2CUEA

Solution structure of the homeobox domain of the human paired box protein pax-6
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
GSSGSSGQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Paired box protein Pax6
publication title Solution structure of the homeobox domain of the human paired box protein Pax-6
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 19
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2cueA01
2P81A 3S1NJ 4QSHA 2GLOA 2XB0X 4BBRJ 1MBHA 1LFBA 3GTKJ 1Y1VJ 2CUFA 2E2HJ 1ZQ3P 2YU9J 3JRCA 5EZHA 1NTCA 2NVYJ 2JMWA 3UKGA 3OSFA 1NK2P 3VPRA 3ZQIA 4A3CJ 3LSRA 1JJ6C 3Q0WA 4RDUA 3L1PA 2TCTA 3RKQA 4MFDA 2R0QC 2R5YA 1AHDP 3JREA 1JTXA 2H8RA 2MGQA 1OFCX 4ABZA 2ME6A 3BQZA 3O8HA 4JX4A 4B1RA 3O8GA 1QPIA 4V2GA 2NS8A 1JKPC 3G1LA 2GM4A 2COBA 3D1NI 5F08A 2R5ZA 2MG4A 4FE7A 4XK4A 1K83J 5IYDJ 3MKLA 1JUMA 2HOAA 4MLOA 1MSFC 4D5CA 3HKZN 3NAUA 3LSPA 2E1OA 4A3KJ 4X6AJ 2VKEA 4JX6A 1JT0A 5F1JA 1HLVA 2DMQA 1O4XA 1MH3A 2DA4A 5E3OA 5IOZA 2IAIA 4A93J 1ETWA 2CRGA 1S7EA 1BJZA 1I6HJ 5FLMJ 2EBIA 4FE4A 1NK3P 2NS7A 1IG7A 4B4CA 4CYCA 2L7ZA 1H88C 1A5JA 5IYBJ 1B72B 4UUSA 2HI3A 1BL0A 2KDZA 2DA1A 3ZOBA 1XS9A 1JJ8C 2MW8A 2XPWA 2R93J 5EGOA 1TC3C 3HB9A 1ZKGA 1JKQC 4IHVA 1RETA 2L7FP 3S2DJ 2R92J 1ZGWA 5J1UA 2JN6A 3HDDA 1HDPA 3GTMJ 2AHQA 4D7NA 3A03A 3GTLJ 5K7ZA 2LFBA 1U9NA 2L0KA 1ETKA 2DA7A 3S1QJ 2AO9A 5M3MJ 1HCRA 1YRNA 1AU7A 5C4XJ 1FTTA 5F0HA 2KT0A 4JX5A 3TW7A 4A3BJ 4Y52J 5FKOA 1Q1VA 4Y7NJ 2XSDC 3Q3SA 2Y0SN 2K40A 2JA7J 3HOWJ 2EZLA 4B3AA 2EZKA 5DTDA 1X2MA 3M3YJ 3MVPA 3TP3A 1WH5A 5F27A 5GP9A 4C3JJ 3OIOA 3HOXJ 2X6OA 1A6IA 1XC5A 2LLKA 3CDLA 3MN2A 4X1EA 4M6VA 4UUTA 4FTHA 3OOUA 1VI0A 1U78A 4M3DA 4J19A 1B8IB 3TP0A 4A3MJ 3W6VA 1MBEA 2EH3A 1UMQA 5FKNA 4XRSG 3ZQFA 2LR8A 3BTIA 4D7MA 2NVXJ 3JR9A 1GT0C 1ITYA 1WH7A 5C4JJ 2LP0A 2FD5A 2ME0A 3RQIA 3F0CA 2QCOA 2ECBA 4BY7J 2CU7A 1VNDA 2DMPA 3CCYA 1CQTA 1JT6A 2NOGA 3GBGA 1YRNB 2LY9A 1ZTRA 1GV5A 5FLVA 5IP7J 4JP0A 1SANA 4A69C 2I10A 3TW6A 4G12A 1B72A 2XB5A 4D5FA 5M3FJ 2XGEA 3A02A 2D5VA 5IYCJ 2HOTA 1MBFA 3QQAA 1EF4A 3NARA 5IP9J 2ID6A 3FIWA 2EQRA 3WHCA 2CQXA 4RBOA 3IH4A 5GPCA 5M5YJ 3BR3A 4MO7A 3BTCA 1P7JA 1RKWA 2XGDA 3HOZJ 2HDDA 2E2IJ 5IPAA 2K9NA 1F36A 3SDGA 3TEDA 1WGXA 2DMNA 1IGNA 4GFBA 5J1RA 5EF6A 2JA5J 2HYJA 1RESA 5IP6A 1UHSA 2Y9YA 3ZQGA 5FJ8J 2DA3A 1IC8A 1ZR4A 4M3FA 3GTQJ 2ECCA 2Y2ZA 4FCYA 1ETVA 3JRIA 2O9LA 1TWAJ 1D5YA 5BNGA 2L9RA 4M3EA 4A3LJ 2WAQN 1ENHA 1U9OA 4BBSJ 2JA8J 1JUSA 3FKIJ 5M5WJ 2EZHA 2L7MP 1QVUA 4C3HJ 1K61A 3GTOJ 3HOUJ 2E19A 3G1OA 1WPKA 2FQ4A 1B8IA 3HM5A 1LE8B 2M0CA 4A3FJ 1G2HA 3H0GJ 1OCTC 3SJMA 4JYKA 3LNQA 4DYRA 3HOVJ 3S1MJ 3A01A 3IH3A 3C2BA 4I6ZA 4V2FA 2DN0A 1X2NA 2DTZA 1TWFJ 1FJLA 1FIAA 1IJWC 1MBJA 3FISA 1PUFB 2M9HA 5FKLA 4A3EJ 5E3LA 1W0TA 3BTJA 4I76A 2VKVA 3RZOJ 1F43A 3S1RJ 3GTGJ 2JJ7A 1ORKA 2NVTJ 3H3VK 1DU6A 3JRFA 1RPWA 2W48A 3CMYA 1JKOC 3FK6A 3S15J 1IRZA 4EEFG 1T33A 3BR6A 5EYRA 1APLC 5EEAA 1WCMJ 1T56A 2FJ1A 3BT9A 1TWGJ 2K9SA 4XIDA 3LOCA 2E2JJ 2H1KA 1IDZA 5F0CA 2RAEA 2B63J 2VUMJ 2GBYA 3S17J 4NDLA 1OJLA 1QVTA 1JUPA 2HOSA 4QTRA 3Q0UA 4A3IJ 1E3OC 4L5EA 1XG1A 2IBDA 4FISA 3A01B 2IEKA 4QIWN 1R9TJ 5J3LA 2LVSA 1OCPA 2WV1A 2CUEA 5K7FA 3BTLA 2VPRA 1MBKA 3DEWA 2LKXA 1JGGA 3GTPJ 3CQZJ 1ZR2A 2EZIA 4IHYA 2YS9A 2PMZN 2M8GX 3QPLA 5JLWA 3QPSA 2JA6J 2FX0A 5C3EJ 5F0FA 2M2EA 3M4OJ 1LE8A 5F04A 1H89C 1UG2A 2ID3A 2M34A 1FEXA 3PM1A 1ETOA 2HQ5A 3Q0VA 3WHBA 1DU0A 1RKTA 4DZPA 1VF9A 3LSGA 1AKHB 3E7LA 1QRYA 3BR5A 3S2HJ 3SFIA 4M3GA 2TRTA 5EG0B 5HODA 2DJNA 1PUFA 1IUFA 1SFOJ 1JKRC 1GV2A 1MNMC 4AYBN 2DMUA 2DA6A 3ZQHA 1ETYA 3BG3A 4XICA 4BXXJ 2OF7A 2HXIA 2X9DA 5K7HA 4MIMA 3B6AA 3IV5A 1I50J 3BG5A 4DW6A 2XRLA 2QF7A 3I4MJ 4IHXA 1I3QJ 2CQQA 4HNVA 4A3DJ 5FKMA 4DYQA 4A3GJ 3HOYJ 2R7ZJ 3BQYA 1GDTA 4XRMA 5FKKA 5E3MA 1TWHJ 2O7OA 5E3NA 1ETQA 3G1MA 4DYCA 2G0EA 4AC0A 2LK2A 3BR0A 2XGCA 2K9QA 3K7AJ 9ANTA 5EZGA 1GVDA 3BG9A 1H8AC 3JRHA 3PO2J 1RR7A 4W97A 2XPUA 2YUSA 3BR2A 5IOYA 4IEJA 3PO3J 2DA2A 1BW5A 4C3IJ 3HGGA 2R5YB 1ETXA 3ZQCA 4IHWA 4BY1J 3S14J 1HF0A 1WI3A 2OPTA 4A3JJ 1IV6A 4S0HB 2JK3A 1Z0XA 5C44J 1Z77A 3FK7A 3DCFA 3GTJJ 2Y9ZA 1TWCJ 5J1YA 3S16J 1POGA 2DMTA 1FTZA 3OSGA 4AUXA 2MSYA 2R5ZB 1AKHA 2LTPA 2O8KA 1X58A 3JRDA 1BW6A 1HDDC 2ZB9A 2NVQJ 4BKXA 5DS9A 2WB1N 4C2MJ 5EG0A 5JLXA 4XRSA 1Y1WJ 3JRAA 3JRGA 2X48A 4DZJA 3ZQLA 5M5XJ 1P7IA 3B6CA 2Y31A 2CJJA 1IDYA 3LSJA 1MH4A 2ELKA 1U8BA 4LOCA 1BA5A 1GUUA 4W1UA 2N8GA 2DA5A 2JWTA 1ZK8A 2VI6A 5EDNA 3IH2A 4CYCB 4UUSB 2Y30A 2XPVA 5GPAA 3RZDJ 1VFCA 3K2AA 5EGOB 4MFEA 1FIPA 1JTYA 2LD5A 1MSEC 3HBLA 4M3BA 3HEFA 3JRBA 2HXOA 1MBGA 3I4NJ 1W0UA 3HGYA 1HOMA 3BR1A 1LFUP
chains in the Genus database with same CATH superfamily
1ZELA 1R23A 2AQFA 4QSHA 4UXNA 4ESBA 3LFUA 3RCOA 3HG9A 2M4GA 3DPTA 3GTKJ 2CUFA 2E35A 4IOCF 2FBKA 2W57A 3UKGA 2PEXA 2CH0A 4BACA 1ZLKA 3WG9A 4IRIA 1X19A 3CTAA 3VPRA 3DKWA 4RLFA 2H8WA 4F3QA 1JJ6C 3Q0WA 2PJRA 2W25A 2ZNYA 4PGGA 1HSTA 2NYXA 4MFDA 1SAXA 4BDZA 1T6SA 2A07F 1IZ1A 2L54A 2O5RA 3WU0A 2LDUA 2ME6A 3OYGA 3OR1C 4UVBA 1BIAA 2HWVA 4ANJA 1U2WA 1R00A 1MMAA 1V5EA 1KYWA 4B1RA 1R5HA 1E17A 4Z2YA 2VXZA 2EIKH 3HTSB 3G1LA 4Q4ZF 3CESA 4J00A 5J8FA 2R5ZA 1WJEA 1SFEA 4FE7A 2VJ5A 2O8XA 4FX0A 4XONA 4R8HA 4MLOA 1MSFC 2M5WA 1O3SA 2P5LC 3DQVC 4I98B 4RAGA 3F8FA 1BI1A 1UB9A 2VKEA 4JX6A 1JT0A 5F1JA 1IRGA 2DMQA 3C2HA 2LBFB 3OYBA 4NQWB 4G6QA 3AL0C 5IOZA 3DLLF 2IAIA 2XC7A 1ETWA 2DO7A 2VN2A 5FRMA 3LWFA 5DCFA 3ZRGA 3RKXA 1FOKA 2UV1A 4F93B 1H88C 3J81Z 5DDGA 2HI3A 5CVVA 1TTYA 2KDZA 2DA1A 1XS9A 3ZMZA 3HOSA 1IXCA 4P9UA 2FMYA 4Y4RA 4XKCA 1T8IA 1YE9A 2EFOA 2L7FP 1S9HA 3OS0A 4KMFA 4OIPF 4RAYA 3K4MA 2R92J 1ZGWA 4PZJA 2Q0OA 2RNGA 5HS9A 3PSIA 2DK5A 3GTMJ 1V4RA 3LFKA 1ONVA 4EJWA 3PNTA 3I59B 5K7ZA 2WC2A 2L0KA 1ETKA 2DA7A 2DYRH 2F5FA 4BJTA 3VYSB 2CV1A 2A5WA 2HZDA 4JOMA 1AU7A 3K4KA 5KHDA 2EA4A 3QP6A 4LLLA 1WJAA 4XLAA 4XLFA 1XDUA 2Y0SN 3CMMA 3VEPA 2JA7J 2EZLA 4B3AA 3F8CA 1LNWA 1HSJA 3BZ6A 5KAIC 4HDUA 3ASOH 3VDXA 2Z9OA 3WE2A 1ZH5A 5GP9A 4NUBA 5JVGF 4A6EA 4C3JJ 2VXDA 1PVEA 3OIOA 3HOXJ 5FO5A 2DK8A 4X1EA 4DJAA 1IAWA 1BM9A 1VI0A 3FXRA 3G3ZA 4RA2A 1B8IB 4A3MJ 4U7BA 1EKEA 2VOOA 3FXJA 2EH3A 2LR8A 2E71A 3LAJA 4XRFA 1BOBA 2QEXI 1ITYA 2OCCH 3K9TA 1YIOA 3OMYA 3WTZA 2FD5A 2LBFA 4NQWA 1W5SA 2R7QA 3NWTA 2VJ4A 1X4PA 1FX7A 1VNDA 5CJ9A 1VQPI 5F64A 1CQTA 2NOGA 2JA2A 3HSEA 3RYRA 4OIOF 4UNOA 2DOAA 1GV5A 3R0AA 1NHAA 5E8GA 4CCLA 5LGUA 3UR3C 4XLPF 4PUSA 4XSZF 2H6CA 2I10A 4ZDOA 3M1EA 3A02A 5L3FA 2HOTA 1F5TA 1MBFA 2CW8A 2H94A 3H5AA 2ID6A 3GO5A 4CDGA 3DLAA 3WHCA 3FXLA 2CWEA 3I56I 1PDNC 5M5YJ 3BR3A 4MO7A 1FBSA 3MZYA 4O5VA 3HOZJ 5JI6A 3P9CA 1MD0A 3I59A 1IGNA 3K6GA 3W2VA 5E18F 2QM3A 5ILUA 2LF7A 4BXFA 2HYJA 4OIRF 3HIFA 3J81K 1UHSA 1C0WA 2DA3A 4AIHA 4M3FA 2CGPA 5BS6A 2PFBA 1Z05A 1S6LA 3ABKH 2IA1A 3GFIA 1SMYF 3WG7H 4II3A 1MJAA 5BNGA 3DP7A 1ACIA 2IA0A 5CYVA 4M3EA 1KZHA 4EV0A 1ENHA 3D0SA 2BW3B 2V4JC 3OYFA 2JA8J 2NVUB 4ZDLA 2WAEA 2FA5A 1MMNA 4CZCA 1Y8RB 5M5WJ 3EYYA 3E6MA 3G1OA 3RPUD 1G4DA 4O6JA 2O0YA 4KIFA 1B8IA 1LE8B 4A3FJ 1VQLI 4KN4X 2DPDA 2HR3A 1WI9A 2K02A 3H92A 4L5JA 4LLNA 2OZ6A 4YELA 4IXAA 2FU4A 4I6ZA 2QYOA 2ZXIA 2DN0A 3HYIA 4M74A 4P1WA 2JSCA 1LPQA 2DTZA 2EINH 1IJWC 1JGSA 1W0TA 5E3LA 2JTVA 2DCEA 1E3HA 1ZG3A 1ORKA 2E1MC 2YPRA 3M8FA 4IRHA 2MA3A 2PMUA 2F4OB 3ESWB 3LL7A 4HEA2 4P5OA 4WXDA 3JRFA 2C6YA 1DUXC 3LQRA 3E5XA 2BE5F 4ZZLA 3FMQA 3EETA 2EA2A 3K2ZA 4M9ZA 2IW5A 3OIPA 1B9NA 1T38A 5EYRA 5EEAA 2K85A 3CC2I 1D8KA 2FJ1A 3EYIA 4IHTA 4L5IA 2KP6A 1OCCH 2L9VA 4WF2A 2V1XA 5LHIA 1IDZA 5F0CA 3BROA 2CG4A 2GZWA 4XKVA 2B63J 3KETA 2VC1A 3BCAA 4IJAA 4NDLA 3QPHA 4YFNF 1QVTA 2R7UA 2ADUA 1RIOH 4E4HA 1RNLA 2HOSA 2NAZA 4ZH4F 3CLOA 4L5EA 5E1XA 3KEQA 4KNYA 2IEKA 1FSHA 3GLLA 4M73A 3GXOA 4QIWN 4XLCA 4XOTA 3F21A 2LY1A 3IUOA 2E7XA 1NG6A 1CF7B 1LEAA 4CCOA 2BW3A 2D2WA 3G73A 2NNYA 1KONA 3DEWA 1MBKA 1N25A 1YX3A 2CW0F 1R71A 1AOYA 2BHZA 1X1AA 2DT5A 1H0MA 1IF1A 2LF8A 3M4OJ 1XSXA 2M2EA 1YLFA 3KPHA 1LE8A 1QGPA 1O3RA 1UZCA 2M34A 3DKYA 1SD4A 3ML6A 1DU0A 4P96A 2L02A 4B3XA 4HNUA 3LSGA 1BBYA 3V8LA 4G7HF 1B6AA 4M9SA 4PDKA 3SFIA 4GXOA 4HQMA 3PFYA 3PFIA 4LB5A 4I01A 2XAFA 2DMUA 3ZQHA 4E7HA 2GOXB 2BVLA 5FFXA 3F8MA 1ZRFA 1STZA 4MNUA 1EA3A 3B6AA 3IV5A 2EV0A 3W6KB 2A3SA 2XRLA 2MBFA 4ASNA 1I3QJ 3ZQ7A 3RPQA 4B48A 2CSOA 1N77A 4BUPA 4DYQA 4A3GJ 1KU9A 2R7ZJ 3BQYA 3QPTA 1F9NA 5LGNA 2XKOA 4HYEA 5KNLA 1MMSA 1G3TA 4M9XA 4KICA 4MGRA 3G1MA 2G0EA 2ZSHB 1MJBA 2LK2A 3W6JB 1JI8A 1S5LC 2K9QA 2JVHA 1BI3A 3WTTC 3EUHC 1MGTA 2PQ8A 1PJRA 3BG9A 2DOEA 3PO2J 2AQEA 1U6GA 2IGNA 2WBMA 2OZUA 3BR2A 2V9VA 3CO6C 1YOVB 1Z6RA 2VBXA 2VPLA 1ETXA 3K4NA 3ZQCA 1QZYA 1CF7A 3S14J 3WTUC 2HZTA 1TT5B 1VQOI 4S0HB 3M8JA 3GW2A 2G9WA 3WODF 2R7WA 3FXOA 1OYWA 1T39A 2F48A 