2CUDA

Solution structure of the sh3 domain of the human src-like adopter protein (slap)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
79
Chain Sequence
GSSGSSGPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTGRESYIPGICVARVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SRC-like-adapter
publication title Solution structure of the SH3 domain of the human SRC-like adopter protein (SLAP)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 10
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2cudA00
2YUQA 1Y57A 4RUGA 2H8HA 2AKLA 4ORZA 1WXBA 2EGEA 1AZEA 1NLOC 2EGCA 4AFQC 1BK2A 2DRKA 1OPKA 2PNIA 1FYNA 2F2VA 2JM9A 2F2WA 3IQLA 2J6KA 1TUCA 2BZ8A 2DL4A 2JT4A 4OMMA 1QKWA 1KSWA 3SEMA 1YN8A 3PVLA 2RNAA 2EVRA 2RQWA 3M0QA 5FWBA 2QDLA 3CQTA 2RQVA 4ZNXA 1RI9A 5EC7A 1FMKA 5HCKA 1T0JA 2DE0X 1WX6A 1GCPA 1OOTA 1GL5A 4AG2C 2B86A 1ARKA 3VRYA 1RLPC 3VS2A 2ESWA 2ROLA 3I9QA 1UGVA 2AZSA 2KRMA 5IHIA 2E5KA 4J9IA 4D8DA 1ABOA 1S1NA 4AFUC 2SEMA 3VS3A 2I0NA 2V1QA 4J9DA 1BB9A 2DF6A 1AWJA 2J7IA 2YSQA 1U3OA 2DYBA 1T0HA 2EBPA 1UJYA 1KFZA 1AWXA 1NEGA 3RBBB 3TVTA 1PRMC 3LH5A 2KRSA 2BTTA 2O9VA 2KGTA 1B3QA 1VYVA 2YUNA 2FO0A 1M3AA 1QKXA 4LN2A 1WXTA 2EGAA 4OMLA 4Z8AA 2D8HA 2KT1A 2MCNA 2ROTA 1JQQA 2YUOA 1ZSGA 1KJWA 1SRMA 1BU1A 1K9AA 2LJ1A 1NYGA 1JXMA 2K7AA 2DLPA 4DEYA 2DM1A 4OMOA 4Z88A 3VS4A 2VKNA 2GQIA 1MV0B 2RF0A 1YCSB 4ESRA 4X1VA 4IIMA 1AOJA 2EYXA 4JJBA 3TSZA 1ZUUA 2IIMA 2L3PA 2EQIA 2DMOA 1G2BA 5IH2A 4QT7A 1AD5A 1VA7A 1NEBA 1VYUA 2JS2A 1YP5A 3VRZA 1T3LA 2D1XA 1PHTA 2DILA 4AFSC 1BBZA 1ZX6A 2LP5A 2RQTA 5FWCA 2K2MA 2L3QA 3C0CA 1XOVA 1K0XA 2PZ1A 1Z9QA 2OI3A 1NLPC 4F16A 1W1FA 3I5SA 2BZXA 1NG2A 3JV3A 2EYYA 2RQRA 1T3SA 2VWFA 4KRTA 1X43A 1PWTA 4HVVA 3REAB 1PKTA 1YNZA 4JZ4A 1GRIA 1V1CA 2JTEA 4EIKA 2CT3A 1TUDA 4LUEA 2DJQA 3EHQA 3UA6A 4JZ3A 3R6NA 2J6OA 2AKKA 1M30A 3ULRB 4LUDA 1PRLC 2LX7A 1E6GA 2HCKA 4CC4B 1WYXA 1ZUKA 3UF4A 4LNPA 5IXBA 2ABLA 4OMQA 1IO6A 1SSHA 1WA7A 3H0HA 4F14A 2CREA 1GCQC 1X6GA 1AZGB 1KIKA 4HXJA 2ED0A 4JJDA 1CSKA 2KYMA 2NWMA 2A08A 2X3WD 2C0IA 2JM8A 2KR3A 1GCQA 3M0RA 3UA7A 2A37A 1JXOA 3M0UA 5ECAA 4J9EA 3M0PA 1JO8A 2W0ZA 2CH4W 1NYFA 4DEXA 1CKAA 2J06A 2CSQA 3KFVA 2KE9A 3NMZC 4CC3A 3EG2A 1OV3A 2YUPA 4E6RA 1ZLMA 2O2OA 2RMOA 1SHGA 1U5SA 2LQWA 1K76A 2XMFA 2F2XA 2FG0A 4J9HA 2DL5A 2W10A 1LCKA 4M4ZA 2CT4A 3UATA 4RTVA 3VS1A 2ECZA 2KXDA 1UJ0A 4RTUA 2LJ3A 1WI7A 2YT6A 1X2QA 1ABQA 2LNHB 2FPEA 2L2PA 3EG3A 2D0NA 1QWEA 5IHKA 2A36A 1H92A 2CSIA 2LQNA 5IHNA 2HDAA 1SHFA 4RTZA 1A0NB 1EFNA 2HSPA 2FPDA 2CUBA 4J9BA 4LE9A 2KYBA 1I0CA 1HD3A 3A98A 1UECA 1VYTA 2RPNA 2J6FA 4HCKA 2JMAA 4Z89A 1B07A 2GTOA 2JMCA 3ZL7C 4CC2A 1HSQA 1AVZC 2PTKA 3O5ZA 1X6BA 2M51A 2K79A 2FPFA 2CUDA 2ED1A 4J9CA 2DRMA 1AWOA 1M27C 1GFCA 1QWFA 2KNBB 3U23A 1M3BA 1JU5C 1N5ZA 2JS0A 2FEIA 3H0IA 1UFFA 1UUEA 5GJWB 3NGPA 2LMJA 2FRWA 3I35A 2L3SA 1X2KA 4IIOA 2LZ6B 2DA9A 2EW3A 3H41A 3H0FA 1UDLA 2DBMA 3SHWA 1WDXA 4HVWA 2KBTA 2V1RA 1TG0A 2EKHA 4GBQA 2HEQA 4K11A 3FJ5A 5I22A 1M3CA 1JEGA 1G83A 1WLPB 2G6FX 2DNUA 1UHCA 2LJ0A 4J9FA 1X69A 2RQUA 1E6HA 2SRCA 1WFWA 3VS7A 2M0YA 3PE0A 1U06A 1I1JA 1E7OA 2EYWA 4RTYA 1H3HA 2VVKA 2C0OA 2DBKA 1YWPA 2K6DA 2X3XD 4RTTA 1PNJA 2KT8A 4JPBW 1GBQA 2AK5A 2DL3A 2KROA 2GGRA 4JJCA 2J05A 2LCSA 1I07A 2EPDA 2A28A 2ENMA 3QWXX 2O88A 1MUZA 2O9SA 2MIOA 1J3TA 1UHFA 1X27A 1ZBJA 3VS0A 1YWOA 2KRNA 1UG1A 1M8MA 5L23A 2K3BA 4AFZC 1WIEA 1Y0MA 1SEMA 1SPKA 4OMNA 2L0AA 3VS5A 4A63B 1QCFA 2C0TA 3EGUA 2JW4A 1UTIA 2P4RA 4OMPA 1QLYA 3EHRA 1HJDA 3I5RA 1NM7A 2CDTA 1H8KA 1W70A 2DL8A 3M0SA 2YDLA 2NUZA 3QWYA 2DL7A 3TSWA 3VS6A 1K0SA 3PVQA 2CH4A 4J9GA 1GBRA 2JXBA 4F17A 2KEAA 3THKA 1OEBA 1W6XA 1SRLA 2GNCA 3NHNA 4HVUA 3REBB 2EYZA 1WXUA 4RTWA 1RUWA 2FRYA 2HBWA 1ZUYA 3NPFA 1RLQC 4R0KA 3M0TA 5FW9A 2MOXA 1UE9A 3GBQA 3EG1A 1AWWA 2GTJA 1PKSA 1OPLA 4D8KA 2D8JA 1CKBA 2OJ2A 2RN8A 2BZYA 1AEYA 4WCIA 4CC7A 4Y92A 3RNJA 2AZVA 2K9GA 2GBQA 2DX1A 4GLMA 5GJVB 4FSSA 1MV3A 4AG1C 2DVJA 1K1ZA 1Z9ZA 2KXCA 5IXFA 1K4US 4RTXA 2OAWA 3EG0A 5I11A 2O31A 1GFDA
chains in the Genus database with same CATH superfamily
4XTYA 1Y57A 2H8HA 2CP0A 2RD1A 1IGQA 4BDYA 3JCMP 1K73R 4AFQC 1SG5A 2VUBA 1OPKA 4EPCA 2F2VA 4C0GA 4PJOC 2BZ8A 3JB9G 4OMMA 1QKWA 2DD4A 4M7AG 2O4XA 1YN8A 3PVLA 2RNAA 4XU3A 3CQTA 2RQVA 4ZNXA 1YIJT 1YIJQ 1M1KU 1WPYA 1OULA 1FMKA 2B8AA 4M78E 4QQ6A 4Q5WA 2KSSA 3TCJA 1GL5A 3VYGA 3GP8A 2HL3A 1RLPC 2DZCA 3VS2A 3N5BB 2AZSA 1U1TA 2X9HA 4KUDK 5GAOr 2SEMA 1NJIR 2CZ1B 4E7SA 2KK4A 1WHLA 1T0HA 2VGNA 3OYBA 1D0XA 4XTWA 1IHVA 3HRUA 1M9SA 4PFOA 3RBBB 3QSUA 1M2OA 1BIAA 1LVKA 3ZEHA 3L2ZA 1B3QA 4LN2A 4M78C 1M3AA 4PLIA 3SDZA 2G3RA 1WXTA 1V29B 1Q95G 5KCOA 3OYLA 1RI0A 2QQ9A 4C92E 5KYYB 2P84A 3OYJA 1VQ4T 1BU1A 2GFAA 5GMKi 2YRDA 2LJ1A 1AHJB 1VQ4Q 1OX9A 2GQVA 3CC7T 1D0ZA 1YJWA 3CC7Q 4OP0A 3VS4A 1EX4A 1MV0B 2RF0A 3MKDA 3E1SA 4F7UG 2X4YA 3CXCP 1ZUUA 3PFSA 2HAXA 1M1FA 2DO3A 4QT7A 3S3OA 2K5IA 3QKJA 1VA7A 2CP6A 2DD5A 1NEBA 2JS2A 2K3YA 2RI5A 3OYNA 5FLXE 3G4ST 5GANj 1T3LA 5A0LA 1OQKA 4C92C 4AFSC 3G4SQ 5GAMg 4PK4A 2CP7A 3HSBA 2HQEA 2OTLA 1W1FA 3I5SA 3M58A 1VQNT 2BZXA 1NG2A 1KHCA 4J6YA 5KYNA 1VQNQ 1RAHB 3JCMX 4KRTA 1PKTA 1YNZA 1JJ2P 3RERA 4EIKA 1G3SA 4M78D 2CT3A 2E41A 1G3YA 4JRQA 2OX7A 1WHJA 3UA6A 1KK7A 3OSSC 1M30A 1Q81U 1KQSA 2ZGWA 4OMQA 1SSHA 3QDRB 2EKOA 2ZPHB 2LRQA 1GCQC 5IN1A 3LWIA 4OB2B 4FYWB 4JS4A 1VQLA 2PVDB 3CC4T 4JJDA 1XJWB 3X28B 4IUVA 4QVCA 4MDXA 2JM8A 5KH6A 3UA7A 2A37A 1VQ7A 1JXOA 3V7CA 5I2MA 2NUPA 3QHSA 3JRZA 3M0PA 2XU8A 2EQUA 1M1GA 1QVPA 4C92D 1CKAA 2YRVA 2CP5A 1DJ7B 2HKNA 2KE9A 3EFOA 1TH7A 3SWNA 3J80E 4BE0A 4C5EA 4L5GA 2RB6A 2RMOA 2LDMA 1K76A 1R77A 1PC0A 2F2XA 3KBGA 1W2BP 2FG0A 2JJ9A 1OZ2A 3RKWA 1IXDA 1D3BA 5A0GA 5J26A 4M75A 3OYGA 4RTVA 3QZ5B 4M7DE 3FC3A 2YLBA 1UJ0A 1NPRA 2QI2A 3MP6A 4C5HA 2GCXA 3ER0A 2XD0A 5CO7A 1S72T 1ABQA 2LNHB 1S72Q 2LCCA 3MP8A 3EG3A 3NTKA 1QWEA 3NTHA 2A36A 4KH0B 1VUBA 1AT1B 2LQNA 4C0ZA 1SHFA 1A0NB 3CD6A 1G5VA 4WTOB 2DEQA 1I5OB 3MEWA 1OU9A 2FPDA 3JCMW 1OU8A 2K5LA 3EGDA 1VQ8T 2R58A 1VQ8Q 4LDYA 4M7DC 4C8QG 4HCKA 2JMCA 2PVGB 1HSQA 4J83A 5GMKh 3META 4M75F 2ED1A 3QG1A 1RACB 2DRMA 1AWOA 5IAYA 2DERA 1GFCA 5KYWA 1I4K1 5GMKm 1M3BA 3RDVA 