLA 4YSOA 1GY2A 1J9RA 1QNIA 3CDZA 1DYZA 3FYIB 2ZONA 4W9ZA 1J9QA 2FWLB 1XB3A 3SBPA 2AZAA 3GDCA 4YSTA 3DIVA 2IDUA 3UGEA 1JXDA 2XVBA 3EH4B 1SDDA 2FT8A 1NIFA 2HX8A 5AKRA 2BWIA 2J56A 3ASOB 2YAFA 2P80A 3FQ1A 3FS9A 3ASNB 2B08A 2E86A 3T9WA 3PPSA 4KO5A 4YSQA 1NTDA 3TBBA 3EHBB 1CYWA 2OV0A 1M56B 1L9SA 2IDQA 2B3IA 2FQEA 3QQXA 1GY1A 1SHWA 2AANA 4E9VA 1ZDQA 1ET8A 2QT6A 1AS8A 1JVLA 2ZWNA 3NSCA 1GR7A 1L9TA 4YL4A 5LDUA 2RACA 1XB8A 2XX1A 1MZZA 5F7AA 1AOZA 1AG6A 1KCBA 3NSFA 1PNDA 1NIEA 3WNIA 1SNRA 1MG2C 3MBWB 1BAWA 3V9EA 2JKWA 5I6NA 5I28A 4JHVA 5B7EA 4BWTA 2YAHA 3QJTB 3OMIB 1SFHA 1XMEB 4HHWA 1J9TA 1L9PA 5B1AB 5E9NA 1AZUA 5I6MA 1JVOA 2R7EB 1PMYA 4G7QB 1FFTB 2AFNA 2FQGA 3NJGA 1ILUA 2EIKB 4BXSV 1J5DA 4YSRA 3NJFA 4DP5X 3NP4A 5TK4A 2YQBA 2WO2B 4FA7B 3NJIA 4M4RB 4F2EA 2XXFA 1SF3A 1E67A 4JHUA 1E30A 5B1BB 3ABKB 5FC9A 1GSKA 1A4BA 3QPKA 2H47C 3PAZA 3GYRA 1URIA 4G71B 2PPDA 1MZYA 2GC7C 2N0MA 4HHGA 3AG1B 3HB3B 2HX9A 4L0PB 5PAZA 1GS6X 3TA4D 3WI9A 1CUOA 1JOIA 3IN2A 2Q5BA 3PAVA 5A7EA 2PLTA 2XV2A 1BXAA 2MRYA 4E9RA 2X88A 2XV0A 3TBCA 1AS6A 2XXGA 3NSYA 3QJSB 1N70A 4KNSA 3CVDA 1PLBA 4DPBX 1JERA 1L9QA 3DKHA 2UXTA 2DWTA 5I6LA 1BQKA 1V54B 1ZIBA 3T6WA 1JZHA 3AZUA 1AANA 1HAUA 2X87A 3QJVB 4RH4A 1AG0A 4PAZA 1AQ8A 2VW6A 1TEGA 3X1NA 2MTAA 4JKNA 4YSEA 5I5MA 2EIJB 2JFCA 1W6WA 4ZK8A 1ASPA 4YSDA 1SFDA 2OJ1A 4BK5C 2FQDA 4UAHA 4HZ1A 1DZ0A 1E5YA 2GBAA 4E9YA 3PAUA 1PY0A 5AZUA 4GP5B 1OV8A 4NAJA 2EINB 3NJMA 3UABA 4BDVB 2BP0B 1BEXA 1OE2A 1BYPA 1X9UA 4DPCX 2Y69B 3WNJA 3OQRA 3X1BA 4A2GA 1JXGA 1OCRB 3NJNA 1GYCA 5AFAA 2FJSA 1NWOA 4AKPA 2A3TA 1KYAA 4A2HA 4AX3A 2GC4C 4CSZA 1KBWA 1KCWA 5I5IA 2BW4A 2BP0A 3WG7B 4BDVA 3T6VA 2IWEA 2VW7A 2YXWA 5D4JA 5EHFA 1I53A 2I85A 4DP8X 2PCFA 2BP8A 2H3XC 1PZCA 5F7BA 4YSCA 2AVFA 4WKXA 4NERA 4N8UA 3SBQA 1W6LA 2CALA 1JZJA 1IKOP 1M57B 2FT6A 2QPEB 3S8FB 5B7FA 1OCOB 2BW5A 2IH8A 1BYOA 5I6OA 2DV6A 3IE9A 3EH3B 3SQRA 1TEFA 3H4HA 3UAEA 2OCCB 2YAEA 2BO0A 3KW8A 2W88A 1W8EA 1GW0A 1A65A 2VW4A 4BXVA 1WS7A 2HRHA 2DYSB 4QLWA 1RCYA 3C75A 2PPEA 3MX0B 1ET5A 4KOCA 4FAAB 1X9RA 3NP3A 1TKWA 2I7OA 2VMJA 3FU9A 2HRGA 4QKTA 1QLEB 2QPDB 2FT7A 2J5WA 2YAMA 4F2FA 1ZPUA 3S8GB 2JXMA 3PCYA 5B1JA 1N68A 3ABMB 4KO6A 3TU6A 1FWXA 3UADA 1FA4A 4BWUA 4A66A 3WIAA 1OE1A 2WSDA 3NJLA 1J5CA 1OCCB 3BQVA 4M3HA 3T71A 3H56A 2TSAA 3CVBA 1AZNA 1WA0X 3ERXA 2EIMB 2R7EA 2GB2A 1AR1B 4P5RA 2BZ7A 1A4CA 3S3CB 4GY4A 3AW5A 1AZBA 2HLEB 2UX7A 1AZCA 3QJRB 4AI7A 1BXUA 2VM3A 1XB6A 3NJJA 3AG2B 4A2DA 1PZBA 1NPJA 3QJUB 2IDTA 2VSMB 1WAEA 7PCYA 4EF3A 3FU7B 3NJHA 1B3IA 1NWPA 2WO3B 4PCYA 4UANA 3FT0A 1NDTA 4DP6X 3JT2A 3FPYA 4YVUA 3FYEB
chains in the Genus database with same CATH superfamily
1E8ZA 5EPMB 3WUZA 5SWQA 5HPMB 5CCHE 2EO7A 3RTQD 1LMKA 4UV4L 1G1CA 4G5ZL 4RWHA 5DI8A 1N4XH 2H6PB 3UAJD 1S7SA 2X2UA 3P9WB 4LSRH 4Z7QF 1KXTA 4Z7VA 2ITEA 5CCKH 4KNTA 3RVWD 2PPAA 4YK4B 1NFKA 3BAKA 1ACYH 2ITCB 4HQQH 3H9SA 1ETZB 2DQTH 4PP1D 3PG2A 3ARWA 2E76C 2MTPA 3KYMB 4WNQB 3BZDA 1T83A 3ELAT 3O3DB 3V0DA 1T0NB 1BXVA 4P23A 5DVNA 1T5XA 2OM5A 2YZ1A 3T3MB 4ALAH 4TTDC 5F9WC 4NP4L 1YVLA 1QHOA 3N04A 5L2JA 2HKFH 3HFML 1SM3H 3E8UH 2ILLA 1CLYH 1ETA1 3U7AA 2DQ6A 4HZAA 4X99B 5IMOB 4JRYA 2EDYA 4XPGL 5E1AB 3IDYC 4ODVH 1E6JL 1EZUA 1BWWA 4TSCH 5DC9B 1F4XL 5H4ZA 3A24A 5SWZB 1B88A 2OA9A 1CLYL 2ZP8A 5I5RA 3C09C 3CDZB 4PJFE 2XETA 1OAUL 3T3PB 2CM5A 1AKPA 5EF0A 4JZJC 2J1KA 3ES6A 3KPTA 5DDHB 1DE4B 1L0QA 1L4IA 4DN4H 4NIYE 3PGCB 3U0PA 1KTKE 1R75A 2EZ0D 1MN4A 2WBJC 3TVMA 4OGYL 5AW9B 4DZ8A 4XVTH 1FNEB 5I17B 1QASA 2J3SA 5C0AE 3SPIA 2F2HA 5D6CB 4BM7A 1K8DA 3NK3A 4DN4L 4AJ0A 5F7DB 1JZEA 5HD8C 3ZZSA 1KCRH 4L29B 4XVTL 1IGIL 3BAWA 4Z3HA 2JKJA 4F24A 1A66A 1NKRA 2VUOA 4OZFH 5KVFH 5DJ6A 5F89A 2FJHB 2VCOA 3EJQA 2I9TB 2JWYA 4LXFA 2FATL 1KGYE 2PYFA 2K7PA 2LV4A 2W91A 4QLRA 3CD4A 3GBLA 4XCFH 2WMPB 1WAAF 1U8LA 5IHHA 1KBBA 2ZYRA 2VQ1A 4GKZB 4YWGH 4J4PC 1XHHA 5EUOB 3V0HA 5A2CA 3X12B 3ALPA 5DYFA 3RB5A 2FBJL 4L9LA 2XI9A 1SDYA 1JZFA 2P5WE 1HS6A 2ZOOA 4KKZA 2FD6L 2HAZA 2WLMA 4N28A 2WD0A 5AVZB 4Y5VC 3ME0A 3O81A 4AOFA 2YLHA 3RVUC 4KKPA 4BQBA 1TZGL 3IPEA 2DQMA 4GG6B 3VG0L 4P06A 3MV8D 5C6PB 2ZXWB 2UY7B 3RUGF 2IFGA 2WYZA 3QXVA 1XO8A 4JFEE 3TN0C 3PWNB 1AIFA 2R1YB 3RLSA 1PAMA 2PCPA 4TUJA 3OD3A 4Z95H 4G9FE 2OSYA 2CJ3A 3C8KA 4LCWB 2F1EA 4C56B 4OSUH 3DXAE 2BDNL 1UXMA 4MAYB 4N9GB 4RFOH 3RNQA 1PCSA 4KK8D 4DCQA 3VD2A 5EBGA 3X3GH 1SLWA 1F3DJ 3L4VA 5IWLA 4MCNA 3UJTL 2IPKA 3DX9A 1A4JA 1V5JA 1IEAB 1T21B 1ET7A 4HUMB 4DP0X 1TTUA 4QWWC 4JG9A 1AJ7H 4G6AD 2ICWB 2WKOF 4JY6A 4WFED 5K33A 4AYBA 1OE3A 3IWVA 4XCEA 1CURA 1CDJA 4TULH 4QRQB 3C60C 5ICZB 5JUEL 4DESA 1AJ7L 2P5PA 3EYSL 3QO1B 1TTCA 1W72H 5CS7A 2BC4A 4ODSL 5FF6A 3RAJL 3DV4B 5I1LB 4JG0L 3KD4A 4KXBA 3RA7H 3DTXA 4WW1B 3X1GA 3D39D 1L5GB 1G6VK 4W68A 4DOHB 1LP9F 2D7TH 5DS8A 2B2XL 2FLRT 