2CV5C

Crystal structure of human nucleosome core particle
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (146-MER)
publication title Alteration of the nucleosomal DNA path in the crystal structure of a human nucleosome core particle
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 30
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2cv5C00
5KDMA 1P3ID 3AZGD 1P3FB 1P3OD 5GT3A 3MGQB 3X1TC 3REIB 5AV5B 3AV1D 3B6GB 2CWEA 5B2IC 3MVDA 3AYWC 5B40C 5DNNB 3RELD 2AROA 4KHAB 4WNNA 5G49A 3REKA 3UTAB 1ID3B 3AZKD 3KSYA 5GXQD 3AZFA 1KU5A 1AOIC 3AV2A 1P3KA 3LJAD 1M18D 3AZEA 1R4VA 5B32C 3MNNC 3RELA 1P34C 2LY8A 5B1LA 3W96A 4XZQA 3WTPB 3A6NC 4ZUXA 1KX4C 3WKJC 5CPJA 4Z66D 1P3FD 4QLCC 1U35A 2HIOD 1P3GB 3W98A 5B0YC 5AV6C 3LZ0A 2CV5B 3REJA 3LZ1D 1BH8B 5DNND 5CPID 5B0ZC 3W97A 3AZLD 3C1BB 1S32B 4J8UB 3C1CC 5E5AB 5DNMB 5B2JB 5CPKD 1P3MC 3UT9A 5BT1C 5AVCA 4LD9A 1BH9B 4Z2MH 3X1SA 5CPIA 5B31G 3MGSB 5JRGD 3B0CT 4WU9B 4X23B 3B6FB 5AY8A 5CP6A 5B31B 1TAFB 4G92C 3AZGC 1P3IC 1P3OC 5BS7C 2PYOC 3LELD 3TU4C 1P3AB 1P3BC 1M19C 3KUYA 3WAAC 5AV9B 4NE6A 5F99D 5AVBB 5GXQC 3KWQC 3X1TD 3O62D 3LJAC 3AZNC 1ZLAD 3AYWD 3AFAB 3X1UC 3X1VB 1JFIB 3NQJA 4YS3D 1KX3D 4J8WA 3AZMA 4H9PB 4XUJB 4WZSB 4DRBA 1AOID 3AZIB 5B1MD 5B31D 2BYKA 1P3PB 4WU8B 1P3FC 3MGQC 5B2IA 5B32D 5B40A 3MNND 5AV5C 3REIC 1P34D 1P3AD 1B67A 5DNNC 4Z5TB 5B24B 1ID3C 3A6ND 3UTAC 1KX5D 1KX4D 4KGCB 1TZYA 3AZHA 2NQBB 4CSRA 4QLCD 4NE5A 4EO5B 2L5AA 4YM6A 3AFAD 1N1JA 5GT3B 4H9QA 3MVDB 4XUJD 3WKJA 5JA4A 4WNNB 5G49B 3WTPC 1M1AA 1P3MD 1P3PD 3AZFB 5B0YA 5AV6A 5BT1D 5GT0A 3AV2B 2F8NG 4JJNA 2CV5C 5B0ZA 4UUZB 1P3LA 1B6WA 3VH6T 5B24D 3WTPE 3VH5A 3C1CA 5B1LB 4H9NA 3W99A 3C1BC 1S32C 4J8UC 3W96B 3O62C 5E5AC 1P3BD 3TU4D 2PYOD 5B2JC 4ZUXB 1ZLAC 1M19D 3AZJB 5CPJB 5BNVA 3WAAD 3WA9B 3REHD 4AWLB 5B33A 4YS3C 3AN2A 3W98B 1KX3C 3MGSC 4WU9C 3B6FC 3KWQD 4X23C 1P3IA 3AZGA 5B1MC 5B31C 1P3OA 5BS7A 3AZND 3MGRB 3AV1A 3X1UD 1P3AC 4WV4B 1EQZB 3AZKA 2F8ND 3UT9B 5GXQA 5AV9C 1KX5C 5AVBC 3X1SB 3VH5T 4H9SC 3LJAA 2YFVA 3MGQD 4J8VB 5AY8B 1M18A 3REID 5AV5D 3B6GD 5BNXA 3AZJD 4J8XB 3AFAC 3WA9D 3B0DB 2NZDB 1ID3D 3MGPB 3UTAD 3NQUA 3B0CW 3KUYB 4XUJC 4CAYB 3AZIC 4Z66A 2IO5C 1P3FA 2HIOA 3MGRD 1P3PC 4WU8C 3LZ1A 5DNNA 4KHAA 1EQZD 3AZLA 4Z5TC 5B24C 3WTPD 3NQJB 4KGCC 4J8WB 1H3OA 4J8VD 5CPKA 5GSUB 1P3GD 2CV5D 2BYKB 4EO5C 2RVQC 1WWSA 4J8XD 3REHC 5GT3C 1F66B 5B2IB 5JRGA 3MGPD 3UTBB 3C1BD 3MVDC 1S32D 4J8UD 5AV8B 2YFWA 4H9RA 5DNMD 5E5AD 5B2JD 3KXBB 1BFMA 1TZYB 3LELA 3AZHB 3AZFC 2FJ7B 3AV2C 4WU9D 5F99A 3MGSD 3B6FD 4YM6B 4X23D 3C1BA 4H9QB 4KUDB 3X1TA 4R8PB 3O62A 5E5AA 5B2JA 1ZLAA 3W96C 5JA4B 1HQ3B 5GSUD 3AYWA 1M1AB 3B6GC 4ZUXC 3VH6A 3AZJC 4YS3A 5CPJC 1KX3A 2F8NK 1BH9A 5GT0B 3WA9C 5AV9D 4AWLC 1F66D 5AVBD 1AOIA 4JJNB 5B1MA 5B31A 5AV8D 1P3LB 3KXBD 3MGRC 5KDMB 5FUGA 5B32A 3MNNA 1P3AA 3W99B 1P34A 2BYMA 3X1VD 2FJ7D 3A6NA 1KX5A 1KX4A 3VH6W 1EQZC 5AVBA 3UT9C 2AROB 5CHLB 4H9OA 5B33B 3REKB 3AZID 3AN2B 4H9SA 4QLCA 4KUDD 4R8PD 3X1SC 4WU8D 4J8VC 5AY8C 1P3GC 1HQ3D 3AZGB 3AFAA 5BO0A 1P3KB 3AV1B 4J8XC 3AZEB 4Z5TD 3B0DC 3R45A 2NZDC 4XUJA 3MGPC 3RELB 4KGCD 2NQBD 4XZQB 3AZKB 1P3MA 5DNMC 1P3PA 2RVQD 1U35B 2YFVB 5GT3D 4HGAB 1M18B 1Q9CA 3LZ0B 5B24A 3REJB 3MVDD 4KGCA 2AROD 4DRAA 3REKD 3NQUB 3W97B 2PYOA 3VH5W 4J8WC 3TU4A 1P3BA 3AZFD 4ZBJB 2HUEB 4Z2MG 1M19A 5GSUC 4Z66B 3AV2D 3WAAA 3REHA 1P3KD 2HIOB 1A7WA 4NFTA 3AZED 1F66C 5AVCB 3LZ1B 3KWQA 4LD9B 3UTBC 5B1LD 5CPIB 3V9RA 3AZNA 5AV8C 4E44A 5CP6B 4XZQD 3AZLB 3W96D 3X1UA 3KXBC 4ZUXD 1HTAA 1TZYC 3AZHC 1H3OB 5CPJD 5CPKB 