2CV5B

Crystal structure of human nucleosome core particle
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (146-MER)
publication title Alteration of the nucleosomal DNA path in the crystal structure of a human nucleosome core particle
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2cv5B00
1P3PB 3TU4C 3W96A 1M1AA 1M19C 5G49B 4EO5B 3UT9D 3AZMC 5AVBC 1P3MC 3WTPD 4H9PB 5AV5D 1ID3C 3W98D 5B1LB 3AZJB 3X1VA 3B6GA 3B0DB 3LJAD 5JRGC 5GXQA 3UTAB 1BH8B 1P3FC 5JA4B 4KUDC 4CSRA 4WU9C 2HUEB 4DRBA 3WTPA 4R8PC 3RELB 3X1TC 3AZGC 5AV5A 5GT0C 3LZ1C 3REHD 3B0CT 1AOIB 3WAAC 3AZFB 3W98A 1P3GB 1B67A 2IO5C 3KXBB 3LJAA 3MGSD 5AY8B 2RVQC 3AZKB 3MGRD 2AROC 5CPJC 2HIOB 4WU8A 4LD9D 1TZYD 4KGCC 4J8UB 4ZUXB 5CPIC 1P3OC 3WKJB 4J8VB 3MGPB 5B2IA 3AZEB 1M18D 3WA9B 3AZHB 4XZQC 1P3BA 5BNXA 5CP6B 5CPKB 3X1SD 4Z66C 3AFAC 3REKB 1TAFB 4LD9A 1TZYA 1N1JA 3C1CC 4J8WB 4H9QB 4H9OA 5B32D 3A6NC 1M1AB 1F66D 3MVDC 4QLCC 3REJD 4E45A 3AV2C 2BYMA 5DNMD 5E5AA 1R4VA 1HQ3D 1P3ID 4J8XC 3X1VB 5BO0A 3X1SA 1M19D 1KX3D 3B6GB 4AWLB 1P3LA 5AV6B 5GXQB 5B32A 1F66A 4CSRB 5B24D 2PYOD 3REJA 3WTPB 5AV5B 1HQ3A 1P3IA 3W98B 1P3PA 4XUJC 1KX3A 4KUDD 5B40C 1F1EA 3LJAB 5AVCC 3WAAD 3KWQD 3LELD 5B24A 2PYOA 3MNND 5B0ZC 5DNND 1P3KD 5CPJD 1EQZD 5B2IB 1BH8A 1S32D 1BH9A 4KGCD 1P3BB 3MGSB 1KX4D 3O62A 4NE6A 3NQUA 5B0YD 4KHAA 3KWQA 3LELA 4LD9B 1N1JB 1TZYB 3MNNA 4XZQD 4H9OB 2NQBC 3W99D 5DNNA 3C1BD 1P3KA 4WU8C 1EQZA 4Z5TC 1S32A 5KDMA 2BYMB 2HIOA 5E5AB 3AZID 3REID 3KUYD 4J8UA 1KX4A 1ZLAD 1P34C 4WV4B 3X1UD 4NFTA 4HGAB 3X1SB 4QLCD 5B0YA 4G91B 5B1MC 5B31D 5B32B 3W99A 3WA9A 5GT3C 1F66B 4J8XD 3VH5A 3C1BA 1HTAA 3REJB 1KX5C 5BS7C 5DNMB 3AYWD 3AZIA 1BFMA 5BNVB 3KUYA 1HQ3B 3KSYA 4H9QA 1P3IB 3X1UA 3MGQC 4JJND 1KX3B 3LZ0C 5BT1C 5B31A 1P3AC 5AV9D 2YFVA 3NQJB 4XUJD 5B40D 5B24B 3AN2C 2PYOB 1P3LC 3AYWA 5AV6A 5C3IC 5GSUD 4YM6D 4H9NB 1BH9B 4CAYA 2NZDD 2L5AA 4G92C 5F99D 3UT9A 5B2JC 3O62B 2FJ7C 4WNNA 3WAAB 3NQUB 3KWQB 4KHAB 5AV9A 3LELB 1P3PC 3MNNB 4EO5C 4H9SC 5DNNB 1P3KB 5CPJB 4YM6A 1EQZB 4YS3D 3VH6A 1S32B 5KDMB 2NZDA 5B1LC 3AZJC 5F99A 3AV1D 1KX4B 3B0DC 3W97D 4M6BA 3VH5W 3B0BA 3UTAC 3REHA 5B0YB 3AZLC 4XZQB 3UTBD 3W99B 5B33D 2HUEC 2F8ND 3B6FD 3MGSA 3C1BB 3RELC 4UUZA 2CV5D 4YS3A 3MGRA 1AOIC 3AZFC 3AZND 1P3GC 3AZIB 3REIB 3AV1A 3KUYB 4X23D 3KXBC 1ZLAB 3W97A 3X1UB 5AY8C 3AZKC 2HIOC 3UTBA 5AV8D 1M18A 1U35D 5B31B 4J8UC 5B33A 4ZUXC 2F8NA 3WKJC 4J8XB 2YFVB 3MGQD 3TU4D 4J8VC 2CV5A 3MGPC 3AZMD 3AZNA 3AZEC 5AVBD 4WZSB 3AYWB 1P3MD 4X23A 3AZHC 1ID3D 5CP6C 4JJNB 4CAYB 5B32G 5CPKC 3R45A 3REKC 3UT9B 1U35A 5DNMA 4J8WC 4WNNB 5JRGD 5BNVA 5AV9B 3TU4A 3VH6W 3W96C 5B40B 1M1AC 1P3FD 1M19A 3AZMA 4WU9D 5AVBA 1P3MA 5GSUB 4R8PD 4YM6B 3X1TD 3AZGD 3LZ1D 5GT0D 1ID3A 2NZDB 3X1VC 3NQJA 5F99B 3B6GC 2RVQD 5GXQC 5JRGA 3REHB 2AROD 1WWSA 4H9NA 1P3FA 4KUDA 4WU9A 5CPID 1P3OD 3WTPC 4R8PA 4UUZB 5AV5C 3LZ1A 5GT0A 3MGRB 3AZLD 4YS3B 3W98C 3WAAA 1WWIA 3AV1B 4ZBJB 3LJAC 3W97B 4H9RA 4Z66D 2AROA 3AFAD 5CPJA 3UTBB 1M18B 3KXBD 5B33B 4KGCA 3C1CD 2F8NB 3B6FB 5CPIA 3A6ND 3AZKD 2CV5B 3MVDD 5B2IC 3AZNB 3AV2D 4X23B 1P3BC 4XZQA 3MGSC 3R45B 4Z66A 3AFAA 4LD9C 3AZED 5AV8B 1TZYC 1U35B 3C1CA 2JSSA 3REIA 4Z2MH 3TU4B 3A6NA 1ZLAA 4NE3A 3MVDA 1M19B 4QLCA 3AZMB 5AVBB 3AV2A 1P3MB 5E5AC 1JFIA 2BYKA 1ID3B 5B31G 3W96D 4J8XA 3X1SC 4HGAC 2YFWB 4G91C 5AVCD 5JRGB 5B32C 1A7WA 1F66C 1P3FB 4JJNA 4KUDB 2LY8A 4WU9B 3REJC 5B0ZD 2F8NH 5DNMC 4R8PB 3X1TB 3AZGB 3LZ1B 5GT0B 1HQ3C 1P3IC 1H3OA 4XUJA 1KX3C 5B40A 2IO5B 4NE5A 5AVCA 5GSUA 4H9RB 2AROB 5B24C 2PYOC 4KGCB 2NQBD 2CWEA 5B0ZA 5CPIB 1P3OB 3AZLB 1B6WA 4WU8D 4Z2MG 4Z5TD 3WTPE 1P34D 3VH6T 3O62C 4Z66B 3AFAB 5B2ID 3KWQC 3LELC 5B1MD 3MNNC 1P3BD 3C1CB 2NQBA 1Q9CA 3A6NB 5GT3D 5DNNC 3MVDB 5FUGA 4QLCB 1P3KC 1EQZC 4DRAA 1S32C 4Z5TA 3AV2B 1KX5D 1JFIB 2BYKB 1KX4C 5CHLB 1P34A 3B6FA 2F8NG 5B0YC 3LZ0D 5B1MA 5E5AD 3WA9C 3W99C 5BT1D 1P3AD 5GT3A 3C1BC 3AN2D 1P3LD 1KX5A 5BS7A 3AZIC 3REIC 5AV8A 3KUYC 1ZLAC 3X1UC 3W96B 1H3OB 4XUJB 3MGQA 3B0CW 3LZ0A 5AVCB 5B2JD 5B31C 2FJ7D 1P3AA 1P3PD 1KU5A 3AN2A 5B0ZB 1ULYA 4AWLC 3AYWC 2YFWA 5AV6C 3V9RA 4JJNC 5B1LD 3AZJD 3UT9C 5B2JA 2FJ7A 4E44A 3X1TA 3UTAD 3AZGA 5AV9C 2NQBB 5G49A 4H9SA 5GSUC 3O62D 3RELD 5FUGB 4H9PA 4YM6C 4WU8B 4Z5TB 1AOID 2NZDC 3AZFD 5B1LA 3AZJA 1P3GD 5F99C 1P34B 1P3OA 5AY8D 3REHC 3UTAA 3AZLA 5B1MB 2HIOD 5JA4A 5BNXB 4J8UD 5GT3B 4ZUXD 3WKJD 3RELA 4YS3C 3MGRC 4J8VD 3MGPD 1KX5B 3AZFA 1AOIA 1P3GA 3AV1C 4ZBJC 3KXBA 3AZHD 3WA9D 3W97C 5AY8A 5CP6D 3MGQB 3AZKA 5CPKD 3LZ0B 3REKD 3UTBC 1M18C 5B33C 1P3AB 3VH5T 4J8WD 4ZUXA 3B6FC 3WKJA 5BO0B 1M1AD 3AN2B 2CV5C 4J8VA 1P3LB 3MGPA 3AZNC 2F8NK 3AZEA 3V9RB 5C3IB 4X23C 3AZHA 5CP6A 3X1VD 5CPKA 4G92B 3REKA 3B6GD 1TAFA 5AV8C 5B2JB 5AV6D 1U35C 2FJ7B 4J8WA 5GXQD