4JKPH 1JNNL 4FTDA 1JXJA 1HEZA 4UIKH 1W72B 5CILL 2BNRB 4FMKA 4NWUL 3AT0A 3EJZD 4JDTH 1N6VA 2FVNA 1TZIA 3PJSA 5KOMC 4D0DA 2B59A 3RZCB 3APDA 2EXYD 3RIFK 1P4BH 3MODL 4MHHG 3VXSB 1RZ8B 2ICCA 2O1AA 4YDKH 4J2XA 4YGVA 3QQ9D 2AEPH 3VXUE 4R7NB 5GGUA 4MJID 5FUZH 3S3SA 1NA8A 2RQ8A 3NA9H 2YC1B 1B2WL 3QCUL 3RYMA 2B8OT 2CCWA 4ONGH 4XO4A 1FAIH 1BGXL 4MGXA 3ZKNC 5CEXB 4U4IA 3R7QA 1R47A 4HPOH 4B41A 1BIIB 4MA1B 3E1F1 5AOKA 3US1A 3IDUA 3OAZH 3K74B 2V5TA 2VXUH 5I1AA 4G72B 4PJAE 4ONGL 3TV3H 3HNVH 4HIHB 1R3IH 2KLTA 1L7IH 2GJZA 3QQDA 4CRPA 5I1IH 3V6FB 1WBZA 3FFDB 3QQ3B 2GFBA 5CSGA 3CPUA 3U9UA 1J9QA 3SBPA 1G4RA 4ETYA 1JDDA 3UG5A 1SLUA 1I1CA 2KLRA 2NXYB 1FCCA 1AD0B 4K23L 3GSQA 3IGAB 4RAVB 3ZDXE 4Q97A 5F3BB 1RFDL 4QHLA 2YOAA 1T4KB 4HKJA 3ASOB 2YAFA 3Q8AA 4PR5A 4WHYH 1S8DB 4ZG1A 3VFWB 2VLLB 4QRTA 3RE0A 1BZ9A 4HIJB 2Y5QA 3U6XS 4ACPA 3PNRB 2CIIB 3S2AA 1UH4A 2VDML 1TZ8A 1SHWA 2E7HA 4NZ8A 5GHWL 4E9VA 3RFZC 4G8EA 1N3NA 3ETTA 1QTSA 3P3RA 4R4NC 4UB0H 3NSCA 4UIMB 4CW1B 3BSZH 3W2DH 1KB5A 1HILA 2XQ0A 1NC4A 4TVSa 1AOZA 4U0QB 3NPSB 1XGQA 3OZLA 4FFVC 4JZNB 1AR1C 2DYPD 2HLAA 3MBWB 3WS6A 4KJQC 1F4HA 2EICA 1Z5HA 3IDNA 4FFYL 4XCCL 3HR5B 5IW6A 5JHLL 1U8IB 3KYNA 2LAAA 4UINH 1CI5A 1S9WA 4JJ5A 5HSFA 3IF1A 5LGYA 1AQDB 1GW6A 4I85A 3H9ZA 4M6OH 1KXQE 4L5FE 4AVJA 2BRRH 3GSXA 4DW2L 4UZUA 3T0BA 2LAGB 3QORC 3MREB 3NJFA 2IDCA 3TONA 2D3LA 3V4PH 4M8RA 2ESVB 2VRAA 3QHZL 1CDGA 2N7BA 4KKLC 4MMXC 4WW2B 1GRWA 1H15B 1UGKA 3OSVA 3WFCL 2F5AH 3FMGH 3PP4H 5IJCC 1XAKA 4ZFQA 4WI5A 1E30A 2DMHA 3IRZA 5KSBE 3HUJF 1A47A 2V7HB 2JKXA 1B90A 3GMPA 3HE6D 3WSQH 3P0YH 1OAQH 4U49A 3CFEA 3W5MA 4OZFG 4G71B 4J4PA 1MCPH 1MFEH 3VA2C 3T1FA 5ERWA 1YEFL 4ZZKA 2XSKA 4WTWA 3WSQL 3L95B 3UTPD 5IMLB 2WV3A 1MIMH 3IPFA 4YNYA 1MCPL 3BZFA 1C16B 2NCEA 3FF7A 1AS6A 5EBMA 3NSYA 4NHUA 4NAQA 1A2YB 1U8JA 1XR9B 3L7FB 4K07A 4PW4A 4OJEH 1U8OB 2EE9A 1OGAD 5I6LA 2DWEA 1UG9A 2GITA 2VR8A 4PJDA 3T6WA 3ARUA 1YDPA 1GYVA 1EZSA 3U4BL 1ADQL 1TZHB 3L4UA 3WL9B 4PRNA 4XI5D 4Y5XB 1FFNA 2LU4A 5CJOH 4XCYB 2A9AA 2NNCA 5GGSY 4HUWA 1I1YB 2KH2B 2JFCA 5INCA 4K3EH 5GGVY 1WK0A 5CJOL 1ASPA 4KDVA 1SFDA 4BK5C 1XVSA 3ATEA 3WN5B 2TAAA 5GS3A 4P9HL 5L88L 1IARB 2FYYB 3QDMB 5CUSH 5KBKA 1O6TA 4MMZB 1XF5B 4PGBA 1ACCA 3UTSE 4V2BA 4I2XB 4NAJA 3UABA 4WCYH 5CGBA 4D0BA 5FYJH 3DDFA 5E9DB 4M48L 4MJ2A 1QFWH 3EGXA 4NPYA 5E5MB 3C60A 3WEOA 2P46B 5T1DL 3D4CA 4F3FA 1WZ1L 2VDOH 4QTIL 3BMVA 1IC7H 3MV9D 4P3CH 5EO0B 4M1CC 2HA1A 4XAKE 4L4TB 4FABH 3VJ6B 4GXUN 2Y2WA 5J56B 3FB7B 2NQ3A 1Z5YD 1DBKH 1MVFA 5ELIA 3AT8A 4N86A 4KZDL 2OS7A 1CYGA 4BUGA 3EH2A 2I07B 3S36L 1KGJA 3ZIMA 3B3IA 1XR8B 5EOTA 1LEKA 2E7LC 4RAHA 5IIEA 3HCVA 4JG1L 3SDDA 4FLOA 5AOIA 4DUXA 2GJ6B 3GTNA 4LNRA 4TNGA 4XNZC 1UKTA 4TPRH 4K55A 2YAEA 1KOAA 2BIOA 2HLFD 4JK0D 2XXCB 1W8EA 4CMHC 4U2ZA 1JPSL 2P8MA 4Z7VE 4JQIA 3RWIA 1RURH 3EJUA 1CLVA 3MLTB 3HKZA 4FTVA 4I3SH 4HLJA 1CCZA 3H9SE 3GMLA 1WGOA 3QWNA 4WEMB 1P84J 25C8L 5CN1A 4MS8C 1E3ZA 1UA3A 2H2SD 1LK3L 4HEPA 5JR1H 3BPOC 3Q5YA 1QZ1A 3OWRA 4OFVA 3ABMB 2RH0A 2Z8RA 1XF1A 3GSWB 4RGMB 3TU6A 4YN3A 4BWUA 4ZTEA 4KZEL 1IX2A 4LSQH 1UOKA 4XMKL 4JUSA 5J9PB 1VFOA 4JRYE 1CTMA 2YD8A 4LBEB 5DVOA 2JB5L 3DBXB 3QWQB 1RZJC 4WDIB 2A9DA 3VB8A 1VCBC 2YQGA 3B6SB 5EC1A 2WQSA 5EEXA 2GB2A 2YKLL 4GI9A 4BQ8A 1KEGL 1FJ1A 3GJFH 1Y18B 3OXRB 4JLRA 3S3CB 3SDXF 1AZBA 3EO1B 1TQBB 2HP4A 4JFWA 4YUEH 1U8MA 5EN2A 3RX7A 3FQNA 1JCVA 2EVJA 1CK0L 1U93B 3F05A 3B5GA 4U1SB 4WHYG 3IJ7A 3MNMA 1HHKB 3GJFB 1V3KA 3M46A 3H42H 3NJHA 4P2QB 3RU8L 3L5WB 2WIIB 4KFMA 2EUZA 1J0HA 2JCCF 5JXEC 2ICWJ 2OMVB 1UQSA 4G7SB 2FRGP 1FRGH 5T3ZE 5HYSG 3EOTH 3IAQA 2QVFB 3LKPB 3B83A 2WZ6A 1FG2A 4MQXC 4JNXA 1DQDL 2XN1A 2Y7QA 4ECNA 2EYSB 5EH1A 1FRGL 2NY1B 4A2FA 3EOTL 3GBMH 1SHXA 2DMCA 3HMXL 1MCQA 2W0KA 4LRIC 3L9EA 3K2UH 2JSFA 4FQHA 4HD5A 3UMNA 5IHUH 2CKBL 3AWGA 3FT2A 1NJ9B 4YBQC 4ZX3A 4YIQB 3F83A 1BPVA 2CNZA 3KM2A 2Z9TA 5GGVH 1I8IB 4P4KC 1VKXA 2OYMA 2F74B 1QRKA 4ZUWB 4LIQL 4DUVA 3RVVD 3T4AC 1A6UL 1EFXA 5GGSB 1T04B 4IJ3C 1ONQB 3G7TA 2IPTL 1IFHL 5GJTH 1MLBB 1X5HA 2BIQA 3T04D 3BAEL 1HH9A 3T2NH 2NSMA 4X6EB 4XO8A 4OTXL 1EHAA 1KB3A 1N7ML 1ZTXL 2Q3XA 1IBGL 2A6DA 3FQWB 4EVNB 5F72S 1AXTH 4HWUA 1X5JA 4WEBL 2P5EA 1YC7A 1EO8L 2B5IB 1MAML 1LE5A 2JJTA 3KWUA 4AZUA 3ARGD 2PP7A 5DMKA 1E7UA 2KT6A 2ZG3A 1B4RA 1KC5L 5I8CB 2KQMA 3MV7E 4WHTB 3VFPA 2NR6A 3FH5A 2GSMB 4I77L 4EEEA 4HMEA 3B7SA 5D93B 3MRGA 1AKJA 3I9AA 4H40A 3HHSA 4W4NA 1KYDA 2PNDA 4QRRA 1D6VH 2PYEB 1QHQA 4PJ8D 2R2BB 2E5EA 3BXNB 3IN0A 1JS4A 1Q0EA 4F8PA 2YPVA 4GRLA 2BMKA 1MCBA 1I75A 3IDXH 1MSPA 1D6VL 2J1YA 4KMTL 3INUL 4QCIA 5IESH 4UOJA 1JZGA 4QRSB 2EVGA 1I1AB 1HCZA 2X0WA 5IROD 3V9CA 4KY2A 5E08L 2ZYHA 3Q8FA 1EANA 4JFED 1I3GL 4N0YL 1ZLVH 3VACA 2K9FB 1E4KC 3NCXA 4EZLA 1T1WB 3QEGH 1HEJC 4G9FD 3BSHA 3TWYA 5GS1A 2OAAA 3BUYB 1A9EA 1AR2A 2NTFA 