4HCZA 2DJZA 3FIFA 1N5ZA 2JS0A 3RUXA 2PQWA 3I55T 3I55Q 3OS5A 2FRWA 3DKMA 5GAMe 4A53A 2O4XB 2LZ6B 2EW3A 1M2VA 3H0FA 1UDLA 3L2QA 3OBWA 2L8DA 4HVWA 2ZPGB 4B6MA 4PLLA 1VQPA 5CK9A 5I22A 2NUTB 2BIVA 2G6FX 2IPOB 2DNUA 3QO3A 1X69A 4X34A 3V8LA 2M0YA 1IGUA 1H3HA 1KC8C 2VVKA 2C0OA 1HYOA 2DKGA 2D9TA 4M7DD 3HRSA 1WHMA 3R6OA 3PMTA 3PIOA 3L2UA 3RIRA 3HP9A 2CKKA 2AK5A 2KROA 3C12A 2GGRA 4D6WA 2JZ2A 1I07A 2A28A 3OA6A 5GAN2 2ENMA 2KQWA 1RAEB 2O9SA 3QYGB 2MIOA 1J3TA 1ZBJA 1Q86C 3MJXA 3VV0A 4DBHA 1M8MA 4ANJA 3QZ9B 3CC2A 2LX9A 1PCXA 3M56A 1MMDA 1QVGS 5FU7C 4AFZC 4FT2A 3HTRA 3M53A 1WIEA 4EDUA 4OMNA 1VQ4A 3INZA 2C0TA 3EGUA 4Y28E 2JW4A 2QGGA 1RAAB 1BI3A 5GAMd 3A1PA 2HSEB 3M0SA 3MCAB 2VYTA 2P0KA 4MDWA 3VS6A 2V26A 2QXFA 3THKA 2HQXA 1G3TA 3REBB 2EYZA 2DYIA 4RTWA 1RUWA 2HBWA 2XG8D 1FX7A 3L2VA 2VGMA 5CQYA 5KYYA 1H3ZA 1U8RA 1IZ6A 4XTVA 3GBQA 3SB2A 3EG1A 2EQJA 2GTJA 1PSFA 3CCET 1PKSA 2EJGA 3CCEQ 5C0MA 2RN8A 2EAYA 4O5VA 1M4ZA 4DBQA 3BDLA 1RAIB 2AZVA 2K9GA 1UGRB 3JSCA 3GOXA 1MHNA 5GAOn 1M1KC 4QW2A 1MV3A 4ELZC 3OYEA 2QQBA 4BUGA 4HVUA 1GFDA 3OYDA 2JOYA 1Q82U 2LTOA 4L59A 2DXUA 2K3XA 2EGEA 3L2WA 4E7KA 3EFOB 4PJOG 5CKEA 3SWNB 4ATOA 2CGHA 3P8DA 2DVEA 2J6KA 1TUCA 4M75E 4MZMA 3MEUA 1KSWA 3SEMA 1YCYA 2K4YA 3T9NA 4KUIA 2YHTA 2QDLA 3UDCA 1RI9A 3SFMA 4MMLA 3EGXA 5LJ3g 1T0JA 2QTXA 4JRPA 2DE0X 3WVEB 3DB4A 1ZHIA 2VC8A 2VASA 3WXMB 4M7AA 4KH1B 3VYHB 3HKSA 2HMAA 2KAFA 2ESWA 4X9CA 3JCMf 2E5KA 2V8IA 4D8DA 1S1NA 4AFUC 1S72A 3VS3A 2I0NA 4J9DA 1IB8A 1ZSZA 4MZPA 3OS0A 2YSQA 2DYBA 1UJYA 1KFZA 1AWXA 3EGDB 5CQXA 3X20B 4M78G 3LH5A 1KC8R 2BTTA 4J8OA 1VYVA 3CMAT 4BDZA 2FO0A 3CMAQ 5GAMj 3UWNA 2QQSA 4Z02A 3M55A 2FYKA 2KT1A 2ROTA 4J7IA 4RMOA 3OW2P 4KT0E 2MAMA 1KJWA 3CXCS 1ZA1B 1K9AA 2E70A 4OF1A 5KYWB 3MEVA 1JB0E 4NS5A 1Q86R 2DLPA 3JB9F 3LYIA 2DM1A 1TXQA 4M7AF 2DFUA 4OMOA 2E65A 2VKNA 1IHWA 2QGFB 2QG9B 5C6SA 1Q81C 4RG8A 2L3PA 2EQIA 1IRXA 4C92G 4PJNA 5GANd 3VRZA 3OYIA 1BBZA 1YITT 2RQTA 1YITQ 2KDSA 1ACMB 3X25B 4XU2A 2XI9A 4F7UA 1Z9QA 4KBMB 2OI3A 4F16A 3D7SB 5HK0A 1TTHB 5FU6C 4M75D 3JV3A 4EMKB 3CCST 1T3SA 5CAIA 1QVFA 3CCSQ 2QDYB 5GAN4 1PWTA 2YLCA 2DIQA 3J7AF 1Q7YC 3CBPA 1YFNA 1MNDA 4LUEA 2DJQA 2JN0A 4HKEA 4LUDA 2LX7A 2R5AA 1Y96B 2HCKA 4PJOB 2RHUA 4CC4B 3FLGA 5IXBA 1KD1U 3H0HA 4F14A 3DB3A 1MMAA 4XTUA 1KIKA 3JCMQ 4HXJA 5LJ5g 2ED0A 2IG0A 4E7IA 1K73U 3A8GB 2Y4XA 4F7UF 5J3BA 3JCMd 2XDDA 2E12A 3CPWS 1WQWA 2NUTA 1W2BS 1JO8A 2DXBA 4JUVA 2CP2A 1NYFA 4DEXA 2J06A 1Y71A 3C94A 4HCCA 1RAGB 1UGPB 3NMZC 4CC3A 1QW1A 1KQ2A 2RJDA 1B34A 5CKBA 5LJ3e 2O2OA 2M16A 4E7ZA 1YHQT 1YHQQ 4M78B 2DL5A 2W10A 4M4ZA 2CT4A 3JCMV 2YWWA 2HL5C 2E3IA 3SD4A 2I2LA 1NJIU 2H3JA 2LJ3A 3L42A 1X2QA 2X51A 2FPEA 1PD0A 4LD9K 1MNEA 2D0NA 1SF9A 3BE3A 3URGA 1WHGA 1YJNT 1YJNQ 3GNGA 1KHIA 3CCVT 3CCVQ 3OB9A 1D1CA 2CUBA 4J9BA 2QA4A 1KG1A 1I0CA 2X4WA 3CCUT 2V8KA 5LL6S 3CCUQ 1HD3A 1U1SA 1UECA 1NPPA 2RPNA 4C92B 1M90C 4R56A 3LH0A 4PKCC 5GMKl 2BKDN 2K79A 5KE3A 3TU4K 2FPFA 3RKXA 1VQKT 2RHZA 1VQKQ 3A8LB 3U23A 4C8QA 3GPLA 3FB9A 3QIIA 2EJ9A 2FEIA 3H0IA 2LMJA 2RM4A 1RADB 3I35A 2OTJT 1VIEA 4JLGA 2OTJQ 3H41A 3JCMc 3CEYA 5D7UA 3FDRA 2ZZDA 3EGXB 3I56T 3PIPA 3X24B 3I56Q 2V1RA 4N4HA 2CZ0B 4GBQA 2LT1A 4M7AB 3FJ5A 3UPUA 1M3CA 1G83A 3EG9B 2EFIA 1UHCA 2LJ0A 3AHUA 2X35A 1N8RR 4PJJA 3CC4Q 1YI2T 1E6HA 2SRCA 1VQ5A 2DXTA 1OX8A 1YI2Q 1JBMA 2BE9B 1ZSZB 1I1JA 1E7OA 4RTYA 1WHHA 1VOMA 2X4JA 1YWPA 4C8QF 8AT1B 2K6DA 1OYXA 3H9NA 1BYMA 3E9FA 3G1JA 2EYQA 4FSXA 1P92A 1Q7YR 3CCJT 2A0FB 5LJ5e 3CCJQ 1K9MC 2D6FA 2X4XA 2LCSA 2EPDA 5CKFA 1XQHA 3CPWP 4OB1B 5D6YA 2Z0WA 5GAMh 3GLXA 3ZFJA 2IVWA 1UG1A 4DBFA 1ZBXA 2K3BA 3LW5E 1YJ9T 3VUBA 4OGEA 1YJ9Q 1LNXA 1UGQB 1SEMA 2L0AA 1QVGA 1QCFA 4FYXB 4XU1A 1UTIA 5IT9E 2DXCA 4ZN3A 4OMPA 3A8MB 3EHRA 3CCMT 1HJDA 3CCMQ 1VQ6T 4IURA 2CDTA 1W70A 2DL8A 1VQ9T 2E1HA 1VQ6Q 2YDLA 3QWYA 1VQ9Q 2QEXT 2DL7A 1D1BA 1B7TA 3TSWA 5GAMf 2QEXQ 3HPWA 3PVQA 4F7UB 4J9GA 4M77F 1BI1A 1BIBA 2MI6A 3BDUA 1O9SA 3A8OB 1YITA 3NHNA 4N4IA 3OSVA 2FRYA 9ATCB 2EWNA 1RLQC 3JB9D 4JDSA 4J6XA 4PL6A 2A3LA 2E3HA 3CCSA 2EJFA 4PFPA 1TSFA 1WJQA 2F5KA 1IREB 1EZZB 1RAFB 2MMPA 5LJ5d 4FSSA 2VV5A 5LJ3j 1K4US 1M90R 3EH2A 4IUTA 2P0PA 1YIJA 3CBOA 2A7YA 2AKLA 4IUQA 2QQRA 4LDVA 1QVFP 3RMSA 4BI3A 4ORZA 4EMKA 2EGCA 4M77G 1TS9A 2XKOC 2MWPA 5GAOl 2E6NA 1FYNA 2JM9A 3PMIA 3QUIA 1B34B 3IQLA 7AT1B 2JT4A 4O6JA 2F5TX 2RHIA 2EVRA 4JRKA 1C0MA 5KE2A 2CZ6B 1RL2A 1Y96A 4PJOA 4AT1B 4LDUA 1YHQA 1F1BB 6AT1B 2HBPA 2E64A 2E5QA 1HK9A 1R0CB 3JCMb 1GCPA 3V8JA 2B86A 4AG2C 1ARKA 1XNIA 4L6V5 4J9IA 1ABOA 5GMKe 2V1QA 1BB9A 2DF6A 2RA2A 1AWJA 3QYHB 5CKDA 2COWA 2PUKB 3OW2S 2EBPA 3CC7A 1PG5B 1TUGB 3CCVA 3PNWC 1LPLA 1FWZA 2KGTA 2YUNA 1QKXA 4E47A 2AIRB 2EGAA 2QQAA 5GAN7 4OMLA 3EAEA 2E6ZA 3CCUA 2HQHA 2XHCA 1JQQA 1K9MR 2YUOA 5GANh 1ZSGA 4EMHA 3G4SA 4M78A 4PJOF 2RI2A 3CMET 4C8QB 3CMEQ 5GAN3 1JXMA 2K7AA 3MO8A 1N6AA 3CXCA 2AT1B 2JNGA 5FRMA 1K8AU 4Z88A 2GQIA 1VQNA 1VQKA 1YCSB 4X1VA 2RHXA 4IIMA 2EYXA 2DMOA 5IH2A 4C0DB 2V8JA 1AD5A 1SKUB 3VJPA 1PHTA 1VQMT 2OTJA 5GANf 1VQMQ 2LP5A 4BI8B 1YJWT 1I81A 1C1AA 1YJWQ 1NLPC 1K73C 5LJ5j 4F04B 4FCYA 1JJ2A 2K57A 4C92A 3L2RA 4ZGJB 4M78F 3REAB 4BY6C 4JZ4A 2YRCA 1G8XA 4GY5A 3CC4A 1V1CA 3S3NA 1FMWA 4Y91A 1TUDA 4CRIA 4M77B 1ZQ1A 3ULRB 2OTLT 1PRLC 3JCMh 4DBRA 1E6GA 2OTLQ 3M5AA 3JAME 1ZUKA 1Y07A 4LNPA 4N4GA 3LGFA 3J81E 1WA7A 3MHXA 1AZGB 4XK8E 4J7FA 4OGCA 3CCJA 5GAOm 1KQSP 2VXEA 4LD6A 1LJOA 3M54A 1NJIC 1CSKA 2KYMA 2NWMA 2A08A 2X3WD 2C0IA 3QXEB 1D1AA 1GCQA 4IUUA 2DTIA 1V76A 3M0UA 5ECAA 4J9EA 3SWNC 1MMNA 4C92F 1YJ9A 3EG9A 2CH4W 4NOYA 2CSQA 2DETA 2RK2A 1RABB 1PM3A 1W2BA 4A4HA 4M75C 1VQLT 3EG2A 1OV3A 2YUPA 3VU3C 2FZGB 1SHGA 3G7ZA 1U5SA 2LQWA 2XMFA 3CCMA 1VQ7T 4J9HA 1LCKA 4A4EA 1VQ9A 1VQ7Q 1VQOT 1VQOQ 2PVOB 2ECZA 1EIFA 3QJ6A 3PT9A 4RTUA 2MPXC 2OAUA 1VQ8A 3GIBA 4OMFB 2YT6A 2R57A 2L2PA 3KUFA 4ELYC 4IUPA 5IHKA 5KCHA 5IHNA 3LX7A 2HDAA 4RTZA 3UT1A 1ZA2B 3S3MA 4HT8A 3HFOA 2KYBA 1O75A 2COZA 2O01E 3M59A 3I55A 1VYTA 1UB4A 3EFSA 3NFCA 1Q86U 2GTOA 2FL7A 3ZL7C 4CC2A 2PTKA 2F69A 2M51A 1LOJA 2CUDA 3CD6T 3L1AA 3OS2A 4RKUE 4XTZA 3CD6Q 4J9CA 1JU5C 3TREA 1UFFA 5GJWB 4XTXA 3NGPA 2JTMA 2L3SA 2Y4YA 4V2SA 1X2KA 4IIOA 2DA9A 3OYMA 5GMKj 