2CUEA

Solution structure of the homeobox domain of the human paired box protein pax-6
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
b'GSSGSSGQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Paired box protein Pax6
publication title Solution structure of the homeobox domain of the human paired box protein Pax-6
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 19
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2cueA01
2K9NA 2DA2A 2ME0A 1FIAA 2E2JJ 4MO7A 3HKZN 3MVPA 1JKPC 2DJNA 1WPKA 2WV1A 3OSGA 3JR9A 4DZPA 3HGYA 4M3DA 2R5ZB 3BR2A 1RKWA 1AKHA 4A3KJ 1IDZA 3BQZA 3ZQLA 1ETKA 1IG7A 1SANA 2DA1A 5J1UA 5F0FA 3CCYA 3GTMJ 1S7EA 3GBGA 5J3LA 3FK7A 2HXIA 1MSEC 4D7NA 4Y52J 3HM5A 3JRGA 3JRAA 2NS8A 1X2MA 3E7LA 3B6AA 4W97A 1WI3A 2E1OA 4XICA 3JRBA 2DMPA 5HODA 1SFOJ 4C2MJ 1FEXA 2HDDA 2CUFA 3DCFA 3UKGA 2X9DA 5EGOA 5F27A 2DA4A 3MN2A 2AHQA 1H88C 1LFBA 2E19A 5IYCJ 1BL0A 3C2BA 1WH5A 5M5XJ 1TWFJ 1HLVA 1AKHB 4B1RA 2O9LA 5M5YJ 2EH3A 2CRGA 3BR5A 3W6VA 5F0HA 5EG0B 3F0CA 5FKKA 2IBDA 1X58A 3SFIA 1GV5A 5EYRA 1Q1VA 1TWAJ 3ZQFA 3H0GJ 2DN0A 5FKNA 4Y7NJ 4M3BA 1U78A 4JX6A 3NAUA 1JJ8C 1NTCA 1RPWA 5F08A 2R7ZJ 3SDGA 4B3AA 4JP0A 3HOZJ 3BR1A 2CQQA 5E3OA 1IGNA 1P7IA 3PO3J 4DZJA 1ETXA 2DA5A 2IAIA 1GV2A 1MBHA 2OPTA 2ZB9A 5DTDA 3ZQGA 2GM4A 2CQXA 5EZGA 1WCMJ 3GTJJ 2QF7A 4MIMA 1DU0A 4MFDA 3JRCA 3I4MJ 3HEFA 4A3IJ 5JLWA 3TP0A 2Y2ZA 4NDLA 1ZK8A 2LY9A 2LK2A 3CQZJ 4DYQA 2NVQJ 3BR0A 2NOGA 3CDLA 2M2EA 3BTLA 3IV5A 1MBEA 2DMUA 3K2AA 3LNQA 1W0UA 3RQIA 2XPUA 4M6VA 3HOUJ 4IHVA 2K9SA 3BG5A 5IP6A 5GPCA 3K7AJ 3FKIJ 3QPLA 3M3YJ 1ETOA 1OJLA 1RESA 3S1RJ 3TW6A 4L5EA 2FX0A 5IOYA 5FJ8J 1HDDC 1YRNA 3LSGA 1U9OA 3B6CA 3FISA 5M3MJ 3JRHA 1ZGWA 2RAEA 2XSDC 4IHWA 3MKLA 2EZKA 2JA5J 3IH4A 4A3CJ 2XPWA 1JJ6C 2DTZA 2ID6A 2M9HA 2VKVA 1LE8B 1TC3C 1TWCJ 1A5JA 1VF9A 1MNMC 2KDZA 2COBA 1IRZA 1X2NA 4HNVA 3ZQCA 1ORKA 4FISA 1IDYA 2JK3A 5C4XJ 3JRIA 1OCPA 2JA8J 2CJJA 4W1UA 2EQRA 4M3EA 1HCRA 4IHYA 2M34A 1JT6A 2X6OA 3ZQIA 1Y1VJ 3BR3A 4RDUA 5E3MA 2WAQN 2QCOA 3HB9A 4QTRA 9ANTA 1VFCA 1Z77A 3S14J 1JTXA 2R0QC 3GTLJ 2VI6A 3GTGJ 1ZR4A 4I6ZA 2LR8A 2HI3A 5DS9A 5GP9A 4BY7J 3HDDA 2JN6A 3LSRA 2H1KA 1APLC 2L9RA 2GLOA 4A3MJ 2Y9ZA 2NVXJ 1F36A 2CUEA 2L7MP 5C4JJ 1QVUA 1MH4A 5F04A 2H8RA 3OSFA 1HDPA 1I50J 3QQAA 1VI0A 3O8HA 2VKEA 4EEFG 3VPRA 3RKQA 3RZOJ 1ETWA 1O4XA 4S0HB 1FIPA 5FKLA 2MG4A 2AO9A 2O8KA 2N8GA 2YUSA 1ZKGA 4BY1J 5F0CA 4FE7A 1JKQC 3GTOJ 2LTPA 3S16J 3DEWA 5J1YA 3GTPJ 3Q0UA 4QIWN 1PUFA 1BJZA 2LLKA 5IYBJ 2VUMJ 1HOMA 2LVSA 3S2DJ 2FD5A 4V2FA 3HGGA 4DYCA 2DMQA 5BNGA 4FCYA 1XS9A 3BG9A 1IUFA 5EGOB 1JGGA 2NS7A 3BQYA 1JUSA 4CYCA 2NVTJ 2Y9YA 4J19A 1OFCX 2ECCA 1JT0A 3TP3A 1E3OC 3LSPA 2HOAA 1K61A 3BR6A 4AYBN 1AU7A 2Y0SN 1ETVA 1A6IA 4BXXJ 5J1RA 3S1MJ 3JRFA 4FTHA 4AC0A 1ITYA 1NK2P 2EZHA 1K83J 1QRYA 4D7MA 1MH3A 4B4CA 5C3EJ 4DYRA 5E3LA 1G2HA 1RETA 3HOWJ 3BTIA 1AHDP 1BW5A 2HOTA 2L0KA 4A3DJ 2YS9A 5M3FJ 2XGEA 2B63J 5F1JA 1PUFB 4X6AJ 1LFUP 3S1QJ 1B72A 3OIOA 4I76A 5IP9J 2XPVA 4UUSA 1VNDA 3RZDJ 3ZQHA 2VPRA 3ZOBA 5EDNA 1GDTA 2DA6A 3JREA 5IP7J 3HBLA 3TW7A 4JX4A 4XRMA 4RBOA 2HXOA 2KT0A 3BTJA 1CQTA 1ETQA 3O8GA 1HF0A 4JYKA 2PMZN 3WHBA 2WB1N 3PO2J 3S17J 4C3JJ 3BTCA 4M3GA 3FK6A 3BG3A 2LP0A 2CU7A 3G1LA 1RKTA 1TWHJ 2ELKA 1FJLA 2G0EA 2ID3A 1JKRC 4IEJA 5GPAA 2L7FP 1TWGJ 3CMYA 5FKOA 3QPSA 1FTTA 1QVTA 2XGCA 1U8BA 1W0TA 2NVYJ 1R9TJ 4V2GA 4A3JJ 5JLXA 1D5YA 3A01A 2XRLA 3OOUA 2HOSA 2K9QA 3BT9A 3G1OA 1B72B 4UUSB 1WH7A 3GTKJ 1YRNB 4A93J 1IC8A 4XIDA 4C3HJ 4C3IJ 1MBGA 1Z0XA 1JTYA 4BBRJ 4D5CA 5EG0A 1MSFC 3HOVJ 1T33A 1Y1WJ 1XC5A 1MBJA 1UMQA 3Q0VA 2R92J 5E3NA 1WGXA 4QSHA 5FKMA 2DA7A 3LOCA 2EBIA 1FTZA 1MBFA 2OF7A 4AUXA 3G1MA 2ME6A 3SJMA 2LD5A 3A02A 4D5FA 4MFEA 5EF6A 1F43A 4FE4A 2M8GX 2YU9J 4ABZA 3L1PA 3Q0WA 4LOCA 5EZHA 3NARA 4BBSJ 3PM1A 1QPIA 1UG2A 3A01B 4MLOA 3LSJA 3IH2A 1T56A 4A3FJ 2E2IJ 5EEAA 1RR7A 2FQ4A 3S15J 1U9NA 5M5WJ 2DA3A 2TRTA 4JX5A 2P81A 4A3BJ 2R5YA 2MW8A 5IPAA 1POGA 4A3EJ 2L7ZA 3WHCA 3FIWA 1NK3P 2IEKA 2JA6J 2MGQA 3JRDA 2X48A 1JUMA 3I4NJ 1H8AC 2I10A 5K7HA 2R93J 4XRSG 4X1EA 2HYJA 2DMTA 4A3LJ 1B8IA 1MBKA 2JMWA 5C44J 1H89C 2MSYA 1DU6A 2XB5A 1EF4A 5FLVA 5K7FA 2Y31A 1XG1A 1BA5A 1OCTC 2D5VA 2JJ7A 1I3QJ 5K7ZA 2FJ1A 3M4OJ 3GTQJ 2ECBA 1IV6A 1LE8A 1GUUA 1UHSA 1P7JA 3H3VK 1JKOC 1IJWC 3D1NI 1JUPA 2W48A 2JA7J 2R5ZA 2K40A 3S1NJ 4IHXA 2R5YB 1ZR2A 3Q3SA 2TCTA 3HOYJ 2Y30A 1I6HJ 4CYCB 1ENHA 4G12A 2XGDA 3A03A 3HOXJ 4DW6A 4A69C 2JWTA 4GFBA 3S2HJ 4UUTA 1GT0C 1ZTRA 2EZLA 5IOZA 2DMNA 5FLMJ 1B8IB 4M3FA 5IYDJ 1GVDA 3IH3A 2O7OA 4XRSA 2HQ5A 2GBYA 1ZQ3P 1BW6A 3TEDA 2LFBA 2LKXA 1ETYA 2XB0X 4XK4A 2EZIA 2M0CA 4BKXA 2E2HJ 4A3GJ
chains in the Genus database with same CATH superfamily
2ZFUA 3MKWB 1WVRA 3ECHA 1FIAA 4HG2A 1E2XA 3HKZN 4MO7A 3OYIA 1FY7A 1GHCA 1WPKA 2DT5A 2BY1A 2WV1A 4DZPA 2DYSH 3RQ4A 3OYFA 4KA4A 3BR2A 1AKHA 4DIQA 3ZQLA 3CP8A 2PJRB 1SANA 5J1UA 1TQIA 2FBKA 3GTMJ 1S7EA 3GBGA 2CQKA 3FK7A 1NG7A 1MSEC 4Y52J 1YTYA 3HM5A 2BYVE 4PSXA 3UR3C 1IUYA 2HNHA 2DQRA 3GZ5A 3PUBA 1X1BA 3HKZA 5IT9K 3B6AA 4HV6A 2HQNA 2E1OA 3L2VA 3HSEA 4KUMA 1SFOJ 3PQKA 2XSJC 1ZELA 1X3UA 2F5FA 4G7OF 2CUFA 2KQRA 3IP4B 2X9DA 3MCZA 5EGOA 3OS2A 3MKYB 5F27A 3UKGA 1FPQA 3TQNA 5LEKA 4IQ4A 2AS5F 2EK5A 2JUGA 2QBYA 1KU2A 2CYYA 2WAFA 1H88C 1LFBA 2YX7A 2XAHA 5LBQA 2QQBA 3C2BA 4WXHA 3DPLC 3V8KA 1HLVA 2O9LA 3F3XA 5M5YJ 2EH3A 2CRGA 3BR5A 5F0HA 4XN0A 3CJQB 4G7ZF 3F0CA 3DLAA 1X58A 2VPLA 1WJ5A 1GV5A 3BPVA 1Q1VA 1ZRFA 1OISA 3ZQFA 1VQ7I 2OQRA 1Z21A 3H0GJ 3KEYA 4M3BA 5FKNA 4Y7NJ 1R49A 2JRTA 1LJ9A 2FNAA 5F08A 3WGGA 3NWTA 1B1BA 3BR1A 3IUOA 2IGKA 4EJUA 3HOZJ 1YOVB 4DZJA 2F4OB 1X4PA 1GV2A 2OPTA 4ZJZA 3ZQGA 1A6QA 1D1BA 3LSIA 2CQXA 3LFUA 1FYLA 2IGOA 1MDMB 1JE8A 4KMFA 3RKWA 4E7SA 2LKPA 4MGRA 3HUGB 1YIOA 3I4MJ 3M07A 4ZYAA 4ESFA 4ETSA 2Y2ZA 5J4YA 2LY9A 3R61A 1XCVA 1FBSA 3A1YA 4WXDA 2IJLA 1WJFA 3TOBA 2NVQJ 5HS9A 3BR0A 3CDLA 1YX5A 2M2EA 3BTLA 1V5GA 1LQ1A 1DQUA 1S3JA 2DMUA 1Z05A 3J81Z 4EQQA 1FOYA 3LA2A 3BCBA 1BJAA 4HQMA 4BACA 4G9YA 2K9SA 5FGMA 3IKVA 1HW1A 2PX9A 1YX3A 4LIUA 2JVHA 1YIJI 2MYSA 3KZZA 1Q1HA 1KU3A 1RESA 5BQTA 3E5UA 2IXSA 4L5EA 5FJ8J 3DBHB 3LSGA 2DI3A 4Y17A 3G71I 3F8BA 5M3MJ 1X4OA 3DBLB 1WSUA 1ZGWA 3AAFA 3DF8A 1TT5B 1TTYA 4LITA 4IHWA 4V19K 5LGUA 2EZKA 2JA5J 3IH4A 3EUAA 2DTZA 2M9HA 4MNUA 3TBIA 2VKVA 1ACIA 1B6AA 1MIJA 2GA2A 4LJZF 2FSWA 2QKLB 4O3MA 3QP5A 1VF9A 1MNMC 1U8RA 3CLOA 2BE5F 3L9FA 4HNVA 1K79A 1W7PB 4ANJA 3ISPA 3FKJA 1IDYA 2JK3A 4UV8A 4OINF 1XCBA 1LPQA 2V9PA 3CCSI 3IRRA 4W1UA 1HCRA 4FHTA 2X6OA 3ZQIA 5CVJA 1W7PD 1BR1A 2QQ9A 4EJOA 3BZ6A 2ISYA 1X1DA 2WAQN 2UZKA 2JSPA 3M1CA 4IKFA 2EV6A 4ZYEA 3EUKL 4ZTFA 4B3XA 3HL2A 3L2CA 3OYEA 1IO2A 3GTGJ 3M8JA 4U7DA 2IRFG 4IX7A 3RTRA 3DQVC 3E5QA 5DS9A 1SD5A 4U0WA 2K7LA 4BDZA 1FP2A 3LSHA 2VONA 3VB2A 2RREA 1H0MA 4CUGA 3S3NA 2VL8A 1MNDA 3SXYA 1F5TA 4XOTA 4BYYA 2CUEA 2HGCA 1YG2A 2L7MP 1YW9A 4F92B 5C4JJ 4NC7A 2AXLA 2WAQA 4XMYA 4B44A 2H8WA 1I50J 5AONA 2VKEA 4XM3A 3DBRB 3RZOJ 2K9LA 4HOBA 4OU0A 5E1XA 3I59B 1EH8A 3I55I 1STZA 2YUSA 3OWTA 3KZYA 3K4BA 1SFUA 2LTPA 1J0RA 2MA3A 4CSWA 1HC8A 1I3AA 3OIPA 3T5XA 1QHHD 1U2WA 1XGNA 3WE3A 3Q0UA 3D5LA 1TT0A 1W4MA 4F91B 3JTHA 1E17A 1XSVA 1DPRA 2IVMA 2KZGA 4PJLA 4AM3A 1J09A 2LVSA 2NRAC 3HG9A 4V2FA 3KYCB 4DYCA 3K70D 4CHUA 3EUHA 1JGGA 4DBQA 4NC6A 2KIFA 1BN5A 1Z6RA 3FBIB 1P6RA 2DLLA 3BLYA 1DPUA 1SD7A 3A2KA 4E7ZA 3ERMA 4XLEA 1E3OC 3LSPA 1WKMA 1K61A 4U87A 3H3UA 5ICCA 3ZMTA 5A2QZ 4AC0A 1QRYA 4PJ0C 4ITVA 3I4PA 1VQ6I 2KJBA 2X0LA 4KN4X 2BHZA 4WXCA 5E3LA 4IRIA 3TO6A 1RETA 3HOWJ 3BTIA 2LC2A 1BW5A 3WG9A 4A3DJ 2IW5A 2W24A 2L4AA 2B63J 1TBXA 2DOFA 2E35A 3S1QJ 2K86A 2XPVA 3V7CA 1UHWA 2VPRA 2Z2SB 1P2FA 5IP7J 1T0FA 3GXOA 2VE8A 3PUFA 3KETA 1LUJB 4F3QA 3BG7A 4RBOA 2HXOA 3RDIA 2V1DA 2EA4A 3DWLE 4M9XA 2J5PA 2GZWA 3O8GA 1DP7P 3GWZA 2PMZN 3HPHA 2VQGA 3AKZA 2ZXHA 2P8TA 1T6SA 3BTCA 4M3GA 3W6JB 4KT5C 2LP0A 2P5KA 1YS6A 3CP2A 3B02A 1J2XA 3G1LA 3CLQA 3WTVC 1TWHJ 2L9SA 1U5TC 2M87A 5B1AH 1X1AA 4IEJA 5GPAA 4XN3A 1S5LC 4RGUA 2UUZA 3CCJI 4G7HF 4CO8A 5FKOA 2F5CA 3QPSA 1O3TA 1H9GA 1K78A 2DCEA 2E1NA 2VBXA 4PGHA 4A6EA 2JVGA 2EA2A 3OOUA 4BEHB 5GAEJ 2VIXA 4RAGA 1HSTA 3KYDB 3G1OA 3L2QA 4ENMA 5D6FA 1REPC 2V26A 2LH9A 3AG3H 3HHHA 1N78A 3HC7A 4RGRA 4C3HJ 4U0VA 4DJAA 1JHFA 1JTYA 3E6MA 4D5CA 5EG0A 2A07F 1EH6A 1T33A 1Y1WJ 1N25A 2DW4A 1UMQA 1FT9A 2EIMH 2W1OA 3CUQA 1SMYF 5E8IA 3FZVA 3K0LA 1MBFA 1USSA 1R5HA 4WF2A 1G3WA 5CVVA 3G1MA 4OIRF 5D5VB 5EF6A 1K7AA 1CF7B 2H09A 2YU9J 2X4HA 4HX7A 5FLXZ 3KIOA 2EB7A 4LOCA 2R7TA 2QWWA 3ZMDA 2E71A 4RGSA 5HLHA 3ZMSA 4XLCA 2LF7A 3LSJA 4BL0B 4RS8A 5DD4A 4KITB 2B0LA 2ZMEB 3FMRA 1RR7A 2VJ4A 5HNHA 2ADUA 2QVOA 4BXFA 5L3CA 1XSDA 3WTUC 4HLXA 3CJRB 3DFGA 2G9WA 2R7QA 5JFRA 4PFPA 2BGCA 5ILVA 4IRHA 