chains in the Genus database with same CATH superfamily
1P3PB 3TU4C 3W96A 1M1AA 1M19C 5G49B 4EO5B 3UT9D 3AZMC 5AVBC 1P3MC 3EPJA 3WTPD 4H9PB 5AV5D 1ID3C 3W98D 5B1LB 3AZJB 2W8SA 3X1VA 3B6GA 3B0DB 3LJAD 3A1KA 5JRGC 5GXQA 3UTAB 2Y2GA 1BH8B 1P3FC 5JA4B 4KUDC 4CSRA 4WU9C 2HUEB 4DRBA 3WTPA 4R8PC 3RELB 3X1TC 3AZGC 5AV5A 5GT0C 3LZ1C 3REHD 3B0CT 1AOIB 3WAAC 3AZFB 3W98A 1P3GB 1B67A 2IO5C 3KXBB 3LJAA 1Z2CB 5AY8B 3MGSD 2RVQC 3AZKB 3MGRD 3KFUG 2AROC 5CPJC 2HIOB 4WU8A 4LD9D 1TZYD 4KGCC 4J8UB 4ZUXB 5CPIC 1P3OC 3WKJB 4J8VB 3MGPB 5B2IA 3AZEB 1M18D 3WA9B 3AZHB 4XZQC 1P3BA 5BNXA 5CP6B 1W2EA 5CPKB 3X1SD 4Z66C 3AFAC 3REKB 1TAFB 4LD9A 1TZYA 1N1JA 3C1CC 4J8WB 4H9QB 4H9OA 5B32D 3A6NC 1M1AB 1F66D 3EPLA 3MVDC 4QLCC 3REJD 4E45A 3AV2C 2BYMA 5DNMD 5E5AA 1R4VA 1HQ3D 1P3ID 4J8XC 3X1VB 5BO0A 3X1SA 1M19D 1KX3D 3B6GB 4AWLB 1P3LA 5AV6B 5GXQB 5B32A 3EPKA 1F66A 4CSRB 5B24D 2PYOD 3REJA 3WTPB 5AV5B 1HQ3A 1P3IA 3W98B 1P3PA 4XUJC 1KX3A 4KUDD 5B40C 1F1EA 3LJAB 5AVCC 3WAAD 3KWQD 3LELD 5B24A 2PYOA 3MNND 5B0ZC 5DNND 1P3KD 5CPJD 1EQZD 5B2IB 1BH8A 1S32D 1BH9A 4KGCD 1P3BB 3MGSB 1KX4D 3O62A 4NE6A 3NQUA 5B0YD 4KHAA 3KWQA 3LELA 4LD9B 1TZYB 3IP4C 1N1JB 2ZM5A 3MNNA 4XZQD 4H9OB 2NQBC 3W99D 5DNNA 3C1BD 1P3KA 4WU8C 1EQZA 4Z5TC 1S32A 5KDMA 2BYMB 2HIOA 5E5AB 3AZID 3REID 3KUYD 4J8UA 1KX4A 1ZLAD 1P34C 4WV4B 3X1UD 2ZY2A 4HGAB 4NFTA 3X1SB 4QLCD 5B0YA 4G91B 5B1MC 5B31D 5B32B 3W99A 3WA9A 5GT3C 1F66B 2Y2NA 3VH5A 4J8XD 3C1BA 1HTAA 3REJB 1KX5C 5BS7C 5DNMB 3AYWD 3AZIA 1BFMA 5BNVB 3KUYA 1HQ3B 3KSYA 2F2AC 4H9QA 1P3IB 3X1UA 3MGQC 4JJND 1KX3B 3LZ0C 3A1IA 5BT1C 5B31A 1P3AC 3H0MC 5AV9D 2YFVA 3NQJB 4XUJD 5B40D 5B24B 3AN2C 2PYOB 1P3LC 2UWXA 3AYWA 5AV6A 5C3IC 5GSUD 3H0RC 4YM6D 4H9NB 1BH9B 4CAYA 2NZDD 2L5AA 4G92C 5F99D 3UT9A 5B2JC 3O62B 2FJ7C 2Y2LA 4WNNA 3WAAB 3NQUB 3KWQB 4KHAB 5AV9A 3LELB 1P3PC 2VQRA 3MNNB 2RIQA 4EO5C 3P5JB 4H9SC 5DNNB 1P3KB 5CPJB 4YM6A 1EQZB 4YS3D 3VH6A 1S32B 5KDMB 2NZDA 5B1LC 3AZJC 2Y2QA 5F99A 3AV1D 1KX4B 3B0DC 2G5HC 3W97D 4M6BA 3VH5W 3B0BA 3UTAC 3REHA 5B0YB 3AZLC 4XZQB 3UTBD 3W99B 5B33D 2HUEC 2F8ND 3B6FD 3MGSA 3C1BB 3RELC 4UUZA 2CV5D 4YS3A 3MGRA 1AOIC 3AZFC 3AZND 3AL0C 1P3GC 3AZIB 3REIB 3AV1A 3KUYB 4X23D 3KXBC 1ZLAB 3W97A 3X1UB 5AY8C 3AZKC 2HIOC 3F6TA 3UTBA 5AV8D 1M18A 1U35D 5B31B 4J8UC 5B33A 4ZUXC 2F8NA 3WKJC 4J8XB 2YFVB 3MGQD 3TU4D 4J8VC 2CV5A 2G5IC 3MGPC 3AZMD 3AZNA 3AZEC 5AVBD 4WZSB 3AYWB 1P3MD 2Y2KA 4X23A 3AZHC 1ID3D 5CP6C 1T3UA 4CAYB 4JJNB 5B32G 5CPKC 3R45A 2ZY4A 3REKC 3UT9B 1U35A 5DNMA 4J8WC 4WNNB 5JRGD 5BNVA 5AV9B 3TU4A 3VH6W 3W96C 5B40B 1M1AC 1P3FD 1M19A 3AZMA 4WU9D 5AVBA 1P3MA 5GSUB 4R8PD 4YM6B 3X1TD 3AZGD 3LZ1D 5GT0D 1ID3A 2NZDB 3X1VC 3NQJA 5F99B 3B6GC 2RVQD 5GXQC 5JRGA 3REHB 2AROD 1WWSA 4H9NA 1P3FA 4KUDA 4WU9A 5CPID 1P3OD 3WTPC 4R8PA 4UUZB 5AV5C 3LZ1A 5GT0A 3MGRB 3AZLD 4YS3B 3W98C 3WAAA 1WWIA 3AV1B 4ZBJB 3LJAC 3W97B 2BG1A 2Y2IA 4H9RA 4Z66D 2AROA 3AFAD 5CPJA 3UTBB 1M18B 3KXBD 5B33B 4KGCA 3C1CD 2F8NB 3B6FB 5CPIA 3A6ND 3AZKD 2CV5B 3MVDD 2Y2PA 5B2IC 3AZNB 3AV2D 4X23B 1P3BC 4XZQA 3MGSC 2Y2HA 3R45B 4Z66A 3AFAA 4LD9C 3AZED 5AV8B 1TZYC 1U35B 3C1CA 2JSSA 3REIA 4Z2MH 3TU4B 3A6NA 1ZLAA 4NE3A 3MVDA 1M19B 4QLCA 3AZMB 5AVBB 3AV2A 1P3MB 5E5AC 1JFIA 2BYKA 1ID3B 5B31G 3W96D 4J8XA 3X1SC 4HGAC 2YFWB 4G91C 5AVCD 5JRGB 2Y2MA 5B32C 1A7WA 1F66C 2DF4C 4JJNA 1P3FB 4KUDB 2LY8A 4WU9B 3REJC 5B0ZD 2F8NH 5DNMC 4R8PB 3X1TB 3AZGB 3LZ1B 5GT0B 1HQ3C 1P3IC 2XD1A 1H3OA 4XUJA 1KX3C 5B40A 2IO5B 4NE5A 5AVCA 2FFFB 5GSUA 4H9RB 2AROB 2Y2OA 4UPKA 5B24C 2PYOC 4KGCB 2NQBD 2CWEA 5B0ZA 5CPIB 1P3OB 3FDDA 3AZLB 1B6WA 4WU8D 4Z2MG 4Z5TD 3H0LC 3WTPE 1P34D 3VH6T 3O62C 4Z66B 3AFAB 5B2ID 3KWQC 3LELC 4DQYB 5B1MD 3MNNC 1P3BD 3C1CB 2NQBA 1Q9CA 3A6NB 5GT3D 5DNNC 3MVDB 5FUGA 4QLCB 1P3KC 3EG5B 1EQZC 4DRAA 1S32C 4Z5TA 3AV2B 1KX5D 2Y2JA 1JFIB 2BYKB 1KX4C 5CHLB 1P34A 3B6FA 2F8NG 2J8PA 2JE5A 5B0YC 3LZ0D 5B1MA 5E5AD 3WA9C 3W99C 5BT1D 1P3AD 5GT3A 3C1BC 3AN2D 1P3LD 1KX5A 5BS7A 3AZIC 3REIC 5AV8A 3KUYC 1ZLAC 3X1UC 3W96B 1H3OB 4XUJB 3MGQA 3B0CW 3LZ0A 5AVCB 5B2JD 2JCHA 5B31C 2FJ7D 1P3AA 1P3PD 1KU5A 3AN2A 4WJ3C 5B0ZB 1ULYA 4AWLC 3AYWC 2YFWA 5AV6C 3V9RA 4JJNC 