3X1VC 1U35D 2FJ7C 2F8NA 3W98D 4UUZA 3LZ0D 3REJD 4YM6C 4G91B 5JRGB 4KUDC 2F8NH 3MGQA 3W97D 4R8PC 3REIA 5AV5A 3B6GA 2YFWB 4H9RB 3AZJA 1HQ3C 1M1AC 3WA9A 1ID3A 3LELB 3UTAA 3UT9D 5GT0C 5AVCD 4LD9D 5C3IB 4JJNC 3AZMB 3X1SD 2NQBC 5F99B 3MGRA 5AY8D 5CP6D 1P3LC 3X1TB 3O62B 3W99C 1ZLAB 2NZDD 3AYWB 5B40B 1EQZA 3WTPA 4YS3B 3KUYD 1KX3B 2AROC 5B33C 3REKC 3AN2C 4J8VA 1P3GA 1AOIB 5B1MB 4CSRB 2CV5A 5B32G 1BH8A 4J8XA 1P3KC 2NZDA 5FUGB 5B32B 3MNNB 3MGPA 3AV1C 3AZEC 1P34B 2BYMB 1N1JB 1S32A 4J8UA 4CAYA 3RELC 5DNMA 5B1LC 4J8WD 3AZMD 3A6NB 1KX5B 4XZQC 1KX4B 3AZKC 3WKJB 4H9OB 4QLCB 5B0YB 5AV6B 1U35C 4HGAC 1M18C 5B2ID 3MGSA 4WU9A 3B6FA 5B40D 4X23A 3UTBD 3W98C 5BO0B 4NE3A 3LZ0C 4E45A 1ULYA 5B0ZB 3REJC 1TAFA 1F1EA 3R45B 3C1CB 3W97C 1TZYD 5GSUA 3AZHD 4H9NB 2IO5B 4ZBJC 2HUEC 1P3MB 4Z66C 5AV9A 2HIOC 1F66A 5BNVB 3UTBA 4YM6D 5AVCC 3LZ1C 4LD9C 5AV8A 5CPIC 1WWIA 3KXBA 3WKJD 5CP6C 3AZLC 4G92B 1P3IB 1P3OB 1M1AD 3X1VA 1JFIA 2PYOB 1P3BB 3TU4B 2FJ7A 5B0YD 5AV6D 5GT0D 5CPKC 1M19B 4H9PA 2JSSA 3WAAB 3REHB 4JJND 3AZIA 4M6BA 5B0ZD 3KUYC 4KUDA 4R8PA 5GXQB 1P3LD 4G91C 5JRGC 4WU8A 3KWQB 3C1CD 1HQ3A 3W99D 3V9RB 3LJAB 3AZNB 3X1UB 3B0BA 4Z5TA 5BNXB 3LELC 5B33D 2NQBA 3AN2D 2F8NB 5C3IC 3AZMC 5F99C
chains in the Genus database with same CATH superfamily
5KDMA 1P3ID 3AZGD 1P3FB 1P3OD 5GT3A 3MGQB 3X1TC 2F2AC 3REIB 5AV5B 3AV1D 3B6GB 2CWEA 5B2IC 3MVDA 3AYWC 5B40C 5DNNB 3RELD 2AROA 4KHAB 4WNNA 5G49A 3REKA 3UTAB 1ID3B 3AZKD 3KSYA 5GXQD 3AZFA 1KU5A 1AOIC 3AV2A 1P3KA 3LJAD 1M18D 3AZEA 1R4VA 5B32C 3MNNC 3RELA 1P34C 2LY8A 5B1LA 3EPLA 3W96A 4XZQA 3A1KA 3WTPB 3A6NC 4ZUXA 1KX4C 3WKJC 2FFFB 5CPJA 4Z66D 1P3FD 4QLCC 1U35A 2HIOD 1P3GB 3W98A 5B0YC 5AV6C 3LZ0A 2CV5B 2VQRA 3LZ1D 3REJA 1BH8B 3EPJA 5DNND 5CPID 5B0ZC 3W97A 3AZLD 3C1BB 1S32B 4J8UB 3C1CC 5E5AB 5DNMB 5B2JB 5CPKD 1P3MC 2XD5A 3UT9A 5BT1C 5AVCA 4LD9A 1BH9B 4Z2MH 3X1SA 5CPIA 5B31G 3MGSB 5JRGD 3B0CT 4WU9B 4X23B 3B6FB 5AY8A 5CP6A 2JE5A 5B31B 1TAFB 4G92C 3AZGC 1P3IC 1P3OC 5BS7C 2PYOC 3LELD 3TU4C 1P3AB 1P3BC 1M19C 3KUYA 3WAAC 5AV9B 4NE6A 5F99D 5AVBB 5GXQC 3KWQC 3X1TD 3O62D 2Y2JA 3LJAC 3AZNC 1ZLAD 3AYWD 3AFAB 3X1UC 3X1VB 1JFIB 3NQJA 4YS3D 1KX3D 4J8WA 3AZMA 4H9PB 4XUJB 4WZSB 4DRBA 1AOID 3AZIB 5B1MD 5B31D 2BYKA 1P3PB 3F6TA 4WU8B 1P3FC 3MGQC 5B2IA 5B32D 5B40A 3MNND 5AV5C 3REIC 1P34D 1P3AD 1B67A 5DNNC 4Z5TB 5B24B 1ID3C 3A6ND 3UTAC 1KX5D 1KX4D 4KGCB 1TZYA 3AZHA 2NQBB 4CSRA 4QLCD 4NE5A 4EO5B 2L5AA 4YM6A 3AFAD 1N1JA 5GT3B 4H9QA 3MVDB 4XUJD 3WKJA 5JA4A 4WNNB 5G49B 3WTPC 1M1AA 2G5IC 1P3MD 1P3PD 3AZFB 3KFUG 5B0YA 5AV6A 5BT1D 5GT0A 3AV2B 2F8NG 4JJNA 2CV5C 5B0ZA 4UUZB 1P3LA 1B6WA 3VH6T 5B24D 3WTPE 3VH5A 3C1CA 5B1LB 4H9NA 3W99A 3C1BC 1S32C 4J8UC 3W96B 3O62C 5E5AC 1P3BD 3TU4D 2PYOD 5B2JC 4ZUXB 1ZLAC 1M19D 3AZJB 2Y2HA 5CPJB 5BNVA 3WAAD 3WA9B 3REHD 4AWLB 5B33A 4YS3C 3AN2A 3W98B 1KX3C 3H0LC 3MGSC 4WU9C 3B6FC 3KWQD 4X23C 1P3IA 3AZGA 5B1MC 5B31C 2Y2QA 1P3OA 5BS7A 3AZND 3MGRB 3AV1A 3X1UD 1PZRA 2JCHA 1P3AC 4WV4B 1EQZB 3AZKA 2F8ND 3UT9B 5GXQA 5AV9C 1KX5C 3IP4C 5AVBC 3X1SB 3VH5T 4H9SC 3LJAA 2YFVA 3MGQD 4J8VB 5AY8B 1M18A 3REID 5AV5D 2J8PA 3B6GD 5BNXA 3AZJD 4J8XB 3AFAC 3WA9D 3B0DB 2NZDB 2Y2LA 1ID3D 3MGPB 3UTAD 3NQUA 3B0CW 3KUYB 4XUJC 4CAYB 3AZIC 4Z66A 2IO5C 1P3FA 2HIOA 3MGRD 1P3PC 4WU8C 3LZ1A 5DNNA 4KHAA 1EQZD 2BG1A 3A1IA 4Z5TC 3AZLA 5B24C 3WTPD 3NQJB 4KGCC 4J8WB 1H3OA 4J8VD 5CPKA 5GSUB 1P3GD 2Y2MA 2CV5D 2BYKB 4EO5C 2RVQC 1WWSA 2ZY5A 4J8XD 3REHC 5GT3C 1F66B 5B2IB 5JRGA 3MGPD 3UTBB 3C1BD 3MVDC 2RIQA 3P5JB 5AV8B 4H9RA 2YFWA 4J8UD 1S32D 5DNMD 5E5AD 5B2JD 