2CUAA

The cua domain of cytochrome ba3 from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
122
structure length
122
Chain Sequence
AGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CUA)
publication title The CuA domain of Thermus thermophilus ba3-type cytochrome c oxidase at 1.6 A resolution.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Electron transport
total genus 30
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 1999-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2cuaA00
1GY2A 1SDDA 1UATA 2I7SA 3QJQB 4BWUA 2VN3A 1FWXA 2MRYA 1BYPA 1EHKB 2BW5A 3N55A 1ET5A 1JERA 3TBBA 3UADA 1TU2A 4AKQA 3X1NA 2PLTA 5B1JA 2PPEA 3ZIYA 2VW4A 4M4RB 2HZHA 3S3CB 1L9OA 2XWZA 2VM4A 1XB3A 3AG1B 4DP1X 1AR1B 3GDCA 2H3XC 1AS6A 1NICA 5IY5B 3PAZA 3WNIA 1J9TA 2FNWA 4P5RA 1URIA 5I6NA 4KO7A 3T6ZA 4KO9A 3H4HA 1EZLA 2YXVA 4G7RB 5B7FA 5I6OA 1GW0A 3EH4B 2GI0A 2EIMB 3OD3A 4L0PB 1J5DA 3QJSB 3NSFA 5A7EA 1SHXA 1RZPA 3OMNB 3OMIB 2H47C 1MG3C 1FFTB 2AZUA 1ZPUA 5EHFA 2ZONA 2UXVA 1V55B 1ET8A 3FQ2A 1X9RA 2HX7A 1SFDA 2Q9OA 4DP2X 1MDAA 2XV2A 1GS7A 4X4KA 1V54B 1A4AA 2LLNA 1OE3A 1N70A 2JFCA 3EHBB 4ENZA 1JVOA 3FSAA 4ZK8A 3T71A 3NJFA 1IC0A 4W1TA 2OV0A 2R7EA 4A2EA 4BXSV 1J5CA 2IH9A 1AZNA 2JXMA 3PAUA 4KOBA 3CVCA 3C75A 3FQYA 3NSCA 1ZIAA 5I5MA 1J9QA 1AG0A 1GR7A 4HCGA 1JXDA 1E65A 3FS9A 1AZCA 1I53A 2XV3A 4WTQA 4JHVA 1BAWA 3IE9A 4P5SA 3FPYA 5B1BB 2IDFA 5FC9A 1ILUA 1OE2A 4GP4B 3ZDWA 3JTBA 5E9NA 5I6MA 1TKWA 2PPCA 4A2FA 2AANA 3SBRA 4DPAX 3T9WA 1PCSA 3UABA 3X1EA 3QJRB 2ZWNA 1KDIA 2FTAA 1T5KA 4NB7A 1X9UA 5AKRA 2XYBA 1AAJA 4G7SB 1A4BA 1L9TA 3AG3B 2PPAA 1BEXA 4E9SA 2BP0B 3OQRA 4A2GA 1CUOA 2DWTA 1GS8A 4DPBX 2YXWA 3V9CA 1TEGA 3NT0A 4DP9X 4HHGA 1W8EA 4Q8BA 2TSAA 5AFAA 1AS8A 1NWPA 2YAQA 1MZYA 3QQXA 2DYSB 2FWLB 1RKRA 4DPCX 4UF7C 1ASPA 3U25A 2IDSA 3KW8A 1W6LA 2HRGA 3SBQA 2QPDB 3AY2A 4HCIA 2IWFA 2GSMB 9PCYA 1AACA 2I7OA 3S8GB 1E5ZA 1DYZA 3NJKA 1CURA 2GC4C 2P80A 1WA1X 3CDZA 2YAEA 2EINB 1B3IA 1IBZA 1WA2X 3AG4B 4F2EA 3CVBA 4MFHA 1PMYA 1AS7A 1L9RA 1MZZA 1IUZA 3N2JA 4GP8B 4DP5X 2XLLA 1SNRA 3PAVA 4DP8X 4BWWA 1XB6A 2W88A 5B1JC 1KCWA 5B7MA 3X2QB 5TK4A 2VMJA 1SF3A 1NDTA 1AOZA 1PLCA 4E9VA 4YSDA 1F56A 3HB3B 3JT2A 1AZRA 3WI9A 3NP3A 4G72B 2DY2A 4E9WA 1PZBA 4G70B 2GB2A 3ASNB 2XVBA 3CVDA 1JVLA 4W9ZA 3TA4D 3SBPA 3DTUB 3X1FA 5I5IA 4KNSA 4NAJA 2Q5BA 2PCFA 4PCYA 3UAEA 2IDTA 4WKXA 3EF4A 4QKTA 3L45A 2VW6A 1J9SA 3ERXA 3NSDA 2Y1AA 3PPSA 1N68A 5B1KA 3NYKA 4DP7X 2FQGA 4TXVB 1PNDA 1OE1A 5F7AA 2FJSA 3NP4A 3NSYA 1NIDA 1HFUA 2OJ1A 3DIVA 1E5YA 1HAUA 3WKQA 3NJHA 3QPKA 1OCRB 1JZJA 1PAZA 3X1BA 1A65A 1E30A 2VM3A 5D4JA 2WO3B 4G7QB 1V10A 4A67A 4HHWA 4DP4X 2GHZA 4FAAB 4K9JA 3FT0A 3NJJA 3S3BB 1PNCA 5B7EA 2HX9A 2R7EB 3D12B 3FU9A 2FQDA 1ZDSA 2HRHA 3FU7A 3KW7A 2UXFA 2N0MA 2VW7A 2Y69B 1AZBA 5ANHA 1JXFA 1BYOA 3QJTB 2E86A 1WS8A 4YVNA 4F2FA 1A4CA 2TSBA 1JZEA 2A3TA 4YSOA 2OCCB 4A68A 3FPXA 1L9SA 2X87A 2YAMA 5LDUA 1CYXA 1BQ5A 2J5WA 3GYRA 4JKNA 3WNJA 3PLYA 2EILB 1GSKA 6PAZA 2BW4A 2BZCA 4AZUA 3T6WA 1ETJA 2CUAA 4HIPA 1BXAA 1FA4A 2XX1A 1OF0A 2X88A 3FQ1A 1QHQA 2UXTA 2FT7A 4GYBA 1SF5A 4UANA 1NIEA 1ET7A 1ASQA 3WG7B 3V9EA 3ABKB 5AZUA 1OCZB 2AZAA 1MG2C 4HALA 1M56B 2CALA 2QPEB 3ABGA 4QLWA 4DP6X 2IDUA 4BDVA 3NJGA 1AG6A 1A8ZA 2DYRB 4KNUA 1WAEA 2IWEA 2PPFA 2XXFA 3EH5B 1RCYA 2AFNA 3ZBMA 4PAZA 2B3IA 3BQVA 1OCCB 4G71B 1HAWA 1ZV2A 4KOCA 1NINA 2IDQA 2BP8A 2IAAC 1AIZA 1AANA 1GY1A 4JHUA 1SDDB 5PAZA 1L9PA 2JKWA 4YSUA 1PF3A 3CDZB 2ZOOA 1NTDA 1JXGA 2XX0A 5I5JA 1CC3A 3H56A 2YAFA 2PCYA 1GS6X 2BHFA 4M3HA 2VSKB 4FA7B 3ABLB 1PY0A 3FYEB 3IN2A 1JZIA 5I26A 4YSTA 4N4YB 3RYMA 4E9RA 1OOWA 1NWOA 1A3ZA 2HLEB 2QT6A 3PXLA 1OV8A 4KO6A 1BXUA 2UX7A 1AQ8A 3IEAA 3T6VA 5TK2A 2QDVA 4AX3A 2ZXWB 4A2HA 3HEIB 5D4IA 5I28A 3TBCA 1J9RA 3G5WA 4DP0X 2PP7A 1PLBA 3EH3B 3FSWA 2CBPA 1KDJA 3NJLA 2W8CA 2GIMA 2UXGA 2CAKA 4N8UA 1BQRA 1WA0X 3AW5A 2WSDA 4E9TA 2YAHA 3BVDB 1ADWA 5I6KA 2VSMB 4YSEA 2GBAA 4HCFA 3S8FB 1R1CA 2FT8A 1KBVA 1JOIA 2XU9A 4KNTA 4YSPA 3NJNA 3IN0A 3FSZA 3IBOA 5I6LA 4A2DA 1CYWA 3WIAA 7PCYA 2PP9A 3OMAB 4CSPA 3MBWB 4BWTA 4GXFA 2I85A 4YSAA 2BO0A 2GC7C 3FU8A 3UGEA 4EF3A 1M57B 4E9QA 2UX6A 1YLBB 4CSZA 1IKOP 1KCBA 2HX8A 3FU7B 2EIKB 1ASOA 5B1AB 4Q89A 4YL4A 3WKPA 5I6PA 1OCOB 3TASA 1JZFA 1L9QA 1ZIBA 2HXAA 1XMEB 1M9WA 2YARA 5D4HA 3TU6A 1RZQA 3ASOB 1ID2A 1PZAA 1WS7A 1IBYA 2CJ3A 2NRDA 2IH8A 1NPNA 3DKHA 2FQEA 1KGYE 1XB8A 3CZUB 5PCYA 7PAZA 1NPJA 2DWSA 3ZX1A 1QNIA 3NJIA 4HZ1A 4YSQA 3GXUB 2AVFA 3X1GA 3FSVA 2YQBA 1KYAA 1ILSA 3H4FA 2XUWA 2PPDA 1KBWA 3T6XA 4YSCA 2WO2B 4NERA 2YAPA 4F7KA 1SJMA 2J56A 3NJMA 4GP5B 2CCWA 1W6WA 2XXGA 4YVUA 3MX0B 4BDVB 3SQRA 1NIBA 2B08A 1NZRA 1SFHA 4GY4A 1SHWA 4YSRA 3PCYA 1NIFA 1BQKA 2IWKA 2QDWA 4E9XA 2BZ7A 1TEFA 5F7BA 4AKOA 2BP8B 2EIJB 1NIAA 1PLAA 4BXVA 1QLEB 2H5UA 3ABMB 4YSSA 2BP0A 1PZCA 2BWDA 3AG2B 1GYCA 2P80D 1KV7A 4HAKA 4KO5A 5B3SB 2YAOA 2FQFA 2FT6A 6PCYA 2XV0A 1AZUA 2MTAA 4A66A 1JZGA 3CG8A 3FYIB 3AZUA 4RH4A 1BXVA 2DV6A 3QJVB 4BK5C 3UAAA 3OM3B 1ZDQA 4AI7A 3QJUB 4E9YA 2J55A 1VLXA 2BWIA 1DZ0A 3S3DB 8PAZA 2RACA 2J57A 1JZHA 4UAHA 3UACA 1E67A 2PP8A 4AKPA