3F72A 3DPUA 3FK7A 3DCFA 5H20A 5D5UB 1D0XA 2Y9ZA 3HRTA 2HOEA 2STTA 3CJNA 1TWCJ 3S16J 2DQLA 2EFNA 1OPCA 2HS5A 3IKVA 4HV6A 3K70C 5HLHA 3SDBA 2LRDA 3GFMA 4BDYA 1B4AA 2KMUA 3CUOA 2HPIA 3J7AO 2LOOA 3GLXA 2DBBA 3B6CA 2Y31A 2CJJA 3P7NA 1IDYA 1ZGAA 2A69F 4PSXA 3LSJA 1XB4A 2ELKA 1L3LA 3KP2A 3HXLA 1BA5A 1J5YA 2M4KA 4W1UA 2BV6A 2N8GA 2JWTA 5LFAA 1ZK8A 2O03A 2HDCA 2ZC2A 2VQHA 1SD7A 5LGTA 1SFKA 4UUSB 4EJUA 1MNDA 2XPVA 3AKZA 2EV5A 1FIPA 2XIGA 2R7TA 3X2QH 2LD5A 1MSEC 2UUZA 4M3BA 3HPHA 4G94A 3J7AY 5AONA 3IAM2 4AYBA 3I4NJ 4XL9A 1W0UA 2NNNA 4Y17A 3TOBA 2QQAA 3MWMA 2J5OA 3MFKA 2P81A 2KIUA 4ZZDA 1YJNI 4BBRJ 2E34A 2BXYA 4D1QA 2BY2A 1LFBA 4UV9A 1Y1VJ 3ZP5A 1I1SA 2X6YA 2E2HJ 3BG7A 3KCCA 5EZHA 3KP5A 1NTCA 3M9AA 2JMWA 1DGWY 3WTYC 3OSFA 2Q2EB 3VYTB 3HOTA 2DOFA 5BMZA 4HBLA 5HNFA 3LSRA 4RDUA 2WAQA 3L2QA 2R0QC 3S93A 4UUVA 3JREA 4E7LA 3WTVC 4A2UA 4CGZA 1OFCX 4BGDA 5JHUA 3BQZA 2FMLA 3N97A 2MLGA 4AIDA 4NHJA 3O8GA 1QPIA 4V2GA 3TBIA 2M3AA 2I5UA 3ONQA 1QHHD 5F08A 1W36D 1I5ZA 1G3SA 1WSUA 1K83J 1X3WB 3MKLA 2HOAA 2R7OA 3OYLA 2F4IA 4U0WA 4XKBA 3LSPA 2W7NA 1R58A 3CC4I 2LC2A 2W82A 2XV4S 4HX7A 2XGXA 2F2EA 2LYCA 5K5OA 3WTXC 1FYMA 5ILVA 3K1MA 1OKRA 2P0WA 2B9SA 3OS2A 4CO8A 3MCZA 3GUDA 2NS7A 2W00A 4LLGF 4B4CA 1FMVA 2L7ZA 2OCEA 2XDVA 4UUSA 2XROA 1H9TA 1BL0A 3MQ0A 4S04A 2XPWA 1K7AA 2WB1A 1ZKGA 3V7SA 1XDSA 2VC0A 1SFUA 2BVMA 1LB2A 4G7ZF 1ZHFA 5J1UA 2O6GE 1HDPA 2IT0A 3GZNB 4HLYA 4C2TA 1ZYRF 2AHQA 2XKPA 4D7NA 3GTLJ 1SC7A 4I02A 1P2FA 1YX5A 3PL8A 3S8PA 2ZXWH 2KZVA 3KE2A 4L9VA 3W2WA 3H9JA 1X1PA 1XSDA 2Q2EA 2GIZA 4CXFA 1R4MB 4BQNA 1FTTA 1KU3A 4JX5A 4OOIA 3OR2C 4Y52J 5FKOA 2CV2A 2QQ9A 1HQCA 2IA2A 4Y7NJ 1SAUA 4RMNA 1FZPB 5B3SH 1BR4A 3K4BA 4LK1F 2XRNA 3SZPA 3AG3H 4KMUX 1MW7A 2EZKA 2FNPA 1XX5A 1QU3A 1S8NA 2PMZA 2VBYA 3TP3A 3E5QA 4XOPA 2MLKA 3MMYB 1A6IA 1XC5A 2LLKA 2Z5UA 3FXKA 5HS7A 5TISC 4ESJA 1Z21A 3ABMH 4M6VA 4UUTA 4M3DA 4BQOA 1Z3XA 1USTA 2B0LA 2KZGA 3W6VA 2XHKA 3ZQQA 1LDJA 1MBEA 5FKNA 1UMQA 4E7KA 4Y33A 1YHQI 3SYTA 3JR9A 4KUMA 4RM3A 2IS6A 5J8CA 4AU7A 1WH7A 1P92A 5LD2C 2HDWA 2QWWA 4IHSA 4BHCA 4JBAA 3RQIA 4PCQA 1O7LA 1OQYA 4BY7J 5LHHA 1KQ9A 3CCYA 3A0HC 1K4TA 1JT6A 4BU2A 2ZFUA 1F4KA 3GBGA 2DFEA 2KPMA 2BY1A 5FLVA 2V9KA 1MZBA 1XTAA 5IP7J 1SANA 2EWNA 3OYAA 4WX9A 3I3LA 3IRQA 2GQQA 2BYVE 5E20A 3V8JA 1E2XA 1VQ9I 5CVIA 2GA1A 1IN5A 3ISPA 3FIWA 2EQRA 3FF5A 1J2XA 1U5TC 3IH4A 2QQ8A 2H27A 1VQNI 2Z99A 2EIJH 4U88A 5HLGA 3BTCA 1MDMB 3H35A 3L9FA 3LSHA 4FASD 1VQ7I 2HDDA 5H6QA 3I53A 2E2IJ 4NNJA 3CCEI 1F36A 2ZJPF 3TEDA 3KP6A 2DMNA 3FHNA 3TO6A 5EF6A 4N0BA 2JA5J 2RREA 1BI0A 1RESA 2DW4A 3UNGC 2VOPA 2P5KA 2DT7B 3BJOA 3ZQGA 3FM3A 1VQKI 2PI0A 4KN7X 2L9SA 1KA8A 1HC8A 1TQPA 1OYIA 2Y2ZA 3CF5F 2CUJA 4YIRX 3BJAA 4EGZA 1MKMA 4LIUA 2GOMA 2HTSA 5IT3A 1I3AA 4BH9A 4UY8I 4HQEA 3SQNA 1XMXA 3WGHA 3V7CA 1IW7F 3C7JA 1NH3A 2H6BA 1QO0D 2VT2A 3HRMA 2BGCA 3FBIB 5CVJA 3GCMA 3MKWB 1JUSA 1D1AA 3CUQB 1ON1A 5JFRA 4AIJA 2L7MP 3HOUJ 3BCBA 4B09A 2RDPA 1TZLA 3COAC 1UFMA 4ETSA 2FQ4A 3HM5A 1BC7C 3T8RA 2FE3A 3LSTA 2ZJQF 5FD5A 1WHUA 2JT1A 1YI2I 3H0GJ 1OCTC 3R60A 4JYKA 1R5ID 2OV7A 1O3QA 1W36C 3KYDB 5H6RA 3A01A 2A6HF 1HW5A 4L0YB 1UJ8A 3CJQB 2K3FA 1FIAA 2CW7A 4UVCA 4N9HA 4GYIA 1KU2A 2M9HA 5FKLA 1Y39A 2LNBA 5HVQC 2BOLA 3BTJA 4EATA 5JHFA 3RZOJ 1HW1A 4XSXF 3B02A 3S1RJ 2IS2A 1RRJA 2JJ7A 3DF8A 3FMRA 2NVTJ 3CZ6A 2R7XA 3H3VK 2ZCWA 4KISA 1DU6A 1WVRA 3D5LA 1MMGA 2ELHA 3U2RA 4HOBA 4OIQF 2W48A 1HBXG 4G6TB 2QSFX 2KFDA 5HS8A 5JR3A 1T0FC 5D6FA 3O3KA 1MJ9A 3H36A 2VT3A 1WJDA 3P5JA 3E0JB 3FBNB 1I39A 4YG2F 2KLOA 3U1DA 1MDMA 5DEQA 3BT9A 2K4JA 4ZYEA 2K9SA 3LOCA 2GXAA 1TNTA 2KQRA 1J9IA 3EUAA 5D6EA 3S17J 1D1BA 2BZTA 5KVRA 1VQ5I 3RTRA 3ZN0A 1VQ8I 1WJ5A 2XAGA 4FISA 3C18A 2W84A 2DFIA 3J80Z 1VZ0A 4L9JA 2X85A 3NWSA 1D0YA 1R9TJ 5HLTA 3LA7A 1X3UA 2Y69H 5FFZA 3TMOA 3G6EI 2ZBKA 3KP4A 2HYGD 3F6VA 1OCPA 3QRFF 3QYFA 5EEGA 2XVCA 3BTLA 3MAJA 3CUQA 4HX4A 3DBRB 3CQZJ 2HU9A 1TL8A 4OAYA 1ZR2A 2D1VA 4IHYA 2YS9A 2HYFA 3QPLA 3DU5A 1O57A 5JLWA 2JA6J 2V79A 1MMDA 1FC3A 2HPMA 1FP2A 3ECOA 3DU6A 1EJ9A 2QKMB 4IL6C 2VKHA 5E79C 1LVKA 2R3SA 3DEEA 1VF9A 3E1SA 4PJNA 3VODA 1DP7P 2M8EA 2K9LA 4FETA 4M3GA 2HQNA 5EG0B 1WZ2A 4HZFA 4IRGA 3RDIA 2OJED 3KX2A 3A4CA 2RN7A 3R0JA 5GADJ 1SFOJ 1JKRC 4BYYA 2M45A 3MEXA 5LEKA 4YRVA 4B44A 3M8EA 1UAAA 2QQBA 2X1DA 2F5EA 1FPQA 2DFFA 3JAMZ 3N4MA 2X9DA 5K7HA 5GAHJ 5K1YA 2XF5A 2DPUA 3LSKA 4HPQA 1UELB 3FXQA 3KYCB 5FROA 4DW6A 5TRDA 4IHXA 3I4MJ 1T08B 2CQQA 4BJ5C 4EMSA 1IO2A 1T98A 2QA4I 4QPOA 1A36A 4A3DJ 5FKMA 5E17F 1Z7LA 1SFXA 4CYDA 3SZGA 1FOWA 4B47A 2IS4A 3GVAA 2BY0A 4JQFA 4ITVA 3IHUA 1ZAOA 4KA4A 1TWHJ 2O7OA 5D5VB 5E3NA 3IC7A 1OCZH 1ETQA 3PNYA 4DBRA 4ZYAA 5LRRA 4E6KG 3K7AJ 3K70D 4RGRA 3SFZA 1QZZA 3GEZA 4E7IA 1ZRDA 1V54H 2XPUA 3TKYA 2YUSA 4OINF 1BC8C 2ISYA 3OIQA 3PJRA 2YU3A 2NS0A 3E97A 5IT9Z 5DM7F 3WGGA 3GZ5A 2DA2A 3PUFA 3IWFA 3OYCA 4HF1A 2V9PA 4CA0A 4C3IJ 3QAHA 2R5YB 1YS7A 2Z2SB 4I99C 4BY1J 1WI3A 2OUMA 1IV6A 4O3MA 3KZIC 5L3EA 5C44J 3S3NA 5FGMA 1X1DA 3BPXA 2VQGA 3L00A 3RYPA 2UWMA 4R79A 4MHGA 3JCUC 2FBIA 3EUHA 3E5UA 1YW7A 1POGA 4YEJA 1FTZA 3OSGA 2MSYA 2O8KA 3J80K 1HDDC 1IXRC 1BW6A 2HKXA 3NQOA 1Y8QB 5DS9A 2RNJA 3K4LA 2EILH 4C2MJ 1WJBA 3KLNA 4M6XA 5EG0A 1PP7U 1ZGJA 1Y1WJ 3BLYA 3JRAA 5HLIA 2ZO4A 1XGOA 2ZXHA 4LITA 3FKJA 3JRGA 1FT9A 1TQMA 4RLQA 1U3EM 1YFHA 1N78A 3L2CA 1GXPA 1HKTA 2CFXA 3GFJA 3WU2C 1BIBA 1I1GA 2P8TA 1Z3YA 2DLLA 3L2WA 4M72A 5EDNA 4E7SA 2DQRA 3DEUA 2P4WA 5CQEA 3WGIA 3OYNA 3FDYA 5HOOA 2JRMA 4E70A 3MKYB 3F8NA 3E6BA 1WWXA 3RPUA 3A2KA 1XCVA 4LIVA 1S3JA 3OS1A 1R6RA 3HBLA 3HEFA 4EJOA 1XGNA 3JRBA 4I0AA 2UXNA 1FBQA 2ZMEC 1R1TA 1RUNA 3ZPLA 3JW4A 5F1RA 3OYMA 1LFUP 3CC7I 3S1NJ 3FXUA 5L3BA 2X4HA 3JAMK 2XB0X 2YR2A 2GLOA 5B1BH 1MBHA 1Y56A 1O3TA 4V19K 1T2KA 4Q5SF 1R49A 5HDNA 3JRCA 3I58A 3P9IA 2I8DA 3QOEA 3RSNA 4BAYA 3FWEA 5D8KB 1EH6A 2WTEA 5H2FC 1Y0NA 4IZZA 4A3CJ 5J6XA 5LLQA 3L1PA 1XPXA 4Y13A 2R5YA 1AHDP 1W7PD 3OL3A 5K5RA 4UHTA 3F3XA 4A0YA 4UB6C 2VASA 3K4CA 1YITI 2EK5A 4NC8A 2CQ7A 4XBFA 2FNAA 4AWXB 4BHPA 5JVTA 2KHMA 4YFXF 4KT5C 2KIQA 3QYBA 4IOAF 4ZYGA 2NS8A 3ULQB 1UHMA 2GM4A 2COBA 1OR7C 4U87A 2FOWA 4F55A 3D1NI 2GA2A 4C9YA 2MG4A 2ZFWA 5IT9K 2KKOA 4XK4A 4CHUA 2IGMA 5IYDJ 1JUMA 5AIQA 1FY7A 2R7FA 4D5CA 1DGRM 3HKZN 3VSKA 2TDXA 2QBYB 3RIRA 2E1OA 4A3KJ 3O6BB 2KJCA 1E3PA 3ELKA 5KAFC 4EM2A 1MH3A 4HF0A 5DD8A 5E3OA 2STWA 4A93J 1OLTA 1VQ6I 3CCMI 4MQ9F 3DTEA 2CRGA 1S7EA 1I6HJ 3I64A 4RB0A 5FLMJ 2IPQX 2EBIA 1YG2A 2RGVA 4FE4A 1IG7A 2LG4A 5DUKA 3S3MA 2M30A 1A5JA 3CCRI 2HVQA 3PIOF 3I0TA 1LVAA 1F1ZA 2M0MA 3D5RC 3ZOBA 2XAHA 4XORA 1JJ8C 2MW8A 2OA4A 1D3YA 1R4NB 1TC3C 4DGWB 3HTUA 2VODA 3HB9A 4XM3A 4CCKA 1JKQC 4DOZA 3S2DJ 3CP8A 2VBWA 3KFWX 4P9FA 5CLSA 3HPGA 3CCLI 2AS5F 4X0GA 3ZMTA 2MFZA 3HRSA 3A03A 4PJ0C 2ACJA 1NG7A 3S1QJ 2AO9A 2HNHA 1YRNA 5GAEJ 1VQ4I 1TBXA 2NXNB 5C4XJ 2WY7Q 2VQCA 2IJLA 5F0HA 2KT0A 3TW7A 1WKMA 3R61A 2BBYA 1IRXA 1BR2A 2XSDC 3Q3SA 3BY6A 1YS6A 2K40A 3A0BC 2O61A 2CV0A 2V7FA 2KISA 5E1ZB 4HSRA 5DTDA 2VE9A 2ESHA 2GAUA 1U5TB 3K4JA 4RAFA 4KJZA 3EUKL 5D4RA 4HV5A 4NC7A 4OMYA 2NOJB 3LA2A 3DTKA 3CDLA 2Z16A 3ERMA 4GDFA 3OWTA 3QYEA 1U78A 3U1KA 3TL4X 3DBHB 4ZYDA 4AIKA 4XQFA 4KFCA 2DODA 3TP0A 2GXBA 3RI4A 1LQ1A 3ZQFA 3U9GA 5ICEA 1PYVA 4D7MA 2NVXJ 2QBYA 3E6DA 3LQQA 5C4JJ 4LG3A 4XLEA 5EEHA 2QZ8A 3AL0B 2QCOA 4PJLA 2LMDA 2VL8A 5GAGJ 5CVUA 3GZ6A 1W4MA 2XAUA 4R1HA 2XAQA 4UV8A 1KQ0A 1ZTRA 2X51A 2QSHX 4JP0A 4A69C 2CMPA 3TW6A 4G12A 3WTSC 2XB5A 3OYDA 1ULYA 4D5FA 3QQAA 1EF4A 3NARA 2WV0A 1S72I 4HX8A 4LFUA 4N4OB 4RBOA 3AAFA 1YO5C 4RGXA 1KYZA 3L7WA 4A5MA 3L2RA 3IKTA 2DXIA 1P7JA 4Z6YA 4AM3A 1HXDA 2DDAA 3MZHA 2JUGA 1R22A 1WGXA 3I71A 3FM5A 2K9MA 5IP6A 2Y9YA 5FJ8J 1IC8A 2P7VB 1IUYA 1ZR4A 3GTQJ 2ECCA 2K4BA 5HDKA 3F23A 4FCYA 2EPFA 3KZYA 4L0ZB 2FRHA 2HVRA 2O9LA 4ON0A 1TWAJ 2X6XA 3QU6A 4LK0F 4I2OA 1TT0A 1U5TA 2L9RA 2UXXA 3I4PA 4EM0B 2WAQN 1U9OA 2L7KA 3OY9A 2FEZA 2Y75A 4CICA 2WADA 3CDHA 2L9NA 4EVIA 4WWCA 2KRCA 3FKIJ 3ZMVA 2EZHA 1QVUA 3GTOJ 2FQ3A 2RV8A 3VOEA 2E19A 2OTJI 1WPKA 3G4SI 2M0CA 2FOKA 2K5CA 4IVNA 2Z1DA 4ZDPA 4U7DA 3SJMA 1DP3A 3LNQA 3IH3A 3C2BA 1X2NA 4QWQA 3PUBA 4D0PA 1TWFJ 2DJIA 3CCVI 1FJLA 3DXJF 1S29A 3HSFA 4IPAA 4F7ZA 2VKVA 5K5QA 3VWBA 2X0LA 3ZXSA 1V55H 5DCMB 3K69A 2PJPA 2KIFA 2VE8A 3LMMA 3J7ZI 4I0BA 1X3ZB 4M71A 1U0JA 3EPZA 1IN4A 3FK6A 3S32A 3HL2A 1OCOH 4OU0A 3CLQA 4HNTA 3S15J 1IV8A 4PSWA 1A35A 4BE0A 4H4KC 1IRZA 2AXTC 3BR6A 3MZ8A 5CVRA 4QLCU 4ZTFA 3BPVA 1APLC 4ESFA 1WCMJ 1P9QC 1T56A 2WAFA 4LB6B 2VB6A 2ZJRF 1TNSA 3LAPA 4XIDA 5CPRB 3CCQI 2E2JJ 2DU9A 4EJVA 1MIJA 4GYGA 3H3UA 2RAEA 2P7CB 3SHFA 2GBYA 5TGTA 2VKDA 4QPQA 1OJLA 1XD7A 2BHYA 2D45A 4QTRA 3Q0UA 1DQUA 4KIBA 1E3OC 2R7RA 1XG1A 3BZKA 1IRFA 1LFPA 4YIIA 3A01B 3M1CA 4OWRB 3SXYA 5ICCA 