5B1LD 3AZJD 3UT9C 5B2JA 2FJ7A 4E44A 3X1TA 3UTAD 3AZGA 5AV9C 2NQBB 5G49A 2XD5A 4H9SA 5GSUC 3O62D 3RELD 5FUGB 4H9PA 4YM6C 4WU8B 4Z5TB 1AOID 2NZDC 3AZFD 2ZY3A 5B1LA 3AZJA 1P3GD 5F99C 1P34B 1P3OA 5AY8D 3REHC 3UTAA 3AZLA 5B1MB 2HIOD 5JA4A 5BNXB 4J8UD 5GT3B 4ZUXD 3WKJD 3RELA 4YS3C 3MGRC 4J8VD 3MGPD 1KX5B 3AZFA 1AOIA 1P3GA 1PZRA 3AV1C 4ZBJC 3KXBA 3AZHD 3WA9D 3W97C 5AY8A 5CP6D 3MGQB 3AZKA 5CPKD 2ZY5A 3LZ0B 3REKD 3UTBC 1M18C 5B33C 1P3AB 3VH5T 4J8WD 4ZUXA 2DQNC 3B6FC 3WKJA 5BO0B 1M1AD 3AN2B 2CV5C 3EPHA 4J8VA 1P3LB 3MGPA 3AZNC 2F8NK 3AZEA 3V9RB 5C3IB 4X23C 3AZHA 5CP6A 3X1VD 5CPKA 4G92B 3REKA 3B6GD 1TAFA 5AV8C 5B2JB 5AV6D 1U35C 2FJ7B 4J8WA 5GXQD
chains in the Genus database with same CATH topology
1P3PB 3TU4C 3W96A 1M1AA 1M19C 5G49B 4EO5B 3UT9D 3AZMC 5AVBC 1P3MC 3EPJA 3WTPD 4H9PB 5AV5D 1ID3C 3W98D 5B1LB 3AZJB 2W8SA 3X1VA 3B6GA 3B0DB 3LJAD 3A1KA 5JRGC 5GXQA 3UTAB 2Y2GA 1BH8B 1P3FC 5JA4B 4KUDC 4CSRA 4WU9C 2HUEB 4DRBA 3WTPA 4R8PC 3RELB 3X1TC 3AZGC 5AV5A 5GT0C 3LZ1C 3REHD 3B0CT 1AOIB 3WAAC 3AZFB 3W98A 1P3GB 1B67A 2IO5C 3KXBB 3LJAA 1Z2CB 5AY8B 3MGSD 2RVQC 3AZKB 3MGRD 3KFUG 2AROC 5CPJC 2HIOB 4WU8A 4LD9D 1TZYD 4KGCC 4J8UB 4ZUXB 5CPIC 1P3OC 3WKJB 4J8VB 3MGPB 5B2IA 3AZEB 1M18D 3WA9B 3AZHB 4XZQC 1P3BA 5BNXA 5CP6B 1W2EA 5CPKB 3X1SD 4Z66C 3AFAC 3REKB 1TAFB 4LD9A 1TZYA 1N1JA 3C1CC 4J8WB 4H9QB 4H9OA 5B32D 3A6NC 1M1AB 1F66D 3EPLA 3MVDC 4QLCC 3REJD 4E45A 3AV2C 2BYMA 5DNMD 5E5AA 1R4VA 1HQ3D 1P3ID 4J8XC 3X1VB 5BO0A 3X1SA 1M19D 1KX3D 3B6GB 4AWLB 1P3LA 5AV6B 5GXQB 5B32A 3EPKA 1F66A 4CSRB 5B24D 2PYOD 3REJA 3WTPB 5AV5B 1HQ3A 1P3IA 3W98B 1P3PA 4XUJC 1KX3A 4KUDD 5B40C 1F1EA 3LJAB 5AVCC 3WAAD 3KWQD 3LELD 5B24A 2PYOA 3MNND 5B0ZC 5DNND 1P3KD 5CPJD 1EQZD 5B2IB 1BH8A 1S32D 1BH9A 4KGCD 1P3BB 3MGSB 1KX4D 3O62A 4NE6A 3NQUA 5B0YD 4KHAA 3KWQA 3LELA 4LD9B 1TZYB 3IP4C 1N1JB 2ZM5A 3MNNA 4XZQD 4H9OB 2NQBC 3W99D 5DNNA 3C1BD 1P3KA 4WU8C 1EQZA 4Z5TC 1S32A 5KDMA 2BYMB 2HIOA 5E5AB 3AZID 3REID 3KUYD 4J8UA 1KX4A 1ZLAD 1P34C 4WV4B 3X1UD 2ZY2A 4HGAB 4NFTA 3X1SB 4QLCD 5B0YA 4G91B 5B1MC 5B31D 5B32B 3W99A 3WA9A 5GT3C 1F66B 2Y2NA 3VH5A 4J8XD 3C1BA 1HTAA 3REJB 1KX5C 5BS7C 5DNMB 3AYWD 3AZIA 1BFMA 5BNVB 3KUYA 1HQ3B 3KSYA 2F2AC 4H9QA 1P3IB 3X1UA 3MGQC 4JJND 1KX3B 3LZ0C 3A1IA 5BT1C 5B31A 1P3AC 3H0MC 5AV9D 2YFVA 3NQJB 4XUJD 5B40D 5B24B 3AN2C 2PYOB 1P3LC 2UWXA 3AYWA 5AV6A 5C3IC 5GSUD 3H0RC 4YM6D 4H9NB 1BH9B 4CAYA 2NZDD 2L5AA 4G92C 5F99D 3UT9A 5B2JC 3O62B 2FJ7C 2Y2LA 4WNNA 3WAAB 3NQUB 3KWQB 4KHAB 5AV9A 3LELB 1P3PC 2VQRA 3MNNB 2RIQA 4EO5C 3P5JB 4H9SC 5DNNB 1P3KB 5CPJB 4YM6A 1EQZB 4YS3D 3VH6A 1S32B 5KDMB 2NZDA 5B1LC 3AZJC 2Y2QA 5F99A 3AV1D 1KX4B 3B0DC 2G5HC 3W97D 4M6BA 3VH5W 3B0BA 3UTAC 3REHA 5B0YB 3AZLC 4XZQB 3UTBD 3W99B 5B33D 2HUEC 2F8ND 3B6FD 3MGSA 3C1BB 3RELC 4UUZA 2CV5D 4YS3A 3MGRA 1AOIC 3AZFC 3AZND 3AL0C 1P3GC 3AZIB 3REIB 3AV1A 3KUYB 4X23D 3KXBC 1ZLAB 3W97A 3X1UB 5AY8C 3AZKC 2HIOC 3F6TA 3UTBA 5AV8D 1M18A 1U35D 5B31B 4J8UC 5B33A 4ZUXC 2F8NA 3WKJC 4J8XB 2YFVB 3MGQD 3TU4D 4J8VC 2CV5A 2G5IC 3MGPC 3AZMD 3AZNA 3AZEC 5AVBD 4WZSB 3AYWB 1P3MD 2Y2KA 4X23A 3AZHC 1ID3D 5CP6C 1T3UA 4CAYB 4JJNB 5B32G 5CPKC 3R45A 2ZY4A 3REKC 3UT9B 1U35A 5DNMA 4J8WC 4WNNB 5JRGD 5BNVA 5AV9B 3TU4A 3VH6W 3W96C 5B40B 1M1AC 1P3FD 1M19A 3AZMA 4WU9D 5AVBA 1P3MA 5GSUB 4R8PD 4YM6B 3X1TD 3AZGD 3LZ1D 5GT0D 1ID3A 2NZDB 3X1VC 3NQJA 5F99B 3B6GC 2RVQD 5GXQC 5JRGA 3REHB 2AROD 1WWSA 4H9NA 1P3FA 4KUDA 4WU9A 5CPID 1P3OD 3WTPC 4R8PA 4UUZB 5AV5C 3LZ1A 5GT0A 3MGRB 3AZLD 4YS3B 3W98C 3WAAA 1WWIA 3AV1B 4ZBJB 3LJAC 3W97B 2BG1A 2Y2IA 4H9RA 4Z66D 2AROA 3AFAD 5CPJA 3UTBB 1M18B 3KXBD 5B33B 4KGCA 3C1CD 2F8NB 3B6FB 5CPIA 3A6ND 3AZKD 2CV5B 3MVDD 2Y2PA 5B2IC 3AZNB 3AV2D 4X23B 1P3BC 4XZQA 3MGSC 2Y2HA 3R45B 4Z66A 3AFAA 4LD9C 3AZED 5AV8B 1TZYC 1U35B 3C1CA 2JSSA 3REIA 4Z2MH 3TU4B 3A6NA 1ZLAA 4NE3A 3MVDA 1M19B 4QLCA 3AZMB 5AVBB 3AV2A 1P3MB 5E5AC 1JFIA 2BYKA 1ID3B 5B31G 3W96D 4J8XA 3X1SC 4HGAC 2YFWB 4G91C 5AVCD 5JRGB 2Y2MA 5B32C 1A7WA 1F66C 2DF4C 4JJNA 1P3FB 4KUDB 2LY8A 4WU9B 3REJC 5B0ZD 2F8NH 5DNMC 4R8PB 3X1TB 3AZGB 3LZ1B 5GT0B 1HQ3C 1P3IC 2XD1A 1H3OA 4XUJA 1KX3C 5B40A 2IO5B 4NE5A 5AVCA 2FFFB 5GSUA 4H9RB 2AROB 2Y2OA 4UPKA 5B24C 2PYOC 4KGCB 2NQBD 2CWEA 5B0ZA 5CPIB 1P3OB 3FDDA 3AZLB 1B6WA 4WU8D 4Z2MG 4Z5TD 3H0LC 3WTPE 1P34D 3VH6T 3O62C 4Z66B 3AFAB 5B2ID 3KWQC 3LELC 4DQYB 5B1MD 3MNNC 1P3BD 3C1CB 2NQBA 1Q9CA 3A6NB 5GT3D 5DNNC 3MVDB 5FUGA 4QLCB 1P3KC 3EG5B 