2CUDA

Solution structure of the sh3 domain of the human src-like adopter protein (slap)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
79
Chain Sequence
GSSGSSGPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTGRESYIPGICVARVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SH3 domain of the human SRC-like adopter protein (SLAP)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords SRC-like-adapter
total genus 10
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2cudA00
4WCIA 1WA7A 1ZBJA 1GCPA 3PVQA 3VS5A 2GNCA 1Z9ZA 2E5KA 1NM7A 1NLOC 1GFCA 1I0CA 1T0JA 2FG0A 2YUPA 1X69A 2DL7A 1I07A 2KRMA 2X3XD 1U5SA 1NEGA 1KJWA 1OPLA 4LN2A 3M0TA 2FRYA 4OMQA 3REAB 2HCKA 2ROLA 2EKHA 5GJVB 3VS1A 2JXBA 2V1QA 3QWYA 3TSZA 1M3AA 2O2OA 1SRMA 2DLPA 2YUOA 2YSQA 2CUBA 1V1CA 2YT6A 3ZL7C 3CQTA 1JU5C 4RTTA 3EG0A 3H0HA 4A63B 2LQNA 4OMPA 2F2XA 4OMNA 4E6RA 3I35A 2CUDA 2KYMA 2DA9A 2CH4A 1FMKA 1ZUYA 4J9CA 2DX1A 2J05A 2EYWA 1PNJA 1NLPC 2KR3A 2P4RA 4ESRA 2SEMA 2C0TA 2HDAA 1GRIA 1K76A 2W0ZA 2EYYA 3M0SA 3NMZC 2GBQA 1X27A 1XOVA 2A36A 4R0KA 4J9DA 4RTUA 4JPBW 1A0NB 2O88A 2AZVA 2GQIA 1WI7A 4JJBA 2PZ1A 2M0YA 1ZUUA 1GL5A 2ENMA 2I0NA 5GJWB 1SHFA 2X3WD 4F16A 2VVKA 2YUNA 3I5SA 1J3TA 1W6XA 1PKSA 2B86A 3UF4A 4AFZC 1QCFA 1BK2A 2CT3A 2J06A 2KRSA 2EGAA 2DL3A 1AVZC 1QLYA 4RTVA 2CT4A 3TVTA 2DF6A 2VWFA 1VYVA 4CC4B 1E7OA 5IHNA 1N5ZA 1VYTA 2LJ1A 2KXDA 2LZ6B 2DNUA 2KXCA 3JV3A 3VRYA 4RTXA 1WFWA 1NEBA 2EVRA 2EYXA 2G6FX 2JMAA 2OAWA 2SRCA 3EG3A 3H0FA 4JJDA 4LUDA 1JO8A 2J6KA 2D0NA 3NHNA 1VYUA 5FWCA 3O5ZA 2EPDA 1ARKA 4AG1C 2HEQA 3RNJA 2O9VA 1K0XA 1TUDA 2KYBA 1VA7A 3VS2A 1JEGA 2RN8A 1K1ZA 4CC2A 2CDTA 3M0RA 3I9QA 1HSQA 1H92A 4J9GA 1PKTA 3RBBB 1WYXA 1H8KA 2ED1A 4IIOA 2DE0X 3KFVA 1YN8A 2IIMA 1UDLA 1MV3A 2DMOA 2GTJA 2RQRA 2LQWA 2AZSA 2DBKA 1LCKA 1YCSB 1UJYA 2AKLA 2JTEA 4J9BA 4RTWA 1M3BA 1JQQA 1M30A 1GCQA 4F14A 3NPFA 1X6BA 3H41A 2JS0A 1WXUA 1K0SA 2O9SA 4J9HA 2EGCA 2LJ0A 2EYZA 4J9FA 2DVJA 1B3QA 2LJ3A 4LE9A 2ESWA 1PRLC 2JW4A 2EGEA 1SEMA 2MIOA 1OOTA 3LH5A 2DJQA 1W70A 4OMOA 1NYGA 3A98A 4HVUA 4Z8AA 3EG2A 2YUQA 2FEIA 1G83A 4DEYA 1UECA 1YWOA 2DL4A 1MV0B 4HCKA 2DRKA 1G2BA 2BTTA 3GBQA 1HJDA 2KE9A 1HD3A 2K6DA 1WLPB 1T3SA 1OEBA 5IHKA 3THKA 2DILA 2RQUA 5IH2A 4JZ3A 4OMLA 1QKXA 5EC7A 2K2MA 5I11A 1RLQC 1T3LA 1Y0MA 1QWEA 3I5RA 2EBPA 4HXJA 2L3SA 1B07A 1W1FA 2JMCA 4ZNXA 3R6NA 1ABOA 3SEMA 4QT7A 3VS7A 2FRWA 1M27C 2ED0A 4GLMA 1KFZA 2JS2A 1JXMA 1TG0A 1EFNA 2PNIA 1MUZA 1UGVA 2K79A 1ZX6A 2C0IA 1M8MA 1YNZA 2NWMA 1X2KA 2OJ2A 2AKKA 1Z9QA 3EGUA 2GTOA 4GBQA 1BBZA 2RQWA 2W10A 4LUEA 1BU1A 1AWOA 1WIEA 2LCSA 1AEYA 4RUGA 2D1XA 1IO6A 2EW3A 2D8HA 2O31A 2CH4W 3QWXX 1UJ0A 3FJ5A 1CSKA 4F17A 1AD5A 2NUZA 2LMJA 4K11A 3VS4A 1NG2A 3UA7A 4FSSA 1SHGA 4Z88A 1YWPA 4CC3A 2D8JA 1U06A 2RMOA 1KSWA 1SSHA 3M0QA 1GBRA 3U23A 3NGPA 1GCQC 1SPKA 2FPFA 4J9IA 1ZSGA 4RTYA 1AWXA 4ORZA 1ZUKA 2HSPA 3REBB 5IXBA 2J6OA 1E6HA 4HVWA 1I1JA 1PRMC 2CSIA 2LX7A 1NYFA 1M3CA 2KGTA 2BZ8A 1UUEA 3VS0A 2FPDA 2ROTA 2DYBA 1QKWA 1T0HA 2K9GA 2L3QA 2FO0A 2MOXA 4LNPA 3UATA 1YP5A 2J6FA 1QWFA 2F2WA 4JJCA 4D8KA 1AWWA 5FW9A 2KT1A 1WDXA 3TSWA 2RNAA 2DL5A 2LNHB 1X2QA 2A28A 2BZXA 1WXBA 2V1RA 2AK5A 1GBQA 4AFUC 3EHRA 1TUCA 2RF0A 2DRMA 4CC7A 3UA6A 1AOJA 2KEAA 1UG1A 4AFQC 1PHTA 3EG1A 2L2PA 4RTZA 5ECAA 2VKNA 4AG2C 2CREA 4HVVA 4X1VA 3M0PA 1CKAA 1AWJA 1K4US 2KBTA 1UHFA 1E6GA 1UFFA 3ULRB 1OV3A 3VS6A 2MCNA 2JM9A 4EIKA 2RPNA 3PVLA 2DBMA 1CKBA 3IQLA 1JXOA 1FYNA 3PE0A 1AZEA 2RQTA 4AFSC 4JZ4A 4Y92A 1RUWA 1WXTA 1U3OA 4OMMA 2ABLA 1RLPC 2DL8A 1AZGB 1S1NA 5L23A 2H8HA 1WX6A 1BB9A 1UHCA 2HBWA 2ECZA 3EHQA 2KRNA 2KT8A 2FPEA 2PTKA 2M51A 1K9AA 2CSQA 2DM1A 3M0UA 4Z89A 1KIKA 2A08A 1X6GA 5FWBA 5IXFA 1ZLMA 2J7IA 3H0IA 4M4ZA 1PWTA 1RI9A 1UE9A 4J9EA 4DEXA 2C0OA 2RQVA 2JM8A 5HCKA 1OPKA 2K3BA 5I22A 3VRZA 1Y57A 5IHIA 2XMFA 1GFDA 2YDLA 2OI3A 3SHWA 2BZYA 2QDLA 2L3PA 2KNBB 1UTIA 2F2VA 4IIMA 2KROA 4D8DA 3C0CA 1X43A 2A37A 2LP5A 2L0AA 1ABQA 1H3HA 2JT4A 1SRLA 2EQIA 2K7AA 3VS3A 2GGRA 4KRTA
chains in the Genus database with same CATH superfamily
1ZBJA 5J26A 4C92G 2JOYA 1D0XA 3I55Q 4BY6C 1NLOC 3WVEB 1I0CA 2FG0A 4E2FB 1YITT 1YJWT 4C5GA 1PG5B 4XTXA 4B9WA 5GAN4 3QJYA 3PIOA 3M0TA 5GAOl 2K3XA 4OMQA 2RD1A 1Q82R 2D0QB 5GJVB 3KXTA 2JXBA 3S3NA 5KYXB 2RJEA 2CUBA 2D9TA 1UGQB 1JU5C 2YRDA 3RKXA 1XJWB 3INZA 1PSEA 4Z02A 2EKOA 5I21A 4JLIA 5CAIA 2H3JA 4EMKB 5FRMA 4E6RA 3OW2P 3G1JA 4C92B 2E5QA 1FMKA 3PGGA 5C0MA 1VQ8T 4XU0A 5GAMg 1PNJA 3M55A 2KI7A 3MP6A 4ESRA 1KC8C 2C0TA 4JRKA 1NZ9A 1C0MA 1PD1A 2XIDA 3P8BB 4C92F 2COYA 2YLBA 4R0KA 3SDZA 2OTLT 1JJ2S 4JPBW 4M7AE 2AZVA 3DLMA 3CCMT 2ENMA 3GNFB 1TSFA 5FU7B 1SHFA 1WJSA 4B6MA 1VQ8Q 2YUNA 4ZTJA 2WACA 3I5SA 2R57A 2JVVA 4M7DB 4UC4A 3RMQA 4KGZB 1OX9A 2EGAA 3OYCA 2G3RA 3OBWA 2DF6A 3CC2T 5GANd 5GMKl 1VQ4A 3CC4A 1ZHIA 3I55A 4ZGDB 3J7AF 3VRYA 1BI1A 1WFWA 2EVRA 4JJDA 2KQWA 4PJOA 3G4SQ 2J6KA 1VQKT 4FW2A 3QJ6A 1VYUA 5FWCA 3MEAA 3O5ZA 1ARKA 4AG1C 5DLOA 3RNJA 4HCCA 3CPFA 2QEXA 3ER0A 3LWHA 2FZGB 4CC2A 3RR6A 2VB6A 5J39A 4PJOD 4QW2A 3RDVA 1WYXA 4OB3B 1H8KA 2EYQA 4E7JA 1I4K1 5GANe 1MV3A 2YRCA 4M7DC 2LCLA 3MCAB 1MMAA 2AKLA 5DM7R 4J9BA 1WNLA 1I5OB 1N8RU 1DJ7B 2XDPA 3GP8A 3QXEB 4C92D 1WXUA 4C0FA 3TCJA 3G6EQ 2O9SA 1TTHB 4A54A 2CZ0B 2K5LA 3LW5E 2LJ0A 2O01E 2P84A 4J9FA 1M1KC 1QVGS 4HT9A 4LE9A 2QGGA 2ESWA 2EQMA 2XICA 2MIOA 1OOTA 3OSVA 4OMOA 1PSFA 1VQ5Q 2DTHA 1ZA2B 4XTYA 2FEIA 5CQXA 5KCHA 2DXCA 3UT1A 4BY6B 1PCXA 2K6DA 3OYJA 1IB8A 1T3SA 4N4IA 3CCVA 4JJNK 1OEBA 5IH2A 4JZ3A 3QZ9B 3JB9G 2K57A 3OS0A 4PK4A 4YTLA 5GMKe 1M90C 4M77E 4C5HA 4HXJA 2L3SA 3A5ZB 1W1FA 1G3YA 4ZNXA 4ME7A 4ATOA 4C0DC 4FT2A 3G7ZA 3SEMA 4N0AC 1KHCA 3X26B 2QA4A 4GLMA 1KFZA 3H8ZA 4NL3A 1TG0A 3CC2Q 2RHZA 4FL6A 2JTMA 2PNIA 5IN1A 2QA4T 2BIVA 1BIAA 3CC7A 5GANh 5GANj 1X2KA 2OJ2A 2AKKA 1Z9QA 1C6VX 2GTOA 4GBQA 1FX7A 5GANf 1YITA 1B7TA 1AWOA 2MF2A 2QTVA 2LCSA 2R58A 1LVKA 5LL6S 6AT1B 5GMKm 4RKUE 2P0PA 2DO3A 5KYYB 4LDXA 2EW3A 4OF1A 3CCVQ 2CH4W 4EPCA 3OYDA 1BCOA 3VUBA 1CSKA 2A0FB 2Y4XA 4E47A 2R5AA 1XNIA 2EJGA 8ATCB 4PFPA 4PFOA 4Y91A 1Y07A 1VQNT 2M02A 2RMOA 2PVGB 1KSWA 1GBRA 2K5IA 1GCQC 2H3EB 2O4XA 4J9IA 3CCEQ 5DY9A 2J6OA 1E6HA 1QW1A 1I1JA 