3M07A 1T0FA 1XGSA 2K7LA 2Q8KA 1ZLJA 4Q47A 2RQQA 4DNCA 1BOAA 2K3PA 3IP4B 4L9NA 4XLHA 1ZREA 2LVSA 3V7RA 5LEJA 2WV1A 1R5GA 2XAJA 4EM1A 2CUEA 4N4NB 2LKXA 2F5CA 3HUGB 2CUZA 3EQLF 1JGGA 1FWZA 2PMZN 2M8GX 4LG0B 4GGGA 2FX0A 2VBZA 2W1OA 4FT8A 1UG2A 4LD5A 3V4GA 3QWLA 3PM1A 3A1YA 1ETOA 3QU3A 4FHTA 1J59A 1YQAA 3Q0VA 4I7HA 3WE3A 4DZPA 5GTHC 1AKHB 4XR6A 2HEOA 3E7LA 1SMTA 1QRYA 3BR5A 1VTNC 3KEOA 5L3GA 2V6CA 2TRTA 2DI3A 1YJ9I 4A5NA 1IUFA 1FYLA 1GV2A 1ZN2A 2DA6A 2EFPA 3BG3A 2ZJ2A 5DCMA 2E1MB 2P6TA 4BEHB 3GYHX 2DT6A 2MD5A 2OF7A 2HXIA 2ZKZA 3H3ZA 4MIMA 2M7BA 3BG5A 2HQAA 2QF7A 3CJTB 1WJFA 2V26A 1W1WE 2JQ7A 4IQ4A 4HNVA 3ABLH 1UCRA 2RVCA 2JRTA 4KT6A 2OTLI 4B43A 4IQJA 2XASA 1XSVA 1GDTA 3LSIA 4RM2A 5FKKA 2ESNA 5E3MA 1W5TA 1HKSA 3CMEI 3PSFA 2L3DA 2DYSH 2ISZA 4DYCA 4AC0A 5BPDA 4L9TA 3BR0A 3ECHA 2XGCA 1RR8C 9ANTA 4MEXF 4Q48A 2KDOA 1OCRH 1YYVA 3F9KA 2D1HA 5EZGA 3H9GA 4U0YA 4OMZA 1H8AC 3JRHA 1RR7A 2Y0SA 4CH7A 1ERDA 4ENNA 3T0YA 4IEJA 4LJZF 4IX7A 2H09A 2EFWA 3HGGA 4IF4A 3ERED 2RKHA 2JSPA 1HF0A 3KIOA 4YFKF 2QENA 4MQVA 4UVAA 3HUGA 2JK3A 4PK4A 3Q9SA 2ZMEB 3K1PA 1Z0XA 2QLZA 4LG0A 1Z77A 3NEUA 3GTJJ 5DV5A 2IGOA 3JSPA 6PAXA 1GXQA 3AG2H 3I5UA 5J1YA 1L0OC 3I54A 2DMTA 2IGKA 1R1UA 1B1BA 1K4SA 1K78B 2Y48A 2LTPA 1AKHA 2DTRA 4F92B 4II2A 4BJ6C 3FXMA 1D8JA 4I09A 1P4XA 2BY3A 3CMAI 2X48A 3ZMSA 2ICWG 1QQIA 4DZJA 3ZQLA 5M5XJ 2G7HA 2RC4A 5L3CA 5DM6F 3RKYA 2QGUA 5KCMA 4BEHA 1A6QA 5FRNA 1QA6A 4HA8A 1MH4A 5J47A 1U8BA 4IKFA 2A6TA 4LOCA 3TDUC 3AFHA 2QSGX 2O3FA 4NBQA 4CCJA 2DA5A 3MKZA 2VI6A 1TLHB 3IH2A 2LKSA 4CYCB 3S2WA 1HW2A 2EIMH 2V6EA 3ZMDA 2Y30A 3PIPF 3SEQA 2JPCA 3DPLC 3RZDJ 3K2AA 1R36A 5EGOB 1CGPA 4PFPA 4MFEA 1ODDA 1JTYA 2FXAA 2A05A 2MH2A 2HXOA 2E36A 2Z33A 2HVSA 5A2QZ 2R7VA 1EH7A 3G71I 1HOMA 4ZTJA 1Z1DA 3QP5A 2VIXA 2OQRA 2W85A 3BWGA 3IAS2 2A68F 3S3OA 2L4AA 2OD5A 3BP8A 3TGNA 3RKWA 1ZQ3P 2YU9J 2NVYJ 3E6CC 2WWYA 2RQPA 1LKXA 3C2GA 4K2EA 3IWZA 3OYJA 4M6YA 1NK2P 3REOA 3RQ4A 2ELJA 3ZQIA 3HZJA 1IN6A 4U0VA 2TCTA 3TOAA 3RKQA 1V5FA 1JTXA 2DDBA 2H8RA 2MGQA 2QUFA 1J7KA 1GLNA 1LUJB 1V3FA 3VB2A 4ABZA 2FSWA 4G9YA 2R7DA 3O8HA 2ZMEA 4A0ZA 5L3DA 2VLAA 4MEYF 4JX4A 3FHZA 2CYYA 1LDKB 1M1EB 4H0EA 5EJCA 2COMA 3ROUA 3OL4A 1GVJA 3GX4X 1JKPC 1X1CA 1K78A 3U21A 3KP7A 1YIJI 4IO9F 2OU2A 2F4MB 5CQGA 3KLOA 1JE8A 3CP2A 3ZCOA 4HRIA 3NAUA 2OQGA 4PGHA 1J75A 4X6AJ 5J4VA 1W5CC 1SVMA 4BE2A 1HLVA 4RGUA 4HW0A 4BXUA 1O4XA 2DA4A 3CCUI 2MH9A 4P55A 5BPIA 3K1NA 1BJZA 2K27A 3SEZA 1I27A 4HLXA 1UHWA 1NK3P 4YIFA 4CYCA 2WA0A 4FQGA 3VYRB 5IYBJ 1B72B 2VJIA 1T95A 1OR7A 4HDVA 2CQNA 3OOPA 2QVOA 2R93J 5EGOA 3HJEA 1USSA 4RB2C 3F22A 2KIMA 4BL0B 4IHVA 1RETA 4BQQA 3AG4H 4F52A 5E1WA 4KITB 2HGCA 1WQ2A 3I55I 1EH8A 2JN6A 3HDDA 2A5YB 2ETHA 5BQTA 2JPBA 2ZNZA 2LFBA 1U9NA 3V8KA 3T5XA 4EGYA 3ZR8X 1FYKA 1HCRA 5M3MJ 2YX7A 4G6DA 5KK1A 4ZJZA 3FX3A 4RB1A 1YJWI 3T1BA 2LY2A 4A3BJ 1HA8A 3HSRA 1Q1VA 3H5RA 4WXHA 1A04A 4S05A 4HSTA 1OMIA 2MD0A 2XF7A 3HOWJ 1KGSA 3ASNH 4RS8A 1J09A 1X2MA 2IXSA 1B59A 5A2QK 3MVPA 3M3YJ 3OYIA 2VQLA 1BI2A 1WH5A 4DBQA 5F27A 3W3CA 4XMYA 2FF4A 4D9JA 1K6YA 2X6OA 1AWCA 4E7JA 3CUQC 3CD6I 3MN2A 3HHGA 4GO1A 4TV7A 3WU1B 1X4OA 4A6DA 3OOUA 3L2UA 4FTHA 3W2AA 3PQJA 4J19A 3FZVA 1XCBA 3CCSI 2R4GA 2Z3YA 4LMYA 3CDIA 2IRFG 2X6WA 1V5GA 4XRSG 2HFHA 3BTIA 1JXSA 1GT0C 1KU7A 1X1BA 2LP0A 2ME0A 3B73A 3Q5FA 3ZMUA 2EB7A 1TP4A 5AIPA 3F0CA 2ECBA 2CU7A 2VJJA 2DMPA 4ENMA 1O7FA 2M87A 3C3WA 3KZZA 1ZRCA 5IY5H 2PX9A 4WCGA 3BC8A 2A6EF 1W7PB 2LY9A 1HKQA 1Z9CA 1YRNB 2XUBA 3DFGA 3HC7A 3DV8A 3AG1H 4CZZA 2LH9A 5HDGA 1B72A 3BZCA 2EJRA 5M3FJ 2XGEA 4BE1A 5IYCJ 2D5VA 3I9V2 4KIGA 4G7OF 5IP9J 3HKZA 4LGWA 1XN7A 2CQXA 1G6NA 5GPCA 5ICGA 4CCNA 1D5VA 1A31A 1RKWA 3ABUA 4L18B 2XGDA 4RGSA 1FNNA 5DD4A 5FD6A 2CFOA 2M1BA 3R4KA 5IPAA 2K9NA 3SDGA 4N9IA 1OISA 2X1EA 1S7AA 4GFBA 5J1RA 4RB3C 3BJ6A 1REPC 1P6RA 4BS9A 5FB2A 2G7UA 4F91B 2ZSIB 1J0RA 3JSOA 3M7GA 3F8BA 1ETVA 1N75A 3JRIA 5J4YA 1D1CA 1D5YA 4C30A 1BN5A 4PJMA 1G3WA 4A3LJ 2LSOA 1S7OA 4BBSJ 3OYHA 4ZYHA 3LA3A 4G8XA 3H5NA 2FBHA 4C3HJ 2E1CA 1K61A 3E3VA 1SVOA 5FLXZ 4GRIA 3TDZC 1G2HA 4ENJA 3CO7C 1GHCA 4DYRA 2JVGA 1QBJA 3HOVJ 3S1MJ 2R7SA 1LDDA 4NB5A 4V2FA 5D4SA 5D5XB 4PFOA 2W24A 1FBUA 4DQ2A 1MBJA 3FISA 3ZN1A 1PUFB 4A3EJ 4I76A 1Z6TA 1F43A 2E5ZA 3GTGJ 1W7PA 1MNEA 1Y6IA 3L2VA 1G3YA 4A12A 2J5PA 5CKTA 3KYLA 3MD2A 1RPWA 3CMYA 1JKOC 2E7WA 2NRAC 1IN8A 4BQAA 1FSEA 1ON2A 4MTEA 1U8RA 4EEFG 1T33A 1PP8F 3SZTA 2BEOA 3DTIA 2YX4A 1ZG5A 1XMAA 3DBLB 1SD5A 5F6FA 3TO9A 1TWGJ 5B1AH 2H1KA 3LSMA 2GIVA 1TQIA 1YW8A 1YW9A 2LKPA 2VUMJ 4CCMA 3TQNA 3ABTA 4XN0A 3FMSA 4BNCA 1QNTA 5ILSA 1JUPA 3BOQA 1SEUA 1P4AA 1FOXA 1Y0UA 4FX4A 1BJAA 3GWZA 4A3IJ 2PG4A 1FMWA 1PUEE 2B7EA 2MC4A 2IBDA 4Y3OA 4GCVA 5D5WB 1ZG1A 3T8TA 1K6OA 3L09A 3O2PE 1QZEA 2W4SA 1VQMI 3F6OA 3QOPA 2OAZA 3H0DA 4HF2A 1R1VA 2LREA 3N05A 2P5VA 5J3LA 4BHBA 5LRSA 1Q1HA 3P9KA 1G59A 2KRHA 5K7FA 2HKOA 2HTJA 2VPRA 4ZC3A 3C1DA 3GTPJ 2V1DA 2EZIA 4OAZA 1OYYA 1H9GA 1DPUA 4B8XA 3QPSA 2YSRA 5ICFA 3VYUB 5F0FA 2X1CA 5C3EJ 5F04A 2F5DA 1UG0A 1H89C 2ID3A 1FEXA 2IVMA 3TO7A 3VFZA 2HQ5A 3WHBA 1RKTA 3DWLE 1LJ9A 3NRVA 5LBQA 3R6SA 3K0LA 3PNVA 5TJJA 4AD9A 2K86A 3S2HJ 2L2OA 5HODA 2CO5A 2DJNA 1PUFA 1SD6A 1MNMC 3GMEA 2ZXJA 1P4WA 4AYBN 3OYKA 1ETYA 3V42A 4XICA 2Q1ZB 4BXXJ 1AA7A 5DYMA 1D0ZA 4HG2A 1JHHA 1FLIA 3Q9VA 1I50J 4ENKA 5FLXK 2JZYA 4A0XA 4CUGA 4C2UA 2L01A 2KJBA 5GTIC 1YTYA 1RZ4A 2PN6A 2XSJC 3CF2A 4Y15A 1DDNA 2KRFA 4E7ZA 3HOYJ 3K10A 4AVZA 1Z91A 5D8LB 2V1NA 3VSLA 4XRMA 1IN7A 1SVLA 2P6SA 3QODA 3DKXA 3RJPA 1Z7UA 4DIQA 2PLYA 4CSWA 1E0EA 2E1NA 3ZGKA 3OYEA 2DAOA 2E5NA 1GVDA 2H1LA 1BR1A 2KL4A 3H1CA 4XKWA 2QKLB 1R7JA 3HHHA 2PBIA 4W97A 4AVPA 1RC9A 2AXLA 2A61A 1TW3A 4XNFA 3KP3A 2L5QA 3GF2A 4JK1X 5IOYA 1I6XA 3JTHA 3PO3J 4KDPA 1BW5A 5HNHA 2F5VA 2MYSA 2PJRB 1TW2A 5DUIA 2OC6A 4IHWA 2M7AA 2OPTA 5B5EC 2PMHA 2CQKA 5ED4A 1QHGA 2MC3A 5ERIA 4A3JJ 1KQ8A 4MTDA 3KEYA 2BXZA 2IS1A 4PJJA 4WK8F 3HRUA 1Z67A 1IXSB 2Y0MA 1WRJA 4UB8C 1FOYA 3EDPA 2EFQA 4AUXA 2R5ZB 2GWRA 3JTGA 5E8IA 1JHFA 1QPMA 2FUG2 1X58A 3OV8A 2F6CA 4XN3A 2ZB9A 3JRDA 2NVQJ 4BKXA 2WY8Q 3D5SC 2JUCA 2WB1N 5JLXA 4XRSA 4EQQA 1WFXA 4NC6A 2E60A 2EV6A 1B9MA 2GXGA 5J40A 3CJRB 1P7IA 5LHGA 3WTWC 1K79A 4KYWA 4RAZA 2IP2A 1XGMA 1G8XA 2HQRA 3CCJI 5B66C 1XMKA 1GUUA 3GFLA 3IRRA 1DPRA 3BG6A 1LEBA 2DFHA 2UZKA 1ZARA 3G2BA 4HAMA 3H9QA 4EJTA 1FP1D 1RI7A 5GPAA 5BOXA 1RUOA 1VFCA 2VONA 3IL2A 2V1UA 2CS3A 3BDDA 2L4MA 1WJCA 4J01A 1MBGA 2MABA 2OBPA 4WXCA 2XF6A 3HGYA 4XLNF 3J7YJ 3BR1A 3PQKA 1EV7A
chains in the Genus database with same CATH topology
2P81A 3S1NJ 4QSHA 2GLOA 2XB0X 4BBRJ 1MBHA 1LFBA 3GTKJ 1Y1VJ 2CUFA 2E2HJ 1ZQ3P 2YU9J 3JRCA 5EZHA 1NTCA 2NVYJ 2JMWA 3UKGA 3OSFA 1NK2P 3VPRA 3ZQIA 4A3CJ 3LSRA 1JJ6C 3Q0WA 4RDUA 3L1PA 2TCTA 3RKQA 4MFDA 2R0QC 2R5YA 1AHDP 3JREA 1JTXA 2H8RA 2MGQA 1OFCX 4ABZA 2ME6A 3BQZA 3O8HA 4JX4A 4B1RA 3O8GA 1QPIA 4V2GA 2NS8A 1JKPC 3G1LA 2GM4A 2COBA 3D1NI 5F08A 2R5ZA 2MG4A 4FE7A 4XK4A 1K83J 5IYDJ 3MKLA 1JUMA 2HOAA 4MLOA 1MSFC 4D5CA 3HKZN 3NAUA 3LSPA 2E1OA 4A3KJ 4X6AJ 2VKEA 4JX6A 1JT0A 5F1JA 1HLVA 2DMQA 1O4XA 1MH3A 2DA4A 5E3OA 5IOZA 2IAIA 4A93J 1ETWA 2CRGA 1S7EA 1BJZA 1I6HJ 5FLMJ 2EBIA 4FE4A 1NK3P 2NS7A 1IG7A 4B4CA 4CYCA 2L7ZA 1H88C 1A5JA 5IYBJ 1B72B 4UUSA 2HI3A 1BL0A 2KDZA 2DA1A 3ZOBA 1XS9A 1JJ8C 2MW8A 2XPWA 2R93J 5EGOA 1TC3C 3HB9A 1ZKGA 1JKQC 4IHVA 1RETA 2L7FP 3S2DJ 2R92J 1ZGWA 5J1UA 2JN6A 3HDDA 1HDPA 3GTMJ 2AHQA 4D7NA 3A03A 3GTLJ 5K7ZA 2LFBA 1U9NA 2L0KA 1ETKA 2DA7A 3S1QJ 2AO9A 5M3MJ 1HCRA 1YRNA 1AU7A 5C4XJ 1FTTA 5F0HA 2KT0A 4JX5A 3TW7A 4A3BJ 4Y52J 5FKOA 1Q1VA 4Y7NJ 2XSDC 3Q3SA 2Y0SN 2K40A 2JA7J 3HOWJ 2EZLA 4B3AA 2EZKA 5DTDA 1X2MA 3M3YJ 3MVPA 3TP3A 1WH5A 5F27A 5GP9A 4C3JJ 3OIOA 3HOXJ 2X6OA 1A6IA 1XC5A 2LLKA 3CDLA 3MN2A 4X1EA 4M6VA 4UUTA 4FTHA 3OOUA 1VI0A 1U78A 4M3DA 4J19A 1B8IB 3TP0A 4A3MJ 3W6VA 1MBEA 2EH3A 1UMQA 5FKNA 4XRSG 3ZQFA 2LR8A 3BTIA 4D7MA 2NVXJ 3JR9A 1GT0C 1ITYA 1WH7A 5C4JJ 2LP0A 2FD5A 2ME0A 3RQIA 3F0CA 2QCOA 2ECBA 4BY7J 2CU7A 1VNDA 2DMPA 3CCYA 1CQTA 1JT6A 2NOGA 3GBGA 1YRNB 2LY9A 1ZTRA 1GV5A 5FLVA 5IP7J 4JP0A 1SANA 4A69C 2I10A 3TW6A 4G12A 1B72A 2XB5A 4D5FA 5M3FJ 2XGEA 3A02A 2D5VA 5IYCJ 2HOTA 1MBFA 3QQAA 1EF4A 3NARA 5IP9J 2ID6A 3FIWA 2EQRA 3WHCA 2CQXA 4RBOA 3IH4A 5GPCA 5M5YJ 3BR3A 4MO7A 3BTCA 1P7JA 1RKWA 2XGDA 3HOZJ 2HDDA 2E2IJ 5IPAA 2K9NA 1F36A 3SDGA 3TEDA 1WGXA 2DMNA 1IGNA 4GFBA 5J1RA 5EF6A 2JA5J 2HYJA 1RESA 5IP6A 1UHSA 2Y9YA 3ZQGA 5FJ8J 2DA3A 1IC8A 1ZR4A 4M3FA 3GTQJ 2ECCA 2Y2ZA 4FCYA 1ETVA 3JRIA 2O9LA 1TWAJ 1D5YA 5BNGA 2L9RA 4M3EA 4A3LJ 2WAQN 1ENHA 1U9OA 4BBSJ 2JA8J 1JUSA 3FKIJ 5M5WJ 2EZHA 2L7MP 1QVUA 4C3HJ 1K61A 3GTOJ 3HOUJ 2E19A 3G1OA 1WPKA 2FQ4A 1B8IA 3HM5A 1LE8B 2M0CA 4A3FJ 1G2HA 3H0GJ 1OCTC 3SJMA 4JYKA 