chains in the Genus database with same CATH superfamily
3L5XH 1KTDB 2DBLL 4N20A 2APTA 2WZ5A 1Q94B 2VN3A 4NQVB 4PLKC 3S36L 1CT8A 3MRQA 2Y5EA 2O5YL 4FQQA 4JG0L 1KLGA 2EZ0C 4UYPA 5C08A 1JZ4A 1GJUA 3IWUA 4DGYL 3NPSB 1MPAH 1MJ8H 4U3XA 1RPQA 2P24A 1MCOH 3VRJB 3NDZE 4KJWC 5C09D 1QP1A 2WAHA 2X4SB 2GK0A 5T33H 3GBNH 3FQNB 2CG9X 5DC9B 2IQAB 4NM4H 4JKMA 3X13A 3D7PA 4CN6A 5BS0A 5I1IH 3TO4A 2FNWA 3D05A 1JPSL 3WV0A 3NBNA 4NSKB 2X38A 3MV8D 4J4PA 4NWUL 2NLJA 3DMMC 8FABA 3O9WB 3TFBA 1YEFH 1IGIH 5T1LB 5A7EA 4ZJ9A 5D55A 1DFXA 5L7XL 4DESA 4X8CA 2X6AA 5KVEE 4FMVA 3WFEH 3Q1SL 4MB1A 5I73B 3CFEA 2DQTH 1X9RA 1H8LA 1SFDA 3S88H 3DK2A 4WLCA 3WJMA 3BXNB 1SUHA 2VQTA 1T6WA 2XV2A 3D39B 3GTNA 3QEHA 4OD2A 4TULL 4HQQL 5IFHH 4Z3EA 4PW3A 1MFDH 4OGAD 1CL7H 4AQ1A 3A67L 4W9IC 4XTRC 4F57H 4FD0A 3BW9A 4HZAA 4NQXA 3TV3H 3ZO0A 1AZNA 2JXMA 3PAUA 4D0BB 3MBED 3HE6D 4ENED 1PKQE 1OOAA 2Y1YA 4A37A 1Y7VA 4L3ED 5I5MA 1AG0A 2Z31C 1NCCL 3FS9A 3MTXA 4WUUB 3FZUC 4O2CB 1DSFH 4JHVA 1GYUA 4HWBH 1N26A 5DHYB 4MQXC 3CFMA 5GS1C 3U79A 1OW0A 4BZ2H 1EXHA 1ADQL 2ESVE 3GMRB 3IJHA 1IQDA 4PVMA 3RVTC 3ZDZF 1RFDL 3FFCD 3IDIB 4D8OA 4OZGF 5KSVA 2XPYA 3BQUB 3QJRB 4LLWB 4N87A 3BDYL 3L1OH 5D7IB 2E6QA 1AHWB 2D7TH 4Z95L 4JO1L 4MNGE 1R3IL 2XYBA 3QIBB 1HHHB 2YPLA 4HPOH 4YXKL 4E9SA 2VLRE 3OF6D 1A3RL 3AB0C 2B15A 2XIDA 3OV6A 3S96B 1K3IA 4X6CA 2E46A 2A6DB 3PIQB 3IJEA 3SDCC 4PLNC 3NZUA 2TSAA 4ZFGL 4AJWA 1RU9H 2BMKB 4LKCB 3RKDD 4ABUA 2HTKD 4POZC 4KZCA 5JDSA 3TIEB 2DIEA 5CBAB 3U25A 3MRIB 1TITA 1CLZH 2DIAA 1G6RB 1OQXA 1PG7X 3O4LE 2GJZA 1ETB1 1IGMH 1ERNA 4K07A 1ADQA 4DFHA 3FU0A 1F3RB 2C3GA 1MI5A 2I7OA 2XPGA 5D70H 1NLBL 4DGWC 3S8GB 1K85A 3QIUA 1AJ7L 1QBBA 1KCVL 4LCCC 4D94A 1B3IA 1BBJA 1XF5A 5DRWA 2IWGA 1LNUA 1KYOK 1IUZA 1W8NA 2J8UA 1GYVA 3T0DA 1Z1WA 4WVRA 2XN1A 1OB0A 1KCWA 3BZEA 1YQVH 1GVIA 3GSRA 3EDKA 5B7MA 3IFOA 2A1WL 5CILH 3TONA 5KYXA 3A6OA 4V1DE 4JQXC 4M7KH 3DVFA 3D0LB 4IRZL 4XZ4A 3SDAB 1AOZA 4QUOA 3RBSA 2VDPL 4RISH 1TO5A 4ATTA 2XA3A 3HNTH 1PBYA 4QHKI 4ANUA 4R2GD 4R0LC 3FTYA 4PJEF 4IGBD 2EUVA 3RZCC 2IV9A 1T6VN 4UTBL 4ZOBA 1DEEA 3RNKB 1W0WA 1AC6A 1ZVHA 2XWCA 5CP7B 4EZMA 5I0XA 2ARWA 4LESA 3M7OA 3O3AA 1E9QB 4HK3N 4XO4A 4EO5A 2OTPA 3KLLA 3N1QC 5AQ0A 5LGHH 2WVSA 4AC4A 1SUJA 4KK5C 1LEGA 4YDLC 1BLNA 1U3NA 1U8CB 3H9YA 5INCB 4KKNA 3N0AA 1EXUB 3I6KA 3RFZA 2RAMA 1DVTA 1NIDA 2R69H 4NM8H 4LSPH 3KR3H 4M02A 4Y7MA 4F27A 3UTTA 5J7CC 1VFMA 3QYCA 4FQXC 1KPRA 3HR5B 4JEGB 2J6EL 1GGUA 4ODWA 4GT0A 5C86A 3MRBB 3BH8A 1V10A 3KDPB 3QEQE 1P4BL 4IRZA 1FDLH 4ODVL 4XXWC 4Q6IA 4CW1B 1F6LL 4JDZA 4DQAA 1E9PB 3FCSA 2WTPA 5DRZA 5EBWB 3W0WB 2VR3A 3ECBA 2HRHA 3RPIB 3N85H 3FU7A 2R1XB 1DQTA 4WI0B 4YIQA 5G4MA 2CGZA 3W9DB 2DQHL 4HUUB 4HKZA 4NO0D 4AJVA 4UTBA 3KHOA 5EORH 4GEJA 3C5ZA 4ODTH 2FX8L 5E6ZA 1NOLA 3GMMA 1IC4H 3QNZA 4YVNA 2DWDB 3VD9A 3B43A 4LNVA 2A0LC 4KHTL 5KVGE 1C8QA 3MRDB 4EIGB 3LS5H 1DUYA 1KGXA 1OT1A 1MQKH 2GSIB 4UB0L 4AQAB 3R06A 5BUPA 3HNVH 3U1QA 1GSKA 4JFQB 3GB7A 4KMTH 4YDMA 2BVQB 3KLQA 3OKOB 3IAGC 1R5VA 2VZOA 4ZBJA 3RIFK 5JORA 3UC0L 5MEOA 4PY8I 2CUAA 4Q2ZA 3QIWC 2J6EA 1DO5A 2NY2D 3FQ1A 4ELMB 2UXTA 5KBDA 1D9KA 3UTSE 5IOPB 2VJ0A 5IG7B 3NRQA 1ASQA 2Z6FA 1NANI 3O3DB 5IFAH 5EF2A 4H8UA 4A63A 2PO6D 1FNGB 4ZX5A 2QSVA 1JPTL 5IQLA 1KJ3L 5IM7A 4HU2A 4FFWD 5CLTA 5B8CC 2HYMA 4U1MA 1T7WA 2PTUA 3DGGA 3V5KA 1M7DA 1JGDA 1RURL 2F53E 2BM3A 1OCCB 4KOCA 5HJGA 1S7RB 3GRWL 3QXUA 4EIZC 1NINA 4PGEA 5KWYC 3S37L 4OFDA 4PH8A 5C0RH 2VRKA 1I7TB 2HFGH 3IK2A 1DJXA 1XZWA 4HIHA 3BSHA 3IS0X 1JGVH 1SDDB 4X6FB 3I2CH 3Q8FA 3KLAB 3EO1A 5KYWA 4XC3H 3CWGA 1JPST 3S34L 4HS6A 1IC1A 1Q9OB 2PW2A 5GJSH 3REWA 3N44B 3WFDH 1JZIA 2QR0A 3E9UA 3DVGB 3LEYL 1V3LA 5AVTB 5EO0B 1A3ZA 1GHFL 4MAUH 3SDDA 2NR6A 4GO8A 2ZXAA 1KJ2B 1YYCA 4QXUL 1KIQB 4O2FA 3EJTA 2PYEB 3EGXA 3DROA 2EEAA 5BS0D 4X98A 3AREC 4NKMB 3GSWB 3RBGA 4GMSH 3TTSA 5ADOL 1WO2A 3CSBA 1QATA 4TTDC 5FM5M 2IBGA 3VGBA 3GRWA 4J4PD 1NBYA 2W8CA 4Q4EA 1KEGH 1MFEL 1A5FH 5K5YA 3JV6A 5LQBL 4WW2C 4ZFZB 3JYCA 3VW3H 1MAJA 3AW5A 2QJDA 2IDCA 3CLEL 2ADGA 3BVDB 3C87A 4IKJA 4JFDD 4TNVF 5LNEA 5GS2H 1XIWB 4WKZB 2AQ1A 2GBTA 1GZHA 2HWZH 3ROLA 5F3BA 3BAEH 3JV5A 4W9CC 2HG0A 2OMBA 3QZOA 1YMHA 5L0QB 2X5PA 3VD2A 2N7AA 4N1CA 1H15A 5ESVB 3FW6A 3MSPA 2JNZA 5I6LA 3P11H 1ZGLB 5HGGS 4P4KA 5AB1A 3DYMA 4XXCC 5TQ2H 3SQOH 3KLHC 3I6LD 4K3JH 4UTAH 1B0RA 2BOBA 2NY0B 4CSPA 1OGPA 4XP4H 2WQSA 1G7IB 3GIZL 4HC1H 3ZL1A 4NHCH 5IJKC 3MLTB 2DKMA 3PWPA 2QBWA 3HI5L 4OLEA 5IF0B 3ARTA 4IMLA 5DEGB 1HKFA 4F37F 3ZE2F 1CDYA 1TJGH 4BK8A 1E4XL 4TKWA 1T3FA 3UZVA 2Y07L 5I6PA 3TH2T 4WWKC 3ZXAC 2XTLA 2VMCA 5JOPE 1XMEB 3TU6A 3EYFA 1IAKA 2O5XL 4HH9A 1IILE 4H26B 4MHHG 3FTZA 2MEJB 3LN5A 1EV2E 1MRDH 4AWJC 2DLTA 1HXMB 4GG6A 1U93B 3QCTH 5EU6B 3BPNC 2AJXL 1KB5B 3WENA 5GS0C 1V7MH 4NKOA 3FU5A 4FQ1H 1E40A 2VDNH 1VCAA 2AVFA 3IAQA 1WEJH 3AROA 3FSVA 4G5ZL 1GZQA 4R7XA 3ILPB 3GTTA 1WUZA 3FAWA 3LNFA 4XCFL 4G8AC 4OH2A 4XC1H 4EI0A 5GGSY 1UQSB 5F9DC 3BKYH 3SJVA 3L13A 1Y1UA 1UD4A 1YPZA 3FO1B 4NUJB 1INDL 2HFEA 4QXVA 2CDFA 3P73B 4YE0A 3STZA 3LDBB 4W9EC 4MCNA 2B1OA 2E47A 3OGOE 3KJ6L 4ATWA 3WDIA 4Y1TA 5D7HA 1UA6H 2J6WA 5HHXL 