4M75F 3BW1A 4KH1B 3PFSA 5KYWA 2LX7A 2QQ9A 2FYKA 2KGTA 1X75C 1OYXA 3VS0A 3HHTB 2DYBA 3OYFA 5LJ3h 1QKWA 2VGMA 3JRZA 3PMIA 2RI3A 1U8RA 1YHQA 2HAXA 5CKDA 3META 3CXCP 1QWFA 1K8AC 3FDRA 1U1SA 2QAZA 3FJPA 2LNHB 3S3MA 2QGFB 2JUFA 1JJ2A 2AK5A 1GBQA 4AFUC 3EHRA 5FRNA 2RF0A 2DRMA 4CC7A 1AOJA 1UG1A 1FMVA 2EQKA 4F7UG 3M59A 5ECAA 5FROA 4AG2C 4E7KA 4LDVA 3OYBA 4X1VA 3JB9I 5LJ3g 3GIBA 3OYKA 1CKAA 3KBGA 3OYEA 2DK3A 5KYNA 3I56Q 4BI3A 1UFFA 1OV3A 4A4GA 3OBYA 1D0YA 3IQLA 1JXOA 4M77G 4BDYA 1AZEA 2RQTA 3QDFA 3CBMA 4OMMA 2ABLA 2HMAA 1D09B 2DL8A 2LQKA 2H8HA 1WX6A 1BB9A 2QEXT 1IRXA 5CO7A 2OTJT 2KRNA 1HK9A 4FSXA 2GFAA 2KT8A 2NUPA 2CP7A 1RACB 1N8RC 4Z89A 1D1BA 1MMDA 1ZLMA 2NLUA 1PWTA 1RI9A 4J8OA 1Y96B 3P8HA 2JM8A 3CPWP 1Y57A 5GAMe 1GFDA 2YDLA 4M78C 5CKHA 1XQHA 2HQHA 2QDLA 4MZTA 3GOXA 2KNBB 4QKUA 3HKSA 4E7HA 3C0CA 3R6OA 1X43A 2XHCA 2L0AA 1H3HA 3VS3A 4M7AA 1IZ6A 3SD4A 3V7RA 2X4WA 1GCPA 3PVQA 2GNCA 2E5KA 4HCZA 1Q82C 1VQKQ 1AHJB 2DAQA 1GFCA 4PKCC 2ZPIB 1JB0E 2KRMA 1OPLA 4IUQA 2DZ9A 1VQMA 3REAB 2RO0A 5GAN2 2CP0A 2EKHA 1QVFP 2X4YA 5GAMf 3VS1A 2V1QA 1VQ7A 3TSZA 4M7AF 5GAN8 2HSEB 4II1A 2CS7A 5GAMj 1VQLQ 4DBRA 1R0BG 3GNGA 1V1CA 4ZN3A 3JCMg 2YT6A 1YJNQ 1D1CA 2OX7A 4RTTA 1MHNA 1VIEA 3H0HA 1KQSP 2LQNA 3CCRT 4FYYB 4EMKA 3JCMb 1IHVA 5L8RE 4XTUA 2VYTA 4OMNA 2M0OA 1Q81C 3AT1B 2KYMA 3CMAT 2RA2A 4C8QG 3OS2A 2J05A 1HXDA 2ZCFB 1Q81U 2HDAA 1GRIA 2W0ZA 2EYYA 3M0SA 3CCMA 4J9DA 1VQKA 4M7AC 2GQIA 2PZ1A 3I56T 3CCSA 2RHYA 1ZUUA 4BI4A 4TVRA 4XU3A 3EFRA 2VVKA 5EG2A 4JS4A 1AT1B 3CMET 1J3TA 4PFZA 3UF4A 3LGLA 1QCFA 5GAOq 2LCCA 2KRSA 4M75D 1AVZC 1QLYA 4RTVA 2HQXA 3CCJQ 3GF5A 3CCUA 4PJLA 3JCMf 1JRIA 3CXCS 1N5ZA 3MHXA 2MWPA 3E9FA 2E1HA 2DNUA 2KXCA 4PJOE 3L2ZA 5KYUA 4C8QD 2G6FX 4Y28E 3H0FA 1JO8A 2RK1A 1IGQA 3OYLA 1M9SA 2MMPA 4CRIA 1WJRA 2EPDA 2HEQA 3FIFA 4N4HA 2O9VA 1XTDA 1K0XA 1TUDA 5CCAA 3CXCA 2XDBA 2X4JA 2KYBA 3VS2A 4C5IA 4J7FA 2CDTA 2FZCB 3DB4A 2QA4Q 4EDUA 1HSQA 4M77F 4J9GA 1PKTA 3RBBB 1M1KU 1NJIU 5KYYA 2ED1A 4M75B 2DE0X 3KFVA 3JAME 2IIMA 1SG5A 1UDLA 1RABB 4MMLA 2RQRA 3UDCA 3SWNA 2LQWA 2RK2A 1TH7A 1GXIE 2P0KA 4J6WA 4XQ3A 3QDRB 4X9DA 2EJFA 1JQQA 3CCVT 1M30A 1GCQA 2ZPHB 3LYIA 3SB2A 3NPFA 3CEYA 3H41A 2DEQA 2E65A 2EIFA 4X9CA 5GANg 3V8JA 4L59A 4J9HA 3FLGA 2EGCA 3CPWS 4OB2B 3CCET 1M5Q1 3Q1JA 4L5GA 3VJPA 8AT1B 5AT1B 1QVFS 4DQ2A 2D6FA 2JW4A 4A4FA 5CR2A 5IAYA 3CCQT 4C8QC 3A98A 1I5LA 1U1TA 4JRQA 4M77D 3L2VA 1VQ5A 1G83A 4DEYA 1YWOA 3MEVA 2MWOA 5A0GA 4DBFA 1B34B 2KE9A 5IT9E 2X9HA 3MEWA 2DILA 3G6ET 2VC8A 4RG8A 3JB9F 1ZQ1A 3TQ7P 1LNXA 2P0QA 5I11A 1WHGA 4PJOF 1O75A 2CKKA 1T3LA 1QWEA 4BE1A 2EBPA 1OQKA 1B07A 3H6ZA 5KYXA 2JMCA 2CP6A 1ABOA 4N4GA 1S72Q 3VS7A 3SWNB 3MP8A 2GCXA 2CGHA 2E64A 4QQDA 1ZX6A 1MMNA 2F69A 2NWMA 4L6V5 3A8GB 3DB3A 4CC4B 4LUEA 3EGUA 3ME9A 1BBZA 4M78E 4PJOC 5AYFA 2DXTA 1BKBA 1V29B 1WIEA 4PLLA 4ANJA 4RUGA 1ZA1B 2D1XA 2O31A 5KE2A 2KDSA 1VQPQ 2C06A 1UJ0A 3JB9D 3FJ5A 3HFNA 4F17A 1AD5A 2ATCB 3CC4Q 2LMJA 4K11A 3VS4A 1K73R 1NG2A 4MZPA 3UA7A 1SHGA 5GAN5 1SSHA 3JCMQ 4M7DA 3NGPA 1VIFA 1NJIR 3M58A 2Z0WA 3MO8A 2HSPA 1YI2T 2E6NA 2KK4A 2PU9B 1IXDA 3LLRA 4XTVA 4Q5WA 1D0ZA 2BZ8A 1UUEA 2BKDN 4OGCA 3A8LB 4C92A 3G71A 4XU2A 4E7ZA 2K9GA 3CD6T 2FO0A 4KT0E 1YJ9T 3QBYA 5FU6C 3OYGA 1YITQ 1YP5A 2J6FA 1G3WA 5CVIA 1WDXA 3TSWA 1VQ9A 2RNAA 3MJXA 2V1RA 1G3TA 2MAMA 5FU7C 1VQPA 1LPLA 5HK3A 4VUBA 2LDMA 3UA6A 4AFQC 2MPXC 4KUIA 1PHTA 3EG1A 1VQ6T 4KH0B 4OP0A 4ZGEB 1VQ9Q 4RMOA 4M7DF 1R77A 3OYNA 4A53A 4FM4B 4BUGA 2QXFA 5FU6B 1G8XA 4EIKA 2RPNA 2DBMA 1CKBA 1R0CB 1M8VA 2QQBA 1LJOA 3PE0A 3WVDB 1JBMA 2EWNA 2LT4A 2EJ9A 1K8AU 1B34A 1WXTA 2JN0A 1K8AR 1U3OA 4A4HA 2KY9A 2BE9B 1RLPC 3JCMe 1AZGB 4PJMA 5L23A 3CPWA 3V8LA 2DJZA 1V76A 2CSQA 1WJQA 2JTFA 4LD9K 2A08A 2HL5C 5IXFA 4BD3A 3QPHA 4XK8E 3GPLA 1VUBA 3BDLA 4M4ZA 1UE9A 3L42A 1YIJT 2HQEA 4HKEA 2K3BA 1VQ7T 1YFNA 3NTHA 5KYWB 4EMHA 3SHWA 3NFCA 5GAN6 2L3PA 3WXMB 2F2VA 4IIMA 1KD1U 4D8DA 2A37A 3G4SA 3C95A 3TREA 5GAN3 2DVEA 3CC2A 3EGDB 2GGRA 5GAOn 3QYGB 3CBPA 1SSFA 1A0NB 3JSCA 2XK0A 3VS5A 2CP2A 2XD0A 1NM7A 1WPYA 2COWA 2L89A 1M4ZA 1T0JA 1NPRA 3BFMA 4R56A 4ZTFA 2M1HA 2DL7A 1OX8A 2E70A 1U5SA 4KBMB 1KJWA 2GFUA 4LN2A 2ZGWA 2DEUA 2HCKA 2HNIA 1VQLT 9ATCB 1YJ9Q 2HKQB 2YWWA 2O2OA 1SRMA 2DLPA 1KHIA 3L2UA 4IUVA 3ZL7C 3CQTA 3L2RA 4IUPA 4A63B 2PUOB 4M7DE 4ELZC 3CCUQ 1TU0B 3SFMA 3EAEA 2AHJB 4NL2A 1VOMA 3AHUA 3I35A 1KC8U 2CUDA 2DA9A 2CH4A 3TEEA 3PIPA 1M90U 3I55T 1M90R 4J9CA 1K73C 2DX1A 2EYWA 2PVOB 1N27A 2KR3A 4QVCA 2XG8D 2P4RA 2SEMA 3TU4K 4HCBA 1M2VA 2JJ9A 1RAEB 1X27A 3HRUA 3VYHB 3OA6A 1RI0A 3M53A 2A3LA 4JJBA 1WI7A 1FMWA 2M0YA 2CZ7B 2X3WD 2LX9A 2EQJA 5A0DA 1H3ZA 2V8IA 3CCRQ 2YRVA 1PC0A 1W6XA 3BDUA 2B86A 4FW1A 1BK2A 5GAMd 2DL3A 4C92E 2HD0A 3JCMJ 2CT4A 3JCMP 1Y7XA 3TVTA 2VWFA 1YBYA 4KGXB 1G3SA 5IHNA 1VYTA 3ZBDA 2LZ6B 3JV3A 2QASA 5GAOr 2EQUA 3FEOA 4RTXA 1O9SA 2EYXA 2OAWA 4M75C 4F7UE 1WHJA 4LUDA 3QSUA 1YJWQ 4P5NA 1SF9A 4AMCA 2RHXA 4JDSA 3C12A 4PJJA 1MGQA 3CCST 2DKGA 4OVAA 1VA7A 1JEGA 1I8FA 2R5MA 5CKFA 1C1AA 1N9RA 2ZPGB 5LJ3d 1X6OA 4M7AD 4IIOA 4XTZA 4M75A 4DA4A 3H9NA 4C0GA 2GTJA 2AZSA 2DBKA 1LCKA 2RB6A 2PVDB 3M54A 3CCRA 2HZYA 4BI8B 5HY6A 3VYGA 3LX7A 2JTEA 3M5AA 4RTWA 3CC4T 4QQGA 1EX4A 4F14A 5GMKi 4E7LA 1X6BA 3OB9A 2KAFA 3ASKA 3EGXB 2LTOA 1N9SA 3EFOA 3ZFJA 4C0DB 1RL2A 2L3RA 1K0SA 3HPWA 4DBQA 3PMTA 3CCQA 4M77C 2DVJA 1B3QA 2LJ3A 1HYOA 1K9MU 3HTRA 3RKYA 2DXUA 2K5FA 2NUTA 1SEMA 1NYGA 1KK7A 1RAGB 3QYHB 3PTAA 1RADB 3QUIA 4F7UB 3EG2A 3X24B 2YUQA 2EFIA 1M1KR 1VQOA 1Y96A 1KQSS 2QQAA 3CD6Q 4HCKA 1Q82U 3GBQA 3NTKA 1HD3A 1WLPB 2E10A 3CMAQ 2X35A 5IHKA 3THKA 2RQUA 5M9OA 2NUPB 1RAIB 4PJNA 1QKXA 1RAAB 3LH0A 3QKJA 4FCYA 2VASA 3QG1A 1RLQC 2F5KA 1YJNA 5LJ5h 4FYXB 2WSFE 4QQ6A 4C0ZA 2RJCA 1KQ2A 2E3IA 1QCNA 1YJNT 3R6NA 4M78D 3X25B 3EH2A 1Q7YU 1BI3A 2ED0A 2QQRA 3UPUA 1JXMA 3T9NA 3A1PA 3X28B 4C5EA 3FC3A 1UEBA 4A4EA 1EFNA 4ELYC 2LNVA 4BDZA 2K3YA 2K79A 1LOJA 1M8MA 1M1GA 1YNZA 3HRTA 3CCSQ 1WHHA 4C8QA 2XKOC 1BU1A 2BUDA 4B9XA 2RI5A 4V2SA 2VXEA 3GLXA 4J6YA 2DD5A 3URGA 3CD6A 1KD1R 4PL6A 3G6EA 1MMGA 3QWXX 1BIBA 3OW2S 4LXCA 1VQ7Q 3OS5A 1YIJQ 3MEUA 1Q86U 1Q95G 1YI2A 3DKMA 3CCJA 4FSSA 2DTIA 1YWPA 3P8DA 4CC3A 3V7SA 3M0QA 1WGSA 