2CV5B

Crystal structure of human nucleosome core particle
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (146-MER)
publication title Alteration of the nucleosomal DNA path in the crystal structure of a human nucleosome core particle
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2cv5B00
3W99C 3C1CA 4J8VC 4QLCC 3WKJD 5GT0B 3VH6T 4KHAB 4Z66A 5B0ZB 3AZLB 1U35C 3C1BC 4Z5TB 5B1MB 5DNNA 5CPIC 5GT3C 1HQ3A 3B6GA 3W99B 5KDMA 3MGQA 3AYWC 4QLCB 3LJAD 4JJND 3REHA 4YM6D 3LZ1A 1P3LD 4R8PA 1U35B 2BYMB 4ZUXC 3VH5W 3R45A 4EO5C 1JFIB 5B32G 1HTAA 1A7WA 1N1JA 5AV9D 5F99D 1P3KC 3AZMC 5CPIB 5GT3B 1R4VA 2FJ7A 5DNMA 5AY8C 5CPKA 3AYWB 4KGCA 3A6ND 3B6FA 5B31G 3KUYC 3AV1A 5B32A 3AZKA 3MGRD 4ZUXB 3REKD 4EO5B 5B40A 3RELA 1P34A 3AZIA 3UTBA 5CP6C 3O62C 3MGPA 3AZLD 1P3KB 5AVBC 3AZMB 1M19A 3AZNA 5G49B 5AY8B 1B67A 4J8UA 3WTPA 5B33D 1KX3D 3KUYB 4ZBJC 4Z66C 4J8VD 4J8XA 1F66C 3X1UD 4CAYB 5CP6B 3O62B 4NE6A 3AN2C 2YFWB 5AVBB 3WAAA 4XUJC 4YS3A 5DNNC 3C1BD 5AVCD 5BNVB 1HQ3C 3AZJA 4M6BA 4H9PB 3MGQC 3UT9C 3REHC 1P3IC 3LZ1C 4ZBJB 4Z66B 3MNND 1S32C 1F66B 4R8PC 3MVDD 4WU9A 3REID 4G92C 3AN2B 3MGSA 1P3GA 1M18D 3REJA 5DNNB 2HIOA 1EQZD 2L5AA 1P3BC 1HQ3B 5AV5A 2F8NH 3AFAA 5KDMB 3B6GB 3MGQB 1P3MA 3AZFA 2RVQC 3REHB 3LZ1B 1S32B 1M1AA 5JA4A 4R8PB 5CHLB 3AV1C 5B32C 4H9RA 3AZKC 3R45B 5B40C 3KUYD 3RELC 1P34C 3AZIC 1N1JB 3UTBC 3MGPC 5AV6D 1M19C 1TAFA 3O62D 3KSYA 4WU8A 3AZNC 1P3BB 4HGAC 5B31C 3WA9C 3WTPC 3AV2A 4X23C 4H9QA 4KGCB 3TU4C 5B32B 3AV1B 1P3PD 4J8XC 3B0DC 3AZKB 5B40B 3RELB 1P34B 2AROA 3AZIB 3KXBA 3UTBB 3MGPB 1P3OC 1F66D 1ID3A 3WAAC 3AZHD 1M19B 3AZED 3AZNB 4YS3C 3AN2D 4HGAB 5B24D 5BNXB 4XUJD 4J8UB 3WTPB 1TZYD 4G91B 5E5AD 4X23B 1P3AC 3X1TA 5B0ZC 3TU4B 3X1VC 5GXQA 3LELA 4J8XB 3UT9D 4WU9C 5JRGA 1P3ID 3AZGC 1S32D 5B0YA 1P3OB 5AV8D 2F8ND 5B1LD 4H9SC 1Q9CA 3WAAB 2CV5D 1P3GC 1KX4A 4YS3B 3W97A 2HUEB 1P3AB 1KX5A 1P3MC 3AZFC 4H9NA 1H3OA 4Z2MG 1BH8A 3X1VB 1P3BD 4WU9B 3W96D 3AZGB 3LZ0A 2NZDA 3W98A 3X1SA 3UTAC 4LD9A 4J8WD 1P3GB 5B2ID 4XZQD 3AFAB 1P3MB 3AZFB 1P3FA 4DRAA 5CPJD 5JA4B 5B31D 3WA9D 4H9RB 5B2JA 4X23D 3KWQA 3UTAB 3TU4D 2AROC 1AOIA 5GSUD 2PYOA 1ID3C 4KUDA 1TAFB 1ZLAD 1F1EA 4WU8B 1P3OD 3V9RA 3X1TC 2NQBA 5GT0D 1ULYA 1P3AD 3LELC 1KU5A 5B0ZD 5JRGC 2AROB 3X1VD 3WKJA 5B0YC 1ID3B 4Z5TD 5B1MD 3AZGD 1KX4C 3C1CC 2F8NK 3W97C 3W99D 4QLCD 5C3IB 3X1TB 1KX5C 5GXQB 3LELB 1P3MD 5JRGB 1U35D 3LJAA 2NZDC 4JJNA 5B0YB 3W98C 3X1SC 4LD9C 4YM6A 1P3LA 1KX4B 3B6GC 3C1CB 3UTAD 5CPID 5GT3D 3W97B 3AYWD 1KX5B 4H9NB 1H3OB 5AV9A 1BH8B 5F99A 4H9OA 5B2JC 4ZUXD 3LZ0B 2NZDB 3W98B 3X1SB 5BT1C 4LD9B 4Z2MH 1AOIC 3A6NA 5DNMC 2FJ7C 2PYOC 5CPKC 1P3KD 3AZMD 3MGRA 3REKA 5BS7A 5AY8D 4KGCC 3B6FC 1P3FB 3AZLA 2NQBC 5B2JB 3KWQB 5B33A 5CP6D 4NE3A 1AOIB 1KX3A 5DNMB 2FJ7B 2PYOB 5CPKB 5AVBD 4KUDB 4J8VA 4J8UC 4G91C 3X1UA 3B6FB 3V9RB 3C1CD 2NQBB 1BFMA 4Z66D 3C1BA 5AVCA 3LJAC 3WKJB 4JJNC 4YM6C 1P3LC 3MNNA 3MVDA 2HUEC 3AZJC 5DNND 3REIA 1HQ3D 3B6GD 3MGQD 1M18A 3REHD 3LZ1D 1EQZA 5F99C 4R8PD 3B0BA 3MGSC 3LJAB 3REJC 4JJNB 2HIOC 4YM6B 1P3LB 5AV5C 3AZJB 3AFAC 5BT1D 3MGRC 3REKC 5BS7C 2FJ7D 5DNMD 3KUYA 3B0CT 4WV4B 5CPKD 1M1AC 2RVQD 5AV9B 5F99B 5AV6A 4KGCD 3B6FD 3O62A 3AV1D 4NE5A 5B32D 3MGSB 3AZKD 3REJB 5B40D 3RELD 2HIOB 4UUZA 3AZID 1P34D 3UTBD 5B33C 4WU8C 3MGPD 5AV5B 1KX3C 4WNNA 2YFVA 1M19D 1P3PA 4H9PA 3MGRB 3REKB 3AZND 3X1UC 3AV2C 1M1AB 4J8UD 3WTPD 1F66A 3AZHA 3AZEA 2F8NG 3KXBC 3AN2A 4J8XD 5B24A 4XUJA 5AVCC 1WWIA 1TZYA 5E5AA 5B33B 4CSRA 1KX3B 3WAAD 4J8VB 3NQUA 3MNNC 3UT9A 4YS3D 3X1UB 3MVDC 3AV2B 4H9QB 3REIC 5C3IC 3B0CW 1P3IA 4E45A 1S32A 2F8NA 5AV8A 3AZJD 5B1LA 5GXQC 2CV5A 1M18C 2IO5C 3KXBB 3C1BB 1EQZC 5AVCB 4WU9D 4DRBA 1P3BA 3MGSD 4NFTA 1P3GD 3MNNB 3REJD 3MVDB 3REIB 2HIOD 3W96A 5FUGA 3VH6W 5AV5D 3AFAD 3AZFD 4J8WA 1M18B 2IO5B 1WWSA 3LZ0C 1M1AD 3NQJA 5AV6C 1EQZB 5B2IA 1BH9A 4XZQA 5CPJA 5BNXA 3WTPE 5B31A 3WA9A 1P3FC 4X23A 4WZSB 1P3PC 4WU8D 3TU4A 5BO0A 2BYKA 5GSUA 3AV2D 5AV6B 3AZHC 3KWQC 3AZEC 1ZLAA 1P3OA 5B24C 4UUZB 4KUDC 1TZYC 2AROD 5E5AC 3KXBD 2LY8A 5GT0A 4KHAA 4WNNB 2YFVB 1ID3D 1P3AA 1P3PB 5B0ZA 3X1VA 5AV8C 5B1LC 3X1TD 4Z5TA 5B1MA 3AZHB 3AZGA 3AZEB 2CV5C 4H9SA 5GXQD 3LELD 5B24B 3WKJC 4XUJB 5JRGD 1TZYB 5E5AB 3W99A 4CSRB 4QLCA 5B0YD 4AWLC 3NQUB 3UT9B 1KX4D 3W96C 1U35A 1P3IB 2BYMA 4E44A 1JFIA 3W97D 2F8NB 5AV8B 5B1LB 1KX5D 4G92B 2CV5B 4J8WC 3UTAA 5CPIA 5GT3A 5B2IC 3VH5A 4XZQC 3AYWA 3LZ0D 2NZDD 3W98D 3X1SD 4LD9D 4AWLB 5CPJC 3W96B 5FUGB 4ZUXA 2CWEA 5AV9C 3VH6A 1P3FD 4J8WB 5GSUC 1P3KA 3AZMA 3NQJB 5B2IB 1ZLAC 1BH9B 5G49A 5AY8A 4XZQB 5B2JD 3A6NC 3KWQD 1AOID 5CPJB 1B6WA 5GT0C 5B31B 2PYOD 3WA9B 4KUDD 3AZLC 4CAYA 4H9OB 5CP6A 3VH5T 5BO0B 3B0DB 2BYKB 5GSUB 2YFWA 5AVBA 2NQBD 4Z5TC 5B1MC 1ZLAB 3A6NB 5BNVA 2JSSA