4DA4A 1JRIA 2DTHA 4QQGA 2MK5A 4K11A 2HEQA 3X26B 2L3RA 2JVVA 1JEGA 1WLPB 3C4SA 5DM7R 4KULA 4J9FA 1M1KR 2DK3A 4ZTJA 2DEUA 1WJSA 1U06A 3NTIA 3PE0A 4M7DF 4B9WA 2EYWA 4JLIA 3TQ7P 2EIFA 2RH2A 2DBKA 2YXYA 3OYKA 2M1HA 3VKIA 1NZ9A 1VQPT 3BFMA 2RO0A 1QQJA 5GAOp 4JPBW 2ZPIB 3M4YA 1VQPQ 4JRIA 1BKBA 1GBQA 2DL3A 3JB9J 4JJCA 4PNOA 1NBEB 3QWXX 3CCLT 2O88A 3PTAA 1BI0A 1UHFA 3CCLQ 1X27A 3OYYA 3VS0A 3OYCA 4KGZB 1X01A 4BE2A 1UEBA 1H641 2K2VA 4A63B 2VXFA 3CMEA 3OMCA 4DOVA 4A54A 1R8OB 3M57A 4LDWA 1QLYA 3KXTA 3I5RA 1N27A 1NM7A 5LJ3f 5CIUA 1H8KA 3G6ET 3CC2T 2DAQA 2F1LA 3G6EQ 4EMGA 3CC2Q 5DY9A 3CCEA 1WZOA 4GLKA 2XDPA 1K0SA 4M7DG 5KYUB 3RESA 1GBRA 2JXBA 4F17A 2KEAA 1OEBA 1VQMA 4QVDA 4PJOD 4RCBA 3Q1JA 4MZTA 4HCBA 5LJ5h 3NPFA 1M8VA 3O8VA 4ZGEB 1UE9A 3FJPA 1XTDA 2ZAEA 2AHJB 4UC4A 5I21A 4D8KA 2D8JA 1CKBA 2OJ2A 2BZYA 4CC7A 4Y92A 3RNJA 5CR2A 2EQKA 3DLLA 2FZKB 2DX1A 4GLMA 3GNFB 4R55A 1QVFS 5LJ3d 3A5ZB 2DVJA 5LJ5f 4M7AE 1Q81R 2KXCA 5I11A 2O31A 2YUQA 1VIFA 2XICA 2ATCB 4RUGA 4ZGDB 5AYFA 5HKCA 1WXBA 2P0QA 5FRNA 3LWHA 1AZEA 1NLOC 1BK2A 4N0AA 3QPHA 2DRKA 1G3WA 2LNVA 2PNIA 5FROA 3MEAA 5CKHA 2F2WA 3E19A 2DL4A 4RCCA 3G71T 2BE7D 1M5Q1 2RQWA 3G71Q 3M0QA 1R0BG 4JS5A 4M7AC 2CYZB 5FWBA 3HRTA 4M77A 1FXXA 4C5IA 5EC7A 2DTOA 1N8RU 2CZ7B 3CCQT 5HCKA 3CCQQ 1WHKA 4ZN1A 4TVRA 3M4GA 1VQOA 1WX6A 4FYYB 1ZSZC 2R5MA 3CMAA 1OOTA 3VRYA 3I9QA 2ROLA 1UGVA 3JB9H 1K8AC 1QP3A 2E4HA 2KRMA 5IHIA 4J6WA 2HKQB 1Q7YU 2RI3A 1QCNA 1FMVA 5KYXA 3F70A 1PD1A 2J7IA 2L5QA 1U3OA 4FIBA 1BCOA 4C0FA 1HXDA 1NEGA 3TVTA 1PRMC 3CCRT 2KRSA 4KGVB 2DIGA 3CCRQ 2D0QB 2O9VA 4OB0B 3OW2A 2DPPB 3OBYA 4F7UE 2CS7A 4Z8AA 3OMGA 3A8HB 1OZ3A 2D8HA 2MCNA 3RMQA 2MYSA 2PU9B 2XK0A 2M9UA 4M7DB 4ME7A 2L89A 1SRMA 3V7RA 2XDBA 1C6VX 4A4FA 1NYGA 4J5YA 1Q82C 4DEYA 2COYA 3FEOA 4PJLA 4ZTFA 4M7AD 4ESRA 1AOJA 2H3EB 4JJBA 1QP2A 2KVQG 3QBYA 3TSZA 5DLOA 2IIMA 3V7SA 1G2BA 5I2SA 1WGSA 1VYUA 1KQ1A 1YP5A 2D1XA 1UGSB 2DILA 3E9GA 4BACA 1ZX6A 5FWCA 2K2MA 2L3QA 3C0CA 1XOVA 1K0XA 1MGQA 1N9RA 2PZ1A 5DLQE 4P5NA 2EYYA 4C5GA 5HK3A 2RQRA 2VWFA 3H8ZA 1X43A 4HVVA 1GRIA 4PJMA 1NE8A 2JTEA 3EH1A 3RR6A 1KQSS 1MMGA 3E2UA 3EHQA 4NL3A 4JZ3A 3R6NA 2J6OA 1QMCA 2AKKA 1WQ7A 1WYXA 3UF4A 2NYSA 2ABLA 5GANg 1IO6A 2FB7A 2CREA 1M90U 3FRNA 4LXCA 5D6XA 1X6GA 1X75C 2WSFE 2C06A 1GXIE 3CCLA 5AT1B 4IKFA 4MMKA 2LC4A 3OQ5A 2DZ9A 2KR3A 3M0RA 1PSEA 2XIDA 5GAN6 3OS1A 2W0ZA 4WF2A 4NL2A 5FU7B 5GAOq 4M75G 4JJNK 4E7JA 2RJCA 3KFVA 3S6WA 3AT1B 4PFZA 1YBYA 3OYHA 4BE1A 3CBMA 3DLMA 3TEEA 4E6RA 4HA8A 1ZLMA 4KGXB 1YJNA 1I5LA 1OI1A 4A4GA 3G6EA 2FZCB 3UATA 3VS1A 2KXDA 3P8BB 5GAN8 3BY7A 3PGGA 1I8FA 1WI7A 4C8QE 4DOWA 3JCMg 8ATCB 2KY9A 2LT4A 3P8HA 3WVDB 2VB6A 2M0OA 1H92A 2CSIA 2LVMA 1EFNA 3LGLA 1K8AR 2CP3A 2HSPA 4LE9A 2E10A 1K9MU 3A98A 1KD1C 2QAZA 3BW1A 3QDFA 2J6FA 2LQKA 2JMAA 2RK1A 4Z89A 1B07A 2M02A 2ZPEB 2QASA 4C8QC 1AVZC 3O5ZA 1X6BA 4BB7A 1TU0B 5KYUA 2JTFA 2MWOA 3I56A 3HHTB 4FU6A 2QA4T 1M27C 1QWFA 2RJEA 3MPUB 2KNBB 2QA4Q 5M9OA 1QCOA 4C0DC 4BY6B 2ZPBB 1UUEA 2QK0A 1Q82R 4M77E 3JB9I 1YI2A 4YTLA 5HY6A 5CCAA 1SSFA 2DBMA 2KI7A 2GF7A 3JCMJ 3OY9A 2KMTA 3H6ZA 5D6WA 3SHWA 1WDXA 2MF2A 3RKYA 3G71A 4QKUA 2KBTA 2Y90A 4N0AC 1TG0A 2EKHA 2NUPB 4XAXB 1WJRA 3GF5A 4OB3B 4E7LA 4QQDA 5GAN5 3CCQA 4CI0C 4RG2A 4FT4A 1Y7XA 3QJYA 2LQ8A 2RQUA 4LDXA 3VUZA 2HNIA 1WFWA 4VUBA 3VS7A 4M77C 5KYXB 2FVUA 1TOVA 2WSCE 4HT9A 5GANe 2QYZA 2X3XD 3EFRA 4RTTA 1PNJA 1D3BB 2KT8A 2PUOB 2RJFA 4C8QD 3CPWA 3ME9A 4M75B 4II1A 2J05A 1VQLQ 4BI4A 3CCRA 2K5FA 4AMCA 3ASKA 1VQ5T 1MUZA 3MP1A 1VQ5Q 2HD0A 2FHDA 1VQ6A 2ZCFB 1YWOA 2KRNA 3HL8A 5CVIA 4A4KA 3C95A 4FW2A 5L23A 2QEXA 5J39A 2NLUA 3OYAA 2WSEE 1Y0MA 1SPKA 3VS5A 5A2QE 4E7HA 1D0YA 2GFUA 5A0DA 2P4RA 2P4TA 2LCLA 2BUDA 5EG2A 1KC8U 4FW1A 4FL6A 1QVGP 2NUZA 4QVZA 2CH4A 3HFNA 4XQ3A 1N9SA 4FYVB 1X6OA 1W6XA 4M77D 3JCMe 1SRLA 2GNCA 2WACA 1BCMA 3V8KA 3ZBDA 1WXUA 5L8RE 2HZYA 4BD3A 1ZUYA 4DQ2A 4E2FB 2JUFA 4R0KA 3M0TA 3LLRA 5FW9A 5LJ3h 5FU6B 2MOXA 4M7DA 4OVAA 1AWWA 1M2VB 1BI2A 2ZPFB 1D09B 1OPLA 1WNLA 1AEYA 4X9DA 4WCIA 3CPFA 2EQMA 1JJ2S 2GBQA 4FM4B 4PJOE 2RHYA 1N8RC 5GJVB 3OYFA 3M9QA 1W4SA 1TWBA 4AG1C 1K1ZA 1Z9ZA 5IXFA 4RTXA 4EMKC 2OAWA 1KD1R 3EG0A 4XU0A 2QTVA 4B9XA
chains in the Genus database with same CATH topology
2YUQA 1Y57A 4RUGA 2H8HA 2AKLA 4ORZA 1WXBA 2EGEA 1AZEA 1NLOC 2EGCA 4AFQC 1BK2A 2DRKA 1OPKA 2PNIA 1FYNA 2F2VA 2JM9A 2F2WA 3IQLA 2J6KA 1TUCA 2BZ8A 2DL4A 2JT4A 4OMMA 1QKWA 1KSWA 3SEMA 1YN8A 3PVLA 2RNAA 2EVRA 2RQWA 3M0QA 5FWBA 2QDLA 3CQTA 2RQVA 4ZNXA 1RI9A 5EC7A 1FMKA 5HCKA 1T0JA 2DE0X 1WX6A 1GCPA 1OOTA 1GL5A 4AG2C 2B86A 1ARKA 3VRYA 1RLPC 3VS2A 2ESWA 2ROLA 3I9QA 1UGVA 2AZSA 2KRMA 5IHIA 2E5KA 4J9IA 4D8DA 1ABOA 1S1NA 4AFUC 2SEMA 3VS3A 2I0NA 2V1QA 4J9DA 1BB9A 2DF6A 1AWJA 2J7IA 2YSQA 1U3OA 2DYBA 1T0HA 2EBPA 1UJYA 1KFZA 1AWXA 1NEGA 3RBBB 3TVTA 1PRMC 3LH5A 2KRSA 2BTTA 2O9VA 2KGTA 1B3QA 1VYVA 2YUNA 2FO0A 1M3AA 1QKXA 4LN2A 1WXTA 2EGAA 4OMLA 4Z8AA 2D8HA 2KT1A 2MCNA 2ROTA 1JQQA 2YUOA 1ZSGA 1KJWA 1SRMA 1BU1A 1K9AA 2LJ1A 1NYGA 1JXMA 2K7AA 2DLPA 4DEYA 2DM1A 4OMOA 4Z88A 3VS4A 2VKNA 2GQIA 1MV0B 2RF0A 1YCSB 4ESRA 4X1VA 4IIMA 1AOJA 2EYXA 4JJBA 3TSZA 1ZUUA 2IIMA 2L3PA 2EQIA 2DMOA 1G2BA 5IH2A 4QT7A 1AD5A 1VA7A 1NEBA 1VYUA 2JS2A 1YP5A 3VRZA 1T3LA 2D1XA 1PHTA 2DILA 4AFSC 1BBZA 1ZX6A 2LP5A 2RQTA 5FWCA 2K2MA 2L3QA 3C0CA 1XOVA 1K0XA 2PZ1A 1Z9QA 2OI3A 1NLPC 4F16A 1W1FA 3I5SA 2BZXA 1NG2A 3JV3A 2EYYA 2RQRA 1T3SA 2VWFA 4KRTA 1X43A 1PWTA 4HVVA 3REAB 1PKTA 1YNZA 4JZ4A 1GRIA 1V1CA 2JTEA 4EIKA 2CT3A 1TUDA 4LUEA 2DJQA 3EHQA 3UA6A 4JZ3A 3R6NA 2J6OA 2AKKA 1M30A 3ULRB 4LUDA 1PRLC 2LX7A 1E6GA 2HCKA 4CC4B 1WYXA 1ZUKA 3UF4A 4LNPA 5IXBA 2ABLA 4OMQA 1IO6A 1SSHA 1WA7A 3H0HA 4F14A 2CREA 1GCQC 1X6GA 1AZGB 1KIKA 4HXJA 2ED0A 4JJDA 1CSKA 2KYMA 2NWMA 2A08A 2X3WD 2C0IA 2JM8A 2KR3A 1GCQA 3M0RA 3UA7A 2A37A 1JXOA 3M0UA 5ECAA 4J9EA 3M0PA 1JO8A 2W0ZA 2CH4W 1NYFA 4DEXA 1CKAA 2J06A 2CSQA 3KFVA 2KE9A 3NMZC 4CC3A 3EG2A 1OV3A 2YUPA 4E6RA 1ZLMA 2O2OA 2RMOA 1SHGA 1U5SA 2LQWA 1K76A 2XMFA 2F2XA 2FG0A 4J9HA 2DL5A 2W10A 1LCKA 4M4ZA 2CT4A 3UATA 4RTVA 3VS1A 2ECZA 2KXDA 1UJ0A 4RTUA 2LJ3A 1WI7A 2YT6A 1X2QA 1ABQA 2LNHB 2FPEA 2L2PA 3EG3A 2D0NA 1QWEA 5IHKA 2A36A 1H92A 