3U23A 2JNGA 2AIRB 2F5TX 2FPFA 1Y71A 3CCJT 4ORZA 3REBB 1WQ7A 3QZ5B 3L2WA 4HVWA 1S72A 3OW2A 1WQWA 1QQJA 2CSIA 3EG9A 3CCMQ 3RERA 1ZSZC 4M7AG 1M3CA 4LDUA 3J81E 5LJ3e 2Y4YA 2CYZB 4DBHA 1VQMQ 4PNOA 2L3QA 2MK5A 2MOXA 3FRNA 2E4HA 2RJFA 3M57A 2B8AA 4LNPA 1W2BP 5HKCA 2O4XB 3UATA 2F2WA 2X51A 4D8KA 1AWWA 2KT1A 3M9QA 4M78F 3EGXA 2A28A 4PJOG 3EFSA 1NJIC 2DERA 3MPUB 2VGNA 1YI2Q 1OU8A 4RTZA 1VQ4Q 4O5VA 2CREA 1MNDA 4C92C 1UGRB 3A8HB 1AWJA 1F1BB 1UHFA 2I2LA 1E6GA 4BB7A 1TOVA 3VS6A 4ZN1A 1N8RR 2IG0A 2ZPBB 1NPPA 2QG9B 4AFSC 4JZ4A 4N0AA 4Y92A 2DYIA 2DD4A 4IURA 2HBPA 2XDDA 3PNWC 1S1NA 5D7UA 1UHCA 2HBWA 4A4KA 2E3HA 4WTOB 4KULA 2FPEA 5GAOm 2PTKA 2M51A 5LJ5f 1K9AA 3M0UA 1KIKA 1VQ6Q 3CCEA 2L5QA 1Q86R 2E6ZA 2RHUA 3LGFA 2J7IA 4JRIA 3H0IA 3J80E 1QVPA 4FT4A 5GMKj 1WHMA 1VQNQ 1KQ1A 1TWBA 5LJ5d 1WHLA 2YLCA 1X01A 1OPKA 1BI2A 3VRZA 2XMFA 1TUGB 2JZ2A 1KQSA 2CZ6B 1Q7YC 1MNEA 5GAOp 1D1AA 2E41A 1FWZA 1VQ5T 2KROA 1QMCA 3JCMd 1ZBXA 2NYSA 2YXYA 2FB7A 2LP5A 7AT1B 3MP1A 3RKWA 4EMGA 2JT4A 1SRLA 4IKFA 3CMAA 4KRTA 3G71T 3N5BB 4WCIA 1WA7A 3HP9A 3CCLQ 1Z9ZA 2FZKB 3S3OA 2DIGA 2YUPA 1X69A 1I07A 2X3XD 4M7DD 4IUUA 1NEGA 4OB1B 3PT9A 2FRYA 4M78A 2V8JA 2ROLA 1UB4A 5FLXE 1TS9A 2OTLQ 2DXBA 1NBEB 3QWYA 1M3AA 4M75E 2YUOA 2YSQA 4O6JA 1VQMT 3E1SA 4FYWB 3UWNA 4D6WA 1M1FA 3EG0A 4XU1A 4OMPA 5J3BA 3RESA 1W2BA 4JUVA 2F2XA 1KG1A 1K73U 4C8QE 4XTWA 3A8MB 2KSSA 1VQ4T 1ZUYA 4JS5A 4LDWA 3QIIA 1IREB 1FXXA 1NLPC 2RM4A 3V7CA 5LJ3j 2VXFA 3I56A 4PJOB 1RAFB 1K76A 2WSEE 4DOWA 3NMZC 5C6SA 2GBQA 1XOVA 2A36A 4RTUA 3JCMX 2O88A 1H641 4M7DG 3S6WA 2GF7A 1GL5A 3EG9B 2I0NA 3QHSA 5GJWB 3CC7Q 4F16A 3HRSA 2OTLA 1QCOA 1OU9A 3CCUT 4RCCA 1PKSA 3OYAA 4AFZC 2IPOB 3OQ5A 4WF2A 3OSSC 3EGDA 2CT3A 2J06A 4IUTA 1W2BS 3QO3A 5I2SA 3OS1A 1VYVA 5CKEA 1E7OA 2A7YA 1VQ8A 3HL8A 4DOVA 5A0LA 4E7IA 2LJ1A 2KXDA 3RUXA 1QVFA 3KUFA 3M56A 4OGEA 3SWNC 4KGVB 1QP2A 5LJ5j 1NEBA 2JMAA 2SRCA 3EG3A 3VKIA 5GMKh 2CP5A 2D0NA 1VQ9T 2GQVA 2HL3A 3NHNA 2V26A 3F70A 4C8QB 5GAN7 2MYSA 2KVQG 2DETA 2RN8A 1K1ZA 3M0RA 3I9QA 1H92A 1KD1C 1G5VA 3G71Q 1YN8A 3JB9H 1QP3A 4BACA 1K9MR 4PLIA 4NS5A 4J83A 4QVZA 5D6YA 2F1LA 4GY5A 2DMOA 1QVGA 5KH6A 1YCSB 1UJYA 1M3BA 1WZOA 2M16A 1OULA 1PM3A 1VQPT 3VU3C 2JS0A 4J6XA 2DFUA 2LT1A 4X34A 2ZAEA 4J5YA 1R8OB 3DLLA 2EYZA 2QEXQ 3RMSA 4EMKC 2QDYB 4FIBA 5LJ5g 4AT1B 2XI9A 2ZZDA 3D7SB 2RI2A 1YJWA 2DZCA 1PRLC 2EGEA 3ZEHA 3LH5A 2DJQA 1W70A 2DTOA 4CI0C 4HVUA 4Z8AA 2QI2A 1Q7YR 2IVWA 1ACMB 1UECA 2DL4A 1MV0B 2DRKA 1G2BA 2BTTA 4MDWA 1HJDA 2AT1B 3LWIA 1OI1A 3E2UA 5D6XA 1YHQT 2VV5A 4M77A 5CQYA 4OMLA 2HKNA 4BE0A 3OMCA 5EC7A 4HA8A 2K2MA 2RH2A 2ZPFB 1YIJA 2OTJQ 3EFOB 3C4SA 1Y0MA 3I5RA 5A2QE 1D3BB 5LJ5e 4RG2A 2OTJA 4RCBA 2QK0A 3OY9A 2YHTA 3JCMV 4QT7A 2FRWA 1M27C 3EH1A 1VQLA 5GAMh 1P92A 2JS2A 3CCQQ 4JRPA 2P4TA 1NE8A 3OYIA 4GLKA 1MUZA 3OMGA 1UGVA 1BI0A 1UGSB 3FB9A 3X20B 1BYMA 2C0IA 3CBOA 2MI6A 3MKDA 4MZMA 2RQWA 2W10A 2E12A 2Y90A 4MMKA 1AEYA 2K2VA 3OYMA 3CC7T 1JJ2P 1IO6A 1OZ2A 3JCMh 2D8HA 4J7IA 3V8KA 2LC4A 1ZSZB 2NUZA 2LRQA 1RAHB 3JCMW 4XAXB 4R55A 1S72T 4Z88A 1SKUB 2D8JA 1U06A 4KUDK 5CK9A 1KC8R 3CCLA 4OMFB 1SPKA 5CKBA 1ZSGA 2FHDA 5KE3A 1IHWA 4RTYA 1AWXA 3L1AA 1VQNA 1ZUKA 4NOYA 4LDYA 4LD6A 4F7UA 5IXBA 1Q81R 3BY7A 5KYUB 3HFOA 3CCLT 3CMEA 3JCMc 1PRMC 1NYFA 1YJ9A 4QVDA 3CMEQ 2FPDA 2ROTA 2NUTB 2L8DA 2FVUA 1T0HA 5LJ3f 3O8VA 2V8KA 2DIQA 1M2VB 5HK0A 1Q86C 5CIUA 4FU6A 3E19A 4JJCA 4E7SA 2WSCE 5FW9A 3E9GA 4M78G 2XU8A 2M9UA 2DL5A 3RIRA 2LQ8A 1EIFA 1K9MC 1X2QA 2K4YA 2BE7D 1YCYA 2BZXA 1WXBA 3VV0A 2EAYA 1TUCA 1YHQQ 2KEAA 3OYYA 2RHIA 1ZSZA 1WHKA 4F7UF 2L2PA 2VKNA 4ZGJB 2CZ1B 1N6AA 4M75G 4HVVA 3L2QA 3M0PA 1K4US 2KBTA 4OB0B 2CP3A 1IGUA 4F04B 1UGPB 2QYZA 3ULRB 4FYVB 2MCNA 2JM9A 5I2MA 2FL7A 2LVMA 2RJDA 3PVLA 1VQ6A 1FYNA 3OYHA 1M2OA 1RUWA 3HSBA 4M78B 3VUZA 3JB9J 2VUBA 2QTXA 2DPPB 1I81A 1OZ3A 5DLQE 2ZPEB 2ECZA 3EHQA 5KCOA 4HT8A 3M4GA 2DM1A 1X6GA 1VQOQ 5FWBA 1W4SA 3M4YA 1D3BA 4J9EA 4DEXA 2C0OA 2RQVA 5HCKA 2X4XA 1BCMA 2KMTA 5I22A 2PUKB 3G4ST 5IHIA 3NTIA 1QVGP 2OAUA 2PQWA 4BE2A 2OI3A 3BE3A 2BZYA 3C94A 4M77B 2COZA 1UTIA 5D6WA 3A8OB 4MDXA 1PD0A 4C8QF 1VQOT 4M7AB 4JLGA 1ABQA 2QQSA 1TXQA 2EQIA 2K7AA 1EZZB
chains in the Genus database with same CATH topology
4WCIA 1WA7A 1ZBJA 1GCPA 3PVQA 3VS5A 2GNCA 1Z9ZA 2E5KA 1NM7A 1NLOC 1GFCA 1I0CA 1T0JA 2FG0A 2YUPA 1X69A 2DL7A 1I07A 2KRMA 2X3XD 1U5SA 1NEGA 1KJWA 1OPLA 4LN2A 3M0TA 2FRYA 4OMQA 3REAB 2HCKA 2ROLA 2EKHA 5GJVB 3VS1A 2JXBA 2V1QA 3QWYA 3TSZA 1M3AA 2O2OA 1SRMA 2DLPA 2YUOA 2YSQA 2CUBA 1V1CA 2YT6A 3ZL7C 3CQTA 1JU5C 4RTTA 3EG0A 3H0HA 4A63B 2LQNA 4OMPA 2F2XA 4OMNA 4E6RA 3I35A 2CUDA 2KYMA 2DA9A 2CH4A 1FMKA 1ZUYA 4J9CA 2DX1A 2J05A 2EYWA 1PNJA 1NLPC 2KR3A 2P4RA 4ESRA 2SEMA 2C0TA 2HDAA 1GRIA 1K76A 2W0ZA 2EYYA 3M0SA 3NMZC 2GBQA 1X27A 1XOVA 2A36A 4R0KA 4J9DA 4RTUA 4JPBW 1A0NB 2O88A 2AZVA 2GQIA 1WI7A 4JJBA 2PZ1A 2M0YA 1ZUUA 1GL5A 2ENMA 2I0NA 5GJWB 1SHFA 2X3WD 4F16A 2VVKA 2YUNA 3I5SA 1J3TA 1W6XA 1PKSA 2B86A 3UF4A 4AFZC 1QCFA 1BK2A 2CT3A 2J06A 2KRSA 2EGAA 2DL3A 1AVZC 1QLYA 4RTVA 2CT4A 3TVTA 2DF6A 2VWFA 1VYVA 4CC4B 1E7OA 5IHNA 1N5ZA 1VYTA 2LJ1A 2KXDA 2LZ6B 2DNUA 2KXCA 3JV3A 3VRYA 4RTXA 1WFWA 1NEBA 2EVRA 2EYXA 2G6FX 2JMAA 2OAWA 2SRCA 3EG3A 3H0FA 4JJDA 4LUDA 1JO8A 2J6KA 2D0NA 3NHNA 1VYUA 5FWCA 3O5ZA 2EPDA 1ARKA 4AG1C 2HEQA 3RNJA 2O9VA 1K0XA 1TUDA 2KYBA 1VA7A 3VS2A 1JEGA 2RN8A 1K1ZA 4CC2A 2CDTA 3M0RA 3I9QA 1HSQA 1H92A 4J9GA 1PKTA 3RBBB 1WYXA 1H8KA 2ED1A 4IIOA 2DE0X 3KFVA 1YN8A 2IIMA 1UDLA 1MV3A 2DMOA 2GTJA 2RQRA 2LQWA 2AZSA 2DBKA 1LCKA 1YCSB 1UJYA 2AKLA 2JTEA 4J9BA 4RTWA 1M3BA 1JQQA 1M30A 1GCQA 4F14A 3NPFA 1X6BA 3H41A 2JS0A 1WXUA 1K0SA 2O9SA 4J9HA 2EGCA 2LJ0A 2EYZA 4J9FA 2DVJA 1B3QA 2LJ3A 4LE9A 2ESWA 1PRLC 2JW4A 2EGEA 1SEMA 2MIOA 1OOTA 3LH5A 2DJQA 1W70A 4OMOA 1NYGA 3A98A 4HVUA 4Z8AA 3EG2A 2YUQA 2FEIA 1G83A 4DEYA 1UECA 1YWOA 2DL4A 1MV0B 4HCKA 2DRKA 1G2BA 2BTTA 3GBQA 1HJDA 2KE9A 1HD3A 2K6DA 1WLPB 1T3SA 1OEBA 5IHKA 3THKA 2DILA 2RQUA 5IH2A 4JZ3A 4OMLA 1QKXA 5EC7A 2K2MA 5I11A 1RLQC 1T3LA 1Y0MA 1QWEA 3I5RA 2EBPA 4HXJA 2L3SA 1B07A 1W1FA 2JMCA 4ZNXA 3R6NA 1ABOA 3SEMA 4QT7A 3VS7A 2FRWA 1M27C 2ED0A 4GLMA 1KFZA 2JS2A 1JXMA 1TG0A 1EFNA 2PNIA 1MUZA 