2VQHA 4G8XA 4IPAA 2W85A 3LQRA 3F6OA 4PFOA 1X1CA 1LB2A 2CH0A 2QGUA 2CFXA 3I4NJ 2F4MB 1MMSA 3O2PE 1X3ZB 1W36D 3OIQA 2LY2A 4U0YA 4L18B 2EFPA 2XF6A 2D1VA 3K4LA 3RSNA 1I27A 1MBKA 1VQ8I 3J7AO 2R7UA 1M1EB 4G6DA 2FMLA 3R0JA 4B8XA 5HDGA 4EJWA 2D5VA 2KDOA 3M7GA 3WTTC 3SQNA 3CTAA 2ECBA 3J80K 3NEUA 5DM6F 1UHSA 3Q9SA 1P7JA 1WJCA 5HLGA 4BQOA 1L0OC 1JKOC 5E20A 3D1NI 3S3MA 1JUPA 2P4WA 3KFWX 4BQQA 2GIVA 2W48A 1BOAA 1YO5C 1MW7A 2R5YB 2NYXA 1ZR2A 3Q3SA 3OL3A 4BH9A 2Y30A 1VQ5I 3K4KA 1GXQA 4BS9A 2X6YA 2M3AA 2EJRA 1EKEA 2RGVA 4XBFA 2KP6A 3CF5F 3H5NA 3BOQA 1GT0C 2J5OA 1DGWY 2DMNA 2DOAA 1B8IB 4M3FA 1GVDA 2FOWA 3FBNB 4FT8A 5JR3A 3KP7A 1XX5A 2LKXA 2XB0X 2V4JC 1XD7A 3HOTA 2PI0A 1FYMA 1PUEE 1IN8A 2CW7A 4CZCA 1OYYA 2FXAA 1T98A 3FMSA 3V8JA 3MVPA 2GOXB 3BWGA 4CH7A 3KP2A 1JKPC 4E6KG 3I9V2 3JR9A 3H5AA 3HGYA 1OPCA 1LVKA 4NC8A 3H92A 5LGNA 2O3FA 5J8FA 3RPUD 3T8RA 4R1HA 2HWVA 1R00A 4BE1A 3CJNA 5J3LA 2FEZA 1IXSB 2HXIA 4JOMA 3IC7A 3JRAA 4I2OA 2R7OA 1ZLKA 2CQ7A 1FP1D 3G73A 2VXZA 2BV6A 3EETA 2CW0F 4RB0A 3E6DA 2XAJA 4A5NA 2ELHA 4W97A 4RMNA 2ACJA 4M9SA 2OQGA 4ENKA 1D0YA 4XICA 3OYGA 2QEXI 3JRBA 3QOPA 1FEXA 3N97A 2NOJB 2HDDA 4AIJA 1JGSA 3MN2A 3A4CA 5FFXA 1LEBA 1I6XA 1Z7UA 4F7ZA 3GVAA 3E3VA 5F1RA 3ZP5A 1RRJA 3FF5A 3CCRI 4M6YA 1UELB 2E19A 1S9HA 2QA4I 2A61A 4NNJA 1BL0A 1WH5A 3ZGKA 2X6XA 2HDCA 2XROA 3WTYC 1AKHB 2X6WA 4LGWA 4BDYA 4MQ9F 1G8XA 3SFZA 5DCFA 1SD4A 3CD6I 2ZCWA 2KIQA 1JJ8C 3NAUA 2STWA 1S7AA 5J4VA 4KFCA 4XL9A 3SZPA 3SDGA 4B3AA 1WHUA 5E3OA 5LD2C 1L3LA 1HSJA 2LSOA 1P7IA 2DA5A 1XGSA 4HNTA 3MAJA 5DTDA 2DBBA 4I0BA 1OCOH 5EZGA 1WJDA 2W4SA 2QF7A 1DGRM 1OCZH 1DU0A 4MFDA 2Z9OA 3KCCA 4TV7A 3I56I 2W25A 3JRCA 2WWYA 2QBYB 5JLWA 4E70A 3WGIA 2V9VA 4DBRA 1ZK8A 2XDVA 4BJ6C 5CVIA 2VN2A 3CQZJ 3RPUA 2O5RA 3VEPA 4BXUA 2AQFA 3LAPA 2VJIA 3LSMA 2RQPA 4ZDOA 3P9CA 3C1DA 3OYMA 2EFQA 4MTEA 3S8PA 1XPXA 3K2AA 3M8FA 1W0UA 1Z91A 3LSTA 3RQIA 1ON2A 3HOUJ 2RC4A 4IHVA 2KMUA 3BG5A 5IT3A 1MMAA 3EYIA 5IP6A 2G7HA 1HXDA 3FKIJ 5D4SA 3QPLA 2ZJQF 4YIFA 3M3YJ 1UZCA 3N4MA 4GYGA 1FC3A 4KICA 3S1RJ 1YJWI 1YRNA 3VODA 5IOYA 4ZH4F 3OY9A 1FNNA 1LDDA 1G3TA 3B6CA 3FISA 2JTVA 1LVAA 4RLQA 1ZG5A 3LA3A 1VQLI 1ZGAA 1USTA 4BNCA 4DGWB 2P7VB 1XB4A 3OYNA 4A3CJ 2XPWA 2L4MA 3H5RA 1J75A 3CJTB 1LE8B 5FFZA 2IS6A 1V4RA 2GIZA 2HQRA 3DU6A 4EGYA 2E1CA 2DPDA 4Y33A 3P9KA 3U1DA 4XLFA 2COBA 2KHMA 2KDZA 2E7XA 3I71A 1X2NA 2W84A 1ORKA 5DUKA 1OYIA 4N9HA 4CYDA 1GLNA 2BW3A 2UV1A 2RQQA 3JRIA 1R71A 1SVLA 4IHYA 4M3EA 3E5XA 4XLAA 1JT6A 3IAM2 3HPGA 2I5UA 4U7BA 3KLNA 3MZHA 5LHGA 2V1XA 3Q9VA 4LK1F 2QCOA 4O5VA 2M5WA 2VBWA 2R0QC 1HA8A 2VI6A 3KEOA 1SFEA 1ZR4A 1R22A 2Q2EB 4I98B 3HDDA 2HPMA 2LRDA 4FX0A 1TNTA 2L9RA 3VYTB 1TL8A 3SHFA 4A3MJ 2E5NA 2OU2A 5J6XA 2X1EA 2ZXIA 2BY3A 1X1PA 4UV9A 5LRRA 4EJTA 5ERIA 2F48A 5F04A 2H8RA 5E1ZB 4YFKF 3OSFA 1HDPA 1R4MB 1MGTA 5EEGA 3W3CA 1ULYA 3DTIA 4RAZA 3WU2C 1KA8A 1O4XA 4DNCA 1FIPA 5FKLA 2MG4A 2ZJRF 2RDPA 5D6EA 2N8GA 3L7WA 1ZKGA 4BY1J 3P9IA 4FE7A 2H6CA 2EWNA 1JKQC 2XC7A 3F72A 2DAOA 3WTXC 2YPRA 2ZC2A 3DEWA 4YFNF 5KHDA 4XLNF 3VFZA 3GTPJ 4QIWN 1PUFA 5FRMA 4E7IA 1XGMA 3HOSA 2K3FA 1HOMA 4A6DA 3S2DJ 2I8DA 1QQIA 3KP3A 2E34A 3HGGA 3ASOH 4CA0A 2A5YB 1F9NA 5E79C 2XASA 3QYEA 2VC1A 2V79A 4U88A 1O7LA 3BQYA 3KP6A 3ECOA 1EV7A 4M71A 3FM5A 4CYCA 2NVTJ 1YITI 5BPIA 4J19A 3GO5A 1OFCX 4Q5SF 4N9IA 4UVCA 4OMZA 3TP3A 3OYAA 4OWRB 3FM3A 4LLGF 3OYDA 1AU7A 2Y0SN 1ETVA 3QOEA 1A6IA 1B9NA 2EFNA 4KIGA 1V54H 2FBHA 3DEUA 3IWZA 2NS0A 2VT3A 2XAQA 3S1MJ 1P92A 3JRFA 4FTHA 1ITYA 1NK2P 3AL0C 5DD8A 3HSFA 2ZFWA 5CJ9A 1LEAA 3W2VA 4AU7A 1AHDP 1R36A 1YLFA 1B59A 2DODA 2G7UA 3ABUA 5KNLA 2XGEA 2E36A 3F9KA 2LOOA 1X19A 1SC7A 3F6VA 2MH2A 3C2HA 1U0JA 3KYLA 3DLLF 4UUSA 2KIMA 4YIIA 3ZQHA 4L5JA 3SZTA 2Y0SA 1GDTA 2AQEA 3HBLA 3TW7A 2OTJI 3K4JA 2R7XA 4XRMA 3ZR8X 2ZJPF 3BTJA 3QAHA 1CQTA 4BQNA 3J80Z 2LF8A 4HBLA 1ETQA 2EIKH 2ZMEC 4JYKA 2YR2A 1XMAA 2YU3A 3FXLA 2JQ7A 2DQLA 1OMIA 5D8LB 3UNGC 4MEYF 3OYBA 2GQQA 4I7HA 4EV0A 3FXOA 5CQGA 2CW8A 1IV8A 3HIFA 4ZDPA 2DXIA 3DPTA 3O3KA 1C0WA 2G0EA 2ID3A 2ZO4A 1JKRC 2IS4A 3TO9A 2L7FP 1TWGJ 3VDXA 3QPTA 2BHYA 3HTUA 2PEXA 2XKPA 2H94A 1FTTA 4ON0A 1QVTA 3M1EA 4A3JJ 3FDYA 5JLXA 5KK1A 2FU4A 2O61A 2HOSA 4MHGA 1OCRH 4QPOA 2R7WA 4GXOA 2A6EF 2IA1A 4ZZLA 3ZPLA 4A93J 4H0EA 3L2WA 3H3ZA 3GEZA 2KRHA 2VT2A 2Z1DA 4C3IJ 3WU1B 2VE9A 3G6EI 5DCMB 4E7JA 1RUOA 2VKHA 4PJNA 4XKVA 4LB6B 4GDFA 4UB8C 3BC8A 1XC5A 3FXMA 4B48A 2H27A 2W57A 3ABKH 5BS6A 1GVJA 3Q0VA 4ZYGA 2R92J 2AXTC 4P9FA 4QSHA 1WJAA 3FXUA 3GZNB 4LG0A 4D1QA 2EBIA 1QU3A 1HW5A 1D1AA 3CCUI 2B9SA 3OYCA 2OF7A 2Z99A 1ZLJA 4EJVA 3SJMA 4XLHA 1F43A 3D0SA 4MFEA 2L2OA 2L02A 4FE4A 1IN4A 2M8GX 3EQLF 4ABZA 2UXNA 2CV2A 4KMUX 3L1PA 3NARA 4CCOA 3PM1A 2EPFA 3BCAA 2KL4A 4S05A 2DFHA 3ASNH 1UG2A 2X1DA 4L9TA 2DFFA 1MZBA 2IGMA 3K1MA 4RM2A 1KU9A 4YFXF 2BEOA 3BZKA 3FMQA 2FQ4A 3V7RA 1G6NA 3S15J 2CUZA 1U9NA 1FBUA 5M5WJ 4JX5A 2LKSA 3HXLA 2P81A 2HDWA 2XF5A 3HRSA 4DQ2A 5FB2A 1O3QA 2HPIA 2MW8A 3L2RA 2XRNA 1PVEA 2FNPA 3CUQB 3WHCA 5E1WA 1NK3P 2IEKA 5ILSA 2MGQA 2ESNA 2X48A 1S8NA 1JUMA 2RN7A 3S32A 2R93J 2STTA 2X85A 4LLNA 5H20A 2OUMA 2HYJA 4J00A 2P6TA 3GZ6A 2JT1A 2DMTA 5TRDA 1LNWA 2FOKA 2JMWA 3F8CA 3T1BA 1RNLA 5FLVA 2Y31A 3TDZC 1O57A 4B47A 3EPZA 5ICFA 4ESBA 1I3QJ 2FJ1A 2PG4A 5K5RA 2M7AA 4O6JA 3QPHA 1W5TA 5JHUA 4CGZA 3CMMA 5J47A 5ICGA 4LB5A 4YIRX 3GLXA 1ZGJA 1IJWC 1KQ9A 2E1MC 1R5ID 4LLLA 2R5ZA 3VYUB 2BY2A 4KIFA 4NHJA 1ONVA 3REOA 4PDKA 2TCTA 5CKTA 3HOYJ 2QKMB 2Y69H 3ZMVA 2VQLA 4HA8A 2CWEA 4CCJA 5D8KB 4A69C 3DKYA 2JWTA 3CC7I 4GFBA 1R4NB 4ZDLA 4PJMA 3GFJA 4AD9A 2CG4A 4IO9F 5IYDJ 4CCNA 1MMDA 3IH3A 4FX4A 2O7OA 2R7SA 4P55A 2HQ5A 2GBYA 1BW6A 4I02A 5FO5A 4CCLA 3TEDA 2LFBA 4I99C 1ETYA 1IW7F 2VXDA 4XK4A 2KZVA 1IZ1A 5GAHJ 5KAFC 2EZIA 3CCEI 1IRFA 4AIKA 4BE2A 1U3EM 3A0HC 2PMZA 2DA2A 3LMMA 2ME0A 3JAMK 5F6FA 4XNFA 2Z3YA 2IS1A 2JPBA 2DJNA 3ESWB 2R4GA 3OSGA 3CDHA 5JHFA 2WY8Q 5DYMA 3QODA 4IHSA 3CESA 2L7KA 1ETKA 4XSXF 2GXGA 5F0FA 3CCYA 4EM1A 4L9VA 5CLSA 2GWRA 1QO0D 1LKXA 2KKOA 5BMZA 3KE2A 2LYCA 3OR2C 4D7NA 3JRGA 3HSRA 3HZJA 3U2RA 2NS8A 4IOAF 1MJ9A 1Z9CA 2FA5A 1VQMI 1WI3A 4N4NB 3SEQA 2DMPA 4C2MJ 1FLIA 3KP4A 5HVQC 1BI0A 4RM3A 2BVLA 2ZNYA 4ZTJA 3VSKA 4HF1A 1BIBA 1XN7A 5KVRA 2HU9A 5IT9Z 2NVUB 2R7DA 2CS3A 2RNGA 3WODF 4UUVA 4E7HA 2DYRH 1FOKA 2XAGA 1TWFJ 3DXJF 2D45A 4XORA 3W6VA 1XSXA 3FXKA 5FKKA 4JBAA 2WBMA 3QP6A 3I3LA 3SFIA 2YSRA 5EYRA 1H9TA 1T2KA 1TWAJ 3TGNA 3T0YA 5DV5A 1NTCA 2XGXA 3ROUA 1UFMA 2R7ZJ 2CQQA 3CCQI 1R7JA 4D0PA 1ETXA 2EIJH 4HLYA 3J7AY 2O03A 5B1BH 4WWCA 2IAIA 1MBHA 2PBIA 2NNYA 4UB6C 3FWEA 1EA3A 1WCMJ 2M8EA 3GTJJ 5FRNA 2QZ8A 1WRJA 3OOPA 4KT6A 1TNSA 3J81K 3HEFA 4A3IJ 4CCKA 5JVGF 1ZG1A 5D5WB 3TP0A 4NDLA 1MKMA 3P5JA 2JUCA 1JXSA 2FRHA 2PMUA 2LK2A 3U9GA 4DYQA 4QWQA 1D0XA 2BY0A 3BG6A 4WK8F 4A0XA 4BGDA 2OC6A 4CZZA 3IV5A 2VJ5A 3CO6C 2ZNZA 2CV0A 2V1NA 1J7KA 1ZN2A 1AOYA 4MEXF 3DEEA 2XPUA 2VQCA 4M6VA 5HS7A 2ISZA 2DK5A 2P0WA 3CCLI 2FQ3A 5GPCA 3OS1A 3K7AJ 4R8HA 4BEHA 5K5QA 4KNYA 2L54A 1ETOA 1ZYRF 5FD5A 3G3ZA 2O0YA 1OJLA 4B09A 4FETA 2IS2A 5EEHA 1HDDC 1EH7A 1U9OA 4FASD 2Q0OA 1I1GA 3ABTA 3CC4I 3JRHA 2K5CA 2RAEA 1V55H 1Y39A 5LHHA 2LY1A 2DU9A 5E18F 3K10A 2OAZA 3MKLA 2FE3A 4Z2YA 5GAGJ 2MLKA 3ONQA 3C18A 1OYWA 1U6GA 2NXNB 1UG0A 5FD6A 3BJAA 1TC3C 1WJBA 1IRZA 5B66C 1EJ9A 3PJRA 4HDUA 1PP7U 3ZQCA 4FISA 3TL4X 5LLQA 5DUIA 4GYIA 1CF7A 3J7ZI 4HX8A 5C4XJ 3L2UA 4IHTA 2L3DA 2CJJA 3HRTA 4XKBA 1O3RA 2M34A 1BBYA 1HQCA 1MD0A 1Y1VJ 2M4GA 4XR6A 1JI8A 1IN5A 3M8EA 3RPQA 5E3MA 3ERED 3HB9A 2Y48A 5DM7F 4QTRA 4OAZA 9ANTA 3F8MA 4G94A 1VFCA 1GXPA 3S14J 1O7FA 1JTXA 2WC2A 3ABLH 1XMKA 1W5CC 4I6ZA 4KIBA 2LR8A 3PL8A 5ILUA 2KPMA 1QZEA 5GP9A 2DDBA 3H9QA 4NQWB 3LSRA 4F93B 1APLC 2GLOA 4P5OA 2KRCA 1W1WE 4XOPA 5K5OA 2NVXJ 1V5EA 3MQ0A 1QVUA 1MH4A 4NB5A 2LBFA 3WTZA 1R1UA 2WADA 3I5UA 3EUHC 1MMNA 2P5LC 3D5RC 3VPRA 3BY6A 3RKQA 1ETWA 2AO9A 2BW3B 2FBIA 4XSZF 3B73A 5F0CA 1G59A 1BC8C 4QPQA 3GTOJ 3PQJA 1SAXA 2JRMA 1BC7C 5J1YA 2CO5A 3RJPA 5EJCA 3SDBA 1BJZA 2LLKA 4UVAA 4EGZA 3CZ6A 2MD0A 1D3YA 1K4TA 3E1SA 2FD5A 4Q48A 3D5SC 2WAEA 2DMQA 4GCVA 1DUXC 3BG9A 1R58A 1HKQA 1S29A 3GMEA 2QYOA 3K9TA 4GGGA 5GTHC 3FXRA 5EGOB 2NS7A 5A2QK 2GXAA 2XV4S 1IXRC 2Y9YA 2E5ZA 1F4KA 4UVBA 1OLTA 2ECCA 4AIDA 1TW2A 3CUOA 4WX9A 2X1CA 1T38A 1FYKA 4RLFA 5J1RA 4OMYA 1MH3A 4B4CA 1XGOA 2QQ8A 3L00A 2DOEA 2Z33A 4IOCF 1G2HA 5CQEA 2F4IA 2HOEA 4S04A 2HOTA 4C2TA 4Y4RA 1K6YA 2Z5UA 5F64A 2L0KA 4L0ZB 3PNTA 1QPMA 1A35A 3I0TA 1PUFB 2HFHA 2ZXJA 4GO1A 1LFUP 1B72A 3RYRA 4LD5A 4X0GA 1VNDA 1LDKB 3C3WA 1Y56A 3BJ6A 4EM0B 2DA6A 3J7YJ 3JREA 2DK8A 4JX4A 4BJ5C 4BJTA 2OCEA 3G4SI 5H2FC 2A68F 2P7CB 2M0MA 3CMAI 4Q4ZF 2M7BA 2V6CA 1D5VA 3K70C 2F6CA 1HF0A 3R60A 5B3SH 2F5VA 4HPQA 3H35A 1Y0NA 4AVZA 4M9ZA 