1EQZC 4DRAA 1S32C 4Z5TA 3AV2B 1KX5D 2Y2JA 1JFIB 2BYKB 1KX4C 5CHLB 1P34A 3B6FA 2F8NG 2J8PA 2JE5A 5B0YC 3LZ0D 5B1MA 5E5AD 3WA9C 3W99C 5BT1D 1P3AD 5GT3A 3C1BC 3AN2D 1P3LD 1KX5A 5BS7A 3AZIC 3REIC 5AV8A 3KUYC 1ZLAC 3X1UC 3W96B 1H3OB 4XUJB 3MGQA 3B0CW 3LZ0A 5AVCB 5B2JD 2JCHA 5B31C 2FJ7D 1P3AA 1P3PD 1KU5A 3AN2A 4WJ3C 5B0ZB 1ULYA 4AWLC 3AYWC 2YFWA 5AV6C 3V9RA 4JJNC 5B1LD 3AZJD 3UT9C 5B2JA 2FJ7A 4E44A 3X1TA 3UTAD 3AZGA 5AV9C 2NQBB 5G49A 2XD5A 4H9SA 5GSUC 3O62D 3RELD 5FUGB 4H9PA 4YM6C 4WU8B 4Z5TB 1AOID 2NZDC 3AZFD 2ZY3A 5B1LA 3AZJA 1P3GD 5F99C 1P34B 1P3OA 5AY8D 3REHC 3UTAA 3AZLA 5B1MB 2HIOD 5JA4A 5BNXB 4J8UD 5GT3B 4ZUXD 3WKJD 3RELA 4YS3C 3MGRC 4J8VD 3MGPD 1KX5B 3AZFA 1AOIA 1P3GA 1PZRA 3AV1C 4ZBJC 3KXBA 3AZHD 3WA9D 3W97C 5AY8A 5CP6D 3MGQB 3AZKA 5CPKD 2ZY5A 3LZ0B 3REKD 3UTBC 1M18C 5B33C 1P3AB 3VH5T 4J8WD 4ZUXA 2DQNC 3B6FC 3WKJA 5BO0B 1M1AD 3AN2B 2CV5C 3EPHA 4J8VA 1P3LB 3MGPA 3AZNC 2F8NK 3AZEA 3V9RB 5C3IB 4X23C 3AZHA 5CP6A 3X1VD 5CPKA 4G92B 3REKA 3B6GD 1TAFA 5AV8C 5B2JB 5AV6D 1U35C 2FJ7B 4J8WA 5GXQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3P B;  3TU4 C;  3W96 A;  1M1A A;  1M19 C;  5G49 B;  4EO5 B;  3UT9 D;  3AZM C;  5AVB C;  1P3M C;  3WTP D;  4H9P B;  5AV5 D;  1ID3 C;  3W98 D;  5B1L B;  3AZJ B;  3X1V A;  3B6G A;  3B0D B;  3LJA D;  5JRG C;  5GXQ A;  3UTA B;  1BH8 B;  1P3F C;  5JA4 B;  4KUD C;  4CSR A;  4WU9 C;  2HUE B;  4DRB A;  3WTP A;  4R8P C;  3REL B;  3X1T C;  3AZG C;  5AV5 A;  5GT0 C;  3LZ1 C;  3REH D;  3B0C T;  1AOI B;  3WAA C;  3AZF B;  3W98 A;  1P3G B;  1B67 A;  2IO5 C;  3KXB B;  3LJA A;  3MGS D;  5AY8 B;  2RVQ C;  3AZK B;  3MGR D;  2ARO C;  5CPJ C;  2HIO B;  4WU8 A;  4LD9 D;  1TZY D;  4KGC C;  4J8U B;  4ZUX B;  5CPI C;  1P3O C;  3WKJ B;  4J8V B;  3MGP B;  5B2I A;  3AZE B;  1M18 D;  3WA9 B;  3AZH B;  4XZQ C;  1P3B A;  5BNX A;  5CP6 B;  5CPK B;  3X1S D;  4Z66 C;  3AFA C;  3REK B;  1TAF B;  4LD9 A;  1TZY A;  1N1J A;  3C1C C;  4J8W B;  4H9Q B;  4H9O A;  5B32 D;  3A6N C;  1M1A B;  1F66 D;  3MVD C;  4QLC C;  3REJ D;  4E45 A;  3AV2 C;  2BYM A;  5DNM D;  5E5A A;  1R4V A;  1HQ3 D;  1P3I D;  4J8X C;  3X1V B;  5BO0 A;  3X1S A;  1M19 D;  1KX3 D;  3B6G B;  4AWL B;  1P3L A;  5AV6 B;  5GXQ B;  5B32 A;  1F66 A;  4CSR B;  5B24 D;  2PYO D;  3REJ A;  3WTP B;  5AV5 B;  1HQ3 A;  1P3I A;  3W98 B;  1P3P A;  4XUJ C;  1KX3 A;  4KUD D;  5B40 C;  1F1E A;  3LJA B;  5AVC C;  3WAA D;  3KWQ D;  3LEL D;  5B24 A;  2PYO A;  3MNN D;  5B0Z C;  5DNN D;  1P3K D;  5CPJ D;  1EQZ D;  5B2I B;  1BH8 A;  1S32 D;  1BH9 A;  4KGC D;  1P3B B;  3MGS B;  1KX4 D;  3O62 A;  4NE6 A;  3NQU A;  5B0Y D;  4KHA A;  3KWQ A;  3LEL A;  4LD9 B;  1N1J B;  1TZY B;  3MNN A;  4XZQ D;  4H9O B;  2NQB C;  3W99 D;  5DNN A;  3C1B D;  1P3K A;  4WU8 C;  1EQZ A;  4Z5T C;  1S32 A;  5KDM A;  2BYM B;  2HIO A;  5E5A B;  3AZI D;  3REI D;  3KUY D;  4J8U A;  1KX4 A;  1ZLA D;  1P34 C;  4WV4 B;  3X1U D;  4NFT A;  4HGA B;  3X1S B;  4QLC D;  5B0Y A;  4G91 B;  5B1M C;  5B31 D;  5B32 B;  3W99 A;  3WA9 A;  5GT3 C;  1F66 B;  4J8X D;  3VH5 A;  3C1B A;  1HTA A;  3REJ B;  1KX5 C;  5BS7 C;  5DNM B;  3AYW D;  3AZI A;  1BFM A;  5BNV B;  3KUY A;  1HQ3 B;  3KSY A;  4H9Q A;  1P3I B;  3X1U A;  3MGQ C;  4JJN D;  1KX3 B;  3LZ0 C;  5BT1 C;  5B31 A;  1P3A C;  5AV9 D;  2YFV A;  3NQJ B;  4XUJ D;  5B40 D;  5B24 B;  3AN2 C;  2PYO B;  1P3L C;  3AYW A;  5AV6 A;  5C3I C;  5GSU D;  4YM6 D;  4H9N B;  1BH9 B;  4CAY A;  2NZD D;  2L5A A;  4G92 C;  5F99 D;  3UT9 A;  5B2J C;  3O62 B;  2FJ7 C;  4WNN A;  3WAA B;  3NQU B;  3KWQ B;  4KHA B;  5AV9 A;  3LEL B;  1P3P C;  3MNN B;  4EO5 C;  4H9S C;  5DNN B;  1P3K B;  5CPJ B;  4YM6 A;  1EQZ B;  4YS3 D;  3VH6 A;  1S32 B;  5KDM B;  2NZD A;  5B1L C;  3AZJ C;  5F99 A;  3AV1 D;  1KX4 B;  3B0D C;  3W97 D;  4M6B A;  3VH5 W;  3B0B A;  3UTA C;  3REH A;  5B0Y B;  3AZL C;  4XZQ B;  3UTB D;  3W99 B;  5B33 D;  2HUE C;  2F8N D;  3B6F D;  3MGS A;  3C1B B;  3REL C;  4UUZ A;  2CV5 D;  4YS3 A;  3MGR A;  1AOI C;  3AZF C;  3AZN D;  1P3G C;  3AZI B;  3REI B;  3AV1 A;  3KUY B;  4X23 D;  3KXB C;  1ZLA B;  3W97 A;  3X1U B;  5AY8 C;  3AZK C;  2HIO C;  3UTB A;  5AV8 D;  1M18 A;  1U35 D;  5B31 B;  4J8U C;  5B33 A;  4ZUX C;  2F8N A;  3WKJ C;  4J8X B;  2YFV B;  3MGQ D;  3TU4 D;  4J8V C;  2CV5 A;  3MGP C;  3AZM D;  3AZN A;  3AZE C;  5AVB D;  4WZS B;  3AYW B;  1P3M D;  4X23 A;  3AZH C;  1ID3 D;  5CP6 C;  4JJN B;  