3KXBB 1BFMA 1TZYB 3LELA 3AZHB 3AZFC 2FJ7B 3AV2C 4WU9D 5F99A 3MGSD 3B6FD 4YM6B 4X23D 3C1BA 4H9QB 4KUDB 3X1TA 4R8PB 3O62A 5E5AA 2W8SA 5B2JA 1ZLAA 3W96C 5JA4B 1HQ3B 5GSUD 3AYWA 1M1AB 3B6GC 4ZUXC 3VH6A 3AZJC 4YS3A 5CPJC 1KX3A 2F8NK 1BH9A 5GT0B 3WA9C 5AV9D 4AWLC 1F66D 5AVBD 1AOIA 4JJNB 2Y2NA 5B1MA 5B31A 5AV8D 2Y2OA 1P3LB 3KXBD 3MGRC 5KDMB 5FUGA 5B32A 3MNNA 1P3AA 3W99B 2DQNC 1P34A 2BYMA 3X1VD 2FJ7D 3A6NA 1KX5A 1KX4A 3VH6W 1EQZC 5AVBA 3UT9C 2AROB 5CHLB 4H9OA 5B33B 3REKB 3AZID 3AN2B 4H9SA 4QLCA 4KUDD 4R8PD 3X1SC 4WU8D 4J8VC 5AY8C 1P3GC 1HQ3D 3AZGB 3AFAA 3EPHA 5BO0A 1P3KB 3AV1B 4J8XC 3AZEB 4Z5TD 3B0DC 3R45A 2NZDC 4XUJA 2ZY2A 3MGPC 3RELB 4DQYB 4KGCD 2NQBD 4XZQB 3AZKB 1T3UA 1P3MA 5DNMC 1P3PA 2RVQD 1U35B 2YFVB 5GT3D 4HGAB 1M18B 1Q9CA 3LZ0B 5B24A 3REJB 2ZY3A 3MVDD 4KGCA 2UWXA 2AROD 4DRAA 3REKD 3NQUB 3W97B 2ZM5A 2PYOA 3VH5W 4J8WC 3TU4A 1P3BA 3AZFD 4ZBJB 2HUEB 4Z2MG 1M19A 5GSUC 4Z66B 2DF4C 3AV2D 3WAAA 3REHA 1P3KD 2HIOB 1A7WA 4NFTA 3AZED 1F66C 5AVCB 3LZ1B 3KWQA 4LD9B 3UTBC 5B1LD 5CPIB 2ZY4A 3V9RA 3AZNA 5AV8C 4E44A 5CP6B 4XZQD 3AZLB 3W96D 3X1UA 3KXBC 4ZUXD 1HTAA 1TZYC 3AZHC 1H3OB 5CPJD 4UPKA 5CPKB 3X1VC 1U35D 2FJ7C 2F8NA 3W98D 4UUZA 3LZ0D 3REJD 4YM6C 4G91B 5JRGB 4KUDC 2F8NH 3MGQA 3W97D 4R8PC 3REIA 5AV5A 3B6GA 2YFWB 4H9RB 3AZJA 1HQ3C 1M1AC 3WA9A 1ID3A 3LELB 3UTAA 3UT9D 5GT0C 5AVCD 4LD9D 5C3IB 4JJNC 3AZMB 3X1SD 2NQBC 5F99B 3MGRA 5AY8D 5CP6D 1P3LC 3X1TB 3O62B 3EPKA 3W99C 1ZLAB 2NZDD 3AYWB 5B40B 1EQZA 3WTPA 4YS3B 3KUYD 1KX3B 3FDDA 1W2EA 2AROC 5B33C 3REKC 3AN2C 4J8VA 1P3GA 1AOIB 5B1MB 4CSRB 2CV5A 5B32G 1BH8A 4J8XA 1P3KC 2NZDA 5FUGB 5B32B 3MNNB 2Y2KA 3MGPA 3AV1C 3AZEC 1P34B 2BYMB 1N1JB 1S32A 4J8UA 4CAYA 3RELC 5DNMA 5B1LC 4J8WD 3AZMD 4WJ3C 3A6NB 1KX5B 4XZQC 1KX4B 3AZKC 3WKJB 1Z2CB 4H9OB 4QLCB 5B0YB 5AV6B 1U35C 4HGAC 1M18C 5B2ID 3MGSA 4WU9A 3B6FA 5B40D 4X23A 3UTBD 3W98C 5BO0B 4NE3A 3LZ0C 4E45A 3AL0C 1ULYA 5B0ZB 3REJC 1TAFA 1F1EA 3R45B 3C1CB 3W97C 1TZYD 5GSUA 3AZHD 4H9NB 2IO5B 4ZBJC 2HUEC 1P3MB 4Z66C 5AV9A 2HIOC 1F66A 2Y2GA 5BNVB 3UTBA 4YM6D 5AVCC 3LZ1C 4LD9C 5AV8A 5CPIC 1WWIA 3KXBA 3WKJD 5CP6C 3AZLC 4G92B 1P3IB 1P3OB 1M1AD 3X1VA 1JFIA 2PYOB 1P3BB 3TU4B 2FJ7A 5B0YD 5AV6D 5GT0D 5CPKC 1M19B 4H9PA 3H0MC 2JSSA 3WAAB 3REHB 4JJND 3AZIA 4M6BA 5B0ZD 3KUYC 4KUDA 4R8PA 5GXQB 1P3LD 4G91C 5JRGC 4WU8A 3KWQB 3H0RC 3C1CD 2XD1A 1HQ3A 2Y2IA 3W99D 2Y2PA 3EG5B 3V9RB 3LJAB 3AZNB 3X1UB 3B0BA 4Z5TA 5BNXB 3LELC 2G5HC 5B33D 2NQBA 3AN2D 2F8NB 5C3IC 3AZMC 5F99C
chains in the Genus database with same CATH topology
5KDMA 1P3ID 3AZGD 1P3FB 1P3OD 5GT3A 3MGQB 3X1TC 2F2AC 3REIB 5AV5B 3AV1D 3B6GB 2CWEA 5B2IC 3MVDA 3AYWC 5B40C 5DNNB 3RELD 2AROA 4KHAB 4WNNA 5G49A 3REKA 3UTAB 1ID3B 3AZKD 3KSYA 5GXQD 3AZFA 1KU5A 1AOIC 3AV2A 1P3KA 3LJAD 1M18D 3AZEA 1R4VA 5B32C 3MNNC 3RELA 1P34C 2LY8A 5B1LA 3EPLA 3W96A 4XZQA 3A1KA 3WTPB 3A6NC 4ZUXA 1KX4C 3WKJC 2FFFB 5CPJA 4Z66D 1P3FD 4QLCC 1U35A 2HIOD 1P3GB 3W98A 5B0YC 5AV6C 3LZ0A 2CV5B 2VQRA 3LZ1D 3REJA 1BH8B 3EPJA 5DNND 5CPID 5B0ZC 3W97A 3AZLD 3C1BB 1S32B 4J8UB 3C1CC 5E5AB 5DNMB 5B2JB 5CPKD 1P3MC 2XD5A 3UT9A 5BT1C 5AVCA 4LD9A 1BH9B 4Z2MH 3X1SA 5CPIA 5B31G 3MGSB 5JRGD 3B0CT 4WU9B 4X23B 3B6FB 5AY8A 5CP6A 2JE5A 5B31B 1TAFB 4G92C 3AZGC 1P3IC 1P3OC 5BS7C 2PYOC 3LELD 3TU4C 1P3AB 1P3BC 1M19C 3KUYA 3WAAC 5AV9B 4NE6A 5F99D 5AVBB 5GXQC 3KWQC 3X1TD 3O62D 2Y2JA 3LJAC 3AZNC 1ZLAD 3AYWD 3AFAB 3X1UC 3X1VB 1JFIB 3NQJA 4YS3D 1KX3D 4J8WA 3AZMA 4H9PB 4XUJB 4WZSB 4DRBA 1AOID 3AZIB 5B1MD 5B31D 2BYKA 1P3PB 3F6TA 4WU8B 1P3FC 3MGQC 5B2IA 5B32D 5B40A 3MNND 5AV5C 