3LRMA 4HEMA 1T7XA 2FQFA 5J0BA 5JW4N 4JRWA 4U1MB 5IOKA 2GI7A 3DXAD 4JGNA 4PWEA 1NICA 3QEGL 2CO2A 4XNUL 2DQDH 3EUDA 4TN9A 5AZ2L 5I8KL 3DPDA 4UQAA 3FSVA 4RISH 3GKZA 5GZNC 3NJKA 4NQEA 5J11C 4AM0B 4UMSA 1IEBA 2CIKA 1IAOB 3GLEA 2IQAA 3GMMB 4NUJB 3IRCA 4X42A 2WLIA 2C1PA 5D5MA 4RISL 3O3AA 2R0ZL 4N2EA 5E00A 4I8DA 1IGMH 2B1AL 3IXTB 2F61A 4Z7WA 3I2CH 1SLXA 4FYRA 4YSPA 1SN5A 3T65B 2CLVA 5T5NF 3PWJA 2PXYB 3LKRA 3IJSB 1IGML 1ZANH 2YQ3A 3DX8A 2WANA 4KPHL 1J1XH 1NCGA 2YK1L 2ZKHH 1UHVA 4FJZA 2CCVA 1Q9WB 1SVCP 2PWEA 1K8IA 2F68X 1UB5B 3CLEL 4LEXL 5HY9B 4PJXB 5T33L 2V7NB 5IFJB 2FZ3B 2ZXCA 4ZS6C 2ITDB 2DWXA 1QG3A 2Q3AA 1ZDSA 2AJVL 4TOYH 4ENED 4P2CG 4AKQA 4NRXA 1DHKA 5FYKU 1NKGA 4AYEC 3C6LD 5DJDB 1A7PL 3RNKB 3ZGHA 4N2OA 3RTLA 1MW2A 3BIKB 2V5RA 1AXIB 2A73B 4K3HA 2GG1A 1H19A 3P9MA 4MCYA 4PRPA 4PS4L 4I0PC 1MELA 1QFWM 1M9SA 1TTBA 2XWJB 2XKUA 3HN8A 3DX1A 4JE0A 1PG7W 4OAWA 4BEIA 2ZE0A 4L18A 5E4EC 3QRFM 1UFGA 2B0SH 1QFHA 1WT5A 1ZVHA 1AXSB 3NZHL 3MLVH 3R1GH 3H7BA 5DQDH 5FGBC 4RA0C 2DLFH 1SRDA 2COVD 5DQJB 1Q94A 5JXEA 1VFAB 5HHPB 1G9NH 4G3YH 1X6LA 1BFSA 4PJHF 4U7MA 1NUGA 4ZFGH 3VD0A 1UCTA 1B3JA 4I9XA 3MLVL 1YEWA 2WUCH 3L5XL 2A74C 1XTLA 3Q7JA 2ROYA 2N3JA 4H8PA 5JTWA 1RK0A 3N42F 4Y2DB 4AEFA 4A2EA 5I1DA 3KPMA 3UGUA 1ULVA 3QAZB 3TEYA 5F0PB 2Q8BL 3GRGA 3O2DH 4LRIA 1NCDL 1C8PA 3FYIB 1JHTB 4LLDB 1YYMH 5IQ9B 3G5YB 5E2WH 1JVKA 2IDUA 1RZKL 2XVBA 4YH6A 4N3UA 1UXSB 1J8SA 2APBA 3UX9B 3APMA 2J6EH 1U21A 4S1SL 4RMQA 5IQNA 4KKBD 1ZT1A 1AGBA 4JL1A 2P80A 5F8RC 3FBKA 2FO4B 2VQ4A 3GEFA 4JQVC 2J6EL 1QFUH 4X4XA 5JOFB 4M56A 4OJAA 3JSSA 2QBWA 2KZ1B 1ZDQA 4PJDE 1JVLA 1YUHB 4FKHA 3K6SB 3MPCA 3WXVL 4QY8B 3OZ9H 1QI5A 5F7AA 3UXFA 3FQTB 5E6IB 1DUYA 2H26B 2AABH 2X40A 3B2MA 3MO1B 3QYCA 4TYUA 4Y8DC 2WNXA 2ORBL 2OL3L 2JKWA 1IM3D 3O6FB 1UWEL 2OL3B 4EIUA 2JKLA 1F5WA 3QS3A 3JWNE 3QJTB 2Y6TE 4NFCA 5F9OH 2VR4A 1HSBB 2W60B 3LQAC 2MOVA 3ZKXC 3LEVH 5ITFA 3K1DA 2EEAA 2OBGA 3L4YA 1ILUA 1AGCA 1KEML 1WFIA 2ZX5A 2WCGA 1HKFA 1KXVC 2AEIT 5C09B 1EGJL 2CRZA 4ORGA 4S2SA 4JFXB 4EDXA 4X5RA 1YEKH 1IBBA 4HKXA 1SXBA 4XXDA 4DVBA 2YRLA 4D94A 5E1GA 2IG2H 3IGKA 2V17H 3GPEA 6FABH 5IB1B 3OQ3B 1NCBL 1TUPA 2E4FA 4BH8B 2EDXA 1URIA 4ZO9A 3C12A 4JPIB 4TUKH 5E94A 5HI4D 2UY6B 4XHJC 3KPRD 3MA9H 3QJHA 5LBVA 4FYSA 4QHKI 4GLRI 1XH2A 3MJ6A 3RJDA 2G9HB 3OKOA 4LKCB 4H8UA 3MRHB 2K6YA 3MUJA 4L1LA 5F1IB 1DQML 4TSAH 4HG4K 2MRYA 1T0MB 3PXJA 5GZNA 4M00A 4NUGH 2XV0A 4E9RA 3QHFH 3VWKC 1OLZA 3IFOB 2R83A 1L9QA 5HDQH 1MHCA 3UTSD 3EO9H 4HOZA 3BD3A 4TSAL 5ADOH 1NGPH 1G5AA 12E8H 3SGDI 3AS0A 1AANA 4NKMB 2A7BA 4FTVE 5IQOA 4IOFD 4AH2B 1M6OB 2Z31B 4PJIF 1DO5A 1OW0C 1HXMB 2J8HA 3ZZQA 5I18L 4ODXA 1YNKL 1AQ8A 1K4CB 4X6CB 1M7XA 2CPCA 3WFHB 2O5ZL 4GXVL 1CDBA 4QO1A 1HNGA 1Y6KR 3VFTA 2V5MA 4NGHL 4XAKD 1Z0MA 3LX9A 4NQSA 2XY2A 4AK2A 4CC0A 1ZVSB 4KRLB 3RHWK 1DZ0A 2A9NL 3K2MC 4H8VA 4U3SA 2HPOA 3BSGA 5CEZH 4CJ0A 2FO1A 3P02A 3Q8EA 2XZZA 4YHNA 3LVTA 3J2PA 3HMWH 3MQIA 4FFZA 3DUUB 4H1LG 1OM3L 4BDVB 3QZWB 4LOUD 3S36X 5K9QI 1JHLL 2QHRL 3IBEA 3CCHA 1Y7VA 2MHAA 3N85L 3PWVB 3CFBA 1MREH 1J0JA 1FL6B 1I7TB 1K3IA 1R5VB 1YPZF 5C6TL 1KYAA 4XRCB 1OGTB 3SSGA 2A83B 1XIWC 3TJHD 3UZQB 3QEQB 2Z1PA 3AADB 3UBFA 2DQIL 3LZNA 1KPRA 5LBGA 3EDFA 4GRWH 3KYOA 2ZJSL 1FCGA 5CLTA 3QI9B 5T1KB 5CGTA 3SGJC 1YJDL 2NY5C 2FT6A 4P23D 1I4FA 1NCWH 3VQ1C 3BZEA 3CFJB 4IS6A 4AIXA 1A5FL 4P3WA 3WD5L 2ZXAA 4UOQA 3DRQB 3NIFB 1TKWB 3FQRB 4GRWB 3H4HA 4I0KA 2H0PA 4HS3A 3U7WH 5C0GA 3FJTA 4JRYD 4XC1H 4FI7A 5DJ0A 3FU6A 1UASA 1YEGH 2QGCA 2PPEA 3QUZC 1HQRB 1EJ6A 4PJEF 3MX0B 5TE4L 1L9MA 5JHAA 3MYJB 5BJTA 3H55A 2NY4B 3DX4A 3R4RA 3OLIA 4F7CA 3GBEA 2QPDB 1HEHC 2LLGA 5FYKH 3IK2A 3AXHA 1P2CA 3TBTB 1CT8B 1ZPUA 4ZFZA 4U2YA 5B1JA 4HBCL 2G2RB 1M6UA 1NEPA 3T2QA 3IXAA 4CDHA 1LNUA 3X17A 4YO0B 1GTNA 4YHKL 1RUAL 1OCCB 1XGTA 5T3ZD 1TSRA 5FK9A 2GJPA 2X4PB 1EX0A 3LXAA 4JQVA 1BM3L 4TVPE 5IQMA 5IGXL 3CFCL 3FH8A 5JZ7C 3T6QC 1DQJB 4IU3B 3D2UA 1AP2A 2J2ZA 2P5EE 3GSRA 4MXQC 5DS1A 3VXRA 3O41A 2AXGB 4B9YA 3C8HA 2HLEB 1VEMA 2NDGA 3MU3A 4DTGH 5CSBA 3FUMA 3NACH 5ESVA 4CJ1A 2CJSA 5DHDA 4OQTH 1YO4A 3EBAA 3QC6X 2ALWA 2G0KA 5SWSA 1NWPA 1J5IA 4ZUTB 4ZW5A 4E5XB 1JDCA 3OPZH 4ELDA 3HPJA 4NJAH 2CO4A 3QJQB 2UZYB 4QRRE 4W6WB 2P7TA 5E8DL 1ZA6A 1E9PB 5I15L 1YEDA 3KVDD 1PTZA 1FL3A 4EUPH 1GPOH 3D18A 5HDBB 1A7QH 1BVNT 2GAZA 1F8TL 3O11A 1KACB 4R84A 4NJAL 3JV5A 1NCOA 5SX5K 5CP7B 3SPJA 1CD1A 2NXZD 4GMSH 3KCPB 3T0AA 4FC3E 4N2LA 2VH5H 4XX1G 5DU7A 4AQ1A 4EUPB 1C08B 4J28A 4NYLB 5IREA 2WTRB 3QNXA 4PGEA 1CBVL 4CVZB 4HKBB 2WUBH 5KS9F 2BS71 3LQZA 4RAUB 2ZOWA 4I48A 5F9AC 5GSVB 2X3BA 3TASA 1ZV9A 5D6DA 1F58H 4PJ5B 3SQOH 5E8OA 4PVMA 4U6XB 2QQKL 4YE0A 1WJ3A 2WUBL 1RZFL 3B9KA 4I3GA 5C3LD 3PNWA 5D1ZB 1UD6A 2X4OA 5D1XC 5F8QC 5ICXB 5KYYA 1IUZA 4YEFA 4OLYL 3A6BH 4NQEE 3FAWA 2OZ4A 2DTMH 2HT3C 