chains in the Genus database with same CATH superfamily
3W99C 3C1CA 4J8VC 4QLCC 3WKJD 5GT0B 3VH6T 4KHAB 4Z66A 5B0ZB 3AZLB 1U35C 3C1BC 4Z5TB 5B1MB 5DNNA 2DQNC 5CPIC 5GT3C 1HQ3A 3B6GA 3W99B 5KDMA 3MGQA 3AYWC 4QLCB 3LJAD 4JJND 3REHA 4YM6D 3LZ1A 2Y2IA 1P3LD 4R8PA 1U35B 2BYMB 4ZUXC 3VH5W 3R45A 4EO5C 3EG5B 1JFIB 5B32G 1HTAA 1A7WA 1N1JA 3H0LC 5AV9D 5F99D 1P3KC 3AZMC 5CPIB 5GT3B 1R4VA 2FJ7A 5DNMA 5AY8C 5CPKA 3AYWB 4KGCA 3A6ND 2ZY2A 5B31G 3KUYC 3AV1A 5B32A 3B6FA 3AZKA 3MGRD 4ZUXB 3REKD 4EO5B 5B40A 3RELA 1P34A 3AZIA 3UTBA 5CP6C 3O62C 3MGPA 3AZLD 1P3KB 5AVBC 3AZMB 1M19A 3AZNA 5G49B 5AY8B 1B67A 2ZM5A 4J8UA 3WTPA 2ZY5A 5B33D 1KX3D 3KUYB 4ZBJC 4Z66C 4J8VD 4J8XA 1F66C 3X1UD 2FFFB 4CAYB 5CP6B 3O62B 4NE6A 3AN2C 2YFWB 5AVBB 3WAAA 3EPHA 4XUJC 4YS3A 5DNNC 3C1BD 5AVCD 5BNVB 1HQ3C 3AZJA 4M6BA 4WJ3C 4H9PB 3MGQC 3UT9C 3REHC 1P3IC 3LZ1C 4ZBJB 4Z66B 3MNND 1S32C 1F66B 4R8PC 3MVDD 4WU9A 3REID 4G92C 1T3UA 3AN2B 3MGSA 1P3GA 1M18D 3REJA 5DNNB 2HIOA 1EQZD 2L5AA 1P3BC 1HQ3B 5AV5A 2F8NH 3AFAA 5KDMB 3B6GB 3MGQB 1P3MA 3AZFA 2RVQC 3REHB 3LZ1B 1S32B 3H0MC 5JA4A 1M1AA 4R8PB 5CHLB 2JE5A 3AV1C 5B32C 4H9RA 2Y2NA 3AZKC 3R45B 5B40C 3KUYD 3RELC 1P34C 3AZIC 1N1JB 3UTBC 2G5HC 3MGPC 5AV6D 3H0RC 1M19C 1TAFA 3O62D 3KSYA 4WU8A 3AZNC 1P3BB 4HGAC 5B31C 3WA9C 3WTPC 3AV2A 4X23C 4H9QA 4KGCB 3TU4C 5B32B 3AV1B 1P3PD 4J8XC 3B0DC 3AZKB 5B40B 3RELB 1P34B 2AROA 3AZIB 3KXBA 3UTBB 3MGPB 1P3OC 1F66D 1ID3A 3WAAC 3AZHD 1M19B 3AZED 3AZNB 4YS3C 3AN2D 4HGAB 5B24D 5BNXB 4XUJD 4J8UB 3WTPB 1TZYD 4G91B 5E5AD 4X23B 1P3AC 3X1TA 2Y2KA 3EPKA 5B0ZC 3TU4B 3X1VC 5GXQA 3LELA 4J8XB 3UT9D 4WU9C 5JRGA 1P3ID 2XD5A 3AZGC 1S32D 5B0YA 1P3OB 5AV8D 2F8ND 5B1LD 4H9SC 1Q9CA 3WAAB 2CV5D 1P3GC 1KX4A 4YS3B 1Z2CB 3W97A 2HUEB 1P3AB 1KX5A 1P3MC 3AZFC 4H9NA 1H3OA 4Z2MG 1BH8A 3X1VB 3IP4C 1P3BD 4WU9B 3W96D 3AZGB 3LZ0A 2NZDA 3W98A 2Y2JA 3X1SA 3UTAC 4LD9A 4J8WD 1P3GB 5B2ID 4XZQD 3AFAB 1PZRA 3A1IA 1P3MB 3AZFB 1P3FA 4DRAA 5CPJD 5JA4B 5B31D 3WA9D 4H9RB 5B2JA 4X23D 3KWQA 3UTAB 3TU4D 2AROC 1AOIA 2Y2MA 5GSUD 2PYOA 1ID3C 4KUDA 1TAFB 1ZLAD 1F1EA 4WU8B 1P3OD 3V9RA 3X1TC 2NQBA 5GT0D 1ULYA 1P3AD 3LELC 1KU5A 5B0ZD 2Y2PA 5JRGC 2AROB 3X1VD 3WKJA 5B0YC 2XD1A 1ID3B 4Z5TD 5B1MD 3AZGD 1KX4C 3C1CC 2F8NK 3W97C 3W99D 4QLCD 5C3IB 3X1TB 1KX5C 5GXQB 3LELB 1P3MD 5JRGB 1U35D 3LJAA 2NZDC 4JJNA 5B0YB 3W98C 3X1SC 4LD9C 4YM6A 1P3LA 1KX4B 3B6GC 3C1CB 3UTAD 5CPID 5GT3D 3W97B 3AYWD 1KX5B 4H9NB 1H3OB 1BH8B 5AV9A 5F99A 4H9OA 5B2JC 4ZUXD 3LZ0B 2NZDB 3W98B 3X1SB 5BT1C 4LD9B 4Z2MH 1AOIC 3A6NA 5DNMC 2FJ7C 2PYOC 5CPKC 1P3KD 3AZMD 3P5JB 3MGRA 3REKA 5BS7A 5AY8D 4KGCC 3B6FC 1P3FB 3AZLA 2NQBC 5B2JB 3KWQB 3EPLA 5B33A 5CP6D 4NE3A 1AOIB 1KX3A 5DNMB 2FJ7B 2PYOB 5CPKB 5AVBD 4KUDB 4J8VA 4J8UC 4G91C 3X1UA 3AL0C 3B6FB 3V9RB 3C1CD 2NQBB 1BFMA 4Z66D 3C1BA 5AVCA 3LJAC 3WKJB 4JJNC 4YM6C 1P3LC 3MNNA 3FDDA 2HUEC 3MVDA 5DNND 3REIA 3AZJC 1HQ3D 3B6GD 3MGQD 1M18A 3REHD 3LZ1D 1EQZA 5F99C 4R8PD 3B0BA 3MGSC 3LJAB 3REJC 4JJNB 2HIOC 4YM6B 1P3LB 2DF4C 5AV5C 3AZJB 3AFAC 5BT1D 4DQYB 3MGRC 3REKC 5BS7C 2FJ7D 5DNMD 3KUYA 3B0CT 4WV4B 5CPKD 3F6TA 1M1AC 2RVQD 4UPKA 5AV9B 5F99B 5AV6A 4KGCD 3B6FD 3O62A 3AV1D 4NE5A 5B32D 3MGSB 3AZKD 3REJB 2RIQA 5B40D 3RELD 2HIOB 4UUZA 3AZID 1W2EA 1P34D 3UTBD 5B33C 4WU8C 3MGPD 5AV5B 1KX3C 4WNNA 2YFVA 1M19D 1P3PA 4H9PA 3MGRB 3REKB 3AZND 3X1UC 3AV2C 1M1AB 4J8UD 3WTPD 1F66A 3AZHA 3AZEA 2JCHA 2F8NG 3KXBC 3AN2A 4J8XD 5B24A 4XUJA 5AVCC 1WWIA 1TZYA 5E5AA 5B33B 4CSRA 1KX3B 3WAAD 4J8VB 3NQUA 3MNNC 3UT9A 4YS3D 3X1UB 3MVDC 3AV2B 4H9QB 3REIC 5C3IC 3B0CW 1P3IA 4E45A 1S32A 2F8NA 5AV8A 3AZJD 5B1LA 5GXQC 2CV5A 1M18C 2IO5C 2VQRA 3KXBB 3C1BB 1EQZC 5AVCB 4WU9D 2Y2OA 4DRBA 2BG1A 1P3BA 2Y2QA 3MGSD 4NFTA 1P3GD 3MNNB 3REJD 3MVDB 3REIB 2HIOD 3W96A 5FUGA 3VH6W 5AV5D 3AFAD 3AZFD 4J8WA 1M18B 2ZY3A 2IO5B 2ZY4A 1WWSA 3LZ0C 1M1AD 3NQJA 5AV6C 1EQZB 5B2IA 2F2AC 1BH9A 4XZQA 5CPJA 2W8SA 5BNXA 5B31A 3WTPE 3WA9A 1P3FC 4X23A 4WZSB 1P3PC 2Y2LA 4WU8D 3TU4A 5BO0A 2BYKA 5GSUA 3AV2D 2G5IC 5AV6B 3AZHC 3KWQC 3AZEC 1ZLAA 1P3OA 3A1KA 5B24C 4UUZB 4KUDC 1TZYC 2AROD 5E5AC 3KXBD 3EPJA 3KFUG 2LY8A 5GT0A 4KHAA 4WNNB 2YFVB 1ID3D 1P3AA 1P3PB 