3REIC 1P34D 1P3AD 1B67A 5DNNC 4Z5TB 5B24B 1ID3C 3A6ND 3UTAC 1KX5D 1KX4D 4KGCB 1TZYA 3AZHA 2NQBB 4CSRA 4QLCD 4NE5A 4EO5B 2L5AA 4YM6A 3AFAD 1N1JA 5GT3B 4H9QA 3MVDB 4XUJD 3WKJA 5JA4A 4WNNB 5G49B 3WTPC 1M1AA 2G5IC 1P3MD 1P3PD 3AZFB 3KFUG 5B0YA 5AV6A 5BT1D 5GT0A 3AV2B 2F8NG 4JJNA 2CV5C 5B0ZA 4UUZB 1P3LA 1B6WA 3VH6T 5B24D 3WTPE 3VH5A 3C1CA 5B1LB 4H9NA 3W99A 3C1BC 1S32C 4J8UC 3W96B 3O62C 5E5AC 1P3BD 3TU4D 2PYOD 5B2JC 4ZUXB 1ZLAC 1M19D 3AZJB 2Y2HA 5CPJB 5BNVA 3WAAD 3WA9B 3REHD 4AWLB 5B33A 4YS3C 3AN2A 3W98B 1KX3C 3H0LC 3MGSC 4WU9C 3B6FC 3KWQD 4X23C 1P3IA 3AZGA 5B1MC 5B31C 2Y2QA 1P3OA 5BS7A 3AZND 3MGRB 3AV1A 3X1UD 1PZRA 2JCHA 1P3AC 4WV4B 1EQZB 3AZKA 2F8ND 3UT9B 5GXQA 5AV9C 1KX5C 3IP4C 5AVBC 3X1SB 3VH5T 4H9SC 3LJAA 2YFVA 3MGQD 4J8VB 5AY8B 1M18A 3REID 5AV5D 2J8PA 3B6GD 5BNXA 3AZJD 4J8XB 3AFAC 3WA9D 3B0DB 2NZDB 2Y2LA 1ID3D 3MGPB 3UTAD 3NQUA 3B0CW 3KUYB 4XUJC 4CAYB 3AZIC 4Z66A 2IO5C 1P3FA 2HIOA 3MGRD 1P3PC 4WU8C 3LZ1A 5DNNA 4KHAA 1EQZD 2BG1A 3A1IA 4Z5TC 3AZLA 5B24C 3WTPD 3NQJB 4KGCC 4J8WB 1H3OA 4J8VD 5CPKA 5GSUB 1P3GD 2Y2MA 2CV5D 2BYKB 4EO5C 2RVQC 1WWSA 2ZY5A 4J8XD 3REHC 5GT3C 1F66B 5B2IB 5JRGA 3MGPD 3UTBB 3C1BD 3MVDC 2RIQA 3P5JB 5AV8B 4H9RA 2YFWA 4J8UD 1S32D 5DNMD 5E5AD 5B2JD 3KXBB 1BFMA 1TZYB 3LELA 3AZHB 3AZFC 2FJ7B 3AV2C 4WU9D 5F99A 3MGSD 3B6FD 4YM6B 4X23D 3C1BA 4H9QB 4KUDB 3X1TA 4R8PB 3O62A 5E5AA 2W8SA 5B2JA 1ZLAA 3W96C 5JA4B 1HQ3B 5GSUD 3AYWA 1M1AB 3B6GC 4ZUXC 3VH6A 3AZJC 4YS3A 5CPJC 1KX3A 2F8NK 1BH9A 5GT0B 3WA9C 5AV9D 4AWLC 1F66D 5AVBD 1AOIA 4JJNB 2Y2NA 5B1MA 5B31A 5AV8D 2Y2OA 1P3LB 3KXBD 3MGRC 5KDMB 5FUGA 5B32A 3MNNA 1P3AA 3W99B 2DQNC 1P34A 2BYMA 3X1VD 2FJ7D 3A6NA 1KX5A 1KX4A 3VH6W 1EQZC 5AVBA 3UT9C 2AROB 5CHLB 4H9OA 5B33B 3REKB 3AZID 3AN2B 4H9SA 4QLCA 4KUDD 4R8PD 3X1SC 4WU8D 4J8VC 5AY8C 1P3GC 1HQ3D 3AZGB 3AFAA 3EPHA 5BO0A 1P3KB 3AV1B 4J8XC 3AZEB 4Z5TD 3B0DC 3R45A 2NZDC 4XUJA 2ZY2A 3MGPC 3RELB 4DQYB 4KGCD 2NQBD 4XZQB 3AZKB 1T3UA 1P3MA 5DNMC 1P3PA 2RVQD 1U35B 2YFVB 5GT3D 4HGAB 1M18B 1Q9CA 3LZ0B 5B24A 3REJB 2ZY3A 3MVDD 4KGCA 2UWXA 2AROD 4DRAA 3REKD 3NQUB 3W97B 2ZM5A 2PYOA 3VH5W 4J8WC 3TU4A 1P3BA 3AZFD 4ZBJB 2HUEB 4Z2MG 1M19A 5GSUC 4Z66B 2DF4C 3AV2D 3WAAA 3REHA 1P3KD 2HIOB 1A7WA 4NFTA 3AZED 1F66C 5AVCB 3LZ1B 3KWQA 4LD9B 3UTBC 5B1LD 5CPIB 2ZY4A 3V9RA 3AZNA 5AV8C 4E44A 5CP6B 4XZQD 3AZLB 3W96D 3X1UA 3KXBC 4ZUXD 1HTAA 1TZYC 3AZHC 1H3OB 5CPJD 4UPKA 5CPKB 3X1VC 1U35D 2FJ7C 2F8NA 3W98D 4UUZA 3LZ0D 3REJD 4YM6C 4G91B 5JRGB 4KUDC 2F8NH 3MGQA 3W97D 4R8PC 3REIA 5AV5A 3B6GA 2YFWB 4H9RB 3AZJA 1HQ3C 1M1AC 3WA9A 1ID3A 3LELB 3UTAA 3UT9D 5GT0C 5AVCD 4LD9D 5C3IB 4JJNC 3AZMB 3X1SD 2NQBC 5F99B 3MGRA 5AY8D 5CP6D 1P3LC 3X1TB 3O62B 3EPKA 3W99C 1ZLAB 2NZDD 3AYWB 5B40B 1EQZA 3WTPA 4YS3B 3KUYD 1KX3B 3FDDA 1W2EA 2AROC 5B33C 3REKC 3AN2C 4J8VA 1P3GA 1AOIB 5B1MB 4CSRB 2CV5A 5B32G 1BH8A 4J8XA 1P3KC 2NZDA 5FUGB 5B32B 3MNNB 2Y2KA 3MGPA 3AV1C 3AZEC 1P34B 2BYMB 1N1JB 1S32A 4J8UA 4CAYA 3RELC 5DNMA 5B1LC 4J8WD 3AZMD 4WJ3C 3A6NB 1KX5B 4XZQC 1KX4B 3AZKC 3WKJB 1Z2CB 4H9OB 4QLCB 5B0YB 5AV6B 1U35C 4HGAC 1M18C 5B2ID 3MGSA 4WU9A 3B6FA 5B40D 4X23A 3UTBD 3W98C 5BO0B 4NE3A 3LZ0C 4E45A 3AL0C 1ULYA 5B0ZB 3REJC 1TAFA 1F1EA 3R45B 3C1CB 3W97C 1TZYD 5GSUA 3AZHD 4H9NB 2IO5B 4ZBJC 2HUEC 1P3MB 4Z66C 5AV9A 2HIOC 1F66A 2Y2GA 5BNVB 3UTBA 4YM6D 5AVCC 3LZ1C 4LD9C 5AV8A 5CPIC 1WWIA 3KXBA 3WKJD 5CP6C 3AZLC 4G92B 1P3IB 1P3OB 1M1AD 3X1VA 1JFIA 2PYOB 1P3BB 3TU4B 2FJ7A 5B0YD 5AV6D 5GT0D 5CPKC 1M19B 4H9PA 3H0MC 2JSSA 3WAAB 3REHB 4JJND 3AZIA 4M6BA 5B0ZD 3KUYC 4KUDA 4R8PA 5GXQB 1P3LD 