2CU7A 3CCVI 4IZZA 2X51A 1VQPI 2DO7A 1KYWA 1KONA 5HDKA 1RKTA 1VTNC 5J40A 3DP7A 2L9NA 3K4NA 3I64A 2M45A 1FSEA 4H4KC 3DPUA 3CMYA 1WJEA 2HYFA 4A2UA 4BUPA 2XGCA 3DKWA 3BPXA 1W0TA 3I58A 2NVYJ 1R9TJ 1FMWA 4V2GA 1QZZA 3V42A 1D5YA 3A01A 2XRLA 3BT9A 2HVRA 3K1NA 1FBQA 4UUSB 3GTKJ 4QLCU 4EVIA 4RB1A 1N77A 2QQAA 2IGNA 2PQ8A 4HF2A 2BXZA 4KYWA 2NNNA 3TO7A 2O8XA 1Z0XA 3K2ZA 1Z6TA 2A3SA 1P4WA 1MSFC 3KX2A 4JQFA 2QM3A 4RB2C 3QRFF 1U5TA 3JAMZ 1MBJA 3RIRA 2K27A 2WY7Q 5FLXK 1J9IA 3RYPA 5E3NA 2E7WA 2V6EA 1NH3A 2RKHA 3LOCA 2XF7A 4PGGA 2K3PA 3JW4A 3H0DA 3Q5FA 1S6LA 1RIOH 4LMYA 4AUXA 1E0EA 2ME6A 3IAS2 4D5FA 4I01A 4HSTA 4KJZA 3U21A 4AVPA 4F55A 2ELJA 2OZ6A 4A0ZA 3Q0WA 5L3EA 5EZHA 2VBYA 2EFWA 3ML6A 1QPIA 3HJEA 4MLOA 2A6HF 1T56A 1NG6A 3IH2A 2BXYA 1ZRCA 2BZTA 4A3FJ 1LFPA 3F8FA 3WE2A 1ZG3A 2A05A 3IHUA 2W82A 2DA3A 2TRTA 4OOIA 4J01A 4CDGA 4ZYHA 1O3SA 3LL7A 4C9YA 4LK0F 5IPAA 3E0JB 4HF0A 2D1HA 4C2UA 5IY5H 3FIWA 2JA6J 2H6BA 3F22A 1BI2A 5JVTA 4UY8I 3FHNA 4LG0B 1H8AC 3H9GA 2XUBA 4IJAA 4BQAA 4XRSG 2COMA 4X1EA 3KPHA 3KLOA 4A3LJ 4A0YA 4IL6C 1OKRA 3HHGA 5C44J 1QHGA 2K9MA 2HYGD 2K85A 2M30A 2XB5A 1DU6A 1EF4A 5HLIA 3JCUC 1XG1A 3WGHA 1OCTC 1P4XA 2JJ7A 5K7ZA 1Z3YA 3M4OJ 3C2GA 4ESJA 1HKSA 3GTQJ 3H1CA 3JTGA 3ZCOA 2QLZA 3JSPA 1IV6A 1LE8A 3TMOA 1QGPA 4XKCA 4ZZDA 3ULQB 3MKZA 3ABMH 3AG4H 5ED4A 4K2EA 2K40A 3PSFA 3S1NJ 1K4SA 4KISA 1I1SA 3CC2I 2HEOA 2PJRA 2TDXA 1I6HJ 4G6TB 4M72A 3KP5A 4G12A 4ENJA 4WCGA 2XGDA 4HW0A 4DOZA 1N75A 4XQFA 1IF1A 3A03A 3TOAA 2KLOA 4UNOA 4UUTA 1AWCA 2CQNA 3PIOF 2EZLA 5IOZA 1W36C 3OYKA 1XDUA 2Q2EA 3W6KB 3OMYA 2VODA 1X3WB 1YW8A 4N0BA 2L5QA 2R3SA 4P1WA 3O6BB 2E2HJ 1VQOI 4A3GJ 2K9NA 2DT6A 1RUNA 3GLLA 2QUFA 2VKDA 1BM9A 1BR2A 2MC3A 3ZXSA 2E2JJ 2BOLA 1T39A 1A31A 3KEQA 2RVCA 2QENA 2ESHA 5LEJA 4P9UA 5ICEA 4M3DA 2R5ZB 2RNJA 1RKWA 1IRXA 3HYIA 3ZQQA 5D5XB 3PNVA 4A3KJ 3ZN1A 1IDZA 3BQZA 1IG7A 5L3BA 3GFIA 1IN7A 4IXAA 2DA1A 4RB3C 2XIGA 2XKOA 2VLAA 4C30A 3HTSB 1OR7C 4MTDA 3K69A 3IL2A 1UHMA 1RZ4A 5CVUA 1W5SA 3GFMA 2P5VA 1X2MA 3I54A 1ZAOA 3E7LA 1G3YA 4L9NA 2HZDA 1Y6IA 4I09A 3MEXA 5HODA 1FMVA 5AIPA 4Y15A 3OYHA 3DCFA 1MDMA 1K78B 3AFHA 2DA4A 3E6BA 3HUGA 2AHQA 1B9MA 3QYBA 4OIQF 1R5GA 4XONA 3RCOA 5IYCJ 1IAWA 4XLPF 1TQPA 5M5XJ 4M73A 4B1RA 3PNYA 4L9JA 1FOXA 3VOEA 2E60A 5EG0B 2IBDA 1VQNI 1IRGA 3V7SA 2QSHX 1BIAA 3LFKA 1BI3A 2DN0A 3QU6A 4AWXB 4M74A 2OBPA 2HQAA 3N05A 4JX6A 1OCCH 1U78A 1S7OA 1RPWA 4CICA 5TGTA 4JP0A 4ENNA 2A5WA 5L3GA 3BP8A 1IGNA 3BDDA 4B43A 3PO3J 3SEZA 4A5MA 2ZB9A 2HVQA 2PMHA 2GM4A 2OA4A 3PFIA 1QA6A 3EYYA 4MIMA 1ZRDA 3NRVA 1J59A 3V4GA 4IVNA 2H1LA 2FUG2 2ZSHB 2L01A 2MH9A 5KCMA 5B5EC 1YJNI 1SAUA 2GA1A 1SD6A 2VB6A 2K4BA 4HSRA 2NOGA 4HRIA 4CXFA 1YW7A 3KZIC 2O6GE 1DP3A 1MBEA 2VASA 1W7PA 1YHQI 2IT0A 3VYRB 3JSOA 4IF4A 1A36A 4ZC3A 3GYHX 3SZGA 3LNQA 1WQ2A 5LFAA 2B7EA 1SVMA 2DDAA 4HX4A 4BHBA 5L3DA 3PFYA 1BOBA 2IA2A 2M1BA 2XVCA 3BZCA 3DTEA 2CFOA 2F5DA 3TW6A 2FX0A 4BHPA 4AIHA 4ASNA 4Z6YA 2CV1A 4PUSA 5LRSA 1BR4A 4E7LA 1YI2I 5DCMA 4HNUA 3AG1H 1D1CA 4CCMA 3ZN0A 2XSDC 3DU5A 3ZQ7A 3GW2A 1YFHA 5LHIA 1D0ZA 1VZ0A 1JJ6C 5GTIC 4LG3A 2ID6A 1WFXA 1R1VA 3AG2H 3K1PA 4XKWA 4EATA 2GOMA 2HTSA 1TWCJ 1A5JA 3W2AA 3VSLA 4UXNA 5K1YA 2Q1ZB 3I59A 4PJJA 2VOPA 1I5ZA 1MMGA 1AA7A 3P7NA 1OCPA 2JZYA 2JA8J 2EQRA 1G3SA 2R7RA 4OIOF 2MLGA 3BR3A 4RDUA 2JA2A 3FX3A 2R7VA 3LAJA 3OV8A 1NHAA 1SFXA 2PN6A 1Z77A 3CO7C 2K4JA 3PSIA 3GTLJ 2YX4A 2WV0A 2Y0MA 1OQYA 2K02A 2HI3A 3LWFA 4HZFA 2OCCH 3LQQA 4II3A 4BY7J 3E6CC 2JN6A 2H1KA 1Y8RB 2KFDA 3QWLA 1FX7A 3IWFA 2BVMA 1RC9A 2GXBA 2HTJA 3LA7A 3CCMI 4KN7X 2DFIA 4L0YB 4BHCA 5FROA 3AL0B 2Y9ZA 4A12A 1F36A 3ZMUA 1RI7A 1I39A 3QQAA 2MC4A 1VI0A 3O8HA 4I0AA 1G4DA 4EEFG 3ZMZA 3DKXA 4S0HB 3MD2A 1QNTA 1WWXA 2O8KA 3X2QH 3COAC 1IN6A 3E97A 1HKTA 1SVOA 4HYEA 3C7JA 2EFOA 3S16J 3K4MA 3R0AA 4D9JA 3ELKA 3FXJA 5J8CA 4JK1X 3DV8A 5TISC 3GUDA 3WTWC 2HKXA 2Z16A 4EMSA 3W2WA 1UAAA 5JI6A 5DDGA 4IQJA 2ZSIB 5IYBJ 3NQOA 2W7NA 2VUMJ 2OJED 1YS7A 2PFBA 5BNGA 4FCYA 2DT7B 1YJ9I 1XS9A 2R7FA 4RAYA 3CMEI 1IUFA 2V9KA 4L5IA 2JPCA 3OYLA 3S3OA 3GFLA 1HW2A 3RKYA 3F23A 1JUSA 3OR1C 3S93A 3LSKA 3MZ8A 2OV7A 3K4CA 1JT0A 2LBFB 1TW3A 2HOAA 2LMDA 2V1UA 3BR6A 4AYBN 1IXCA 4BXXJ 4PSWA 2EZHA 1K83J 5D4RA 4FQGA 4D7MA 5C3EJ 4DYRA 1KQ0A 4RGXA 4N4OB 2KJCA 1SEUA 3PIPF 2OD5A 2YS9A 2XAFA 2RV8A 1MJBA 4II2A 5CVRA 5M3FJ 5F1JA 4YELA 3L09A 1KQ8A 3NWSA 4X6AJ 1PJRA 3OIOA 4I76A 1FWZA 5IP9J 2MABA 2XAUA 5CPRB 5H6RA 5KAIC 3OS0A 4AYBA 3IKTA 3VYSB 3RZDJ 3ZOBA 5EDNA 3V8LA 1B4AA 2LG4A 3MZYA 1D8KA 5GADJ 1E3PA 1Y0UA 2KT0A 3CF2A 1P4AA 1VQKI 1TQMA 1SMTA 1ERDA 3HRMA 1WZ2A 3WHBA 1T95A 2WB1N 3ZRGA 2F5EA 4YG2F 3S17J 2MFZA 2FMYA 2V7FA 4PCQA 4C3JJ 3PO2J 4MQVA 5HDNA 2IP2A 3FK6A 3BG3A 1TZLA 1TLHB 4OAYA 3SYTA 2CGPA 2DPUA 1RR8C 3I53A 1T08B 1K6OA 4PZJA 1VQ9I 2ELKA 2HZTA 1FJLA 3BROA 5HLTA 3H36A 3R4KA 4HAMA 1D8JA 1QZYA 1JHHA 2ZBKA 4UHTA 4HV5A 1P9QC 3H9JA 1U8BA 4RAFA 1PYVA 1R6RA 3T8TA 4M6XA 3RI4A 2WB1A 1S72I 3F21A 4EM2A 1BI1A 2NAZA 2CSOA 2K9QA 5AIQA 3EDPA 3OL4A 1B72B 1R1TA 2OTLI 1YQAA 4ZYDA 5LGTA 2ZMEA 3G2BA 1WH7A 1YRNB 2VBZA 2ZJ2A 1XTAA 1MNEA 4NBQA 4Y3OA 4IRGA 4XIDA 2EV5A 1IC8A 1MBGA 3VWBA 5HNFA 3DTKA 4PK4A 1A04A 1YYVA 4BBRJ 4BAYA 3HOVJ 1UCRA 4XRFA 4HDVA 1ODDA 4Y13A 1WI9A 1Z1DA 1LDJA 2CMPA 3MFKA 2D2WA 4NUBA 4RA2A 1DDNA 1KZHA 1WGXA 1FOWA 2KISA 5FKMA 2DA7A 3BJOA 3WG7H 2GAUA 4P96A 1FTZA 1UJ8A 3S2WA 2VJJA 3HRUA 1Y8QB 2LD5A 5H6QA 2ICWG 3A02A 2QSGX 2Q8KA 1F1ZA 1ZREA 3WU0A 2OZUA 5D5UB 2E1MB 4G6QA 4OIPF 2BBYA 3M9AA 4BBSJ 5L3FA 3A01B 3FXQA 4BE0A 2E2IJ 2MD5A 3R6SA 4YRVA 1MJAA 1Z7LA 4GRIA 4Q47A 5EEAA 1OR7A 1V3FA 2EILH 3QU3A 1ON1A 2VOOA 2C6YA 2DJIA 4A3BJ 2R5YA 1POGA 1U5TB 4A3EJ 2W00A 4F52A 2L7ZA 2M4KA 1KU7A 2WTEA 2UXXA 3JRDA 1UB9A 3OYJA 5CYVA 1Z3XA 1PDNC 1T0FC 3CDIA 2F2EA 2CUJA 2WA0A 1QBJA 2I10A 2ZKZA 5K7HA 2LNBA 4BU2A 1SFKA 1KGSA 1R23A 2IPQX 4E7KA 2QSFX 3GCMA 4KDPA 1ZARA 1B8IA 5HS8A 2UWMA 1H89C 1FZPB 2LDUA 2FF4A 2MSYA 2A69F 1XMXA 2ETHA 2KIUA 2MBFA 3TKYA 5K7FA 1FSHA 1T8IA 1J5YA 1BA5A 2DTRA 2HKOA 2EINH 1TP4A 2IA0A 1YE9A 4R79A 3IRQA 1GUUA 3QYFA 4LIVA 3U1KA 3H3VK 2P6SA 1HBXG 1PP8F 3F8NA 4HEA2 2JSCA 2VC0A 5TJJA 5HOOA 2JA7J 4E4HA 1VQ4I 2ZXWH 4IHXA 3K6GA 6PAXA 3MMYB 5E17F 1XDSA 3WTSC 1CGPA 1Z67A 3TDUC 4LFUA 4CYCB 1ENHA 2XHKA 1KYZA 4YEJA 2PJPA 2LREA 3HOXJ 4DW6A 3MWMA 5BPDA 2DFEA 1V5FA 3S2HJ 2Y75A 2HS5A 1ZTRA 3FHZA 5FLMJ 5BOXA 1ZHFA 5E8GA 3RKXA 1E3HA 2EV0A 3CUQC 4XRSA 2PLYA 5DEQA 1ZQ3P 4NQWA 2HR3A 4HQEA 2L9VA 2HVSA 2KRFA 3A0BC 1ZH5A 2M0CA 4BKXA 3GX4X 3GF2A 2A6TA
chains in the Genus database with same CATH topology
2K9NA 2DA2A 2ME0A 1FIAA 2E2JJ 4MO7A 3HKZN 3MVPA 1JKPC 2DJNA 1WPKA 2WV1A 3OSGA 3JR9A 4DZPA 3HGYA 4M3DA 2R5ZB 3BR2A 1RKWA 1AKHA 4A3KJ 1IDZA 3BQZA 3ZQLA 1ETKA 1IG7A 1SANA 2DA1A 5J1UA 5F0FA 3CCYA 3GTMJ 1S7EA 3GBGA 5J3LA 3FK7A 2HXIA 1MSEC 4D7NA 4Y52J 3HM5A 3JRGA 3JRAA 2NS8A 1X2MA 3E7LA 3B6AA 4W97A 1WI3A 2E1OA 4XICA 3JRBA 2DMPA 5HODA 1SFOJ 4C2MJ 1FEXA 2HDDA 2CUFA 3DCFA 3UKGA 2X9DA 5EGOA 5F27A 2DA4A 3MN2A 2AHQA 1H88C 1LFBA 2E19A 5IYCJ 1BL0A 3C2BA 1WH5A 5M5XJ 1TWFJ 1HLVA 1AKHB 4B1RA 2O9LA 5M5YJ 2EH3A 2CRGA 3BR5A 3W6VA 5F0HA 5EG0B 3F0CA 5FKKA 2IBDA 1X58A 3SFIA 1GV5A 5EYRA 1Q1VA 1TWAJ 3ZQFA 3H0GJ 2DN0A 5FKNA 4Y7NJ 4M3BA 1U78A 4JX6A 3NAUA 1JJ8C 1NTCA 1RPWA 5F08A 2R7ZJ 3SDGA 4B3AA 4JP0A 3HOZJ 3BR1A 2CQQA 5E3OA 1IGNA 1P7IA 3PO3J 4DZJA 1ETXA 2DA5A 2IAIA 1GV2A 1MBHA 2OPTA 2ZB9A 5DTDA 3ZQGA 2GM4A 2CQXA 5EZGA 1WCMJ 3GTJJ 2QF7A 4MIMA 1DU0A 4MFDA 3JRCA 3I4MJ 3HEFA 4A3IJ 5JLWA 3TP0A 2Y2ZA 4NDLA 1ZK8A 2LY9A 2LK2A 3CQZJ 4DYQA 2NVQJ 3BR0A 2NOGA 3CDLA 2M2EA 3BTLA 3IV5A 1MBEA 2DMUA 3K2AA 3LNQA 1W0UA 3RQIA 2XPUA 4M6VA 3HOUJ 4IHVA 2K9SA 3BG5A 5IP6A 5GPCA 3K7AJ 3FKIJ 3QPLA 3M3YJ 1ETOA 1OJLA 1RESA 3S1RJ 3TW6A 4L5EA 2FX0A 5IOYA 5FJ8J 1HDDC 1YRNA 3LSGA 1U9OA 3B6CA 3FISA 5M3MJ 3JRHA 1ZGWA 2RAEA 2XSDC 4IHWA 3MKLA 2EZKA 2JA5J 3IH4A 4A3CJ 2XPWA 1JJ6C 2DTZA 2ID6A 2M9HA 2VKVA 1LE8B 1TC3C 1TWCJ 1A5JA 1VF9A 1MNMC 2KDZA 2COBA 1IRZA 1X2NA 4HNVA 3ZQCA 1ORKA 4FISA 1IDYA 2JK3A 5C4XJ 3JRIA 1OCPA 2JA8J 2CJJA 4W1UA 2EQRA 4M3EA 1HCRA 4IHYA 2M34A 1JT6A 2X6OA 3ZQIA 1Y1VJ 3BR3A 4RDUA 5E3MA 2WAQN 2QCOA 3HB9A 4QTRA 9ANTA 1VFCA 1Z77A 3S14J 1JTXA 2R0QC 3GTLJ 2VI6A 3GTGJ 1ZR4A 4I6ZA 2LR8A 2HI3A 5DS9A 5GP9A 4BY7J 3HDDA 2JN6A 3LSRA 2H1KA 1APLC 2L9RA 2GLOA 4A3MJ 2Y9ZA 2NVXJ 1F36A 2CUEA 2L7MP 5C4JJ 1QVUA 1MH4A 5F04A 2H8RA 3OSFA 1HDPA 1I50J 3QQAA 1VI0A 3O8HA 2VKEA 4EEFG 3VPRA 3RKQA 3RZOJ 1ETWA 1O4XA 4S0HB 1FIPA 5FKLA 2MG4A 2AO9A 2O8KA 2N8GA 2YUSA 1ZKGA 4BY1J 5F0CA 4FE7A 1JKQC 3GTOJ 2LTPA 3S16J 3DEWA 5J1YA 3GTPJ 3Q0UA 4QIWN 1PUFA 1BJZA 2LLKA 5IYBJ 2VUMJ 1HOMA 2LVSA 3S2DJ 2FD5A 4V2FA 3HGGA 4DYCA 2DMQA 5BNGA 4FCYA 1XS9A 3BG9A 1IUFA 5EGOB 1JGGA 2NS7A 3BQYA 1JUSA 