5B0ZA 3X1VA 5AV8C 5B1LC 3X1TD 4Z5TA 5B1MA 3AZHB 3AZGA 3AZEB 2CV5C 2UWXA 4H9SA 5GXQD 3LELD 5B24B 3WKJC 4XUJB 5JRGD 1TZYB 5E5AB 3W99A 4CSRB 4QLCA 5B0YD 4AWLC 3NQUB 3UT9B 1KX4D 3W96C 1U35A 1P3IB 2BYMA 4E44A 1JFIA 3W97D 2F8NB 5AV8B 5B1LB 1KX5D 4G92B 2CV5B 2J8PA 4J8WC 3UTAA 5CPIA 5GT3A 5B2IC 3VH5A 4XZQC 3AYWA 3LZ0D 2NZDD 3W98D 3X1SD 4LD9D 4AWLB 2Y2GA 5CPJC 3W96B 5FUGB 4ZUXA 2CWEA 5AV9C 3VH6A 1P3FD 4J8WB 5GSUC 1P3KA 3AZMA 3NQJB 5B2IB 1ZLAC 1BH9B 5G49A 5AY8A 4XZQB 5B2JD 3A6NC 3KWQD 1AOID 5CPJB 1B6WA 5GT0C 5B31B 2PYOD 3WA9B 4KUDD 2Y2HA 3AZLC 4CAYA 4H9OB 5CP6A 3VH5T 5BO0B 3B0DB 2BYKB 5GSUB 2YFWA 5AVBA 2NQBD 4Z5TC 5B1MC 1ZLAB 3A6NB 5BNVA 2JSSA
chains in the Genus database with same CATH topology
3W99C 3C1CA 4J8VC 4QLCC 3WKJD 5GT0B 3VH6T 4KHAB 4Z66A 5B0ZB 3AZLB 1U35C 3C1BC 4Z5TB 5B1MB 5DNNA 2DQNC 5CPIC 5GT3C 1HQ3A 3B6GA 3W99B 5KDMA 3MGQA 3AYWC 4QLCB 3LJAD 4JJND 3REHA 4YM6D 3LZ1A 2Y2IA 1P3LD 4R8PA 1U35B 2BYMB 4ZUXC 3VH5W 3R45A 4EO5C 3EG5B 1JFIB 5B32G 1HTAA 1A7WA 1N1JA 3H0LC 5AV9D 5F99D 1P3KC 3AZMC 5CPIB 5GT3B 1R4VA 2FJ7A 5DNMA 5AY8C 5CPKA 3AYWB 4KGCA 3A6ND 2ZY2A 5B31G 3KUYC 3AV1A 5B32A 3B6FA 3AZKA 3MGRD 4ZUXB 3REKD 4EO5B 5B40A 3RELA 1P34A 3AZIA 3UTBA 5CP6C 3O62C 3MGPA 3AZLD 1P3KB 5AVBC 3AZMB 1M19A 3AZNA 5G49B 5AY8B 1B67A 2ZM5A 4J8UA 3WTPA 2ZY5A 5B33D 1KX3D 3KUYB 4ZBJC 4Z66C 4J8VD 4J8XA 1F66C 3X1UD 2FFFB 4CAYB 5CP6B 3O62B 4NE6A 3AN2C 2YFWB 5AVBB 3WAAA 3EPHA 4XUJC 4YS3A 5DNNC 3C1BD 5AVCD 5BNVB 1HQ3C 3AZJA 4M6BA 4WJ3C 4H9PB 3MGQC 3UT9C 3REHC 1P3IC 3LZ1C 4ZBJB 4Z66B 3MNND 1S32C 1F66B 4R8PC 3MVDD 4WU9A 3REID 4G92C 1T3UA 3AN2B 3MGSA 1P3GA 1M18D 3REJA 5DNNB 2HIOA 1EQZD 2L5AA 1P3BC 1HQ3B 5AV5A 2F8NH 3AFAA 5KDMB 3B6GB 3MGQB 1P3MA 3AZFA 2RVQC 3REHB 3LZ1B 1S32B 3H0MC 5JA4A 1M1AA 4R8PB 5CHLB 2JE5A 3AV1C 5B32C 4H9RA 2Y2NA 3AZKC 3R45B 5B40C 3KUYD 3RELC 1P34C 3AZIC 1N1JB 3UTBC 2G5HC 3MGPC 5AV6D 3H0RC 1M19C 1TAFA 3O62D 3KSYA 4WU8A 3AZNC 1P3BB 4HGAC 5B31C 3WA9C 3WTPC 3AV2A 4X23C 4H9QA 4KGCB 3TU4C 5B32B 3AV1B 1P3PD 4J8XC 3B0DC 3AZKB 5B40B 3RELB 1P34B 2AROA 3AZIB 3KXBA 3UTBB 3MGPB 1P3OC 1F66D 1ID3A 3WAAC 3AZHD 1M19B 3AZED 3AZNB 4YS3C 3AN2D 4HGAB 5B24D 5BNXB 4XUJD 4J8UB 3WTPB 1TZYD 4G91B 5E5AD 4X23B 1P3AC 3X1TA 2Y2KA 3EPKA 5B0ZC 3TU4B 3X1VC 5GXQA 3LELA 4J8XB 3UT9D 4WU9C 5JRGA 1P3ID 2XD5A 3AZGC 1S32D 5B0YA 1P3OB 5AV8D 2F8ND 5B1LD 4H9SC 1Q9CA 3WAAB 2CV5D 1P3GC 1KX4A 4YS3B 1Z2CB 3W97A 2HUEB 1P3AB 1KX5A 1P3MC 3AZFC 4H9NA 1H3OA 4Z2MG 1BH8A 3X1VB 3IP4C 1P3BD 4WU9B 3W96D 3AZGB 3LZ0A 2NZDA 3W98A 2Y2JA 3X1SA 3UTAC 4LD9A 4J8WD 1P3GB 5B2ID 4XZQD 3AFAB 1PZRA 3A1IA 1P3MB 3AZFB 1P3FA 4DRAA 5CPJD 5JA4B 5B31D 3WA9D 4H9RB 5B2JA 4X23D 3KWQA 3UTAB 3TU4D 2AROC 1AOIA 2Y2MA 5GSUD 2PYOA 1ID3C 4KUDA 1TAFB 1ZLAD 1F1EA 4WU8B 1P3OD 3V9RA 3X1TC 2NQBA 5GT0D 1ULYA 1P3AD 3LELC 1KU5A 5B0ZD 2Y2PA 5JRGC 2AROB 3X1VD 3WKJA 5B0YC 2XD1A 1ID3B 4Z5TD 5B1MD 3AZGD 1KX4C 3C1CC 2F8NK 3W97C 3W99D 4QLCD 5C3IB 3X1TB 1KX5C 5GXQB 3LELB 1P3MD 5JRGB 1U35D 3LJAA 2NZDC 4JJNA 5B0YB 3W98C 3X1SC 4LD9C 4YM6A 1P3LA 1KX4B 3B6GC 3C1CB 3UTAD 5CPID 5GT3D 3W97B 3AYWD 1KX5B 4H9NB 1H3OB 1BH8B 5AV9A 5F99A 4H9OA 5B2JC 4ZUXD 3LZ0B 2NZDB 3W98B 3X1SB 5BT1C 4LD9B 4Z2MH 1AOIC 3A6NA 5DNMC 2FJ7C 2PYOC 5CPKC 1P3KD 3AZMD 3P5JB 3MGRA 3REKA 5BS7A 5AY8D 4KGCC 3B6FC 1P3FB 3AZLA 2NQBC 5B2JB 3KWQB 3EPLA 5B33A 5CP6D 4NE3A 1AOIB 1KX3A 5DNMB 2FJ7B 2PYOB 5CPKB 5AVBD 4KUDB 4J8VA 4J8UC 4G91C 3X1UA 3AL0C 3B6FB 3V9RB 3C1CD 2NQBB 1BFMA 4Z66D 3C1BA 5AVCA 3LJAC 3WKJB 4JJNC 4YM6C 1P3LC 3MNNA 3FDDA 2HUEC 3MVDA 5DNND 3REIA 3AZJC 1HQ3D 3B6GD 3MGQD 1M18A 3REHD 3LZ1D 1EQZA 5F99C 4R8PD 3B0BA 3MGSC 3LJAB 3REJC 4JJNB 2HIOC 4YM6B 1P3LB 2DF4C 5AV5C 3AZJB 3AFAC 5BT1D 4DQYB 3MGRC 3REKC 5BS7C 2FJ7D 5DNMD 3KUYA 3B0CT 4WV4B 5CPKD 3F6TA 1M1AC 2RVQD 4UPKA 5AV9B 5F99B 5AV6A 4KGCD 3B6FD 3O62A 3AV1D 4NE5A 5B32D 3MGSB 3AZKD 3REJB 2RIQA 5B40D 3RELD 2HIOB 4UUZA 3AZID 1W2EA 1P34D 3UTBD 5B33C 4WU8C 3MGPD 5AV5B 1KX3C 4WNNA 2YFVA 1M19D 1P3PA 4H9PA 3MGRB 3REKB 3AZND 3X1UC 3AV2C 1M1AB 4J8UD 3WTPD 1F66A 3AZHA 3AZEA 2JCHA 2F8NG 3KXBC 3AN2A 4J8XD 5B24A 4XUJA 5AVCC 1WWIA 1TZYA 5E5AA 5B33B 4CSRA 1KX3B 3WAAD 4J8VB 3NQUA 3MNNC 3UT9A 4YS3D 3X1UB 3MVDC 3AV2B 4H9QB 3REIC 5C3IC 3B0CW 1P3IA 4E45A 1S32A 2F8NA 5AV8A 3AZJD 5B1LA 5GXQC 2CV5A 1M18C 2IO5C 2VQRA 3KXBB 3C1BB 1EQZC 5AVCB 4WU9D 2Y2OA 4DRBA 2BG1A 1P3BA 2Y2QA 3MGSD 4NFTA 1P3GD 3MNNB 3REJD 3MVDB 3REIB 2HIOD 3W96A 5FUGA 3VH6W 