2CSIA 2LQNA 5IHNA 2HDAA 1SHFA 4RTZA 1A0NB 1EFNA 2HSPA 2FPDA 2CUBA 4J9BA 4LE9A 2KYBA 1I0CA 1HD3A 3A98A 1UECA 1VYTA 2RPNA 2J6FA 4HCKA 2JMAA 4Z89A 1B07A 2GTOA 2JMCA 3ZL7C 4CC2A 1HSQA 1AVZC 2PTKA 3O5ZA 1X6BA 2M51A 2K79A 2FPFA 2CUDA 2ED1A 4J9CA 2DRMA 1AWOA 1M27C 1GFCA 1QWFA 2KNBB 3U23A 1M3BA 1JU5C 1N5ZA 2JS0A 2FEIA 3H0IA 1UFFA 1UUEA 5GJWB 3NGPA 2LMJA 2FRWA 3I35A 2L3SA 1X2KA 4IIOA 2LZ6B 2DA9A 2EW3A 3H41A 3H0FA 1UDLA 2DBMA 3SHWA 1WDXA 4HVWA 2KBTA 2V1RA 1TG0A 2EKHA 4GBQA 2HEQA 4K11A 3FJ5A 5I22A 1M3CA 1JEGA 1G83A 1WLPB 2G6FX 2DNUA 1UHCA 2LJ0A 4J9FA 1X69A 2RQUA 1E6HA 2SRCA 1WFWA 3VS7A 2M0YA 3PE0A 1U06A 1I1JA 1E7OA 2EYWA 4RTYA 1H3HA 2VVKA 2C0OA 2DBKA 1YWPA 2K6DA 2X3XD 4RTTA 1PNJA 2KT8A 4JPBW 1GBQA 2AK5A 2DL3A 2KROA 2GGRA 4JJCA 2J05A 2LCSA 1I07A 2EPDA 2A28A 2ENMA 3QWXX 2O88A 1MUZA 2O9SA 2MIOA 1J3TA 1UHFA 1X27A 1ZBJA 3VS0A 1YWOA 2KRNA 1UG1A 1M8MA 5L23A 2K3BA 4AFZC 1WIEA 1Y0MA 1SEMA 1SPKA 4OMNA 2L0AA 3VS5A 4A63B 1QCFA 2C0TA 3EGUA 2JW4A 1UTIA 2P4RA 4OMPA 1QLYA 3EHRA 1HJDA 3I5RA 1NM7A 2CDTA 1H8KA 1W70A 2DL8A 3M0SA 2YDLA 2NUZA 3QWYA 2DL7A 3TSWA 3VS6A 1K0SA 3PVQA 2CH4A 4J9GA 1GBRA 2JXBA 4F17A 2KEAA 3THKA 1OEBA 1W6XA 1SRLA 2GNCA 3NHNA 4HVUA 3REBB 2EYZA 1WXUA 4RTWA 1RUWA 2FRYA 2HBWA 1ZUYA 3NPFA 1RLQC 4R0KA 3M0TA 5FW9A 2MOXA 1UE9A 3GBQA 3EG1A 1AWWA 2GTJA 1PKSA 1OPLA 4D8KA 2D8JA 1CKBA 2OJ2A 2RN8A 2BZYA 1AEYA 4WCIA 4CC7A 4Y92A 3RNJA 2AZVA 2K9GA 2GBQA 2DX1A 4GLMA 5GJVB 4FSSA 1MV3A 4AG1C 2DVJA 1K1ZA 1Z9ZA 2KXCA 5IXFA 1K4US 4RTXA 2OAWA 3EG0A 5I11A 2O31A 1GFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUQ A;  1Y57 A;  4RUG A;  2H8H A;  2AKL A;  4ORZ A;  1WXB A;  2EGE A;  1AZE A;  1NLO C;  2EGC A;  4AFQ C;  1BK2 A;  2DRK A;  1OPK A;  2PNI A;  1FYN A;  2F2V A;  2JM9 A;  2F2W A;  3IQL A;  2J6K A;  1TUC A;  2BZ8 A;  2DL4 A;  2JT4 A;  4OMM A;  1QKW A;  1KSW A;  3SEM A;  1YN8 A;  3PVL A;  2RNA A;  2EVR A;  2RQW A;  3M0Q A;  5FWB A;  2QDL A;  3CQT A;  2RQV A;  4ZNX A;  1RI9 A;  5EC7 A;  1FMK A;  5HCK A;  1T0J A;  2DE0 X;  1WX6 A;  1GCP A;  1OOT A;  1GL5 A;  4AG2 C;  2B86 A;  1ARK A;  3VRY A;  1RLP C;  3VS2 A;  2ESW A;  2ROL A;  3I9Q A;  1UGV A;  2AZS A;  2KRM A;  5IHI A;  2E5K A;  4J9I A;  4D8D A;  1ABO A;  1S1N A;  4AFU C;  2SEM A;  3VS3 A;  2I0N A;  2V1Q A;  4J9D A;  1BB9 A;  2DF6 A;  1AWJ A;  2J7I A;  2YSQ A;  1U3O A;  2DYB A;  1T0H A;  2EBP A;  1UJY A;  1KFZ A;  1AWX A;  1NEG A;  3RBB B;  3TVT A;  1PRM C;  3LH5 A;  2KRS A;  2BTT A;  2O9V A;  2KGT A;  1B3Q A;  1VYV A;  2YUN A;  2FO0 A;  1M3A A;  1QKX A;  4LN2 A;  1WXT A;  2EGA A;  4OML A;  4Z8A A;  2D8H A;  2KT1 A;  2MCN A;  2ROT A;  1JQQ A;  2YUO A;  1ZSG A;  1KJW A;  1SRM A;  1BU1 A;  1K9A A;  2LJ1 A;  1NYG A;  1JXM A;  2K7A A;  2DLP A;  4DEY A;  2DM1 A;  4OMO A;  4Z88 A;  3VS4 A;  2VKN A;  2GQI A;  1MV0 B;  2RF0 A;  1YCS B;  4ESR A;  4X1V A;  4IIM A;  1AOJ A;  2EYX A;  4JJB A;  3TSZ A;  1ZUU A;  2IIM A;  2L3P A;  2EQI A;  2DMO A;  1G2B A;  5IH2 A;  4QT7 A;  1AD5 A;  1VA7 A;  1NEB A;  1VYU A;  2JS2 A;  1YP5 A;  3VRZ A;  1T3L A;  2D1X A;  1PHT A;  2DIL A;  4AFS C;  1BBZ A;  1ZX6 A;  2LP5 A;  2RQT A;  5FWC A;  2K2M A;  2L3Q A;  3C0C A;  1XOV A;  1K0X A;  2PZ1 A;  1Z9Q A;  2OI3 A;  1NLP C;  4F16 A;  1W1F A;  3I5S A;  2BZX A;  1NG2 A;  3JV3 A;  2EYY A;  2RQR A;  1T3S A;  2VWF A;  4KRT A;  1X43 A;  1PWT A;  4HVV A;  3REA B;  1PKT A;  1YNZ A;  4JZ4 A;  1GRI A;  1V1C A;  2JTE A;  4EIK A;  2CT3 A;  1TUD A;  4LUE A;  2DJQ A;  3EHQ A;  3UA6 A;  4JZ3 A;  3R6N A;  2J6O A;  2AKK A;  1M30 A;  3ULR B;  4LUD A;  1PRL C;  2LX7 A;  1E6G A;  2HCK A;  4CC4 B;  1WYX A;  1ZUK A;  3UF4 A;  4LNP A;  5IXB A;  2ABL A;  4OMQ A;  1IO6 A;  1SSH A;  1WA7 A;  3H0H A;  4F14 A;  2CRE A;  1GCQ C;  1X6G A;  1AZG B;  1KIK A;  4HXJ A;  2ED0 A;  4JJD A;  1CSK A;  2KYM A;  2NWM A;  2A08 A;  2X3W D;  2C0I A;  2JM8 A;  2KR3 A;  1GCQ A;  3M0R A;  3UA7 A;  2A37 A;  1JXO A;  3M0U A;  5ECA A;  4J9E A;  3M0P A;  1JO8 A;  2W0Z A;  2CH4 W;  1NYF A;  4DEX A;  1CKA A;  2J06 A;  2CSQ A;  3KFV A;  2KE9 A;  3NMZ C;  4CC3 A;  3EG2 A;  1OV3 A;  2YUP A;  4E6R A;  1ZLM A;  2O2O A;  2RMO A;  1SHG A;  1U5S A;  2LQW A;  1K76 A;  2XMF A;  2F2X A;  2FG0 A;  4J9H A;  2DL5 A;  2W10 A;  1LCK A;  4M4Z A;  2CT4 A;  3UAT A;  4RTV A;  3VS1 A;  2ECZ A;  2KXD A;  1UJ0 A;  4RTU A;  2LJ3 A;  1WI7 A;  2YT6 A;  1X2Q A;  1ABQ A;  2LNH B;  2FPE A;  2L2P A;  3EG3 A;  2D0N A;  1QWE A;  5IHK A;  2A36 A;  1H92 A;  2CSI A;  2LQN A;  5IHN A;  2HDA A;  1SHF A;  4RTZ A;  1A0N B;  1EFN A;  2HSP A;  2FPD A;  2CUB A;  4J9B A;  4LE9 A;  2KYB A;  1I0C A;  1HD3 A;  3A98 A;  1UEC A;  1VYT A;  2RPN A;  2J6F A;  4HCK A;  2JMA A;  4Z89 A;  1B07 A;  2GTO A;  2JMC A;  3ZL7 C;  4CC2 A;  1HSQ A;  1AVZ C;  2PTK A;  3O5Z A;  1X6B A;  2M51 A;  2K79 A;  2FPF A;  2CUD A;  2ED1 A;  4J9C A;  2DRM A;  1AWO A;  1M27 C;  1GFC A;  1QWF A;  2KNB B;  3U23 A;  1M3B A;  1JU5 C;  1N5Z A;  2JS0 A;  2FEI A;  3H0I A;  1UFF A;  1UUE A;  5GJW B;  3NGP A;  2LMJ A;  2FRW A;  3I35 A;  2L3S A;  1X2K A;  4IIO A;  2LZ6 B;  2DA9 A;  2EW3 A;  3H41 A;  3H0F A;  1UDL A;  2DBM A;  3SHW A;  1WDX A;  4HVW A;  2KBT A;  2V1R A;  1TG0 A;  2EKH A;  4GBQ A;  2HEQ A;  4K11 A;  3FJ5 A;  5I22 A;  1M3C A;  1JEG A;  1G83 A;  1WLP B;  2G6F X;  2DNU A;  1UHC A;  2LJ0 A;  4J9F A;  1X69 A;  2RQU A;  1E6H A;  2SRC A;  1WFW A;  3VS7 A;  2M0Y A;  3PE0 A;  1U06 A;  1I1J A;  1E7O A;  2EYW A;  4RTY A;  1H3H A;  2VVK A;  2C0O A;  2DBK A;  1YWP A;  2K6D A;  2X3X D;  4RTT A;  1PNJ A;  2KT8 A;  4JPB W;  1GBQ A;  2AK5 A;  2DL3 A;  2KRO A;  2GGR A;  4JJC A;  2J05 A;  2LCS A;  1I07 A;  2EPD A;  2A28 A;  2ENM A;  3QWX X;  2O88 A;  1MUZ A;  2O9S A;  2MIO A;  1J3T A;  1UHF A;  1X27 A;  1ZBJ A;  3VS0 A;  1YWO A;  2KRN A;  1UG1 A;  1M8M A;  5L23 A;  2K3B A;  4AFZ C;  1WIE A;  1Y0M A;  1SEM A;  1SPK A;  4OMN A;  2L0A A;  3VS5 A;  4A63 B;  1QCF A;  2C0T A;  3EGU A;  2JW4 A;  1UTI A;  2P4R A;  4OMP A;  1QLY A;  3EHR A;  1HJD A;  3I5R A;  1NM7 A;  2CDT A;  1H8K A;  1W70 A;  2DL8 A;  3M0S A;  2YDL A;  2NUZ A;  3QWY A;  2DL7 A;  3TSW A;  3VS6 A;  1K0S A;  3PVQ A;  2CH4 A;  4J9G A;  1GBR A;  2JXB A;  4F17 A;  2KEA A;  3THK A;  1OEB A;  1W6X A;  1SRL A;  2GNC A;  3NHN A;  4HVU A;  3REB B;  2EYZ A;  1WXU A;  4RTW A;  1RUW A;  2FRY A;  2HBW A;  1ZUY A;  3NPF A;  1RLQ C;  4R0K A;  3M0T A;  5FW9 A;  2MOX A;  1UE9 A;  3GBQ A;  3EG1 A;  1AWW A;  2GTJ A;  1PKS A;  1OPL A;  4D8K A;  2D8J A;  1CKB A;  2OJ2 A;  2RN8 A;  2BZY A;  1AEY A;  4WCI A;  4CC7 A;  4Y92 A;  3RNJ A;  2AZV A;  2K9G A;  2GBQ A;  2DX1 A;  4GLM A;  5GJV B;  4FSS A;  1MV3 A;  4AG1 C;  2DVJ A;  1K1Z A;  1Z9Z A;  2KXC A;  5IXF A;  1K4U S;  4RTX A;  2OAW A;  3EG0 A;  5I11 A;  2O31 A;  1GFD A; 