4XBGB 5DO8A 2GIYA 1AO7B 5KVGE 5DTFA 1JFQH 1BBDL 5D5ME 4WO4B 2P3YA 2DY2A 3QQ4B 2DTML 2IOMA 1ECYA 3N2JA 2EXTA 2YFNA 3VWKA 1MQKH 4MD0B 4Z7WE 4Z0BH 4FFWC 5DMGD 4GI6A 2CMRL 1BJMA 3M1BB 3BGFB 3L1FA 1E90A 1DSYA 2Q7AA 4FHJA 5HHOA 3IGLA 2YMTA 2BJMH 3D09A 4MNQB 1P6WA 2OP4L 4GKNA 4XVSH 1X3DA 1SVBA 4QRPA 2Y7SA 1RULH 1EK3A 1HHGB 2VXTH 2XWTA 3MRMA 2OMTB 1D9KC 1T66D 4F2MB 4RDQF 2FX7H 1RQ5A 2I60L 1DVQA 1RZIB 2EKSA 1H6UA 4JDZB 2ZPKH 4HDIA 1J8RA 1T5KA 2HFEA 3BW9A 2XUWA 3BP7B 2VXTL 3QXUA 4HGWA 6PAZA 1RK1B 4NC0B 3MR9B 4XNYL 1T03H 3HG2A 2FTAA 4G1EA 4JHWL 4Q89A 4UBDD 1EPFA 3SDAA 5F96H 4PV9A 1HOCB 3MOQA 4Z3GA 2CGRL 1KJMB 2NUPA 4AYID 1AGFB 3BE1H 4TRPL 1LK2A 5AYQA 1IGFL 5KSAB 1Q9OA 4WWKD 4BRVA 4YQXL 1EZVX 3GRWA 3WJMB 3QZWG 3TLRA 1WC7B 4KTEH 2PR4H 5EU6B 4MA3A 4PRPE 2A1WH 2J4WH 2AMUA 1AC0A 2C3GA 1KBGL 2YHGA 1S9XB 4IRSA 5CEZD 3BE1L 4APQA 5KWYC 2VAJA 4ZTOH 3VGBA 5KBDA 4A6YA 5DHMC 2J88H 3GHEL 5CEYB 1XIWA 4LPUA 4GBXC 1OT1A 3JZ7A 4LT7A 2AEWA 1YAIA 2ZOKB 4PJ7A 5D4HA 4ZFOL 2EDKA 4QHNB 3PJNA 3RKDC 5IEKB 4JFOB 4ZFOB 3B2XA 4YPJA 4GOSA 3BUIA 4NX0A 4F91B 1R24B 1S2EA 4PHZA 1U8PA 2BERA 3L3GA 4IBSA 3UERA 3IBOA 3IFLL 1S7VB 2HX7A 1FPTL 3DOHA 1NLBL 1MRFH 4UDTB 1PAZA 4AENB 2RMNA 4PHXA 5E8EA 3AVEA 2WWOA 2NZ1A 5D4IA 1OD9A 1A6PA 1WTLA 2IWGA 2XA8L 2G75A 3QUZA 5EZJA 1YG9A 2K1MA 2G4GA 3HFFA 2W0FB 4GAJH 4DEPB 1PSKL 1M71B 3U1PA 3C8DA 4LCIL 5IJVB 4P8QA 1C5DB 3F7RA 4AMKH 4L1DA 1NC4D 3PDOB 1S3KH 1WV7T 4L0ZA 2P49B 1NSNL 5FUOH 4Z3TA 5ISZD 3MCLH 1EJOH 2FNBA 3QG7H 3PPEA 1PX8A 3SD5A 2ZX6A 3GIVB 4U33A 1PFOA 3GSNH 1IC1A 1RMFL 1S3KL 2A9ML 3DGGB 4U3CA 1NM9A 3QEHB 4AG4H 5DYOA 2GJRA 2R59A 2UX6A 3FDWA 4HS6B 3RBSA 1AGDB 1KDJA 5JHBA 4Z3JA 3NIDF 4LKXA 4NUQA 4TL4A 4I18B 3NDZE 4NCDA 3PRZA 2LU3A 1CLOH 1PG7H 1ZK9A 3FQYA 3GSNL 4YBHA 5FYKD 5LWYL 1NOFA 3GSNB 2Q8AL 3WKML 4UM9B 2V9UA 2VAAA 3NZSA 2CH8A 4IIQB 2WINB 2R29A 3MJWA 3D4GA 2V9TA 3KYKH 4D9LH 2PCYA 2X6BA 4W9LC 5D1QB 5DC2A 3MRPB 3CFTA 5I1JL 3VXTA 3DV6A 3VSTA 5A1AA 5I73B 2V9QA 3VDBA 1KMGA 1MJ7L 4KTYA 3IWUA 1LO0L 1NPUA 1YY9D 2BSCA 2DIEA 1OP3K 5CSZB 4PSPA 4DKEL 5LKNA 2ZNXA 3VU2A 5AOMA 3FT4B 4A55A 4F5CA 3PHAA 4O2EB 3KBPA 1HYSC 2BVTA 1RU9H 1VFBA 4FQQB 3FN0H 3OGOE 2XKSA 4IHBA 3APCA 1RUML 4UM8A 3O45B 3FONB 4YFEA 3BZ4B 5I2IB 1NLDH 2ICEB 5AD0B 1MWAL 3C5JB 1IC4L 2R8SH 1B0IA 1IBFA 3FN0L 1MWAB 4HOMA 2AEOA 3OX8A 3Q1SH 1JL8A 3WLWC 2FR4B 3LYRA 5DLMH 2EC9T 1NLDL 1OSPH 5C0CA 2R1WB 3B9EA 4PBXA 5DJ2B 3HLAA 4R90H 1ZCRA 4MVBC 2Q7YA 1JTOA 3W3BA 1C12B 2W9LA 1U2CA 4JKLA 3BKML 3LIZA 4G42B 4G6FD 4CMMB 3U1QA 4FQXA 1EEYA 2XKNA 3MRKB 3ASNB 2B08A 3C6SB 3ROOB 3JWNG 3T9WA 3TURA 1X5KA 3BH9B 4M5ZH 3TBBA 4HIXH 4XWGL 3ZYZA 4JY5H 1SJEB 2HH0L 4JPVH 3ULVH 3BP5B 1LGVA 1QTPA 3I50H 5F7MC 2M26A 3FCSA 2DM2A 4Y1TA 1ZVNA 2DI8A 5CWSB 3SPHA 2FEDC 2XG5A 4FG0A 2P24A 4Q6IB 5FR3A 1NMBL 2GSGB 4PMEA 5BZXA 3WNIA 3ZPDA 1CFNA 3GSUB 5GSRA 1KB9K 4KK9C 5I6NA 4QXWA 2XHNA 2XNAB 4UUJA 3S97C 4BA0A 3QCVL 4Y4KC 3OTTA 4M43H 1WE5A 4YDVB 3MLRL 4BFRA 3KJ6L 1D9KA 3V5KB 3N41F 1DJWA 2CK0H 1RLBA 3IAGC 2RFXA 5TFSH 3UBXB 3ULUL 3C5SA 5DUBB 2YZ8A 4QXGL 2JV6A 4PJGB 1JPTH 3RILA 1QBLL 1X5FA 3SDDD 5I1KH 3I6GB 4LU5L 4MX7A 1MW1A 1HSAB 2WO2B 3ZE0F 4HU8A 3FOLB 4KKQA 2X53A 3WELA 3OR7A 3B1TA 1G7JB 5GRWA 1MUJB 3V55A 2H47C 2QELA 4G9DB 5I0WA 1DJIA 4G8FA 1MFCL 3ZN6A 3ZL4H 1QOKA 2GC7C 4PCKA 4LLQA 2CHZA 1WZKA 3WI9A 2GCYA 2MJWA 3I02B 5CJXC 4ZNEA 5IVXF 4U7KA 4HEPG 3V6OC 3ENEA 1CL7L 4URTB 4JY4A 4KJYB 3QIBC 4HBQA 4X4YA 4N0FA 1U95A 3S9DB 3CVDA 1JERA 2V3EA 1YECL 4FERA 4OZGB 3WY2A 5DA4A 1LDPH 1ZIBA 2CU9A 3RI5F 4XCNA 2VR6A 3FULA 2PWHA 3CJJA 1OL0A 4XPTH 5DJXB 2C3VA 3BPCA 5LBSH 1N8ZA 1UM6L 2W9EH 2HG5B 2VUKA 1AMXA 2NY6B 2QVMA 2V9RA 4OGAC 3VFVB 3OJVC 1N26A 2VZ1A 3IJEB 5E6YA 2WJ5A 1X44A 2ZOLA 2DDQL 4E9YA 1Z32X 3IS0X 3BN9D 5IW3A 3MRIB 4MRBA 1JWMA 5CXPA 3QWOA 3V4VA 1S46A 4HPHA 3ZT5A 3SKMA 4EOWH 1TU2B 2A5UA 2VO5A 2EDLA 3LS5H 5TF1H 2FGWH 3L54A 5CBAB 5HYIA 3L3OB 1N0LB 4ONFL 1IFRA 2KDYA 4KX9A 4S1RL 4NN6C 2XWRA 2E8ZA 4V1DB 3K72B 3VXRE 1E4XL 2Z93B 3AS2A 3QQNA 5DUPH 3J8F7 5DEGB 4AX3A 4MLIA 2FX9L 3LS5L 4HISA 5I5IA 1A1MA 1PY9A 2CLRB 2IBBA 3GMQA 4JZOB 4J7RA 2C1OB 4AYFA 2X4RB 4PRBB 1ZXQA 2I85A 1G6RA 2BSTB 3C5ZB 5ECGA 2BP8A 5DD6B 4GS7B 5F7BA 3SE4C 5KSUB 5MEQB 3EW3B 4ZS7H 4IMLA 5KSVB 5FHBH 4LCCC 1U6AH 4YR6B 3ILPB 3NFPB 3OB0K 4YHLH 5KVDE 2JK5B 2ZYSA 1EFXD 1TVBB 5FO8A 3AXLA 2DV6A 1HXKA 2D3JA 4NT6A 1TEFA 4PJCB 2D7OA 2WAHA 4ZUSB 2X9YA 3IM1A 1E50A 3DSFH 3C6EA 5F6HI 4NM8H 2HT2C 3KWXA 1VF5C 2FSDA 3LPWA 3P3YA 4R4BB 3WE6B 4TVPD 4FG2A 1H5BA 5HGDB 3G5XA 1DCEA 4KQ3H 4NM8L 2NYYC 3HRZA 2P5ED 2VMJA 3S0PA 2FB4H 2WYHA 2H32A 3WJLC 5HJGA 2CR3A 3DI2B 4PY7A 3S8GB 4P5TA 4KQ3L 2AERT 2N59A 3MJ7A 2Y4SA 3SKOB 2FB4L 3JV6A 4KO6A 3X14B 2ZNWA 1FL5B 1FWXA 2QR0A 2CJUL 3AAZA 2NR6D 4KK6D 1FA4A 1JRHL 1MY7A 4IRJB 