5AV5D 3AFAD 3AZFD 4J8WA 1M18B 2ZY3A 2IO5B 2ZY4A 1WWSA 3LZ0C 1M1AD 3NQJA 5AV6C 1EQZB 5B2IA 2F2AC 1BH9A 4XZQA 5CPJA 2W8SA 5BNXA 5B31A 3WTPE 3WA9A 1P3FC 4X23A 4WZSB 1P3PC 2Y2LA 4WU8D 3TU4A 5BO0A 2BYKA 5GSUA 3AV2D 2G5IC 5AV6B 3AZHC 3KWQC 3AZEC 1ZLAA 1P3OA 3A1KA 5B24C 4UUZB 4KUDC 1TZYC 2AROD 5E5AC 3KXBD 3EPJA 3KFUG 2LY8A 5GT0A 4KHAA 4WNNB 2YFVB 1ID3D 1P3AA 1P3PB 5B0ZA 3X1VA 5AV8C 5B1LC 3X1TD 4Z5TA 5B1MA 3AZHB 3AZGA 3AZEB 2CV5C 2UWXA 4H9SA 5GXQD 3LELD 5B24B 3WKJC 4XUJB 5JRGD 1TZYB 5E5AB 3W99A 4CSRB 4QLCA 5B0YD 4AWLC 3NQUB 3UT9B 1KX4D 3W96C 1U35A 1P3IB 2BYMA 4E44A 1JFIA 3W97D 2F8NB 5AV8B 5B1LB 1KX5D 4G92B 2CV5B 2J8PA 4J8WC 3UTAA 5CPIA 5GT3A 5B2IC 3VH5A 4XZQC 3AYWA 3LZ0D 2NZDD 3W98D 3X1SD 4LD9D 4AWLB 2Y2GA 5CPJC 3W96B 5FUGB 4ZUXA 2CWEA 5AV9C 3VH6A 1P3FD 4J8WB 5GSUC 1P3KA 3AZMA 3NQJB 5B2IB 1ZLAC 1BH9B 5G49A 5AY8A 4XZQB 5B2JD 3A6NC 3KWQD 1AOID 5CPJB 1B6WA 5GT0C 5B31B 2PYOD 3WA9B 4KUDD 2Y2HA 3AZLC 4CAYA 4H9OB 5CP6A 3VH5T 5BO0B 3B0DB 2BYKB 5GSUB 2YFWA 5AVBA 2NQBD 4Z5TC 5B1MC 1ZLAB 3A6NB 5BNVA 2JSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W99 C;  3C1C A;  4J8V C;  4QLC C;  3WKJ D;  5GT0 B;  3VH6 T;  4KHA B;  4Z66 A;  5B0Z B;  3AZL B;  1U35 C;  3C1B C;  4Z5T B;  5B1M B;  5DNN A;  5CPI C;  5GT3 C;  1HQ3 A;  3B6G A;  3W99 B;  5KDM A;  3MGQ A;  3AYW C;  4QLC B;  3LJA D;  4JJN D;  3REH A;  4YM6 D;  3LZ1 A;  1P3L D;  4R8P A;  1U35 B;  2BYM B;  4ZUX C;  3VH5 W;  3R45 A;  4EO5 C;  1JFI B;  5B32 G;  1HTA A;  1A7W A;  1N1J A;  5AV9 D;  5F99 D;  1P3K C;  3AZM C;  5CPI B;  5GT3 B;  1R4V A;  2FJ7 A;  5DNM A;  5AY8 C;  5CPK A;  3AYW B;  4KGC A;  3A6N D;  3B6F A;  5B31 G;  3KUY C;  3AV1 A;  5B32 A;  3AZK A;  3MGR D;  4ZUX B;  3REK D;  4EO5 B;  5B40 A;  3REL A;  1P34 A;  3AZI A;  3UTB A;  5CP6 C;  3O62 C;  3MGP A;  3AZL D;  1P3K B;  5AVB C;  3AZM B;  1M19 A;  3AZN A;  5G49 B;  5AY8 B;  1B67 A;  4J8U A;  3WTP A;  5B33 D;  1KX3 D;  3KUY B;  4ZBJ C;  4Z66 C;  4J8V D;  4J8X A;  1F66 C;  3X1U D;  4CAY B;  5CP6 B;  3O62 B;  4NE6 A;  3AN2 C;  2YFW B;  5AVB B;  3WAA A;  4XUJ C;  4YS3 A;  5DNN C;  3C1B D;  5AVC D;  5BNV B;  1HQ3 C;  3AZJ A;  4M6B A;  4H9P B;  3MGQ C;  3UT9 C;  3REH C;  1P3I C;  3LZ1 C;  4ZBJ B;  4Z66 B;  3MNN D;  1S32 C;  1F66 B;  4R8P C;  3MVD D;  4WU9 A;  3REI D;  4G92 C;  3AN2 B;  3MGS A;  1P3G A;  1M18 D;  3REJ A;  5DNN B;  2HIO A;  1EQZ D;  2L5A A;  1P3B C;  1HQ3 B;  5AV5 A;  2F8N H;  3AFA A;  5KDM B;  3B6G B;  3MGQ B;  1P3M A;  3AZF A;  2RVQ C;  3REH B;  3LZ1 B;  1S32 B;  1M1A A;  5JA4 A;  4R8P B;  5CHL B;  3AV1 C;  5B32 C;  4H9R A;  3AZK C;  3R45 B;  5B40 C;  3KUY D;  3REL C;  1P34 C;  3AZI C;  1N1J B;  3UTB C;  3MGP C;  5AV6 D;  1M19 C;  1TAF A;  3O62 D;  3KSY A;  4WU8 A;  3AZN C;  1P3B B;  4HGA C;  5B31 C;  3WA9 C;  3WTP C;  3AV2 A;  4X23 C;  4H9Q A;  4KGC B;  3TU4 C;  5B32 B;  3AV1 B;  1P3P D;  4J8X C;  3B0D C;  3AZK B;  5B40 B;  3REL B;  1P34 B;  2ARO A;  3AZI B;  3KXB A;  3UTB B;  3MGP B;  1P3O C;  1F66 D;  1ID3 A;  3WAA C;  3AZH D;  1M19 B;  3AZE D;  3AZN B;  4YS3 C;  3AN2 D;  4HGA B;  5B24 D;  5BNX B;  4XUJ D;  4J8U B;  3WTP B;  1TZY D;  4G91 B;  5E5A D;  4X23 B;  1P3A C;  3X1T A;  5B0Z C;  3TU4 B;  3X1V C;  5GXQ A;  3LEL A;  4J8X B;  3UT9 D;  4WU9 C;  5JRG A;  1P3I D;  3AZG C;  1S32 D;  5B0Y A;  1P3O B;  5AV8 D;  2F8N D;  5B1L D;  4H9S C;  1Q9C A;  3WAA B;  2CV5 D;  1P3G C;  1KX4 A;  4YS3 B;  3W97 A;  2HUE B;  1P3A B;  1KX5 A;  1P3M C;  3AZF C;  4H9N A;  1H3O A;  4Z2M G;  1BH8 A;  3X1V B;  1P3B D;  4WU9 B;  3W96 D;  3AZG B;  3LZ0 A;  2NZD A;  3W98 A;  3X1S A;  3UTA C;  4LD9 A;  4J8W D;  1P3G B;  5B2I D;  4XZQ D;  3AFA B;  1P3M B;  3AZF B;  1P3F A;  4DRA A;  5CPJ D;  5JA4 B;  5B31 D;  3WA9 D;  4H9R B;  5B2J A;  4X23 D;  3KWQ A;  3UTA B;  3TU4 D;  2ARO C;  1AOI A;  5GSU D;  2PYO A;  1ID3 C;  4KUD A;  1TAF B;  1ZLA D;  1F1E A;  4WU8 B;  1P3O D;  3V9R A;  3X1T C;  2NQB A;  5GT0 D;  1ULY A;  1P3A D;  3LEL C;  1KU5 A;  5B0Z D;  5JRG C;  2ARO B;  3X1V D;  3WKJ A;  5B0Y C;  1ID3 B;  4Z5T D;  5B1M D;  3AZG D;  1KX4 C;  3C1C C;  2F8N K;  3W97 C;  3W99 D;  4QLC D;  5C3I B;  3X1T B;  1KX5 C;  5GXQ B;  3LEL B;  1P3M D;  5JRG B;  1U35 D;  3LJA A;  2NZD C;  4JJN A;  5B0Y B;  3W98 C;  3X1S C;  4LD9 C;  4YM6 A;  1P3L A;  1KX4 B;  3B6G C;  3C1C B;  3UTA D;  5CPI D;  5GT3 D;  3W97 B;  3AYW D;  1KX5 B;  4H9N B;  1H3O B;  5AV9 A;  