4QPEA 2ID5A 4QYOB 3ZOAA 2WC7A 2OMUA 3MLYH 2UZIL 3WN5A 3SYPA 1R19A 5DMIL 2OYKA 1V27A 1Z3GH 5C0IA 2A6KA 1LP9E 2GY7B 3J27A 4Z7OE 2EKSA 3DJZA 1A4JA 1S7WB 2H41A 3Q1EA 3QIUD 4OQTL 5C0AA 2FQFA 5EC2B 4AEEA 2MHAB 2AK1L 5DVNA 4GW5A 6PCYA 5F6IB 1VRSA 4OCMC 1EQWA 1LM8V 4OJDH 4YDVA 1AHMA 1TEYA 4RH4A 3PU7A 3QQ9C 5JTWA 4PJFF 2JKJA 3RNQB 5AAMA 4AI7A 5I1KL 1SMAA 4MAYC 2BWIA 4UNVA 4OFPA 2R0KL 5CHNA 3FK3A 3GSNB 3WJJA 2VE6B 4M3KB 3BVNB 1KEML 2WOBA 2CU9A 2W0LA 3ARYA 7TAAA 3DXAB 4QRRA 1UATA 1BBDL 5HGAB 4H13C 5DUML 1DQVA 1MW2A 5FV1L 2AQSA 2GEQA 2R2HA 2H1LM 3ETBJ 3HUJA 3N55A 1OXYA 1FFQA 1T1YB 2YGPA 2CPCA 5SX5H 1I3GL 4MDJA 2GT9B 1A47A 2ZYRA 1NGQL 5E56A 4PUBH 4X9IA 3ZQWA 1E4KA 4YAQB 3T0XA 1XHHA 2JCWA 1AR1D 1MFCL 2EDEA 4OQTA 4PJGF 4PJ7E 4L4VE 3C09C 4D3CL 3WS6A 3CK0L 3O8XA 3RWIA 3I50H 2MKLC 4YHOH 5CGMA 1FZKA 5EDXA 5KS9E 2EUWA 4JREB 1QBLH 3UTTD 1IJNA 4N3TA 1FYTE 3A47A 2MNJB 5F9AC 3DX9A 4ODSL 4XP1H 4AJYV 1QLFA 5HVWA 1JIBA 3RL1B 3PWJA 3VXPB 2MPVA 4HS3B 1D6VH 5T1KA 1FFTB 4XNQA 4YFEA 4LU5H 2IQ9H 3DUSB 4MA8H 4ZO9A 43CAB 3NPZB 5IQ9B 5KVEL 4N8VG 1NGXA 2A5UA 2WLZA 3C5ZD 1JK9A 2H2SC 1ZVNA 5DD6A 2A38A 1C5CL 3CZGA 3V0HA 3MRCB 2C9UA 3BT2H 2QADD 4LCUB 5CGBA 4DGVL 2NY3B 5K9OB 5E8OA 4XODA 3WUWA 4GB9A 5IROC 1SVCP 2FGZA 1OANA 4WI3A 4X5RA 2WIMA 1ACYH 2R2CA 1A2YA 4KK8D 5C8JA 2X0UA 1GYWA 1IAIL 1KMGA 3OR6B 5J57B 3ZMEA 3ZTDC 3JWOH 4HKBA 1IGJA 1OF2B 1P2CA 2IO5A 4Z0BL 4PJXF 4R3SA 1ZE3C 4IDJL 3MRRB 1WICA 5AWNL 4Z18A 4XNUH 2VLKD 4RFEA 3SKOA 2GJPA 5B39B 1HWHB 2FYYA 1DSYA 3QQDA 1I9IL 1NMAH 4KHXL 2LOEA 3K7UA 5E5MA 3MOAL 5K39B 4OCRH 4Y4FC 2BSBA 5CCHE 1D9KD 4JM4H 2CIIB 3L1EA 4P59H 4WTQA 4QD2E 4QIRA 3H2WA 1FL5B 3RJDA 3BYTA 3RUGE 3MRJB 1I9EA 2YKLL 2WBJA 5JQ6H 4AGLA 3ZDWA 1JAEA 4WTZG 1QBAA 5DJXA 4LPUA 3ES6B 3ZVVA 4NQDB 1G9EA 3TVMB 1G7QA 1XGYH 2ZSVA 1T5KA 1YMMB 1X9UA 2M83A 3CLFL 3ULVE 1VFOA 5JO5B 3T4AB 1S7XB 3VRLF 1UOVA 3T3PF 2WCSA 4YXLL 2OW7A 3ZY7A 5C9JB 3ARZA 3UYRL 2OMZB 2M2DA 4R4FH 3MA9H 2WLYA 3DO4A 4GI9A 1IIKA 5IJDC 5JZ7C 3FQXB 2NXZB 4RMBA 4G7YH 1PKQA 1FZJA 1AS8A 1WAAF 4GO9A 2YAQA 4L48A 3SGDH 1A7RH 1C12A 2OMYA 4IIQB 3OKKB 1F86A 1UZ8B 2GIYA 5DVKA 3U4AA 1RKRA 4DK3A 1ASPA 5C0BB 4J3UA 2EDOA 3TBSB 1CICB 3MRHA 1MFVA 3H3PH 3SDDD 5I66A 3SBQA 4FG4A 3QT2A 1ORQB 2K4WA 2GG1A 3UXFA 3HI6L 1G5GA 1A6WH 4HJ0C 2ESVA 2ZT9C 4P48A 4MVBC 4DKDC 1GL4B 2WLHA 3NJKA 4UM8B 2DQFB 1H9DA 1M05A 2UZYA 1A1NA 3FQUA 3AITA 5I0DA 4KDTA 4YWGH 1VGEL 3LN9A 3QXAA 2WTOA 1ZLUH 4CVXB 4CNIA 4G9DB 3NG5A 1CF1A 5D1ZB 1QW8A 1SNRA 4LL9A 4MNGA 4LLQA 3MRNA 3G9AB 1GZPB 1HC1A 1MCRA 3IFPB 2VLRA 3OKMB 4RDBA 5AEAA 4M5TA 5KTEL 1WD9A 3AY4C 4YE4L 4GW1B 1PLCA 2B5IC 4Y4KB 1R3LA 3V6OE 1I8AA 4FYRA 5DHEA 4JUTA 4GEIA 3I9AA 5MENB 3ARGD 3G5ZB 4P4KD 1JF5A 1NM4A 2DLEA 2EXYD 3QWNA 4WU7B 5D7JC 4NENB 3UBXB 2AQNA 4FNSA 4P2RE 1NLDH 3QO1B 5DHVA 3CVDA 2E8ZA 2VDQH 3OPZL 4NQTA 3VU1A 3DVNB 5T33L 3SBPA 4NM4L 4QRSB 3PWPD 5BZXA 2YBRB 2Q5BA 3HBGA 3LH2L 3O4LA 5TF1H 1BAFL 4BHUI 5DJDB 3POHA 1OLZA 1Q9LB 5KBPA 2A74C 1BF5A 4LFHD 3QPQD 1R3KB 1QSEB 4JRXD 3G9VA 4PTUB 3ZHNA 5I71B 2J5LB 2P1YA 4M6NH 1A4KA 1IT9L 1JNHA 1DJHA 5CJXC 5HGBB 3WFHB 2YD2A 5MP6H 1YEFL 2YQGA 5BPPA 1X3DA 4I87A 3VCLA 2B39A 4RLDA 2IG2H 2GCYA 4BZ1H 1E5YA 1AY1L 3NJHA 4IBSA 2KI6A 4NIKB 2CLRA 2VM3A 2WO3B 4HIQA 1QSFE 3LKSA 5F7WC 3GNML 1YUHA 4R5XA 3M1CA 4V1DA 1KUMA 3OWEA 1FQ9C 2H32B 3HLAA 4HVBA 1KPUA 3PQYB 3VFSA 4KI5D 5A16A 2E5EA 2CBMA 4AENB 2HJKA 3GF8A 4IOIA 3TO2A 4KXAA 4U1SB 3I6GB 4CC0A 4O4YL 1E42A 3BO8A 1U4EA 3QNYB 1JXFA 3BLPX 2K7QA 3O0RL 4MCMA 1NC2D 3IF1A 4F57L 4Y2LA 4MQ7B 1WS8A 3HKZA 5IJVA 3B2XA 1S7UA 1X5HA 3SJVD 3X14B 2WINA 4KJPC 1F3JB 5KVGL 4A68A 3MACH 2E59A 5D4QA 5EBMA 3B7SA 5DK3A 4I88A 3HG1B 2R2BA 4IHBA 3EH2A 3MLZL 5C07E 2XZZA 1J1PH 2EYRB 2J4WL 3ZKXB 1RZIA 2FZ3A 2R9HC 2BXZA 4XVJL 4Z5RA 2ZUUA 1IBHA 3QA3A 1SBSH 2XX1A 1MHHB 4EDWL 2CPUA 2GYSA 2FLBT 1K6QL 3V0VA 3QEQA 3DOIA 4CVWA 5KUKA 4K8RD 3OKNB 5C0AD 3M46A 1FVEB 4Q6KA 2AZAA 4DKFH 4NCC2 4BQBA 3L1GA 1RUQL 3BJ91 5F1SA 2K6WA 3RX7A 3H42H 3MUZ1 1AG6A 4FRWA 5SX5K 2XZAH 3F83A 4QRPB 3EH5B 4NQEB 4B9JA 3SCMC 3PDOB 2LGNA 5FKPB 1CE6A 3KLKA 4WV1A 4F7MA 1EDYA 1DLHA 4PLOB 1QFHA 1AIZA 3DDGA 3U36B 4PD4K 1T2QH 4B7LA 5IQOA 3APDA 1T2XA 4RRPM 1HWWA 5E5UB 2R51A 1SDAB 4QRRD 4L4TE 2O5ZL 2ZX9A 1RJZB 3S48A 5DC4B 4Z8FH 1IGML 1EHLL 1CLOL 3LEXB 1HKLH 4IDLA 4CMHB 1DVFC 5TH2B 2QV4A 3EW3B 1DL7H 1AXSA 1DDHA 4PJEB 2GSGB 3GJEB 3FUNA 4LEXH 5LLIC 3LMJL 3HFFA 2FBJL 1N59B 2V7HB 2F61A 1JDCA 5ITFA 2VISB 3DJRA 2NSXA 3UTSA 1OTUC 1LQBC 3H7BA 4KK9D 4F7TA 2DOCA 2DRUA 1JWUB 1FVDA 3O8XD 4MS8D 4B50A 1EDHA 4GIOA 4NZUH 2WB7A 4DP0X 3HZ3A 4PJHE 3T1FB 2DLFL 2G75A 1U8PA 4LSRL 1EJOH 1FFNB 3FRPA 4J39A 1C5BL 1X6LA 2WNKA 3CZSA 3MFFA 3N1GC 3QUMB 2F53A 3HNTL 2DQIL 2GIMA 3NA4A 3NIFE 2CAKA 5JHMA 1WIPA 1NGZA 1ZEAL 1NCUA 5KOMC 2H0JA 1PZ5B 2YAHA 4BRVA 4PRBA 3TC9A 4RMSA 3LXCA 4QRQB 5DD3H 1MWAH 2ZKHL 3KDMB 3KH4A 3VYPA 3KYKH 1PYWA 4ELDA 3C6LA 3LRGA 2AXFB 1EZVX 3U0TB 5JMRA 4MSWA 1CDCA 1X9LA 5EU4B 4KZDH 3FSZA 5GZNA 3V79C 3ROOA 1E7VA 5IJBC 4FNLH 5HSFA 1GGBL 3MBWB 4ANVA 4N9GB 2CUIA 3REVA 1FC2D 2D9CA 1U41A 3ECQA 5JPNA 2WYIA 2NSMA 