4CAY B;  5B32 G;  5CPK C;  3R45 A;  3REK C;  3UT9 B;  1U35 A;  5DNM A;  4J8W C;  4WNN B;  5JRG D;  5BNV A;  5AV9 B;  3TU4 A;  3VH6 W;  3W96 C;  5B40 B;  1M1A C;  1P3F D;  1M19 A;  3AZM A;  4WU9 D;  5AVB A;  1P3M A;  5GSU B;  4R8P D;  4YM6 B;  3X1T D;  3AZG D;  3LZ1 D;  5GT0 D;  1ID3 A;  2NZD B;  3X1V C;  3NQJ A;  5F99 B;  3B6G C;  2RVQ D;  5GXQ C;  5JRG A;  3REH B;  2ARO D;  1WWS A;  4H9N A;  1P3F A;  4KUD A;  4WU9 A;  5CPI D;  1P3O D;  3WTP C;  4R8P A;  4UUZ B;  5AV5 C;  3LZ1 A;  5GT0 A;  3MGR B;  3AZL D;  4YS3 B;  3W98 C;  3WAA A;  1WWI A;  3AV1 B;  4ZBJ B;  3LJA C;  3W97 B;  4H9R A;  4Z66 D;  2ARO A;  3AFA D;  5CPJ A;  3UTB B;  1M18 B;  3KXB D;  5B33 B;  4KGC A;  3C1C D;  2F8N B;  3B6F B;  5CPI A;  3A6N D;  3AZK D;  2CV5 B;  3MVD D;  5B2I C;  3AZN B;  3AV2 D;  4X23 B;  1P3B C;  4XZQ A;  3MGS C;  3R45 B;  4Z66 A;  3AFA A;  4LD9 C;  3AZE D;  5AV8 B;  1TZY C;  1U35 B;  3C1C A;  2JSS A;  3REI A;  4Z2M H;  3TU4 B;  3A6N A;  1ZLA A;  4NE3 A;  3MVD A;  1M19 B;  4QLC A;  3AZM B;  5AVB B;  3AV2 A;  1P3M B;  5E5A C;  1JFI A;  2BYK A;  1ID3 B;  5B31 G;  3W96 D;  4J8X A;  3X1S C;  4HGA C;  2YFW B;  4G91 C;  5AVC D;  5JRG B;  5B32 C;  1A7W A;  1F66 C;  1P3F B;  4JJN A;  4KUD B;  2LY8 A;  4WU9 B;  3REJ C;  5B0Z D;  2F8N H;  5DNM C;  4R8P B;  3X1T B;  3AZG B;  3LZ1 B;  5GT0 B;  1HQ3 C;  1P3I C;  1H3O A;  4XUJ A;  1KX3 C;  5B40 A;  2IO5 B;  4NE5 A;  5AVC A;  5GSU A;  4H9R B;  2ARO B;  5B24 C;  2PYO C;  4KGC B;  2NQB D;  2CWE A;  5B0Z A;  5CPI B;  1P3O B;  3AZL B;  1B6W A;  4WU8 D;  4Z2M G;  4Z5T D;  3WTP E;  1P34 D;  3VH6 T;  3O62 C;  4Z66 B;  3AFA B;  5B2I D;  3KWQ C;  3LEL C;  5B1M D;  3MNN C;  1P3B D;  3C1C B;  2NQB A;  1Q9C A;  3A6N B;  5GT3 D;  5DNN C;  3MVD B;  5FUG A;  4QLC B;  1P3K C;  1EQZ C;  4DRA A;  1S32 C;  4Z5T A;  3AV2 B;  1KX5 D;  1JFI B;  2BYK B;  1KX4 C;  5CHL B;  1P34 A;  3B6F A;  2F8N G;  5B0Y C;  3LZ0 D;  5B1M A;  5E5A D;  3WA9 C;  3W99 C;  5BT1 D;  1P3A D;  5GT3 A;  3C1B C;  3AN2 D;  1P3L D;  1KX5 A;  5BS7 A;  3AZI C;  3REI C;  5AV8 A;  3KUY C;  1ZLA C;  3X1U C;  3W96 B;  1H3O B;  4XUJ B;  3MGQ A;  3B0C W;  3LZ0 A;  5AVC B;  5B2J D;  5B31 C;  2FJ7 D;  1P3A A;  1P3P D;  1KU5 A;  3AN2 A;  5B0Z B;  1ULY A;  4AWL C;  3AYW C;  2YFW A;  5AV6 C;  3V9R A;  4JJN C;  5B1L D;  3AZJ D;  3UT9 C;  5B2J A;  2FJ7 A;  4E44 A;  3X1T A;  3UTA D;  3AZG A;  5AV9 C;  2NQB B;  5G49 A;  4H9S A;  5GSU C;  3O62 D;  3REL D;  5FUG B;  4H9P A;  4YM6 C;  4WU8 B;  4Z5T B;  1AOI D;  2NZD C;  3AZF D;  5B1L A;  3AZJ A;  1P3G D;  5F99 C;  1P34 B;  1P3O A;  5AY8 D;  3REH C;  3UTA A;  3AZL A;  5B1M B;  2HIO D;  5JA4 A;  5BNX B;  4J8U D;  5GT3 B;  4ZUX D;  3WKJ D;  3REL A;  4YS3 C;  3MGR C;  4J8V D;  3MGP D;  1KX5 B;  3AZF A;  1AOI A;  1P3G A;  3AV1 C;  4ZBJ C;  3KXB A;  3AZH D;  3WA9 D;  3W97 C;  5AY8 A;  5CP6 D;  3MGQ B;  3AZK A;  5CPK D;  3LZ0 B;  3REK D;  3UTB C;  1M18 C;  5B33 C;  1P3A B;  3VH5 T;  4J8W D;  4ZUX A;  3B6F C;  3WKJ A;  5BO0 B;  1M1A D;  3AN2 B;  2CV5 C;  4J8V A;  1P3L B;  3MGP A;  3AZN C;  2F8N K;  3AZE A;  3V9R B;  5C3I B;  4X23 C;  3AZH A;  5CP6 A;  3X1V D;  5CPK A;  4G92 B;  3REK A;  3B6G D;  1TAF A;  5AV8 C;  5B2J B;  5AV6 D;  1U35 C;  2FJ7 B;  4J8W A;  5GXQ D; 
#chains in the Genus database with same CATH topology
 1P3P B;  3TU4 C;  3W96 A;  1M1A A;  1M19 C;  5G49 B;  4EO5 B;  3UT9 D;  3AZM C;  5AVB C;  1P3M C;  3EPJ A;  3WTP D;  4H9P B;  5AV5 D;  1ID3 C;  3W98 D;  5B1L B;  3AZJ B;  2W8S A;  3X1V A;  3B6G A;  3B0D B;  3LJA D;  3A1K A;  5JRG C;  5GXQ A;  3UTA B;  2Y2G A;  1BH8 B;  1P3F C;  5JA4 B;  4KUD C;  4CSR A;  4WU9 C;  2HUE B;  4DRB A;  3WTP A;  4R8P C;  3REL B;  3X1T C;  3AZG C;  5AV5 A;  5GT0 C;  3LZ1 C;  3REH D;  3B0C T;  1AOI B;  3WAA C;  3AZF B;  3W98 A;  1P3G B;  1B67 A;  2IO5 C;  3KXB B;  3LJA A;  1Z2C B;  5AY8 B;  3MGS D;  2RVQ C;  3AZK B;  3MGR D;  3KFU G;  2ARO C;  5CPJ C;  2HIO B;  4WU8 A;  4LD9 D;  1TZY D;  4KGC C;  4J8U B;  4ZUX B;  5CPI C;  1P3O C;  3WKJ B;  4J8V B;  3MGP B;  5B2I A;  3AZE B;  1M18 D;  3WA9 B;  3AZH B;  4XZQ C;  1P3B A;  5BNX A;  5CP6 B;  1W2E A;  5CPK B;  3X1S D;  4Z66 C;  3AFA C;  3REK B;  1TAF B;  4LD9 A;  1TZY A;  1N1J A;  3C1C C;  4J8W B;  4H9Q B;  4H9O A;  5B32 D;  3A6N C;  1M1A B;  1F66 D;  3EPL A;  3MVD C;  4QLC C;  3REJ D;  4E45 A;  3AV2 C;  2BYM A;  5DNM D;  5E5A A;  1R4V A;  