1BH8 B;  5F99 A;  4H9O A;  5B2J C;  4ZUX D;  3LZ0 B;  2NZD B;  3W98 B;  3X1S B;  5BT1 C;  4LD9 B;  4Z2M H;  1AOI C;  3A6N A;  5DNM C;  2FJ7 C;  2PYO C;  5CPK C;  1P3K D;  3AZM D;  3MGR A;  3REK A;  5BS7 A;  5AY8 D;  4KGC C;  3B6F C;  1P3F B;  3AZL A;  2NQB C;  5B2J B;  3KWQ B;  5B33 A;  5CP6 D;  4NE3 A;  1AOI B;  1KX3 A;  5DNM B;  2FJ7 B;  2PYO B;  5CPK B;  5AVB D;  4KUD B;  4J8V A;  4J8U C;  4G91 C;  3X1U A;  3B6F B;  3V9R B;  3C1C D;  2NQB B;  1BFM A;  4Z66 D;  3C1B A;  5AVC A;  3LJA C;  3WKJ B;  4JJN C;  4YM6 C;  1P3L C;  3MNN A;  3MVD A;  2HUE C;  3AZJ C;  5DNN D;  3REI A;  1HQ3 D;  3B6G D;  3MGQ D;  1M18 A;  3REH D;  3LZ1 D;  1EQZ A;  5F99 C;  4R8P D;  3B0B A;  3MGS C;  3LJA B;  3REJ C;  4JJN B;  2HIO C;  4YM6 B;  1P3L B;  5AV5 C;  3AZJ B;  3AFA C;  5BT1 D;  3MGR C;  3REK C;  5BS7 C;  2FJ7 D;  5DNM D;  3KUY A;  3B0C T;  4WV4 B;  5CPK D;  1M1A C;  2RVQ D;  5AV9 B;  5F99 B;  5AV6 A;  4KGC D;  3B6F D;  3O62 A;  3AV1 D;  4NE5 A;  5B32 D;  3MGS B;  3AZK D;  3REJ B;  5B40 D;  3REL D;  2HIO B;  4UUZ A;  3AZI D;  1P34 D;  3UTB D;  5B33 C;  4WU8 C;  3MGP D;  5AV5 B;  1KX3 C;  4WNN A;  2YFV A;  1M19 D;  1P3P A;  4H9P A;  3MGR B;  3REK B;  3AZN D;  3X1U C;  3AV2 C;  1M1A B;  4J8U D;  3WTP D;  1F66 A;  3AZH A;  3AZE A;  2F8N G;  3KXB C;  3AN2 A;  4J8X D;  5B24 A;  4XUJ A;  5AVC C;  1WWI A;  1TZY A;  5E5A A;  5B33 B;  4CSR A;  1KX3 B;  3WAA D;  4J8V B;  3NQU A;  3MNN C;  3UT9 A;  4YS3 D;  3X1U B;  3MVD C;  3AV2 B;  4H9Q B;  3REI C;  5C3I C;  3B0C W;  1P3I A;  4E45 A;  1S32 A;  2F8N A;  5AV8 A;  3AZJ D;  5B1L A;  5GXQ C;  2CV5 A;  1M18 C;  2IO5 C;  3KXB B;  3C1B B;  1EQZ C;  5AVC B;  4WU9 D;  4DRB A;  1P3B A;  3MGS D;  4NFT A;  1P3G D;  3MNN B;  3REJ D;  3MVD B;  3REI B;  2HIO D;  3W96 A;  5FUG A;  3VH6 W;  5AV5 D;  3AFA D;  3AZF D;  4J8W A;  1M18 B;  2IO5 B;  1WWS A;  3LZ0 C;  1M1A D;  3NQJ A;  5AV6 C;  1EQZ B;  5B2I A;  1BH9 A;  4XZQ A;  5CPJ A;  5BNX A;  3WTP E;  5B31 A;  3WA9 A;  1P3F C;  4X23 A;  4WZS B;  1P3P C;  4WU8 D;  3TU4 A;  5BO0 A;  2BYK A;  5GSU A;  3AV2 D;  5AV6 B;  3AZH C;  3KWQ C;  3AZE C;  1ZLA A;  1P3O A;  5B24 C;  4UUZ B;  4KUD C;  1TZY C;  2ARO D;  5E5A C;  3KXB D;  2LY8 A;  5GT0 A;  4KHA A;  4WNN B;  2YFV B;  1ID3 D;  1P3A A;  1P3P B;  5B0Z A;  3X1V A;  5AV8 C;  5B1L C;  3X1T D;  4Z5T A;  5B1M A;  3AZH B;  3AZG A;  3AZE B;  2CV5 C;  4H9S A;  5GXQ D;  3LEL D;  5B24 B;  3WKJ C;  4XUJ B;  5JRG D;  1TZY B;  5E5A B;  3W99 A;  4CSR B;  4QLC A;  5B0Y D;  4AWL C;  3NQU B;  3UT9 B;  1KX4 D;  3W96 C;  1U35 A;  1P3I B;  2BYM A;  4E44 A;  1JFI A;  3W97 D;  2F8N B;  5AV8 B;  5B1L B;  1KX5 D;  4G92 B;  2CV5 B;  4J8W C;  3UTA A;  5CPI A;  5GT3 A;  5B2I C;  3VH5 A;  4XZQ C;  3AYW A;  3LZ0 D;  2NZD D;  3W98 D;  3X1S D;  4LD9 D;  4AWL B;  5CPJ C;  3W96 B;  5FUG B;  4ZUX A;  2CWE A;  5AV9 C;  3VH6 A;  1P3F D;  4J8W B;  5GSU C;  1P3K A;  3AZM A;  3NQJ B;  5B2I B;  1ZLA C;  1BH9 B;  5G49 A;  5AY8 A;  4XZQ B;  5B2J D;  3A6N C;  3KWQ D;  1AOI D;  5CPJ B;  1B6W A;  5GT0 C;  5B31 B;  2PYO D;  3WA9 B;  4KUD D;  3AZL C;  4CAY A;  4H9O B;  5CP6 A;  3VH5 T;  5BO0 B;  3B0D B;  2BYK B;  5GSU B;  2YFW A;  5AVB A;  2NQB D;  4Z5T C;  5B1M C;  1ZLA B;  3A6N B;  5BNV A;  2JSS A; 
#chains in the Genus database with same CATH topology
 3W99 C;  3C1C A;  4J8V C;  4QLC C;  3WKJ D;  5GT0 B;  3VH6 T;  4KHA B;  4Z66 A;  5B0Z B;  3AZL B;  1U35 C;  3C1B C;  4Z5T B;  5B1M B;  5DNN A;  2DQN C;  5CPI C;  5GT3 C;  1HQ3 A;  3B6G A;  3W99 B;  5KDM A;  3MGQ A;  3AYW C;  4QLC B;  3LJA D;  4JJN D;  3REH A;  4YM6 D;  3LZ1 A;  2Y2I A;  1P3L D;  4R8P A;  1U35 B;  2BYM B;  4ZUX C;  3VH5 W;  3R45 A;  4EO5 C;  3EG5 B;  1JFI B;  5B32 G;  1HTA A;  1A7W A;  1N1J A;  3H0L C;  5AV9 D;  5F99 D;  1P3K C;  3AZM C;  5CPI B;  5GT3 B;  1R4V A;  2FJ7 A;  5DNM A;  5AY8 C;  5CPK A;  3AYW B;  4KGC A;  3A6N D;  2ZY2 A;  5B31 G;  3KUY C;  3AV1 A;  5B32 A;  3B6F A;  3AZK A;  3MGR D;  4ZUX B;  3REK D;  4EO5 B;  5B40 A;  3REL A;  1P34 A;  3AZI A;  3UTB A;  5CP6 C;  3O62 C;  3MGP A;  3AZL D;  1P3K B;  5AVB C;  3AZM B;  1M19 A;  3AZN A;  5G49 B;  5AY8 B;  1B67 A;  2ZM5 A;  4J8U A;  3WTP A;  2ZY5 A;  5B33 D;  1KX3 D;  3KUY B;  4ZBJ C;  4Z66 C;  4J8V D;  4J8X A;  1F66 C;  3X1U D;  2FFF B;  4CAY B;  5CP6 B;  3O62 B;  4NE6 A;  3AN2 C;  2YFW B;  5AVB B;  3WAA A;  3EPH A;  4XUJ C;  4YS3 A;  