4JO3L 5DS1A 2QL1A 3ME0A 4OZHF 2IGFH 1IKOP 2HPOA 1XZ0A 5IIEA 3GIVB 3P3YA 4GKSB 3A5VA 3MYZA 1JFHA 1TZOA 4H0IA 1JF1B 3KJ4B 1ID5I 1YNKH 4G7VH 5J9PA 1R5WA 3CX2A 3KPQB 5HYSG 3T2PA 3K2UH 4YLQT 3N85L 2ZJSL 2HXAA 4WGWB 4Z7UB 3VFUA 1K2DB 1RQ5A 1RZQA 3LPWA 5CLZA 3VH8G 2VXTH 2WBJD 4GNKB 4KKQA 1PZAA 2H0EA 1IBFA 2F5AL 1Z5LB 3VXNA 4FULA 2JMRA 5HYQA 5ES4B 1CI5A 2FIRT 4QI3A 4OGAC 3ZE0F 4RGOH 5FEBA 4AITA 1TQUA 4AM0B 2B4CC 2Y0SA 4P5TB 3KVDD 3L2MA 3MBEC 3HE6C 2X2YA 4ENEC 5INDB 1VGKB 3MOQA 3MREA 1MNUL 3H4FA 3O41B 3TBYB 2WQRA 2YXMA 4XX1E 2Z4QB 3M8OH 5D1QE 3T8XB 6FABL 2DQEL 4JANB 4NHUA 3LX9A 4FXGC 3SDYL 4PGZA 1R3HB 5DMYA 4BFEA 2FWSA 4KKBD 3BVWA 4U4IA 3GXMA 2ADFH 4M6ML 4XN4A 2F58H 1I31A 2B08A 2VAAB 4HJSA 4LRIA 2YSSB 1SHWA 4Y5VC 5I23A 3PCYA 5E5RB 5IOKA 3L3JB 4HT1L 4LPTA 2ITDB 4PJIB 2IFGA 5F7BA 3B1TA 1UM5L 3AABA 3EGDA 3VRIA 4M3JA 4N2AA 5AOIA 2ENYA 2HJLA 2ESVD 4OGZA 43C9A 3VM7A 4WY7L 4GAYA 3QWRD 1Z9PA 4G1EB 3D34A 2VDKB 2BSTA 4NRYA 1NC4A 3EFFA 4A7GF 2BH0A 3OLGA 3QRBA 5JDJA 3UCQA 1RIVL 1KENH 4F15C 3VVWA 4LSTL 3MR9B 3GKZA 1P7QB 3BAWA 3VWKA 1JGVL 4AQZA 2DV6A 3FH5A 2YQ3A 3P4LA 1S9KC 3RKDC 3LVEA 2HTKC 3QWQB 3ASWA 4K23H 3LAFA 5DMJB 2VH5H 1M2OA 2UZXB 1ZSDA 1MIEL 1M71B 2NYZA 2QFPA 1BVKB 3LEVL 4WDIB 4OM0L 4I89A 2K4AA 1HHGA 1U8IA 3VGFA 3NIGF 2VDMB 5HYJE 3ALWA 2WLLB 2A73A 3TWCH 4GRLA 2EVJA 4JN1H 4MAUL 1RZFH 4OF7A 1UH3A 2Y7QB 2Z8SA 4XGZB 5GZOA 4D8PB 4LDEB 5F7EH 1RL1A 4WJ5A 4H88H 2IXQB 5DQJA 4G6MH 3CN4A 5AVRB 3BVVA 3HMXL 5E8NB 4BFNA 3MNWB 5B1JA 3CVHH 3SKMA 2Y1VA 3LNHA 5A6MA 2X6UA 3B5TA 1LP9A 3TS8A 1IAOA 1N9PA 4BE6A 1NCTA 4NKDB 3T2QA 4WGVB 2FJGB 5K9KA 2DQDH 2HJFB 3TCXA 1TCRA 4GW4A 2JK5A 3T8VA 2ZUSA 3RWEA 3L7EA 1T5XB 5F7DB 4R2GC 5ETUB 1LEKA 5I16A 2VR5A 3HN5A 4IGBC 4MQTB 5F44A 1HHJB 3BAEL 3P2TA 4JVWA 5EOTA 4YHLH 5C6PB 3VFVB 2MIZA 4GO6B 3GI8H 3G6JB 1WPCA 3IBEA 1HWGB 1C5DA 4AEHH 2BVYA 3P9WB 4UM9D 4V1DD 1XF2B 4NZDA 4HV8A 2XFXB 5G55A 3IE4A 1KT2B 5F89A 1J5OH 5KYUA 3BHBA 3NZSA 2QKIB 5I15L 4PG9A 4NUGH 3U48A 2A6IA 5AVVB 5H94B 5ID1A 1NA8A 1OWWA 2P8MA 2JLPA 3DURB 3P2DA 5LB1A 4HPYH 1VZHA 2I9TA 1I82A 3HMXA 4KBPA 1MDAA 3LS4L 5AAWC 1A4AA 2HAZA 1XH0A 2DL2A 3C2AH 2CDGB 1N70A 1BVOA 2DW5A 4FADA 3SGKA 2OX5B 3T71A 3X12B 4PJ7A 2HMID 4L4VA 3OZ9L 2F7RA 4P06A 5J6SA 3WL9B 1WYJA 5KS9A 3PV6B 3RX5A 2XIBA 2X4NB 4AMKL 3OJMB 1WGVA 4UILH 1XXFC 1FYTA 3QCTL 2BNUB 2W9LA 2OI9B 1JXDA 1OPOA 4I9WD 4PS3A 4YLCA 5F9JB 2A2QT 3QEQD 3FHAA 1RJLA 2IC2A 1MSPA 4FQ1L 3VYNA 1J0YA 1G9MH 3IXTA 4JQVC 1BWWA 4JR9H 3B4NA 1UZ6E 4GLRH 3T5WA 4ZMNA 4LKXA 4C56E 5H35A 5A7BA 2PETA 3BIBX 1IRAY 5FCUH 5E70A 4Z7VE 2IBBA 4XPFL 4DPAX 3A6CL 2X6VA 1PCSA 1RJCA 1AQKL 4IBQA 3UABA 1UM6H 2GITA 3BKJL 1T7ZA 2RTTA 5DSCA 2J88H 2CKBH 4LAJH 5HDBF 5EF0A 3ULVL 1YDPA 4UQ2A 4L1SA 5DEFA 5CZKA 4R4BB 2NY2C 3BP4A 1BEXA 1EAOA 3C8DA 3WNPA 4JPKH 5F21B 4EKJA 4PJBF 4QGYA 2JB6B 4U1IB 3VB9A 2CGRH 1I9JH 3O6FA 3MX0A 1E0OB 2PO6C 3ZDXB 2Y7NA 4XP9H 3BISA 2YA1A 4AGOA 3AXLB 2XV6B 4N2NA 2WYZA 1G1OA 4L8BA 1ZK5A 3OKEB 4FFWC 1U8LB 3BPOB 3UAFA 3TIDA 2A9CA 3UTSD 1FL6A 4U49A 2NDGA 2NXYB 3AXHA 3QS2A 3SE8L 1A66A 3NFNA 2IWFA 4XRCB 3RUGA 3KWWB 3GMOB 12E8L 9PCYA 2OYMA 4P2QB 4Z78B 4WJG3 3CDZA 4PJGB 4YDNA 1PD1A 4F33B 3QCVL 4CVZA 3AG4B 1R0AH 3TL5A 2F53D 3GEFA 3KPRD 2FH8A 4H40A 1BFVH 1V3JA 1KLFA 3FO0H 2Q7AA 2XLLA 3L4UA 4OGQC 4NP9A 1T1ZB 5IHLB 3LQAL 5TK4A 3DTDA 1TVHB 1LXMA 3GI9H 4A6YL 1NDTA 1X4XA 3S4SG 4YMPA 4J28A 4M93B 1X44A 2NZIA 4TVPH 2HVJA 1A6ZA 1SJXA 1LO2L 3DRQB 4PUBL 4U2YA 2IANB 1QWHA 2CGYA 4PV9B 3GMNA 1P7KA 1N2RB 5CEYA 1HYRC 5CUSL 1IVTA 5E6YA 2ARJQ 4P23D 5KW9L 5K1VA 3QPXH 5BUGA 1TG8A 4YHOL 2LU7A 4J4PC 5J1TC 4PYGA 1QBLL 1MW0A 2PCFA 3BKCL 3FH8A 4PG2A 1EA9C 3H9HB 5EEYA 1H3PL 4JB9H 3UJJH 1ZA3B 2I26N 2R4RH 2XWDA 3COOA 5EOCJ 4H20L 3VMNA 2VLJE 3IJYA 3PG2A 4PJXB 1XCTB 4L1BA 4XN8A 1CFTA 3ISYA 2YA0A 2K9UA 4ZUSB 4QXGL 1BEYH 3PNRB 5LNGA 1A65A 3R8BB 5CEXB 1FLRL 4G7QB 4NAQA 4DKAA 4DP4X 3MJ7B 4A6YA 1BZ9B 3GLEA 3JVGC 4NZRL 5IKCA 3S3BB 4ZQTA 5IMKB 3VNYA 4PGBB 4YBLC 5CCGE 4RIRB 5J3HD 3V6OA 4MXQD 1N5AA 2OMWB 1QRNE 3M7FB 4LCWB 1ZDSA 4RZCB 3JWDH 1Q0XL 3ZE1B 3IJSA 3BLKA 3MRLA 4PGDA 1GMIA 2ADIA 5I1GH 4PJCE 1BYOA 4P2RA 1DQJB 4CJ0A 1BQHB 2E86A 4U1LA 1RK0B 1YQ2A 4MJ6A 3DI3B 3EYOB 4LLVB 1B4LA 4GH7B 5GS1B 2NUPA 3G6AA 2GBVA 3V5DA 1DDTA 2OCCB 3GHBL 4PWIA 4ZOAA 1OW0C 3T3PB 1DBKH 3P9LB 1QLEL 1F1AA 2ZP0T 3I02A 4NNXB 3PLYA 4TTGA 1DQLH 2APSA 3QG6B 2BRQA 1XEDA 4P3DB 3WEXA 4Y88A 3RRQA 1RVFH 5MEQA 1PZ3A 5JOPD 3HJ0A 4LSSH 3X3FL 5I17B 1K3ZA 1FA4A 1J1XL 1FYHB 2VJ8A 1FL3B 4GYBA 1QSFA 1QABA 4NJAL 2A7BA 4RFNC 3AB0B 4FKKA 4WK0B 2PTTA 2WXPA 3DX7B 4MWFB 4KC3B 3R0MA 3K6IA 3RWHB 1IGTA 1K72A 1N0LB 2WNWA 2WV3A 2XY2A 4KX9A 5TTRA 2NY6D 4ZMWA 1E8YA 2CALA 4FQJH 4TOYL 3SDCB 2OJEB 4DP6X 5C6WH 2ZZUT 3L3IA 3Q5OA 2JIXA 2H26A 1S5IL 2IWEA 5AW3B 3MNVB 5LXGH 3MOBH 1J8HE 1R3JA 1I4FA 1RH8A 1I8MB 1HAWA 4WO0A 1JPEA 1Y0LB 2YWZA 3BH9A 3EO0A 3FCUB 2JV6A 4G2AA 4TMPA 4UIKL 1AGBB 3SE6A 1G6VK 1NBZB 4J3TA 4QOKB 4S10A 4LARL 1CGUA 3H53A 4HUNB 3LD8B 5F97E 2JKWA 1S7VB 3G04A 2VDLH 4MMXA 5C07A 3QIUC 4LCCB 4QWWD 5GZOD 1I8LC 2J8OA 3H1ZA 1A6WL 1RXLA 5AOJA 2ZUXA 