#chains in the Genus database with same CATH topology
 4XTY A;  1Y57 A;  2H8H A;  2CP0 A;  2RD1 A;  1IGQ A;  4BDY A;  3JCM P;  1K73 R;  4AFQ C;  1SG5 A;  2VUB A;  1OPK A;  4EPC A;  2F2V A;  4C0G A;  4PJO C;  2BZ8 A;  3JB9 G;  4OMM A;  1QKW A;  2DD4 A;  4M7A G;  2O4X A;  1YN8 A;  3PVL A;  2RNA A;  4XU3 A;  3CQT A;  2RQV A;  4ZNX A;  1YIJ T;  1YIJ Q;  1M1K U;  1WPY A;  1OUL A;  1FMK A;  2B8A A;  4M78 E;  4QQ6 A;  4Q5W A;  2KSS A;  3TCJ A;  1GL5 A;  3VYG A;  3GP8 A;  2HL3 A;  1RLP C;  2DZC A;  3VS2 A;  3N5B B;  2AZS A;  1U1T A;  2X9H A;  4KUD K;  5GAO r;  2SEM A;  1NJI R;  2CZ1 B;  4E7S A;  2KK4 A;  1WHL A;  1T0H A;  2VGN A;  3OYB A;  1D0X A;  4XTW A;  1IHV A;  3HRU A;  1M9S A;  4PFO A;  3RBB B;  3QSU A;  1M2O A;  1BIA A;  1LVK A;  3ZEH A;  3L2Z A;  1B3Q A;  4LN2 A;  4M78 C;  1M3A A;  4PLI A;  3SDZ A;  2G3R A;  1WXT A;  1V29 B;  1Q95 G;  5KCO A;  3OYL A;  1RI0 A;  2QQ9 A;  4C92 E;  5KYY B;  2P84 A;  3OYJ A;  1VQ4 T;  1BU1 A;  2GFA A;  5GMK i;  2YRD A;  2LJ1 A;  1AHJ B;  1VQ4 Q;  1OX9 A;  2GQV A;  3CC7 T;  1D0Z A;  1YJW A;  3CC7 Q;  4OP0 A;  3VS4 A;  1EX4 A;  1MV0 B;  2RF0 A;  3MKD A;  3E1S A;  4F7U G;  2X4Y A;  3CXC P;  1ZUU A;  3PFS A;  2HAX A;  1M1F A;  2DO3 A;  4QT7 A;  3S3O A;  2K5I A;  3QKJ A;  1VA7 A;  2CP6 A;  2DD5 A;  1NEB A;  2JS2 A;  2K3Y A;  2RI5 A;  3OYN A;  5FLX E;  3G4S T;  5GAN j;  1T3L A;  5A0L A;  1OQK A;  4C92 C;  4AFS C;  3G4S Q;  5GAM g;  4PK4 A;  2CP7 A;  3HSB A;  2HQE A;  2OTL A;  1W1F A;  3I5S A;  3M58 A;  1VQN T;  2BZX A;  1NG2 A;  1KHC A;  4J6Y A;  5KYN A;  1VQN Q;  1RAH B;  3JCM X;  4KRT A;  1PKT A;  1YNZ A;  1JJ2 P;  3RER A;  4EIK A;  1G3S A;  4M78 D;  2CT3 A;  2E41 A;  1G3Y A;  4JRQ A;  2OX7 A;  1WHJ A;  3UA6 A;  1KK7 A;  3OSS C;  1M30 A;  1Q81 U;  1KQS A;  2ZGW A;  4OMQ A;  1SSH A;  3QDR B;  2EKO A;  2ZPH B;  2LRQ A;  1GCQ C;  5IN1 A;  3LWI A;  4OB2 B;  4FYW B;  4JS4 A;  1VQL A;  2PVD B;  3CC4 T;  4JJD A;  1XJW B;  3X28 B;  4IUV A;  4QVC A;  4MDX A;  2JM8 A;  5KH6 A;  3UA7 A;  2A37 A;  1VQ7 A;  1JXO A;  3V7C A;  5I2M A;  2NUP A;  3QHS A;  3JRZ A;  3M0P A;  2XU8 A;  2EQU A;  1M1G A;  1QVP A;  4C92 D;  1CKA A;  2YRV A;  2CP5 A;  1DJ7 B;  2HKN A;  2KE9 A;  3EFO A;  1TH7 A;  3SWN A;  3J80 E;  4BE0 A;  4C5E A;  4L5G A;  2RB6 A;  2RMO A;  2LDM A;  1K76 A;  1R77 A;  1PC0 A;  2F2X A;  3KBG A;  1W2B P;  2FG0 A;  2JJ9 A;  1OZ2 A;  3RKW A;  1IXD A;  1D3B A;  5A0G A;  5J26 A;  4M75 A;  3OYG A;  4RTV A;  3QZ5 B;  4M7D E;  3FC3 A;  2YLB A;  1UJ0 A;  1NPR A;  2QI2 A;  3MP6 A;  4C5H A;  2GCX A;  3ER0 A;  2XD0 A;  5CO7 A;  1S72 T;  1ABQ A;  2LNH B;  1S72 Q;  2LCC A;  3MP8 A;  3EG3 A;  3NTK A;  1QWE A;  3NTH A;  2A36 A;  4KH0 B;  1VUB A;  1AT1 B;  2LQN A;  4C0Z A;  1SHF A;  1A0N B;  3CD6 A;  1G5V A;  4WTO B;  2DEQ A;  1I5O B;  3MEW A;  1OU9 A;  2FPD A;  3JCM W;  1OU8 A;  2K5L A;  3EGD A;  1VQ8 T;  2R58 A;  1VQ8 Q;  4LDY A;  4M7D C;  4C8Q G;  4HCK A;  2JMC A;  2PVG B;  1HSQ A;  4J83 A;  5GMK h;  3MET A;  4M75 F;  2ED1 A;  3QG1 A;  1RAC B;  2DRM A;  1AWO A;  5IAY A;  2DER A;  1GFC A;  5KYW A;  1I4K 1;  5GMK m;  1M3B A;  3RDV A;  4HCZ A;  2DJZ A;  3FIF A;  1N5Z A;  2JS0 A;  3RUX A;  2PQW A;  3I55 T;  3I55 Q;  3OS5 A;  2FRW A;  3DKM A;  5GAM e;  4A53 A;  2O4X B;  2LZ6 B;  2EW3 A;  1M2V A;  3H0F A;  1UDL A;  3L2Q A;  3OBW A;  2L8D A;  4HVW A;  2ZPG B;  4B6M A;  4PLL A;  1VQP A;  5CK9 A;  5I22 A;  2NUT B;  2BIV A;  2G6F X;  2IPO B;  2DNU A;  3QO3 A;  1X69 A;  4X34 A;  3V8L A;  2M0Y A;  1IGU A;  1H3H A;  1KC8 C;  2VVK A;  2C0O A;  1HYO A;  2DKG A;  2D9T A;  4M7D D;  3HRS A;  1WHM A;  3R6O A;  3PMT A;  3PIO A;  3L2U A;  3RIR A;  3HP9 A;  2CKK A;  2AK5 A;  2KRO A;  3C12 A;  2GGR A;  4D6W A;  2JZ2 A;  1I07 A;  2A28 A;  3OA6 A;  5GAN 2;  2ENM A;  2KQW A;  1RAE B;  2O9S A;  3QYG B;  2MIO A;  1J3T A;  1ZBJ A;  1Q86 C;  3MJX A;  3VV0 A;  4DBH A;  1M8M A;  4ANJ A;  3QZ9 B;  3CC2 A;  2LX9 A;  1PCX A;  3M56 A;  1MMD A;  1QVG S;  5FU7 C;  4AFZ C;  4FT2 A;  3HTR A;  3M53 A;  1WIE A;  4EDU A;  4OMN A;  1VQ4 A;  3INZ A;  2C0T A;  3EGU A;  4Y28 E;  2JW4 A;  2QGG A;  1RAA B;  1BI3 A;  5GAM d;  3A1P A;  2HSE B;  3M0S A;  3MCA B;  2VYT A;  2P0K A;  4MDW A;  3VS6 A;  2V26 A;  2QXF A;  3THK A;  2HQX A;  1G3T A;  3REB B;  2EYZ A;  2DYI A;  4RTW A;  1RUW A;  2HBW A;  2XG8 D;  1FX7 A;  3L2V A;  2VGM A;  5CQY A;  5KYY A;  1H3Z A;  1U8R A;  1IZ6 A;  4XTV A;  3GBQ A;  3SB2 A;  3EG1 A;  2EQJ A;  2GTJ A;  1PSF A;  3CCE T;  1PKS A;  2EJG A;  3CCE Q;  5C0M A;  2RN8 A;  2EAY A;  4O5V A;  1M4Z A;  4DBQ A;  3BDL A;  1RAI B;  2AZV A;  2K9G A;  1UGR B;  3JSC A;  3GOX A;  1MHN A;  5GAO n;  1M1K C;  4QW2 A;  1MV3 A;  4ELZ C;  3OYE A;  2QQB A;  4BUG A;  4HVU A;  1GFD A;  3OYD A;  2JOY A;  1Q82 U;  2LTO A;  4L59 A;  2DXU A;  2K3X A;  2EGE A;  3L2W A;  4E7K A;  3EFO B;  4PJO G;  5CKE A;  3SWN B;  4ATO A;  2CGH A;  3P8D A;  2DVE A;  2J6K A;  1TUC A;  4M75 E;  4MZM A;  3MEU A;  1KSW A;  3SEM A;  1YCY A;  2K4Y A;  3T9N A;  4KUI A;  2YHT A;  2QDL A;  3UDC A;  1RI9 A;  3SFM A;  4MML A;  3EGX A;  5LJ3 g;  1T0J A;  2QTX A;  4JRP A;  2DE0 X;  3WVE B;  3DB4 A;  1ZHI A;  2VC8 A;  2VAS A;  3WXM B;  4M7A A;  4KH1 B;  3VYH B;  3HKS A;  2HMA A;  2KAF A;  2ESW A;  4X9C A;  3JCM f;  2E5K A;  2V8I A;  4D8D A;  1S1N A;  4AFU C;  1S72 A;  3VS3 A;  2I0N A;  4J9D A;  1IB8 A;  1ZSZ A;  4MZP A;  3OS0 A;  2YSQ A;  2DYB A;  1UJY A;  1KFZ A;  1AWX A;  3EGD B;  5CQX A;  