1HQ3 D;  1P3I D;  4J8X C;  3X1V B;  5BO0 A;  3X1S A;  1M19 D;  1KX3 D;  3B6G B;  4AWL B;  1P3L A;  5AV6 B;  5GXQ B;  5B32 A;  3EPK A;  1F66 A;  4CSR B;  5B24 D;  2PYO D;  3REJ A;  3WTP B;  5AV5 B;  1HQ3 A;  1P3I A;  3W98 B;  1P3P A;  4XUJ C;  1KX3 A;  4KUD D;  5B40 C;  1F1E A;  3LJA B;  5AVC C;  3WAA D;  3KWQ D;  3LEL D;  5B24 A;  2PYO A;  3MNN D;  5B0Z C;  5DNN D;  1P3K D;  5CPJ D;  1EQZ D;  5B2I B;  1BH8 A;  1S32 D;  1BH9 A;  4KGC D;  1P3B B;  3MGS B;  1KX4 D;  3O62 A;  4NE6 A;  3NQU A;  5B0Y D;  4KHA A;  3KWQ A;  3LEL A;  4LD9 B;  1TZY B;  3IP4 C;  1N1J B;  2ZM5 A;  3MNN A;  4XZQ D;  4H9O B;  2NQB C;  3W99 D;  5DNN A;  3C1B D;  1P3K A;  4WU8 C;  1EQZ A;  4Z5T C;  1S32 A;  5KDM A;  2BYM B;  2HIO A;  5E5A B;  3AZI D;  3REI D;  3KUY D;  4J8U A;  1KX4 A;  1ZLA D;  1P34 C;  4WV4 B;  3X1U D;  2ZY2 A;  4HGA B;  4NFT A;  3X1S B;  4QLC D;  5B0Y A;  4G91 B;  5B1M C;  5B31 D;  5B32 B;  3W99 A;  3WA9 A;  5GT3 C;  1F66 B;  2Y2N A;  3VH5 A;  4J8X D;  3C1B A;  1HTA A;  3REJ B;  1KX5 C;  5BS7 C;  5DNM B;  3AYW D;  3AZI A;  1BFM A;  5BNV B;  3KUY A;  1HQ3 B;  3KSY A;  2F2A C;  4H9Q A;  1P3I B;  3X1U A;  3MGQ C;  4JJN D;  1KX3 B;  3LZ0 C;  3A1I A;  5BT1 C;  5B31 A;  1P3A C;  3H0M C;  5AV9 D;  2YFV A;  3NQJ B;  4XUJ D;  5B40 D;  5B24 B;  3AN2 C;  2PYO B;  1P3L C;  2UWX A;  3AYW A;  5AV6 A;  5C3I C;  5GSU D;  3H0R C;  4YM6 D;  4H9N B;  1BH9 B;  4CAY A;  2NZD D;  2L5A A;  4G92 C;  5F99 D;  3UT9 A;  5B2J C;  3O62 B;  2FJ7 C;  2Y2L A;  4WNN A;  3WAA B;  3NQU B;  3KWQ B;  4KHA B;  5AV9 A;  3LEL B;  1P3P C;  2VQR A;  3MNN B;  2RIQ A;  4EO5 C;  3P5J B;  4H9S C;  5DNN B;  1P3K B;  5CPJ B;  4YM6 A;  1EQZ B;  4YS3 D;  3VH6 A;  1S32 B;  5KDM B;  2NZD A;  5B1L C;  3AZJ C;  2Y2Q A;  5F99 A;  3AV1 D;  1KX4 B;  3B0D C;  2G5H C;  3W97 D;  4M6B A;  3VH5 W;  3B0B A;  3UTA C;  3REH A;  5B0Y B;  3AZL C;  4XZQ B;  3UTB D;  3W99 B;  5B33 D;  2HUE C;  2F8N D;  3B6F D;  3MGS A;  3C1B B;  3REL C;  4UUZ A;  2CV5 D;  4YS3 A;  3MGR A;  1AOI C;  3AZF C;  3AZN D;  3AL0 C;  1P3G C;  3AZI B;  3REI B;  3AV1 A;  3KUY B;  4X23 D;  3KXB C;  1ZLA B;  3W97 A;  3X1U B;  5AY8 C;  3AZK C;  2HIO C;  3F6T A;  3UTB A;  5AV8 D;  1M18 A;  1U35 D;  5B31 B;  4J8U C;  5B33 A;  4ZUX C;  2F8N A;  3WKJ C;  4J8X B;  2YFV B;  3MGQ D;  3TU4 D;  4J8V C;  2CV5 A;  2G5I C;  3MGP C;  3AZM D;  3AZN A;  3AZE C;  5AVB D;  4WZS B;  3AYW B;  1P3M D;  2Y2K A;  4X23 A;  3AZH C;  1ID3 D;  5CP6 C;  1T3U A;  4CAY B;  4JJN B;  5B32 G;  5CPK C;  3R45 A;  2ZY4 A;  3REK C;  3UT9 B;  1U35 A;  5DNM A;  4J8W C;  4WNN B;  5JRG D;  5BNV A;  5AV9 B;  3TU4 A;  3VH6 W;  3W96 C;  5B40 B;  1M1A C;  1P3F D;  1M19 A;  3AZM A;  4WU9 D;  5AVB A;  1P3M A;  5GSU B;  4R8P D;  4YM6 B;  3X1T D;  3AZG D;  3LZ1 D;  5GT0 D;  1ID3 A;  2NZD B;  3X1V C;  3NQJ A;  5F99 B;  3B6G C;  2RVQ D;  5GXQ C;  5JRG A;  3REH B;  2ARO D;  1WWS A;  4H9N A;  1P3F A;  4KUD A;  4WU9 A;  5CPI D;  1P3O D;  3WTP C;  4R8P A;  4UUZ B;  5AV5 C;  3LZ1 A;  5GT0 A;  3MGR B;  3AZL D;  4YS3 B;  3W98 C;  3WAA A;  1WWI A;  3AV1 B;  4ZBJ B;  3LJA C;  3W97 B;  2BG1 A;  2Y2I A;  4H9R A;  4Z66 D;  2ARO A;  3AFA D;  5CPJ A;  3UTB B;  1M18 B;  3KXB D;  5B33 B;  4KGC A;  3C1C D;  2F8N B;  3B6F B;  5CPI A;  3A6N D;  3AZK D;  2CV5 B;  3MVD D;  2Y2P A;  5B2I C;  3AZN B;  3AV2 D;  4X23 B;  1P3B C;  4XZQ A;  3MGS C;  2Y2H A;  3R45 B;  4Z66 A;  3AFA A;  4LD9 C;  3AZE D;  5AV8 B;  1TZY C;  1U35 B;  3C1C A;  2JSS A;  3REI A;  4Z2M H;  3TU4 B;  3A6N A;  1ZLA A;  4NE3 A;  3MVD A;  1M19 B;  4QLC A;  3AZM B;  5AVB B;  3AV2 A;  1P3M B;  5E5A C;  1JFI A;  2BYK A;  1ID3 B;  5B31 G;  3W96 D;  4J8X A;  3X1S C;  4HGA C;  2YFW B;  4G91 C;  5AVC D;  5JRG B;  2Y2M A;  5B32 C;  1A7W A;  1F66 C;  2DF4 C;  4JJN A;  1P3F B;  4KUD B;  2LY8 A;  4WU9 B;  3REJ C;  5B0Z D;  2F8N H;  5DNM C;  4R8P B;  3X1T B;  3AZG B;  3LZ1 B;  5GT0 B;  1HQ3 C;  1P3I C;  2XD1 A;  1H3O A;  4XUJ A;  1KX3 C;  5B40 A;  2IO5 B;  4NE5 A;  5AVC A;  2FFF B;  5GSU A;  4H9R B;  2ARO B;  2Y2O A;  4UPK A;  5B24 C;  2PYO C;  4KGC B;  2NQB D;  2CWE A;  5B0Z A;  5CPI B;  1P3O B;  3FDD A;  3AZL B;  1B6W A;  4WU8 D;  4Z2M G;  4Z5T D;  3H0L C;  3WTP E;  1P34 D;  3VH6 T;  3O62 C;  4Z66 B;  3AFA B;  5B2I D;  3KWQ C;  3LEL C;  4DQY B;  5B1M D;  3MNN C;  1P3B D;  3C1C B;  2NQB A;  1Q9C A;  3A6N B;  5GT3 D;  5DNN C;  3MVD B;  5FUG A;  