1CD1A 1ODAA 3QDME 2BSSA 3RX8A 3ABLB 5L6YH 5IHZB 1QMUA 1I3RB 2AABL 3PGCB 1NEZA 3MLWL 3B2VH 4FQHB 4PRHB 4XMWA 5SX4I 3UX9B 5D9SA 4KITB 1A7NL 3PXLA 3DGCR 4I18C 5D7KE 5FA4A 3FN9A 2JCCF 1AQ8A 5DK0A 3O2WL 3T6VA 1BVNP 4R6UA 3IDUA 5IW6B 3WUZA 4R0LB 2WYTA 3RZCB 2GJRA 1RPUA 3MLRL 5IP4A 3WTYA 1X9QA 4TVPE 5DMKA 3PWVA 4YNYB 1QPPA 2UXGA 2XTJE 4PJ6A 3SQBB 2IH1A 4NN6C 5BRPA 1UURA 3IXAB 1CF8H 2XG4B 4ZXBA 1M7IA 3I74A 4JS7A 4KJYA 2FVNA 4HCFA 4M4RA 1D5IL 4AMXA 5BRZE 3INOA 4XO8A 4L4TA 3WAKA 1AR1C 1YNTB 5TF1L 4HK0A 1YEJL 4KRNA 1ROWA 1JVKA 3ZKQD 4N1EA 4GBXD 2G2PA 5IHHA 5IQNA 1R17A 1M6UA 3RFZC 3CIQA 2Z7YA 4FQXB 1ZTXH 4HSAC 3GHEH 1HH6B 1X5ZA 3KAAA 7PCYA 3LKPA 5DC2A 1BZ7A 1JK8A 1YUKB 4GSQA 1WT5A 3EADA 2HFFA 2IG2L 4CA4A 3KXFB 4OB5H 5HHPA 5ACLA 1TMQA 4LEOB 4Q6IC 5EZJB 5AW6B 1G7MB 2OBGA 1M2VA 2VYRE 4NLAA 1U58B 3MV7B 2EIKB 3HNSL 5EH1A 1AGFA 1A7PL 2V4LA 4PJHA 3NOIA 2ROXA 3AQXA 1TFPA 2CBOA 3FTGA 4I4WA 2R4SH 1Y6MR 2WVVB 4LBEA 1XO8A 3C5ZC 2V7NB 4DKEH 4RAHA 1FG2A 1L9QA 2QADC 1TZIB 3QRFM 3V8OA 2R0ZH 1F4AA 1BZQK 2AK4B 2VABB 3DV6A 4M7ZC 2GPZA 1UTDA 5CM1A 1X5YA 1QR1B 3BGMB 3Q01A 4DZ8A 4G1MA 1S3RA 4QF1B 4RFOH 4KK8C 5KZCD 3JTSA 3MMEA 1C08A 3PP3K 4JFHE 2X4TB 3F58H 1KFAH 4YJZL 2RJMA 1V8HA 4DGUA 4NQQA 4H8WL 1I8IA 4QTHA 1U8HA 4Y8DC 1FSKC 5F88B 5C7ZA 3QIWB 1NBCA 3GZPA 4FG6D 1J1PL 4Y5XA 2A83B 3L3DB 3BLBA 1D9KC 3KBHE 1SJMA 2DMGA 3ESVF 3IRCA 5F8QC 3VFMA 3O6FD 1SBSL 3MRPA 1T1WB 3CFUA 1G9HA 4K7PH 4LMQE 4UINH 2VQ1B 5T3ZE 4JFEB 3SQRA 4KKRA 3QJFB 5E6SB 4WI8A 1JCKA 2YIHA 3K46A 5B8CB 1URLA 3WS3A 4H2AA 2AKRB 3IPFA 1AO7B 5FDYA 5DJCA 4K5LA 4DKFL 5I8OL 3U2SB 1GGCL 1TEFA 2ARJB 1EEZA 4AUYA 1LK2A 2IH3B 4PCSA 4P2AA 4LASL 4E5XB 1UH4A 1MVYA 2OSLA 4GQQA 5KVFE 3MLXL 1KJVA 1WBYB 2GW5A 1CS6A 4KTEH 4UDTB 1D7CA 3P0GB 1O9WA 4I85A 4ZD3H 4JPIB 4N0FA 2CK0L 3P0VL 4OJFL 4TUUA 3ULVD 1LQSR 4WEBL 1JNNH 3AM8A 5IREA 3KPLA 3DX6B 3NACL 1D5BB 1UYWH 2PCPA 3QFJB 4QKXB 5EU7C 3ZZ1A 5D1QA 3IMBA 2FK9A 4L2LA 5BCAA 5ILTL 1U8OA 3SDDC 4PRID 2XN0A 4NRZB 4JFZL 5TDOB 1MCHA 5C0CB 1FV1B 4LEXL 1MREH 1GMEA 1MF2H 5C2BL 5IVXF 4UAHA 3V9FA 3HHRB 1F0LA 4OD1L 4BQ9A 1E4XI 4OCWH 4R8WH 4IHOB 4BSWA 1T22A 4QO1B 5HD8D 1ET5A 2Z92B 2W91A 3UADA 5IB1B 2R0LH 3QUYA 4Z7QE 4J6RL 4WW2B 4AKQA 1JZ2A 3ARDB 5AVWB 1EZSA 2AJ3A 5BZDA 2GUOB 4CUCA 3WFCH 2EC8A 3JUYA 3D2TA 4XO3A 4LLAA 4YHMH 5DO8A 5EBLA 1IEAA 1T5WB 2Y06L 3L1FA 5I1DA 1OAJA 3PAZA 4HJJL 2EE2A 2VLLA 3NGBC 1THAA 2R56L 5G5DB 1KYUA 1XX9C 2YOAA 4K7FA 3W1ZA 5CJ5A 4CSSA 5EEUA 3CN1A 5GGUA 5F0JB 3ARGC 4P4KC 3U6RA 1F58L 3ZDYB 3QNXA 2EXYC 5F8RC 1KV3A 3TNNA 4N2FA 4NWTH 1DN0A 3QORB 4OLXH 2RIKA 5AG8A 3BZFA 2XG5B 4KZDL 3ZZSA 3ILDA 3VXRB 3WTXA 3PHSA 2L3BA 1JTPA 4TQHA 4RGNB 4PV1C 3Q44A 1VADB 3QPQC 3HAEB 1UXSB 5ALBH 5HYJA 1BIHA 4HDIB 2WWMD 2A9BA 4JY4A 4NO5B 3CGTA 2X09A 2JELH 2APXA 4NNYB 4LZKA 1AGCB 1KCUH 3ELAT 3KVQA 4P2RD 15C8H 2IGFL 2WBXA 3ZRSA 2ZNXA 1F6FB 5B38G 4JCLA 2ENJA 5KYNA 3BFQG 1U8KB 4DN3H 4ZMXA 2F19L 3ARBB 2WWNA 1EWHA 2ED7A 2P7TB 3GSQB 2FECL 2WQAA 3FSAA 5B4MC 5LNDA 5BV7H 1HSBB 3W82A 4GT7A 2WXMA 4IW4C 5CR1A 2EDYA 4KI5C 2Z91A 1SQ2N 1MWAA 3C75A 3VG0H 1VAHA 1O6SA 1QASA 2RD0A 1LK3H 3VH8A 1AZCA 3RGVD 3U4BL 1KG0B 4O5LL 4FXKA 2XV3A 4OY9A 3F12A 5DR5L 5FWQA 5B1BB 1SVZA 3UTZA 1MVUB 3UDWC 1F3DH 2DQ6A 5I6MA 1XCXA 3CSFA 4M8VA 1BVLB 1U92B 2JIXD 4TM9A 1LD9B 3V4VB 4LLDA 3V52H 3OXSB 4XOBA 4WWOA 4G9FE 3N41F 1J0JA 3BWAA 2X4OA 3DDFA 3WEOA 3WMQA 2FTAA 3EFDL 1UM4L 3UERA 4G6JH 1C9SA 1M6OA 2F58L 1AP2B 3IKKA 5HI5D 1L9TA 3GJFB 1E2VA 4MZIA 2CMRL 2YHGA 5DD5L 1H8OA 1XWVA 2DWTA 3NTCL 4WCYH 4DPBX 3T0AA 4ZPTB 5C07D 4K8RC 2I9LA 1LHZA 4HIXH 1N4XL 1BGXH 3IGAB 3QH3B 3NEEA 2Q8BH 5JHLL 2XC8A 4JVUA 1NEUA 2VDOB 2DI7A 1NWPA 2N7SA 4S11A 2AJYL 3VJ6B 5AFAA 3U9UB 1TTRA 2VCOA 4CADB 2FSEB 4MAYB 1MH5B 5GGVH 5AAMC 4MJHA 2C4FU 1CIUA 2J2ZB 3MRMB 2RHEA 1Y18A 5CKAA 2XNAB 1XGRA 2PWGA 4AGQA 1AD0A 1IAIM 1DQKA 1XQ4A 4KVCH 4YHZH 3WJJC 4C56A 5IW1A 5IB4B 3K72B 4FZ8L 1E5ZA 3NAAH 2B20A 1II4E 2ZOTA 5HPMA 4TLUA 3PFQA 4Z7VA 4PU2A 2BCKA 1A7QL 1WA2X 5LAXA 4YZWA 1AE6L 2BZDA 5E9DB 5TDNA 1H6UA 1N0XL 3F01A 3L3GA 3N9GL 4BWWA 3GXNA 4ZXBD 1XB6A 2W0FB 5FLVA 1TENA 5D5ME 4E41A 1E4KC 1QQDA 3TNMA 3E6FA 4LDLB 4L4TD 4KK9C 3C09B 4Q9BA 4PJ8D 5DRNA 5CCKL 2NY1C 3HCVA 4POUB 5K59E 3WS6C 3O8XC 5DGQA 4MS8C 5JHLA 4NUQA 4UUJA 4P3WA 5L2KE 1OCWL 4XXDA 2GEEA 2ZUQB 1K8DA 5KSBE 4ELKA 5BO0D 2X42A 4LAQL 2CSPA 4W9DC 5TE7L 3FB5B 5K1JA 1SXZA 1AZVA 1UXLA 3FTSA 2FB4H 5HGHA 3W2DH 5C0ND 1CFQA 3PGDA 2WN3A 3WNLA 3FBKA 2Z7ZA 2OZ4H 2DTSA 3GI8L 3P4OB 3NIDB 5SWZB 3NYKA 4N0CD 4XCNB 4ZFOL 3BPCB 3B9EA 3NSYA 5CSZA 1I7ZA 4ZO8A 4R83A 3SKJH 2OJ1A 5KEZA 3DSNA 3TESA 1Q8MA 1SMDA 1MVFA 3B8YA 3QRLA 1ONQA 5JHDE 4QHMB 4KH9A 4GUPA 2F54B 4MYWB 4AIOA 2D0GA 2QPUA 1TTBA 1TJIL 5FYLH 3ZTNH 1SYVB 4FHBD 5DJZB 3BN9D 1IEBA 4RA0C 2HUEA 5DI8A 2B77A 2IADB 1RHHB 1KTJA 3V6FB 1AZBA 4ABWA 3TBWB 1E5CA 1I1AA 1ZHLB 2XHNA 4Y4FB 1RZKH 4NXSA 4M48H 5JXAH 3RL2B 3GK8H 4N2HA 2CLZA 4MDIB 4HZLA 4M5ZL 4KWUA 3L4YA 5HDBB 2OSWA 2MTPA 4FC3E 5CN2A 5BOPA 1NCDH 3FTXA 5ISZE 2VIRB 4N5UA 2WBJC 4HHAB 2AMGA 2XWBA 1KTKE 4B9PA 4E0RB 2YEZA 4ZFOA 4DVRH 2CHXA 2VLJA 4Y4HA 