4CYCA 2NVTJ 2Y9YA 4J19A 1OFCX 2ECCA 1JT0A 3TP3A 1E3OC 3LSPA 2HOAA 1K61A 3BR6A 4AYBN 1AU7A 2Y0SN 1ETVA 1A6IA 4BXXJ 5J1RA 3S1MJ 3JRFA 4FTHA 4AC0A 1ITYA 1NK2P 2EZHA 1K83J 1QRYA 4D7MA 1MH3A 4B4CA 5C3EJ 4DYRA 5E3LA 1G2HA 1RETA 3HOWJ 3BTIA 1AHDP 1BW5A 2HOTA 2L0KA 4A3DJ 2YS9A 5M3FJ 2XGEA 2B63J 5F1JA 1PUFB 4X6AJ 1LFUP 3S1QJ 1B72A 3OIOA 4I76A 5IP9J 2XPVA 4UUSA 1VNDA 3RZDJ 3ZQHA 2VPRA 3ZOBA 5EDNA 1GDTA 2DA6A 3JREA 5IP7J 3HBLA 3TW7A 4JX4A 4XRMA 4RBOA 2HXOA 2KT0A 3BTJA 1CQTA 1ETQA 3O8GA 1HF0A 4JYKA 2PMZN 3WHBA 2WB1N 3PO2J 3S17J 4C3JJ 3BTCA 4M3GA 3FK6A 3BG3A 2LP0A 2CU7A 3G1LA 1RKTA 1TWHJ 2ELKA 1FJLA 2G0EA 2ID3A 1JKRC 4IEJA 5GPAA 2L7FP 1TWGJ 3CMYA 5FKOA 3QPSA 1FTTA 1QVTA 2XGCA 1U8BA 1W0TA 2NVYJ 1R9TJ 4V2GA 4A3JJ 5JLXA 1D5YA 3A01A 2XRLA 3OOUA 2HOSA 2K9QA 3BT9A 3G1OA 1B72B 4UUSB 1WH7A 3GTKJ 1YRNB 4A93J 1IC8A 4XIDA 4C3HJ 4C3IJ 1MBGA 1Z0XA 1JTYA 4BBRJ 4D5CA 5EG0A 1MSFC 3HOVJ 1T33A 1Y1WJ 1XC5A 1MBJA 1UMQA 3Q0VA 2R92J 5E3NA 1WGXA 4QSHA 5FKMA 2DA7A 3LOCA 2EBIA 1FTZA 1MBFA 2OF7A 4AUXA 3G1MA 2ME6A 3SJMA 2LD5A 3A02A 4D5FA 4MFEA 5EF6A 1F43A 4FE4A 2M8GX 2YU9J 4ABZA 3L1PA 3Q0WA 4LOCA 5EZHA 3NARA 4BBSJ 3PM1A 1QPIA 1UG2A 3A01B 4MLOA 3LSJA 3IH2A 1T56A 4A3FJ 2E2IJ 5EEAA 1RR7A 2FQ4A 3S15J 1U9NA 5M5WJ 2DA3A 2TRTA 4JX5A 2P81A 4A3BJ 2R5YA 2MW8A 5IPAA 1POGA 4A3EJ 2L7ZA 3WHCA 3FIWA 1NK3P 2IEKA 2JA6J 2MGQA 3JRDA 2X48A 1JUMA 3I4NJ 1H8AC 2I10A 5K7HA 2R93J 4XRSG 4X1EA 2HYJA 2DMTA 4A3LJ 1B8IA 1MBKA 2JMWA 5C44J 1H89C 2MSYA 1DU6A 2XB5A 1EF4A 5FLVA 5K7FA 2Y31A 1XG1A 1BA5A 1OCTC 2D5VA 2JJ7A 1I3QJ 5K7ZA 2FJ1A 3M4OJ 3GTQJ 2ECBA 1IV6A 1LE8A 1GUUA 1UHSA 1P7JA 3H3VK 1JKOC 1IJWC 3D1NI 1JUPA 2W48A 2JA7J 2R5ZA 2K40A 3S1NJ 4IHXA 2R5YB 1ZR2A 3Q3SA 2TCTA 3HOYJ 2Y30A 1I6HJ 4CYCB 1ENHA 4G12A 2XGDA 3A03A 3HOXJ 4DW6A 4A69C 2JWTA 4GFBA 3S2HJ 4UUTA 1GT0C 1ZTRA 2EZLA 5IOZA 2DMNA 5FLMJ 1B8IB 4M3FA 5IYDJ 1GVDA 3IH3A 2O7OA 4XRSA 2HQ5A 2GBYA 1ZQ3P 1BW6A 3TEDA 2LFBA 2LKXA 1ETYA 2XB0X 4XK4A 2EZIA 2M0CA 4BKXA 2E2HJ 4A3GJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9N A;  2DA2 A;  2ME0 A;  1FIA A;  2E2J J;  4MO7 A;  3HKZ N;  3MVP A;  1JKP C;  2DJN A;  1WPK A;  2WV1 A;  3OSG A;  3JR9 A;  4DZP A;  3HGY A;  4M3D A;  2R5Z B;  3BR2 A;  1RKW A;  1AKH A;  4A3K J;  1IDZ A;  3BQZ A;  3ZQL A;  1ETK A;  1IG7 A;  1SAN A;  2DA1 A;  5J1U A;  5F0F A;  3CCY A;  3GTM J;  1S7E A;  3GBG A;  5J3L A;  3FK7 A;  2HXI A;  1MSE C;  4D7N A;  4Y52 J;  3HM5 A;  3JRG A;  3JRA A;  2NS8 A;  1X2M A;  3E7L A;  3B6A A;  4W97 A;  1WI3 A;  2E1O A;  4XIC A;  3JRB A;  2DMP A;  5HOD A;  1SFO J;  4C2M J;  1FEX A;  2HDD A;  2CUF A;  3DCF A;  3UKG A;  2X9D A;  5EGO A;  5F27 A;  2DA4 A;  3MN2 A;  2AHQ A;  1H88 C;  1LFB A;  2E19 A;  5IYC J;  1BL0 A;  3C2B A;  1WH5 A;  5M5X J;  1TWF J;  1HLV A;  1AKH B;  4B1R A;  2O9L A;  5M5Y J;  2EH3 A;  2CRG A;  3BR5 A;  3W6V A;  5F0H A;  5EG0 B;  3F0C A;  5FKK A;  2IBD A;  1X58 A;  3SFI A;  1GV5 A;  5EYR A;  1Q1V A;  1TWA J;  3ZQF A;  3H0G J;  2DN0 A;  5FKN A;  4Y7N J;  4M3B A;  1U78 A;  4JX6 A;  3NAU A;  1JJ8 C;  1NTC A;  1RPW A;  5F08 A;  2R7Z J;  3SDG A;  4B3A A;  4JP0 A;  3HOZ J;  3BR1 A;  2CQQ A;  5E3O A;  1IGN A;  1P7I A;  3PO3 J;  4DZJ A;  1ETX A;  2DA5 A;  2IAI A;  1GV2 A;  1MBH A;  2OPT A;  2ZB9 A;  5DTD A;  3ZQG A;  2GM4 A;  2CQX A;  5EZG A;  1WCM J;  3GTJ J;  2QF7 A;  4MIM A;  1DU0 A;  4MFD A;  3JRC A;  3I4M J;  3HEF A;  4A3I J;  5JLW A;  3TP0 A;  2Y2Z A;  4NDL A;  1ZK8 A;  2LY9 A;  2LK2 A;  3CQZ J;  4DYQ A;  2NVQ J;  3BR0 A;  2NOG A;  3CDL A;  2M2E A;  3BTL A;  3IV5 A;  1MBE A;  2DMU A;  3K2A A;  3LNQ A;  1W0U A;  3RQI A;  2XPU A;  4M6V A;  3HOU J;  4IHV A;  2K9S A;  3BG5 A;  5IP6 A;  5GPC A;  3K7A J;  3FKI J;  3QPL A;  3M3Y J;  1ETO A;  1OJL A;  1RES A;  3S1R J;  3TW6 A;  4L5E A;  2FX0 A;  5IOY A;  5FJ8 J;  1HDD C;  1YRN A;  3LSG A;  1U9O A;  3B6C A;  3FIS A;  5M3M J;  3JRH A;  1ZGW A;  2RAE A;  2XSD C;  4IHW A;  3MKL A;  2EZK A;  2JA5 J;  3IH4 A;  4A3C J;  2XPW A;  1JJ6 C;  2DTZ A;  2ID6 A;  2M9H A;  2VKV A;  1LE8 B;  1TC3 C;  1TWC J;  1A5J A;  1VF9 A;  1MNM C;  2KDZ A;  2COB A;  1IRZ A;  1X2N A;  4HNV A;  3ZQC A;  1ORK A;  4FIS A;  1IDY A;  2JK3 A;  5C4X J;  3JRI A;  1OCP A;  2JA8 J;  2CJJ A;  4W1U A;  2EQR A;  4M3E A;  1HCR A;  4IHY A;  2M34 A;  1JT6 A;  2X6O A;  3ZQI A;  1Y1V J;  3BR3 A;  4RDU A;  5E3M A;  2WAQ N;  2QCO A;  3HB9 A;  4QTR A;  9ANT A;  1VFC A;  1Z77 A;  3S14 J;  1JTX A;  2R0Q C;  3GTL J;  2VI6 A;  3GTG J;  1ZR4 A;  4I6Z A;  2LR8 A;  2HI3 A;  5DS9 A;  5GP9 A;  4BY7 J;  3HDD A;  2JN6 A;  3LSR A;  2H1K A;  1APL C;  2L9R A;  2GLO A;  4A3M J;  2Y9Z A;  2NVX J;  1F36 A;  2CUE A;  2L7M P;  5C4J J;  1QVU A;  1MH4 A;  5F04 A;  2H8R A;  3OSF A;  1HDP A;  1I50 J;  3QQA A;  1VI0 A;  3O8H A;  2VKE A;  4EEF G;  3VPR A;  3RKQ A;  3RZO J;  1ETW A;  1O4X A;  4S0H B;  1FIP A;  5FKL A;  2MG4 A;  2AO9 A;  2O8K A;  2N8G A;  2YUS A;  1ZKG A;  4BY1 J;  5F0C A;  4FE7 A;  1JKQ C;  3GTO J;  2LTP A;  3S16 J;  3DEW A;  5J1Y A;  3GTP J;  3Q0U A;  4QIW N;  1PUF A;  1BJZ A;  2LLK A;  5IYB J;  2VUM J;  1HOM A;  2LVS A;  3S2D J;  2FD5 A;  4V2F A;  3HGG A;  4DYC A;  2DMQ A;  5BNG A;  4FCY A;  1XS9 A;  3BG9 A;  1IUF A;  5EGO B;  1JGG A;  2NS7 A;  3BQY A;  1JUS A;  4CYC A;  2NVT J;  2Y9Y A;  4J19 A;  1OFC X;  2ECC A;  1JT0 A;  3TP3 A;  1E3O C;  3LSP A;  2HOA A;  1K61 A;  3BR6 A;  4AYB N;  1AU7 A;  2Y0S N;  1ETV A;  1A6I A;  4BXX J;  5J1R A;  3S1M J;  3JRF A;  4FTH A;  4AC0 A;  1ITY A;  1NK2 P;  2EZH A;  1K83 J;  1QRY A;  4D7M A;  1MH3 A;  4B4C A;  5C3E J;  4DYR A;  5E3L A;  1G2H A;  1RET A;  3HOW J;  3BTI A;  1AHD P;  1BW5 A;  2HOT A;  2L0K A;  4A3D J;  2YS9 A;  5M3F J;  2XGE A;  2B63 J;  5F1J A;  1PUF B;  4X6A J;  1LFU P;  3S1Q J;  1B72 A;  3OIO A;  4I76 A;  5IP9 J;  2XPV A;  4UUS A;  1VND A;  3RZD J;  3ZQH A;  2VPR A;  3ZOB A;  5EDN A;  1GDT A;  2DA6 A;  3JRE A;  5IP7 J;  3HBL A;  3TW7 A;  4JX4 A;  4XRM A;  4RBO A;  2HXO A;  2KT0 A;  3BTJ A;  1CQT A;  1ETQ A;  3O8G A;  1HF0 A;  4JYK A;  2PMZ N;  3WHB A;  2WB1 N;  3PO2 J;  3S17 J;  4C3J J;  3BTC A;  4M3G A;  3FK6 A;  3BG3 A;  2LP0 A;  2CU7 A;  3G1L A;  1RKT A;  1TWH J;  2ELK A;  1FJL A;  2G0E A;  2ID3 A;  1JKR C;  4IEJ A;  5GPA A;  2L7F P;  1TWG J;  3CMY A;  5FKO A;  3QPS A;  1FTT A;  1QVT A;  2XGC A;  1U8B A;  1W0T A;  2NVY J;  1R9T J;  4V2G A;  4A3J J;  5JLX A;  1D5Y A;  3A01 A;  2XRL A;  3OOU A;  2HOS A;  2K9Q A;  3BT9 A;  3G1O A;  1B72 B;  4UUS B;  1WH7 A;  3GTK J;  1YRN B;  4A93 J;  1IC8 A;  4XID A;  4C3H J;  4C3I J;  1MBG A;  1Z0X A;  1JTY A;  4BBR J;  4D5C A;  5EG0 A;  1MSF C;  3HOV J;  1T33 A;  1Y1W J;  1XC5 A;  1MBJ A;  1UMQ A;  3Q0V A;  2R92 J;  5E3N A;  1WGX A;  4QSH A;  5FKM A;  2DA7 A;  3LOC A;  2EBI A;  1FTZ A;  1MBF A;  2OF7 A;  4AUX A;  3G1M A;  2ME6 A;  3SJM A;  2LD5 A;  3A02 A;  4D5F A;  4MFE A;  5EF6 A;  1F43 A;  4FE4 A;  2M8G X;  2YU9 J;  4ABZ A;  3L1P A;  3Q0W A;  4LOC A;  5EZH A;  3NAR A;  4BBS J;  3PM1 A;  1QPI A;  1UG2 A;  3A01 B;  4MLO A;  3LSJ A;  3IH2 A;  1T56 A;  4A3F J;  2E2I J;  5EEA A;  1RR7 A;  2FQ4 A;  3S15 J;  1U9N A;  5M5W J;  2DA3 A;  2TRT A;  4JX5 A;  2P81 A;  4A3B J;  2R5Y A;  2MW8 A;  5IPA A;  1POG A;  4A3E J;  2L7Z A;  3WHC A;  3FIW A;  1NK3 P;  2IEK A;  2JA6 J;  2MGQ A;  3JRD A;  2X48 A;  1JUM A;  3I4N J;  1H8A C;  2I10 A;  5K7H A;  2R93 J;  4XRS G;  4X1E A;  2HYJ A;  2DMT A;  4A3L J;  1B8I A;  1MBK A;  2JMW A;  5C44 J;  1H89 C;  2MSY A;  1DU6 A;  2XB5 A;  1EF4 A;  5FLV A;  5K7F A;  2Y31 A;  1XG1 A;  1BA5 A;  1OCT C;  2D5V A;  2JJ7 A;  1I3Q J;  5K7Z A;  2FJ1 A;  3M4O J;  3GTQ J;  2ECB A;  1IV6 A;  1LE8 A;  1GUU A;  1UHS A;  1P7J A;  3H3V K;  1JKO C;  1IJW C;  3D1N I;  1JUP A;  2W48 A;  2JA7 J;  2R5Z A;  2K40 A;  3S1N J;  4IHX A;  2R5Y B;  1ZR2 A;  3Q3S A;  2TCT A;  3HOY J;  2Y30 A;  1I6H J;  4CYC B;  1ENH A;  4G12 A;  2XGD A;  3A03 A;  3HOX J;  4DW6 A;  4A69 C;  2JWT A;  4GFB A;  3S2H J;  4UUT A;  1GT0 C;  1ZTR A;  2EZL A;  5IOZ A;  2DMN A;  5FLM J;  1B8I B;  4M3F A;  5IYD J;  1GVD A;  3IH3 A;  2O7O A;  4XRS A;  2HQ5 A;  2GBY A;  1ZQ3 P;  1BW6 A;  3TED A;  2LFB A;  2LKX A;  1ETY A;  2XB0 X;  4XK4 A;  2EZI A;  2M0C A;  4BKX A;  2E2H J;  4A3G J; 
#chains in the Genus database with same CATH topology