1UGVA 2K79A 1ZX6A 2C0IA 1M8MA 1YNZA 2NWMA 1X2KA 2OJ2A 2AKKA 1Z9QA 3EGUA 2GTOA 4GBQA 1BBZA 2RQWA 2W10A 4LUEA 1BU1A 1AWOA 1WIEA 2LCSA 1AEYA 4RUGA 2D1XA 1IO6A 2EW3A 2D8HA 2O31A 2CH4W 3QWXX 1UJ0A 3FJ5A 1CSKA 4F17A 1AD5A 2NUZA 2LMJA 4K11A 3VS4A 1NG2A 3UA7A 4FSSA 1SHGA 4Z88A 1YWPA 4CC3A 2D8JA 1U06A 2RMOA 1KSWA 1SSHA 3M0QA 1GBRA 3U23A 3NGPA 1GCQC 1SPKA 2FPFA 4J9IA 1ZSGA 4RTYA 1AWXA 4ORZA 1ZUKA 2HSPA 3REBB 5IXBA 2J6OA 1E6HA 4HVWA 1I1JA 1PRMC 2CSIA 2LX7A 1NYFA 1M3CA 2KGTA 2BZ8A 1UUEA 3VS0A 2FPDA 2ROTA 2DYBA 1QKWA 1T0HA 2K9GA 2L3QA 2FO0A 2MOXA 4LNPA 3UATA 1YP5A 2J6FA 1QWFA 2F2WA 4JJCA 4D8KA 1AWWA 5FW9A 2KT1A 1WDXA 3TSWA 2RNAA 2DL5A 2LNHB 1X2QA 2A28A 2BZXA 1WXBA 2V1RA 2AK5A 1GBQA 4AFUC 3EHRA 1TUCA 2RF0A 2DRMA 4CC7A 3UA6A 1AOJA 2KEAA 1UG1A 4AFQC 1PHTA 3EG1A 2L2PA 4RTZA 5ECAA 2VKNA 4AG2C 2CREA 4HVVA 4X1VA 3M0PA 1CKAA 1AWJA 1K4US 2KBTA 1UHFA 1E6GA 1UFFA 3ULRB 1OV3A 3VS6A 2MCNA 2JM9A 4EIKA 2RPNA 3PVLA 2DBMA 1CKBA 3IQLA 1JXOA 1FYNA 3PE0A 1AZEA 2RQTA 4AFSC 4JZ4A 4Y92A 1RUWA 1WXTA 1U3OA 4OMMA 2ABLA 1RLPC 2DL8A 1AZGB 1S1NA 5L23A 2H8HA 1WX6A 1BB9A 1UHCA 2HBWA 2ECZA 3EHQA 2KRNA 2KT8A 2FPEA 2PTKA 2M51A 1K9AA 2CSQA 2DM1A 3M0UA 4Z89A 1KIKA 2A08A 1X6GA 5FWBA 5IXFA 1ZLMA 2J7IA 3H0IA 4M4ZA 1PWTA 1RI9A 1UE9A 4J9EA 4DEXA 2C0OA 2RQVA 2JM8A 5HCKA 1OPKA 2K3BA 5I22A 3VRZA 1Y57A 5IHIA 2XMFA 1GFDA 2YDLA 2OI3A 3SHWA 2BZYA 2QDLA 2L3PA 2KNBB 1UTIA 2F2VA 4IIMA 2KROA 4D8DA 3C0CA 1X43A 2A37A 2LP5A 2L0AA 1ABQA 1H3HA 2JT4A 1SRLA 2EQIA 2K7AA 3VS3A 2GGRA 4KRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WCI A;  1WA7 A;  1ZBJ A;  1GCP A;  3PVQ A;  3VS5 A;  2GNC A;  1Z9Z A;  2E5K A;  1NM7 A;  1NLO C;  1GFC A;  1I0C A;  1T0J A;  2FG0 A;  2YUP A;  1X69 A;  2DL7 A;  1I07 A;  2KRM A;  2X3X D;  1U5S A;  1NEG A;  1KJW A;  1OPL A;  4LN2 A;  3M0T A;  2FRY A;  4OMQ A;  3REA B;  2HCK A;  2ROL A;  2EKH A;  5GJV B;  3VS1 A;  2JXB A;  2V1Q A;  3QWY A;  3TSZ A;  1M3A A;  2O2O A;  1SRM A;  2DLP A;  2YUO A;  2YSQ A;  2CUB A;  1V1C A;  2YT6 A;  3ZL7 C;  3CQT A;  1JU5 C;  4RTT A;  3EG0 A;  3H0H A;  4A63 B;  2LQN A;  4OMP A;  2F2X A;  4OMN A;  4E6R A;  3I35 A;  2CUD A;  2KYM A;  2DA9 A;  2CH4 A;  1FMK A;  1ZUY A;  4J9C A;  2DX1 A;  2J05 A;  2EYW A;  1PNJ A;  1NLP C;  2KR3 A;  2P4R A;  4ESR A;  2SEM A;  2C0T A;  2HDA A;  1GRI A;  1K76 A;  2W0Z A;  2EYY A;  3M0S A;  3NMZ C;  2GBQ A;  1X27 A;  1XOV A;  2A36 A;  4R0K A;  4J9D A;  4RTU A;  4JPB W;  1A0N B;  2O88 A;  2AZV A;  2GQI A;  1WI7 A;  4JJB A;  2PZ1 A;  2M0Y A;  1ZUU A;  1GL5 A;  2ENM A;  2I0N A;  5GJW B;  1SHF A;  2X3W D;  4F16 A;  2VVK A;  2YUN A;  3I5S A;  1J3T A;  1W6X A;  1PKS A;  2B86 A;  3UF4 A;  4AFZ C;  1QCF A;  1BK2 A;  2CT3 A;  2J06 A;  2KRS A;  2EGA A;  2DL3 A;  1AVZ C;  1QLY A;  4RTV A;  2CT4 A;  3TVT A;  2DF6 A;  2VWF A;  1VYV A;  4CC4 B;  1E7O A;  5IHN A;  1N5Z A;  1VYT A;  2LJ1 A;  2KXD A;  2LZ6 B;  2DNU A;  2KXC A;  3JV3 A;  3VRY A;  4RTX A;  1WFW A;  1NEB A;  2EVR A;  2EYX A;  2G6F X;  2JMA A;  2OAW A;  2SRC A;  3EG3 A;  3H0F A;  4JJD A;  4LUD A;  1JO8 A;  2J6K A;  2D0N A;  3NHN A;  1VYU A;  5FWC A;  3O5Z A;  2EPD A;  1ARK A;  4AG1 C;  2HEQ A;  3RNJ A;  2O9V A;  1K0X A;  1TUD A;  2KYB A;  1VA7 A;  3VS2 A;  1JEG A;  2RN8 A;  1K1Z A;  4CC2 A;  2CDT A;  3M0R A;  3I9Q A;  1HSQ A;  1H92 A;  4J9G A;  1PKT A;  3RBB B;  1WYX A;  1H8K A;  2ED1 A;  4IIO A;  2DE0 X;  3KFV A;  1YN8 A;  2IIM A;  1UDL A;  1MV3 A;  2DMO A;  2GTJ A;  2RQR A;  2LQW A;  2AZS A;  2DBK A;  1LCK A;  1YCS B;  1UJY A;  2AKL A;  2JTE A;  4J9B A;  4RTW A;  1M3B A;  1JQQ A;  1M30 A;  1GCQ A;  4F14 A;  3NPF A;  1X6B A;  3H41 A;  2JS0 A;  1WXU A;  1K0S A;  2O9S A;  4J9H A;  2EGC A;  2LJ0 A;  2EYZ A;  4J9F A;  2DVJ A;  1B3Q A;  2LJ3 A;  4LE9 A;  2ESW A;  1PRL C;  2JW4 A;  2EGE A;  1SEM A;  2MIO A;  1OOT A;  3LH5 A;  2DJQ A;  1W70 A;  4OMO A;  1NYG A;  3A98 A;  4HVU A;  4Z8A A;  3EG2 A;  2YUQ A;  2FEI A;  1G83 A;  4DEY A;  1UEC A;  1YWO A;  2DL4 A;  1MV0 B;  4HCK A;  2DRK A;  1G2B A;  2BTT A;  3GBQ A;  1HJD A;  2KE9 A;  1HD3 A;  2K6D A;  1WLP B;  1T3S A;  1OEB A;  5IHK A;  3THK A;  2DIL A;  2RQU A;  5IH2 A;  4JZ3 A;  4OML A;  1QKX A;  5EC7 A;  2K2M A;  5I11 A;  1RLQ C;  1T3L A;  1Y0M A;  1QWE A;  3I5R A;  2EBP A;  4HXJ A;  2L3S A;  1B07 A;  1W1F A;  2JMC A;  4ZNX A;  3R6N A;  1ABO A;  3SEM A;  4QT7 A;  3VS7 A;  2FRW A;  1M27 C;  2ED0 A;  4GLM A;  1KFZ A;  2JS2 A;  1JXM A;  1TG0 A;  1EFN A;  2PNI A;  1MUZ A;  1UGV A;  2K79 A;  1ZX6 A;  2C0I A;  1M8M A;  1YNZ A;  2NWM A;  1X2K A;  2OJ2 A;  2AKK A;  1Z9Q A;  3EGU A;  2GTO A;  4GBQ A;  1BBZ A;  2RQW A;  2W10 A;  4LUE A;  1BU1 A;  1AWO A;  1WIE A;  2LCS A;  1AEY A;  4RUG A;  2D1X A;  1IO6 A;  2EW3 A;  2D8H A;  2O31 A;  2CH4 W;  3QWX X;  1UJ0 A;  3FJ5 A;  1CSK A;  4F17 A;  1AD5 A;  2NUZ A;  2LMJ A;  4K11 A;  3VS4 A;  1NG2 A;  3UA7 A;  4FSS A;  1SHG A;  4Z88 A;  1YWP A;  4CC3 A;  2D8J A;  1U06 A;  2RMO A;  1KSW A;  1SSH A;  3M0Q A;  1GBR A;  3U23 A;  3NGP A;  1GCQ C;  1SPK A;  2FPF A;  4J9I A;  1ZSG A;  4RTY A;  1AWX A;  4ORZ A;  1ZUK A;  2HSP A;  3REB B;  5IXB A;  2J6O A;  1E6H A;  4HVW A;  1I1J A;  1PRM C;  2CSI A;  2LX7 A;  1NYF A;  1M3C A;  2KGT A;  2BZ8 A;  1UUE A;  3VS0 A;  2FPD A;  2ROT A;  2DYB A;  1QKW A;  1T0H A;  2K9G A;  2L3Q A;  2FO0 A;  2MOX A;  4LNP A;  3UAT A;  1YP5 A;  2J6F A;  1QWF A;  2F2W A;  4JJC A;  4D8K A;  1AWW A;  5FW9 A;  2KT1 A;  1WDX A;  3TSW A;  2RNA A;  2DL5 A;  2LNH B;  1X2Q A;  2A28 A;  2BZX A;  1WXB A;  2V1R A;  2AK5 A;  1GBQ A;  4AFU C;  3EHR A;  1TUC A;  2RF0 A;  2DRM A;  4CC7 A;  3UA6 A;  1AOJ A;  2KEA A;  1UG1 A;  4AFQ C;  1PHT A;  3EG1 A;  2L2P A;  4RTZ A;  5ECA A;  2VKN A;  4AG2 C;  2CRE A;  4HVV A;  4X1V A;  3M0P A;  1CKA A;  1AWJ A;  1K4U S;  2KBT A;  1UHF A;  1E6G A;  1UFF A;  3ULR B;  1OV3 A;  3VS6 A;  2MCN A;  2JM9 A;  4EIK A;  2RPN A;  3PVL A;  2DBM A;  1CKB A;  3IQL A;  1JXO A;  1FYN A;  3PE0 A;  1AZE A;  2RQT A;  4AFS C;  4JZ4 A;  4Y92 A;  1RUW A;  1WXT A;  1U3O A;  4OMM A;  2ABL A;  1RLP C;  2DL8 A;  1AZG B;  1S1N A;  5L23 A;  2H8H A;  1WX6 A;  1BB9 A;  1UHC A;  2HBW A;  2ECZ A;  3EHQ A;  2KRN A;  2KT8 A;  2FPE A;  2PTK A;  2M51 A;  1K9A A;  2CSQ A;  2DM1 A;  3M0U A;  4Z89 A;  1KIK A;  2A08 A;  1X6G A;  5FWB A;  5IXF A;  1ZLM A;  2J7I A;  3H0I A;  4M4Z A;  1PWT A;  1RI9 A;  1UE9 A;  4J9E A;  4DEX A;  2C0O A;  2RQV A;  2JM8 A;  5HCK A;  1OPK A;  2K3B A;  5I22 A;  3VRZ A;  1Y57 A;  5IHI A;  2XMF A;  1GFD A;  2YDL A;  2OI3 A;  3SHW A;  2BZY A;  2QDL A;  2L3P A;  2KNB B;  1UTI A;  2F2V A;  4IIM A;  2KRO A;  4D8D A;  3C0C A;  1X43 A;  2A37 A;  2LP5 A;  2L0A A;  1ABQ A;  1H3H A;  2JT4 A;  1SRL A;  2EQI A;  2K7A A;  3VS3 A;  2GGR A;  4KRT A; 