5EO9A 3WIAA 4ZMNA 4JHBA 1AKJD 1UA7A 4M8QA 1S9VA 5FCSH 4R0LC 1ID5I 4QRRD 5H8DA 2WQRA 3N1QC 4DKDC 3CVBA 3MA7B 1OTSD 1KCVH 2C7UB 3E2HC 3OKNB 2HUHA 4GRLD 2WVUA 5KBNC 4N85A 4NJ9H 1JV2B 2EDMA 1FZJA 3GI9L 1JI1A 3QJRB 2BSDA 3D25A 3ML8A 2IV9A 3HC3H 1XB6A 3AJ7A 5HHOE 5E99H 1WF5A 2Q2EB 2XTSA 3QJUB 3D85B 1MNUH 4LQ1A 4QRPE 5GGQH 5I1HH 3GMRB 3CBKB 3Q6GH 2XTJB 5TH2A 1NGWB 4YHMH 1KTBA 3ULVD 1GZPA 1NUFA 2J8UB 2DQCH 4MDJA 2R0LL 3QH3A 2ISDA 2YJLA 4Y4KA 1Y6MR 2ZIDA 2OMZB 1HDMB 4KVPA 2W8CA 1U8CA 2BSRA 2YEZA 1YMMB 1AACA 4HU2A 4WU7B 3BVWA 2IANB 2AJXL 1HHHB 3FT9A 2EDWA 1FI8C 3DJZA 4K5OA 3ZU8A 4NQED 1O7DE 5GS0D 3BP4B 4ZDHA 3SDYH 1KJ2L 4HCRH 4Y7OC 1P5UC 4HKZA 3UBXG 5AVVB 1S7WA 5AWNL 4KNUA 2FECL 2YD6A 4HH9A 1YEIH 4K4KA 4S10A 5AVRB 3O8XC 2PTVA 4RQQB 3VWJB 4MA7L 4HCRL 1JF5A 1ZXKA 3ZY7A 4B27A 5LGKA 1SUHA 3CV5A 3EFFB 3QJZA 2OI9B 2YEVB 3LH2L 2YUWA 5BZWA 1K2DA 2MKLC 4DUWA 3LRLA 4X7SH 4EQ2A 5A16A 3QULB 1S78D 4X5PA 5ABZA 5KBPA 1VRSA 3G6DH 3D8MA 5L4JA 2CWRA 5F3HB 5JXAL 5JW5B 3G9VA 1LO3L 4X6FA 1G0XA 3EFOB 3DRTA 4XPFH 1I8UA 1T89A 2IAMC 2VLRD 5D72H 1FV1B 4X7SL 1JGUH 1H8OA 3V6OA 1XD0A 2WXNA 4Z9KB 2BVPA 4P46D 2Y22A 4WI0B 1REIA 2AQQA 3QIBA 4JPWL 1ZTMA 4G8IB 3DX7B 3VXMA 1DLFH 4N3TA 2QADD 2TSBA 3HZYB 4LF3A 3SDCB 4UT6L 3NJVA 5C8JA 5I1GL 1NFIA 4GAYA 3TP4A 5AUMB 1GGTA 4Y5YA 3CXDL 3B4NA 1TJHL 5LAXB 3MGTB 5KBMA 4BBWA 3CBJB 4AQEA 2DAVA 2X1PA 4N2GA 1RSFA 4FQLH 4JDVA 2UYLA 4N0CC 4CUCA 3ZTNH 3ZDYF 5CN2A 3QIUA 1WA2X 3N0AA 5I8OH 3DMMB 3LZFL 4NDMA 4WUKH 1T1XA 1A9BB 3ILDA 1A64A 5F7EH 5HHVL 5GZOA 4EI5A 2EIDA 2B39A 3EYOA 3L45A 2GKIA 1MI5A 2X4NB 2JLLA 1OHZA 2DQGL 5E1HB 1S7RA 1U3HA 2BOLA 4KXDA 1BVLB 4H8HA 5C9JB 4JM2A 1NANH 1GAFL 3P3UA 3GS7A 4JANB 2OMYA 4KUZL 1ERNA 1TETH 4DQOH 4YSUA 2Q9OA 3QNYA 1JPGB 1JWSB 2UV3A 3QDJA 5JYMA 2LTQC 2BHZA 1NBVL 5CJBA 4BZ1L 2C8NA 2XG4B 2YAPA 4PJFB 3SE4A 1KDIA 4JN1H 5BO1L 3HE7C 1PF3A 2FL5B 2WW8A 4N1CA 4BJLA 2BWDA 1T6WA 3L9RA 4F5CE 4MKTA 2SEBB 4B3VA 3GXFA 2DKUA 4KDTA 2F58L 1S7TA 5A2IH 1NQBA 3MBEA 3LY6A 1LWHA 2P80D 5C0AB 3TZVC 5AW8B 1WSST 1M9WA 3RWFB 4GEJA 1DQQA 1ODUA 1QR1A 1ORSB 3CAFA 2DIAA 2LW3A 2W07B 2OULB 2V2WA 4AGPA 4DAGL 3LKQA 1JMZA 1LD9A 5DZVA 2R2HB 4ELMB 2YAOA 5TGBB 5B4MD 2WLYA 3RJQB 3U46B 4HSCX 2H0JA 2Y2TA 5T5FA 5KANG 4IBLT 3ZOAA 3L7EB 3WFZA 5EMYA 3VW3L 5E5UB 1T3FB 2XWZA 2C9AA 2HG0A 4GQQA 2Y25A 2AJUH 4CC4C 5D1XE 1PLGL 1GA2A 4K94L 5CCGE 3EADA 3ARBA 3X13B 4DP2X 2CO7B 1EERB 3B9AA 3CVHA 3CZUB 3RX8A 4HC1A 3CMOH 3RURA 3MBXH 2JB6A 2XVKA 1AAJA 1IKNC 2AJUL 3GO1H 4ICWA 1S9YA 5DD5L 3E1ZA 3PFQA 3LEXA 1KELH 3SO3B 2UVEA 1DVZA 2FE0A 2P5WB 3GHPA 4H44C 4JFDB 5JO5B 3TL5A 1BD2B 2JTDA 3Q2CA 2P8LB 4Q9QH 3GO1L 1U33A 3HNSH 2OZ4H 3MLUH 1UT9A 3WS3B 4NCC1 2VNCA 4UTAA 1AS7A 4H7VA 1NBYB 1BLIA 3OR6B 3KLLA 1RJYB 1MJUH 5EWIL 1H6EA 4GUCA 5L6YH 3KLAB 3MLSL 1AD9A 3Q3GB 4FQ2L 5F3FA 4AIOA 1N5YL 3OHXA 4P59H 2BNQA 2Z8SA 5ID1B 2HVJB 2O5YL 1V05A 1KLUA 5ESQB 3JUYA 4E9TA 3VG9B 1XGZA 1GH7A 3DIFA 3CVCA 1P69B 2Y06H 2YBGA 3UL4A 5BXFA 1CF8H 1X5AA 1EUTA 3TT3L 4LLWA 2GHZA 5AKVA 4IGBA 4CGTA 1NKOA 4L3EB 1JK9A 4F8QA 1Z9SA 1PZ3A 3LKSA 2D03L 2FEEL 4QHMA 3Q8CA 1HINL 2F7QA 5TTRA 4CGUB 1KIUB 2HPTA 3AGVA 3MRJA 2VDQL 5EBLB 5LN8A 3DURA 3NGBB 3E80A 3ZMNA 2AZAA 5CZRA 3FB8B 1UKSA 2HVKB 4P2RB 2E8YA 2P52A 3F00A 1SXNA 1BFOA 4OZIA 4TUUA 1IGTB 3H3PH 3OVUB 4GKOA 1XF3B 5FM5M 2XWDA 3QSKB 5EOCH 1QBMH 5T1LA 4RFNB 2OJZH 4ZNEE 2P4AB 1QSZA 3DOIA 3FS9A 3HI1B 3RWEB 4LHJB 3MMEB 3P4LA 4P5MA 3U2IA 4Y8AA 3LHPL 4UTBL 2F54D 5LVEA 3BKCH 3TO4C 2VZTA 5F7YC 4JFYB 3ARFB 3VTTA 4DVRL 1T1YB 3OBAA 3FUIA 3V5HB 1YNTB 1JPFA 2H7WA 2GTQA 3VXUB 3P4OB 1XDTT 3MGOA 5LDUA 2Y1VA 5E2VL 4JB9H 1NBZB 2JXMB 4KROB 4J3BA 3FCBA 3MRDA 2A6IB 3HG5A 43CAA 1NMCC 1BAWA 3V9EA 2ZAGA 2I25N 3ARYA 2A4CA 4ZFFB 1FVCA 3FTXA 4JB9L 3Q0HA 1U4FA 2R23B 3KGSA 3WIIH 3QISA 3H3BC 1G7HB 5DD0L 1R3KB 2R9HC 2NW2A 3ILQD 5E9NA 4G7QB 2GVYA 2FQGA 3NDYE 3QK0A 5FW6A 2QQNH 3IU4L 3P77A 1MIEH 1F4WH 4U3HA 3IFPA 1J5DA 4DT2A 3RUGE 3LKNA 2I32A 3RJOA 5JQ6H 5SV4A 1DVFA 4JR9H 3LXUX 4NZUL 1QD0A 1R3JB 5J89A 5B1BB 3U9PL 1XGYH 3L3IA 4M5SA 5FKPB 1OAZH 2JKTM 1I85A 2BVOA 3DOSB 4NKOB 3EHBD 3REVB 3LH8A 3VH8A 3WNMA 4BZYA 1XBRA 1BQLL 2ZZUT 2KMWA 2ZCZA 5D71H 5CBEA 1XD1A 1DTUA 1WEJL 4XPHH 3OJMB 3TBYA 2WIMA 3THML 3O6ML 4X8GA 4BQ9A 3KGRA 3OKMA 2VXSL 2EDHA 4OZ4B 4A7GF 3HE7A 4KNSA 4U1NB 5TQ0L 3O6LL 5E2UL 4KJPD 4L1HA 1B0GA 3G3LA 1TZAA 4H26B 5F21B 1DUZA 1GJWA 5F88B 3QJVB 5C97A 5DRXA 4X9IA 3TA3B 3MROB 4JKMA 2ADIB 1T2XA 3VX0A 1CICA 4QAWA 1ES0A 4L5FL 4UV7H 5EF1A 2W5PA 1TEGA 2BFGA 3D2UD 3KM1A 1V27A 4KK5C 5I24A 1QI4A 3VXRD 3TNMB 1T7ZA 2AW2A 3NCYP 4HXAL 4PIBA 3SKJH 3CFIC 4F37K 4L8SA 4ZK8A 4JCMA 1F1DA 1ZS8B 1D6EA 1PIFA 2Z4TA 4DZBB 4KI5E 4U1GC 4M6NL 4N2DA 3RL2B 2WGNB 5SWSD 2G60L 3GXMA 2AJSH 3QUYC 1U91B 1K5WA 4Z5RB 3PHSA 5DRZA 3GXTA 2D3NA 1OV8A 