 2ZFU A;  3MKW B;  1WVR A;  3ECH A;  1FIA A;  4HG2 A;  1E2X A;  3HKZ N;  4MO7 A;  3OYI A;  1FY7 A;  1GHC A;  1WPK A;  2DT5 A;  2BY1 A;  2WV1 A;  4DZP A;  2DYS H;  3RQ4 A;  3OYF A;  4KA4 A;  3BR2 A;  1AKH A;  4DIQ A;  3ZQL A;  3CP8 A;  2PJR B;  1SAN A;  5J1U A;  1TQI A;  2FBK A;  3GTM J;  1S7E A;  3GBG A;  2CQK A;  3FK7 A;  1NG7 A;  1MSE C;  4Y52 J;  1YTY A;  3HM5 A;  2BYV E;  4PSX A;  3UR3 C;  1IUY A;  2HNH A;  2DQR A;  3GZ5 A;  3PUB A;  1X1B A;  3HKZ A;  5IT9 K;  3B6A A;  4HV6 A;  2HQN A;  2E1O A;  3L2V A;  3HSE A;  4KUM A;  1SFO J;  3PQK A;  2XSJ C;  1ZEL A;  1X3U A;  2F5F A;  4G7O F;  2CUF A;  2KQR A;  3IP4 B;  2X9D A;  3MCZ A;  5EGO A;  3OS2 A;  3MKY B;  5F27 A;  3UKG A;  1FPQ A;  3TQN A;  5LEK A;  4IQ4 A;  2AS5 F;  2EK5 A;  2JUG A;  2QBY A;  1KU2 A;  2CYY A;  2WAF A;  1H88 C;  1LFB A;  2YX7 A;  2XAH A;  5LBQ A;  2QQB A;  3C2B A;  4WXH A;  3DPL C;  3V8K A;  1HLV A;  2O9L A;  3F3X A;  5M5Y J;  2EH3 A;  2CRG A;  3BR5 A;  5F0H A;  4XN0 A;  3CJQ B;  4G7Z F;  3F0C A;  3DLA A;  1X58 A;  2VPL A;  1WJ5 A;  1GV5 A;  3BPV A;  1Q1V A;  1ZRF A;  1OIS A;  3ZQF A;  1VQ7 I;  2OQR A;  1Z21 A;  3H0G J;  3KEY A;  4M3B A;  5FKN A;  4Y7N J;  1R49 A;  2JRT A;  1LJ9 A;  2FNA A;  5F08 A;  3WGG A;  3NWT A;  1B1B A;  3BR1 A;  3IUO A;  2IGK A;  4EJU A;  3HOZ J;  1YOV B;  4DZJ A;  2F4O B;  1X4P A;  1GV2 A;  2OPT A;  4ZJZ A;  3ZQG A;  1A6Q A;  1D1B A;  3LSI A;  2CQX A;  3LFU A;  1FYL A;  2IGO A;  1MDM B;  1JE8 A;  4KMF A;  3RKW A;  4E7S A;  2LKP A;  4MGR A;  3HUG B;  1YIO A;  3I4M J;  3M07 A;  4ZYA A;  4ESF A;  4ETS A;  2Y2Z A;  5J4Y A;  2LY9 A;  3R61 A;  1XCV A;  1FBS A;  3A1Y A;  4WXD A;  2IJL A;  1WJF A;  3TOB A;  2NVQ J;  5HS9 A;  3BR0 A;  3CDL A;  1YX5 A;  2M2E A;  3BTL A;  1V5G A;  1LQ1 A;  1DQU A;  1S3J A;  2DMU A;  1Z05 A;  3J81 Z;  4EQQ A;  1FOY A;  3LA2 A;  3BCB A;  1BJA A;  4HQM A;  4BAC A;  4G9Y A;  2K9S A;  5FGM A;  3IKV A;  1HW1 A;  2PX9 A;  1YX3 A;  4LIU A;  2JVH A;  1YIJ I;  2MYS A;  3KZZ A;  1Q1H A;  1KU3 A;  1RES A;  5BQT A;  3E5U A;  2IXS A;  4L5E A;  5FJ8 J;  3DBH B;  3LSG A;  2DI3 A;  4Y17 A;  3G71 I;  3F8B A;  5M3M J;  1X4O A;  3DBL B;  1WSU A;  1ZGW A;  3AAF A;  3DF8 A;  1TT5 B;  1TTY A;  4LIT A;  4IHW A;  4V19 K;  5LGU A;  2EZK A;  2JA5 J;  3IH4 A;  3EUA A;  2DTZ A;  2M9H A;  4MNU A;  3TBI A;  2VKV A;  1ACI A;  1B6A A;  1MIJ A;  2GA2 A;  4LJZ F;  2FSW A;  2QKL B;  4O3M A;  3QP5 A;  1VF9 A;  1MNM C;  1U8R A;  3CLO A;  2BE5 F;  3L9F A;  4HNV A;  1K79 A;  1W7P B;  4ANJ A;  3ISP A;  3FKJ A;  1IDY A;  2JK3 A;  4UV8 A;  4OIN F;  1XCB A;  1LPQ A;  2V9P A;  3CCS I;  3IRR A;  4W1U A;  1HCR A;  4FHT A;  2X6O A;  3ZQI A;  5CVJ A;  1W7P D;  1BR1 A;  2QQ9 A;  4EJO A;  3BZ6 A;  2ISY A;  1X1D A;  2WAQ N;  2UZK A;  2JSP A;  3M1C A;  4IKF A;  2EV6 A;  4ZYE A;  3EUK L;  4ZTF A;  4B3X A;  3HL2 A;  3L2C A;  3OYE A;  1IO2 A;  3GTG J;  3M8J A;  4U7D A;  2IRF G;  4IX7 A;  3RTR A;  3DQV C;  3E5Q A;  5DS9 A;  1SD5 A;  4U0W A;  2K7L A;  4BDZ A;  1FP2 A;  3LSH A;  2VON A;  3VB2 A;  2RRE A;  1H0M A;  4CUG A;  3S3N A;  2VL8 A;  1MND A;  3SXY A;  1F5T A;  4XOT A;  4BYY A;  2CUE A;  2HGC A;  1YG2 A;  2L7M P;  1YW9 A;  4F92 B;  5C4J J;  4NC7 A;  2AXL A;  2WAQ A;  4XMY A;  4B44 A;  2H8W A;  1I50 J;  5AON A;  2VKE A;  4XM3 A;  3DBR B;  3RZO J;  2K9L A;  4HOB A;  4OU0 A;  5E1X A;  3I59 B;  1EH8 A;  3I55 I;  1STZ A;  2YUS A;  3OWT A;  3KZY A;  3K4B A;  1SFU A;  2LTP A;  1J0R A;  2MA3 A;  4CSW A;  1HC8 A;  1I3A A;  3OIP A;  3T5X A;  1QHH D;  1U2W A;  1XGN A;  3WE3 A;  3Q0U A;  3D5L A;  1TT0 A;  1W4M A;  4F91 B;  3JTH A;  1E17 A;  1XSV A;  1DPR A;  2IVM A;  2KZG A;  4PJL A;  4AM3 A;  1J09 A;  2LVS A;  2NRA C;  3HG9 A;  4V2F A;  3KYC B;  4DYC A;  3K70 D;  4CHU A;  3EUH A;  1JGG A;  4DBQ A;  4NC6 A;  2KIF A;  1BN5 A;  1Z6R A;  3FBI B;  1P6R A;  2DLL A;  3BLY A;  1DPU A;  1SD7 A;  3A2K A;  4E7Z A;  3ERM A;  4XLE A;  1E3O C;  3LSP A;  1WKM A;  1K61 A;  4U87 A;  3H3U A;  5ICC A;  3ZMT A;  5A2Q Z;  4AC0 A;  1QRY A;  4PJ0 C;  4ITV A;  3I4P A;  1VQ6 I;  2KJB A;  2X0L A;  4KN4 X;  2BHZ A;  4WXC A;  5E3L A;  4IRI A;  3TO6 A;  1RET A;  3HOW J;  3BTI A;  2LC2 A;  1BW5 A;  3WG9 A;  4A3D J;  2IW5 A;  2W24 A;  2L4A A;  2B63 J;  1TBX A;  2DOF A;  2E35 A;  3S1Q J;  2K86 A;  2XPV A;  3V7C A;  1UHW A;  2VPR A;  2Z2S B;  1P2F A;  5IP7 J;  1T0F A;  3GXO A;  2VE8 A;  3PUF A;  3KET A;  1LUJ B;  4F3Q A;  3BG7 A;  4RBO A;  2HXO A;  3RDI A;  2V1D A;  2EA4 A;  3DWL E;  4M9X A;  2J5P A;  2GZW A;  3O8G A;  1DP7 P;  3GWZ A;  2PMZ N;  3HPH A;  2VQG A;  3AKZ A;  2ZXH A;  2P8T A;  1T6S A;  3BTC A;  4M3G A;  3W6J B;  4KT5 C;  2LP0 A;  2P5K A;  1YS6 A;  3CP2 A;  3B02 A;  1J2X A;  3G1L A;  3CLQ A;  3WTV C;  1TWH J;  2L9S A;  1U5T C;  2M87 A;  5B1A H;  1X1A A;  4IEJ A;  5GPA A;  4XN3 A;  1S5L C;  4RGU A;  2UUZ A;  3CCJ I;  4G7H F;  4CO8 A;  5FKO A;  2F5C A;  3QPS A;  1O3T A;  1H9G A;  1K78 A;  2DCE A;  2E1N A;  2VBX A;  4PGH A;  4A6E A;  2JVG A;  2EA2 A;  3OOU A;  4BEH B;  5GAE J;  2VIX A;  4RAG A;  1HST A;  3KYD B;  3G1O A;  3L2Q A;  4ENM A;  5D6F A;  1REP C;  2V26 A;  2LH9 A;  3AG3 H;  3HHH A;  1N78 A;  3HC7 A;  4RGR A;  4C3H J;  4U0V A;  4DJA A;  1JHF A;  1JTY A;  3E6M A;  4D5C A;  5EG0 A;  2A07 F;  1EH6 A;  1T33 A;  1Y1W J;  1N25 A;  2DW4 A;  1UMQ A;  1FT9 A;  2EIM H;  2W1O A;  3CUQ A;  1SMY F;  5E8I A;  3FZV A;  3K0L A;  1MBF A;  1USS A;  1R5H A;  4WF2 A;  1G3W A;  5CVV A;  3G1M A;  4OIR F;  5D5V B;  5EF6 A;  1K7A A;  1CF7 B;  2H09 A;  2YU9 J;  2X4H A;  4HX7 A;  5FLX Z;  3KIO A;  2EB7 A;  4LOC A;  2R7T A;  2QWW A;  3ZMD A;  2E71 A;  4RGS A;  5HLH A;  3ZMS A;  4XLC A;  2LF7 A;  3LSJ A;  4BL0 B;  4RS8 A;  5DD4 A;  4KIT B;  2B0L A;  2ZME B;  3FMR A;  1RR7 A;  2VJ4 A;  5HNH A;  2ADU A;  2QVO A;  4BXF A;  5L3C A;  1XSD A;  3WTU C;  4HLX A;  3CJR B;  3DFG A;  2G9W A;  2R7Q A;  5JFR A;  4PFP A;  2BGC A;  5ILV A;  4IRH A;  2VQH A;  4G8X A;  4IPA A;  2W85 A;  3LQR A;  3F6O A;  4PFO A;  1X1C A;  1LB2 A;  2CH0 A;  2QGU A;  2CFX A;  3I4N J;  2F4M B;  1MMS A;  3O2P E;  1X3Z B;  1W36 D;  3OIQ A;  2LY2 A;  4U0Y A;  4L18 B;  2EFP A;  2XF6 A;  2D1V A;  3K4L A;  3RSN A;  1I27 A;  1MBK A;  1VQ8 I;  3J7A O;  2R7U A;  1M1E B;  4G6D A;  2FML A;  3R0J A;  4B8X A;  5HDG A;  4EJW A;  2D5V A;  2KDO A;  3M7G A;  3WTT C;  3SQN A;  3CTA A;  2ECB A;  3J80 K;  3NEU A;  5DM6 F;  1UHS A;  3Q9S A;  1P7J A;  1WJC A;  5HLG A;  4BQO A;  1L0O C;  1JKO C;  5E20 A;  3D1N I;  3S3M A;  1JUP A;  2P4W A;  3KFW X;  4BQQ A;  2GIV A;  2W48 A;  1BOA A;  1YO5 C;  1MW7 A;  2R5Y B;  2NYX A;  1ZR2 A;  3Q3S A;  3OL3 A;  4BH9 A;  2Y30 A;  1VQ5 I;  3K4K A;  1GXQ A;  4BS9 A;  2X6Y A;  2M3A A;  2EJR A;  1EKE A;  2RGV A;  4XBF A;  2KP6 A;  3CF5 F;  3H5N A;  3BOQ A;  1GT0 C;  2J5O A;  1DGW Y;  2DMN A;  2DOA A;  1B8I B;  4M3F A;  1GVD A;  2FOW A;  3FBN B;  4FT8 A;  5JR3 A;  3KP7 A;  1XX5 A;  2LKX A;  2XB0 X;  2V4J C;  1XD7 A;  3HOT A;  2PI0 A;  1FYM A;  1PUE E;  1IN8 A;  2CW7 A;  4CZC A;  1OYY A;  2FXA A;  1T98 A;  3FMS A;  3V8J A;  3MVP A;  2GOX B;  3BWG A;  4CH7 A;  3KP2 A;  1JKP C;  4E6K G;  3I9V 2;  3JR9 A;  3H5A A;  3HGY A;  1OPC A;  1LVK A;  4NC8 A;  3H92 A;  5LGN A;  2O3F A;  5J8F A;  3RPU D;  3T8R A;  4R1H A;  2HWV A;  1R00 A;  4BE1 A;  3CJN A;  5J3L A;  2FEZ A;  1IXS B;  2HXI A;  4JOM A;  3IC7 A;  3JRA A;  4I2O A;  2R7O A;  1ZLK A;  2CQ7 A;  1FP1 D;  3G73 A;  2VXZ A;  2BV6 A;  3EET A;  2CW0 F;  4RB0 A;  3E6D A;  2XAJ A;  4A5N A;  2ELH A;  4W97 A;  4RMN A;  2ACJ A;  4M9S A;  2OQG A;  4ENK A;  1D0Y A;  4XIC A;  3OYG A;  2QEX I;  3JRB A;  3QOP A;  1FEX A;  3N97 A;  2NOJ B;  2HDD A;  4AIJ A;  1JGS A;  3MN2 A;  3A4C A;  5FFX A;  1LEB A;  1I6X A;  1Z7U A;  4F7Z A;  3GVA A;  3E3V A;  5F1R A;  3ZP5 A;  1RRJ A;  3FF5 A;  3CCR I;  4M6Y A;  1UEL B;  2E19 A;  1S9H A;  2QA4 I;  2A61 A;  4NNJ A;  1BL0 A;  1WH5 A;  3ZGK A;  2X6X A;  2HDC A;  2XRO A;  3WTY C;  1AKH B;  2X6W A;  4LGW A;  4BDY A;  4MQ9 F;  1G8X A;  3SFZ A;  5DCF A;  1SD4 A;  3CD6 I;  2ZCW A;  2KIQ A;  1JJ8 C;  3NAU A;  2STW A;  1S7A A;  5J4V A;  4KFC A;  4XL9 A;  3SZP A;  3SDG A;  4B3A A;  1WHU A;  5E3O A;  5LD2 C;  1L3L A;  1HSJ A;  2LSO A;  1P7I A;  2DA5 A;  1XGS A;  4HNT A;  3MAJ A;  5DTD A;  2DBB A;  4I0B A;  1OCO H;  5EZG A;  1WJD A;  2W4S A;  2QF7 A;  1DGR M;  1OCZ H;  1DU0 A;  4MFD A;  2Z9O A;  3KCC A;  4TV7 A;  3I56 I;  2W25 A;  3JRC A;  2WWY A;  2QBY B;  5JLW A;  4E70 A;  3WGI A;  2V9V A;  4DBR A;  1ZK8 A;  2XDV A;  4BJ6 C;  5CVI A;  2VN2 A;  3CQZ J;  3RPU A;  2O5R A;  3VEP A;  4BXU A;  2AQF A;  3LAP A;  2VJI A;  3LSM A;  2RQP A;  4ZDO A;  3P9C A;  3C1D A;  3OYM A;  2EFQ A;  4MTE A;  3S8P A;  1XPX A;  3K2A A;  3M8F A;  1W0U A;  1Z91 A;  3LST A;  3RQI A;  1ON2 A;  3HOU J;  2RC4 A;  4IHV A;  2KMU A;  3BG5 A;  5IT3 A;  1MMA A;  3EYI A;  5IP6 A;  2G7H A;  1HXD A;  3FKI J;  5D4S A;  3QPL A;  2ZJQ F;  4YIF A;  