#chains in the Genus database with same CATH topology
 1ZBJ A;  5J26 A;  4C92 G;  2JOY A;  1D0X A;  3I55 Q;  4BY6 C;  1NLO C;  3WVE B;  1I0C A;  2FG0 A;  4E2F B;  1YIT T;  1YJW T;  4C5G A;  1PG5 B;  4XTX A;  4B9W A;  5GAN 4;  3QJY A;  3PIO A;  3M0T A;  5GAO l;  2K3X A;  4OMQ A;  2RD1 A;  1Q82 R;  2D0Q B;  5GJV B;  3KXT A;  2JXB A;  3S3N A;  5KYX B;  2RJE A;  2CUB A;  2D9T A;  1UGQ B;  1JU5 C;  2YRD A;  3RKX A;  1XJW B;  3INZ A;  1PSE A;  4Z02 A;  2EKO A;  5I21 A;  4JLI A;  5CAI A;  2H3J A;  4EMK B;  5FRM A;  4E6R A;  3OW2 P;  3G1J A;  4C92 B;  2E5Q A;  1FMK A;  3PGG A;  5C0M A;  1VQ8 T;  4XU0 A;  5GAM g;  1PNJ A;  3M55 A;  2KI7 A;  3MP6 A;  4ESR A;  1KC8 C;  2C0T A;  4JRK A;  1NZ9 A;  1C0M A;  1PD1 A;  2XID A;  3P8B B;  4C92 F;  2COY A;  2YLB A;  4R0K A;  3SDZ A;  2OTL T;  1JJ2 S;  4JPB W;  4M7A E;  2AZV A;  3DLM A;  3CCM T;  2ENM A;  3GNF B;  1TSF A;  5FU7 B;  1SHF A;  1WJS A;  4B6M A;  1VQ8 Q;  2YUN A;  4ZTJ A;  2WAC A;  3I5S A;  2R57 A;  2JVV A;  4M7D B;  4UC4 A;  3RMQ A;  4KGZ B;  1OX9 A;  2EGA A;  3OYC A;  2G3R A;  3OBW A;  2DF6 A;  3CC2 T;  5GAN d;  5GMK l;  1VQ4 A;  3CC4 A;  1ZHI A;  3I55 A;  4ZGD B;  3J7A F;  3VRY A;  1BI1 A;  1WFW A;  2EVR A;  4JJD A;  2KQW A;  4PJO A;  3G4S Q;  2J6K A;  1VQK T;  4FW2 A;  3QJ6 A;  1VYU A;  5FWC A;  3MEA A;  3O5Z A;  1ARK A;  4AG1 C;  5DLO A;  3RNJ A;  4HCC A;  3CPF A;  2QEX A;  3ER0 A;  3LWH A;  2FZG B;  4CC2 A;  3RR6 A;  2VB6 A;  5J39 A;  4PJO D;  4QW2 A;  3RDV A;  1WYX A;  4OB3 B;  1H8K A;  2EYQ A;  4E7J A;  1I4K 1;  5GAN e;  1MV3 A;  2YRC A;  4M7D C;  2LCL A;  3MCA B;  1MMA A;  2AKL A;  5DM7 R;  4J9B A;  1WNL A;  1I5O B;  1N8R U;  1DJ7 B;  2XDP A;  3GP8 A;  3QXE B;  4C92 D;  1WXU A;  4C0F A;  3TCJ A;  3G6E Q;  2O9S A;  1TTH B;  4A54 A;  2CZ0 B;  2K5L A;  3LW5 E;  2LJ0 A;  2O01 E;  2P84 A;  4J9F A;  1M1K C;  1QVG S;  4HT9 A;  4LE9 A;  2QGG A;  2ESW A;  2EQM A;  2XIC A;  2MIO A;  1OOT A;  3OSV A;  4OMO A;  1PSF A;  1VQ5 Q;  2DTH A;  1ZA2 B;  4XTY A;  2FEI A;  5CQX A;  5KCH A;  2DXC A;  3UT1 A;  4BY6 B;  1PCX A;  2K6D A;  3OYJ A;  1IB8 A;  1T3S A;  4N4I A;  3CCV A;  4JJN K;  1OEB A;  5IH2 A;  4JZ3 A;  3QZ9 B;  3JB9 G;  2K57 A;  3OS0 A;  4PK4 A;  4YTL A;  5GMK e;  1M90 C;  4M77 E;  4C5H A;  4HXJ A;  2L3S A;  3A5Z B;  1W1F A;  1G3Y A;  4ZNX A;  4ME7 A;  4ATO A;  4C0D C;  4FT2 A;  3G7Z A;  3SEM A;  4N0A C;  1KHC A;  3X26 B;  2QA4 A;  4GLM A;  1KFZ A;  3H8Z A;  4NL3 A;  1TG0 A;  3CC2 Q;  2RHZ A;  4FL6 A;  2JTM A;  2PNI A;  5IN1 A;  2QA4 T;  2BIV A;  1BIA A;  3CC7 A;  5GAN h;  5GAN j;  1X2K A;  2OJ2 A;  2AKK A;  1Z9Q A;  1C6V X;  2GTO A;  4GBQ A;  1FX7 A;  5GAN f;  1YIT A;  1B7T A;  1AWO A;  2MF2 A;  2QTV A;  2LCS A;  2R58 A;  1LVK A;  5LL6 S;  6AT1 B;  5GMK m;  4RKU E;  2P0P A;  2DO3 A;  5KYY B;  4LDX A;  2EW3 A;  4OF1 A;  3CCV Q;  2CH4 W;  4EPC A;  3OYD A;  1BCO A;  3VUB A;  1CSK A;  2A0F B;  2Y4X A;  4E47 A;  2R5A A;  1XNI A;  2EJG A;  8ATC B;  4PFP A;  4PFO A;  4Y91 A;  1Y07 A;  1VQN T;  2M02 A;  2RMO A;  2PVG B;  1KSW A;  1GBR A;  2K5I A;  1GCQ C;  2H3E B;  2O4X A;  4J9I A;  3CCE Q;  5DY9 A;  2J6O A;  1E6H A;  1QW1 A;  1I1J A;  4M75 F;  3BW1 A;  4KH1 B;  3PFS A;  5KYW A;  2LX7 A;  2QQ9 A;  2FYK A;  2KGT A;  1X75 C;  1OYX A;  3VS0 A;  3HHT B;  2DYB A;  3OYF A;  5LJ3 h;  1QKW A;  2VGM A;  3JRZ A;  3PMI A;  2RI3 A;  1U8R A;  1YHQ A;  2HAX A;  5CKD A;  3MET A;  3CXC P;  1QWF A;  1K8A C;  3FDR A;  1U1S A;  2QAZ A;  3FJP A;  2LNH B;  3S3M A;  2QGF B;  2JUF A;  1JJ2 A;  2AK5 A;  1GBQ A;  4AFU C;  3EHR A;  5FRN A;  2RF0 A;  2DRM A;  4CC7 A;  1AOJ A;  1UG1 A;  1FMV A;  2EQK A;  4F7U G;  3M59 A;  5ECA A;  5FRO A;  4AG2 C;  4E7K A;  4LDV A;  3OYB A;  4X1V A;  3JB9 I;  5LJ3 g;  3GIB A;  3OYK A;  1CKA A;  3KBG A;  3OYE A;  2DK3 A;  5KYN A;  3I56 Q;  4BI3 A;  1UFF A;  1OV3 A;  4A4G A;  3OBY A;  1D0Y A;  3IQL A;  1JXO A;  4M77 G;  4BDY A;  1AZE A;  2RQT A;  3QDF A;  3CBM A;  4OMM A;  2ABL A;  2HMA A;  1D09 B;  2DL8 A;  2LQK A;  2H8H A;  1WX6 A;  1BB9 A;  2QEX T;  1IRX A;  5CO7 A;  2OTJ T;  2KRN A;  1HK9 A;  4FSX A;  2GFA A;  2KT8 A;  2NUP A;  2CP7 A;  1RAC B;  1N8R C;  4Z89 A;  1D1B A;  1MMD A;  1ZLM A;  2NLU A;  1PWT A;  1RI9 A;  4J8O A;  1Y96 B;  3P8H A;  2JM8 A;  3CPW P;  1Y57 A;  5GAM e;  1GFD A;  2YDL A;  4M78 C;  5CKH A;  1XQH A;  2HQH A;  2QDL A;  4MZT A;  3GOX A;  2KNB B;  4QKU A;  3HKS A;  4E7H A;  3C0C A;  3R6O A;  1X43 A;  2XHC A;  2L0A A;  1H3H A;  3VS3 A;  4M7A A;  1IZ6 A;  3SD4 A;  3V7R A;  2X4W A;  1GCP A;  3PVQ A;  2GNC A;  2E5K A;  4HCZ A;  1Q82 C;  1VQK Q;  1AHJ B;  2DAQ A;  1GFC A;  4PKC C;  2ZPI B;  1JB0 E;  2KRM A;  1OPL A;  4IUQ A;  2DZ9 A;  1VQM A;  3REA B;  2RO0 A;  5GAN 2;  2CP0 A;  2EKH A;  1QVF P;  2X4Y A;  5GAM f;  3VS1 A;  2V1Q A;  1VQ7 A;  3TSZ A;  4M7A F;  5GAN 8;  2HSE B;  4II1 A;  2CS7 A;  5GAM j;  1VQL Q;  4DBR A;  1R0B G;  3GNG A;  1V1C A;  4ZN3 A;  3JCM g;  2YT6 A;  1YJN Q;  1D1C A;  2OX7 A;  4RTT A;  1MHN A;  1VIE A;  3H0H A;  1KQS P;  2LQN A;  3CCR T;  4FYY B;  4EMK A;  3JCM b;  1IHV A;  5L8R E;  4XTU A;  2VYT A;  4OMN A;  2M0O A;  1Q81 C;  3AT1 B;  2KYM A;  3CMA T;  2RA2 A;  4C8Q G;  3OS2 A;  2J05 A;  1HXD A;  2ZCF B;  1Q81 U;  2HDA A;  1GRI A;  2W0Z A;  2EYY A;  3M0S A;  3CCM A;  4J9D A;  1VQK A;  4M7A C;  2GQI A;  2PZ1 A;  3I56 T;  3CCS A;  2RHY A;  1ZUU A;  4BI4 A;  4TVR A;  4XU3 A;  3EFR A;  2VVK A;  5EG2 A;  4JS4 A;  1AT1 B;  3CME T;  1J3T A;  