3K1KC 3NQKA 1C1EH 2ENPA 1I9JL 3S4SB 1BYPA 5IB3B 1SYSB 4UU9A 2ZCLH 3VRJA 4J1UB 1JGDA 1RZKC 4NNPL 5IW1A 2J71A 3HS0A 4YHYB 1GYCA 3WIHA 1IKNA 4QRUB 1NWOA 4AEHL 3CZFA 3WEMA 2H9GB 5MERA 5INDB 3D6GA 3KEDA 4EAEA 2BK8A 3O4OC 2AK4B 2GUOB 3V8CA 5F1NA 1EEZB 3VFNB 1M2VA 2CHXA 4J8RA 5C07E 3ZDXF 5K9OA 1XSOA 1PYWA 3B9KD 4PJ9A 1OCOB 1NGZA 4L9DA 3SE8L 1KN2L 3VGDA 4JM0A 3KVQA 5EU7C 3IDJA 3QXDA 4Z3EA 3L2NA 1N6QH 2X1QA 1FH5H 4OM1L 5GRJH 1ND0B 1BF2A 3JTTA 5ENWA 1RCYA 2CGZA 2EAEA 4IM8A 1K9TA 5CLYA 4BH7A 1ZAGA 2Q10A 4F1SA 3D9AL 3MRFA 1MEXH 2XN9B 1ESOA 1AOHA 1YEJH 3S98A 2HRGA 2DQJL 3FT3A 3P9LB 4HJJH 4ELKA 3W9DB 4HWNA 4YDIL 5HP5A 3BAIA 5D7EA 1MCSA 2OX5B 4F57L 5HHOD 4MCZB 2G3MA 1FBIL 1UURA 3VQMA 2X89A 3OGCB 3DUSA 2WKLA 5E6UB 2ZUWA 3KPOA 3DC0A 4L23A 3U4EB 4Z76A 2WTPA 5SX5H 5HGHB 4OT1H 4F7PB 3V6OE 2EC9U 4HIIB 3G6JF 1KG0B 3U2SB 3W56A 1UWGH 2BSBA 4NC1C 3VXME 4OCYL 4ZMAT 2AV7B 4H8WC 3SDAD 5A3ID 1CFSB 4OI8A 2LOEA 4JO4H 1ZWIA 4Z7OF 2VM3A 3LEYL 5IVNA 4H25A 4YL9A 1UWGL 1HC1A 4D0CA 3HUJE 5DHVA 2RBLA 3ARSA 4JPKL 5DI8B 1BBJA 5C0IA 1DL7H 3U7YH 4EF3A 5HYJB 1VEOA 4IRSD 4HPYH 4Z7VB 4G2AA 4APQD 2ATKB 3QG6B 1DP0A 2F7PA 4GW4B 3H9SB 4X80L 3EJTA 4YHOL 1IAIH 4NPJA 2X1WL 3IJYB 4EQ3A 4X5WA 4NXSA 2AJYH 1A3LL 1CLZL 3F7YB 1J9SA 2OMWB 5GISL 1JAEA 5C0RL 3ZGIA 3QIWA 1W15A 3UAFA 1MI5E 3NEEA 1I8MB 4OCXL 2AJYL 5K9QG 3D52A 1NMAH 4X6DB 5ADPH 1QSFA 4Q58C 4FXKC 2AKRA 4R4FH 4AQAA 4RWYL 2E27L 3BIAX 4EN3A 3BGAA 4DP9X 3TBWA 2DQEL 1MCLA 1NMAL 4BZ2H 5AB9A 1LO5B 2EDJA 3QDJE 3MCG1 4QXUH 4R4FL 3FZUC 3VFUA 5D7JA 2CO3A 4Z77A 1GGCH 4O9HH 3KPNA 4M3JA 1I9RH 4NHCL 4RETB 2KI6A 5I82A 1FHGA 3QGVA 2AGJL 2ZCHL 1GCFA 3FO9B 2DM4A 4N2CA 3TVMB 1GGCL 4DZ8B 1NFAA 3QUXB 2FGZA 1TSHA 1MDAA 5FA4A 5K5YA 4JN2A 4O4YH 4GP4B 2BVUA 4U6VH 1RP8A 5BS0A 5B39B 1AGEB 3ULSA 5T3ZL 3T0XA 3EO0B 2BOCB 3SOBH 1T6VN 1DJZA 3KPSA 3QB7C 4MD5A 5JDSA 3MOAL 3V0JA 2YPLB 5JHDB 5J8OA 1GYWA 3D0VA 1MXGA 5DZNA 5EU5A 5F89B 2EEDA 4WVRA 2Y1AA 1UM4H 2F08A 5ACZB 5TDPB 3U6RB 3L3KB 4FQ1L 2DKMA 4P2YA 1JZ3A 1T22A 2HXAA 4NNYA 5A6IA 3ARDC 2BXYA 3NCEB 1UXWB 3JQOB 5ACLA 1OSZB 3PHQB 2FK9A 2E47A 3H6JA 4P2OC 3GI8H 1UM4L 1YRKA 1F86A 4KZ0A 4PS3A 4FA6A 5LLIC 5IB4A 4NENA 4U1LA 4OKVA 4PTUA 2LU5A 5F71A 4NO0B 5AAPA 3N91A 2PPFA 1R5WA 1CD9B 3OV6A 3JWOL 3F58H 3KXFB 3ZBMA 1F3JA 4WV1A 1KNOB 4CSPA 2OMXA 3T6ZA 5DEZA 4PJ6A 1IM9A 3P0VL 3FB5B 4DGYH 8FABA 3GB7B 5IHZB 4FQIH 4AV4A 4OCRL 5JPNA 4KY1L 1CO1A 5EO1A 5K9JL 3FSZA 5AW0B 3EYFA 3II2A 4NLHA 1B4JH 2VM4A 5HHME 1CMOA 1J0ZA 1A7OL 1TLKA 2C9VA 4WWNA 3HAEH 4YZFF 5C0CD 4YSSA 4GFXA 3WTYA 2JJSA 2BNQE 3ESMA 4JBSA 4ACTA 1B4JL 5E4AA 5IMKA 1UKQA 1TCRB 3G6AB 1ID2A 4QHPA 1YCSA 3RNQB 4MNGA 1QNZL 3T4YA 3HB3C 3O9WB 2EEFA 1E0OB 3AREA 3HAEB 3MV7B 4FQXD 1JZIA 1FGVH 1TTFA 5DEJA 4WU5A 3UZVA 3WKNA 1Z9MA 1FFRA 1TOXA 1MJJB 3DX9B 4AL8C 1A4JB 2WSKA 4QPEA 1A1NA 4XMUA 1TENA 1FGVL 4X83A 5B8CA 3PQYA 4JY6B 1W80A 4RZCB 2VXQH 4ZXBA 4E9QA 1H3UA 5IG7B 3KS0J 5DRWA 1CU4L 4U6YA 3EJYD 3PUCA 4XPAL 3MXVH 3NZ8A 1OP3H 5IEHB 4OZIE 3BQUB 4YXKH 1FZKA 4RFEB 3TJPA 2VO8A 2VXQL 3RWGA 2HT4D 1FH2A 2JCCE 2RCSL 4N4YB 2R69A 5D2NB 5DS8B 2X4UB 2UWEB 2YMOA 1OP4A 1F97A 4BSWB 4GQRA 4X0KB 3B2PA 4X7TB 1TFHA 1SY6H 4PCSA 1YYLL 2D7PA 2N01B 3EDKA 4AEIL 2W92A 4JVPA 5D7LA 5F7WC 5EG6C 1DQLL 3NRPA 1Y1DA 3N9GL 1EXUB 3APNA 3CH1A 1G7LA 4I4WB 5LHDA 2W1NA 2DBLL 3T2OA 1Y6NR 5LAPA 2BXZA 2Y7OA 3SCMA 4KGJA 4XVOA 1H3WM 2YA2A 4OJDH 1OXYA 4P5KB 1AHKA 3CPLA 3SEPA 4APXA 1G7MB 1OF2A 1TQWA 1XZ0B 2C4XA 2OMUA 2VN6A 3UPRB 4TSBL 2WGXA 3S5ZA 1HHJB 1CXIA 2F0CA 4KVNH 4WK4B 4Y4FA 1EA9C 3OMZA 3QFJD 4OLWH 4F15C 1EDHA 3FB6B 4HFUL 1KLGA 4WTQA 2EUXA 4KNQA 3OJDA 1FG9C 1UVQA 2B4CH 1URZA 1IIIA 1KF9B 2VUYA 1V7NL 3GWJA 1IC0A 4QJ3B 3K8LA 4KVNL 5F9WB 5BV7C 3S3BB 2AEQL 5L2KA 4MWFA 4RA3A 5I23A 3BN3B 4UILH 2FWLB 4QRTB 3UBHA 4YSTA 3UGEA 3RGVA 2H4EA 3AM8A 3IDYB 2C3WA 2SODB 1IC5L 5DVLA 2NY0D 3RTQC 2WLJA 1ZGLA 1L0PA 5B1CA 3CZNA 1KB5L 5HDRA 5A40E 3C09B 3FQ1A 3UAJC 3K5RA 4XN8A 3PPSA 1KZYA 4LSDA 5K39A 4B53A 2K4WA 1EWHA 1SYVA 3RVWC 4N8VG 1AHWA 3B2VH 4JZJB 4P4RB 2OV0A 1NBQA 2HLAB 2C9SA 4MYPA 1YMHA 1NFDF 4PP1C 3IDNB 2WBJB 3S2CA 1YN6B 1PDKB 5FW7A 4KQ4L 1FNSL 2ZWNA 1ZJAA 4X9FA 4WUUA 4AXWA 4XNQA 4PJBA 4BQ6A 4JJ5B 1TQVA 4LPYA 2G4EA 5J6HA 1X9QA 2R39A 3F7VB 1DJHA 1SJHA 1T7YA 1FVDA 1JD9A 1OHQA 2YD9A 5IB4B 3UTQA 3LPOA 1AFVL 4HS8L 1F00I 4LAJH 5DFAA 1J12A 4PI2A 5BCAA 2R7EB 4ODHH 2VLKA 3L9BA 3REWA 2LR4A 1A9VA 3NCWA 1QKZL 4AE0A 1MHHB 3IJHB 2HKHH 1IGYA 3SJVE 1QW9A 3FH7A 4HWEH 4M62H 1ZHLA 4UQ2B 5ERWB 1JIBA 2KQNA 2EZ0C 5D2LF 1Z3GH 4NQXA 1IEHA 5KJ4A 2XXFA 1KIQA 4QI3A 2HKHL 3ETBF 1E67A 3WDIA 4YNYB 3GSVB 5FC9A 5DSCB 5IV2A 3KPQA 1KTDA 4N90E 3QPKA 2C9XA 3C9NB 4Y5VB 3N43B 3AMKA 3U0TB 1DR9A 3KDPB 3C2AL 2OTUB 3QWRA 4ZX6A 4HHGA 1T5WA 4PJDB 3W9EA 1R0AH 3IDMB 3AU1A 1YDPB 3TN0B 2NYZA 