4G91C 5JRGC 4WU8A 3KWQB 3H0RC 3C1CD 2XD1A 1HQ3A 2Y2IA 3W99D 2Y2PA 3EG5B 3V9RB 3LJAB 3AZNB 3X1UB 3B0BA 4Z5TA 5BNXB 3LELC 2G5HC 5B33D 2NQBA 3AN2D 2F8NB 5C3IC 3AZMC 5F99C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KDM A;  1P3I D;  3AZG D;  1P3F B;  1P3O D;  5GT3 A;  3MGQ B;  3X1T C;  3REI B;  5AV5 B;  3AV1 D;  3B6G B;  2CWE A;  5B2I C;  3MVD A;  3AYW C;  5B40 C;  5DNN B;  3REL D;  2ARO A;  4KHA B;  4WNN A;  5G49 A;  3REK A;  3UTA B;  1ID3 B;  3AZK D;  3KSY A;  5GXQ D;  3AZF A;  1KU5 A;  1AOI C;  3AV2 A;  1P3K A;  3LJA D;  1M18 D;  3AZE A;  1R4V A;  5B32 C;  3MNN C;  3REL A;  1P34 C;  2LY8 A;  5B1L A;  3W96 A;  4XZQ A;  3WTP B;  3A6N C;  4ZUX A;  1KX4 C;  3WKJ C;  5CPJ A;  4Z66 D;  1P3F D;  4QLC C;  1U35 A;  2HIO D;  1P3G B;  3W98 A;  5B0Y C;  5AV6 C;  3LZ0 A;  2CV5 B;  3REJ A;  3LZ1 D;  1BH8 B;  5DNN D;  5CPI D;  5B0Z C;  3W97 A;  3AZL D;  3C1B B;  1S32 B;  4J8U B;  3C1C C;  5E5A B;  5DNM B;  5B2J B;  5CPK D;  1P3M C;  3UT9 A;  5BT1 C;  5AVC A;  4LD9 A;  1BH9 B;  4Z2M H;  3X1S A;  5CPI A;  5B31 G;  3MGS B;  5JRG D;  3B0C T;  4WU9 B;  4X23 B;  3B6F B;  5AY8 A;  5CP6 A;  5B31 B;  1TAF B;  4G92 C;  3AZG C;  1P3I C;  1P3O C;  5BS7 C;  2PYO C;  3LEL D;  3TU4 C;  1P3A B;  1P3B C;  1M19 C;  3KUY A;  3WAA C;  5AV9 B;  4NE6 A;  5F99 D;  5AVB B;  5GXQ C;  3KWQ C;  3X1T D;  3O62 D;  3LJA C;  3AZN C;  1ZLA D;  3AYW D;  3AFA B;  3X1U C;  3X1V B;  1JFI B;  3NQJ A;  4YS3 D;  1KX3 D;  4J8W A;  3AZM A;  4H9P B;  4XUJ B;  4WZS B;  4DRB A;  1AOI D;  3AZI B;  5B1M D;  5B31 D;  2BYK A;  1P3P B;  4WU8 B;  1P3F C;  3MGQ C;  5B2I A;  5B32 D;  5B40 A;  3MNN D;  5AV5 C;  3REI C;  1P34 D;  1P3A D;  1B67 A;  5DNN C;  4Z5T B;  5B24 B;  1ID3 C;  3A6N D;  3UTA C;  1KX5 D;  1KX4 D;  4KGC B;  1TZY A;  3AZH A;  2NQB B;  4CSR A;  4QLC D;  4NE5 A;  4EO5 B;  2L5A A;  4YM6 A;  3AFA D;  1N1J A;  5GT3 B;  4H9Q A;  3MVD B;  4XUJ D;  3WKJ A;  5JA4 A;  4WNN B;  5G49 B;  3WTP C;  1M1A A;  1P3M D;  1P3P D;  3AZF B;  5B0Y A;  5AV6 A;  5BT1 D;  5GT0 A;  3AV2 B;  2F8N G;  4JJN A;  2CV5 C;  5B0Z A;  4UUZ B;  1P3L A;  1B6W A;  3VH6 T;  5B24 D;  3WTP E;  3VH5 A;  3C1C A;  5B1L B;  4H9N A;  3W99 A;  3C1B C;  1S32 C;  4J8U C;  3W96 B;  3O62 C;  5E5A C;  1P3B D;  3TU4 D;  2PYO D;  5B2J C;  4ZUX B;  1ZLA C;  1M19 D;  3AZJ B;  5CPJ B;  5BNV A;  3WAA D;  3WA9 B;  3REH D;  4AWL B;  5B33 A;  4YS3 C;  3AN2 A;  3W98 B;  1KX3 C;  3MGS C;  4WU9 C;  3B6F C;  3KWQ D;  4X23 C;  1P3I A;  3AZG A;  5B1M C;  5B31 C;  1P3O A;  5BS7 A;  3AZN D;  3MGR B;  3AV1 A;  3X1U D;  1P3A C;  4WV4 B;  1EQZ B;  3AZK A;  2F8N D;  3UT9 B;  5GXQ A;  5AV9 C;  1KX5 C;  5AVB C;  3X1S B;  3VH5 T;  4H9S C;  3LJA A;  2YFV A;  3MGQ D;  4J8V B;  5AY8 B;  1M18 A;  3REI D;  5AV5 D;  3B6G D;  5BNX A;  3AZJ D;  4J8X B;  3AFA C;  3WA9 D;  3B0D B;  2NZD B;  1ID3 D;  3MGP B;  3UTA D;  3NQU A;  3B0C W;  3KUY B;  4XUJ C;  4CAY B;  3AZI C;  4Z66 A;  2IO5 C;  1P3F A;  2HIO A;  3MGR D;  1P3P C;  4WU8 C;  3LZ1 A;  5DNN A;  4KHA A;  1EQZ D;  3AZL A;  4Z5T C;  5B24 C;  3WTP D;  3NQJ B;  4KGC C;  4J8W B;  1H3O A;  4J8V D;  5CPK A;  5GSU B;  1P3G D;  2CV5 D;  2BYK B;  4EO5 C;  2RVQ C;  1WWS A;  4J8X D;  3REH C;  5GT3 C;  1F66 B;  5B2I B;  5JRG A;  3MGP D;  3UTB B;  3C1B D;  3MVD C;  1S32 D;  4J8U D;  5AV8 B;  2YFW A;  4H9R A;  5DNM D;  5E5A D;  5B2J D;  3KXB B;  1BFM A;  1TZY B;  3LEL A;  3AZH B;  3AZF C;  2FJ7 B;  3AV2 C;  4WU9 D;  5F99 A;  3MGS D;  3B6F D;  4YM6 B;  4X23 D;  3C1B A;  4H9Q B;  4KUD B;  3X1T