4PFZ A;  3UF4 A;  3LGL A;  1QCF A;  5GAO q;  2LCC A;  2KRS A;  4M75 D;  1AVZ C;  1QLY A;  4RTV A;  2HQX A;  3CCJ Q;  3GF5 A;  3CCU A;  4PJL A;  3JCM f;  1JRI A;  3CXC S;  1N5Z A;  3MHX A;  2MWP A;  3E9F A;  2E1H A;  2DNU A;  2KXC A;  4PJO E;  3L2Z A;  5KYU A;  4C8Q D;  2G6F X;  4Y28 E;  3H0F A;  1JO8 A;  2RK1 A;  1IGQ A;  3OYL A;  1M9S A;  2MMP A;  4CRI A;  1WJR A;  2EPD A;  2HEQ A;  3FIF A;  4N4H A;  2O9V A;  1XTD A;  1K0X A;  1TUD A;  5CCA A;  3CXC A;  2XDB A;  2X4J A;  2KYB A;  3VS2 A;  4C5I A;  4J7F A;  2CDT A;  2FZC B;  3DB4 A;  2QA4 Q;  4EDU A;  1HSQ A;  4M77 F;  4J9G A;  1PKT A;  3RBB B;  1M1K U;  1NJI U;  5KYY A;  2ED1 A;  4M75 B;  2DE0 X;  3KFV A;  3JAM E;  2IIM A;  1SG5 A;  1UDL A;  1RAB B;  4MML A;  2RQR A;  3UDC A;  3SWN A;  2LQW A;  2RK2 A;  1TH7 A;  1GXI E;  2P0K A;  4J6W A;  4XQ3 A;  3QDR B;  4X9D A;  2EJF A;  1JQQ A;  3CCV T;  1M30 A;  1GCQ A;  2ZPH B;  3LYI A;  3SB2 A;  3NPF A;  3CEY A;  3H41 A;  2DEQ A;  2E65 A;  2EIF A;  4X9C A;  5GAN g;  3V8J A;  4L59 A;  4J9H A;  3FLG A;  2EGC A;  3CPW S;  4OB2 B;  3CCE T;  1M5Q 1;  3Q1J A;  4L5G A;  3VJP A;  8AT1 B;  5AT1 B;  1QVF S;  4DQ2 A;  2D6F A;  2JW4 A;  4A4F A;  5CR2 A;  5IAY A;  3CCQ T;  4C8Q C;  3A98 A;  1I5L A;  1U1T A;  4JRQ A;  4M77 D;  3L2V A;  1VQ5 A;  1G83 A;  4DEY A;  1YWO A;  3MEV A;  2MWO A;  5A0G A;  4DBF A;  1B34 B;  2KE9 A;  5IT9 E;  2X9H A;  3MEW A;  2DIL A;  3G6E T;  2VC8 A;  4RG8 A;  3JB9 F;  1ZQ1 A;  3TQ7 P;  1LNX A;  2P0Q A;  5I11 A;  1WHG A;  4PJO F;  1O75 A;  2CKK A;  1T3L A;  1QWE A;  4BE1 A;  2EBP A;  1OQK A;  1B07 A;  3H6Z A;  5KYX A;  2JMC A;  2CP6 A;  1ABO A;  4N4G A;  1S72 Q;  3VS7 A;  3SWN B;  3MP8 A;  2GCX A;  2CGH A;  2E64 A;  4QQD A;  1ZX6 A;  1MMN A;  2F69 A;  2NWM A;  4L6V 5;  3A8G B;  3DB3 A;  4CC4 B;  4LUE A;  3EGU A;  3ME9 A;  1BBZ A;  4M78 E;  4PJO C;  5AYF A;  2DXT A;  1BKB A;  1V29 B;  1WIE A;  4PLL A;  4ANJ A;  4RUG A;  1ZA1 B;  2D1X A;  2O31 A;  5KE2 A;  2KDS A;  1VQP Q;  2C06 A;  1UJ0 A;  3JB9 D;  3FJ5 A;  3HFN A;  4F17 A;  1AD5 A;  2ATC B;  3CC4 Q;  2LMJ A;  4K11 A;  3VS4 A;  1K73 R;  1NG2 A;  4MZP A;  3UA7 A;  1SHG A;  5GAN 5;  1SSH A;  3JCM Q;  4M7D A;  3NGP A;  1VIF A;  1NJI R;  3M58 A;  2Z0W A;  3MO8 A;  2HSP A;  1YI2 T;  2E6N A;  2KK4 A;  2PU9 B;  1IXD A;  3LLR A;  4XTV A;  4Q5W A;  1D0Z A;  2BZ8 A;  1UUE A;  2BKD N;  4OGC A;  3A8L B;  4C92 A;  3G71 A;  4XU2 A;  4E7Z A;  2K9G A;  3CD6 T;  2FO0 A;  4KT0 E;  1YJ9 T;  3QBY A;  5FU6 C;  3OYG A;  1YIT Q;  1YP5 A;  2J6F A;  1G3W A;  5CVI A;  1WDX A;  3TSW A;  1VQ9 A;  2RNA A;  3MJX A;  2V1R A;  1G3T A;  2MAM A;  5FU7 C;  1VQP A;  1LPL A;  5HK3 A;  4VUB A;  2LDM A;  3UA6 A;  4AFQ C;  2MPX C;  4KUI A;  1PHT A;  3EG1 A;  1VQ6 T;  4KH0 B;  4OP0 A;  4ZGE B;  1VQ9 Q;  4RMO A;  4M7D F;  1R77 A;  3OYN A;  4A53 A;  4FM4 B;  4BUG A;  2QXF A;  5FU6 B;  1G8X A;  4EIK A;  2RPN A;  2DBM A;  1CKB A;  1R0C B;  1M8V A;  2QQB A;  1LJO A;  3PE0 A;  3WVD B;  1JBM A;  2EWN A;  2LT4 A;  2EJ9 A;  1K8A U;  1B34 A;  1WXT A;  2JN0 A;  1K8A R;  1U3O A;  4A4H A;  2KY9 A;  2BE9 B;  1RLP C;  3JCM e;  1AZG B;  4PJM A;  5L23 A;  3CPW A;  3V8L A;  2DJZ A;  1V76 A;  2CSQ A;  1WJQ A;  2JTF A;  4LD9 K;  2A08 A;  2HL5 C;  5IXF A;  4BD3 A;  3QPH A;  4XK8 E;  3GPL A;  1VUB A;  3BDL A;  4M4Z A;  1UE9 A;  3L42 A;  1YIJ T;  2HQE A;  4HKE A;  2K3B A;  1VQ7 T;  1YFN A;  3NTH A;  5KYW B;  4EMH A;  3SHW A;  3NFC A;  5GAN 6;  2L3P A;  3WXM B;  2F2V A;  4IIM A;  1KD1 U;  4D8D A;  2A37 A;  3G4S A;  3C95 A;  3TRE A;  5GAN 3;  2DVE A;  3CC2 A;  3EGD B;  2GGR A;  5GAO n;  3QYG B;  3CBP A;  1SSF A;  1A0N B;  3JSC A;  2XK0 A;  3VS5 A;  2CP2 A;  2XD0 A;  1NM7 A;  1WPY A;  2COW A;  2L89 A;  1M4Z A;  1T0J A;  1NPR A;  3BFM A;  4R56 A;  4ZTF A;  2M1H A;  2DL7 A;  1OX8 A;  2E70 A;  1U5S A;  4KBM B;  1KJW A;  2GFU A;  4LN2 A;  2ZGW A;  2DEU A;  2HCK A;  2HNI A;  1VQL T;  9ATC B;  1YJ9 Q;  2HKQ B;  2YWW A;  2O2O A;  1SRM A;  2DLP A;  1KHI A;  3L2U A;  4IUV A;  3ZL7 C;  3CQT A;  3L2R A;  4IUP A;  4A63 B;  2PUO B;  4M7D E;  4ELZ C;  3CCU Q;  1TU0 B;  3SFM A;  3EAE A;  2AHJ B;  4NL2 A;  1VOM A;  3AHU A;  3I35 A;  1KC8 U;  2CUD A;  2DA9 A;  2CH4 A;  3TEE A;  3PIP A;  1M90 U;  3I55 T;  1M90 R;  4J9C A;  1K73 C;  2DX1 A;  2EYW A;  2PVO B;  1N27 A;  2KR3 A;  4QVC A;  2XG8 D;  2P4R A;  2SEM A;  3TU4 K;  4HCB A;  1M2V A;  2JJ9 A;  1RAE B;  1X27 A;  3HRU A;  3VYH B;  3OA6 A;  1RI0 A;  3M53 A;  2A3L A;  4JJB A;  1WI7 A;  1FMW A;  2M0Y A;  2CZ7 B;  2X3W D;  2LX9 A;  2EQJ A;  5A0D A;  1H3Z A;  2V8I A;  3CCR Q;  2YRV A;  1PC0 A;  1W6X A;  3BDU A;  2B86 A;  4FW1 A;  1BK2 A;  5GAM d;  2DL3 A;  4C92 E;  2HD0 A;  3JCM J;  2CT4 A;  3JCM P;  1Y7X A;  3TVT A;  2VWF A;  1YBY A;  4KGX B;  1G3S A;  5IHN A;  1VYT A;  3ZBD A;  2LZ6 B;  3JV3 A;  2QAS A;  5GAO r;  2EQU A;  3FEO A;  4RTX A;  1O9S A;  2EYX A;  2OAW A;  4M75 C;  4F7U E;  1WHJ A;  4LUD A;  3QSU A;  1YJW Q;  4P5N A;  1SF9 A;  4AMC A;  2RHX A;  4JDS A;  3C12 A;  4PJJ A;  1MGQ A;  3CCS T;  2DKG A;  4OVA A;  1VA7 A;  1JEG A;  1I8F A;  2R5M A;  5CKF A;  1C1A A;  1N9R A;  2ZPG B;  5LJ3 d;  1X6O A;  4M7A D;  4IIO A;  4XTZ A;  4M75 A;  4DA4 A;  3H9N A;  4C0G A;  2GTJ A;  2AZS A;  2DBK A;  1LCK A;  2RB6 A;  2PVD B;  3M54 A;  3CCR A;  2HZY A;  4BI8 B;  5HY6 A;  3VYG A;  3LX7 A;  2JTE A;  3M5A A;  4RTW A;  3CC4 T;  4QQG A;  1EX4 A;  4F14 A;  5GMK i;  4E7L A;  1X6B A;  3OB9 A;  2KAF A;  3ASK A;  3EGX B;  2LTO A;  1N9S A;  3EFO A;  3ZFJ A;  4C0D B;  1RL2 A;  2L3R A;  1K0S A;  3HPW A;  4DBQ A;  3PMT A;  3CCQ A;  4M77 C;  2DVJ A;  1B3Q A;  2LJ3 A;  1HYO A;  1K9M U;  3HTR A;  3RKY A;  2DXU A;  2K5F A;  2NUT A;  1SEM A;  1NYG A;  1KK7 A;  1RAG B;  3QYH B;  3PTA A;  1RAD B;  3QUI A;  4F7U B;  3EG2 A;  3X24 B;  2YUQ A;  2EFI A;  1M1K R;  1VQO A;  1Y96 A;  1KQS S;  2QQA A;  3CD6 Q;  4HCK A;  1Q82 U;  3GBQ A;  3NTK A;  1HD3 A;  1WLP B;  2E10 A;  3CMA Q;  2X35 A;  5IHK A;  3THK A;  2RQU A;  5M9O A;  2NUP B;  1RAI B;  4PJN A;  1QKX A;  1RAA B;  3LH0 A;  3QKJ A;  4FCY A;  2VAS A;  3QG1 A;  1RLQ C;  