5DNN C;  3C1B D;  5AVC D;  5BNV B;  1HQ3 C;  3AZJ A;  4M6B A;  4WJ3 C;  4H9P B;  3MGQ C;  3UT9 C;  3REH C;  1P3I C;  3LZ1 C;  4ZBJ B;  4Z66 B;  3MNN D;  1S32 C;  1F66 B;  4R8P C;  3MVD D;  4WU9 A;  3REI D;  4G92 C;  1T3U A;  3AN2 B;  3MGS A;  1P3G A;  1M18 D;  3REJ A;  5DNN B;  2HIO A;  1EQZ D;  2L5A A;  1P3B C;  1HQ3 B;  5AV5 A;  2F8N H;  3AFA A;  5KDM B;  3B6G B;  3MGQ B;  1P3M A;  3AZF A;  2RVQ C;  3REH B;  3LZ1 B;  1S32 B;  3H0M C;  5JA4 A;  1M1A A;  4R8P B;  5CHL B;  2JE5 A;  3AV1 C;  5B32 C;  4H9R A;  2Y2N A;  3AZK C;  3R45 B;  5B40 C;  3KUY D;  3REL C;  1P34 C;  3AZI C;  1N1J B;  3UTB C;  2G5H C;  3MGP C;  5AV6 D;  3H0R C;  1M19 C;  1TAF A;  3O62 D;  3KSY A;  4WU8 A;  3AZN C;  1P3B B;  4HGA C;  5B31 C;  3WA9 C;  3WTP C;  3AV2 A;  4X23 C;  4H9Q A;  4KGC B;  3TU4 C;  5B32 B;  3AV1 B;  1P3P D;  4J8X C;  3B0D C;  3AZK B;  5B40 B;  3REL B;  1P34 B;  2ARO A;  3AZI B;  3KXB A;  3UTB B;  3MGP B;  1P3O C;  1F66 D;  1ID3 A;  3WAA C;  3AZH D;  1M19 B;  3AZE D;  3AZN B;  4YS3 C;  3AN2 D;  4HGA B;  5B24 D;  5BNX B;  4XUJ D;  4J8U B;  3WTP B;  1TZY D;  4G91 B;  5E5A D;  4X23 B;  1P3A C;  3X1T A;  2Y2K A;  3EPK A;  5B0Z C;  3TU4 B;  3X1V C;  5GXQ A;  3LEL A;  4J8X B;  3UT9 D;  4WU9 C;  5JRG A;  1P3I D;  2XD5 A;  3AZG C;  1S32 D;  5B0Y A;  1P3O B;  5AV8 D;  2F8N D;  5B1L D;  4H9S C;  1Q9C A;  3WAA B;  2CV5 D;  1P3G C;  1KX4 A;  4YS3 B;  1Z2C B;  3W97 A;  2HUE B;  1P3A B;  1KX5 A;  1P3M C;  3AZF C;  4H9N A;  1H3O A;  4Z2M G;  1BH8 A;  3X1V B;  3IP4 C;  1P3B D;  4WU9 B;  3W96 D;  3AZG B;  3LZ0 A;  2NZD A;  3W98 A;  2Y2J A;  3X1S A;  3UTA C;  4LD9 A;  4J8W D;  1P3G B;  5B2I D;  4XZQ D;  3AFA B;  1PZR A;  3A1I A;  1P3M B;  3AZF B;  1P3F A;  4DRA A;  5CPJ D;  5JA4 B;  5B31 D;  3WA9 D;  4H9R B;  5B2J A;  4X23 D;  3KWQ A;  3UTA B;  3TU4 D;  2ARO C;  1AOI A;  2Y2M A;  5GSU D;  2PYO A;  1ID3 C;  4KUD A;  1TAF B;  1ZLA D;  1F1E A;  4WU8 B;  1P3O D;  3V9R A;  3X1T C;  2NQB A;  5GT0 D;  1ULY A;  1P3A D;  3LEL C;  1KU5 A;  5B0Z D;  2Y2P A;  5JRG C;  2ARO B;  3X1V D;  3WKJ A;  5B0Y C;  2XD1 A;  1ID3 B;  4Z5T D;  5B1M D;  3AZG D;  1KX4 C;  3C1C C;  2F8N K;  3W97 C;  3W99 D;  4QLC D;  5C3I B;  3X1T B;  1KX5 C;  5GXQ B;  3LEL B;  1P3M D;  5JRG B;  1U35 D;  3LJA A;  2NZD C;  4JJN A;  5B0Y B;  3W98 C;  3X1S C;  4LD9 C;  4YM6 A;  1P3L A;  1KX4 B;  3B6G C;  3C1C B;  3UTA D;  5CPI D;  5GT3 D;  3W97 B;  3AYW D;  1KX5 B;  4H9N B;  1H3O B;  1BH8 B;  5AV9 A;  5F99 A;  4H9O A;  5B2J C;  4ZUX D;  3LZ0 B;  2NZD B;  3W98 B;  3X1S B;  5BT1 C;  4LD9 B;  4Z2M H;  1AOI C;  3A6N A;  5DNM C;  2FJ7 C;  2PYO C;  5CPK C;  1P3K D;  3AZM D;  3P5J B;  3MGR A;  3REK A;  5BS7 A;  5AY8 D;  4KGC C;  3B6F C;  1P3F B;  3AZL A;  2NQB C;  5B2J B;  3KWQ B;  3EPL A;  5B33 A;  5CP6 D;  4NE3 A;  1AOI B;  1KX3 A;  5DNM B;  2FJ7 B;  2PYO B;  5CPK B;  5AVB D;  4KUD B;  4J8V A;  4J8U C;  4G91 C;  3X1U A;  3AL0 C;  3B6F B;  3V9R B;  3C1C D;  2NQB B;  1BFM A;  4Z66 D;  3C1B A;  5AVC A;  3LJA C;  3WKJ B;  4JJN C;  4YM6 C;  1P3L C;  3MNN A;  3FDD A;  2HUE C;  3MVD A;  5DNN D;  3REI A;  3AZJ C;  1HQ3 D;  3B6G D;  3MGQ D;  1M18 A;  3REH D;  3LZ1 D;  1EQZ A;  5F99 C;  4R8P D;  3B0B A;  3MGS C;  3LJA B;  3REJ C;  4JJN B;  2HIO C;  4YM6 B;  1P3L B;  2DF4 C;  5AV5 C;  3AZJ B;  3AFA C;  5BT1 D;  4DQY B;  3MGR C;  3REK C;  5BS7 C;  2FJ7 D;  5DNM D;  3KUY A;  3B0C T;  4WV4 B;  5CPK D;  3F6T A;  1M1A C;  2RVQ D;  4UPK A;  5AV9 B;  5F99 B;  5AV6 A;  4KGC D;  3B6F D;  3O62 A;  3AV1 D;  4NE5 A;  5B32 D;  3MGS B;  3AZK D;  3REJ B;  2RIQ A;  5B40 D;  3REL D;  2HIO B;  4UUZ A;  3AZI D;  1W2E A;  1P34 D;  3UTB D;  5B33 C;  4WU8 C;  3MGP D;  5AV5 B;  1KX3 C;  4WNN A;  2YFV A;  1M19 D;  1P3P A;  4H9P A;  3MGR B;  3REK B;  3AZN D;  3X1U C;  3AV2 C;  1M1A B;  4J8U D;  3WTP D;  1F66 A;  3AZH A;  3AZE A;  2JCH A;  2F8N G;  3KXB C;  3AN2 A;  4J8X D;  5B24 A;  4XUJ A;  5AVC C;  1WWI A;  1TZY A;  5E5A A;  5B33 B;  4CSR A;  1KX3 B;  3WAA D;  4J8V B;  3NQU A;  3MNN C;  3UT9 A;  4YS3 D;  3X1U B;  3MVD C;  3AV2 B;  4H9Q B;  3REI C;  5C3I C;  3B0C W;  1P3I A;  4E45 A;  1S32 A;  2F8N A;  5AV8 A;  3AZJ D;  5B1L A;  5GXQ C;  2CV5 A;  1M18 C;  2IO5 C;  2VQR A;  3KXB B;  3C1B B;  1EQZ C;  5AVC B;  4WU9 D;  2Y2O A;  4DRB A;  2BG1 A;  1P3B A;  2Y2Q A;  3MGS D;  4NFT A;  1P3G D;  3MNN B;  3REJ D;  3MVD B;  3REI B;  2HIO D;  