3SGEI 4EUPB 1S6NA 4BSVB 1QPXA 3MNDA 1N6VA 3UBHA 5KYYB 4MMYB 1XCQA 2X88A 1AD9A 3D06A 3Q6FB 1OZUA 5IGXH 1BAGA 4BGLA 5B3JF 5ESQA 1UM6L 5CNHA 3CC5B 1F11A 2CKBL 3UGUA 1IGFH 4JM2A 1NAKH 1QRNA 1KLUB 2AJUL 1IQWL 1DLFH 4BCZA 3W39B 3M88A 4QLWA 2Q10A 3L3OA 2JH2A 2XIIA 4K2UL 4YHPA 1B9ZA 2EE9A 5JYMA 4JZNB 1DFBL 3BN3B 3P4NA 5IMMB 5J89A 1FHNA 5IBLD 2FWUA 3MGTB 4FABL 2OJZH 4XP9L 1JNLL 4X6CF 2VTFA 2OMVA 2K0RA 4BCYA 5A40E 5EIIB 4FNPA 3EO9L 3G5VA 1HHIB 3K0YA 3CQQA 1ES0A 1UWXH 5E8EA 2AXGA 3HZYB 1KGIA 4NUMA 2QEJA 3CSYA 2PYFA 3U7WL 4WUKL 3GUTB 2ZNWA 4F7CA 3D25B 5DFVD 2UWEB 3RWFA 3A23A 1LWRA 3WD5H 1UT9A 2J7LA 3KPOA 4MCZA 3PF2A 1FRGL 5EBGA 2CKBA 2YUVA 4ZSOB 5FFLA 1SVBA 1XH3A 4QT5A 3GXIA 1ZS8B 4H8PA 3SKNA 2JB5L 2ROYA 5DJYA 3F6LA 3HEIB 5ANMB 1HNFA 1K4CA 3RPBA 1J9RA 1NMCC 4YDZA 5D7JB 1CL7I 1KGCD 2VNCA 3NCYP 4EI6B 1CIDA 4TVPL 3FSWA 5SWSB 1BYNA 1J8HA 3UPRB 3C8KB 1FE8H 2EXSA 4O02B 2YRPA 2VZSA 5E4EB 5F9WC 1FPTL 3KPSD 4FFZH 5DTFB 3FB7B 4B9KC 1YC8A 1YC7A 4XVTH 2I60L 2EIDA 1NGPL 3DPBB 4I2XB 2UVEA 3MU3A 3P4MB 3B3BA 2W9DL 2ZXBA 1FFRA 1THCA 3CFNA 4EQ3A 2P5EB 5DA0B 5L9DH 3IBOA 2DPKA 3QDMA 3DHMA 4ZAKA 3B2DC 1DVUA 1QEWB 4GKZB 1K5NA 3IDXH 4P46A 4WUUE 4DO5A 2JKTM 2QSQA 4PP2A 4PY7A 3FOMA 5GS0H 1IBGH 1M57B 4M8QB 2UX6A 2OMXB 3G08A 2JLLA 2W9EH 4LLMB 3AAZB 4ODHL 3WNNA 2HVKA 5DK2B 1NAMB 2ODIA 1A6AA 2ZX8A 4HUVB 4HUWA 3WSQH 4TYUA 3MJ9H 1AIFA 5GSVA 4F7PB 4B60A 3GZOA 2VC2B 3PDDA 1Q9KA 4PRNA 1WWBX 3BUPA 3KWVA 4XMPL 4F1ZA 3CVIH 4DQOH 3VXMD 3BDXA 5BRZA 3S2AA 3INUH 4D9RE 1MUJA 4XVSL 4F80A 1DBML 3MV01 4FCHA 1HH9A 1TQWA 1WIOA 2WK2A 1EFQA 2Y7OA 3HG4A 5PCYA 2HMIC 1OAKL 2AQ3A 4OSUH 1DBKL 4MNHA 1TTFA 4R97C 3UROR 1AMXA 1YEWA 4YSQA 2JJSA 5IBUB 1VESA 3JBG7 4I0PD 2CBQA 4Z77A 3IJ8A 3S5LB 2ZX5A 2NY4D 4C83B 2EYTB 1E3XA 2WXLA 3T6XA 4X6BB 1TVDA 1ZLEA 1UOLA 4X50A 4WWNA 3SO3C 4PYHA 1YY8B 2CA4A 4JKWA 5C0EA 4LCYB 5EZIL 2VZ3A 2X41A 1EHXA 4JY5L 5T3ZL 3QW9A 3UO8B 4ZUVA 1P84J 1DJGA 3CXHK 1KNOB 3WHXB 3SPIA 4WV1C 4L37A 1QFWL 4HPHA 4Z3HA 4OV5A 5E1QA 2DJ4A 2FAUA 3FRUB 4C56D 3VD0A 3MOBL 4WO4D 5KVFL 2EDMA 2JE8A 1RULL 1ZMYA 3CXFA 4K3HA 5B3SB 2A9ML 2R2EB 1JZ8A 2O72A 1DVFB 4TPRH 1KBGH 1AZUA 5KAQF 1XT5A 4A66A 2A77H 5BW7A 5J1AB 2Y5TA 3CHQA 1KB9K 3RZWA 1TETH 1MEXL 4LB8A 2ZXQA 3F7LA 4I7ZC 1TLKA 3EOBB 4LOVA 1SPDA 1EO5A 3FONB 5D6CA 4C8XA 4E41D 1L6ZA 1RMFH 4JLRB 4NPJA 4KI1A 2HCZX 2QSCH 4CC4A 4AG4H 2RACA 4XPBL 1B4JL 1XCWA 2C7UA 3VD1A 5EA0L 1AI1H 4ERSH 2W95A 1CXIA 1E9OA 2I7SA 3QJQB 2R1WB 3BI9X 4PRPD 1KB3A 2FATH 3HPLA 3CH8A 2I27N 2I69A 3US9A 3RVVD 1TU2A 2WBKA 2B0SH 1UKSA 1ZY9A 1ZLVK 3ZIYA 2PPEA 4UT7H 1A1OB 2WAQA 3UYPA 3ARFD 4XPTL 3QHZH 3LXAA 4Y16B 4C59B 5FGBA 2QGCA 4NQSB 5K9JL 2DQJH 5C09B 4YHIB 1RZ7H 3W0WE 4G43A 4WFHD 5DURB 1KFGA 4XZUB 3SKUD 3VGAC 2YGVA 5EZOH 1T0NB 2AJVL 4P5RA 2Y6TE 1DBAL 1HESA 4PTTB 4XPGL 4P23C 1EUUA 2XA8L 4HSCX 1YCSA 1EERB 2A4CA 3EH4B 3MV8B 2ZP8A 2EIMB 3OD3A 5ICZB 3O3EB 3KL0A 1X5IA 2BJML 2Z4TA 5JPNC 5D71L 3TT1H 5T5NG 2PXYA 1XXDC 4H44C 2FIKB 5E7FA 3RURA 4G11A 5FIEA 1EGJH 1JPGB 1KXVC 5LG6A 4XBEL 4Y2OB 3T2LA 1EVUA 4GKNA 4KTDH 5AVSB 5D96B 4HBCH 4Z3TA 3NK4A 5E95B 1KJMB 4ELME 5IR1B 4GSDL 2XDHA 1YEGL 4XN2A 2YPVL 1JWSB 2XOTA 1Z6JT 1JVOA 2EE0A 5JR1H 3LH8A 4Z0XA 2XY1A 4K9EL 5D2NB 5J3HC 3EGSA 1FH5H 3VGHA 4BXSV 4MXQC 4P07A 1DQDH 4NO2B 1P4IL 2YRZA 5DS8B 5FB8A 1USZA 4S1SH 1CB4A 4GSXA 1XF3A 5H37H 2AXWA 4L3EB 4YZFE 1GSMA 2V2XA 2BS9A 1JGIA 2BVPA 2HH0H 5E1GA 4S0HA 4GG6F 3OLEA 3WKML 4JM2D 4AL8L 1QRND 2ZXDA 1UWXK 4KI5F 3BEWA 4G5AA 5AYQA 1H0DB 3BP7A 2Z35A 4PFEA 5EF1A 3FFCB 4MCYA 3GSOB 32C2B 4FG0A 4OUOA 4Y5VB 2NTFB 2FO8A 4CGTA 3BRDA 3Q2VA 1Q90A 2LR4A 2Y7LA 1Z32X 3N40F 3B2UD 1SYSB 3PWLA 3BD3A 3LHPH 4RMTA 1RIHL 2CO7B 1YPZF 2NYYD 1D6EA 2F08A 4FQLH 2EE6A 1YJDL 4ANKA 3APCA 5FF6B 4LP4A 5CFAA 2NY5H 3C8HA 2YPVA 2A9NL 4JVPA 1JDAA 2BVTA 3RTQD 3WIFB 1WBZB 4U1GB 1XL6A 2C5DC 4H1LH 5H37G 2WXRA 4L8DB 4N85A 1YN6B 3CFCL 3SE4A 2BOCB 4MA1C 3NT0A 1J0IA 4KFZC 4F15B 2YK1L 3OHXA 2PYEE 2NY6C 3C08H 4PR5B 1HS6A 5AVUB 3VWKC 1PEZA 5DLLA 5KN5B 4YEFA 5L4JA 1ZGLP 2VL5B 4UF7C 3IVKA 1XAUA 2RCSH 2X4UB 5IVZB 5TFSH 2C3VA 4MHHI 1CG9A 3SO5A 4HCIA 2ZXCA 3MLVH 3QYNA 3T4YB 4BBWA 1BVNT 1VEOA 1S46A 3QEGH 1QPKA 1Z0MA 4YGVA 1IC5L 2GFBA 5D8JL 3DK0A 2GJ6B 1JGEA 1I7UB 3QHTC 3EJUA 2BNQB 4GRLC 3THMH 4DFIA 1E2ZA 3HG3A 3WBDA 2J1YA 1MF2L 1X7QB 1XFPA 4G9FA 4MFHA 1J8HD 4H1LG 4OIIH 4QWWC 3MCLL 4NOFA 5GZOC 2WBWB 4WHDA 3T6QC 4M1CD 1OAZH 4D0CB 2VL4A 2JKIS 3PAVA 1CR9L 2C9RA 4WFFE 2DYPA 4M1GL 5B1JC 1FIGL 4L8CB 1OAQL 4TS6A 4GSUA 5AKVA 2DMHA 2CUHA 1KYDA 3VFPA 4ZS7H 2Q6WA 2IPKB 1N6QL 2YJLA 3NSXA 4IRJD 5CWSA 1MIML 1U95A 3NDYE 2BX5A 3IMVA 3F8UB 4OIFA 2K6ZA 3HUJF 4RDQF 3VSUA 4M6OH 4R2GB 4GAGL 5FOJA 4XMLH 3F6IA 3CFIC 1NCHA 3T0EE 4YHML 1IM9A 1PQZB 3ASNB 4P46D 4P3CH 4E9VA 3ETBF 2EICA 1WFUA 4J3OH 5D7KD 3VX1A 5C0FA 5IUSA 1JXJA 1EAPA 2DH3A 4U2ZA 5DRXA 4PMEA 1U33A 5E7BA 5AD0A 4OFKA 5EU6E 4TVPD 2Z34A 3F84A 5JW3H 1A9EB 1OM9A 3FB8B 5JNYA 1NJ9A 1OAYH 5FGSA 4B41A 4C55A 4CMMA 2E7HA 2BVOB 2X9YA 5AW1B 3ML9A 2YFNA 1F8TH 1RZGA 2VERA 3BAJA 3GSXB 3MUGA 4Y19D 2VT0A 4MS6A 5D5MA 5BRZD 5LAPA 2HTLD 3EHBD 2CM5A 