2F5K A;  1YJN A;  5LJ5 h;  4FYX B;  2WSF E;  4QQ6 A;  4C0Z A;  2RJC A;  1KQ2 A;  2E3I A;  1QCN A;  1YJN T;  3R6N A;  4M78 D;  3X25 B;  3EH2 A;  1Q7Y U;  1BI3 A;  2ED0 A;  2QQR A;  3UPU A;  1JXM A;  3T9N A;  3A1P A;  3X28 B;  4C5E A;  3FC3 A;  1UEB A;  4A4E A;  1EFN A;  4ELY C;  2LNV A;  4BDZ A;  2K3Y A;  2K79 A;  1LOJ A;  1M8M A;  1M1G A;  1YNZ A;  3HRT A;  3CCS Q;  1WHH A;  4C8Q A;  2XKO C;  1BU1 A;  2BUD A;  4B9X A;  2RI5 A;  4V2S A;  2VXE A;  3GLX A;  4J6Y A;  2DD5 A;  3URG A;  3CD6 A;  1KD1 R;  4PL6 A;  3G6E A;  1MMG A;  3QWX X;  1BIB A;  3OW2 S;  4LXC A;  1VQ7 Q;  3OS5 A;  1YIJ Q;  3MEU A;  1Q86 U;  1Q95 G;  1YI2 A;  3DKM A;  3CCJ A;  4FSS A;  2DTI A;  1YWP A;  3P8D A;  4CC3 A;  3V7S A;  3M0Q A;  1WGS A;  3U23 A;  2JNG A;  2AIR B;  2F5T X;  2FPF A;  1Y71 A;  3CCJ T;  4ORZ A;  3REB B;  1WQ7 A;  3QZ5 B;  3L2W A;  4HVW A;  1S72 A;  3OW2 A;  1WQW A;  1QQJ A;  2CSI A;  3EG9 A;  3CCM Q;  3RER A;  1ZSZ C;  4M7A G;  1M3C A;  4LDU A;  3J81 E;  5LJ3 e;  2Y4Y A;  2CYZ B;  4DBH A;  1VQM Q;  4PNO A;  2L3Q A;  2MK5 A;  2MOX A;  3FRN A;  2E4H A;  2RJF A;  3M57 A;  2B8A A;  4LNP A;  1W2B P;  5HKC A;  2O4X B;  3UAT A;  2F2W A;  2X51 A;  4D8K A;  1AWW A;  2KT1 A;  3M9Q A;  4M78 F;  3EGX A;  2A28 A;  4PJO G;  3EFS A;  1NJI C;  2DER A;  3MPU B;  2VGN A;  1YI2 Q;  1OU8 A;  4RTZ A;  1VQ4 Q;  4O5V A;  2CRE A;  1MND A;  4C92 C;  1UGR B;  3A8H B;  1AWJ A;  1F1B B;  1UHF A;  2I2L A;  1E6G A;  4BB7 A;  1TOV A;  3VS6 A;  4ZN1 A;  1N8R R;  2IG0 A;  2ZPB B;  1NPP A;  2QG9 B;  4AFS C;  4JZ4 A;  4N0A A;  4Y92 A;  2DYI A;  2DD4 A;  4IUR A;  2HBP A;  2XDD A;  3PNW C;  1S1N A;  5D7U A;  1UHC A;  2HBW A;  4A4K A;  2E3H A;  4WTO B;  4KUL A;  2FPE A;  5GAO m;  2PTK A;  2M51 A;  5LJ5 f;  1K9A A;  3M0U A;  1KIK A;  1VQ6 Q;  3CCE A;  2L5Q A;  1Q86 R;  2E6Z A;  2RHU A;  3LGF A;  2J7I A;  4JRI A;  3H0I A;  3J80 E;  1QVP A;  4FT4 A;  5GMK j;  1WHM A;  1VQN Q;  1KQ1 A;  1TWB A;  5LJ5 d;  1WHL A;  2YLC A;  1X01 A;  1OPK A;  1BI2 A;  3VRZ A;  2XMF A;  1TUG B;  2JZ2 A;  1KQS A;  2CZ6 B;  1Q7Y C;  1MNE A;  5GAO p;  1D1A A;  2E41 A;  1FWZ A;  1VQ5 T;  2KRO A;  1QMC A;  3JCM d;  1ZBX A;  2NYS A;  2YXY A;  2FB7 A;  2LP5 A;  7AT1 B;  3MP1 A;  3RKW A;  4EMG A;  2JT4 A;  1SRL A;  4IKF A;  3CMA A;  4KRT A;  3G71 T;  3N5B B;  4WCI A;  1WA7 A;  3HP9 A;  3CCL Q;  1Z9Z A;  2FZK B;  3S3O A;  2DIG A;  2YUP A;  1X69 A;  1I07 A;  2X3X D;  4M7D D;  4IUU A;  1NEG A;  4OB1 B;  3PT9 A;  2FRY A;  4M78 A;  2V8J A;  2ROL A;  1UB4 A;  5FLX E;  1TS9 A;  2OTL Q;  2DXB A;  1NBE B;  3QWY A;  1M3A A;  4M75 E;  2YUO A;  2YSQ A;  4O6J A;  1VQM T;  3E1S A;  4FYW B;  3UWN A;  4D6W A;  1M1F A;  3EG0 A;  4XU1 A;  4OMP A;  5J3B A;  3RES A;  1W2B A;  4JUV A;  2F2X A;  1KG1 A;  1K73 U;  4C8Q E;  4XTW A;  3A8M B;  2KSS A;  1VQ4 T;  1ZUY A;  4JS5 A;  4LDW A;  3QII A;  1IRE B;  1FXX A;  1NLP C;  2RM4 A;  3V7C A;  5LJ3 j;  2VXF A;  3I56 A;  4PJO B;  1RAF B;  1K76 A;  2WSE E;  4DOW A;  3NMZ C;  5C6S A;  2GBQ A;  1XOV A;  2A36 A;  4RTU A;  3JCM X;  2O88 A;  1H64 1;  4M7D G;  3S6W A;  2GF7 A;  1GL5 A;  3EG9 B;  2I0N A;  3QHS A;  5GJW B;  3CC7 Q;  4F16 A;  3HRS A;  2OTL A;  1QCO A;  1OU9 A;  3CCU T;  4RCC A;  1PKS A;  3OYA A;  4AFZ C;  2IPO B;  3OQ5 A;  4WF2 A;  3OSS C;  3EGD A;  2CT3 A;  2J06 A;  4IUT A;  1W2B S;  3QO3 A;  5I2S A;  3OS1 A;  1VYV A;  5CKE A;  1E7O A;  2A7Y A;  1VQ8 A;  3HL8 A;  4DOV A;  5A0L A;  4E7I A;  2LJ1 A;  2KXD A;  3RUX A;  1QVF A;  3KUF A;  3M56 A;  4OGE A;  3SWN C;  4KGV B;  1QP2 A;  5LJ5 j;  1NEB A;  2JMA A;  2SRC A;  3EG3 A;  3VKI A;  5GMK h;  2CP5 A;  2D0N A;  1VQ9 T;  2GQV A;  2HL3 A;  3NHN A;  2V26 A;  3F70 A;  4C8Q B;  5GAN 7;  2MYS A;  2KVQ G;  2DET A;  2RN8 A;  1K1Z A;  3M0R A;  3I9Q A;  1H92 A;  1KD1 C;  1G5V A;  3G71 Q;  1YN8 A;  3JB9 H;  1QP3 A;  4BAC A;  1K9M R;  4PLI A;  4NS5 A;  4J83 A;  4QVZ A;  5D6Y A;  2F1L A;  4GY5 A;  2DMO A;  1QVG A;  5KH6 A;  1YCS B;  1UJY A;  1M3B A;  1WZO A;  2M16 A;  1OUL A;  1PM3 A;  1VQP T;  3VU3 C;  2JS0 A;  4J6X A;  2DFU A;  2LT1 A;  4X34 A;  2ZAE A;  4J5Y A;  1R8O B;  3DLL A;  2EYZ A;  2QEX Q;  3RMS A;  4EMK C;  2QDY B;  4FIB A;  5LJ5 g;  4AT1 B;  2XI9 A;  2ZZD A;  3D7S B;  2RI2 A;  1YJW A;  2DZC A;  1PRL C;  2EGE A;  3ZEH A;  3LH5 A;  2DJQ A;  1W70 A;  2DTO A;  4CI0 C;  4HVU A;  4Z8A A;  2QI2 A;  1Q7Y R;  2IVW A;  1ACM B;  1UEC A;  2DL4 A;  1MV0 B;  2DRK A;  1G2B A;  2BTT A;  4MDW A;  1HJD A;  2AT1 B;  3LWI A;  1OI1 A;  3E2U A;  5D6X A;  1YHQ T;  2VV5 A;  4M77 A;  5CQY A;  4OML A;  2HKN A;  4BE0 A;  3OMC A;  5EC7 A;  4HA8 A;  2K2M A;  2RH2 A;  2ZPF B;  1YIJ A;  2OTJ Q;  3EFO B;  3C4S A;  1Y0M A;  3I5R A;  5A2Q E;  1D3B B;  5LJ5 e;  4RG2 A;  2OTJ A;  4RCB A;  2QK0 A;  3OY9 A;  2YHT A;  3JCM V;  4QT7 A;  2FRW A;  1M27 C;  3EH1 A;  1VQL A;  5GAM h;  1P92 A;  2JS2 A;  3CCQ Q;  4JRP A;  2P4T A;  1NE8 A;  3OYI A;  4GLK A;  1MUZ A;  3OMG A;  1UGV A;  1BI0 A;  1UGS B;  3FB9 A;  3X20 B;  1BYM A;  2C0I A;  3CBO A;  2MI6 A;  3MKD A;  4MZM A;  2RQW A;  2W10 A;  2E12 A;  2Y90 A;  4MMK A;  1AEY A;  2K2V A;  3OYM A;  3CC7 T;  1JJ2 P;  1IO6 A;  1OZ2 A;  3JCM h;  2D8H A;  4J7I A;  3V8K A;  2LC4 A;  1ZSZ B;  2NUZ A;  2LRQ A;  1RAH B;  3JCM W;  4XAX B;  4R55 A;  1S72 T;  4Z88 A;  1SKU B;  2D8J A;  1U06 A;  4KUD K;  5CK9 A;  1KC8 R;  3CCL A;  4OMF B;  1SPK A;  5CKB A;  1ZSG A;  2FHD A;  5KE3 A;  1IHW A;  4RTY A;  1AWX A;  3L1A A;  1VQN A;  1ZUK A;  4NOY A;  4LDY A;  4LD6 A;  4F7U A;  5IXB A;  1Q81 R;  3BY7 A;  5KYU B;  3HFO A;  3CCL T;  3CME A;  3JCM c;  1PRM C;  1NYF A;  1YJ9 A;  4QVD A;  3CME Q;  2FPD A;  2ROT A;  2NUT B;  2L8D A;  2FVU A;  1T0H A;  5LJ3 f;  3O8V A;  2V8K A;  2DIQ A;  1M2V B;  5HK0 A;  1Q86 C;  5CIU A;  4FU6 A;  3E19 A;  4JJC A;  4E7S A;  2WSC E;  5FW9 A;  3E9G A;  4M78 G;  2XU8 A;  2M9U A;  2DL5 A;  3RIR A;  2LQ8 A;  1EIF A;  1K9M C;  1X2Q A;  2K4Y A;  2BE7 D;  1YCY A;  2BZX A;  1WXB A;  3VV0 A;  2EAY A;  1TUC A;  1YHQ Q;  2KEA A;  3OYY A;  2RHI A;  1ZSZ A;  1WHK A;  4F7U F;  2L2P A;  2VKN A;  4ZGJ B;  2CZ1 B;  1N6A A;  4M75 G;  4HVV A;  3L2Q A;  3M0P A;  1K4U S;  2KBT A;  4OB0 B;  2CP3 A;  1IGU A;  4F04 B;  1UGP B;  2QYZ A;  3ULR B;  4FYV B;  2MCN A;  2JM9 A;  5I2M A;  2FL7 A;  2LVM A;  2RJD A;  3PVL A;  1VQ6 A;  1FYN A;  3OYH A;  1M2O A;  1RUW A;  3HSB A;  4M78 B;  3VUZ A;  3JB9 J;  2VUB A;  2QTX A;  2DPP B;  1I81 A;  1OZ3 A;  5DLQ E;  2ZPE B;  2ECZ A;  3EHQ A;  5KCO A;  4HT8 A;  3M4G A;  2DM1 A;  1X6G A;  1VQO Q;  5FWB A;  1W4S A;  3M4Y A;  1D3B A;  4J9E A;  4DEX A;  2C0O A;  2RQV A;  5HCK A;  2X4X A;  1BCM A;  2KMT A;  5I22 A;  2PUK B;  3G4S T;  5IHI A;  3NTI A;  1QVG P;  2OAU A;  2PQW A;  4BE2 A;  2OI3 A;  3BE3 A;  2BZY A;  3C94 A;  4M77 B;  2COZ A;  1UTI A;  5D6W A;  3A8O B;  4MDX A;  1PD0 A;  4C8Q F;  1VQO T;  4M7A B;  4JLG A;  1ABQ A;  2QQS A;  1TXQ A;  2EQI A;  2K7A A;  1EZZ B; 