3LNQA 4DYRA 3HOVJ 3S1MJ 3A01A 3IH3A 3C2BA 4I6ZA 4V2FA 2DN0A 1X2NA 2DTZA 1TWFJ 1FJLA 1FIAA 1IJWC 1MBJA 3FISA 1PUFB 2M9HA 5FKLA 4A3EJ 5E3LA 1W0TA 3BTJA 4I76A 2VKVA 3RZOJ 1F43A 3S1RJ 3GTGJ 2JJ7A 1ORKA 2NVTJ 3H3VK 1DU6A 3JRFA 1RPWA 2W48A 3CMYA 1JKOC 3FK6A 3S15J 1IRZA 4EEFG 1T33A 3BR6A 5EYRA 1APLC 5EEAA 1WCMJ 1T56A 2FJ1A 3BT9A 1TWGJ 2K9SA 4XIDA 3LOCA 2E2JJ 2H1KA 1IDZA 5F0CA 2RAEA 2B63J 2VUMJ 2GBYA 3S17J 4NDLA 1OJLA 1QVTA 1JUPA 2HOSA 4QTRA 3Q0UA 4A3IJ 1E3OC 4L5EA 1XG1A 2IBDA 4FISA 3A01B 2IEKA 4QIWN 1R9TJ 5J3LA 2LVSA 1OCPA 2WV1A 2CUEA 5K7FA 3BTLA 2VPRA 1MBKA 3DEWA 2LKXA 1JGGA 3GTPJ 3CQZJ 1ZR2A 2EZIA 4IHYA 2YS9A 2PMZN 2M8GX 3QPLA 5JLWA 3QPSA 2JA6J 2FX0A 5C3EJ 5F0FA 2M2EA 3M4OJ 1LE8A 5F04A 1H89C 1UG2A 2ID3A 2M34A 1FEXA 3PM1A 1ETOA 2HQ5A 3Q0VA 3WHBA 1DU0A 1RKTA 4DZPA 1VF9A 3LSGA 1AKHB 3E7LA 1QRYA 3BR5A 3S2HJ 3SFIA 4M3GA 2TRTA 5EG0B 5HODA 2DJNA 1PUFA 1IUFA 1SFOJ 1JKRC 1GV2A 1MNMC 4AYBN 2DMUA 2DA6A 3ZQHA 1ETYA 3BG3A 4XICA 4BXXJ 2OF7A 2HXIA 2X9DA 5K7HA 4MIMA 3B6AA 3IV5A 1I50J 3BG5A 4DW6A 2XRLA 2QF7A 3I4MJ 4IHXA 1I3QJ 2CQQA 4HNVA 4A3DJ 5FKMA 4DYQA 4A3GJ 3HOYJ 2R7ZJ 3BQYA 1GDTA 4XRMA 5FKKA 5E3MA 1TWHJ 2O7OA 5E3NA 1ETQA 3G1MA 4DYCA 2G0EA 4AC0A 2LK2A 3BR0A 2XGCA 2K9QA 3K7AJ 9ANTA 5EZGA 1GVDA 3BG9A 1H8AC 3JRHA 3PO2J 1RR7A 4W97A 2XPUA 2YUSA 3BR2A 5IOYA 4IEJA 3PO3J 2DA2A 1BW5A 4C3IJ 3HGGA 2R5YB 1ETXA 3ZQCA 4IHWA 4BY1J 3S14J 1HF0A 1WI3A 2OPTA 4A3JJ 1IV6A 4S0HB 2JK3A 1Z0XA 5C44J 1Z77A 3FK7A 3DCFA 3GTJJ 2Y9ZA 1TWCJ 5J1YA 3S16J 1POGA 2DMTA 1FTZA 3OSGA 4AUXA 2MSYA 2R5ZB 1AKHA 2LTPA 2O8KA 1X58A 3JRDA 1BW6A 1HDDC 2ZB9A 2NVQJ 4BKXA 5DS9A 2WB1N 4C2MJ 5EG0A 5JLXA 4XRSA 1Y1WJ 3JRAA 3JRGA 2X48A 4DZJA 3ZQLA 5M5XJ 1P7IA 3B6CA 2Y31A 2CJJA 1IDYA 3LSJA 1MH4A 2ELKA 1U8BA 4LOCA 1BA5A 1GUUA 4W1UA 2N8GA 2DA5A 2JWTA 1ZK8A 2VI6A 5EDNA 3IH2A 4CYCB 4UUSB 2Y30A 2XPVA 5GPAA 3RZDJ 1VFCA 3K2AA 5EGOB 4MFEA 1FIPA 1JTYA 2LD5A 1MSEC 3HBLA 4M3BA 3HEFA 3JRBA 2HXOA 1MBGA 3I4NJ 1W0UA 3HGYA 1HOMA 3BR1A 1LFUP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P81 A;  3S1N J;  4QSH A;  2GLO A;  2XB0 X;  4BBR J;  1MBH A;  1LFB A;  3GTK J;  1Y1V J;  2CUF A;  2E2H J;  1ZQ3 P;  2YU9 J;  3JRC A;  5EZH A;  1NTC A;  2NVY J;  2JMW A;  3UKG A;  3OSF A;  1NK2 P;  3VPR A;  3ZQI A;  4A3C J;  3LSR A;  1JJ6 C;  3Q0W A;  4RDU A;  3L1P A;  2TCT A;  3RKQ A;  4MFD A;  2R0Q C;  2R5Y A;  1AHD P;  3JRE A;  1JTX A;  2H8R A;  2MGQ A;  1OFC X;  4ABZ A;  2ME6 A;  3BQZ A;  3O8H A;  4JX4 A;  4B1R A;  3O8G A;  1QPI A;  4V2G A;  2NS8 A;  1JKP C;  3G1L A;  2GM4 A;  2COB A;  3D1N I;  5F08 A;  2R5Z A;  2MG4 A;  4FE7 A;  4XK4 A;  1K83 J;  5IYD J;  3MKL A;  1JUM A;  2HOA A;  4MLO A;  1MSF C;  4D5C A;  3HKZ N;  3NAU A;  3LSP A;  2E1O A;  4A3K J;  4X6A J;  2VKE A;  4JX6 A;  1JT0 A;  5F1J A;  1HLV A;  2DMQ A;  1O4X A;  1MH3 A;  2DA4 A;  5E3O A;  5IOZ A;  2IAI A;  4A93 J;  1ETW A;  2CRG A;  1S7E A;  1BJZ A;  1I6H J;  5FLM J;  2EBI A;  4FE4 A;  1NK3 P;  2NS7 A;  1IG7 A;  4B4C A;  4CYC A;  2L7Z A;  1H88 C;  1A5J A;  5IYB J;  1B72 B;  4UUS A;  2HI3 A;  1BL0 A;  2KDZ A;  2DA1 A;  3ZOB A;  1XS9 A;  1JJ8 C;  2MW8 A;  2XPW A;  2R93 J;  5EGO A;  1TC3 C;  3HB9 A;  1ZKG A;  1JKQ C;  4IHV A;  1RET A;  2L7F P;  3S2D J;  2R92 J;  1ZGW A;  5J1U A;  2JN6 A;  3HDD A;  1HDP A;  3GTM J;  2AHQ A;  4D7N A;  3A03 A;  3GTL J;  5K7Z A;  2LFB A;  1U9N A;  2L0K A;  1ETK A;  2DA7 A;  3S1Q J;  2AO9 A;  5M3M J;  1HCR A;  1YRN A;  1AU7 A;  5C4X J;  1FTT A;  5F0H A;  2KT0 A;  4JX5 A;  3TW7 A;  4A3B J;  4Y52 J;  5FKO A;  1Q1V A;  4Y7N J;  2XSD C;  3Q3S A;  2Y0S N;  2K40 A;  2JA7 J;  3HOW J;  2EZL A;  4B3A A;  2EZK A;  5DTD A;  1X2M A;  3M3Y J;  3MVP A;  3TP3 A;  1WH5 A;  5F27 A;  5GP9 A;  4C3J J;  3OIO A;  3HOX J;  2X6O A;  1A6I A;  1XC5 A;  2LLK A;  3CDL A;  3MN2 A;  4X1E A;  4M6V A;  4UUT A;  4FTH A;  3OOU A;  1VI0 A;  1U78 A;  4M3D A;  4J19 A;  1B8I B;  3TP0 A;  4A3M J;  3W6V A;  1MBE A;  2EH3 A;  1UMQ A;  5FKN A;  4XRS G;  3ZQF A;  2LR8 A;  3BTI A;  4D7M A;  2NVX J;  3JR9 A;  1GT0 C;  1ITY A;  1WH7 A;  5C4J J;  2LP0 A;  2FD5 A;  2ME0 A;  3RQI A;  3F0C A;  2QCO A;  2ECB A;  4BY7 J;  2CU7 A;  1VND A;  2DMP A;  3CCY A;  1CQT A;  1JT6 A;  2NOG A;  3GBG A;  1YRN B;  2LY9 A;  1ZTR A;  1GV5 A;  5FLV A;  5IP7 J;  4JP0 A;  1SAN A;  4A69 C;  2I10 A;  3TW6 A;  4G12 A;  1B72 A;  2XB5 A;  4D5F A;  5M3F J;  2XGE A;  3A02 A;  2D5V A;  5IYC J;  2HOT A;  1MBF A;  3QQA A;  1EF4 A;  3NAR A;  5IP9 J;  2ID6 A;  3FIW A;  2EQR A;  3WHC A;  2CQX A;  4RBO A;  3IH4 A;  5GPC A;  5M5Y J;  3BR3 A;  4MO7 A;  3BTC A;  1P7J A;  1RKW A;  2XGD A;  3HOZ J;  2HDD A;  2E2I J;  5IPA A;  2K9N A;  1F36 A;  3SDG A;  3TED A;  1WGX A;  2DMN A;  1IGN A;  4GFB A;  5J1R A;  5EF6 A;  2JA5 J;  2HYJ A;  1RES A;  5IP6 A;  1UHS A;  2Y9Y A;  3ZQG A;  5FJ8 J;  2DA3 A;  1IC8 A;  1ZR4 A;  4M3F A;  3GTQ J;  2ECC A;  2Y2Z A;  4FCY A;  1ETV A;  3JRI A;  2O9L A;  1TWA J;  1D5Y A;  5BNG A;  2L9R A;  4M3E A;  4A3L J;  2WAQ N;  1ENH A;  1U9O A;  4BBS J;  2JA8 J;  1JUS A;  3FKI J;  5M5W J;  2EZH A;  2L7M P;  1QVU A;  4C3H J;  1K61 A;  3GTO J;  3HOU J;  2E19 A;  3G1O A;  1WPK A;  2FQ4 A;  1B8I A;  3HM5 A;  1LE8 B;  2M0C A;  4A3F J;  1G2H A;  3H0G J;  1OCT C;  3SJM A;  4JYK A;  3LNQ A;  4DYR A;  3HOV J;  3S1M J;  3A01 A;  3IH3 A;  3C2B A;  4I6Z A;  4V2F A;  2DN0 A;  1X2N A;  2DTZ A;  1TWF J;  1FJL A;  1FIA A;  1IJW C;  1MBJ A;  3FIS A;  1PUF B;  2M9H A;  5FKL A;  4A3E J;  5E3L A;  1W0T A;  3BTJ A;  4I76 A;  2VKV A;  3RZO J;  1F43 A;  3S1R J;  3GTG J;  2JJ7 A;  1ORK A;  2NVT J;  3H3V K;  1DU6 A;  3JRF A;  1RPW A;  2W48 A;  3CMY A;  1JKO C;  3FK6 A;  3S15 J;  1IRZ A;  4EEF G;  1T33 A;  3BR6 A;  5EYR A;  1APL C;  5EEA A;  1WCM J;  1T56 A;  2FJ1 A;  3BT9 A;  1TWG J;  2K9S A;  4XID A;  3LOC A;  2E2J J;  2H1K A;  1IDZ A;  5F0C A;  2RAE A;  2B63 J;  2VUM J;  2GBY A;  3S17 J;  4NDL A;  1OJL A;  1QVT A;  1JUP A;  2HOS A;  4QTR A;  3Q0U A;  4A3I J;  1E3O C;  4L5E A;  1XG1 A;  2IBD A;  4FIS A;  3A01 B;  2IEK A;  4QIW N;  1R9T J;  5J3L A;  2LVS A;  1OCP A;  2WV1 A;  2CUE A;  5K7F A;  3BTL A;  2VPR A;  1MBK A;  3DEW A;  2LKX A;  1JGG A;  3GTP J;  3CQZ J;  1ZR2 A;  2EZI A;  4IHY A;  2YS9 A;  2PMZ N;  2M8G X;  3QPL A;  5JLW A;  3QPS A;  2JA6 J;  2FX0 A;  5C3E J;  5F0F A;  2M2E A;  3M4O J;  1LE8 A;  5F04 A;  1H89 C;  1UG2 A;  2ID3 A;  2M34 A;  1FEX A;  3PM1 A;  1ETO A;  2HQ5 A;  3Q0V A;  3WHB A;  1DU0 A;  1RKT A;  4DZP A;  1VF9 A;  3LSG A;  1AKH B;  3E7L A;  1QRY A;  3BR5 A;  3S2H J;  3SFI A;  4M3G A;  2TRT A;  5EG0 B;  5HOD A;  2DJN A;  1PUF A;  1IUF A;  1SFO J;  1JKR C;  1GV2 A;  1MNM C;  4AYB N;  2DMU A;  2DA6 A;  3ZQH A;  1ETY A;  3BG3 A;  4XIC A;  4BXX J;  2OF7 A;  2HXI A;  2X9D A;  5K7H A;  4MIM A;  3B6A A;  3IV5 A;  1I50 J;  3BG5 A;  4DW6 A;  2XRL A;  2QF7 A;  3I4M J;  4IHX A;  1I3Q J;  2CQQ A;  4HNV A;  4A3D J;  5FKM A;  4DYQ A;  4A3G J;  3HOY J;  2R7Z J;  3BQY A;  1GDT A;  4XRM A;  5FKK A;  5E3M A;  1TWH J;  2O7O A;  5E3N A;  1ETQ A;  3G1M A;  4DYC A;  2G0E A;  4AC0 A;  2LK2 A;  3BR0 A;  2XGC A;  2K9Q A;  3K7A J;  9ANT A;  5EZG A;  1GVD A;  3BG9 A;  1H8A C;  3JRH A;  3PO2 J;  1RR7 A;  4W97 A;  2XPU A;  2YUS A;  3BR2 A;  5IOY A;  4IEJ A;  3PO3 J;  2DA2 A;  1BW5 A;  4C3I J;  3HGG A;  2R5Y B;  1ETX A;  3ZQC A;  4IHW A;  4BY1 J;  3S14 J;  1HF0 A;  1WI3 A;  2OPT A;  4A3J J;  1IV6 A;  4S0H B;  2JK3 A;  1Z0X A;  5C44 J;  1Z77 A;  3FK7 A;  3DCF A;  3GTJ J;  2Y9Z A;  1TWC J;  5J1Y A;  3S16 J;  1POG A;  2DMT A;  1FTZ A;  3OSG A;  4AUX A;  2MSY A;  2R5Z B;  1AKH A;  2LTP A;  2O8K A;  1X58 A;  3JRD A;  1BW6 A;  1HDD C;  2ZB9 A;  2NVQ J;  4BKX A;  5DS9 A;  2WB1 N;  4C2M J;  5EG0 A;  5JLX A;  4XRS A;  1Y1W J;  3JRA A;  3JRG A;  2X48 A;  4DZJ A;  3ZQL A;  5M5X J;  1P7I A;  3B6C A;  2Y31 A;  2CJJ A;  1IDY A;  3LSJ A;  1MH4 A;  2ELK A;  1U8B A;  4LOC A;  1BA5 A;  1GUU A;  4W1U A;  2N8G A;  2DA5 A;  2JWT A;  1ZK8 A;  2VI6 A;  5EDN A;  3IH2 A;  4CYC B;  4UUS B;  2Y30 A;  2XPV A;  5GPA A;  3RZD J;  1VFC A;  3K2A A;  5EGO B;  4MFE A;  1FIP A;  1JTY A;  2LD5 A;  1MSE C;  3HBL A;  4M3B A;  3HEF A;  3JRB A;  2HXO A;  1MBG A;  3I4N J;  1W0U A;  3HGY A;  1HOM A;  3BR1 A;  1LFU P; 
#chains in the Genus database with same CATH topology