A;  4R8P B;  3O62 A;  5E5A A;  5B2J A;  1ZLA A;  3W96 C;  5JA4 B;  1HQ3 B;  5GSU D;  3AYW A;  1M1A B;  3B6G C;  4ZUX C;  3VH6 A;  3AZJ C;  4YS3 A;  5CPJ C;  1KX3 A;  2F8N K;  1BH9 A;  5GT0 B;  3WA9 C;  5AV9 D;  4AWL C;  1F66 D;  5AVB D;  1AOI A;  4JJN B;  5B1M A;  5B31 A;  5AV8 D;  1P3L B;  3KXB D;  3MGR C;  5KDM B;  5FUG A;  5B32 A;  3MNN A;  1P3A A;  3W99 B;  1P34 A;  2BYM A;  3X1V D;  2FJ7 D;  3A6N A;  1KX5 A;  1KX4 A;  3VH6 W;  1EQZ C;  5AVB A;  3UT9 C;  2ARO B;  5CHL B;  4H9O A;  5B33 B;  3REK B;  3AZI D;  3AN2 B;  4H9S A;  4QLC A;  4KUD D;  4R8P D;  3X1S C;  4WU8 D;  4J8V C;  5AY8 C;  1P3G C;  1HQ3 D;  3AZG B;  3AFA A;  5BO0 A;  1P3K B;  3AV1 B;  4J8X C;  3AZE B;  4Z5T D;  3B0D C;  3R45 A;  2NZD C;  4XUJ A;  3MGP C;  3REL B;  4KGC D;  2NQB D;  4XZQ B;  3AZK B;  1P3M A;  5DNM C;  1P3P A;  2RVQ D;  1U35 B;  2YFV B;  5GT3 D;  4HGA B;  1M18 B;  1Q9C A;  3LZ0 B;  5B24 A;  3REJ B;  3MVD D;  4KGC A;  2ARO D;  4DRA A;  3REK D;  3NQU B;  3W97 B;  2PYO A;  3VH5 W;  4J8W C;  3TU4 A;  1P3B A;  3AZF D;  4ZBJ B;  2HUE B;  4Z2M G;  1M19 A;  5GSU C;  4Z66 B;  3AV2 D;  3WAA A;  3REH A;  1P3K D;  2HIO B;  1A7W A;  4NFT A;  3AZE D;  1F66 C;  5AVC B;  3LZ1 B;  3KWQ A;  4LD9 B;  3UTB C;  5B1L D;  5CPI B;  3V9R A;  3AZN A;  5AV8 C;  4E44 A;  5CP6 B;  4XZQ D;  3AZL B;  3W96 D;  3X1U A;  3KXB C;  4ZUX D;  1HTA A;  1TZY C;  3AZH C;  1H3O B;  5CPJ D;  5CPK B;  3X1V C;  1U35 D;  2FJ7 C;  2F8N A;  3W98 D;  4UUZ A;  3LZ0 D;  3REJ D;  4YM6 C;  4G91 B;  5JRG B;  4KUD C;  2F8N H;  3MGQ A;  3W97 D;  4R8P C;  3REI A;  5AV5 A;  3B6G A;  2YFW B;  4H9R B;  3AZJ A;  1HQ3 C;  1M1A C;  3WA9 A;  1ID3 A;  3LEL B;  3UTA A;  3UT9 D;  5GT0 C;  5AVC D;  4LD9 D;  5C3I B;  4JJN C;  3AZM B;  3X1S D;  2NQB C;  5F99 B;  3MGR A;  5AY8 D;  5CP6 D;  1P3L C;  3X1T B;  3O62 B;  3W99 C;  1ZLA B;  2NZD D;  3AYW B;  5B40 B;  1EQZ A;  3WTP A;  4YS3 B;  3KUY D;  1KX3 B;  2ARO C;  5B33 C;  3REK C;  3AN2 C;  4J8V A;  1P3G A;  1AOI B;  5B1M B;  4CSR B;  2CV5 A;  5B32 G;  1BH8 A;  4J8X A;  1P3K C;  2NZD A;  5FUG B;  5B32 B;  3MNN B;  3MGP A;  3AV1 C;  3AZE C;  1P34 B;  2BYM B;  1N1J B;  1S32 A;  4J8U A;  4CAY A;  3REL C;  5DNM A;  5B1L C;  4J8W D;  3AZM D;  3A6N B;  1KX5 B;  4XZQ C;  1KX4 B;  3AZK C;  3WKJ B;  4H9O B;  4QLC B;  5B0Y B;  5AV6 B;  1U35 C;  4HGA C;  1M18 C;  5B2I D;  3MGS A;  4WU9 A;  3B6F A;  5B40 D;  4X23 A;  3UTB D;  3W98 C;  5BO0 B;  4NE3 A;  3LZ0 C;  4E45 A;  1ULY A;  5B0Z B;  3REJ C;  1TAF A;  1F1E A;  3R45 B;  3C1C B;  3W97 C;  1TZY D;  5GSU A;  3AZH D;  4H9N B;  2IO5 B;  4ZBJ C;  2HUE C;  1P3M B;  4Z66 C;  5AV9 A;  2HIO C;  1F66 A;  5BNV B;  3UTB A;  4YM6 D;  5AVC C;  3LZ1 C;  4LD9 C;  5AV8 A;  5CPI C;  1WWI A;  3KXB A;  3WKJ D;  5CP6 C;  3AZL C;  4G92 B;  1P3I B;  1P3O B;  1M1A D;  3X1V A;  1JFI A;  2PYO B;  1P3B B;  3TU4 B;  2FJ7 A;  5B0Y D;  5AV6 D;  5GT0 D;  5CPK C;  1M19 B;  4H9P A;  2JSS A;  3WAA B;  3REH B;  4JJN D;  3AZI A;  4M6B A;  5B0Z D;  3KUY C;  4KUD A;  4R8P A;  5GXQ B;  1P3L D;  4G91 C;  5JRG C;  4WU8 A;  3KWQ B;  3C1C D;  1HQ3 A;  3W99 D;  3V9R B;  3LJA B;  3AZN B;  3X1U B;  3B0B A;  4Z5T A;  5BNX B;  3LEL C;  5B33 D;  2NQB A;  3AN2 D;  2F8N B;  5C3I C;  3AZM C;  5F99 C; 
#chains in the Genus database with same CATH topology