3M3Y J;  1UZC A;  3N4M A;  4GYG A;  1FC3 A;  4KIC A;  3S1R J;  1YJW I;  1YRN A;  3VOD A;  5IOY A;  4ZH4 F;  3OY9 A;  1FNN A;  1LDD A;  1G3T A;  3B6C A;  3FIS A;  2JTV A;  1LVA A;  4RLQ A;  1ZG5 A;  3LA3 A;  1VQL I;  1ZGA A;  1UST A;  4BNC A;  4DGW B;  2P7V B;  1XB4 A;  3OYN A;  4A3C J;  2XPW A;  2L4M A;  3H5R A;  1J75 A;  3CJT B;  1LE8 B;  5FFZ A;  2IS6 A;  1V4R A;  2GIZ A;  2HQR A;  3DU6 A;  4EGY A;  2E1C A;  2DPD A;  4Y33 A;  3P9K A;  3U1D A;  4XLF A;  2COB A;  2KHM A;  2KDZ A;  2E7X A;  3I71 A;  1X2N A;  2W84 A;  1ORK A;  5DUK A;  1OYI A;  4N9H A;  4CYD A;  1GLN A;  2BW3 A;  2UV1 A;  2RQQ A;  3JRI A;  1R71 A;  1SVL A;  4IHY A;  4M3E A;  3E5X A;  4XLA A;  1JT6 A;  3IAM 2;  3HPG A;  2I5U A;  4U7B A;  3KLN A;  3MZH A;  5LHG A;  2V1X A;  3Q9V A;  4LK1 F;  2QCO A;  4O5V A;  2M5W A;  2VBW A;  2R0Q C;  1HA8 A;  2VI6 A;  3KEO A;  1SFE A;  1ZR4 A;  1R22 A;  2Q2E B;  4I98 B;  3HDD A;  2HPM A;  2LRD A;  4FX0 A;  1TNT A;  2L9R A;  3VYT B;  1TL8 A;  3SHF A;  4A3M J;  2E5N A;  2OU2 A;  5J6X A;  2X1E A;  2ZXI A;  2BY3 A;  1X1P A;  4UV9 A;  5LRR A;  4EJT A;  5ERI A;  2F48 A;  5F04 A;  2H8R A;  5E1Z B;  4YFK F;  3OSF A;  1HDP A;  1R4M B;  1MGT A;  5EEG A;  3W3C A;  1ULY A;  3DTI A;  4RAZ A;  3WU2 C;  1KA8 A;  1O4X A;  4DNC A;  1FIP A;  5FKL A;  2MG4 A;  2ZJR F;  2RDP A;  5D6E A;  2N8G A;  3L7W A;  1ZKG A;  4BY1 J;  3P9I A;  4FE7 A;  2H6C A;  2EWN A;  1JKQ C;  2XC7 A;  3F72 A;  2DAO A;  3WTX C;  2YPR A;  2ZC2 A;  3DEW A;  4YFN F;  5KHD A;  4XLN F;  3VFZ A;  3GTP J;  4QIW N;  1PUF A;  5FRM A;  4E7I A;  1XGM A;  3HOS A;  2K3F A;  1HOM A;  4A6D A;  3S2D J;  2I8D A;  1QQI A;  3KP3 A;  2E34 A;  3HGG A;  3ASO H;  4CA0 A;  2A5Y B;  1F9N A;  5E79 C;  2XAS A;  3QYE A;  2VC1 A;  2V79 A;  4U88 A;  1O7L A;  3BQY A;  3KP6 A;  3ECO A;  1EV7 A;  4M71 A;  3FM5 A;  4CYC A;  2NVT J;  1YIT I;  5BPI A;  4J19 A;  3GO5 A;  1OFC X;  4Q5S F;  4N9I A;  4UVC A;  4OMZ A;  3TP3 A;  3OYA A;  4OWR B;  3FM3 A;  4LLG F;  3OYD A;  1AU7 A;  2Y0S N;  1ETV A;  3QOE A;  1A6I A;  1B9N A;  2EFN A;  4KIG A;  1V54 H;  2FBH A;  3DEU A;  3IWZ A;  2NS0 A;  2VT3 A;  2XAQ A;  3S1M J;  1P92 A;  3JRF A;  4FTH A;  1ITY A;  1NK2 P;  3AL0 C;  5DD8 A;  3HSF A;  2ZFW A;  5CJ9 A;  1LEA A;  3W2V A;  4AU7 A;  1AHD P;  1R36 A;  1YLF A;  1B59 A;  2DOD A;  2G7U A;  3ABU A;  5KNL A;  2XGE A;  2E36 A;  3F9K A;  2LOO A;  1X19 A;  1SC7 A;  3F6V A;  2MH2 A;  3C2H A;  1U0J A;  3KYL A;  3DLL F;  4UUS A;  2KIM A;  4YII A;  3ZQH A;  4L5J A;  3SZT A;  2Y0S A;  1GDT A;  2AQE A;  3HBL A;  3TW7 A;  2OTJ I;  3K4J A;  2R7X A;  4XRM A;  3ZR8 X;  2ZJP F;  3BTJ A;  3QAH A;  1CQT A;  4BQN A;  3J80 Z;  2LF8 A;  4HBL A;  1ETQ A;  2EIK H;  2ZME C;  4JYK A;  2YR2 A;  1XMA A;  2YU3 A;  3FXL A;  2JQ7 A;  2DQL A;  1OMI A;  5D8L B;  3UNG C;  4MEY F;  3OYB A;  2GQQ A;  4I7H A;  4EV0 A;  3FXO A;  5CQG A;  2CW8 A;  1IV8 A;  3HIF A;  4ZDP A;  2DXI A;  3DPT A;  3O3K A;  1C0W A;  2G0E A;  2ID3 A;  2ZO4 A;  1JKR C;  2IS4 A;  3TO9 A;  2L7F P;  1TWG J;  3VDX A;  3QPT A;  2BHY A;  3HTU A;  2PEX A;  2XKP A;  2H94 A;  1FTT A;  4ON0 A;  1QVT A;  3M1E A;  4A3J J;  3FDY A;  5JLX A;  5KK1 A;  2FU4 A;  2O61 A;  2HOS A;  4MHG A;  1OCR H;  4QPO A;  2R7W A;  4GXO A;  2A6E F;  2IA1 A;  4ZZL A;  3ZPL A;  4A93 J;  4H0E A;  3L2W A;  3H3Z A;  3GEZ A;  2KRH A;  2VT2 A;  2Z1D A;  4C3I J;  3WU1 B;  2VE9 A;  3G6E I;  5DCM B;  4E7J A;  1RUO A;  2VKH A;  4PJN A;  4XKV A;  4LB6 B;  4GDF A;  4UB8 C;  3BC8 A;  1XC5 A;  3FXM A;  4B48 A;  2H27 A;  2W57 A;  3ABK H;  5BS6 A;  1GVJ A;  3Q0V A;  4ZYG A;  2R92 J;  2AXT C;  4P9F A;  4QSH A;  1WJA A;  3FXU A;  3GZN B;  4LG0 A;  4D1Q A;  2EBI A;  1QU3 A;  1HW5 A;  1D1A A;  3CCU I;  2B9S A;  3OYC A;  2OF7 A;  2Z99 A;  1ZLJ A;  4EJV A;  3SJM A;  4XLH A;  1F43 A;  3D0S A;  4MFE A;  2L2O A;  2L02 A;  4FE4 A;  1IN4 A;  2M8G X;  3EQL F;  4ABZ A;  2UXN A;  2CV2 A;  4KMU X;  3L1P A;  3NAR A;  4CCO A;  3PM1 A;  2EPF A;  3BCA A;  2KL4 A;  4S05 A;  2DFH A;  3ASN H;  1UG2 A;  2X1D A;  4L9T A;  2DFF A;  1MZB A;  2IGM A;  3K1M A;  4RM2 A;  1KU9 A;  4YFX F;  2BEO A;  3BZK A;  3FMQ A;  2FQ4 A;  3V7R A;  1G6N A;  3S15 J;  2CUZ A;  1U9N A;  1FBU A;  5M5W J;  4JX5 A;  2LKS A;  3HXL A;  2P81 A;  2HDW A;  2XF5 A;  3HRS A;  4DQ2 A;  5FB2 A;  1O3Q A;  2HPI A;  2MW8 A;  3L2R A;  2XRN A;  1PVE A;  2FNP A;  3CUQ B;  3WHC A;  5E1W A;  1NK3 P;  2IEK A;  5ILS A;  2MGQ A;  2ESN A;  2X48 A;  1S8N A;  1JUM A;  2RN7 A;  3S32 A;  2R93 J;  2STT A;  2X85 A;  4LLN A;  5H20 A;  2OUM A;  2HYJ A;  4J00 A;  2P6T A;  3GZ6 A;  2JT1 A;  2DMT A;  5TRD A;  1LNW A;  2FOK A;  2JMW A;  3F8C A;  3T1B A;  1RNL A;  5FLV A;  2Y31 A;  3TDZ C;  1O57 A;  4B47 A;  3EPZ A;  5ICF A;  4ESB A;  1I3Q J;  2FJ1 A;  2PG4 A;  5K5R A;  2M7A A;  4O6J A;  3QPH A;  1W5T A;  5JHU A;  4CGZ A;  3CMM A;  5J47 A;  5ICG A;  4LB5 A;  4YIR X;  3GLX A;  1ZGJ A;  1IJW C;  1KQ9 A;  2E1M C;  1R5I D;  4LLL A;  2R5Z A;  3VYU B;  2BY2 A;  4KIF A;  4NHJ A;  1ONV A;  3REO A;  4PDK A;  2TCT A;  5CKT A;  3HOY J;  2QKM B;  2Y69 H;  3ZMV A;  2VQL A;  4HA8 A;  2CWE A;  4CCJ A;  5D8K B;  4A69 C;  3DKY A;  2JWT A;  3CC7 I;  4GFB A;  1R4N B;  4ZDL A;  4PJM A;  3GFJ A;  4AD9 A;  2CG4 A;  4IO9 F;  5IYD J;  4CCN A;  1MMD A;  3IH3 A;  4FX4 A;  2O7O A;  2R7S A;  4P55 A;  2HQ5 A;  2GBY A;  1BW6 A;  4I02 A;  5FO5 A;  4CCL A;  3TED A;  2LFB A;  4I99 C;  1ETY A;  1IW7 F;  2VXD A;  4XK4 A;  2KZV A;  1IZ1 A;  5GAH J;  5KAF C;  2EZI A;  3CCE I;  1IRF A;  4AIK A;  4BE2 A;  1U3E M;  3A0H C;  2PMZ A;  2DA2 A;  3LMM A;  2ME0 A;  3JAM K;  5F6F A;  4XNF A;  2Z3Y A;  2IS1 A;  2JPB A;  2DJN A;  3ESW B;  2R4G A;  3OSG A;  3CDH A;  5JHF A;  2WY8 Q;  5DYM A;  3QOD A;  4IHS A;  3CES A;  2L7K A;  1ETK A;  4XSX F;  2GXG A;  5F0F A;  3CCY A;  4EM1 A;  4L9V A;  5CLS A;  2GWR A;  1QO0 D;  1LKX A;  2KKO A;  5BMZ A;  3KE2 A;  2LYC A;  3OR2 C;  4D7N A;  3JRG A;  3HSR A;  3HZJ A;  3U2R A;  2NS8 A;  4IOA F;  1MJ9 A;  1Z9C A;  2FA5 A;  1VQM I;  1WI3 A;  4N4N B;  3SEQ A;  2DMP A;  4C2M J;  1FLI A;  3KP4 A;  5HVQ C;  1BI0 A;  4RM3 A;  2BVL A;  2ZNY A;  4ZTJ A;  3VSK A;  4HF1 A;  1BIB A;  1XN7 A;  5KVR A;  2HU9 A;  5IT9 Z;  2NVU B;  2R7D A;  2CS3 A;  2RNG A;  3WOD F;  4UUV A;  4E7H A;  2DYR H;  1FOK A;  2XAG A;  1TWF J;  3DXJ F;  2D45 A;  4XOR A;  3W6V A;  1XSX A;  3FXK A;  5FKK A;  4JBA A;  2WBM A;  3QP6 A;  3I3L A;  3SFI A;  2YSR A;  5EYR A;  1H9T A;  1T2K A;  1TWA J;  3TGN A;  3T0Y A;  5DV5 A;  1NTC A;  2XGX A;  3ROU A;  1UFM A;  2R7Z J;  2CQQ A;  3CCQ I;  1R7J A;  4D0P A;  1ETX A;  2EIJ H;  4HLY A;  3J7A Y;  2O03 A;  5B1B H;  4WWC A;  2IAI A;  1MBH A;  2PBI A;  2NNY A;  4UB6 C;  3FWE A;  1EA3 A;  1WCM J;  2M8E A;  3GTJ J;  5FRN A;  2QZ8 A;  1WRJ A;  3OOP A;  4KT6 A;  1TNS A;  3J81 K;  3HEF A;  4A3I J;  4CCK A;  5JVG F;  1ZG1 A;  5D5W B;  3TP0 A;  4NDL A;  1MKM A;  3P5J A;  2JUC A;  1JXS A;  2FRH A;  2PMU A;  2LK2 A;  3U9G A;  4DYQ A;  4QWQ A;  1D0X A;  2BY0 A;  3BG6 A;  4WK8 F;  4A0X A;  4BGD A;  2OC6 A;  4CZZ A;  3IV5 A;  2VJ5 A;  3CO6 C;  2ZNZ A;  2CV0 A;  2V1N A;  1J7K A;  1ZN2 A;  1AOY A;  4MEX F;  3DEE A;  2XPU A;  2VQC A;  4M6V A;  5HS7 A;  2ISZ A;  2DK5 A;  2P0W A;  3CCL I;  2FQ3 A;  5GPC A;  3OS1 A;  3K7A J;  4R8H A;  4BEH A;  5K5Q A;  4KNY A;  2L54 A;  1ETO A;  1ZYR F;  5FD5 A;  3G3Z A;  2O0Y A;  1OJL A;  4B09 A;  4FET A;  2IS2 A;  5EEH A;  1HDD C;  1EH7 A;  1U9O A;  4FAS D;  2Q0O A;  1I1G A;  3ABT A;  3CC4 I;  3JRH A;  2K5C A;  2RAE A;  1V55 H;  1Y39 A;  5LHH A;  2LY1 A;  2DU9 A;  5E18 F;  3K10 A;  2OAZ A;  3MKL A;  2FE3 A;  4Z2Y A;  5GAG J;  2MLK A;  3ONQ A;  3C18 A;  1OYW A;  1U6G A;  2NXN B;  1UG0 A;  5FD6 A;  3BJA A;  1TC3 C;  1WJB A;  1IRZ A;  5B66 C;  1EJ9 A;  3PJR A;  4HDU A;  1PP7 U;  3ZQC A;  4FIS A;  3TL4 X;  5LLQ A;  5DUI A;  4GYI A;  1CF7 A;  3J7Z I;  4HX8 A;  5C4X J;  3L2U A;  4IHT A;  2L3D A;  2CJJ A;  3HRT A;  4XKB A;  1O3R A;  2M34 A;  1BBY A;  1HQC A;  1MD0 A;  1Y1V J;  2M4G A;  4XR6 A;  1JI8 A;  1IN5 A;  3M8E A;  3RPQ A;  5E3M A;  3ERE D;  3HB9 A;  2Y48 A;  5DM7 F;  4QTR A;  4OAZ A;  9ANT A;  3F8M A;  4G94 A;  1VFC A;  1GXP A;  3S14 J;  1O7F A;  1JTX A;  2WC2 A;  3ABL H;  1XMK A;  1W5C C;  4I6Z A;  4KIB A;  2LR8 A;  3PL8 A;  5ILU A;  2KPM A;  1QZE A;  5GP9 A;  2DDB A;  3H9Q A;  4NQW B;  3LSR A;  4F93 B;  1APL C;  2GLO A;  4P5O A;  2KRC A;  1W1W E;  4XOP A;  5K5O A;  2NVX J;  1V5E A;  3MQ0 A;  1QVU A;  1MH4 A;  4NB5 A;  2LBF A;  3WTZ A;  1R1U A;  2WAD A;  3I5U A;  3EUH C;  1MMN A;  2P5L C;  3D5R C;  3VPR A;  3BY6 A;  3RKQ A;  1ETW A;  2AO9 A;  2BW3 B;  2FBI A;  4XSZ F;  3B73 A;  5F0C A;  1G59 A;  1BC8 C;  4QPQ A;  3GTO J;  3PQJ A;  1SAX A;  2JRM A;  1BC7 C;  5J1Y A;  2CO5 A;  3RJP A;  5EJC A;  3SDB A;  1BJZ A;  2LLK A;  4UVA A;  4EGZ A;  3CZ6 A;  2MD0 A;  1D3Y A;  1K4T A;  3E1S A;  2FD5 A;  4Q48 A;  3D5S C;  2WAE A;  2DMQ A;  4GCV A;  1DUX C;  3BG9 A;  1R58 A;  1HKQ A;  1S29 A;  3GME A;  2QYO A;  3K9T A;  4GGG A;  5GTH C;  3FXR A;  5EGO B;  2NS7 A;  5A2Q K;  2GXA A;  2XV4 S;  1IXR C;  2Y9Y A;  2E5Z A;  1F4K A;  4UVB A;  1OLT A;  2ECC A;  4AID A;  1TW2 A;  3CUO A;  4WX9 A;  2X1C A;  1T38 A;  1FYK A;  4RLF A;  5J1R A;  4OMY A;  1MH3 A;  4B4C A;  1XGO A;  2QQ8 A;  3L00 A;  2DOE A;  2Z33 A;  4IOC F;  1G2H A;  5CQE A;  2F4I A;  2HOE A;  4S04 A;  2HOT A;  4C2T A;  4Y4R A;  1K6Y A;  2Z5U A;  5F64 A;  2L0K A;  4L0Z B;  3PNT A;  1QPM A;  1A35 A;  3I0T A;  1PUF B;  2HFH A;  2ZXJ A;  4GO1 A;  1LFU P;  1B72 A;  3RYR A;  4LD5 A;  4X0G A;  1VND A;  1LDK B;  3C3W A;  1Y56 A;  3BJ6 A;  4EM0 B;  2DA6 A;  3J7Y J;  3JRE A;  2DK8 A;  4JX4 A;  4BJ5 C;  4BJT A;  2OCE A;  3G4S I;  5H2F C;  2A68 F;  2P7C B;  2M0M A;  3CMA I;  4Q4Z F;  2M7B A;  2V6C A;  1D5V A;  3K70 C;  2F6C A;  1HF0 A;  3R60 A;  5B3S H;  2F5V A;  4HPQ A;  3H35 A;  1Y0N A;  4AVZ A;  4M9Z A;  2CU7 A;  3CCV I;  4IZZ A;  2X51 A;  1VQP I;  2DO7 A;  1KYW A;  1KON A;  5HDK A;  1RKT A;  1VTN C;  5J40 A;  3DP7 A;  2L9N A;  3K4N A;  3I64 A;  2M45 A;  1FSE A;  4H4K C;  3DPU A;  3CMY A;  1WJE A;  2HYF A;  4A2U A;  4BUP A;  2XGC A;  3DKW A;  3BPX A;  1W0T A;  3I58 A;  2NVY J;  1R9T J;  1FMW A;  4V2G A;  1QZZ A;  3V42 A;  1D5Y A;  3A01 A;  2XRL A;  3BT9 A;  2HVR A;  3K1N A;  1FBQ A;  4UUS B;  3GTK J;  4QLC U;  4EVI A;  4RB1 A;  1N77 A;  2QQA A;  2IGN A;  2PQ8 A;  4HF2 A;  2BXZ A;  4KYW A;  2NNN A;  3TO7 A;  2O8X A;  1Z0X A;  3K2Z A;  1Z6T A;  2A3S A;  1P4W A;  1MSF C;  3KX2 A;  4JQF A;  2QM3 A;  4RB2 C;  3QRF F;  1U5T A;  3JAM Z;  1MBJ A;  3RIR A;  2K27 A;  2WY7 Q;  5FLX K;  1J9I A;  3RYP A;  5E3N A;  2E7W A;  2V6E A;  1NH3 A;  2RKH A;  3LOC A;  2XF7 A;  4PGG A;  2K3P A;  3JW4 A;  3H0D A;  3Q5F A;  1S6L A;  1RIO H;  4LMY A;  4AUX A;  1E0E A;  2ME6 A;  3IAS 2;  4D5F A;  4I01 A;  4HST A;  4KJZ A;  3U21 A;  4AVP A;  4F55 A;  2ELJ A;  2OZ6 A;  4A0Z A;  3Q0W A;  5L3E A;  5EZH A;  2VBY A;  2EFW A;  3ML6 A;  1QPI A;  3HJE A;  4MLO A;  2A6H F;  1T56 A;  1NG6 A;  3IH2 A;  2BXY A;  1ZRC A;  2BZT A;  4A3F J;  1LFP A;  3F8F A;  3WE2 A;  1ZG3 A;  2A05 A;  3IHU A;  2W82 A;  2DA3 A;  2TRT A;  4OOI A;  4J01 A;  4CDG A;  4ZYH A;  1O3S A;  3LL7 A;  4C9Y A;  4LK0 F;  5IPA A;  3E0J B;  4HF0 A;  2D1H A;  4C2U A;  5IY5 H;  3FIW A;  2JA6 J;  2H6B A;  3F22 A;  1BI2 A;  5JVT A;  4UY8 I;  3FHN A;  4LG0 B;  1H8A C;  3H9G A;  2XUB A;  4IJA A;  4BQA A;  4XRS G;  2COM A;  4X1E A;  3KPH A;  3KLO A;  4A3L J;  4A0Y A;  4IL6 C;  1OKR A;  3HHG A;  5C44 J;  1QHG A;  2K9M A;  2HYG D;  2K85 A;  2M30 A;  2XB5 A;  1DU6 A;  1EF4 A;  5HLI A;  3JCU C;  1XG1 A;  3WGH A;  1OCT C;  1P4X A;  2JJ7 A;  5K7Z A;  1Z3Y A;  3M4O J;  3C2G A;  4ESJ A;  1HKS A;  3GTQ J;  3H1C A;  3JTG A;  3ZCO A;  2QLZ A;  3JSP A;  1IV6 A;  1LE8 A;  3TMO A;  1QGP A;  4XKC A;  4ZZD A;  3ULQ B;  3MKZ A;  3ABM H;  3AG4 H;  5ED4 A;  4K2E A;  2K40 A;  3PSF A;  3S1N J;  1K4S A;  4KIS A;  1I1S A;  3CC2 I;  2HEO A;  2PJR A;  2TDX A;  1I6H J;  4G6T B;  4M72 A;  3KP5 A;  4G12 A;  4ENJ A;  4WCG A;  2XGD A;  4HW0 A;  4DOZ A;  1N75 A;  4XQF A;  1IF1 A;  3A03 A;  3TOA A;  2KLO A;  4UNO A;  4UUT A;  1AWC A;  2CQN A;  3PIO F;  2EZL A;  5IOZ A;  1W36 C;  3OYK A;  1XDU A;  2Q2E A;  3W6K B;  3OMY A;  2VOD A;  1X3W B;  1YW8 A;  4N0B A;  2L5Q A;  2R3S A;  4P1W A;  3O6B B;  2E2H J;  1VQO I;  4A3G J;  2K9N A;  2DT6 A;  1RUN A;  3GLL A;  2QUF A;  2VKD A;  1BM9 A;  1BR2 A;  2MC3 A;  3ZXS A;  2E2J J;  2BOL A;  1T39 A;  1A31 A;  3KEQ A;  2RVC A;  2QEN A;  2ESH A;  5LEJ A;  4P9U A;  5ICE A;  4M3D A;  2R5Z B;  2RNJ A;  1RKW A;  1IRX A;  3HYI A;  3ZQQ A;  5D5X B;  3PNV A;  4A3K J;  3ZN1 A;  1IDZ A;  3BQZ A;  1IG7 A;  5L3B A;  3GFI A;  1IN7 A;  4IXA A;  2DA1 A;  4RB3 C;  2XIG A;  2XKO A;  2VLA A;  4C30 A;  3HTS B;  1OR7 C;  4MTD A;  3K69 A;  3IL2 A;  1UHM A;  1RZ4 A;  5CVU A;  1W5S A;  3GFM A;  2P5V A;  1X2M A;  3I54 A;  1ZAO A;  3E7L A;  1G3Y A;  4L9N A;  2HZD A;  1Y6I A;  4I09 A;  3MEX A;  5HOD A;  1FMV A;  5AIP A;  4Y15 A;  3OYH A;  3DCF A;  1MDM A;  1K78 B;  3AFH A;  2DA4 A;  3E6B A;  3HUG A;  2AHQ A;  1B9M A;  3QYB A;  4OIQ F;  1R5G A;  4XON A;  3RCO A;  5IYC J;  1IAW A;  4XLP F;  1TQP A;  5M5X J;  4M73 A;  4B1R A;  3PNY A;  4L9J A;  1FOX A;  3VOE A;  2E60 A;  5EG0 B;  2IBD A;  1VQN I;  1IRG A;  3V7S A;  2QSH X;  1BIA A;  3LFK A;  1BI3 A;  2DN0 A;  3QU6 A;  4AWX B;  4M74 A;  2OBP A;  2HQA A;  3N05 A;  4JX6 A;  1OCC H;  1U78 A;  1S7O A;  1RPW A;  4CIC A;  5TGT A;  4JP0 A;  4ENN A;  2A5W A;  5L3G A;  3BP8 A;  1IGN A;  3BDD A;  4B43 A;  3PO3 J;  3SEZ A;  4A5M A;  2ZB9 A;  2HVQ A;  2PMH A;  2GM4 A;  2OA4 A;  3PFI A;  1QA6 A;  3EYY A;  4MIM A;  1ZRD A;  3NRV A;  1J59 A;  3V4G A;  4IVN A;  2H1L A;  2FUG 2;  2ZSH B;  2L01 A;  2MH9 A;  5KCM A;  5B5E C;  1YJN I;  1SAU A;  2GA1 A;  1SD6 A;  2VB6 A;  2K4B A;  4HSR A;  2NOG A;  4HRI A;  4CXF A;  1YW7 A;  3KZI C;  2O6G E;  1DP3 A;  1MBE A;  2VAS A;  1W7P A;  1YHQ I;  2IT0 A;  3VYR B;  3JSO A;  4IF4 A;  1A36 A;  4ZC3 A;  3GYH X;  3SZG A;  3LNQ A;  1WQ2 A;  5LFA A;  2B7E A;  1SVM A;  2DDA A;  4HX4 A;  4BHB A;  5L3D A;  3PFY A;  1BOB A;  2IA2 A;  2M1B A;  2XVC A;  3BZC A;  3DTE A;  2CFO A;  2F5D A;  3TW6 A;  2FX0 A;  4BHP A;  4AIH A;  4ASN A;  4Z6Y A;  2CV1 A;  4PUS A;  5LRS A;  1BR4 A;  4E7L A;  1YI2 I;  5DCM A;  4HNU A;  3AG1 H;  1D1C A;  4CCM A;  3ZN0 A;  2XSD C;  3DU5 A;  3ZQ7 A;  3GW2 A;  1YFH A;  5LHI A;  1D0Z A;  1VZ0 A;  1JJ6 C;  5GTI C;  4LG3 A;  2ID6 A;  1WFX A;  1R1V A;  3AG2 H;  3K1P A;  4XKW A;  4EAT A;  2GOM A;  2HTS A;  1TWC J;  1A5J A;  3W2A A;  3VSL A;  4UXN A;  5K1Y A;  2Q1Z B;  3I59 A;  4PJJ A;  2VOP A;  1I5Z A;  1MMG A;  1AA7 A;  3P7N A;  1OCP A;  2JZY A;  2JA8 J;  2EQR A;  1G3S A;  2R7R A;  4OIO F;  2MLG A;  3BR3 A;  4RDU A;  2JA2 A;  3FX3 A;  2R7V A;  3LAJ A;  3OV8 A;  1NHA A;  1SFX A;  2PN6 A;  1Z77 A;  3CO7 C;  2K4J A;  3PSI A;  3GTL J;  2YX4 A;  2WV0 A;  2Y0M A;  1OQY A;  2K02 A;  2HI3 A;  3LWF A;  4HZF A;  2OCC H;  3LQQ A;  4II3 A;  4BY7 J;  3E6C C;  2JN6 A;  2H1K A;  1Y8R B;  2KFD A;  3QWL A;  1FX7 A;  3IWF A;  2BVM A;  1RC9 A;  2GXB A;  2HTJ A;  3LA7 A;  3CCM I;  4KN7 X;  2DFI A;  4L0Y B;  4BHC A;  5FRO A;  3AL0 B;  2Y9Z A;  4A12 A;  1F36 A;  3ZMU A;  1RI7 A;  1I39 A;  3QQA A;  2MC4 A;  1VI0 A;  3O8H A;  4I0A A;  1G4D A;  4EEF G;  3ZMZ A;  3DKX A;  4S0H B;  3MD2 A;  1QNT A;  1WWX A;  2O8K A;  3X2Q H;  3COA C;  1IN6 A;  3E97 A;  1HKT A;  1SVO A;  4HYE A;  3C7J A;  2EFO A;  3S16 J;  3K4M A;  3R0A A;  4D9J A;  3ELK A;  3FXJ A;  5J8C A;  4JK1 X;  3DV8 A;  5TIS C;  3GUD A;  3WTW C;  2HKX A;  2Z16 A;  4EMS A;  3W2W A;  1UAA A;  5JI6 A;  5DDG A;  4IQJ A;  2ZSI B;  5IYB J;  3NQO A;  2W7N A;  2VUM J;  2OJE D;  1YS7 A;  2PFB A;  5BNG A;  4FCY A;  2DT7 B;  1YJ9 I;  1XS9 A;  2R7F A;  4RAY A;  3CME I;  1IUF A;  2V9K A;  4L5I A;  2JPC A;  3OYL A;  3S3O A;  3GFL A;  1HW2 A;  3RKY A;  3F23 A;  1JUS A;  3OR1 C;  3S93 A;  3LSK A;  3MZ8 A;  2OV7 A;  3K4C A;  1JT0 A;  2LBF B;  1TW3 A;  2HOA A;  2LMD A;  2V1U A;  3BR6 A;  4AYB N;  1IXC A;  4BXX J;  4PSW A;  2EZH A;  1K83 J;  5D4R A;  4FQG A;  4D7M A;  5C3E J;  4DYR A;  1KQ0 A;  4RGX A;  4N4O B;  2KJC A;  1SEU A;  3PIP F;  2OD5 A;  2YS9 A;  2XAF A;  2RV8 A;  1MJB A;  4II2 A;  5CVR A;  5M3F J;  5F1J A;  4YEL A;  3L09 A;  1KQ8 A;  3NWS A;  4X6A J;  1PJR A;  3OIO A;  4I76 A;  1FWZ A;  5IP9 J;  2MAB A;  2XAU A;  5CPR B;  5H6R A;  5KAI C;  3OS0 A;  4AYB A;  3IKT A;  3VYS B;  3RZD J;  3ZOB A;  5EDN A;  3V8L A;  1B4A A;  2LG4 A;  3MZY A;  1D8K A;  5GAD J;  1E3P A;  1Y0U A;  2KT0 A;  3CF2 A;  1P4A A;  1VQK I;  1TQM A;  1SMT A;  1ERD A;  3HRM A;  1WZ2 A;  3WHB A;  1T95 A;  2WB1 N;  3ZRG A;  2F5E A;  4YG2 F;  3S17 J;  2MFZ A;  2FMY A;  2V7F A;  4PCQ A;  4C3J J;  3PO2 J;  4MQV A;  5HDN A;  2IP2 A;  3FK6 A;  3BG3 A;  1TZL A;  1TLH B;  4OAY A;  3SYT A;  2CGP A;  2DPU A;  1RR8 C;  3I53 A;  1T08 B;  1K6O A;  4PZJ A;  1VQ9 I;  2ELK A;  2HZT A;  1FJL A;  3BRO A;  5HLT A;  3H36 A;  3R4K A;  4HAM A;  1D8J A;  1QZY A;  1JHH A;  2ZBK A;  4UHT A;  4HV5 A;  1P9Q C;  3H9J A;  1U8B A;  4RAF A;  1PYV A;  1R6R A;  3T8T A;  4M6X A;  3RI4 A;  2WB1 A;  1S72 