 1ZEL A;  1R23 A;  2AQF A;  4QSH A;  4UXN A;  4ESB A;  3LFU A;  3RCO A;  3HG9 A;  2M4G A;  3DPT A;  3GTK J;  2CUF A;  2E35 A;  4IOC F;  2FBK A;  2W57 A;  3UKG A;  2PEX A;  2CH0 A;  4BAC A;  1ZLK A;  3WG9 A;  4IRI A;  1X19 A;  3CTA A;  3VPR A;  3DKW A;  4RLF A;  2H8W A;  4F3Q A;  1JJ6 C;  3Q0W A;  2PJR A;  2W25 A;  2ZNY A;  4PGG A;  1HST A;  2NYX A;  4MFD A;  1SAX A;  4BDZ A;  1T6S A;  2A07 F;  1IZ1 A;  2L54 A;  2O5R A;  3WU0 A;  2LDU A;  2ME6 A;  3OYG A;  3OR1 C;  4UVB A;  1BIA A;  2HWV A;  4ANJ A;  1U2W A;  1R00 A;  1MMA A;  1V5E A;  1KYW A;  4B1R A;  1R5H A;  1E17 A;  4Z2Y A;  2VXZ A;  2EIK H;  3HTS B;  3G1L A;  4Q4Z F;  3CES A;  4J00 A;  5J8F A;  2R5Z A;  1WJE A;  1SFE A;  4FE7 A;  2VJ5 A;  2O8X A;  4FX0 A;  4XON A;  4R8H A;  4MLO A;  1MSF C;  2M5W A;  1O3S A;  2P5L C;  3DQV C;  4I98 B;  4RAG A;  3F8F A;  1BI1 A;  1UB9 A;  2VKE A;  4JX6 A;  1JT0 A;  5F1J A;  1IRG A;  2DMQ A;  3C2H A;  2LBF B;  3OYB A;  4NQW B;  4G6Q A;  3AL0 C;  5IOZ A;  3DLL F;  2IAI A;  2XC7 A;  1ETW A;  2DO7 A;  2VN2 A;  5FRM A;  3LWF A;  5DCF A;  3ZRG A;  3RKX A;  1FOK A;  2UV1 A;  4F93 B;  1H88 C;  3J81 Z;  5DDG A;  2HI3 A;  5CVV A;  1TTY A;  2KDZ A;  2DA1 A;  1XS9 A;  3ZMZ A;  3HOS A;  1IXC A;  4P9U A;  2FMY A;  4Y4R A;  4XKC A;  1T8I A;  1YE9 A;  2EFO A;  2L7F P;  1S9H A;  3OS0 A;  4KMF A;  4OIP F;  4RAY A;  3K4M A;  2R92 J;  1ZGW A;  4PZJ A;  2Q0O A;  2RNG A;  5HS9 A;  3PSI A;  2DK5 A;  3GTM J;  1V4R A;  3LFK A;  1ONV A;  4EJW A;  3PNT A;  3I59 B;  5K7Z A;  2WC2 A;  2L0K A;  1ETK A;  2DA7 A;  2DYR H;  2F5F A;  4BJT A;  3VYS B;  2CV1 A;  2A5W A;  2HZD A;  4JOM A;  1AU7 A;  3K4K A;  5KHD A;  2EA4 A;  3QP6 A;  4LLL A;  1WJA A;  4XLA A;  4XLF A;  1XDU A;  2Y0S N;  3CMM A;  3VEP A;  2JA7 J;  2EZL A;  4B3A A;  3F8C A;  1LNW A;  1HSJ A;  3BZ6 A;  5KAI C;  4HDU A;  3ASO H;  3VDX A;  2Z9O A;  3WE2 A;  1ZH5 A;  5GP9 A;  4NUB A;  5JVG F;  4A6E A;  4C3J J;  2VXD A;  1PVE A;  3OIO A;  3HOX J;  5FO5 A;  2DK8 A;  4X1E A;  4DJA A;  1IAW A;  1BM9 A;  1VI0 A;  3FXR A;  3G3Z A;  4RA2 A;  1B8I B;  4A3M J;  4U7B A;  1EKE A;  2VOO A;  3FXJ A;  2EH3 A;  2LR8 A;  2E71 A;  3LAJ A;  4XRF A;  1BOB A;  2QEX I;  1ITY A;  2OCC H;  3K9T A;  1YIO A;  3OMY A;  3WTZ A;  2FD5 A;  2LBF A;  4NQW A;  1W5S A;  2R7Q A;  3NWT A;  2VJ4 A;  1X4P A;  1FX7 A;  1VND A;  5CJ9 A;  1VQP I;  5F64 A;  1CQT A;  2NOG A;  2JA2 A;  3HSE A;  3RYR A;  4OIO F;  4UNO A;  2DOA A;  1GV5 A;  3R0A A;  1NHA A;  5E8G A;  4CCL A;  5LGU A;  3UR3 C;  4XLP F;  4PUS A;  4XSZ F;  2H6C A;  2I10 A;  4ZDO A;  3M1E A;  3A02 A;  5L3F A;  2HOT A;  1F5T A;  1MBF A;  2CW8 A;  2H94 A;  3H5A A;  2ID6 A;  3GO5 A;  4CDG A;  3DLA A;  3WHC A;  3FXL A;  2CWE A;  3I56 I;  1PDN C;  5M5Y J;  3BR3 A;  4MO7 A;  1FBS A;  3MZY A;  4O5V A;  3HOZ J;  5JI6 A;  3P9C A;  1MD0 A;  3I59 A;  1IGN A;  3K6G A;  3W2V A;  5E18 F;  2QM3 A;  5ILU A;  2LF7 A;  4BXF A;  2HYJ A;  4OIR F;  3HIF A;  3J81 K;  1UHS A;  1C0W A;  2DA3 A;  4AIH A;  4M3F A;  2CGP A;  5BS6 A;  2PFB A;  1Z05 A;  1S6L A;  3ABK H;  2IA1 A;  3GFI A;  1SMY F;  3WG7 H;  4II3 A;  1MJA A;  5BNG A;  3DP7 A;  1ACI A;  2IA0 A;  5CYV A;  4M3E A;  1KZH A;  4EV0 A;  1ENH A;  3D0S A;  2BW3 B;  2V4J C;  3OYF A;  2JA8 J;  2NVU B;  4ZDL A;  2WAE A;  2FA5 A;  1MMN A;  4CZC A;  1Y8R B;  5M5W J;  3EYY A;  3E6M A;  3G1O A;  3RPU D;  1G4D A;  4O6J A;  2O0Y A;  4KIF A;  1B8I A;  1LE8 B;  4A3F J;  1VQL I;  4KN4 X;  2DPD A;  2HR3 A;  1WI9 A;  2K02 A;  3H92 A;  4L5J A;  4LLN A;  2OZ6 A;  4YEL A;  4IXA A;  2FU4 A;  4I6Z A;  2QYO A;  2ZXI A;  2DN0 A;  3HYI A;  4M74 A;  4P1W A;  2JSC A;  1LPQ A;  2DTZ A;  2EIN H;  1IJW C;  1JGS A;  1W0T A;  5E3L A;  2JTV A;  2DCE A;  1E3H A;  1ZG3 A;  1ORK A;  2E1M C;  2YPR A;  3M8F A;  4IRH A;  2MA3 A;  2PMU A;  2F4O B;  3ESW B;  3LL7 A;  4HEA 2;  4P5O A;  4WXD A;  3JRF A;  2C6Y A;  1DUX C;  3LQR A;  3E5X A;  2BE5 F;  4ZZL A;  3FMQ A;  3EET A;  2EA2 A;  3K2Z A;  4M9Z A;  2IW5 A;  3OIP A;  1B9N A;  1T38 A;  5EYR A;  5EEA A;  2K85 A;  3CC2 I;  1D8K A;  2FJ1 A;  3EYI A;  4IHT A;  4L5I A;  2KP6 A;  1OCC H;  2L9V A;  4WF2 A;  2V1X A;  5LHI A;  1IDZ A;  5F0C A;  3BRO A;  2CG4 A;  2GZW A;  4XKV A;  2B63 J;  3KET A;  2VC1 A;  3BCA A;  4IJA A;  4NDL A;  3QPH A;  4YFN F;  1QVT A;  2R7U A;  2ADU A;  1RIO H;  4E4H A;  1RNL A;  2HOS A;  2NAZ A;  4ZH4 F;  3CLO A;  4L5E A;  5E1X A;  3KEQ A;  4KNY A;  2IEK A;  1FSH A;  3GLL A;  4M73 A;  3GXO A;  4QIW N;  4XLC A;  4XOT A;  3F21 A;  2LY1 A;  3IUO A;  2E7X A;  1NG6 A;  1CF7 B;  1LEA A;  4CCO A;  2BW3 A;  2D2W A;  3G73 A;  2NNY A;  1KON A;  3DEW A;  1MBK A;  1N25 A;  1YX3 A;  2CW0 F;  1R71 A;  1AOY A;  2BHZ A;  1X1A A;  2DT5 A;  1H0M A;  1IF1 A;  2LF8 A;  3M4O J;  1XSX A;  2M2E A;  1YLF A;  3KPH A;  1LE8 A;  1QGP A;  1O3R A;  1UZC A;  2M34 A;  3DKY A;  1SD4 A;  3ML6 A;  1DU0 A;  4P96 A;  2L02 A;  4B3X A;  4HNU A;  3LSG A;  1BBY A;  3V8L A;  4G7H F;  1B6A A;  4M9S A;  4PDK A;  3SFI A;  4GXO A;  4HQM A;  3PFY A;  3PFI A;  4LB5 A;  4I01 A;  2XAF A;  2DMU A;  3ZQH A;  4E7H A;  2GOX B;  2BVL A;  5FFX A;  3F8M A;  1ZRF A;  1STZ A;  4MNU A;  1EA3 A;  3B6A A;  3IV5 A;  2EV0 A;  3W6K B;  2A3S A;  2XRL A;  2MBF A;  4ASN A;  1I3Q J;  3ZQ7 A;  3RPQ A;  4B48 A;  2CSO A;  1N77 A;  4BUP A;  4DYQ A;  4A3G J;  1KU9 A;  2R7Z J;  3BQY A;  3QPT A;  1F9N A;  5LGN A;  2XKO A;  4HYE A;  5KNL A;  1MMS A;  1G3T A;  4M9X A;  4KIC A;  4MGR A;  3G1M A;  2G0E A;  2ZSH B;  1MJB A;  2LK2 A;  3W6J B;  1JI8 A;  1S5L C;  2K9Q A;  2JVH A;  1BI3 A;  3WTT C;  3EUH C;  1MGT A;  2PQ8 A;  1PJR A;  3BG9 A;  2DOE A;  3PO2 J;  2AQE A;  1U6G A;  2IGN A;  2WBM A;  2OZU A;  3BR2 A;  2V9V A;  3CO6 C;  1YOV B;  1Z6R A;  2VBX A;  2VPL A;  1ETX A;  3K4N A;  3ZQC A;  1QZY A;  1CF7 A;  3S14 J;  3WTU C;  2HZT A;  1TT5 B;  1VQO I;  4S0H B;  3M8J A;  3GW2 A;  2G9W A;  3WOD F;  2R7W A;  3FXO A;  1OYW A;  1T39 A;  2F48 A;  3F72 A;  3DPU A;  3FK7 A;  3DCF A;  5H20 A;  5D5U B;  1D0X A;  2Y9Z A;  3HRT A;  2HOE A;  2STT A;  3CJN A;  1TWC J;  3S16 J;  2DQL A;  2EFN A;  1OPC A;  2HS5 A;  3IKV A;  4HV6 A;  3K70 C;  5HLH A;  3SDB A;  2LRD A;  3GFM A;  4BDY A;  1B4A A;  2KMU A;  3CUO A;  2HPI A;  3J7A O;  2LOO A;  3GLX A;  2DBB A;  3B6C A;  2Y31 A;  2CJJ A;  3P7N A;  1IDY A;  1ZGA A;  2A69 F;  4PSX A;  3LSJ A;  1XB4 A;  2ELK A;  1L3L A;  3KP2 A;  3HXL A;  1BA5 A;  1J5Y A;  2M4K A;  4W1U A;  2BV6 A;  2N8G A;  2JWT A;  5LFA A;  1ZK8 A;  2O03 A;  2HDC A;  2ZC2 A;  2VQH A;  1SD7 A;  5LGT A;  1SFK A;  4UUS B;  4EJU A;  1MND A;  2XPV A;  3AKZ A;  2EV5 A;  1FIP A;  2XIG A;  2R7T A;  3X2Q H;  2LD5 A;  1MSE C;  2UUZ A;  4M3B A;  3HPH A;  4G94 A;  3J7A Y;  5AON A;  3IAM 2;  4AYB A;  3I4N J;  4XL9 A;  1W0U A;  2NNN A;  4Y17 A;  3TOB A;  2QQA A;  3MWM A;  2J5O A;  3MFK A;  2P81 A;  2KIU A;  4ZZD A;  1YJN I;  4BBR J;  2E34 A;  2BXY A;  4D1Q A;  2BY2 A;  1LFB A;  4UV9 A;  1Y1V J;  3ZP5 A;  1I1S A;  2X6Y A;  2E2H J;  3BG7 A;  3KCC A;  5EZH A;  3KP5 A;  1NTC A;  3M9A A;  2JMW A;  1DGW Y;  3WTY C;  3OSF A;  2Q2E B;  3VYT B;  3HOT A;  2DOF A;  5BMZ A;  4HBL A;  5HNF A;  3LSR A;  4RDU A;  2WAQ A;  3L2Q A;  2R0Q C;  3S93 A;  4UUV A;  3JRE A;  4E7L A;  3WTV C;  4A2U A;  4CGZ A;  1OFC X;  4BGD A;  5JHU A;  3BQZ A;  2FML A;  3N97 A;  2MLG A;  4AID A;  4NHJ A;  3O8G A;  1QPI A;  4V2G A;  3TBI A;  2M3A A;  2I5U A;  3ONQ A;  1QHH D;  5F08 A;  1W36 D;  1I5Z A;  1G3S A;  1WSU A;  1K83 J;  1X3W B;  3MKL A;  2HOA A;  2R7O A;  3OYL A;  2F4I A;  4U0W A;  4XKB A;  3LSP A;  2W7N A;  1R58 A;  3CC4 I;  2LC2 A;  2W82 A;  2XV4 S;  4HX7 A;  2XGX A;  2F2E A;  2LYC A;  5K5O A;  3WTX C;  1FYM A;  5ILV A;  3K1M A;  1OKR A;  2P0W A;  2B9S A;  3OS2 A;  4CO8 A;  3MCZ A;  3GUD A;  2NS7 A;  2W00 A;  4LLG F;  4B4C A;  1FMV A;  2L7Z A;  2OCE A;  2XDV A;  4UUS A;  2XRO A;  1H9T A;  1BL0 A;  3MQ0 A;  4S04 A;  2XPW A;  1K7A A;  2WB1 A;  1ZKG A;  3V7S A;  1XDS A;  2VC0 A;  1SFU A;  2BVM A;  1LB2 A;  4G7Z F;  1ZHF A;  5J1U A;  2O6G E;  1HDP A;  2IT0 A;  3GZN B;  4HLY A;  4C2T A;  1ZYR F;  2AHQ A;  2XKP A;  4D7N A;  3GTL J;  1SC7 A;  4I02 A;  1P2F A;  1YX5 A;  3PL8 A;  3S8P A;  2ZXW H;  2KZV A;  3KE2 A;  4L9V A;  3W2W A;  3H9J A;  1X1P A;  1XSD A;  2Q2E A;  2GIZ A;  4CXF A;  1R4M B;  4BQN A;  1FTT A;  1KU3 A;  4JX5 A;  4OOI A;  3OR2 C;  4Y52 J;  5FKO A;  2CV2 A;  2QQ9 A;  1HQC A;  2IA2 A;  4Y7N J;  1SAU A;  4RMN A;  1FZP B;  5B3S H;  1BR4 A;  3K4B A;  4LK1 F;  2XRN A;  3SZP A;  3AG3 H;  4KMU X;  1MW7 A;  2EZK A;  2FNP A;  1XX5 A;  1QU3 A;  1S8N A;  2PMZ A;  2VBY A;  3TP3 A;  3E5Q A;  4XOP A;  2MLK A;  3MMY B;  1A6I A;  1XC5 A;  2LLK A;  2Z5U A;  3FXK A;  5HS7 A;  5TIS C;  4ESJ A;  1Z21 A;  3ABM H;  4M6V A;  4UUT A;  4M3D A;  4BQO A;  1Z3X A;  1UST A;  2B0L A;  2KZG A;  3W6V A;  2XHK A;  3ZQQ A;  1LDJ A;  1MBE A;  5FKN A;  1UMQ A;  4E7K A;  4Y33 A;  1YHQ I;  3SYT A;  3JR9 A;  4KUM A;  