 5KDM A;  1P3I D;  3AZG D;  1P3F B;  1P3O D;  5GT3 A;  3MGQ B;  3X1T C;  2F2A C;  3REI B;  5AV5 B;  3AV1 D;  3B6G B;  2CWE A;  5B2I C;  3MVD A;  3AYW C;  5B40 C;  5DNN B;  3REL D;  2ARO A;  4KHA B;  4WNN A;  5G49 A;  3REK A;  3UTA B;  1ID3 B;  3AZK D;  3KSY A;  5GXQ D;  3AZF A;  1KU5 A;  1AOI C;  3AV2 A;  1P3K A;  3LJA D;  1M18 D;  3AZE A;  1R4V A;  5B32 C;  3MNN C;  3REL A;  1P34 C;  2LY8 A;  5B1L A;  3EPL A;  3W96 A;  4XZQ A;  3A1K A;  3WTP B;  3A6N C;  4ZUX A;  1KX4 C;  3WKJ C;  2FFF B;  5CPJ A;  4Z66 D;  1P3F D;  4QLC C;  1U35 A;  2HIO D;  1P3G B;  3W98 A;  5B0Y C;  5AV6 C;  3LZ0 A;  2CV5 B;  2VQR A;  3LZ1 D;  3REJ A;  1BH8 B;  3EPJ A;  5DNN D;  5CPI D;  5B0Z C;  3W97 A;  3AZL D;  3C1B B;  1S32 B;  4J8U B;  3C1C C;  5E5A B;  5DNM B;  5B2J B;  5CPK D;  1P3M C;  2XD5 A;  3UT9 A;  5BT1 C;  5AVC A;  4LD9 A;  1BH9 B;  4Z2M H;  3X1S A;  5CPI A;  5B31 G;  3MGS B;  5JRG D;  3B0C T;  4WU9 B;  4X23 B;  3B6F B;  5AY8 A;  5CP6 A;  2JE5 A;  5B31 B;  1TAF B;  4G92 C;  3AZG C;  1P3I C;  1P3O C;  5BS7 C;  2PYO C;  3LEL D;  3TU4 C;  1P3A B;  1P3B C;  1M19 C;  3KUY A;  3WAA C;  5AV9 B;  4NE6 A;  5F99 D;  5AVB B;  5GXQ C;  3KWQ C;  3X1T D;  3O62 D;  2Y2J A;  3LJA C;  3AZN C;  1ZLA D;  3AYW D;  3AFA B;  3X1U C;  3X1V B;  1JFI B;  3NQJ A;  4YS3 D;  1KX3 D;  4J8W A;  3AZM A;  4H9P B;  4XUJ B;  4WZS B;  4DRB A;  1AOI D;  3AZI B;  5B1M D;  5B31 D;  2BYK A;  1P3P B;  3F6T A;  4WU8 B;  1P3F C;  3MGQ C;  5B2I A;  5B32 D;  5B40 A;  3MNN D;  5AV5 C;  3REI C;  1P34 D;  1P3A D;  1B67 A;  5DNN C;  4Z5T B;  5B24 B;  1ID3 C;  3A6N D;  3UTA C;  1KX5 D;  1KX4 D;  4KGC B;  1TZY A;  3AZH A;  2NQB B;  4CSR A;  4QLC D;  4NE5 A;  4EO5 B;  2L5A A;  4YM6 A;  3AFA D;  1N1J A;  5GT3 B;  4H9Q A;  3MVD B;  4XUJ D;  3WKJ A;  5JA4 A;  4WNN B;  5G49 B;  3WTP C;  1M1A A;  2G5I C;  1P3M D;  1P3P D;  3AZF B;  3KFU G;  5B0Y A;  5AV6 A;  5BT1 D;  5GT0 A;  3AV2 B;  2F8N G;  4JJN A;  2CV5 C;  5B0Z A;  4UUZ B;  1P3L A;  1B6W A;  3VH6 T;  5B24 D;  3WTP E;  3VH5 A;  3C1C A;  5B1L B;  4H9N A;  3W99 A;  3C1B C;  1S32 C;  4J8U C;  3W96 B;  3O62 C;  5E5A C;  1P3B D;  3TU4 D;  2PYO D;  5B2J C;  4ZUX B;  1ZLA C;  1M19 D;  3AZJ B;  2Y2H A;  5CPJ B;  5BNV A;  3WAA D;  3WA9 B;  3REH D;  4AWL B;  5B33 A;  4YS3 C;  3AN2 A;  3W98 B;  1KX3 C;  3H0L C;  3MGS C;  4WU9 C;  3B6F C;  3KWQ D;  4X23 C;  1P3I A;  3AZG A;  5B1M C;  5B31 C;  2Y2Q A;  1P3O A;  5BS7 A;  3AZN D;  3MGR B;  3AV1 A;  3X1U D;  1PZR A;  2JCH A;  1P3A C;  4WV4 B;  1EQZ B;  3AZK A;  2F8N D;  3UT9 B;  5GXQ A;  5AV9 C;  1KX5 C;  3IP4 C;  5AVB C;  3X1S B;  3VH5 T;  4H9S C;  3LJA A;  2YFV A;  3MGQ D;  4J8V B;  5AY8 B;  1M18 A;  3REI D;  5AV5 D;  2J8P A;  3B6G D;  5BNX A;  3AZJ D;  4J8X B;  3AFA C;  3WA9 D;  3B0D B;  2NZD B;  2Y2L A;  1ID3 D;  3MGP B;  3UTA D;  3NQU A;  3B0C W;  3KUY B;  4XUJ C;  4CAY B;  3AZI C;  4Z66 A;  2IO5 C;  1P3F A;  2HIO A;  3MGR D;  1P3P C;  4WU8 C;  3LZ1 A;  5DNN A;  4KHA A;  1EQZ D;  2BG1 A;  3A1I A;  4Z5T C;  3AZL A;  5B24 C;  3WTP D;  3NQJ B;  4KGC C;  4J8W B;  1H3O A;  4J8V D;  5CPK A;  5GSU B;  1P3G D;  2Y2M A;  2CV5 D;  2BYK B;  4EO5 C;  2RVQ C;  1WWS A;  2ZY5 A;  4J8X D;  3REH C;  5GT3 C;  1F66 B;  5B2I B;  5JRG A;  3MGP D;  3UTB B;  3C1B D;  3MVD C;  2RIQ A;  3P5J B;  5AV8 B;  4H9R A;  2YFW A;  4J8U D;  1S32 D;  5DNM D;  5E5A D;  5B2J D;  3KXB B;  1BFM A;  1TZY B;  3LEL A;  3AZH B;  3AZF C;  2FJ7 B;  3AV2 C;  4WU9 D;  5F99 A;  3MGS D;  3B6F D;  4YM6 B;  4X23 D;  3C1B A;  4H9Q B;  4KUD B;  3X1T A;  4R8P B;  3O62 A;  5E5A A;  2W8S A;  5B2J A;  1ZLA A;  3W96 C;  5JA4 B;  1HQ3 B;  5GSU D;  3AYW A;  1M1A B;  3B6G C;  4ZUX C;  3VH6 A;  3AZJ C;  4YS3 A;  5CPJ C;  1KX3 A;  2F8N K;  1BH9 