4QLC B;  1P3K C;  3EG5 B;  1EQZ C;  4DRA A;  1S32 C;  4Z5T A;  3AV2 B;  1KX5 D;  2Y2J A;  1JFI B;  2BYK B;  1KX4 C;  5CHL B;  1P34 A;  3B6F A;  2F8N G;  2J8P A;  2JE5 A;  5B0Y C;  3LZ0 D;  5B1M A;  5E5A D;  3WA9 C;  3W99 C;  5BT1 D;  1P3A D;  5GT3 A;  3C1B C;  3AN2 D;  1P3L D;  1KX5 A;  5BS7 A;  3AZI C;  3REI C;  5AV8 A;  3KUY C;  1ZLA C;  3X1U C;  3W96 B;  1H3O B;  4XUJ B;  3MGQ A;  3B0C W;  3LZ0 A;  5AVC B;  5B2J D;  2JCH A;  5B31 C;  2FJ7 D;  1P3A A;  1P3P D;  1KU5 A;  3AN2 A;  4WJ3 C;  5B0Z B;  1ULY A;  4AWL C;  3AYW C;  2YFW A;  5AV6 C;  3V9R A;  4JJN C;  5B1L D;  3AZJ D;  3UT9 C;  5B2J A;  2FJ7 A;  4E44 A;  3X1T A;  3UTA D;  3AZG A;  5AV9 C;  2NQB B;  5G49 A;  2XD5 A;  4H9S A;  5GSU C;  3O62 D;  3REL D;  5FUG B;  4H9P A;  4YM6 C;  4WU8 B;  4Z5T B;  1AOI D;  2NZD C;  3AZF D;  2ZY3 A;  5B1L A;  3AZJ A;  1P3G D;  5F99 C;  1P34 B;  1P3O A;  5AY8 D;  3REH C;  3UTA A;  3AZL A;  5B1M B;  2HIO D;  5JA4 A;  5BNX B;  4J8U D;  5GT3 B;  4ZUX D;  3WKJ D;  3REL A;  4YS3 C;  3MGR C;  4J8V D;  3MGP D;  1KX5 B;  3AZF A;  1AOI A;  1P3G A;  1PZR A;  3AV1 C;  4ZBJ C;  3KXB A;  3AZH D;  3WA9 D;  3W97 C;  5AY8 A;  5CP6 D;  3MGQ B;  3AZK A;  5CPK D;  2ZY5 A;  3LZ0 B;  3REK D;  3UTB C;  1M18 C;  5B33 C;  1P3A B;  3VH5 T;  4J8W D;  4ZUX A;  2DQN C;  3B6F C;  3WKJ A;  5BO0 B;  1M1A D;  3AN2 B;  2CV5 C;  3EPH A;  4J8V A;  1P3L B;  3MGP A;  3AZN C;  2F8N K;  3AZE A;  3V9R B;  5C3I B;  4X23 C;  3AZH A;  5CP6 A;  3X1V D;  5CPK A;  4G92 B;  3REK A;  3B6G D;  1TAF A;  5AV8 C;  5B2J B;  5AV6 D;  1U35 C;  2FJ7 B;  4J8W A;  5GXQ D; 
#chains in the Genus database with same CATH homology
 1P3P B;  3TU4 C;  3W96 A;  1M1A A;  1M19 C;  5G49 B;  4EO5 B;  3UT9 D;  3AZM C;  5AVB C;  1P3M C;  3EPJ A;  3WTP D;  4H9P B;  5AV5 D;  1ID3 C;  3W98 D;  5B1L B;  3AZJ B;  2W8S A;  3X1V A;  3B6G A;  3B0D B;  3LJA D;  3A1K A;  5JRG C;  5GXQ A;  3UTA B;  2Y2G A;  1BH8 B;  1P3F C;  5JA4 B;  4KUD C;  4CSR A;  4WU9 C;  2HUE B;  4DRB A;  3WTP A;  4R8P C;  3REL B;  3X1T C;  3AZG C;  5AV5 A;  5GT0 C;  3LZ1 C;  3REH D;  3B0C T;  1AOI B;  3WAA C;  3AZF B;  3W98 A;  1P3G B;  1B67 A;  2IO5 C;  3KXB B;  3LJA A;  1Z2C B;  5AY8 B;  3MGS D;  2RVQ C;  3AZK B;  3MGR D;  3KFU G;  2ARO C;  5CPJ C;  2HIO B;  4WU8 A;  4LD9 D;  1TZY D;  4KGC C;  4J8U B;  4ZUX B;  5CPI C;  1P3O C;  3WKJ B;  4J8V B;  3MGP B;  5B2I A;  3AZE B;  1M18 D;  3WA9 B;  3AZH B;  4XZQ C;  1P3B A;  5BNX A;  5CP6 B;  1W2E A;  5CPK B;  3X1S D;  4Z66 C;  3AFA C;  3REK B;  1TAF B;  4LD9 A;  1TZY A;  1N1J A;  3C1C C;  4J8W B;  4H9Q B;  4H9O A;  5B32 D;  3A6N C;  1M1A B;  1F66 D;  3EPL A;  3MVD C;  4QLC C;  3REJ D;  4E45 A;  3AV2 C;  2BYM A;  5DNM D;  5E5A A;  1R4V A;  1HQ3 D;  1P3I D;  4J8X C;  3X1V B;  5BO0 A;  3X1S A;  1M19 D;  1KX3 D;  3B6G B;  4AWL B;  1P3L A;  5AV6 B;  5GXQ B;  5B32 A;  3EPK A;  1F66 A;  4CSR B;  5B24 D;  2PYO D;  3REJ A;  3WTP B;  5AV5 B;  1HQ3 A;  1P3I A;  3W98 B;  1P3P A;  4XUJ C;  1KX3 A;  4KUD D;  5B40 C;  1F1E A;  3LJA B;  5AVC C;  3WAA D;  3KWQ D;  3LEL D;  5B24 A;  2PYO A;  3MNN D;  5B0Z C;  5DNN D;  1P3K D;  5CPJ D;  1EQZ D;  5B2I B;  1BH8 A;  1S32 D;  1BH9 A;  4KGC D;  1P3B B;  3MGS B;  1KX4 D;  3O62 A;  4NE6 A;  3NQU A;  5B0Y D;  4KHA A;  3KWQ A;  3LEL A;  4LD9 B;  1TZY B;  3IP4 C;  1N1J B;  2ZM5 A;  3MNN A;  4XZQ D;  4H9O B;  2NQB C;  3W99 D;  5DNN A;  3C1B D;  1P3K A;  4WU8 C;  1EQZ A;  4Z5T C;  1S32 A;  5KDM A;  2BYM B;  2HIO A;  5E5A B;  3AZI D;  3REI D;  3KUY D;  4J8U A;  1KX4 A;  1ZLA D;  1P34 C;  4WV4 B;  3X1U D;  2ZY2 A;  4HGA B;  4NFT A;  3X1S B;  4QLC D;  5B0Y A;  4G91 B;  5B1M C;  5B31 D;  5B32 B;  3W99 A;  3WA9 A;  5GT3 C;  1F66 B;  2Y2N A;  3VH5 A;  4J8X D;  3C1B A;  1HTA A;  3REJ B;  1KX5 C;  5BS7 C;  5DNM B;  3AYW D;  3AZI A;  1BFM A;  5BNV B;  3KUY A;  1HQ3 B;  3KSY A;  2F2A C;  4H9Q A;  1P3I B;  3X1U A;  3MGQ C;  4JJN D;  1KX3 B;  3LZ0 C;  3A1I A;  5BT1 C;  5B31 A;  1P3A C;  3H0M C;  5AV9 D;  2YFV A;  3NQJ B;  4XUJ D;  5B40 D;  5B24 B;  3AN2 C;  2PYO B;  1P3L C;  2UWX A;  3AYW A;  5AV6 A;  5C3I C;  5GSU D;  3H0R C;  4YM6 D;  4H9N B;  1BH9 B;  4CAY A;  2NZD D;  2L5A A;  4G92 C;  5F99 D;  3UT9 A;  5B2J C;  3O62 B;  2FJ7 C;  2Y2L A;  4WNN A;  3WAA B;  3NQU B;  3KWQ B;  4KHA B;  5AV9 A;  3LEL B;  1P3P C;  2VQR A;  3MNN B;  2RIQ A;  4EO5 C;  3P5J B;  4H9S C;  5DNN B;  1P3K