I;  3F21 A;  4EM2 A;  1BI1 A;  2NAZ A;  2CSO A;  2K9Q A;  5AIQ A;  3EDP A;  3OL4 A;  1B72 B;  1R1T A;  2OTL I;  1YQA A;  4ZYD A;  5LGT A;  2ZME A;  3G2B A;  1WH7 A;  1YRN B;  2VBZ A;  2ZJ2 A;  1XTA A;  1MNE A;  4NBQ A;  4Y3O A;  4IRG A;  4XID A;  2EV5 A;  1IC8 A;  1MBG A;  3VWB A;  5HNF A;  3DTK A;  4PK4 A;  1A04 A;  1YYV A;  4BBR J;  4BAY A;  3HOV J;  1UCR A;  4XRF A;  4HDV A;  1ODD A;  4Y13 A;  1WI9 A;  1Z1D A;  1LDJ A;  2CMP A;  3MFK A;  2D2W A;  4NUB A;  4RA2 A;  1DDN A;  1KZH A;  1WGX A;  1FOW A;  2KIS A;  5FKM A;  2DA7 A;  3BJO A;  3WG7 H;  2GAU A;  4P96 A;  1FTZ A;  1UJ8 A;  3S2W A;  2VJJ A;  3HRU A;  1Y8Q B;  2LD5 A;  5H6Q A;  2ICW G;  3A02 A;  2QSG X;  2Q8K A;  1F1Z A;  1ZRE A;  3WU0 A;  2OZU A;  5D5U B;  2E1M B;  4G6Q A;  4OIP F;  2BBY A;  3M9A A;  4BBS J;  5L3F A;  3A01 B;  3FXQ A;  4BE0 A;  2E2I J;  2MD5 A;  3R6S A;  4YRV A;  1MJA A;  1Z7L A;  4GRI A;  4Q47 A;  5EEA A;  1OR7 A;  1V3F A;  2EIL H;  3QU3 A;  1ON1 A;  2VOO A;  2C6Y A;  2DJI A;  4A3B J;  2R5Y A;  1POG A;  1U5T B;  4A3E J;  2W00 A;  4F52 A;  2L7Z A;  2M4K A;  1KU7 A;  2WTE A;  2UXX A;  3JRD A;  1UB9 A;  3OYJ A;  5CYV A;  1Z3X A;  1PDN C;  1T0F C;  3CDI A;  2F2E A;  2CUJ A;  2WA0 A;  1QBJ A;  2I10 A;  2ZKZ A;  5K7H A;  2LNB A;  4BU2 A;  1SFK A;  1KGS A;  1R23 A;  2IPQ X;  4E7K A;  2QSF X;  3GCM A;  4KDP A;  1ZAR A;  1B8I A;  5HS8 A;  2UWM A;  1H89 C;  1FZP B;  2LDU A;  2FF4 A;  2MSY A;  2A69 F;  1XMX A;  2ETH A;  2KIU A;  2MBF A;  3TKY A;  5K7F A;  1FSH A;  1T8I A;  1J5Y A;  1BA5 A;  2DTR A;  2HKO A;  2EIN H;  1TP4 A;  2IA0 A;  1YE9 A;  4R79 A;  3IRQ A;  1GUU A;  3QYF A;  4LIV A;  3U1K A;  3H3V K;  2P6S A;  1HBX G;  1PP8 F;  3F8N A;  4HEA 2;  2JSC A;  2VC0 A;  5TJJ A;  5HOO A;  2JA7 J;  4E4H A;  1VQ4 I;  2ZXW H;  4IHX A;  3K6G A;  6PAX A;  3MMY B;  5E17 F;  1XDS A;  3WTS C;  1CGP A;  1Z67 A;  3TDU C;  4LFU A;  4CYC B;  1ENH A;  2XHK A;  1KYZ A;  4YEJ A;  2PJP A;  2LRE A;  3HOX J;  4DW6 A;  3MWM A;  5BPD A;  2DFE A;  1V5F A;  3S2H J;  2Y75 A;  2HS5 A;  1ZTR A;  3FHZ A;  5FLM J;  5BOX A;  1ZHF A;  5E8G A;  3RKX A;  1E3H A;  2EV0 A;  3CUQ C;  4XRS A;  2PLY A;  5DEQ A;  1ZQ3 P;  4NQW A;  2HR3 A;  4HQE A;  2L9V A;  2HVS A;  2KRF A;  3A0B C;  1ZH5 A;  2M0C A;  4BKX A;  3GX4 X;  3GF2 A;  2A6T A; 
#chains in the Genus database with same CATH homology
 2K9N A;  2DA2 A;  2ME0 A;  1FIA A;  2E2J J;  4MO7 A;  3HKZ N;  3MVP A;  1JKP C;  2DJN A;  1WPK A;  2WV1 A;  3OSG A;  3JR9 A;  4DZP A;  3HGY A;  4M3D A;  2R5Z B;  3BR2 A;  1RKW A;  1AKH A;  4A3K J;  1IDZ A;  3BQZ A;  3ZQL A;  1ETK A;  1IG7 A;  1SAN A;  2DA1 A;  5J1U A;  5F0F A;  3CCY A;  3GTM J;  1S7E A;  3GBG A;  5J3L A;  3FK7 A;  2HXI A;  1MSE C;  4D7N A;  4Y52 J;  3HM5 A;  3JRG A;  3JRA A;  2NS8 A;  1X2M A;  3E7L A;  3B6A A;  4W97 A;  1WI3 A;  2E1O A;  4XIC A;  3JRB A;  2DMP A;  5HOD A;  1SFO J;  4C2M J;  1FEX A;  2HDD A;  2CUF A;  3DCF A;  3UKG A;  2X9D A;  5EGO A;  5F27 A;  2DA4 A;  3MN2 A;  2AHQ A;  1H88 C;  1LFB A;  2E19 A;  5IYC J;  1BL0 A;  3C2B A;  1WH5 A;  5M5X J;  1TWF J;  1HLV A;  1AKH B;  4B1R A;  2O9L A;  5M5Y J;  2EH3 A;  2CRG A;  3BR5 A;  3W6V A;  5F0H A;  5EG0 B;  3F0C A;  5FKK A;  2IBD A;  1X58 A;  3SFI A;  1GV5 A;  5EYR A;  1Q1V A;  1TWA J;  3ZQF A;  3H0G J;  2DN0 A;  5FKN A;  4Y7N J;  4M3B A;  1U78 A;  4JX6 A;  3NAU A;  1JJ8 C;  1NTC A;  1RPW A;  5F08 A;  2R7Z J;  3SDG A;  4B3A A;  4JP0 A;  3HOZ J;  3BR1 A;  2CQQ A;  5E3O A;  1IGN A;  1P7I A;  3PO3 J;  4DZJ A;  1ETX A;  2DA5 A;  2IAI A;  1GV2 A;  1MBH A;  2OPT A;  2ZB9 A;  5DTD A;  3ZQG A;  2GM4 A;  2CQX A;  5EZG A;  1WCM J;  3GTJ J;  2QF7 A;  4MIM A;  1DU0 A;  4MFD A;  3JRC A;  3I4M J;  3HEF A;  4A3I J;  5JLW A;  3TP0 A;  2Y2Z A;  4NDL A;  1ZK8 A;  2LY9 A;  2LK2 A;  3CQZ J;  4DYQ A;  2NVQ J;  3BR0 A;  2NOG A;  3CDL A;  2M2E A;  3BTL A;  3IV5 A;  1MBE A;  2DMU A;  3K2A A;  3LNQ A;  1W0U A;  3RQI A;  2XPU A;  4M6V A;  3HOU J;  4IHV A;  2K9S A;  3BG5 A;  5IP6 A;  5GPC A;  3K7A J;  3FKI J;  3QPL A;  3M3Y J;  1ETO A;  1OJL A;  1RES A;  3S1R J;  3TW6 A;  4L5E A;  2FX0 A;  5IOY A;  5FJ8 J;  1HDD C;  1YRN A;  3LSG A;  1U9O A;  3B6C A;  3FIS A;  5M3M J;  3JRH A;  1ZGW A;  2RAE A;  2XSD C;  4IHW A;  3MKL A;  2EZK A;  2JA5 J;  3IH4 A;  4A3C J;  2XPW A;  1JJ6 C;  2DTZ A;  2ID6 A;  2M9H A;  2VKV A;  1LE8 B;  1TC3 C;  1TWC J;  1A5J A;  1VF9 A;  1MNM C;  2KDZ A;  2COB A;  1IRZ A;  1X2N A;  4HNV A;  3ZQC A;  1ORK A;  4FIS A;  1IDY A;  2JK3 A;  5C4X J;  3JRI A;  1OCP A;  2JA8 J;  2CJJ A;  4W1U A;  2EQR A;  4M3E A;  1HCR A;  4IHY A;  2M34 A;  1JT6 A;  2X6O A;  3ZQI A;  1Y1V J;  3BR3 A;  4RDU A;  5E3M A;  2WAQ N;  2QCO A;  3HB9 A;  4QTR A;  9ANT A;  1VFC A;  1Z77 A;  3S14 J;  1JTX A;  2R0Q C;  3GTL J;  2VI6 A;  3GTG J;  1ZR4 A;  4I6Z A;  2LR8 A;  2HI3 A;  5DS9 A;  5GP9 A;  4BY7 J;  3HDD A;  2JN6 A;  3LSR A;  2H1K A;  1APL C;  2L9R A;  2GLO A;  4A3M J;  2Y9Z A;  2NVX J;  1F36 A;  2CUE A;  2L7M P;  5C4J J;  1QVU A;  1MH4 A;  5F04 A;  2H8R A;  3OSF A;  1HDP A;  1I50 J;  3QQA A;  1VI0 A;  3O8H A;  2VKE A;  4EEF G;  3VPR A;  3RKQ A;  3RZO J;  1ETW A;  1O4X A;  4S0H B;  1FIP A;  5FKL A;  2MG4 A;  2AO9 A;  2O8K A;  2N8G A;  2YUS A;  1ZKG A;  4BY1 J;  5F0C A;  4FE7 A;  1JKQ C;  3GTO J;  2LTP A;  3S16 J;  3DEW A;  5J1Y A;  3GTP J;  3Q0U A;  4QIW N;  1PUF A;  1BJZ A;  2LLK A;  5IYB J;  2VUM J;  1HOM A;  2LVS A;  3S2D J;  2FD5 A;  4V2F A;  3HGG A;  4DYC A;  2DMQ A;  5BNG A;  4FCY A;  1XS9 A;  3BG9 A;  1IUF A;  5EGO B;  1JGG A;  2NS7 A;  3BQY A;  1JUS A;  4CYC A;  2NVT J;  2Y9Y A;  4J19 A;  1OFC X;  2ECC A;  1JT0 A;  3TP3 A;  1E3O C;  3LSP A;  2HOA A;  1K61 A;  3BR6 A;  4AYB N;  1AU7 A;  2Y0S N;  1ETV A;  1A6I A;  4BXX J;  5J1R A;  3S1M J;  3JRF A;  4FTH A;  4AC0 A;  1ITY A;  1NK2 P;  2EZH A;  1K83 J;  1QRY A;  4D7M A;  1MH3 A;  4B4C A;  5C3E J;  4DYR A;  5E3L A;  1G2H A;  1RET A;  3HOW J;  3BTI A;  1AHD P;  1BW5 A;  2HOT A;  2L0K A;  4A3D J;  2YS9 A;  5M3F J;  2XGE A;  2B63 J;  5F1J A;  1PUF B;  4X6A J;  1LFU P;  3S1Q J;  1B72 A;  3OIO A;  4I76 A;  5IP9 J;  2XPV A;  4UUS A;  1VND A;  3RZD J;  3ZQH A;  2VPR A;  3ZOB A;  5EDN A;  1GDT A;  2DA6 A;  3JRE A;  5IP7 J;  3HBL A;  3TW7 A;  4JX4 A;  4XRM A;  4RBO A;  2HXO A;  2KT0 A;  3BTJ A;  1CQT A;  1ETQ A;  3O8G A;  1HF0 A;  4JYK A;  2PMZ N;  3WHB A;  2WB1 N;  3PO2 J;  3S17 J;  4C3J J;  3BTC A;  4M3G A;  3FK6 A;  3BG3 A;  2LP0 A;  2CU7 A;  3G1L A;  1RKT A;  1TWH J;  2ELK A;  1FJL A;  2G0E A;  2ID3 A;  1JKR C;  4IEJ A;  5GPA A;  2L7F P;  1TWG J;  3CMY A;  5FKO A;  3QPS A;  1FTT A;  1QVT A;  2XGC A;  1U8B A;  1W0T A;  2NVY J;  1R9T J;  4V2G A;  4A3J J;  5JLX A;  1D5Y A;  3A01 A;  2XRL A;  3OOU A;  2HOS A;  2K9Q A;  3BT9 A;  3G1O A;  1B72 B;  4UUS B;  1WH7 A;  3GTK J;  1YRN B;  4A93 J;  1IC8 A;  4XID A;  4C3H J;  4C3I J;  1MBG A;  1Z0X A;  1JTY A;  4BBR J;  4D5C A;  5EG0 A;  1MSF C;  3HOV J;  1T33 A;  1Y1W J;  1XC5 A;  1MBJ A;  1UMQ A;  3Q0V A;  2R92 J;  5E3N A;  1WGX A;  4QSH A;  5FKM A;  2DA7 A;  3LOC A;  2EBI A;  1FTZ A;  1MBF A;  2OF7 A;  4AUX A;  3G1M A;  2ME6 A;  3SJM A;  2LD5 A;  3A02 A;  4D5F A;  4MFE A;  5EF6 A;  1F43 A;  4FE4 A;  2M8G X;  2YU9 J;  4ABZ A;  3L1P A;  3Q0W A;  4LOC A;  5EZH A;  3NAR A;  4BBS J;  3PM1 A;  1QPI A;  1UG2 A;  3A01 B;  4MLO A;  3LSJ A;  3IH2 A;  1T56 A;  4A3F J;  2E2I J;  5EEA A;  1RR7 A;  2FQ4 A;  3S15 J;  1U9N A;  5M5W J;  2DA3 A;  2TRT A;  4JX5 A;  2P81 A;  4A3B J;  2R5Y A;  2MW8 A;  5IPA A;  1POG A;  4A3E J;  2L7Z A;  3WHC A;  3FIW A;  1NK3 P;  2IEK A;  2JA6 J;  2MGQ A;  3JRD A;  2X48 A;  1JUM A;  3I4N J;  1H8A C;  2I10 A;  5K7H A;  2R93 J;  4XRS G;  4X1E A;  2HYJ A;  2DMT A;  4A3L J;  1B8I A;  1MBK A;  2JMW A;  5C44 J;  1H89 C;  2MSY A;  1DU6 A;  2XB5 A;  1EF4 A;  5FLV A;  5K7F A;  2Y31 A;  1XG1 A;  1BA5 A;  1OCT C;  2D5V A;  2JJ7 A;  1I3Q J;  5K7Z A;  2FJ1 A;  3M4O J;  3GTQ J;  2ECB A;  1IV6 A;  1LE8 A;  1GUU A;  1UHS A;  1P7J A;  3H3V K;  1JKO C;  1IJW C;  3D1N I;  1JUP A;  2W48 A;  2JA7 J;  2R5Z A;  2K40 A;  3S1N J;  4IHX A;  2R5Y B;  1ZR2 A;  3Q3S A;  2TCT A;  3HOY J;  2Y30 A;  1I6H J;  4CYC B;  1ENH A;  4G12 A;  2XGD A;  3A03 A;  3HOX J;  4DW6 A;  4A69 C;  2JWT A;  4GFB A;  3S2H J;  4UUT A;  1GT0 C;  1ZTR A;  2EZL A;  5IOZ A;  2DMN A;  5FLM J;  1B8I B;  4M3F A;  5IYD J;  1GVD A;  3IH3 A;  2O7O A;  4XRS A;  2HQ5 A;  2GBY A;  1ZQ3 P;  1BW6 A;  3TED A;  2LFB A;  2LKX A;  1ETY A;  2XB0 X;  4XK4 A;  2EZI A;  2M0C A;  4BKX A;  2E2H J;  4A3G J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...