3X20 B;  4M78 G;  3LH5 A;  1KC8 R;  2BTT A;  4J8O A;  1VYV A;  3CMA T;  4BDZ A;  2FO0 A;  3CMA Q;  5GAM j;  3UWN A;  2QQS A;  4Z02 A;  3M55 A;  2FYK A;  2KT1 A;  2ROT A;  4J7I A;  4RMO A;  3OW2 P;  4KT0 E;  2MAM A;  1KJW A;  3CXC S;  1ZA1 B;  1K9A A;  2E70 A;  4OF1 A;  5KYW B;  3MEV A;  1JB0 E;  4NS5 A;  1Q86 R;  2DLP A;  3JB9 F;  3LYI A;  2DM1 A;  1TXQ A;  4M7A F;  2DFU A;  4OMO A;  2E65 A;  2VKN A;  1IHW A;  2QGF B;  2QG9 B;  5C6S A;  1Q81 C;  4RG8 A;  2L3P A;  2EQI A;  1IRX A;  4C92 G;  4PJN A;  5GAN d;  3VRZ A;  3OYI A;  1BBZ A;  1YIT T;  2RQT A;  1YIT Q;  2KDS A;  1ACM B;  3X25 B;  4XU2 A;  2XI9 A;  4F7U A;  1Z9Q A;  4KBM B;  2OI3 A;  4F16 A;  3D7S B;  5HK0 A;  1TTH B;  5FU6 C;  4M75 D;  3JV3 A;  4EMK B;  3CCS T;  1T3S A;  5CAI A;  1QVF A;  3CCS Q;  2QDY B;  5GAN 4;  1PWT A;  2YLC A;  2DIQ A;  3J7A F;  1Q7Y C;  3CBP A;  1YFN A;  1MND A;  4LUE A;  2DJQ A;  2JN0 A;  4HKE A;  4LUD A;  2LX7 A;  2R5A A;  1Y96 B;  2HCK A;  4PJO B;  2RHU A;  4CC4 B;  3FLG A;  5IXB A;  1KD1 U;  3H0H A;  4F14 A;  3DB3 A;  1MMA A;  4XTU A;  1KIK A;  3JCM Q;  4HXJ A;  5LJ5 g;  2ED0 A;  2IG0 A;  4E7I A;  1K73 U;  3A8G B;  2Y4X A;  4F7U F;  5J3B A;  3JCM d;  2XDD A;  2E12 A;  3CPW S;  1WQW A;  2NUT A;  1W2B S;  1JO8 A;  2DXB A;  4JUV A;  2CP2 A;  1NYF A;  4DEX A;  2J06 A;  1Y71 A;  3C94 A;  4HCC A;  1RAG B;  1UGP B;  3NMZ C;  4CC3 A;  1QW1 A;  1KQ2 A;  2RJD A;  1B34 A;  5CKB A;  5LJ3 e;  2O2O A;  2M16 A;  4E7Z A;  1YHQ T;  1YHQ Q;  4M78 B;  2DL5 A;  2W10 A;  4M4Z A;  2CT4 A;  3JCM V;  2YWW A;  2HL5 C;  2E3I A;  3SD4 A;  2I2L A;  1NJI U;  2H3J A;  2LJ3 A;  3L42 A;  1X2Q A;  2X51 A;  2FPE A;  1PD0 A;  4LD9 K;  1MNE A;  2D0N A;  1SF9 A;  3BE3 A;  3URG A;  1WHG A;  1YJN T;  1YJN Q;  3GNG A;  1KHI A;  3CCV T;  3CCV Q;  3OB9 A;  1D1C A;  2CUB A;  4J9B A;  2QA4 A;  1KG1 A;  1I0C A;  2X4W A;  3CCU T;  2V8K A;  5LL6 S;  3CCU Q;  1HD3 A;  1U1S A;  1UEC A;  1NPP A;  2RPN A;  4C92 B;  1M90 C;  4R56 A;  3LH0 A;  4PKC C;  5GMK l;  2BKD N;  2K79 A;  5KE3 A;  3TU4 K;  2FPF A;  3RKX A;  1VQK T;  2RHZ A;  1VQK Q;  3A8L B;  3U23 A;  4C8Q A;  3GPL A;  3FB9 A;  3QII A;  2EJ9 A;  2FEI A;  3H0I A;  2LMJ A;  2RM4 A;  1RAD B;  3I35 A;  2OTJ T;  1VIE A;  4JLG A;  2OTJ Q;  3H41 A;  3JCM c;  3CEY A;  5D7U A;  3FDR A;  2ZZD A;  3EGX B;  3I56 T;  3PIP A;  3X24 B;  3I56 Q;  2V1R A;  4N4H A;  2CZ0 B;  4GBQ A;  2LT1 A;  4M7A B;  3FJ5 A;  3UPU A;  1M3C A;  1G83 A;  3EG9 B;  2EFI A;  1UHC A;  2LJ0 A;  3AHU A;  2X35 A;  1N8R R;  4PJJ A;  3CC4 Q;  1YI2 T;  1E6H A;  2SRC A;  1VQ5 A;  2DXT A;  1OX8 A;  1YI2 Q;  1JBM A;  2BE9 B;  1ZSZ B;  1I1J A;  1E7O A;  4RTY A;  1WHH A;  1VOM A;  2X4J A;  1YWP A;  4C8Q F;  8AT1 B;  2K6D A;  1OYX A;  3H9N A;  1BYM A;  3E9F A;  3G1J A;  2EYQ A;  4FSX A;  1P92 A;  1Q7Y R;  3CCJ T;  2A0F B;  5LJ5 e;  3CCJ Q;  1K9M C;  2D6F A;  2X4X A;  2LCS A;  2EPD A;  5CKF A;  1XQH A;  3CPW P;  4OB1 B;  5D6Y A;  2Z0W A;  5GAM h;  3GLX A;  3ZFJ A;  2IVW A;  1UG1 A;  4DBF A;  1ZBX A;  2K3B A;  3LW5 E;  1YJ9 T;  3VUB A;  4OGE A;  1YJ9 Q;  1LNX A;  1UGQ B;  1SEM A;  2L0A A;  1QVG A;  1QCF A;  4FYX B;  4XU1 A;  1UTI A;  5IT9 E;  2DXC A;  4ZN3 A;  4OMP A;  3A8M B;  3EHR A;  3CCM T;  1HJD A;  3CCM Q;  1VQ6 T;  4IUR A;  2CDT A;  1W70 A;  2DL8 A;  1VQ9 T;  2E1H A;  1VQ6 Q;  2YDL A;  3QWY A;  1VQ9 Q;  2QEX T;  2DL7 A;  1D1B A;  1B7T A;  3TSW A;  5GAM f;  2QEX Q;  3HPW A;  3PVQ A;  4F7U B;  4J9G A;  4M77 F;  1BI1 A;  1BIB A;  2MI6 A;  3BDU A;  1O9S A;  3A8O B;  1YIT A;  3NHN A;  4N4I A;  3OSV A;  2FRY A;  9ATC B;  2EWN A;  1RLQ C;  3JB9 D;  4JDS A;  4J6X A;  4PL6 A;  2A3L A;  2E3H A;  3CCS A;  2EJF A;  4PFP A;  1TSF A;  1WJQ A;  2F5K A;  1IRE B;  1EZZ B;  1RAF B;  2MMP A;  5LJ5 d;  4FSS A;  2VV5 A;  5LJ3 j;  1K4U S;  1M90 R;  3EH2 A;  4IUT A;  2P0P A;  1YIJ A;  3CBO A;  2A7Y A;  2AKL A;  4IUQ A;  2QQR A;  4LDV A;  1QVF P;  3RMS A;  4BI3 A;  4ORZ A;  4EMK A;  2EGC A;  4M77 G;  1TS9 A;  2XKO C;  2MWP A;  5GAO l;  2E6N A;  1FYN A;  2JM9 A;  3PMI A;  3QUI A;  1B34 B;  3IQL A;  7AT1 B;  2JT4 A;  4O6J A;  2F5T X;  2RHI A;  2EVR A;  4JRK A;  1C0M A;  5KE2 A;  2CZ6 B;  1RL2 A;  1Y96 A;  4PJO A;  4AT1 B;  4LDU A;  1YHQ A;  1F1B B;  6AT1 B;  2HBP A;  2E64 A;  2E5Q A;  1HK9 A;  1R0C B;  3JCM b;  1GCP A;  3V8J A;  2B86 A;  4AG2 C;  1ARK A;  1XNI A;  4L6V 5;  4J9I A;  1ABO A;  5GMK e;  2V1Q A;  1BB9 A;  2DF6 A;  2RA2 A;  1AWJ A;  3QYH B;  5CKD A;  2COW A;  2PUK B;  3OW2 S;  2EBP A;  3CC7 A;  1PG5 B;  1TUG B;  3CCV A;  3PNW C;  1LPL A;  1FWZ A;  2KGT A;  2YUN A;  1QKX A;  4E47 A;  2AIR B;  2EGA A;  2QQA A;  5GAN 7;  4OML A;  3EAE A;  2E6Z A;  3CCU A;  2HQH A;  2XHC A;  1JQQ A;  1K9M R;  2YUO A;  5GAN h;  1ZSG A;  4EMH A;  3G4S A;  4M78 A;  4PJO F;  2RI2 A;  3CME T;  4C8Q B;  3CME Q;  5GAN 3;  1JXM A;  2K7A A;  3MO8 A;  1N6A A;  3CXC A;  2AT1 B;  2JNG A;  5FRM A;  1K8A U;  4Z88 A;  2GQI A;  1VQN A;  1VQK A;  1YCS B;  4X1V A;  2RHX A;  4IIM A;  2EYX A;  2DMO A;  5IH2 A;  4C0D B;  2V8J A;  1AD5 A;  1SKU B;  3VJP A;  1PHT A;  1VQM T;  2OTJ A;  5GAN f;  1VQM Q;  2LP5 A;  4BI8 B;  1YJW T;  1I81 A;  1C1A A;  1YJW Q;  1NLP C;  1K73 C;  5LJ5 j;  4F04 B;  4FCY A;  1JJ2 A;  2K57 A;  4C92 A;  3L2R A;  4ZGJ B;  4M78 F;  3REA B;  4BY6 C;  4JZ4 A;  2YRC A;  1G8X A;  4GY5 A;  3CC4 A;  1V1C A;  3S3N A;  1FMW A;  4Y91 A;  1TUD A;  4CRI A;  4M77 B;  1ZQ1 A;  3ULR B;  2OTL T;  1PRL C;  3JCM h;  4DBR A;  1E6G A;  2OTL Q;  3M5A A;  3JAM E;  1ZUK A;  1Y07 A;  4LNP A;  4N4G A;  3LGF A;  3J81 E;  1WA7 A;  3MHX A;  1AZG B;  4XK8 E;  4J7F A;  4OGC A;  3CCJ A;  5GAO m;  1KQS P;  2VXE A;  4LD6 A;  1LJO A;  3M54 A;  1NJI C;  1CSK A;  2KYM A;  2NWM A;  2A08 A;  2X3W D;  2C0I A;  3QXE B;  1D1A A;  1GCQ A;  4IUU A;  2DTI A;  1V76 A;  3M0U A;  5ECA A;  4J9E A;  3SWN C;  1MMN A;  4C92 F;  1YJ9 A;  3EG9 A;  2CH4 W;  4NOY A;  2CSQ A;  2DET A;  2RK2 A;  1RAB B;  1PM3 A;  1W2B A;  4A4H A;  4M75 C;  1VQL T;  3EG2 A;  1OV3 A;  2YUP A;  3VU3 C;  2FZG B;  1SHG A;  3G7Z A;  1U5S A;  2LQW A;  2XMF A;  3CCM A;  1VQ7 T;  