3W96 A;  5FUG A;  3VH6 W;  5AV5 D;  3AFA D;  3AZF D;  4J8W A;  1M18 B;  2ZY3 A;  2IO5 B;  2ZY4 A;  1WWS A;  3LZ0 C;  1M1A D;  3NQJ A;  5AV6 C;  1EQZ B;  5B2I A;  2F2A C;  1BH9 A;  4XZQ A;  5CPJ A;  2W8S A;  5BNX A;  5B31 A;  3WTP E;  3WA9 A;  1P3F C;  4X23 A;  4WZS B;  1P3P C;  2Y2L A;  4WU8 D;  3TU4 A;  5BO0 A;  2BYK A;  5GSU A;  3AV2 D;  2G5I C;  5AV6 B;  3AZH C;  3KWQ C;  3AZE C;  1ZLA A;  1P3O A;  3A1K A;  5B24 C;  4UUZ B;  4KUD C;  1TZY C;  2ARO D;  5E5A C;  3KXB D;  3EPJ A;  3KFU G;  2LY8 A;  5GT0 A;  4KHA A;  4WNN B;  2YFV B;  1ID3 D;  1P3A A;  1P3P B;  5B0Z A;  3X1V A;  5AV8 C;  5B1L C;  3X1T D;  4Z5T A;  5B1M A;  3AZH B;  3AZG A;  3AZE B;  2CV5 C;  2UWX A;  4H9S A;  5GXQ D;  3LEL D;  5B24 B;  3WKJ C;  4XUJ B;  5JRG D;  1TZY B;  5E5A B;  3W99 A;  4CSR B;  4QLC A;  5B0Y D;  4AWL C;  3NQU B;  3UT9 B;  1KX4 D;  3W96 C;  1U35 A;  1P3I B;  2BYM A;  4E44 A;  1JFI A;  3W97 D;  2F8N B;  5AV8 B;  5B1L B;  1KX5 D;  4G92 B;  2CV5 B;  2J8P A;  4J8W C;  3UTA A;  5CPI A;  5GT3 A;  5B2I C;  3VH5 A;  4XZQ C;  3AYW A;  3LZ0 D;  2NZD D;  3W98 D;  3X1S D;  4LD9 D;  4AWL B;  2Y2G A;  5CPJ C;  3W96 B;  5FUG B;  4ZUX A;  2CWE A;  5AV9 C;  3VH6 A;  1P3F D;  4J8W B;  5GSU C;  1P3K A;  3AZM A;  3NQJ B;  5B2I B;  1ZLA C;  1BH9 B;  5G49 A;  5AY8 A;  4XZQ B;  5B2J D;  3A6N C;  3KWQ D;  1AOI D;  5CPJ B;  1B6W A;  5GT0 C;  5B31 B;  2PYO D;  3WA9 B;  4KUD D;  2Y2H A;  3AZL C;  4CAY A;  4H9O B;  5CP6 A;  3VH5 T;  5BO0 B;  3B0D B;  2BYK B;  5GSU B;  2YFW A;  5AVB A;  2NQB D;  4Z5T C;  5B1M C;  1ZLA B;  3A6N B;  5BNV A;  2JSS A; 
#chains in the Genus database with same CATH homology
 3W99 C;  3C1C A;  4J8V C;  4QLC C;  3WKJ D;  5GT0 B;  3VH6 T;  4KHA B;  4Z66 A;  5B0Z B;  3AZL B;  1U35 C;  3C1B C;  4Z5T B;  5B1M B;  5DNN A;  2DQN C;  5CPI C;  5GT3 C;  1HQ3 A;  3B6G A;  3W99 B;  5KDM A;  3MGQ A;  3AYW C;  4QLC B;  3LJA D;  4JJN D;  3REH A;  4YM6 D;  3LZ1 A;  2Y2I A;  1P3L D;  4R8P A;  1U35 B;  2BYM B;  4ZUX C;  3VH5 W;  3R45 A;  4EO5 C;  3EG5 B;  1JFI B;  5B32 G;  1HTA A;  1A7W A;  1N1J A;  3H0L C;  5AV9 D;  5F99 D;  1P3K C;  3AZM C;  5CPI B;  5GT3 B;  1R4V A;  2FJ7 A;  5DNM A;  5AY8 C;  5CPK A;  3AYW B;  4KGC A;  3A6N D;  2ZY2 A;  5B31 G;  3KUY C;  3AV1 A;  5B32 A;  3B6F A;  3AZK A;  3MGR D;  4ZUX B;  3REK D;  4EO5 B;  5B40 A;  3REL A;  1P34 A;  3AZI A;  3UTB A;  5CP6 C;  3O62 C;  3MGP A;  3AZL D;  1P3K B;  5AVB C;  3AZM B;  1M19 A;  3AZN A;  5G49 B;  5AY8 B;  1B67 A;  2ZM5 A;  4J8U A;  3WTP A;  2ZY5 A;  5B33 D;  1KX3 D;  3KUY B;  4ZBJ C;  4Z66 C;  4J8V D;  4J8X A;  1F66 C;  3X1U D;  2FFF B;  4CAY B;  5CP6 B;  3O62 B;  4NE6 A;  3AN2 C;  2YFW B;  5AVB B;  3WAA A;  3EPH A;  4XUJ C;  4YS3 A;  5DNN C;  3C1B D;  5AVC D;  5BNV B;  1HQ3 C;  3AZJ A;  4M6B A;  4WJ3 C;  4H9P B;  3MGQ C;  3UT9 C;  3REH C;  1P3I C;  3LZ1 C;  4ZBJ B;  4Z66 B;  3MNN D;  1S32 C;  1F66 B;  4R8P C;  3MVD D;  4WU9 A;  3REI D;  4G92 C;  1T3U A;  3AN2 B;  3MGS A;  1P3G A;  1M18 D;  3REJ A;  5DNN B;  2HIO A;  1EQZ D;  2L5A A;  1P3B C;  1HQ3 B;  5AV5 A;  2F8N H;  3AFA A;  5KDM B;  3B6G B;  3MGQ B;  1P3M A;  3AZF A;  2RVQ C;  3REH B;  3LZ1 B;  1S32 B;  3H0M C;  5JA4 A;  1M1A A;  4R8P B;  5CHL B;  2JE5 A;  3AV1 C;  5B32 C;  4H9R A;  2Y2N A;  3AZK C;  3R45 B;  5B40 C;  3KUY D;  3REL C;  1P34 C;  3AZI C;  1N1J B;  3UTB C;  2G5H C;  3MGP C;  5AV6 D;  3H0R C;  1M19 C;  1TAF A;  3O62 D;  3KSY A;  4WU8 A;  3AZN C;  1P3B B;  4HGA C;  5B31 C;  3WA9 C;  3WTP C;  3AV2 A;  4X23 C;  4H9Q A;  4KGC B;  3TU4 C;  5B32 B;  3AV1 B;  1P3P D;  4J8X C;  3B0D C;  3AZK B;  5B40 B;  3REL B;  1P34 B;  2ARO A;  3AZI B;  3KXB A;  3UTB B;  3MGP B;  1P3O C;  1F66 D;  1ID3 A;  3WAA C;  3AZH D;  1M19 B;  3AZE D;  3AZN B;  4YS3 C;  3AN2 D;  4HGA B;  5B24 D;  5BNX B;  4XUJ D;  4J8U B;  3WTP B;  1TZY D;  4G91 B;  5E5A D;  4X23 B;  1P3A C;  3X1T A;  2Y2K A;  3EPK A;  5B0Z C;  3TU4 B;  3X1V C;  5GXQ A;  3LEL A;  4J8X B;  3UT9 D;  4WU9 C;  5JRG A;  1P3I D;  2XD5 A;  3AZG C;  1S32 D;  5B0Y A;  1P3O B;  5AV8 D;  2F8N D;  5B1L D;  4H9S C;  1Q9C A;  3WAA B;  2CV5 D;  1P3G C;  1KX4 A;  4YS3 B;  1Z2C B;  3W97 A;  2HUE B;  1P3A B;  1KX5 A;  1P3M C;  3AZF C;  4H9N A;  1H3O A;  4Z2M G;  1BH8 A;  3X1V B;  3IP4 C;  1P3B D;  4WU9 B;  3W96 D;  3AZG B;  3LZ0 A;  2NZD A;  3W98 A;  2Y2J A;  3X1S A;  3UTA C;  4LD9 A;  4J8W D;  1P3G