4RM3 A;  2IS6 A;  5J8C A;  4AU7 A;  1WH7 A;  1P92 A;  5LD2 C;  2HDW A;  2QWW A;  4IHS A;  4BHC A;  4JBA A;  3RQI A;  4PCQ A;  1O7L A;  1OQY A;  4BY7 J;  5LHH A;  1KQ9 A;  3CCY A;  3A0H C;  1K4T A;  1JT6 A;  4BU2 A;  2ZFU A;  1F4K A;  3GBG A;  2DFE A;  2KPM A;  2BY1 A;  5FLV A;  2V9K A;  1MZB A;  1XTA A;  5IP7 J;  1SAN A;  2EWN A;  3OYA A;  4WX9 A;  3I3L A;  3IRQ A;  2GQQ A;  2BYV E;  5E20 A;  3V8J A;  1E2X A;  1VQ9 I;  5CVI A;  2GA1 A;  1IN5 A;  3ISP A;  3FIW A;  2EQR A;  3FF5 A;  1J2X A;  1U5T C;  3IH4 A;  2QQ8 A;  2H27 A;  1VQN I;  2Z99 A;  2EIJ H;  4U88 A;  5HLG A;  3BTC A;  1MDM B;  3H35 A;  3L9F A;  3LSH A;  4FAS D;  1VQ7 I;  2HDD A;  5H6Q A;  3I53 A;  2E2I J;  4NNJ A;  3CCE I;  1F36 A;  2ZJP F;  3TED A;  3KP6 A;  2DMN A;  3FHN A;  3TO6 A;  5EF6 A;  4N0B A;  2JA5 J;  2RRE A;  1BI0 A;  1RES A;  2DW4 A;  3UNG C;  2VOP A;  2P5K A;  2DT7 B;  3BJO A;  3ZQG A;  3FM3 A;  1VQK I;  2PI0 A;  4KN7 X;  2L9S A;  1KA8 A;  1HC8 A;  1TQP A;  1OYI A;  2Y2Z A;  3CF5 F;  2CUJ A;  4YIR X;  3BJA A;  4EGZ A;  1MKM A;  4LIU A;  2GOM A;  2HTS A;  5IT3 A;  1I3A A;  4BH9 A;  4UY8 I;  4HQE A;  3SQN A;  1XMX A;  3WGH A;  3V7C A;  1IW7 F;  3C7J A;  1NH3 A;  2H6B A;  1QO0 D;  2VT2 A;  3HRM A;  2BGC A;  3FBI B;  5CVJ A;  3GCM A;  3MKW B;  1JUS A;  1D1A A;  3CUQ B;  1ON1 A;  5JFR A;  4AIJ A;  2L7M P;  3HOU J;  3BCB A;  4B09 A;  2RDP A;  1TZL A;  3COA C;  1UFM A;  4ETS A;  2FQ4 A;  3HM5 A;  1BC7 C;  3T8R A;  2FE3 A;  3LST A;  2ZJQ F;  5FD5 A;  1WHU A;  2JT1 A;  1YI2 I;  3H0G J;  1OCT C;  3R60 A;  4JYK A;  1R5I D;  2OV7 A;  1O3Q A;  1W36 C;  3KYD B;  5H6R A;  3A01 A;  2A6H F;  1HW5 A;  4L0Y B;  1UJ8 A;  3CJQ B;  2K3F A;  1FIA A;  2CW7 A;  4UVC A;  4N9H A;  4GYI A;  1KU2 A;  2M9H A;  5FKL A;  1Y39 A;  2LNB A;  5HVQ C;  2BOL A;  3BTJ A;  4EAT A;  5JHF A;  3RZO J;  1HW1 A;  4XSX F;  3B02 A;  3S1R J;  2IS2 A;  1RRJ A;  2JJ7 A;  3DF8 A;  3FMR A;  2NVT J;  3CZ6 A;  2R7X A;  3H3V K;  2ZCW A;  4KIS A;  1DU6 A;  1WVR A;  3D5L A;  1MMG A;  2ELH A;  3U2R A;  4HOB A;  4OIQ F;  2W48 A;  1HBX G;  4G6T B;  2QSF X;  2KFD A;  5HS8 A;  5JR3 A;  1T0F C;  5D6F A;  3O3K A;  1MJ9 A;  3H36 A;  2VT3 A;  1WJD A;  3P5J A;  3E0J B;  3FBN B;  1I39 A;  4YG2 F;  2KLO A;  3U1D A;  1MDM A;  5DEQ A;  3BT9 A;  2K4J A;  4ZYE A;  2K9S A;  3LOC A;  2GXA A;  1TNT A;  2KQR A;  1J9I A;  3EUA A;  5D6E A;  3S17 J;  1D1B A;  2BZT A;  5KVR A;  1VQ5 I;  3RTR A;  3ZN0 A;  1VQ8 I;  1WJ5 A;  2XAG A;  4FIS A;  3C18 A;  2W84 A;  2DFI A;  3J80 Z;  1VZ0 A;  4L9J A;  2X85 A;  3NWS A;  1D0Y A;  1R9T J;  5HLT A;  3LA7 A;  1X3U A;  2Y69 H;  5FFZ A;  3TMO A;  3G6E I;  2ZBK A;  3KP4 A;  2HYG D;  3F6V A;  1OCP A;  3QRF F;  3QYF A;  5EEG A;  2XVC A;  3BTL A;  3MAJ A;  3CUQ A;  4HX4 A;  3DBR B;  3CQZ J;  2HU9 A;  1TL8 A;  4OAY A;  1ZR2 A;  2D1V A;  4IHY A;  2YS9 A;  2HYF A;  3QPL A;  3DU5 A;  1O57 A;  5JLW A;  2JA6 J;  2V79 A;  1MMD A;  1FC3 A;  2HPM A;  1FP2 A;  3ECO A;  3DU6 A;  1EJ9 A;  2QKM B;  4IL6 C;  2VKH A;  5E79 C;  1LVK A;  2R3S A;  3DEE A;  1VF9 A;  3E1S A;  4PJN A;  3VOD A;  1DP7 P;  2M8E A;  2K9L A;  4FET A;  4M3G A;  2HQN A;  5EG0 B;  1WZ2 A;  4HZF A;  4IRG A;  3RDI A;  2OJE D;  3KX2 A;  3A4C A;  2RN7 A;  3R0J A;  5GAD J;  1SFO J;  1JKR C;  4BYY A;  2M45 A;  3MEX A;  5LEK A;  4YRV A;  4B44 A;  3M8E A;  1UAA A;  2QQB A;  2X1D A;  2F5E A;  1FPQ A;  2DFF A;  3JAM Z;  3N4M A;  2X9D A;  5K7H A;  5GAH J;  5K1Y A;  2XF5 A;  2DPU A;  3LSK A;  4HPQ A;  1UEL B;  3FXQ A;  3KYC B;  5FRO A;  4DW6 A;  5TRD A;  4IHX A;  3I4M J;  1T08 B;  2CQQ A;  4BJ5 C;  4EMS A;  1IO2 A;  1T98 A;  2QA4 I;  4QPO A;  1A36 A;  4A3D J;  5FKM A;  5E17 F;  1Z7L A;  1SFX A;  4CYD A;  3SZG A;  1FOW A;  4B47 A;  2IS4 A;  3GVA A;  2BY0 A;  4JQF A;  4ITV A;  3IHU A;  1ZAO A;  4KA4 A;  1TWH J;  2O7O A;  5D5V B;  5E3N A;  3IC7 A;  1OCZ H;  1ETQ A;  3PNY A;  4DBR A;  4ZYA A;  5LRR A;  4E6K G;  3K7A J;  3K70 D;  4RGR A;  3SFZ A;  1QZZ A;  3GEZ A;  4E7I A;  1ZRD A;  1V54 H;  2XPU A;  3TKY A;  2YUS A;  4OIN F;  1BC8 C;  2ISY A;  3OIQ A;  3PJR A;  2YU3 A;  2NS0 A;  3E97 A;  5IT9 Z;  5DM7 F;  3WGG A;  3GZ5 A;  2DA2 A;  3PUF A;  3IWF A;  3OYC A;  4HF1 A;  2V9P A;  4CA0 A;  4C3I J;  3QAH A;  2R5Y B;  1YS7 A;  2Z2S B;  4I99 C;  4BY1 J;  1WI3 A;  2OUM A;  1IV6 A;  4O3M A;  3KZI C;  5L3E A;  5C44 J;  3S3N A;  5FGM A;  1X1D A;  3BPX A;  2VQG A;  3L00 A;  3RYP A;  2UWM A;  4R79 A;  4MHG A;  3JCU C;  2FBI A;  3EUH A;  3E5U A;  1YW7 A;  1POG A;  4YEJ A;  1FTZ A;  3OSG A;  2MSY A;  2O8K A;  3J80 K;  1HDD C;  1IXR C;  1BW6 A;  2HKX A;  3NQO A;  1Y8Q B;  5DS9 A;  2RNJ A;  3K4L A;  2EIL H;  4C2M J;  1WJB A;  3KLN A;  4M6X A;  5EG0 A;  1PP7 U;  1ZGJ A;  1Y1W J;  3BLY A;  3JRA A;  5HLI A;  2ZO4 A;  1XGO A;  2ZXH A;  4LIT A;  3FKJ A;  3JRG A;  1FT9 A;  1TQM A;  4RLQ A;  1U3E M;  1YFH A;  1N78 A;  3L2C A;  1GXP A;  1HKT A;  2CFX A;  3GFJ A;  3WU2 C;  1BIB A;  1I1G A;  2P8T A;  1Z3Y A;  2DLL A;  3L2W A;  4M72 A;  5EDN A;  4E7S A;  2DQR A;  3DEU A;  2P4W A;  5CQE A;  3WGI A;  3OYN A;  3FDY A;  5HOO A;  2JRM A;  4E70 A;  3MKY B;  3F8N A;  3E6B A;  1WWX A;  3RPU A;  3A2K A;  1XCV A;  4LIV A;  1S3J A;  3OS1 A;  1R6R A;  3HBL A;  3HEF A;  4EJO A;  1XGN A;  3JRB A;  4I0A A;  2UXN A;  1FBQ A;  2ZME C;  1R1T A;  1RUN A;  3ZPL A;  3JW4 A;  5F1R A;  3OYM A;  1LFU P;  3CC7 I;  3S1N J;  3FXU A;  5L3B A;  2X4H A;  3JAM K;  2XB0 X;  2YR2 A;  2GLO A;  5B1B H;  1MBH A;  1Y56 A;  1O3T A;  4V19 K;  1T2K A;  4Q5S F;  1R49 A;  5HDN A;  3JRC A;  3I58 A;  3P9I A;  2I8D A;  3QOE A;  3RSN A;  4BAY A;  3FWE A;  5D8K B;  1EH6 A;  2WTE A;  5H2F C;  1Y0N A;  4IZZ A;  4A3C J;  5J6X A;  5LLQ A;  3L1P A;  1XPX A;  4Y13 A;  2R5Y A;  1AHD P;  1W7P D;  3OL3 A;  5K5R A;  4UHT A;  3F3X A;  4A0Y A;  4UB6 C;  2VAS A;  3K4C A;  1YIT I;  2EK5 A;  4NC8 A;  2CQ7 A;  4XBF A;  2FNA A;  4AWX B;  4BHP A;  5JVT A;  2KHM A;  4YFX F;  4KT5 C;  2KIQ A;  3QYB A;  4IOA F;  4ZYG A;  2NS8 A;  3ULQ B;  1UHM A;  2GM4 A;  2COB A;  1OR7 C;  4U87 A;  2FOW A;  4F55 A;  3D1N I;  2GA2 A;  4C9Y A;  2MG4 A;  2ZFW A;  5IT9 K;  2KKO A;  4XK4 A;  4CHU A;  2IGM A;  5IYD J;  1JUM A;  5AIQ A;  1FY7 A;  2R7F A;  4D5C A;  1DGR M;  3HKZ N;  3VSK A;  2TDX A;  2QBY B;  3RIR A;  2E1O A;  4A3K J;  3O6B B;  2KJC A;  1E3P A;  3ELK A;  5KAF C;  4EM2 A;  1MH3 A;  4HF0 A;  5DD8 A;  5E3O A;  2STW A;  4A93 J;  1OLT A;  1VQ6 I;  3CCM I;  4MQ9 F;  3DTE A;  2CRG A;  1S7E A;  1I6H J;  3I64 A;  4RB0 A;  5FLM J;  2IPQ X;  2EBI A;  1YG2 A;  2RGV A;  4FE4 A;  1IG7 A;  2LG4 A;  5DUK A;  3S3M A;  2M30 A;  1A5J A;  3CCR I;  2HVQ A;  3PIO F;  3I0T A;  1LVA A;  1F1Z A;  2M0M A;  3D5R C;  3ZOB A;  2XAH A;  4XOR A;  1JJ8 C;  2MW8 A;  2OA4 A;  1D3Y A;  1R4N B;  1TC3 C;  4DGW B;  3HTU A;  2VOD A;  3HB9 A;  4XM3 A;  4CCK A;  1JKQ C;  4DOZ A;  3S2D J;  3CP8 A;  2VBW A;  3KFW X;  4P9F A;  5CLS A;  3HPG A;  3CCL I;  2AS5 F;  4X0G A;  3ZMT A;  2MFZ A;  3HRS A;  3A03 A;  4PJ0 C;  2ACJ A;  1NG7 A;  3S1Q J;  2AO9 A;  2HNH A;  1YRN A;  5GAE J;  1VQ4 I;  1TBX A;  2NXN B;  5C4X J;  2WY7 Q;  2VQC A;  2IJL A;  5F0H A;  2KT0 A;  3TW7 A;  1WKM A;  3R61 A;  2BBY A;  1IRX A;  1BR2 A;  2XSD C;  3Q3S A;  3BY6 A;  1YS6 A;  2K40 A;  3A0B C;  2O61 A;  2CV0 A;  2V7F A;  2KIS A;  5E1Z B;  4HSR A;  5DTD A;  2VE9 A;  2ESH A;  2GAU A;  1U5T B;  3K4J A;  4RAF A;  4KJZ A;  3EUK L;  5D4R A;  4HV5 A;  4NC7 A;  4OMY A;  2NOJ B;  3LA2 A;  3DTK A;  3CDL A;  2Z16 A;  3ERM A;  4GDF A;  3OWT A;  3QYE A;  1U78 A;  3U1K A;  3TL4 X;  3DBH B;  4ZYD A;  4AIK A;  4XQF A;  4KFC A;  2DOD A;  3TP0 A;  2GXB A;  3RI4 A;  1LQ1 A;  3ZQF A;  3U9G A;  5ICE A;  1PYV A;  4D7M A;  2NVX J;  2QBY A;  3E6D A;  3LQQ A;  5C4J J;  4LG3 A;  4XLE A;  5EEH A;  2QZ8 A;  3AL0 B;  2QCO A;  4PJL A;  2LMD A;  2VL8 A;  5GAG J;  5CVU A;  3GZ6 A;  1W4M A;  2XAU A;  4R1H A;  2XAQ A;  4UV8 A;  1KQ0 A;  1ZTR A;  2X51 A;  2QSH X;  4JP0 A;  4A69 C;  2CMP A;  3TW6 A;  4G12 A;  3WTS C;  2XB5 A;  3OYD A;  1ULY A;  4D5F A;  3QQA A;  1EF4 A;  3NAR A;  2WV0 A;  1S72 I;  4HX8 A;  4LFU A;  4N4O B;  4RBO A;  3AAF A;  1YO5 C;  4RGX A;  1KYZ A;  3L7W A;  4A5M A;  3L2R A;  3IKT A;  2DXI A;  1P7J A;  4Z6Y A;  4AM3 A;  1HXD A;  2DDA A;  3MZH A;  2JUG A;  1R22 A;  1WGX A;  3I71 A;  3FM5 A;  2K9M A;  5IP6 A;  2Y9Y A;  5FJ8 J;  1IC8 A;  2P7V B;  1IUY A;  1ZR4 A;  3GTQ J;  2ECC A;  2K4B A;  5HDK A;  3F23 A;  4FCY A;  2EPF A;  3KZY A;  4L0Z B;  2FRH A;  2HVR A;  2O9L A;  4ON0 A;  1TWA J;  2X6X A;  3QU6 A;  4LK0 F;  4I2O A;  1TT0 A;  1U5T A;  2L9R A;  2UXX A;  3I4P A;  