B;  5CPJ B;  4YM6 A;  1EQZ B;  4YS3 D;  3VH6 A;  1S32 B;  5KDM B;  2NZD A;  5B1L C;  3AZJ C;  2Y2Q A;  5F99 A;  3AV1 D;  1KX4 B;  3B0D C;  2G5H C;  3W97 D;  4M6B A;  3VH5 W;  3B0B A;  3UTA C;  3REH A;  5B0Y B;  3AZL C;  4XZQ B;  3UTB D;  3W99 B;  5B33 D;  2HUE C;  2F8N D;  3B6F D;  3MGS A;  3C1B B;  3REL C;  4UUZ A;  2CV5 D;  4YS3 A;  3MGR A;  1AOI C;  3AZF C;  3AZN D;  3AL0 C;  1P3G C;  3AZI B;  3REI B;  3AV1 A;  3KUY B;  4X23 D;  3KXB C;  1ZLA B;  3W97 A;  3X1U B;  5AY8 C;  3AZK C;  2HIO C;  3F6T A;  3UTB A;  5AV8 D;  1M18 A;  1U35 D;  5B31 B;  4J8U C;  5B33 A;  4ZUX C;  2F8N A;  3WKJ C;  4J8X B;  2YFV B;  3MGQ D;  3TU4 D;  4J8V C;  2CV5 A;  2G5I C;  3MGP C;  3AZM D;  3AZN A;  3AZE C;  5AVB D;  4WZS B;  3AYW B;  1P3M D;  2Y2K A;  4X23 A;  3AZH C;  1ID3 D;  5CP6 C;  1T3U A;  4CAY B;  4JJN B;  5B32 G;  5CPK C;  3R45 A;  2ZY4 A;  3REK C;  3UT9 B;  1U35 A;  5DNM A;  4J8W C;  4WNN B;  5JRG D;  5BNV A;  5AV9 B;  3TU4 A;  3VH6 W;  3W96 C;  5B40 B;  1M1A C;  1P3F D;  1M19 A;  3AZM A;  4WU9 D;  5AVB A;  1P3M A;  5GSU B;  4R8P D;  4YM6 B;  3X1T D;  3AZG D;  3LZ1 D;  5GT0 D;  1ID3 A;  2NZD B;  3X1V C;  3NQJ A;  5F99 B;  3B6G C;  2RVQ D;  5GXQ C;  5JRG A;  3REH B;  2ARO D;  1WWS A;  4H9N A;  1P3F A;  4KUD A;  4WU9 A;  5CPI D;  1P3O D;  3WTP C;  4R8P A;  4UUZ B;  5AV5 C;  3LZ1 A;  5GT0 A;  3MGR B;  3AZL D;  4YS3 B;  3W98 C;  3WAA A;  1WWI A;  3AV1 B;  4ZBJ B;  3LJA C;  3W97 B;  2BG1 A;  2Y2I A;  4H9R A;  4Z66 D;  2ARO A;  3AFA D;  5CPJ A;  3UTB B;  1M18 B;  3KXB D;  5B33 B;  4KGC A;  3C1C D;  2F8N B;  3B6F B;  5CPI A;  3A6N D;  3AZK D;  2CV5 B;  3MVD D;  2Y2P A;  5B2I C;  3AZN B;  3AV2 D;  4X23 B;  1P3B C;  4XZQ A;  3MGS C;  2Y2H A;  3R45 B;  4Z66 A;  3AFA A;  4LD9 C;  3AZE D;  5AV8 B;  1TZY C;  1U35 B;  3C1C A;  2JSS A;  3REI A;  4Z2M H;  3TU4 B;  3A6N A;  1ZLA A;  4NE3 A;  3MVD A;  1M19 B;  4QLC A;  3AZM B;  5AVB B;  3AV2 A;  1P3M B;  5E5A C;  1JFI A;  2BYK A;  1ID3 B;  5B31 G;  3W96 D;  4J8X A;  3X1S C;  4HGA C;  2YFW B;  4G91 C;  5AVC D;  5JRG B;  2Y2M A;  5B32 C;  1A7W A;  1F66 C;  2DF4 C;  4JJN A;  1P3F B;  4KUD B;  2LY8 A;  4WU9 B;  3REJ C;  5B0Z D;  2F8N H;  5DNM C;  4R8P B;  3X1T B;  3AZG B;  3LZ1 B;  5GT0 B;  1HQ3 C;  1P3I C;  2XD1 A;  1H3O A;  4XUJ A;  1KX3 C;  5B40 A;  2IO5 B;  4NE5 A;  5AVC A;  2FFF B;  5GSU A;  4H9R B;  2ARO B;  2Y2O A;  4UPK A;  5B24 C;  2PYO C;  4KGC B;  2NQB D;  2CWE A;  5B0Z A;  5CPI B;  1P3O B;  3FDD A;  3AZL B;  1B6W A;  4WU8 D;  4Z2M G;  4Z5T D;  3H0L C;  3WTP E;  1P34 D;  3VH6 T;  3O62 C;  4Z66 B;  3AFA B;  5B2I D;  3KWQ C;  3LEL C;  4DQY B;  5B1M D;  3MNN C;  1P3B D;  3C1C B;  2NQB A;  1Q9C A;  3A6N B;  5GT3 D;  5DNN C;  3MVD B;  5FUG A;  4QLC B;  1P3K C;  3EG5 B;  1EQZ C;  4DRA A;  1S32 C;  4Z5T A;  3AV2 B;  1KX5 D;  2Y2J A;  1JFI B;  2BYK B;  1KX4 C;  5CHL B;  1P34 A;  3B6F A;  2F8N G;  2J8P A;  2JE5 A;  5B0Y C;  3LZ0 D;  5B1M A;  5E5A D;  3WA9 C;  3W99 C;  5BT1 D;  1P3A D;  5GT3 A;  3C1B C;  3AN2 D;  1P3L D;  1KX5 A;  5BS7 A;  3AZI C;  3REI C;  5AV8 A;  3KUY C;  1ZLA C;  3X1U C;  3W96 B;  1H3O B;  4XUJ B;  3MGQ A;  3B0C W;  3LZ0 A;  5AVC B;  5B2J D;  2JCH A;  5B31 C;  2FJ7 D;  1P3A A;  1P3P D;  1KU5 A;  3AN2 A;  4WJ3 C;  5B0Z B;  1ULY A;  4AWL C;  3AYW C;  2YFW A;  5AV6 C;  3V9R A;  4JJN C;  5B1L D;  3AZJ D;  3UT9 C;  5B2J A;  2FJ7 A;  4E44 A;  3X1T A;  3UTA D;  3AZG A;  5AV9 C;  2NQB B;  5G49 A;  2XD5 A;  4H9S A;  5GSU C;  3O62 D;  3REL D;  5FUG B;  4H9P A;  4YM6 C;  4WU8 B;  4Z5T B;  1AOI D;  2NZD C;  3AZF D;  2ZY3 A;  5B1L A;  3AZJ A;  1P3G D;  5F99 C;  1P34 B;  1P3O A;  5AY8 D;  3REH C;  3UTA A;  3AZL A;  5B1M B;  2HIO D;  5JA4 A;  5BNX B;  4J8U D;  5GT3 B;  4ZUX D;  3WKJ D;  3REL A;  4YS3 C;  3MGR C;  4J8V D;  3MGP D;  1KX5 B;  3AZF A;  1AOI A;  1P3G A;  1PZR A;  3AV1 C;  4ZBJ C;  3KXB A;  3AZH D;  3WA9 D;  3W97 C;  5AY8 A;  5CP6 D;  3MGQ B;  3AZK A;  5CPK D;  2ZY5 A;  3LZ0 B;  3REK D;  3UTB C;  1M18 C;  5B33 C;  1P3A B;  3VH5 T;  4J8W D;  4ZUX A;  2DQN C;  3B6F C;  3WKJ A;  5BO0 B;  1M1A D;  3AN2 B;  2CV5 C;  3EPH A;  4J8V A;  1P3L B;  3MGP A;  3AZN C;  2F8N K;  3AZE A;  3V9R B;  5C3I B;  4X23 C;  3AZH A;  5CP6 A;  3X1V D;  5CPK A;  4G92 B;  3REK A;  3B6G D;  1TAF A;  5AV8 C;  5B2J B;  5AV6 D;  1U35 C;  2FJ7 B;  4J8W A;  5GXQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...