#chains in the Genus database with same CATH homology
 4WCI A;  1WA7 A;  1ZBJ A;  1GCP A;  3PVQ A;  3VS5 A;  2GNC A;  1Z9Z A;  2E5K A;  1NM7 A;  1NLO C;  1GFC A;  1I0C A;  1T0J A;  2FG0 A;  2YUP A;  1X69 A;  2DL7 A;  1I07 A;  2KRM A;  2X3X D;  1U5S A;  1NEG A;  1KJW A;  1OPL A;  4LN2 A;  3M0T A;  2FRY A;  4OMQ A;  3REA B;  2HCK A;  2ROL A;  2EKH A;  5GJV B;  3VS1 A;  2JXB A;  2V1Q A;  3QWY A;  3TSZ A;  1M3A A;  2O2O A;  1SRM A;  2DLP A;  2YUO A;  2YSQ A;  2CUB A;  1V1C A;  2YT6 A;  3ZL7 C;  3CQT A;  1JU5 C;  4RTT A;  3EG0 A;  3H0H A;  4A63 B;  2LQN A;  4OMP A;  2F2X A;  4OMN A;  4E6R A;  3I35 A;  2CUD A;  2KYM A;  2DA9 A;  2CH4 A;  1FMK A;  1ZUY A;  4J9C A;  2DX1 A;  2J05 A;  2EYW A;  1PNJ A;  1NLP C;  2KR3 A;  2P4R A;  4ESR A;  2SEM A;  2C0T A;  2HDA A;  1GRI A;  1K76 A;  2W0Z A;  2EYY A;  3M0S A;  3NMZ C;  2GBQ A;  1X27 A;  1XOV A;  2A36 A;  4R0K A;  4J9D A;  4RTU A;  4JPB W;  1A0N B;  2O88 A;  2AZV A;  2GQI A;  1WI7 A;  4JJB A;  2PZ1 A;  2M0Y A;  1ZUU A;  1GL5 A;  2ENM A;  2I0N A;  5GJW B;  1SHF A;  2X3W D;  4F16 A;  2VVK A;  2YUN A;  3I5S A;  1J3T A;  1W6X A;  1PKS A;  2B86 A;  3UF4 A;  4AFZ C;  1QCF A;  1BK2 A;  2CT3 A;  2J06 A;  2KRS A;  2EGA A;  2DL3 A;  1AVZ C;  1QLY A;  4RTV A;  2CT4 A;  3TVT A;  2DF6 A;  2VWF A;  1VYV A;  4CC4 B;  1E7O A;  5IHN A;  1N5Z A;  1VYT A;  2LJ1 A;  2KXD A;  2LZ6 B;  2DNU A;  2KXC A;  3JV3 A;  3VRY A;  4RTX A;  1WFW A;  1NEB A;  2EVR A;  2EYX A;  2G6F X;  2JMA A;  2OAW A;  2SRC A;  3EG3 A;  3H0F A;  4JJD A;  4LUD A;  1JO8 A;  2J6K A;  2D0N A;  3NHN A;  1VYU A;  5FWC A;  3O5Z A;  2EPD A;  1ARK A;  4AG1 C;  2HEQ A;  3RNJ A;  2O9V A;  1K0X A;  1TUD A;  2KYB A;  1VA7 A;  3VS2 A;  1JEG A;  2RN8 A;  1K1Z A;  4CC2 A;  2CDT A;  3M0R A;  3I9Q A;  1HSQ A;  1H92 A;  4J9G A;  1PKT A;  3RBB B;  1WYX A;  1H8K A;  2ED1 A;  4IIO A;  2DE0 X;  3KFV A;  1YN8 A;  2IIM A;  1UDL A;  1MV3 A;  2DMO A;  2GTJ A;  2RQR A;  2LQW A;  2AZS A;  2DBK A;  1LCK A;  1YCS B;  1UJY A;  2AKL A;  2JTE A;  4J9B A;  4RTW A;  1M3B A;  1JQQ A;  1M30 A;  1GCQ A;  4F14 A;  3NPF A;  1X6B A;  3H41 A;  2JS0 A;  1WXU A;  1K0S A;  2O9S A;  4J9H A;  2EGC A;  2LJ0 A;  2EYZ A;  4J9F A;  2DVJ A;  1B3Q A;  2LJ3 A;  4LE9 A;  2ESW A;  1PRL C;  2JW4 A;  2EGE A;  1SEM A;  2MIO A;  1OOT A;  3LH5 A;  2DJQ A;  1W70 A;  4OMO A;  1NYG A;  3A98 A;  4HVU A;  4Z8A A;  3EG2 A;  2YUQ A;  2FEI A;  1G83 A;  4DEY A;  1UEC A;  1YWO A;  2DL4 A;  1MV0 B;  4HCK A;  2DRK A;  1G2B A;  2BTT A;  3GBQ A;  1HJD A;  2KE9 A;  1HD3 A;  2K6D A;  1WLP B;  1T3S A;  1OEB A;  5IHK A;  3THK A;  2DIL A;  2RQU A;  5IH2 A;  4JZ3 A;  4OML A;  1QKX A;  5EC7 A;  2K2M A;  5I11 A;  1RLQ C;  1T3L A;  1Y0M A;  1QWE A;  3I5R A;  2EBP A;  4HXJ A;  2L3S A;  1B07 A;  1W1F A;  2JMC A;  4ZNX A;  3R6N A;  1ABO A;  3SEM A;  4QT7 A;  3VS7 A;  2FRW A;  1M27 C;  2ED0 A;  4GLM A;  1KFZ A;  2JS2 A;  1JXM A;  1TG0 A;  1EFN A;  2PNI A;  1MUZ A;  1UGV A;  2K79 A;  1ZX6 A;  2C0I A;  1M8M A;  1YNZ A;  2NWM A;  1X2K A;  2OJ2 A;  2AKK A;  1Z9Q A;  3EGU A;  2GTO A;  4GBQ A;  1BBZ A;  2RQW A;  2W10 A;  4LUE A;  1BU1 A;  1AWO A;  1WIE A;  2LCS A;  1AEY A;  4RUG A;  2D1X A;  1IO6 A;  2EW3 A;  2D8H A;  2O31 A;  2CH4 W;  3QWX X;  1UJ0 A;  3FJ5 A;  1CSK A;  4F17 A;  1AD5 A;  2NUZ A;  2LMJ A;  4K11 A;  3VS4 A;  1NG2 A;  3UA7 A;  4FSS A;  1SHG A;  4Z88 A;  1YWP A;  4CC3 A;  2D8J A;  1U06 A;  2RMO A;  1KSW A;  1SSH A;  3M0Q A;  1GBR A;  3U23 A;  3NGP A;  1GCQ C;  1SPK A;  2FPF A;  4J9I A;  1ZSG A;  4RTY A;  1AWX A;  4ORZ A;  1ZUK A;  2HSP A;  3REB B;  5IXB A;  2J6O A;  1E6H A;  4HVW A;  1I1J A;  1PRM C;  2CSI A;  2LX7 A;  1NYF A;  1M3C A;  2KGT A;  2BZ8 A;  1UUE A;  3VS0 A;  2FPD A;  2ROT A;  2DYB A;  1QKW A;  1T0H A;  2K9G A;  2L3Q A;  2FO0 A;  2MOX A;  4LNP A;  3UAT A;  1YP5 A;  2J6F A;  1QWF A;  2F2W A;  4JJC A;  4D8K A;  1AWW A;  5FW9 A;  2KT1 A;  1WDX A;  3TSW A;  2RNA A;  2DL5 A;  2LNH B;  1X2Q A;  2A28 A;  2BZX A;  1WXB A;  2V1R A;  2AK5 A;  1GBQ A;  4AFU C;  3EHR A;  1TUC A;  2RF0 A;  2DRM A;  4CC7 A;  3UA6 A;  1AOJ A;  2KEA A;  1UG1 A;  4AFQ C;  1PHT A;  3EG1 A;  2L2P A;  4RTZ A;  5ECA A;  2VKN A;  4AG2 C;  2CRE A;  4HVV A;  4X1V A;  3M0P A;  1CKA A;  1AWJ A;  1K4U S;  2KBT A;  1UHF A;  1E6G A;  1UFF A;  3ULR B;  1OV3 A;  3VS6 A;  2MCN A;  2JM9 A;  4EIK A;  2RPN A;  3PVL A;  2DBM A;  1CKB A;  3IQL A;  1JXO A;  1FYN A;  3PE0 A;  1AZE A;  2RQT A;  4AFS C;  4JZ4 A;  4Y92 A;  1RUW A;  1WXT A;  1U3O A;  4OMM A;  2ABL A;  1RLP C;  2DL8 A;  1AZG B;  1S1N A;  5L23 A;  2H8H A;  1WX6 A;  1BB9 A;  1UHC A;  2HBW A;  2ECZ A;  3EHQ A;  2KRN A;  2KT8 A;  2FPE A;  2PTK A;  2M51 A;  1K9A A;  2CSQ A;  2DM1 A;  3M0U A;  4Z89 A;  1KIK A;  2A08 A;  1X6G A;  5FWB A;  5IXF A;  1ZLM A;  2J7I A;  3H0I A;  4M4Z A;  1PWT A;  1RI9 A;  1UE9 A;  4J9E A;  4DEX A;  2C0O A;  2RQV A;  2JM8 A;  5HCK A;  1OPK A;  2K3B A;  5I22 A;  3VRZ A;  1Y57 A;  5IHI A;  2XMF A;  1GFD A;  2YDL A;  2OI3 A;  3SHW A;  2BZY A;  2QDL A;  2L3P A;  2KNB B;  1UTI A;  2F2V A;  4IIM A;  2KRO A;  4D8D A;  3C0C A;  1X43 A;  2A37 A;  2LP5 A;  2L0A A;  1ABQ A;  1H3H A;  2JT4 A;  1SRL A;  2EQI A;  2K7A A;  3VS3 A;  2GGR A;  4KRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...