4EM0 B;  2WAQ N;  1U9O A;  2L7K A;  3OY9 A;  2FEZ A;  2Y75 A;  4CIC A;  2WAD A;  3CDH A;  2L9N A;  4EVI A;  4WWC A;  2KRC A;  3FKI J;  3ZMV A;  2EZH A;  1QVU A;  3GTO J;  2FQ3 A;  2RV8 A;  3VOE A;  2E19 A;  2OTJ I;  1WPK A;  3G4S I;  2M0C A;  2FOK A;  2K5C A;  4IVN A;  2Z1D A;  4ZDP A;  4U7D A;  3SJM A;  1DP3 A;  3LNQ A;  3IH3 A;  3C2B A;  1X2N A;  4QWQ A;  3PUB A;  4D0P A;  1TWF J;  2DJI A;  3CCV I;  1FJL A;  3DXJ F;  1S29 A;  3HSF A;  4IPA A;  4F7Z A;  2VKV A;  5K5Q A;  3VWB A;  2X0L A;  3ZXS A;  1V55 H;  5DCM B;  3K69 A;  2PJP A;  2KIF A;  2VE8 A;  3LMM A;  3J7Z I;  4I0B A;  1X3Z B;  4M71 A;  1U0J A;  3EPZ A;  1IN4 A;  3FK6 A;  3S32 A;  3HL2 A;  1OCO H;  4OU0 A;  3CLQ A;  4HNT A;  3S15 J;  1IV8 A;  4PSW A;  1A35 A;  4BE0 A;  4H4K C;  1IRZ A;  2AXT C;  3BR6 A;  3MZ8 A;  5CVR A;  4QLC U;  4ZTF A;  3BPV A;  1APL C;  4ESF A;  1WCM J;  1P9Q C;  1T56 A;  2WAF A;  4LB6 B;  2VB6 A;  2ZJR F;  1TNS A;  3LAP A;  4XID A;  5CPR B;  3CCQ I;  2E2J J;  2DU9 A;  4EJV A;  1MIJ A;  4GYG A;  3H3U A;  2RAE A;  2P7C B;  3SHF A;  2GBY A;  5TGT A;  2VKD A;  4QPQ A;  1OJL A;  1XD7 A;  2BHY A;  2D45 A;  4QTR A;  3Q0U A;  1DQU A;  4KIB A;  1E3O C;  2R7R A;  1XG1 A;  3BZK A;  1IRF A;  1LFP A;  4YII A;  3A01 B;  3M1C A;  4OWR B;  3SXY A;  5ICC A;  3M07 A;  1T0F A;  1XGS A;  2K7L A;  2Q8K A;  1ZLJ A;  4Q47 A;  2RQQ A;  4DNC A;  1BOA A;  2K3P A;  3IP4 B;  4L9N A;  4XLH A;  1ZRE A;  2LVS A;  3V7R A;  5LEJ A;  2WV1 A;  1R5G A;  2XAJ A;  4EM1 A;  2CUE A;  4N4N B;  2LKX A;  2F5C A;  3HUG B;  2CUZ A;  3EQL F;  1JGG A;  1FWZ A;  2PMZ N;  2M8G X;  4LG0 B;  4GGG A;  2FX0 A;  2VBZ A;  2W1O A;  4FT8 A;  1UG2 A;  4LD5 A;  3V4G A;  3QWL A;  3PM1 A;  3A1Y A;  1ETO A;  3QU3 A;  4FHT A;  1J59 A;  1YQA A;  3Q0V A;  4I7H A;  3WE3 A;  4DZP A;  5GTH C;  1AKH B;  4XR6 A;  2HEO A;  3E7L A;  1SMT A;  1QRY A;  3BR5 A;  1VTN C;  3KEO A;  5L3G A;  2V6C A;  2TRT A;  2DI3 A;  1YJ9 I;  4A5N A;  1IUF A;  1FYL A;  1GV2 A;  1ZN2 A;  2DA6 A;  2EFP A;  3BG3 A;  2ZJ2 A;  5DCM A;  2E1M B;  2P6T A;  4BEH B;  3GYH X;  2DT6 A;  2MD5 A;  2OF7 A;  2HXI A;  2ZKZ A;  3H3Z A;  4MIM A;  2M7B A;  3BG5 A;  2HQA A;  2QF7 A;  3CJT B;  1WJF A;  2V26 A;  1W1W E;  2JQ7 A;  4IQ4 A;  4HNV A;  3ABL H;  1UCR A;  2RVC A;  2JRT A;  4KT6 A;  2OTL I;  4B43 A;  4IQJ A;  2XAS A;  1XSV A;  1GDT A;  3LSI A;  4RM2 A;  5FKK A;  2ESN A;  5E3M A;  1W5T A;  1HKS A;  3CME I;  3PSF A;  2L3D A;  2DYS H;  2ISZ A;  4DYC A;  4AC0 A;  5BPD A;  4L9T A;  3BR0 A;  3ECH A;  2XGC A;  1RR8 C;  9ANT A;  4MEX F;  4Q48 A;  2KDO A;  1OCR H;  1YYV A;  3F9K A;  2D1H A;  5EZG A;  3H9G A;  4U0Y A;  4OMZ A;  1H8A C;  3JRH A;  1RR7 A;  2Y0S A;  4CH7 A;  1ERD A;  4ENN A;  3T0Y A;  4IEJ A;  4LJZ F;  4IX7 A;  2H09 A;  2EFW A;  3HGG A;  4IF4 A;  3ERE D;  2RKH A;  2JSP A;  1HF0 A;  3KIO A;  4YFK F;  2QEN A;  4MQV A;  4UVA A;  3HUG A;  2JK3 A;  4PK4 A;  3Q9S A;  2ZME B;  3K1P A;  1Z0X A;  2QLZ A;  4LG0 A;  1Z77 A;  3NEU A;  3GTJ J;  5DV5 A;  2IGO A;  3JSP A;  6PAX A;  1GXQ A;  3AG2 H;  3I5U A;  5J1Y A;  1L0O C;  3I54 A;  2DMT A;  2IGK A;  1R1U A;  1B1B A;  1K4S A;  1K78 B;  2Y48 A;  2LTP A;  1AKH A;  2DTR A;  4F92 B;  4II2 A;  4BJ6 C;  3FXM A;  1D8J A;  4I09 A;  1P4X A;  2BY3 A;  3CMA I;  2X48 A;  3ZMS A;  2ICW G;  1QQI A;  4DZJ A;  3ZQL A;  5M5X J;  2G7H A;  2RC4 A;  5L3C A;  5DM6 F;  3RKY A;  2QGU A;  5KCM A;  4BEH A;  1A6Q A;  5FRN A;  1QA6 A;  4HA8 A;  1MH4 A;  5J47 A;  1U8B A;  4IKF A;  2A6T A;  4LOC A;  3TDU C;  3AFH A;  2QSG X;  2O3F A;  4NBQ A;  4CCJ A;  2DA5 A;  3MKZ A;  2VI6 A;  1TLH B;  3IH2 A;  2LKS A;  4CYC B;  3S2W A;  1HW2 A;  2EIM H;  2V6E A;  3ZMD A;  2Y30 A;  3PIP F;  3SEQ A;  2JPC A;  3DPL C;  3RZD J;  3K2A A;  1R36 A;  5EGO B;  1CGP A;  4PFP A;  4MFE A;  1ODD A;  1JTY A;  2FXA A;  2A05 A;  2MH2 A;  2HXO A;  2E36 A;  2Z33 A;  2HVS A;  5A2Q Z;  2R7V A;  1EH7 A;  3G71 I;  1HOM A;  4ZTJ A;  1Z1D A;  3QP5 A;  2VIX A;  2OQR A;  2W85 A;  3BWG A;  3IAS 2;  2A68 F;  3S3O A;  2L4A A;  2OD5 A;  3BP8 A;  3TGN A;  3RKW A;  1ZQ3 P;  2YU9 J;  2NVY J;  3E6C C;  2WWY A;  2RQP A;  1LKX A;  3C2G A;  4K2E A;  3IWZ A;  3OYJ A;  4M6Y A;  1NK2 P;  3REO A;  3RQ4 A;  2ELJ A;  3ZQI A;  3HZJ A;  1IN6 A;  4U0V A;  2TCT A;  3TOA A;  3RKQ A;  1V5F A;  1JTX A;  2DDB A;  2H8R A;  2MGQ A;  2QUF A;  1J7K A;  1GLN A;  1LUJ B;  1V3F A;  3VB2 A;  4ABZ A;  2FSW A;  4G9Y A;  2R7D A;  3O8H A;  2ZME A;  4A0Z A;  5L3D A;  2VLA A;  4MEY F;  4JX4 A;  3FHZ A;  2CYY A;  1LDK B;  1M1E B;  4H0E A;  5EJC A;  2COM A;  3ROU A;  3OL4 A;  1GVJ A;  3GX4 X;  1JKP C;  1X1C A;  1K78 A;  3U21 A;  3KP7 A;  1YIJ I;  4IO9 F;  2OU2 A;  2F4M B;  5CQG A;  3KLO A;  1JE8 A;  3CP2 A;  3ZCO A;  4HRI A;  3NAU A;  2OQG A;  4PGH A;  1J75 A;  4X6A J;  5J4V A;  1W5C C;  1SVM A;  4BE2 A;  1HLV A;  4RGU A;  4HW0 A;  4BXU A;  1O4X A;  2DA4 A;  3CCU I;  2MH9 A;  4P55 A;  5BPI A;  3K1N A;  1BJZ A;  2K27 A;  3SEZ A;  1I27 A;  4HLX A;  1UHW A;  1NK3 P;  4YIF A;  4CYC A;  2WA0 A;  4FQG A;  3VYR B;  5IYB J;  1B72 B;  2VJI A;  1T95 A;  1OR7 A;  4HDV A;  2CQN A;  3OOP A;  2QVO A;  2R93 J;  5EGO A;  3HJE A;  1USS A;  4RB2 C;  3F22 A;  2KIM A;  4BL0 B;  4IHV A;  1RET A;  4BQQ A;  3AG4 H;  4F52 A;  5E1W A;  4KIT B;  2HGC A;  1WQ2 A;  3I55 I;  1EH8 A;  2JN6 A;  3HDD A;  2A5Y B;  2ETH A;  5BQT A;  2JPB A;  2ZNZ A;  2LFB A;  1U9N A;  3V8K A;  3T5X A;  4EGY A;  3ZR8 X;  1FYK A;  1HCR A;  5M3M J;  2YX7 A;  4G6D A;  5KK1 A;  4ZJZ A;  3FX3 A;  4RB1 A;  1YJW I;  3T1B A;  2LY2 A;  4A3B J;  1HA8 A;  3HSR A;  1Q1V A;  3H5R A;  4WXH A;  1A04 A;  4S05 A;  4HST A;  1OMI A;  2MD0 A;  2XF7 A;  3HOW J;  1KGS A;  3ASN H;  4RS8 A;  1J09 A;  1X2M A;  2IXS A;  1B59 A;  5A2Q K;  3MVP A;  3M3Y J;  3OYI A;  2VQL A;  1BI2 A;  1WH5 A;  4DBQ A;  5F27 A;  3W3C A;  4XMY A;  2FF4 A;  4D9J A;  1K6Y A;  2X6O A;  1AWC A;  4E7J A;  3CUQ C;  3CD6 I;  3MN2 A;  3HHG A;  4GO1 A;  4TV7 A;  3WU1 B;  1X4O A;  4A6D A;  3OOU A;  3L2U A;  4FTH A;  3W2A A;  3PQJ A;  4J19 A;  3FZV A;  1XCB A;  3CCS I;  2R4G A;  2Z3Y A;  4LMY A;  3CDI A;  2IRF G;  2X6W A;  1V5G A;  4XRS G;  2HFH A;  3BTI A;  1JXS A;  1GT0 C;  1KU7 A;  1X1B A;  2LP0 A;  2ME0 A;  3B73 A;  3Q5F A;  3ZMU A;  2EB7 A;  1TP4 A;  5AIP A;  3F0C A;  2ECB A;  2CU7 A;  2VJJ A;  2DMP A;  4ENM A;  1O7F A;  2M87 A;  3C3W A;  3KZZ A;  1ZRC A;  5IY5 H;  2PX9 A;  4WCG A;  3BC8 A;  2A6E F;  1W7P B;  2LY9 A;  1HKQ A;  1Z9C A;  1YRN B;  2XUB A;  3DFG A;  3HC7 A;  3DV8 A;  3AG1 H;  4CZZ A;  2LH9 A;  5HDG A;  1B72 A;  3BZC A;  2EJR A;  5M3F J;  2XGE A;  4BE1 A;  5IYC J;  2D5V A;  3I9V 2;  4KIG A;  4G7O F;  5IP9 J;  3HKZ A;  4LGW A;  1XN7 A;  2CQX A;  1G6N A;  5GPC A;  5ICG A;  4CCN A;  1D5V A;  1A31 A;  1RKW A;  3ABU A;  4L18 B;  2XGD A;  4RGS A;  1FNN A;  5DD4 A;  5FD6 A;  2CFO A;  2M1B A;  3R4K A;  5IPA A;  2K9N A;  3SDG A;  4N9I A;  1OIS A;  2X1E A;  1S7A A;  4GFB A;  5J1R A;  4RB3 C;  3BJ6 A;  1REP C;  1P6R A;  4BS9 A;  5FB2 A;  2G7U A;  4F91 B;  2ZSI B;  1J0R A;  3JSO A;  3M7G A;  3F8B A;  1ETV A;  1N75 A;  3JRI A;  5J4Y A;  1D1C A;  1D5Y A;  4C30 A;  1BN5 A;  4PJM A;  1G3W A;  4A3L J;  2LSO A;  1S7O A;  4BBS J;  3OYH A;  4ZYH A;  3LA3 A;  4G8X A;  3H5N A;  2FBH A;  4C3H J;  2E1C A;  1K61 A;  3E3V A;  1SVO A;  5FLX Z;  4GRI A;  3TDZ C;  1G2H A;  4ENJ A;  3CO7 C;  1GHC A;  4DYR A;  2JVG A;  1QBJ A;  3HOV J;  3S1M J;  2R7S A;  1LDD A;  4NB5 A;  4V2F A;  5D4S A;  5D5X B;  4PFO A;  2W24 A;  1FBU A;  4DQ2 A;  1MBJ A;  3FIS A;  3ZN1 A;  1PUF B;  4A3E J;  4I76 A;  1Z6T A;  1F43 A;  2E5Z A;  3GTG J;  1W7P A;  1MNE A;  1Y6I A;  3L2V A;  1G3Y A;  4A12 A;  2J5P A;  5CKT A;  3KYL A;  3MD2 A;  1RPW A;  3CMY A;  1JKO C;  2E7W A;  2NRA C;  1IN8 A;  4BQA A;  1FSE A;  1ON2 A;  4MTE A;  1U8R A;  4EEF G;  1T33 A;  1PP8 F;  3SZT A;  2BEO A;  3DTI A;  2YX4 A;  1ZG5 A;  1XMA A;  3DBL B;  1SD5 A;  5F6F A;  3TO9 A;  1TWG J;  5B1A H;  2H1K A;  3LSM A;  2GIV A;  1TQI A;  1YW8 A;  1YW9 A;  2LKP A;  2VUM J;  4CCM A;  3TQN A;  3ABT A;  4XN0 A;  3FMS A;  4BNC A;  1QNT A;  5ILS A;  1JUP A;  3BOQ A;  1SEU A;  1P4A A;  1FOX A;  1Y0U A;  4FX4 A;  1BJA A;  3GWZ A;  4A3I J;  2PG4 A;  1FMW A;  1PUE E;  2B7E A;  2MC4 A;  2IBD A;  4Y3O A;  4GCV A;  5D5W B;  1ZG1 A;  3T8T A;  1K6O A;  3L09 A;  3O2P E;  1QZE A;  2W4S A;  1VQM I;  3F6O A;  3QOP A;  2OAZ A;  3H0D A;  4HF2 A;  1R1V A;  2LRE A;  3N05 A;  2P5V A;  5J3L A;  4BHB A;  5LRS A;  1Q1H A;  3P9K A;  1G59 A;  2KRH A;  5K7F A;  2HKO A;  2HTJ A;  2VPR A;  4ZC3 A;  3C1D A;  3GTP J;  2V1D A;  2EZI A;  4OAZ A;  1OYY A;  1H9G A;  1DPU A;  4B8X A;  3QPS A;  2YSR A;  5ICF A;  3VYU B;  5F0F A;  2X1C A;  5C3E J;  5F04 A;  2F5D A;  1UG0 A;  1H89 C;  2ID3 A;  1FEX A;  2IVM A;  3TO7 A;  3VFZ A;  2HQ5 A;  3WHB A;  1RKT A;  3DWL E;  1LJ9 A;  3NRV A;  5LBQ A;  3R6S A;  3K0L A;  3PNV A;  5TJJ A;  4AD9 A;  2K86 A;  3S2H J;  2L2O A;  5HOD A;  2CO5 A;  2DJN A;  1PUF A;  1SD6 A;  1MNM C;  3GME A;  2ZXJ A;  1P4W A;  4AYB N;  3OYK A;  1ETY A;  3V42 A;  4XIC A;  2Q1Z B;  4BXX J;  1AA7 A;  5DYM A;  1D0Z A;  4HG2 A;  1JHH A;  1FLI A;  3Q9V A;  1I50 J;  4ENK A;  5FLX K;  2JZY A;  4A0X A;  4CUG A;  4C2U A;  2L01 A;  2KJB A;  5GTI C;  1YTY A;  1RZ4 A;  2PN6 A;  2XSJ C;  3CF2 A;  4Y15 A;  1DDN A;  2KRF A;  4E7Z A;  3HOY J;  3K10 A;  4AVZ A;  1Z91 A;  5D8L B;  2V1N A;  3VSL A;  4XRM A;  1IN7 A;  1SVL A;  2P6S A;  3QOD A;  3DKX A;  3RJP A;  1Z7U A;  4DIQ A;  2PLY A;  4CSW A;  1E0E A;  2E1N A;  3ZGK A;  3OYE A;  2DAO A;  2E5N A;  1GVD A;  2H1L A;  1BR1 A;  2KL4 A;  3H1C A;  4XKW A;  2QKL B;  1R7J A;  3HHH A;  2PBI A;  4W97 A;  4AVP A;  1RC9 A;  2AXL A;  2A61 A;  1TW3 A;  4XNF A;  3KP3 A;  2L5Q A;  3GF2 A;  4JK1 X;  5IOY A;  1I6X A;  3JTH A;  3PO3 J;  4KDP A;  1BW5 A;  5HNH A;  2F5V A;  2MYS A;  2PJR B;  1TW2 A;  5DUI A;  2OC6 A;  4IHW A;  2M7A A;  2OPT A;  5B5E C;  2PMH A;  2CQK A;  5ED4 A;  1QHG A;  2MC3 A;  5ERI A;  4A3J J;  1KQ8 A;  4MTD A;  3KEY A;  2BXZ A;  2IS1 A;  4PJJ A;  4WK8 F;  3HRU A;  1Z67 A;  1IXS B;  2Y0M A;  1WRJ A;  4UB8 C;  1FOY A;  3EDP A;  2EFQ A;  4AUX A;  2R5Z B;  2GWR A;  3JTG A;  5E8I A;  1JHF A;  1QPM A;  2FUG 2;  1X58 A;  3OV8 A;  2F6C A;  4XN3 A;  2ZB9 A;  3JRD A;  2NVQ J;  4BKX A;  2WY8 Q;  3D5S C;  2JUC A;  2WB1 N;  5JLX A;  4XRS A;  4EQQ A;  1WFX A;  4NC6 A;  2E60 A;  2EV6 A;  1B9M A;  2GXG A;  5J40 A;  3CJR B;  1P7I A;  5LHG A;  3WTW C;  1K79 A;  4KYW A;  4RAZ A;  2IP2 A;  1XGM A;  1G8X A;  2HQR A;  3CCJ I;  5B66 C;  1XMK A;  1GUU A;  3GFL A;  3IRR A;  1DPR A;  3BG6 A;  1LEB A;  2DFH A;  2UZK A;  1ZAR A;  3G2B A;  4HAM A;  3H9Q A;  4EJT A;  1FP1 D;  1RI7 A;  5GPA A;  5BOX A;  1RUO A;  1VFC A;  2VON A;  3IL2 A;  2V1U A;  2CS3 A;  3BDD A;  2L4M A;  1WJC A;  4J01 A;  1MBG A;  2MAB A;  2OBP A;  4WXC A;  2XF6 A;  3HGY A;  4XLN F;  3J7Y J;  3BR1 A;  3PQK A;  1EV7 A; 
#chains in the Genus database with same CATH homology
 2P81 A;  3S1N J;  4QSH A;  2GLO A;  2XB0 X;  4BBR J;  1MBH A;  1LFB A;  3GTK J;  1Y1V J;  2CUF A;  2E2H J;  1ZQ3 P;  2YU9 J;  3JRC A;  5EZH A;  1NTC A;  2NVY J;  2JMW A;  3UKG A;  3OSF A;  1NK2 P;  3VPR A;  3ZQI A;  4A3C J;  3LSR A;  1JJ6 C;  3Q0W A;  4RDU A;  3L1P A;  2TCT A;  3RKQ A;  4MFD A;  2R0Q C;  2R5Y A;  1AHD P;  3JRE A;  1JTX A;  2H8R A;  2MGQ A;  1OFC X;  4ABZ A;  2ME6 A;  3BQZ A;  3O8H A;  4JX4 A;  4B1R A;  3O8G A;  1QPI A;  4V2G A;  2NS8 A;  1JKP C;  3G1L A;  2GM4 A;  2COB A;  3D1N I;  5F08 A;  2R5Z A;  2MG4 A;  4FE7 A;  4XK4 A;  1K83 J;  5IYD J;  3MKL A;  1JUM A;  2HOA A;  4MLO A;  1MSF C;  4D5C A;  3HKZ N;  3NAU A;  3LSP A;  2E1O A;  4A3K J;  4X6A J;  2VKE A;  4JX6 A;  1JT0 A;  5F1J A;  1HLV A;  2DMQ A;  1O4X A;  1MH3 A;  2DA4 A;  5E3O A;  5IOZ A;  2IAI A;  4A93 J;  1ETW A;  2CRG A;  1S7E A;  1BJZ A;  1I6H J;  5FLM J;  2EBI A;  4FE4 A;  1NK3 P;  2NS7 A;  1IG7 A;  4B4C A;  4CYC A;  2L7Z A;  1H88 C;  1A5J A;  5IYB J;  1B72 B;  4UUS A;  2HI3 A;  1BL0 A;  2KDZ A;  2DA1 A;  3ZOB A;  1XS9 A;  1JJ8 C;  2MW8 A;  2XPW A;  2R93 J;  5EGO A;  1TC3 C;  3HB9 A;  1ZKG A;  1JKQ C;  4IHV A;  1RET A;  2L7F P;  3S2D J;  2R92 J;  1ZGW A;  5J1U A;  2JN6 A;  3HDD A;  1HDP A;  3GTM J;  2AHQ A;  4D7N A;  3A03 A;  3GTL J;  5K7Z A;  2LFB A;  1U9N A;  2L0K A;  1ETK A;  2DA7 A;  3S1Q J;  2AO9 A;  5M3M J;  1HCR A;  1YRN A;  1AU7 A;  5C4X J;  1FTT A;  5F0H A;  2KT0 A;  4JX5 A;  3TW7 A;  4A3B J;  4Y52 J;  5FKO A;  1Q1V A;  4Y7N J;  2XSD C;  3Q3S A;  2Y0S N;  2K40 A;  2JA7 J;  3HOW J;  2EZL A;  4B3A A;  2EZK A;  5DTD A;  1X2M A;  3M3Y J;  3MVP A;  3TP3 A;  1WH5 A;  5F27 A;  5GP9 A;  4C3J J;  3OIO A;  3HOX J;  2X6O A;  1A6I A;  1XC5 A;  2LLK A;  3CDL A;  3MN2 A;  4X1E A;  4M6V A;  4UUT A;  4FTH A;  3OOU A;  1VI0 A;  1U78 A;  4M3D A;  4J19 A;  1B8I B;  3TP0 A;  4A3M J;  3W6V A;  1MBE A;  2EH3 A;  1UMQ A;  5FKN A;  4XRS G;  3ZQF A;  2LR8 A;  3BTI A;  4D7M A;  2NVX J;  3JR9 A;  1GT0 C;  1ITY A;  1WH7 A;  5C4J J;  2LP0 A;  2FD5 A;  2ME0 A;  3RQI A;  3F0C A;  2QCO A;  2ECB A;  4BY7 J;  2CU7 A;  1VND A;  2DMP A;  3CCY A;  1CQT A;  1JT6 A;  2NOG A;  3GBG A;  1YRN B;  2LY9 A;  1ZTR A;  1GV5 A;  5FLV A;  5IP7 J;  4JP0 A;  1SAN A;  4A69 C;  2I10 A;  3TW6 A;  4G12 A;  1B72 A;  2XB5 A;  4D5F A;  5M3F J;  2XGE A;  3A02 A;  2D5V A;  5IYC J;  2HOT A;  1MBF A;  3QQA A;  1EF4 A;  3NAR A;  5IP9 J;  2ID6 A;  3FIW A;  2EQR A;  3WHC A;  2CQX A;  4RBO A;  3IH4 A;  5GPC A;  5M5Y J;  3BR3 A;  4MO7 A;  3BTC A;  1P7J A;  1RKW A;  2XGD A;  3HOZ J;  2HDD A;  2E2I J;  5IPA A;  2K9N A;  1F36 A;  3SDG A;  3TED A;  1WGX A;  2DMN A;  1IGN A;  4GFB A;  5J1R A;  5EF6 A;  2JA5 J;  2HYJ A;  1RES A;  5IP6 A;  1UHS A;  2Y9Y A;  3ZQG A;  5FJ8 J;  2DA3 A;  1IC8 A;  1ZR4 A;  4M3F A;  3GTQ J;  2ECC A;  2Y2Z A;  4FCY A;  1ETV A;  3JRI A;  2O9L A;  1TWA J;  1D5Y A;  5BNG A;  2L9R A;  4M3E A;  4A3L J;  2WAQ N;  1ENH A;  1U9O A;  4BBS J;  2JA8 J;  1JUS A;  3FKI J;  5M5W J;  2EZH A;  2L7M P;  1QVU A;  4C3H J;  1K61 A;  3GTO J;  3HOU J;  2E19 A;  3G1O A;  1WPK A;  2FQ4 A;  1B8I A;  3HM5 A;  1LE8 B;  2M0C A;  4A3F J;  1G2H A;  3H0G J;  1OCT C;  3SJM A;  4JYK A;  3LNQ A;  4DYR A;  3HOV J;  3S1M J;  3A01 A;  3IH3 A;  3C2B A;  4I6Z A;  4V2F A;  2DN0 A;  1X2N A;  2DTZ A;  1TWF J;  1FJL A;  1FIA A;  1IJW C;  1MBJ A;  3FIS A;  1PUF B;  2M9H A;  5FKL A;  4A3E J;  5E3L A;  1W0T A;  3BTJ A;  4I76 A;  2VKV A;  3RZO J;  1F43 A;  3S1R J;  3GTG J;  2JJ7 A;  1ORK A;  2NVT J;  3H3V K;  1DU6 A;  3JRF A;  1RPW A;  2W48 A;  3CMY A;  1JKO C;  3FK6 A;  3S15 J;  1IRZ A;  4EEF G;  1T33 A;  3BR6 A;  5EYR A;  1APL C;  5EEA A;  1WCM J;  1T56 A;  2FJ1 A;  3BT9 A;  1TWG J;  2K9S A;  4XID A;  3LOC A;  2E2J J;  2H1K A;  1IDZ A;  5F0C A;  2RAE A;  2B63 J;  2VUM J;  2GBY A;  3S17 J;  4NDL A;  1OJL A;  1QVT A;  1JUP A;  2HOS A;  4QTR A;  3Q0U A;  4A3I J;  1E3O C;  4L5E A;  1XG1 A;  2IBD A;  4FIS A;  3A01 B;  2IEK A;  4QIW N;  1R9T J;  5J3L A;  2LVS A;  1OCP A;  2WV1 A;  2CUE A;  5K7F A;  3BTL A;  2VPR A;  1MBK A;  3DEW A;  2LKX A;  1JGG A;  3GTP J;  3CQZ J;  1ZR2 A;  2EZI A;  4IHY A;  2YS9 A;  2PMZ N;  2M8G X;  3QPL A;  5JLW A;  3QPS A;  2JA6 J;  2FX0 A;  5C3E J;  5F0F A;  2M2E A;  3M4O J;  1LE8 A;  5F04 A;  1H89 C;  1UG2 A;  2ID3 A;  2M34 A;  1FEX A;  3PM1 A;  1ETO A;  2HQ5 A;  3Q0V A;  3WHB A;  1DU0 A;  1RKT A;  4DZP A;  1VF9 A;  3LSG A;  1AKH B;  3E7L A;  1QRY A;  3BR5 A;  3S2H J;  3SFI A;  4M3G A;  2TRT A;  5EG0 B;  5HOD A;  2DJN A;  1PUF A;  1IUF A;  1SFO J;  1JKR C;  1GV2 A;  1MNM C;  4AYB N;  2DMU A;  2DA6 A;  3ZQH A;  1ETY A;  3BG3 A;  4XIC A;  4BXX J;  2OF7 A;  2HXI A;  2X9D A;  5K7H A;  4MIM A;  3B6A A;  3IV5 A;  1I50 J;  3BG5 A;  4DW6 A;  2XRL A;  2QF7 A;  3I4M J;  4IHX A;  1I3Q J;  2CQQ A;  4HNV A;  4A3D J;  5FKM A;  4DYQ A;  4A3G J;  3HOY J;  2R7Z J;  3BQY A;  1GDT A;  4XRM A;  5FKK A;  5E3M A;  1TWH J;  2O7O A;  5E3N A;  1ETQ A;  3G1M A;  4DYC A;  2G0E A;  4AC0 A;  2LK2 A;  3BR0 A;  2XGC A;  2K9Q A;  3K7A J;  9ANT A;  5EZG A;  1GVD A;  3BG9 A;  1H8A C;  3JRH A;  3PO2 J;  1RR7 A;  4W97 A;  2XPU A;  2YUS A;  3BR2 A;  5IOY A;  4IEJ A;  3PO3 J;  2DA2 A;  1BW5 A;  4C3I J;  3HGG A;  2R5Y B;  1ETX A;  3ZQC A;  4IHW A;  4BY1 J;  3S14 J;  1HF0 A;  1WI3 A;  2OPT A;  4A3J J;  1IV6 A;  4S0H B;  2JK3 A;  1Z0X A;  5C44 J;  1Z77 A;  3FK7 A;  3DCF A;  3GTJ J;  2Y9Z A;  1TWC J;  5J1Y A;  3S16 J;  1POG A;  2DMT A;  1FTZ A;  3OSG A;  4AUX A;  2MSY A;  2R5Z B;  1AKH A;  2LTP A;  2O8K A;  1X58 A;  3JRD A;  1BW6 A;  1HDD C;  2ZB9 A;  2NVQ J;  4BKX A;  5DS9 A;  2WB1 N;  4C2M J;  5EG0 A;  5JLX A;  4XRS A;  1Y1W J;  3JRA A;  3JRG A;  2X48 A;  4DZJ A;  3ZQL A;  5M5X J;  1P7I A;  3B6C A;  2Y31 A;  2CJJ A;  1IDY A;  3LSJ A;  1MH4 A;  2ELK A;  1U8B A;  4LOC A;  1BA5 A;  1GUU A;  4W1U A;  2N8G A;  2DA5 A;  2JWT A;  1ZK8 A;  2VI6 A;  5EDN A;  3IH2 A;  4CYC B;  4UUS B;  2Y30 A;  2XPV A;  5GPA A;  3RZD J;  1VFC A;  3K2A A;  5EGO B;  4MFE A;  1FIP A;  1JTY A;  2LD5 A;  1MSE C;  3HBL A;  4M3B A;  3HEF A;  3JRB A;  2HXO A;  1MBG A;  3I4N J;  1W0U A;  3HGY A;  1HOM A;  3BR1 A;  1LFU P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...