3B83A 4FFYL 3L5WA 1CLVA 2GTZB 4FHKA 3MN8A 2R7EB 4HUXB 3D12B 3FU9A 2FQDA 4J3OG 4OLWL 3CFKA 3NH7L 1JWMA 3V0DA 3U9PH 2WNGA 3CH1B 4KGJA 3VFRB 5L2KA 5KSBA 1IC7L 2B1HL 4NO0B 3K2MC 4KVNH 1B0GB 4PSRA 2P46B 5CJBA 4ZUUB 4BKSC 3O6KH 2ZOKB 1IAMA 2WJ5A 3N41B 4PM1A 5AYUH 1AR2A 4F2FA 3CFBB 3HMWL 1SEBB 4M6AA 1VPOL 4L1TA 1U3ZA 3OAWA 4JO2L 5L4IA 1FO0B 3HS0A 4R7VA 3G5YA 4HWEL 4H7VA 1BQ5A 4Y9EA 1N5YH 3WNJA 5D6DC 4ZZFA 1FNLA 1CBJA 3QZWA 4XCEA 3BSZL 1GC1H 3M6DA 2BW4A 1A1MA 1QX1A 2ODHA 5CAYB 1P5VA 3DPDA 1G7LA 4Q58C 3VFNA 3V52L 1S9WB 4OZIB 5DQDH 1C16A 1OF0A 1HZHH 2NY2B 5DO2D 2EEXA 1I1RA 2CJSA 3D2UA 3OGCB 3DOHA 4FG6C 1WZ1L 4WWID 2Q7YB 4AV5A 2EO1A 4XT1C 4FFYA 3GSUB 1UD6A 4FNUA 1E6OL 3R0NA 4JFHD 3CDCA 4OZ4A 1HSAA 2R15A 4FZEL 2PO6B 3O6FC 5F7FA 3DXAE 4AEIH 4BDVA 4RNRA 4LCIH 5E51A 2ZSWB 4OW6A 1WAEA 3QARA 1ODUA 2VDRH 2H6PB 2AFNA 4R4ND 1A7BA 1ZVSA 3V8CA 4YHNA 5HYIA 2APVA 4R5VA 5CEZH 1GPOL 4G83A 1G7PB 1V7NL 4TN9A 2R23B 3W9EB 4AMWA 5ISZA 4EVNB 3DX8B 4LSUL 1LE5A 3KYMA 4M9OA 2C4FT 5IHUL 2FX7L 4OKVA 3K81A 1X4YA 4TRPH 4X5XA 5T3ZD 5IEHA 4PJ9A 1T20A 3BSZA 1J9CT 1E50A 1RUPH 3UIYA 4XPAL 3QDJB 2NY7H 3HVDA 5B1CA 2AAAA 4G6KH 4WI9A 3S97C 4FL4B 1BW8A 3ULVC 2EIZA 4TQPA 3OAUH 1LDPH 1J18A 4MD4A 2HT3D 3UTQA 1KIRB 4UDUA 4KO6A 4ZTOH 5T8IA 3V6ZB 2V8MA 4LQFL 3QDHA 4HXAH 4LPYA 5H4YA 2JTDA 4XP5L 4AK1A 4QJ5B 1L5GB 2CO1A 4IMKA 3TT3H 2PR4H 5HD8C 1HINL 1J5HA 4X7SL 4N8UA 3SOTA 4HCRL 4AYMC 4AE0A 2NLJB 2Y6SD 2A4ZA 2HG5A 4WU5B 1U3JA 1AZZC 1ADWA 2WZ6A 3IU3B 4JFDB 5JQHC 2DM4A 2IVFC 3OC8A 4HWUA 2AI0H 3VRJA 4POYA 2QVMA 2FB4L 3QR2A 2EDFA 3FTVA 1AQHA 3UOAB 3FQNA 2IQAA 1TZHB 4A2DA 1EIBA 3C2SA 1T21B 2DDQL 3RIFF 4U6VL 1VZIA 5KVDE 4NSKA 3W5NA 3V4PB 2I85A 3B2PA 2GC7C 3DUUB 3UGEA 4CU7A 3O9WA 1OAXL 2KZ1B 4ETQB 2VXUL 3V6OC 4KZEH 4J7RA 1ZK9A 4MJIB 5SWQA 2ZOWA 4FERA 3X1EA 4S2SA 1E27A 1E8ZA 2WWMC 2MPAH 4NQDE 4YL4A 1FCGA 3T0BA 1BOYA 1O6TA 2ED8A 2G9HB 4OZFH 3BXNA 1YMME 1ND0B 4HCRA 1OM3L 3SGDI 5DJ0A 1M9WA 3TOPA 1OTTD 3N06B 1RZKL 1NPNA 2WHVA 2X4QB 3ILEA 3UP6A 3GZKA 4YL9A 3LPOA 5KSVB 3B9KB 3K6FA 4D0BA 3K91A 3H7LA 3QVAA 1EO8L 3AMLA 1BMWA 4Q97A 2CO4A 5C0BE 4WUUA 2FUTA 2LQRA 4O2CA 3RGVC 1C1EL 5DHYA 1G6RL 4A1RA 3D3VD 4F7KA 4OFQA 1HHKB 1PLGH 2ZKWA 3W37A 4X6CB 4RRPG 3GWJA 5SWQB 3GMRA 1U2HA 3M1BB 4OZFG 1J05B 5CR8A 3IDIA 1A7OH 2D03H 3IDYB 1DJIA 1KXTA 4LHUG 3UYOD 1BJ1J 5AOLA 1G7JA 2IWKA 3BQUA 2ORBH 3NEXA 4LLWA 2F15A 4ONHB 4BUHA 5FXCH 3UO1H 1XD1A 1AHWA 4LVNC 5D7SH 4AKOA 1ZOXA 3DVIA 3QIBA 1HHHA 5ECJE 4FP8H 2P48B 5HI5C 1AHKA 4DW2L 1PD0A 5CIPB 2TRHA 5TE6H 2J71A 2A6DA 4MMXC 4TL5A 4G9FD 4L9LB 1J1OL 1F4YL 4DEPC 3CG8A 3HKFA 3TZVB 3ARQA 5DRWB 5MENE 1W72H 3G6DL 4JO5A 4LKCA 3QCUL 4QJ4B 2DYPD 2Q0ZX 3Q2CA 4HGWB 4K5OA 3TIEA 3BZEB 1VLXA 5CBAA 3MRIA 2WUBL 4I18B 3S35H 3FT2B 1G6RA 1KPVB 3W11D 3TXAA 1NCAL 1NGWB 1TJXA 1DN2A 3RQ3A 3U0WH 3C9NB 1QSEE 3OX8B 2JQMA 5H2BB 1NFDB 2WJ7A 4X8JA 5IZ7A 3HG5A 3OLDA 3DHPA 4JG1H 4B5EA 1KGWA 3FT1A 3N1FC 3VMPA 2V3DA 1RUMH 2OL3H 1A21A 4FTVB 1NOFA 3FUDA 4OGXL 2NW3A 2PWHA 1ZT4B 1WE5A 4XNDA 4HGMA 4G8EB 4ZXBC 4EPSA 5FR3A 3ESOA 3G5XA 4KJWD 3D0LA 3SDAA 4CDHA 1AR1B 1L7IL 3VFGH 1MNNA 1Q72H 1SY6H 4F92B 2NNCA 3PQYE 4KQ4H 2YGNA 4PJ8C 2JSFA 4K94L 4X6DB 1LWHA 3I6KB 1E8XA 1URIA 2EDHA 3UTTB 3RNKA 4XMKH 4ODWB 4KO9A 2J3SA 2NX5E 3K80A 2YD0A 1WT5C 2A6JB 5HHVL 3TCTA 4Q9RL 1E9QA 1CE1L 5DRZB 1RZPA 5JA9A 1MLBB 5C0NC 3IDXL 1UXWB 3WTVA 3UTPE 4JK0D 4LE8A 3HG1E 5L2KD 1AFVH 3DV4B 1F1GA 4G8IA 4IJ3C 1U8CA 2YUZA 4N0CC 2OSXA 2XJLA 5INCA 2HX7A 3C5ZB 1JGLH 1EXUA 1U8QA 5I75B 2QVFB 2CR6A 2QADB 4M7ZB 5IB3B 3HR5A 2OA9A 3CPUA 3T65B 4MJ5A 3D4GA 1XF1A 2JFCA 1L4IA 4S1QH 3V0IA 5BVPH 1SM3L 2H1PH 4XTRD 2JKLA 5ABZA 1A6UH 5DDHB 4CW1A 4UMSA 1E9PA 4AGMA 4E42A 4HJTA 3V10A 4UZSA 3QE5A 5EBWA 1PX4A 2FHFA 3B5GA 4NJ9L 5CINH 3VACA 3BN9C 3OZKA 4M1DH 3L9BA 3RPIA 1TTAA 2R1XA 3W9DA 4AUJA 5AKTA 2VLKB 4HUUA 4AT6B 5MEOB 3IMWA 4BE5A 1OPGH 4QRPE 2BRRL 2XI9A 3SZ6A 1T89A 2EIBA 3IFLL 3LRSB 4HLZH 5JHDD 1IEHA 1E65A 1D5RA 1I53A 5A2JH 2GKIA 2H6UA 1M7UA 2E0PA 4ECNA 3MRDA 4N2EA 1BJMA 2H4EA 2RGSA 5D7LB 4TUJB 4KKLC 2ADJB 4BA0A 4AQAA 1UZGA 3LZOA 3AJ7A 4FCAA 4HF5L 2Q1EA 4LBAA 1OWRM 1E4JA 4H0GA 4U1MB 5IBTL 4JFQA 3DGGB 3IWVA 1QSZA 1M7DB 2BVQA 2RFXB 3OKOA 4U3HA 4UOQA 4NB7A 4PJEE 2C9VA 1IMHC 2DTML 4BD4A 3VD7A 3RKPA 4ELMA 1HEJC 5ISZD 5HBBA 4P05A 4TUOB 3QUZD 1S3KH 5IOPA 2OW6A 2C9PA 1NUDA 3IRPX 3QR1A 4HLZG 4PJ9D 5HJBA 3O3DA 1KJ2L 4TUKH 2UZPA 3WY3A 3EO1B 1FNGA 2Z7UA 4H8WC 1MLCA 5DWUH 2PW2B 3B56A 4XAWL 2E6JA 3V5HB 2BVUA 3CN2A 4PB9L 2WQWA 5ELIA 1EXGA 1VEPA 2P45B 4H0HB 1UH2A 4TPRL 1C7SA 2A77L 5IBLC 1E4HA 1UOWA 3U30C 3QYMA 1WFTA 4OF6A 5BZWB 1I7TA 2Q3ZA 4EQ2A 3ZSSA 2QQNH 3E2HC 3FN3A 5KBLA 1NBQA 2YMXH 2VERN 5F96H 1JHLH 4NO3B 4X6FA 3BZ4B 4YUEL 3ESNA 4YDIL 4MBOA 4OLUL 1ZWIB 1Q9OA 3E8UL 3BWZA 2B1AL 3P02A 2ZWSA 4W68A 1QKZL 4MXVE 5DFVC 5DYOB 2ZKYA 3DVGA 5I9QC 4NC1E 5EO0A 2DBLH 1VHPA 2FATL 5GJTL 1A02N 5HHMD 5CJOL 3ROLB 3A4DA 4R26L 3S36H 2O5YH 2B0SL 4JG0H 3OC5A 5L8LB 1KJ2A 1BFTA 1K8IB 3NGBB 1KIQA 1YMHB 3FUJA 4ORZC 4DGYH 2PYEA 1JNJA 5LCVL 4QY8B 2Q8AL 3GSWA 1D5MB 4N2IA 1DBJH 3ARGB 1PZBA 2QQQA 2XVBA 1U6AL 1LP9F 