1TR7A 5GGTH 3V7AE 4P5TD 1FFNB 1MCEA 1BXAA 5HYFA 4KI5D 2H1LM 4D3CH 2BHYA 2IQ9H 4BGLA 5FO9A 1HWWA 3MUGB 5D9SA 2DWTA 2CO6B 4XBMA 4LAQH 2DD8L 2CE6A 3DVNA 3MKGA 2OTWA 3SY6A 3HZMA 4XP4H 2PWFA 3MRNB 2IQ9L 3HAEG 5E5RB 3FTYA 5DZJA 1T2QH 3H7LA 1KY6A 3L3HA 5F7KC 1XZWA 5B38B 5I5MA 4Y16A 4XP4L 3AITA 3KZ8A 1UA6L 3G5VA 1GHFL 1TJIL 4HW6A 1FGNH 3C60B 3CU1A 4F3FB 2CDEA 4JKWA 4Y1AD 3OB0H 2G2PA 5A43C 3VI3F 1THCA 1E5UI 1BOGB 1KGIA 4CKVX 5DWUH 4UQIM 4GEIA 1RZGA 1XCWA 3M7FB 2OK0H 5HHXL 4JFZL 4ATWA 3BWAA 5EORL 2Y69B 4FD0A 1JN6B 5IMMB 3TF4A 5MEOB 1I31A 5E23A 1QA9A 4QIRA 3PDDA 5E95B 3VD1A 2JIXA 4AQZA 5IT2L 3NJNA 2MCMA 4U6HB 5DMJB 1KJVB 3BEWB 3GS4A 4KK8C 2F18A 3UTTD 4AQ8C 3GD1C 3ROLA 1OVZA 4N87A 3HCVB 5IIEB 1KCWA 2Z4QB 2FO8A 1MRDL 1O0VA 4X9YA 4OFPA 5F7HA 1OAYL 1XCXA 4MHHI 4BHUI 1E4JA 4G6AC 2K45A 4F8NA 4GW1B 4FTVB 1MCRA 3AROA 3HG1E 3VGEA 1Q0XH 4ES9A 4YXLH 5I6OA 2P26A 2YN5A 5FFLA 2EIZB 5EUKA 2E9BA 3VSQA 5FB8B 5BRZB 1L6ZA 4B3EA 1VADA 4BFFA 3TIDA 3RDTD 1GW0A 2V2XA 4E68A 1A65A 1HIMH 1Q0XL 4F8OA 1KT2B 2AXFB 4FG6D 4PWHA 2HRPH 3CHSA 3DX6A 3EJZC 1AE6H 4YDJB 4FJYA 3WO3B 2B77A 4M7JH 2EXYC 4F7TB 3FU9A 4I1RA 1HCFX 5GQBA 1RZ7H 3QQ9C 4YHIA 1UYWH 3B56A 2I9LB 1CFQA 1CFVL 1JV5A 2VLJA 3BH8B 1I8KA 4A66A 1JGVL 3T0EA 3RTQA 3RFZB 1MFDL 3O3BA 4WI8A 3BCDA 5D8JH 3T71A 3QIUD 2MCPH 4R8WL 3CFKB 1ORQA 2VMCA 1QYGH 1D5XB 3DVIA 1BZOA 5BS0E 5I75C 1AR1B 1RVFL 1T7WA 3UYPB 2ZXEB 1JF1B 5GZOD 4EI5D 4Z7UB 5I0ZA 1I8LA 2J72A 3AW5A 4GY4A 4P9ML 3KPSE 1WZLA 4UYQA 4F7EA 1IVTA 1MI5D 2PABA 3EH1A 4S1QH 3K4AA 1FYTA 1U3HD 4KH9A 2OR8A 5CJQL 4DN3H 2HJLB 4JM2D 2FAUA 4PGDA 1B3IA 3O3UN 3S96A 4ZAKB 1GOHA 5JPMA 1U58A 1EIBA 1TLMA 3K6NA 4LLVA 4DN3L 4FHBD 3QORB 3GK8L 3QDJD 4FQHB 4IBZA 3IPBA 4MNHA 4MMXB 3MRRA 4OLXH 1MOEA 4L4VA 3H0TA 3MNZA 3ABLB 4ZW8A 4ALAC 3EOBA 4GNKB 2GQHA 4MMYA 2HJKB 1NCCL 1HZKA 3T6XA 1XCTB 3ZDZB 4GXFA 3MBED 3WLBA 4ERSL 4H5SB 2M83A 2XFXB 4ODUA 2BY2A 2CR6A 3H85A 3M07A 5C0FA 5EFIA 3S35L 4EIGB 4LRNL 4HP5A 4TVPL 4XNXH 2VL4A 2ARJB 5IF0B 3MFFB 3ETBJ 4G8GB 4GSRA 4E2OA 4E42B 2VIRA 2VJ8A 2HZHA 3HPLA 4PD4J 1R3LA 4XNXL 1P4UA 4HIPA 4PRHE 1F11A 3WHE1 4IU2B 4MZIA 2PO6A 3ZUCA 1OAXH 4FXLA 3HC0A 4PB9L 3CBRA 4LASL 2YUVA 4MNGE 1SVZA 1BFTA 3OM3B 5DD1L 3WTWA 1FNHA 3RL1A 3T5WA 5TDNA 3LN4A 5KN5B 2AV1A 3FPXA 4NKDB 3QCTL 1GL4B 3ARBD 3IDGA 3V9FA 3DTUB 1Q9LA 1MJ8H 4LESA 2FBOJ 3HE6C 2ODIA 1I1FA 2OLDA 3NABH 2XIDA 5DJAB 3S37H 3P11H 1V55B 2NMSA 3OAUH 5MENA 2YPVL 2NRDA 1KYOJ 2P8PB 3PQYE 2R2CA 5CMAB 1BAFH 2ED6A 1MJ8L 3U1SL 5IR1B 3PL6A 3ZTDC 3FHAA 4HUCA 4N24A 1PW3A 2J57A 5IM7B 5D7SH 5HHMD 3W57A 3MTRA 1VACB 5B38G 2EP6A 3BWUF 2VDLH 4K15A 5L8KB 4WJKB 3CXFA 3F84A 4BINA 5IVXA 1IILE 4ZUUB 2J55A 2P43B 3HVNA 2OYLA 1L9RA 1UOLA 4QUOA 2VC2L 2BNQD 1INEH 3GSOB 2XN0A 5I71C 3RIFF 3GNML 1DSFH 2NDFA 5I76A 4K3DL 4XI5C 3HC4H 2CG9X 2VDLB 3HTLX 1DBMH 3NESA 3ZUNC 4R2GD 3GINA 4NQDA 5ECJE 5HVGB 4N8CH 5D7LE 5GS0L 1UACH 5KVGL 3GUTA 1MFAH 4IGBD 4PJEE 5DZLA 4EI6A 4NC1E 5J6GB 5IFAL 1D2OA 3HC4L 4HGKC 1DBML 3PXLA 2DTSA 2M1KA 4OY9A 4PRDB 5E00B 1O9WA 5E4IA 2DI7A 2J44A 4XNZB 1MPAH 4XP1H 4G7VL 3QDGD 5EC2B 5EIIG 2QKIA 4IRZA 3UACA 4CMHB 4KI1A 4ZD3H 3UC0L 2CHWA 3K8KA 1MH5A 5TDOB 3POHA 4LSTL 5JIHA 1MRCL 1OO2A 1XF4A 1BJ1J 1CWVA 2FECI 2ZSVB 3AQXA 1CR9L 4FG4A 1X7QA 3GLDA 2WLLA 4IKLA 1VB9A 4KTDL 1ITBB 1AYRA 3GHBL 3D39A 3BLBA 4Q8BA 3K7UA 3BPOB 2XYCA 1CTOA 1M1XA 4Q9RH 1RZJH 3B7UX 1XGPB 2VKXA 3EGDB 3FQXA 3TYFB 5L2KE 3QPXL 2X2IA 1KV3A 4X5LA 1NCAH 4IDJH 4BFJA 4OCMC 2Y07L 4NRXB 1GMEA 5JW3H 2YRZA 5I6KA 2NLJB 4M1DH 1C5CL 1OEZW 2F53B 4ZO8A 2FJFB 1VZHA 1NGQL 3MV11 4YEEA 2EYTA 3SGKC 1HQ4B 2AHIA 2V2TA 5C08A 1ETJA 1C7SA 2XRAH 3FU7A 4G70B 3U4AA 3O4LB 4PRPB 3G08B 4PYHA 1JDAA 1VESA 4G8AC 1CD0A 3FO0H 3FU8A 4PLOB 3B34A 3MJ8A 5EPMA 5HPMA 4P5SA 1THAA 3OKLB 1JZDC 3L4ZA 1FHNA 5E51A 2APSA 3QYMA 2H6PA 4J3XA 2CBMA 3FRUB 3U6XA 4WUUE 3WJJA 1BZ7A 2H2SC 2HFTA 2I27N 2NY3D 1KJ3H 1N59B 1J48A 1DVFD 5KYUB 3A4FA 2W9DL 2ITCA 2X44D 1ETZA 1N0XH 1OTTD 4ZMVA 4I3RH 5DK0B 2DQUL 2BH0A 2KERA 3KYMA 4WNQA 5G5DB 4R7XA 3ULVF 1RAMA 1WGVA 1C5BH 3O3DA 2ATPB 1T0NA 1JYVA 3I9GL 3SE3C 4I1PA 2VWEE 2AQ1A 2O93L 2J1WA 4K8RH 5LO7A 5TE7H 1GGIH 2VLKE 4QTHB 3V0FA 3NA4A 3PIQA 4X99A 5IMOA 5D5MF 2VDPL 5E1AA 1P4LB 1GGIL 2VMFA 1FQ9C 2VDPB 3HHRB 3QNFA 4P4KB 5MHSD 4OJFL 5SWZA 3I6LE 3P2DA 2Y5TB 3T4AB 3ZTJH 2UXFA 2PCFB 1J87A 5M94B 5KBLA 4Z7WF 1AGBB 4RGNE 3CDZA 3QARA 5BQ7B 1KTJA 4IJ3B 4QOKB 4NC2B 4DKAA 2DYPA 3QW9A 5HHNB 3RGHA 4HJTA 1ZLSH 1JXDA 5LXGL 1CICD 1SEQH 1OWWA 3RQ3A 1SDDA 1JNLH 3PGCA 4TNEA 2GT9B 4HUUA 4LK4A 4IMKC 4OLUH 4LPWA 1FNEA 2WK2A 5I17A 3D50A 4OFKA 1YNLL 1IQDB 5D6CA 4JREC 1Z66A 1JZ7A 4PREB 4KO5A 2FHFA 5F7DA 1F3RB 1DUYB 1H3GA 2X6MA 4OR1A 2D31B 4L29A 3WMQA 3V10A 3SODB 4R83A 4PVBA 2V3FA 2FQEA 3EJJX 5E7BA 4TF4A 4GH7B 3WCYA 3TIEB 1ET8A 3DJTA 