4J9H A;  1LCK A;  4A4E A;  1VQ9 A;  1VQ7 Q;  1VQO T;  1VQO Q;  2PVO B;  2ECZ A;  1EIF A;  3QJ6 A;  3PT9 A;  4RTU A;  2MPX C;  2OAU A;  1VQ8 A;  3GIB A;  4OMF B;  2YT6 A;  2R57 A;  2L2P A;  3KUF A;  4ELY C;  4IUP A;  5IHK A;  5KCH A;  5IHN A;  3LX7 A;  2HDA A;  4RTZ A;  3UT1 A;  1ZA2 B;  3S3M A;  4HT8 A;  3HFO A;  2KYB A;  1O75 A;  2COZ A;  2O01 E;  3M59 A;  3I55 A;  1VYT A;  1UB4 A;  3EFS A;  3NFC A;  1Q86 U;  2GTO A;  2FL7 A;  3ZL7 C;  4CC2 A;  2PTK A;  2F69 A;  2M51 A;  1LOJ A;  2CUD A;  3CD6 T;  3L1A A;  3OS2 A;  4RKU E;  4XTZ A;  3CD6 Q;  4J9C A;  1JU5 C;  3TRE A;  1UFF A;  5GJW B;  4XTX A;  3NGP A;  2JTM A;  2L3S A;  2Y4Y A;  4V2S A;  1X2K A;  4IIO A;  2DA9 A;  3OYM A;  5GMK j;  4DA4 A;  1JRI A;  2DTH A;  4QQG A;  2MK5 A;  4K11 A;  2HEQ A;  3X26 B;  2L3R A;  2JVV A;  1JEG A;  1WLP B;  3C4S A;  5DM7 R;  4KUL A;  4J9F A;  1M1K R;  2DK3 A;  4ZTJ A;  2DEU A;  1WJS A;  1U06 A;  3NTI A;  3PE0 A;  4M7D F;  4B9W A;  2EYW A;  4JLI A;  3TQ7 P;  2EIF A;  2RH2 A;  2DBK A;  2YXY A;  3OYK A;  2M1H A;  3VKI A;  1NZ9 A;  1VQP T;  3BFM A;  2RO0 A;  1QQJ A;  5GAO p;  4JPB W;  2ZPI B;  3M4Y A;  1VQP Q;  4JRI A;  1BKB A;  1GBQ A;  2DL3 A;  3JB9 J;  4JJC A;  4PNO A;  1NBE B;  3QWX X;  3CCL T;  2O88 A;  3PTA A;  1BI0 A;  1UHF A;  3CCL Q;  1X27 A;  3OYY A;  3VS0 A;  3OYC A;  4KGZ B;  1X01 A;  4BE2 A;  1UEB A;  1H64 1;  2K2V A;  4A63 B;  2VXF A;  3CME A;  3OMC A;  4DOV A;  4A54 A;  1R8O B;  3M57 A;  4LDW A;  1QLY A;  3KXT A;  3I5R A;  1N27 A;  1NM7 A;  5LJ3 f;  5CIU A;  1H8K A;  3G6E T;  3CC2 T;  2DAQ A;  2F1L A;  3G6E Q;  4EMG A;  3CC2 Q;  5DY9 A;  3CCE A;  1WZO A;  4GLK A;  2XDP A;  1K0S A;  4M7D G;  5KYU B;  3RES A;  1GBR A;  2JXB A;  4F17 A;  2KEA A;  1OEB A;  1VQM A;  4QVD A;  4PJO D;  4RCB A;  3Q1J A;  4MZT A;  4HCB A;  5LJ5 h;  3NPF A;  1M8V A;  3O8V A;  4ZGE B;  1UE9 A;  3FJP A;  1XTD A;  2ZAE A;  2AHJ B;  4UC4 A;  5I21 A;  4D8K A;  2D8J A;  1CKB A;  2OJ2 A;  2BZY A;  4CC7 A;  4Y92 A;  3RNJ A;  5CR2 A;  2EQK A;  3DLL A;  2FZK B;  2DX1 A;  4GLM A;  3GNF B;  4R55 A;  1QVF S;  5LJ3 d;  3A5Z B;  2DVJ A;  5LJ5 f;  4M7A E;  1Q81 R;  2KXC A;  5I11 A;  2O31 A;  2YUQ A;  1VIF A;  2XIC A;  2ATC B;  4RUG A;  4ZGD B;  5AYF A;  5HKC A;  1WXB A;  2P0Q A;  5FRN A;  3LWH A;  1AZE A;  1NLO C;  1BK2 A;  4N0A A;  3QPH A;  2DRK A;  1G3W A;  2LNV A;  2PNI A;  5FRO A;  3MEA A;  5CKH A;  2F2W A;  3E19 A;  2DL4 A;  4RCC A;  3G71 T;  2BE7 D;  1M5Q 1;  2RQW A;  3G71 Q;  3M0Q A;  1R0B G;  4JS5 A;  4M7A C;  2CYZ B;  5FWB A;  3HRT A;  4M77 A;  1FXX A;  4C5I A;  5EC7 A;  2DTO A;  1N8R U;  2CZ7 B;  3CCQ T;  5HCK A;  3CCQ Q;  1WHK A;  4ZN1 A;  4TVR A;  3M4G A;  1VQO A;  1WX6 A;  4FYY B;  1ZSZ C;  2R5M A;  3CMA A;  1OOT A;  3VRY A;  3I9Q A;  2ROL A;  1UGV A;  3JB9 H;  1K8A C;  1QP3 A;  2E4H A;  2KRM A;  5IHI A;  4J6W A;  2HKQ B;  1Q7Y U;  2RI3 A;  1QCN A;  1FMV A;  5KYX A;  3F70 A;  1PD1 A;  2J7I A;  2L5Q A;  1U3O A;  4FIB A;  1BCO A;  4C0F A;  1HXD A;  1NEG A;  3TVT A;  1PRM C;  3CCR T;  2KRS A;  4KGV B;  2DIG A;  3CCR Q;  2D0Q B;  2O9V A;  4OB0 B;  3OW2 A;  2DPP B;  3OBY A;  4F7U E;  2CS7 A;  4Z8A A;  3OMG A;  3A8H B;  1OZ3 A;  2D8H A;  2MCN A;  3RMQ A;  2MYS A;  2PU9 B;  2XK0 A;  2M9U A;  4M7D B;  4ME7 A;  2L89 A;  1SRM A;  3V7R A;  2XDB A;  1C6V X;  4A4F A;  1NYG A;  4J5Y A;  1Q82 C;  4DEY A;  2COY A;  3FEO A;  4PJL A;  4ZTF A;  4M7A D;  4ESR A;  1AOJ A;  2H3E B;  4JJB A;  1QP2 A;  2KVQ G;  3QBY A;  3TSZ A;  5DLO A;  2IIM A;  3V7S A;  1G2B A;  5I2S A;  1WGS A;  1VYU A;  1KQ1 A;  1YP5 A;  2D1X A;  1UGS B;  2DIL A;  3E9G A;  4BAC A;  1ZX6 A;  5FWC A;  2K2M A;  2L3Q A;  3C0C A;  1XOV A;  1K0X A;  1MGQ A;  1N9R A;  2PZ1 A;  5DLQ E;  4P5N A;  2EYY A;  4C5G A;  5HK3 A;  2RQR A;  2VWF A;  3H8Z A;  1X43 A;  4HVV A;  1GRI A;  4PJM A;  1NE8 A;  2JTE A;  3EH1 A;  3RR6 A;  1KQS S;  1MMG A;  3E2U A;  3EHQ A;  4NL3 A;  4JZ3 A;  3R6N A;  2J6O A;  1QMC A;  2AKK A;  1WQ7 A;  1WYX A;  3UF4 A;  2NYS A;  2ABL A;  5GAN g;  1IO6 A;  2FB7 A;  2CRE A;  1M90 U;  3FRN A;  4LXC A;  5D6X A;  1X6G A;  1X75 C;  2WSF E;  2C06 A;  1GXI E;  3CCL A;  5AT1 B;  4IKF A;  4MMK A;  2LC4 A;  3OQ5 A;  2DZ9 A;  2KR3 A;  3M0R A;  1PSE A;  2XID A;  5GAN 6;  3OS1 A;  2W0Z A;  4WF2 A;  4NL2 A;  5FU7 B;  5GAO q;  4M75 G;  4JJN K;  4E7J A;  2RJC A;  3KFV A;  3S6W A;  3AT1 B;  4PFZ A;  1YBY A;  3OYH A;  4BE1 A;  3CBM A;  3DLM A;  3TEE A;  4E6R A;  4HA8 A;  1ZLM A;  4KGX B;  1YJN A;  1I5L A;  1OI1 A;  4A4G A;  3G6E A;  2FZC B;  3UAT A;  3VS1 A;  2KXD A;  3P8B B;  5GAN 8;  3BY7 A;  3PGG A;  1I8F A;  1WI7 A;  4C8Q E;  4DOW A;  3JCM g;  8ATC B;  2KY9 A;  2LT4 A;  3P8H A;  3WVD B;  2VB6 A;  2M0O A;  1H92 A;  2CSI A;  2LVM A;  1EFN A;  3LGL A;  1K8A R;  2CP3 A;  2HSP A;  4LE9 A;  2E10 A;  1K9M U;  3A98 A;  1KD1 C;  2QAZ A;  3BW1 A;  3QDF A;  2J6F A;  2LQK A;  2JMA A;  2RK1 A;  4Z89 A;  1B07 A;  2M02 A;  2ZPE B;  2QAS A;  4C8Q C;  1AVZ C;  3O5Z A;  1X6B A;  4BB7 A;  1TU0 B;  5KYU A;  2JTF A;  2MWO A;  3I56 A;  3HHT B;  4FU6 A;  2QA4 T;  1M27 C;  1QWF A;  2RJE A;  3MPU B;  2KNB B;  2QA4 Q;  5M9O A;  1QCO A;  4C0D C;  4BY6 B;  2ZPB B;  1UUE A;  2QK0 A;  1Q82 R;  4M77 E;  3JB9 I;  1YI2 A;  4YTL A;  5HY6 A;  5CCA A;  1SSF A;  2DBM A;  2KI7 A;  2GF7 A;  3JCM J;  3OY9 A;  2KMT A;  3H6Z A;  5D6W A;  3SHW A;  1WDX A;  2MF2 A;  3RKY A;  3G71 A;  4QKU A;  2KBT A;  2Y90 A;  4N0A C;  1TG0 A;  2EKH A;  2NUP B;  4XAX B;  1WJR A;  3GF5 A;  4OB3 B;  4E7L A;  4QQD A;  5GAN 5;  3CCQ A;  4CI0 C;  4RG2 A;  4FT4 A;  1Y7X A;  3QJY A;  2LQ8 A;  2RQU A;  4LDX A;  3VUZ A;  2HNI A;  1WFW A;  4VUB A;  3VS7 A;  4M77 C;  5KYX B;  2FVU A;  1TOV A;  2WSC E;  4HT9 A;  5GAN e;  2QYZ A;  2X3X D;  3EFR A;  4RTT A;  1PNJ A;  1D3B B;  2KT8 A;  2PUO B;  2RJF A;  4C8Q D;  3CPW A;  3ME9 A;  4M75 B;  4II1 A;  2J05 A;  1VQL Q;  4BI4 A;  3CCR A;  2K5F A;  4AMC A;  3ASK A;  1VQ5 T;  1MUZ A;  3MP1 A;  1VQ5 Q;  2HD0 A;  2FHD A;  1VQ6 A;  2ZCF B;  1YWO A;  2KRN A;  3HL8 A;  5CVI A;  4A4K A;  3C95 A;  4FW2 A;  5L23 A;  2QEX A;  5J39 A;  2NLU A;  3OYA A;  2WSE E;  1Y0M A;  1SPK A;  3VS5 A;  5A2Q E;  4E7H A;  1D0Y A;  2GFU A;  5A0D A;  2P4R A;  2P4T A;  2LCL A;  2BUD A;  5EG2 A;  1KC8 U;  4FW1 A;  4FL6 A;  1QVG P;  2NUZ A;  4QVZ A;  2CH4 A;  3HFN A;  4XQ3 A;  1N9S A;  4FYV B;  1X6O A;  1W6X A;  4M77 D;  3JCM e;  1SRL A;  2GNC A;  2WAC A;  1BCM A;  3V8K A;  3ZBD A;  1WXU A;  5L8R E;  2HZY A;  4BD3 A;  1ZUY A;  4DQ2 A;  4E2F B;  2JUF A;  4R0K A;  3M0T A;  3LLR A;  5FW9 A;  5LJ3 h;  5FU6 B;  2MOX A;  4M7D A;  4OVA A;  1AWW A;  1M2V B;  1BI2 A;  2ZPF B;  1D09 B;  1OPL A;  1WNL A;  1AEY A;  4X9D A;  4WCI A;  3CPF A;  2EQM A;  1JJ2 S;  2GBQ A;  4FM4 B;  4PJO E;  2RHY A;  1N8R C;  5GJV B;  3OYF A;  3M9Q A;  1W4S A;  1TWB A;  4AG1 C;  1K1Z A;  1Z9Z A;  5IXF A;  4RTX A;  4EMK C;  2OAW A;  1KD1 R;  3EG0 A;  4XU0 A;  2QTV A;  4B9X A; 