1RZ7L 4Z7OF 1CD0A 1TYRA 2OTUB 4Z7UE 4ZFZA 3WGUB 3O9WD 3PFUA 3L5JA 1XIWA 1IE4A 1EJFA 4JRXB 4WKZA 3NSDA 1N68A 4ONFL 3X3GH 4DK5A 4UV7L 5IQMA 5HGDB 2ILLA 1KB5L 2FJSA 3NCBB 4XE5B 5ESVA 3AT8A 5LGJB 3GBML 1FJ1A 4NWUH 1ZGLA 4IBUA 2EACA 5L7XH 4FJZA 2WOYA 1G7IA 4XVOA 3Q1SH 3MLTA 4JZOB 4KTDL 4HBCL 2KZKA 3LZNA 5B7EA 4FGMA 3M17B 4GQPH 5DEGA 4PIBA 3MTRA 3ZKMC 1HK6A 5LCVA 3MUY1 3ESPA 1ZXKA 2MOQA 3T0EA 5JR1L 1Q1JL 4TULH 4OT1L 1M53A 3K5SA 4HQQH 4DNLA 1AYOA 5EIVA 4WUUD 1NC2B 3GS7A 4PJIE 3A67H 1QLRB 4UV4L 5MERB 4S1SL 4URTB 4PJ7F 2HFEB 3MJGX 4H26A 5IB5B 4C58B 3SPCA 1D2OA 4QHPA 3QJOA 5KS9F 3EXJA 1HXMA 1T04B 3VM5A 1NCCH 5EU6A 5FYLD 4F93B 1J11A 4MBRA 1KB5A 4NT6B 2BY2A 1YY9D 1TQTA 1KTBA 4P49A 1HZLA 1UFUA 3QIBD 3ILPA 5F7KC 1RFDH 2FT7A 2G0KA 3MYJB 4JRYE 5I30L 2A6KB 2NY4C 1UQSA 1A4JB 3JT0A 4NUJA 1ETA1 3FO1A 2ITCB 1S9YA 3P73A 2ZYSA 3GSNL 1QTYT 1ZLWK 2H2PD 3ABGA 3MAWA 4Z95H 2LFGA 4JO1H 4Y5YB 5T1JA 3LN4B 4YXKH 1JTOA 5T3XE 3VDBA 1I8KB 1A3RH 1VFBA 2YXFA 3CDYA 3TF7C 2JWYA 4QYOA 4G71B 4Q0XL 4X0KB 2VKXA 5FHBL 5L8JB 2LAAA 1AANA 1N64L 2PMZA 3K8KA 4ZFGH 1X5FA 1F4XL 4Z3JA 4UT6L 1S7WA 1OGAB 5TFSL 4QRRB 4WO4C 1V3KA 2DS4A 5EC2A 4EZJA 2MHAA 3KWXA 1JXGA 5DUJA 1XGTB 4B53A 2XX0A 3H56A 2FUQA 3B3IB 2PCYA 5I24A 1M7XA 2R59A 3QO0A 4YSTA 3RNQA 1NLBH 1FN4A 1X5LA 3G6JE 2QT6A 2KQMA 5D1XD 5FK9B 4AVIA 1SGKA 1AJ7H 1Y1DA 1KCVH 1YVLA 4FDWA 3SDAD 5HHNB 5CFHA 3GSNA 4NKQB 3BVNA 3WE6B 4C57C 4AX3A 3ZSTA 1D2PA 4DWHA 1U91B 3DXAA 3ULVF 4HD5A 5HGAA 2NNAB 2PP7A 1PLBA 2ENPA 3I85A 2A1WH 2XFGB 3QI9D 4IRZH 1KDJA 2GT9A 3NJLA 4M6OL 1H8NA 1H19A 3TEYA 2YEVB 1ZXQA 2V5SA 3CZKA 3VA6A 2VDPH 1CTNA 3RVVC 1O9ZA 1Q0EA 4B3EA 3RY6A 1MXDA 5BOZG 4P3CL 4UT6A 2YQ2A 3ARFC 4YAQA 3OKDB 4UTBH 4ZX6A 5JUEL 4UTCA 4P5KB 4AQ8A 4FYTA 5F7HA 4GLRI 1NGXB 4JO4L 4XE0A 2G5BB 3PXHA 2HRPL 3TTYA 1A3QA 4YC2B 1CFSB 3DWTA 5KVDL 4AC2A 3T77B 1BP3B 1SBBA 3ZR5A 3AUWB 4BELD 4HWNA 4O51B 3TPKA 2X7LB 2ZF9A 3VXPA 3K1KC 4AXWB 2JKNA 2AERT 3DUSA 2J6EH 43CAA 2OXHB 3FU3A 3PHAA 2BINA 4X99B 3JZ7A 5E5MB 3EKCA 5AKSA 4ODVH 5IJCC 1EDQA 3MRCA 2WMPA 1T4KB 3NCYS 4LCUA 5I8EB 4KX7A 2PTVA 1TYJA 5K93A 3TASA 1HE8A 5K9OA 3ASOB 1XGUB 4KVNL 4FQPA 2WBJB 4N8PA 2DQHH 2F8VA 3RTLA 3OR6A 2X12A 5AYUL 3WGVB 4CU6A 2FX8H 1OF2A 3RAJH 1JZDC 3KBFA 1MAML 3BPLC 4PJ5B 3EYSL 5E1AB 3MRRA 3ZDXE 3N5AA 2RB8A 4KHTH 1RI8A 4FA6A 1N5YL 5B39A 4ZNEE 5K39A 1ILSA 1RP8A 3QAZC 2XUWA 5HI4D 5ICUA 2EEFA 4UB0H 4ZG1A 1BF8A 3DLQR 3EF7A 4BFGA 3VI3B 3NJMA 1M1XB 3MRJA 1G0YR 3GFUA 4JM2C 4KY1L 3UC0H 3MO1B 4KDVA 1IM3B 3L3OC 4P2QE 1NH6A 3CSPA 4PJGE 1O7VA 1XR8A 4NQDA 4YSRA 3TVMA 1XH2A 2DD8L 3B2UC 1YMMA 2BHYA 1S78D 5JO5A 5KAQG 1S7XA 3LQZA 2NYYC 3MCG1 3MI6A 1J8RA 4GRWH 1JPTH 2ESVB 3MRGB 4WHTB 4YBHA 5C9JA 2BWDA 3RLSA 2OMZA 1HOEA 1JF6A 1A1NB 5FX3A 1B0IA 1RURH 1CGWA 2IANE 3GRWH 4OCXL 3S37H 2FR4B 5MEPB 4IIQA 1H3TA 3OKKA 1UZ8A 4MNGB 5C0BA 2O6EA 1DZ0A 1CICA 4I1RA 2DL9A 4HBQA 4HAFA 2CIKB 2X4RB 3K0WA 4WI2A 1ITCA 2XWJB 3S34H 1IKFL 2UVFA 2NUTB 1FZOB 2V2WB 3TH3T 3CX5J 1QA9A 3OAUL 2PYED 4GXUM 5HJ3B 4AKPA 2WLJA 3QQ4B 2A99A 2DQFA 3BP5B 4FN0A 1PSKH 2DICA 3LEYH 5I0WA 4JHAL 1GHFH 4CVXA 2ICES 4ZUWA 4PJXE 2Y25A 5AVXB 5EIQA 4G9DA 5F9WB 3RWDB 5D1ZA 2MH4A 2PLTA 4M1CC 5DEJA 4LF3B 4BKTC 1GZPA 1MCFA 4OM1L 4ZTPL 5F72S 1XIWD 2DWEB 4Z7NE 1S5HB 2Q2LA 3VX0A 1A4KB 4NN7B 3ZMRA 4GW1A 4IRJC 4Y4KA 2WLNA 5ENWB 2V3EA 4LCWE 4PRAB 3WY4A 3ZE1E 4HYTB 3ZL4L 2SEBB 2V17L 3WIIL 3OB0H 5MENA 3CLEH 2DWXA 3G5ZA 2GCYB 5KBMA 3UBXA 4NENA 3IYLW 5E6RB 3QO1A 2NY0D 1LL1A 2P3YA 3CQPA 4J1UB 4P46C 3FO2B 3F64A 1QFWM 3DVNA 3T0VA 3TBTB 4ZOCA 4QRSA 2GI0A 4IRSB 4UM9B 3NCCB 4O2EB 5DJDA 1Q9LA 4S0TD 3OTTA 5TDPA 1SHXA 1P7BA 1R3KA 1QSEA 3OMIB 4OBRA 5IB2A 1B9KA 4LMQI 4CRPA 4LFHG 1L6PA 2ZONA 5HGBA 3T0ED 1WZAA 3QXWA 3WFHA 1V55B 2DIBA 3NQKA 3GIZH 4LEBA 1T6BX 2Q9OA 2D8KA 2VN7A 3GQFA 3HI5H 5CLYA 1QFWI 5C0JB 4OU3A 5CSBA 2WINB 1E28B 4AH2B 2LLNA 3PHQB 3GPEA 3QZLA 3IDMB 5JW5B 2HTLC 3EHBC 2R2BB 4HETA 2D3NA 4PJHF 2Y07H 2B9BA 3DJ9A 3PQYA 5E9AA 4AENA 3GMLB 3NIFF 4R97B 2O5XH 4U1SA 3I6GA 1CDHA 3SPVB 5ABDE 3VI4B 4Z5RB 1X4ZA 2JJSC 3QNYA 4QDGA 3QA3B 5GRWA 1HXYB 3I6SA 4ABVA 2NX5A 2AJXH 2CR0A 4JKPH 4JFOB 1XD0A 4EEEA 1F3JA 4QOKE 2HVBA 3VXTB 3BOVA 2YFOA 1S7QB 3HG1A 4G5ZH 2AQQA 3E6HB 2EYRA 4XCFH 3EZ8A 3ZYJA 3PGFL 1V3MA 2IF7A 1TTCA 1E6JL 2O6DA 1INDH 3U2JA 4F7MB 3A6BL 5DHXB 1DQQB 3U7YL 1LLAA 5F9OL 3KJ6H 1MHHA 3K8MA 4PRHE 4LVEA 3US0A 5DO2C 1KCRL 3T08A 1NCOA 3HZKB 2W07B 4GG8B 3OKNA 4JFFB 3SY0A 1FVEA 5CBEB 4DP9X 2EH7L 3VD4A 3SDXF 2UZIH 4GRWE 2JKSA 4LHUA 5DMIH 1TPXC 5A2AA 2V37A 2D7NA 5BW7C 1GYAA 3NCXA 2CRIA 1R5IB 4QRPA 1F2XK 3NZHL 5TE6L 1NMBL 4B96A 3PDOA 5FKPA 3QUML 4R4NC 4A04A 4OQTH 2DQUH 4AQEA 4UT9L 1OKEA 4ICWA 3QEUB 4HWZB 1WIUA 3U36A 1FVDB 2YN5A 1N3NB 3K71B 4GUCA 2XVGA 4CC4C 3EJPA 2KLRA 3G7TA 3DXAD 1INQB 5HDOA 1RJZA 5I1KH 3EJYD 1G1YA 3TBVB 1NCBL 4LHJB 1A9VA 1IBZA 3LEXA 4GI8A 2R0KH 1Z3RA 5TH2A 3KPRB 2GSGA 3GJEA 1KEMH 4K73A 4Z7AA 2OXGA 3QQ3B 5I82A 1N59A 3UIZA 1ANUA 5CJ8A 3TYFA 2DEWX 5A2CA 1BBDH 5DUMH 2VISA 2HT3C 4ZT1A 1Z9NA 3KXFE 5FGBC 1JWUA 1I3GH 3RGBA 1BV8A 2FGWL 1AZRA 4R5TA 5E08L 1NGQH 1NDMB 3MV7E 1B2YA