4RCAA 2NZIA 2FJHA 3V6ZB 3CDFA 3CK0H 4FF9A 1NGXA 3EFDL 1L9TA 4NO5B 15C8L 2OCJA 2NW3A 3BGMA 5EDSA 4WRLA 3CSYB 2X4SB 2X9WA 5ITFB 3RVVC 1RK7A 2WMPA 4OZFA 1VPOL 4B9KC 3NH7H 3I6KB 1AGCB 4GKZA 4N90D 4J3UA 1UEYA 1G9ML 3HC2A 4J6RL 3C87A 5EUOA 1I9IH 1HZHH 2R4RH 3I9IA 4XXDB 3MLZL 1L9PA 1V7ML 3TJEL 3KG5A 4TQEH 4AGOA 4FHKA 1FFTB 4EDWL 1HH6B 1HZHL 1RIUH 4PV8B 3BO8B 1QPXA 4HOWA 4FZ8L 2K8QA 5E94B 4L8DB 1P7QB 4PJ9D 1OGAA 1LYQA 3K71B 3FU5A 3GC3A 2BFVH 2CPUA 4GG6A 2ZKWA 3ARGC 1JHKL 3NIGB 4CSSA 2UY7A 3QZLA 4GAAA 4MRCA 5KVEE 1LMIA 3BUTA 1N10A 2APVA 2R1YA 3PWPE 5K1NA 1NCNA 4K94C 4L3CB 5HXMA 1CE6B 1RH8A 4A63A 5DT1H 5DJCB 2PPDA 2CUHA 2WXGA 4PJ8C 2EACA 1SBSH 3AG1B 1BEYH 1QFWI 4PGZA 2J43A 3BVXA 3BYYA 1CUOA 4K7FB 1JF6A 1E5CA 4WI7A 1PEZA 4K3GA 2IO5A 1QSED 1IEAA 4JM4L 4JRXD 1J9CT 2VSDA 1P5VB 5IROC 4OUOA 3IKCB 3LS4L 1BREA 2X09A 2X89D 3OKKA 3Q5OA 4XP9H 4XVUD 1JGEA 1NAMH 4G6MH 4NQSB 4TLUA 3BEVB 1F4YH 4QRQA 4TQIA 5ICZA 3ZHFA 2X2JA 3QO1A 3CTTA 3UP1A 2WVVB 4QRBA 1MCFA 4YHNB 3DV4A 5I1LA 5EBWB 1F4YL 3ET9F 5ANMB 1NAMB 3GJFK 2EIJB 1ODAA 3HJ0A 4WSGA 1HKLH 5JW4Q 4FP8H 1SLVA 2FQDA 3FUEA 1W72A 2BNRA 3PFUA 1E4WH 2VLJE 2GBAA 3PAUA 5FOBB 1JYXA 3RZCA 1DBAH 1HKLL 4ZI8A 2A6KB 3T0EE 1OAJA 3VXSA 1NOAA 4YHZL 4AWJC 3N6YA 4TUOB 4R7NA 4MXVE 3BC9A 4QAMB 4I0PB 4DPCX 4DGIH 1ANUA 4X2UA 2YC1A 1KPRB 5GRUL 2H1PH 3KYOB 1S7QB 4HHAB 1I3RB 3Q13A 5CEXA 1QEXA 4XZUB 1YEEH 5E4EB 1BIIA 3BZEB 3QIWD 4Z3FA 5DD3H 4IS6B 2H1PL 2ZCKL 4WEUD 4HIHA 2ZG1A 4YAQB 1HT6A 2VISB 5CLZA 4DP8X 1QSFD 3STZB 3V6FA 4DO5A 3FFDA 3QQ3A 4IQHA 2DRUA 1J1PH 1TQCC 4EN3D 1BYNA 4Q9BA 3QJFA 4AGQA 3RVXD 1U2YA 4K71C 2A74B 4ZMOA 5L9DL 3S8FB 1AD0A 3GTTA 4MKMA 4PG9A 4ENEC 4KKNA 2OSXA 1GCYA 4PBDA 1S7UB 3C6LC 3IGAA 4H0HB 4RAVA 5F3BA 5D7JD 1ROWA 3PABB 3SE3A 4L4VE 1OGPA 1T4KA 3DHUA 3L48A 3K2IA 5A2BA 3NMEA 2EEBA 1OK8A 4BXVA 2DYSB 3ESUF 4RX4D 2VLLA 3VFWA 4HIJA 5C7ZA 3EIFA 5TPWH 3BWSA 1HJBC 2CIIA 2Q76B 3IXAB 5BS0D 1KFAH 1A0QH 1QLEL 2I7OA 1IMHC 2VR9A 4QKTA 1QLEB 3KPSD 2FT7A 4K8RD 4KHTH 4UIMA 1OAKH 4NWTL 4CW1A 5FK9B 5TPWL 4PBVC 5T3XE 2M2DA 2Y1ZA 1FORL 4JZNA 5HYSA 1MKFA 2FJGA 1A1OB 3AMLA 3FCGA 3GXIA 1OIOA 3HR5A 3I9PA 5ESVB 3BSZA 3ZTJG 1U8IA 2XQBL 4TNWK 5JHLA 5BW7A 4KHXL 1RPUA 4O00A 1AQDA 2AVGA 3P40A 2YMXH 2A6JA 4XMPH 4YDZA 2VZVA 1PG7X 5FPIA 5KVDL 1BP3B 3ZE0E 1ZT7B 3MREA 1CGUA 3LQAL 2IH1B 5MENE 4MAUL 3W0WB 2IMNA 4JCWA 5AOZA 1A7NL 4WW2A 4Y9EA 2QPSA 3GQFA 1H15A 1P4IH 4NQCB 2FYVA 2IDTA 3D08A 3GMNA 2CLZB 3O11B 4KKBC 1IM9D 4QGYA 1MLCA 3IT8D 4PGJA 1JGLH 1GGBL 4UQEA 1NDTA 3RKPA 1FSKC 3V4PA 3HI6L 2X5PA 3JT2A 3QUKB 4JVWA 5FFOA 5KTEL 1MAJA 1YSOA 1AQKH 1I7ZB 1VZIA 2DH2A 5ID0B 3LQZB 5IVXE 1J5OL 3KR3L 2YRPA 3HHMA 1U8NB 1U30A 1UCBH 3L95A 3T77B 1EHKB 3UZEA 3VQLA 5IMLA 3A5VA 1SQ2N 2BHFA 1UEMA 4GQ9H 1BSIA 1F13A 2VZOA 2OXHB 5I19H 4ZTPH 4QHUB 3ARED 4G6KL 3J7HA 5C0BB 1XR9A 3L7FA 4NQDE 3DGDA 5KYYB 1U8OA 2WWMD 3EYVB 3WXWH 4KX8A 4UNTA 3VUAA 3K8MA 1G84A 4FL4C 3G5WA 4DO6A 3WMPA 4KRPC 2CBOA 3IGUA 1X5LA 1SJMA 4RGOL 1XT5A 1TZHA 2XU9A 4Y5XA 3PREA 4R97C 1KCSH 4XCYA 2RD0A 4JFVA 4ZXBD 3VWKB 4I9WE 3ZE1B 3M88A 1I1YA 3NG5A 2XJLA 3U4KA 3ZE2B 4M7LH 1WWBX 2KL6A 2W94A 3QZPA 4Z7IA 5AB2A 1KCSL 1KN4L 1TG8A 4GLRH 4Y2OB 4JL2A 3WN5A 1H3PH 4LPTA 4LZKA 2EADA 2FYYA 1A6TB 3QDMA 2DBJA 3KNBB 3VSUA 1OKEA 5ANHA 2IALB 1O9VA 1XF5A 4MMZA 4QRPB 1LO2H 5FYLH 5I1EH 3RB7A 4O58L 2JELL 2E7CA 2AQRA 2VE6B 4F7KA 4CNIA 3D39E 4HK3J 4UZGA 5FHAH 1MFMA 4G82A 5HI4C 1CLCA 1OD7A 2WXJA 4XBPB 4FZEH 2QGEA 3ESOA 3BKJH 3HI5H 2Z7YA 4OCWH 3CSBA 4WGWB 1WIPA 5ETUB 4AMXA 3ZSSA 1BQRA 2DL2A 4MBOA 1UWXH 4L4TA 4LVOC 1WWAX 3VJ6A 1S5IH 2YD1A 1LK2B 4N8PA 3BKJL 4Q0XL 5C08E 5IZ7A 3L2MA 4FDWA 4N1EA 3SCMD 1ZPLA 4LPXA 3AABA 1KBVA 4I0CC 1FLTX 5CLXA 4LL9A 3ULAB 4A6YL 2I07A 4A1RA 2MPAH 2AZUA 4A7GA 1XR8A 3DDGA 2EDQA 4PRIB 4IOFC 4ENZA 1XIWB 2GJ6A 4NZRL 4X4KA 1P1ZB 4LSVH 4Y4FD 2Y5EA 1P9MC 1JK8B 5ITBH 1CZ8L 4BQCA 2NY5L 4PS7A 4NRYB 5FGRA 1BF5A 1UZ6F 1VA9A 1A6AA 3MLTA 4EKXA 2ADYA 1U8PB 1GC1H 1A14H 1JWUA 3MRBB 1CC3A 2Y3AA 1MW0A 1SOKA 1BECA 1J10A 4A7UA 4G43B 2UUDK 5E1IA 2LU7A 3H2QA 4OIFA 4Z7NB 3OJ2C 3RGVD 1U9KA 2O5NA 2KUTA 2X9XA 1ZIAA 3CZSA 4LOUC 1ADWA 2F8VA 5AAMC 1HXYA 2G75B 3QUZB 3HR6A 3NZUA 4PB0H 1PLAA 1JNHB 4W93A 5DMIL 1X5ZA 3X1EA 1AMYA 3C6LA 3OXSB 4GXUM 4NLAA 4LBEA 4R96B 3RPIB 2JLPA 1CJYA 4LEEA 3TJHC 4B0MB 1QBAA 1GJIA 3FN3A 1R3HB 3B6SA 2NY2D 5GXBB 3K4DA 1R33A 5I6PA 3OXRA 1T83C 1XV8A 3T3PE 1F3DH 3EO1A 1NCUA 4P23C 1WIOA 4OD3L 4W6XB 3SPCA 4OU3A 1DN2A 4JO3H 3FTGB 1U93A 2BY0A 2Y36H 3WHXA 4GW5B 5ESAA 3TM6A 2R29L 1N64H 1HHKA 3GJFA 2VAAB 4ZJ9A 4P2QA 2H0EA 2I7SA 3SGEH 1XH1A 5C7XH 2M8XA 3Q1EA 3WAKA 2OMVA 4O02H 3VXTB 1B6UA 4M9PA 1N64L 3VB9A 2CGYA 1D5ZB 2VKWA 4JX0A 3U0WH 2WAQA 3LKPA 4L8CA 4OZHF 3NN8B 3UEQA 1TMQA 1U8HB 3M1CA 2BVQB 4FQJL 4MJHA 3UTOA 4M8VA 5C3TA 2GK0B 1D7FA