B;  5B2I D;  4XZQ D;  3AFA B;  1PZR A;  3A1I A;  1P3M B;  3AZF B;  1P3F A;  4DRA A;  5CPJ D;  5JA4 B;  5B31 D;  3WA9 D;  4H9R B;  5B2J A;  4X23 D;  3KWQ A;  3UTA B;  3TU4 D;  2ARO C;  1AOI A;  2Y2M A;  5GSU D;  2PYO A;  1ID3 C;  4KUD A;  1TAF B;  1ZLA D;  1F1E A;  4WU8 B;  1P3O D;  3V9R A;  3X1T C;  2NQB A;  5GT0 D;  1ULY A;  1P3A D;  3LEL C;  1KU5 A;  5B0Z D;  2Y2P A;  5JRG C;  2ARO B;  3X1V D;  3WKJ A;  5B0Y C;  2XD1 A;  1ID3 B;  4Z5T D;  5B1M D;  3AZG D;  1KX4 C;  3C1C C;  2F8N K;  3W97 C;  3W99 D;  4QLC D;  5C3I B;  3X1T B;  1KX5 C;  5GXQ B;  3LEL B;  1P3M D;  5JRG B;  1U35 D;  3LJA A;  2NZD C;  4JJN A;  5B0Y B;  3W98 C;  3X1S C;  4LD9 C;  4YM6 A;  1P3L A;  1KX4 B;  3B6G C;  3C1C B;  3UTA D;  5CPI D;  5GT3 D;  3W97 B;  3AYW D;  1KX5 B;  4H9N B;  1H3O B;  1BH8 B;  5AV9 A;  5F99 A;  4H9O A;  5B2J C;  4ZUX D;  3LZ0 B;  2NZD B;  3W98 B;  3X1S B;  5BT1 C;  4LD9 B;  4Z2M H;  1AOI C;  3A6N A;  5DNM C;  2FJ7 C;  2PYO C;  5CPK C;  1P3K D;  3AZM D;  3P5J B;  3MGR A;  3REK A;  5BS7 A;  5AY8 D;  4KGC C;  3B6F C;  1P3F B;  3AZL A;  2NQB C;  5B2J B;  3KWQ B;  3EPL A;  5B33 A;  5CP6 D;  4NE3 A;  1AOI B;  1KX3 A;  5DNM B;  2FJ7 B;  2PYO B;  5CPK B;  5AVB D;  4KUD B;  4J8V A;  4J8U C;  4G91 C;  3X1U A;  3AL0 C;  3B6F B;  3V9R B;  3C1C D;  2NQB B;  1BFM A;  4Z66 D;  3C1B A;  5AVC A;  3LJA C;  3WKJ B;  4JJN C;  4YM6 C;  1P3L C;  3MNN A;  3FDD A;  2HUE C;  3MVD A;  5DNN D;  3REI A;  3AZJ C;  1HQ3 D;  3B6G D;  3MGQ D;  1M18 A;  3REH D;  3LZ1 D;  1EQZ A;  5F99 C;  4R8P D;  3B0B A;  3MGS C;  3LJA B;  3REJ C;  4JJN B;  2HIO C;  4YM6 B;  1P3L B;  2DF4 C;  5AV5 C;  3AZJ B;  3AFA C;  5BT1 D;  4DQY B;  3MGR C;  3REK C;  5BS7 C;  2FJ7 D;  5DNM D;  3KUY A;  3B0C T;  4WV4 B;  5CPK D;  3F6T A;  1M1A C;  2RVQ D;  4UPK A;  5AV9 B;  5F99 B;  5AV6 A;  4KGC D;  3B6F D;  3O62 A;  3AV1 D;  4NE5 A;  5B32 D;  3MGS B;  3AZK D;  3REJ B;  2RIQ A;  5B40 D;  3REL D;  2HIO B;  4UUZ A;  3AZI D;  1W2E A;  1P34 D;  3UTB D;  5B33 C;  4WU8 C;  3MGP D;  5AV5 B;  1KX3 C;  4WNN A;  2YFV A;  1M19 D;  1P3P A;  4H9P A;  3MGR B;  3REK B;  3AZN D;  3X1U C;  3AV2 C;  1M1A B;  4J8U D;  3WTP D;  1F66 A;  3AZH A;  3AZE A;  2JCH A;  2F8N G;  3KXB C;  3AN2 A;  4J8X D;  5B24 A;  4XUJ A;  5AVC C;  1WWI A;  1TZY A;  5E5A A;  5B33 B;  4CSR A;  1KX3 B;  3WAA D;  4J8V B;  3NQU A;  3MNN C;  3UT9 A;  4YS3 D;  3X1U B;  3MVD C;  3AV2 B;  4H9Q B;  3REI C;  5C3I C;  3B0C W;  1P3I A;  4E45 A;  1S32 A;  2F8N A;  5AV8 A;  3AZJ D;  5B1L A;  5GXQ C;  2CV5 A;  1M18 C;  2IO5 C;  2VQR A;  3KXB B;  3C1B B;  1EQZ C;  5AVC B;  4WU9 D;  2Y2O A;  4DRB A;  2BG1 A;  1P3B A;  2Y2Q A;  3MGS D;  4NFT A;  1P3G D;  3MNN B;  3REJ D;  3MVD B;  3REI B;  2HIO D;  3W96 A;  5FUG A;  3VH6 W;  5AV5 D;  3AFA D;  3AZF D;  4J8W A;  1M18 B;  2ZY3 A;  2IO5 B;  2ZY4 A;  1WWS A;  3LZ0 C;  1M1A D;  3NQJ A;  5AV6 C;  1EQZ B;  5B2I A;  2F2A C;  1BH9 A;  4XZQ A;  5CPJ A;  2W8S A;  5BNX A;  5B31 A;  3WTP E;  3WA9 A;  1P3F C;  4X23 A;  4WZS B;  1P3P C;  2Y2L A;  4WU8 D;  3TU4 A;  5BO0 A;  2BYK A;  5GSU A;  3AV2 D;  2G5I C;  5AV6 B;  3AZH C;  3KWQ C;  3AZE C;  1ZLA A;  1P3O A;  3A1K A;  5B24 C;  4UUZ B;  4KUD C;  1TZY C;  2ARO D;  5E5A C;  3KXB D;  3EPJ A;  3KFU G;  2LY8 A;  5GT0 A;  4KHA A;  4WNN B;  2YFV B;  1ID3 D;  1P3A A;  1P3P B;  5B0Z A;  3X1V A;  5AV8 C;  5B1L C;  3X1T D;  4Z5T A;  5B1M A;  3AZH B;  3AZG A;  3AZE B;  2CV5 C;  2UWX A;  4H9S A;  5GXQ D;  3LEL D;  5B24 B;  3WKJ C;  4XUJ B;  5JRG D;  1TZY B;  5E5A B;  3W99 A;  4CSR B;  4QLC A;  5B0Y D;  4AWL C;  3NQU B;  3UT9 B;  1KX4 D;  3W96 C;  1U35 A;  1P3I B;  2BYM A;  4E44 A;  1JFI A;  3W97 D;  2F8N B;  5AV8 B;  5B1L B;  1KX5 D;  4G92 B;  2CV5 B;  2J8P A;  4J8W C;  3UTA A;  5CPI A;  5GT3 A;  5B2I C;  3VH5 A;  4XZQ C;  3AYW A;  3LZ0 D;  2NZD D;  3W98 D;  3X1S D;  4LD9 D;  4AWL B;  2Y2G A;  5CPJ C;  3W96 B;  5FUG B;  4ZUX A;  2CWE A;  5AV9 C;  3VH6 A;  1P3F D;  4J8W B;  5GSU C;  1P3K A;  3AZM A;  3NQJ B;  5B2I B;  1ZLA C;  1BH9 B;  5G49 A;  5AY8 A;  4XZQ B;  5B2J D;  3A6N C;  3KWQ D;  1AOI D;  5CPJ B;  1B6W A;  5GT0 C;  5B31 B;  2PYO D;  3WA9 B;  4KUD D;  2Y2H A;  3AZL C;  4CAY A;  4H9O B;  5CP6 A;  3VH5 T;  5BO0 B;  3B0D B;  2BYK B;  5GSU B;  2YFW A;  5AVB A;  2NQB D;  4Z5T C;  5B1M C;  1ZLA B;  3A6N B;  5BNV A;  2JSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...