#chains in the Genus database with same CATH homology
 2YUQ A;  1Y57 A;  4RUG A;  2H8H A;  2AKL A;  4ORZ A;  1WXB A;  2EGE A;  1AZE A;  1NLO C;  2EGC A;  4AFQ C;  1BK2 A;  2DRK A;  1OPK A;  2PNI A;  1FYN A;  2F2V A;  2JM9 A;  2F2W A;  3IQL A;  2J6K A;  1TUC A;  2BZ8 A;  2DL4 A;  2JT4 A;  4OMM A;  1QKW A;  1KSW A;  3SEM A;  1YN8 A;  3PVL A;  2RNA A;  2EVR A;  2RQW A;  3M0Q A;  5FWB A;  2QDL A;  3CQT A;  2RQV A;  4ZNX A;  1RI9 A;  5EC7 A;  1FMK A;  5HCK A;  1T0J A;  2DE0 X;  1WX6 A;  1GCP A;  1OOT A;  1GL5 A;  4AG2 C;  2B86 A;  1ARK A;  3VRY A;  1RLP C;  3VS2 A;  2ESW A;  2ROL A;  3I9Q A;  1UGV A;  2AZS A;  2KRM A;  5IHI A;  2E5K A;  4J9I A;  4D8D A;  1ABO A;  1S1N A;  4AFU C;  2SEM A;  3VS3 A;  2I0N A;  2V1Q A;  4J9D A;  1BB9 A;  2DF6 A;  1AWJ A;  2J7I A;  2YSQ A;  1U3O A;  2DYB A;  1T0H A;  2EBP A;  1UJY A;  1KFZ A;  1AWX A;  1NEG A;  3RBB B;  3TVT A;  1PRM C;  3LH5 A;  2KRS A;  2BTT A;  2O9V A;  2KGT A;  1B3Q A;  1VYV A;  2YUN A;  2FO0 A;  1M3A A;  1QKX A;  4LN2 A;  1WXT A;  2EGA A;  4OML A;  4Z8A A;  2D8H A;  2KT1 A;  2MCN A;  2ROT A;  1JQQ A;  2YUO A;  1ZSG A;  1KJW A;  1SRM A;  1BU1 A;  1K9A A;  2LJ1 A;  1NYG A;  1JXM A;  2K7A A;  2DLP A;  4DEY A;  2DM1 A;  4OMO A;  4Z88 A;  3VS4 A;  2VKN A;  2GQI A;  1MV0 B;  2RF0 A;  1YCS B;  4ESR A;  4X1V A;  4IIM A;  1AOJ A;  2EYX A;  4JJB A;  3TSZ A;  1ZUU A;  2IIM A;  2L3P A;  2EQI A;  2DMO A;  1G2B A;  5IH2 A;  4QT7 A;  1AD5 A;  1VA7 A;  1NEB A;  1VYU A;  2JS2 A;  1YP5 A;  3VRZ A;  1T3L A;  2D1X A;  1PHT A;  2DIL A;  4AFS C;  1BBZ A;  1ZX6 A;  2LP5 A;  2RQT A;  5FWC A;  2K2M A;  2L3Q A;  3C0C A;  1XOV A;  1K0X A;  2PZ1 A;  1Z9Q A;  2OI3 A;  1NLP C;  4F16 A;  1W1F A;  3I5S A;  2BZX A;  1NG2 A;  3JV3 A;  2EYY A;  2RQR A;  1T3S A;  2VWF A;  4KRT A;  1X43 A;  1PWT A;  4HVV A;  3REA B;  1PKT A;  1YNZ A;  4JZ4 A;  1GRI A;  1V1C A;  2JTE A;  4EIK A;  2CT3 A;  1TUD A;  4LUE A;  2DJQ A;  3EHQ A;  3UA6 A;  4JZ3 A;  3R6N A;  2J6O A;  2AKK A;  1M30 A;  3ULR B;  4LUD A;  1PRL C;  2LX7 A;  1E6G A;  2HCK A;  4CC4 B;  1WYX A;  1ZUK A;  3UF4 A;  4LNP A;  5IXB A;  2ABL A;  4OMQ A;  1IO6 A;  1SSH A;  1WA7 A;  3H0H A;  4F14 A;  2CRE A;  1GCQ C;  1X6G A;  1AZG B;  1KIK A;  4HXJ A;  2ED0 A;  4JJD A;  1CSK A;  2KYM A;  2NWM A;  2A08 A;  2X3W D;  2C0I A;  2JM8 A;  2KR3 A;  1GCQ A;  3M0R A;  3UA7 A;  2A37 A;  1JXO A;  3M0U A;  5ECA A;  4J9E A;  3M0P A;  1JO8 A;  2W0Z A;  2CH4 W;  1NYF A;  4DEX A;  1CKA A;  2J06 A;  2CSQ A;  3KFV A;  2KE9 A;  3NMZ C;  4CC3 A;  3EG2 A;  1OV3 A;  2YUP A;  4E6R A;  1ZLM A;  2O2O A;  2RMO A;  1SHG A;  1U5S A;  2LQW A;  1K76 A;  2XMF A;  2F2X A;  2FG0 A;  4J9H A;  2DL5 A;  2W10 A;  1LCK A;  4M4Z A;  2CT4 A;  3UAT A;  4RTV A;  3VS1 A;  2ECZ A;  2KXD A;  1UJ0 A;  4RTU A;  2LJ3 A;  1WI7 A;  2YT6 A;  1X2Q A;  1ABQ A;  2LNH B;  2FPE A;  2L2P A;  3EG3 A;  2D0N A;  1QWE A;  5IHK A;  2A36 A;  1H92 A;  2CSI A;  2LQN A;  5IHN A;  2HDA A;  1SHF A;  4RTZ A;  1A0N B;  1EFN A;  2HSP A;  2FPD A;  2CUB A;  4J9B A;  4LE9 A;  2KYB A;  1I0C A;  1HD3 A;  3A98 A;  1UEC A;  1VYT A;  2RPN A;  2J6F A;  4HCK A;  2JMA A;  4Z89 A;  1B07 A;  2GTO A;  2JMC A;  3ZL7 C;  4CC2 A;  1HSQ A;  1AVZ C;  2PTK A;  3O5Z A;  1X6B A;  2M51 A;  2K79 A;  2FPF A;  2CUD A;  2ED1 A;  4J9C A;  2DRM A;  1AWO A;  1M27 C;  1GFC A;  1QWF A;  2KNB B;  3U23 A;  1M3B A;  1JU5 C;  1N5Z A;  2JS0 A;  2FEI A;  3H0I A;  1UFF A;  1UUE A;  5GJW B;  3NGP A;  2LMJ A;  2FRW A;  3I35 A;  2L3S A;  1X2K A;  4IIO A;  2LZ6 B;  2DA9 A;  2EW3 A;  3H41 A;  3H0F A;  1UDL A;  2DBM A;  3SHW A;  1WDX A;  4HVW A;  2KBT A;  2V1R A;  1TG0 A;  2EKH A;  4GBQ A;  2HEQ A;  4K11 A;  3FJ5 A;  5I22 A;  1M3C A;  1JEG A;  1G83 A;  1WLP B;  2G6F X;  2DNU A;  1UHC A;  2LJ0 A;  4J9F A;  1X69 A;  2RQU A;  1E6H A;  2SRC A;  1WFW A;  3VS7 A;  2M0Y A;  3PE0 A;  1U06 A;  1I1J A;  1E7O A;  2EYW A;  4RTY A;  1H3H A;  2VVK A;  2C0O A;  2DBK A;  1YWP A;  2K6D A;  2X3X D;  4RTT A;  1PNJ A;  2KT8 A;  4JPB W;  1GBQ A;  2AK5 A;  2DL3 A;  2KRO A;  2GGR A;  4JJC A;  2J05 A;  2LCS A;  1I07 A;  2EPD A;  2A28 A;  2ENM A;  3QWX X;  2O88 A;  1MUZ A;  2O9S A;  2MIO A;  1J3T A;  1UHF A;  1X27 A;  1ZBJ A;  3VS0 A;  1YWO A;  2KRN A;  1UG1 A;  1M8M A;  5L23 A;  2K3B A;  4AFZ C;  1WIE A;  1Y0M A;  1SEM A;  1SPK A;  4OMN A;  2L0A A;  3VS5 A;  4A63 B;  1QCF A;  2C0T A;  3EGU A;  2JW4 A;  1UTI A;  2P4R A;  4OMP A;  1QLY A;  3EHR A;  1HJD A;  3I5R A;  1NM7 A;  2CDT A;  1H8K A;  1W70 A;  2DL8 A;  3M0S A;  2YDL A;  2NUZ A;  3QWY A;  2DL7 A;  3TSW A;  3VS6 A;  1K0S A;  3PVQ A;  2CH4 A;  4J9G A;  1GBR A;  2JXB A;  4F17 A;  2KEA A;  3THK A;  1OEB A;  1W6X A;  1SRL A;  2GNC A;  3NHN A;  4HVU A;  3REB B;  2EYZ A;  1WXU A;  4RTW A;  1RUW A;  2FRY A;  2HBW A;  1ZUY A;  3NPF A;  1RLQ C;  4R0K A;  3M0T A;  5FW9 A;  2MOX A;  1UE9 A;  3GBQ A;  3EG1 A;  1AWW A;  2GTJ A;  1PKS A;  1OPL A;  4D8K A;  2D8J A;  1CKB A;  2OJ2 A;  2RN8 A;  2BZY A;  1AEY A;  4WCI A;  4CC7 A;  4Y92 A;  3RNJ A;  2AZV A;  2K9G A;  2GBQ A;  2DX1 A;  4GLM A;  5GJV B;  4FSS A;  1MV3 A;  4AG1 C;  2DVJ A;  1K1Z A;  1Z9Z A;  2KXC A;  5IXF A;  1K4U S;  4RTX A;  2OAW A;  3EG0 A;  5I11 A;  2O31 A;  1GFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...