A;  5GT0 B;  3WA9 C;  5AV9 D;  4AWL C;  1F66 D;  5AVB D;  1AOI A;  4JJN B;  2Y2N A;  5B1M A;  5B31 A;  5AV8 D;  2Y2O A;  1P3L B;  3KXB D;  3MGR C;  5KDM B;  5FUG A;  5B32 A;  3MNN A;  1P3A A;  3W99 B;  2DQN C;  1P34 A;  2BYM A;  3X1V D;  2FJ7 D;  3A6N A;  1KX5 A;  1KX4 A;  3VH6 W;  1EQZ C;  5AVB A;  3UT9 C;  2ARO B;  5CHL B;  4H9O A;  5B33 B;  3REK B;  3AZI D;  3AN2 B;  4H9S A;  4QLC A;  4KUD D;  4R8P D;  3X1S C;  4WU8 D;  4J8V C;  5AY8 C;  1P3G C;  1HQ3 D;  3AZG B;  3AFA A;  3EPH A;  5BO0 A;  1P3K B;  3AV1 B;  4J8X C;  3AZE B;  4Z5T D;  3B0D C;  3R45 A;  2NZD C;  4XUJ A;  2ZY2 A;  3MGP C;  3REL B;  4DQY B;  4KGC D;  2NQB D;  4XZQ B;  3AZK B;  1T3U A;  1P3M A;  5DNM C;  1P3P A;  2RVQ D;  1U35 B;  2YFV B;  5GT3 D;  4HGA B;  1M18 B;  1Q9C A;  3LZ0 B;  5B24 A;  3REJ B;  2ZY3 A;  3MVD D;  4KGC A;  2UWX A;  2ARO D;  4DRA A;  3REK D;  3NQU B;  3W97 B;  2ZM5 A;  2PYO A;  3VH5 W;  4J8W C;  3TU4 A;  1P3B A;  3AZF D;  4ZBJ B;  2HUE B;  4Z2M G;  1M19 A;  5GSU C;  4Z66 B;  2DF4 C;  3AV2 D;  3WAA A;  3REH A;  1P3K D;  2HIO B;  1A7W A;  4NFT A;  3AZE D;  1F66 C;  5AVC B;  3LZ1 B;  3KWQ A;  4LD9 B;  3UTB C;  5B1L D;  5CPI B;  2ZY4 A;  3V9R A;  3AZN A;  5AV8 C;  4E44 A;  5CP6 B;  4XZQ D;  3AZL B;  3W96 D;  3X1U A;  3KXB C;  4ZUX D;  1HTA A;  1TZY C;  3AZH C;  1H3O B;  5CPJ D;  4UPK A;  5CPK B;  3X1V C;  1U35 D;  2FJ7 C;  2F8N A;  3W98 D;  4UUZ A;  3LZ0 D;  3REJ D;  4YM6 C;  4G91 B;  5JRG B;  4KUD C;  2F8N H;  3MGQ A;  3W97 D;  4R8P C;  3REI A;  5AV5 A;  3B6G A;  2YFW B;  4H9R B;  3AZJ A;  1HQ3 C;  1M1A C;  3WA9 A;  1ID3 A;  3LEL B;  3UTA A;  3UT9 D;  5GT0 C;  5AVC D;  4LD9 D;  5C3I B;  4JJN C;  3AZM B;  3X1S D;  2NQB C;  5F99 B;  3MGR A;  5AY8 D;  5CP6 D;  1P3L C;  3X1T B;  3O62 B;  3EPK A;  3W99 C;  1ZLA B;  2NZD D;  3AYW B;  5B40 B;  1EQZ A;  3WTP A;  4YS3 B;  3KUY D;  1KX3 B;  3FDD A;  1W2E A;  2ARO C;  5B33 C;  3REK C;  3AN2 C;  4J8V A;  1P3G A;  1AOI B;  5B1M B;  4CSR B;  2CV5 A;  5B32 G;  1BH8 A;  4J8X A;  1P3K C;  2NZD A;  5FUG B;  5B32 B;  3MNN B;  2Y2K A;  3MGP A;  3AV1 C;  3AZE C;  1P34 B;  2BYM B;  1N1J B;  1S32 A;  4J8U A;  4CAY A;  3REL C;  5DNM A;  5B1L C;  4J8W D;  3AZM D;  4WJ3 C;  3A6N B;  1KX5 B;  4XZQ C;  1KX4 B;  3AZK C;  3WKJ B;  1Z2C B;  4H9O B;  4QLC B;  5B0Y B;  5AV6 B;  1U35 C;  4HGA C;  1M18 C;  5B2I D;  3MGS A;  4WU9 A;  3B6F A;  5B40 D;  4X23 A;  3UTB D;  3W98 C;  5BO0 B;  4NE3 A;  3LZ0 C;  4E45 A;  3AL0 C;  1ULY A;  5B0Z B;  3REJ C;  1TAF A;  1F1E A;  3R45 B;  3C1C B;  3W97 C;  1TZY D;  5GSU A;  3AZH D;  4H9N B;  2IO5 B;  4ZBJ C;  2HUE C;  1P3M B;  4Z66 C;  5AV9 A;  2HIO C;  1F66 A;  2Y2G A;  5BNV B;  3UTB A;  4YM6 D;  5AVC C;  3LZ1 C;  4LD9 C;  5AV8 A;  5CPI C;  1WWI A;  3KXB A;  3WKJ D;  5CP6 C;  3AZL C;  4G92 B;  1P3I B;  1P3O B;  1M1A D;  3X1V A;  1JFI A;  2PYO B;  1P3B B;  3TU4 B;  2FJ7 A;  5B0Y D;  5AV6 D;  5GT0 D;  5CPK C;  1M19 B;  4H9P A;  3H0M C;  2JSS A;  3WAA B;  3REH B;  4JJN D;  3AZI A;  4M6B A;  5B0Z D;  3KUY C;  4KUD A;  4R8P A;  5GXQ B;  1P3L D;  4G91 C;  5JRG C;  4WU8 A;  3KWQ B;  3H0R C;  3C1C D;  2XD1 A;  1HQ3 A;  2Y2I A;  3W99 D;  2Y2P A;  3EG5 B;  3V9R B;  3LJA B;  3AZN B;  3X1U B;  3B0B A;  4Z5T A;  5BNX B;  3LEL C;  2G5H C;  5B33 D;  2NQB A;  3AN2 D;  2F8N B;  5C3I C;  3AZM C;  5F99 C; 
#chains in the Genus database with same CATH homology
 5KDM A;  1P3I D;  3AZG D;  1P3F B;  1P3O D;  5GT3 A;  3MGQ B;  3X1T C;  2F2A C;  3REI B;  5AV5 B;  3AV1 D;  3B6G B;  2CWE A;  5B2I C;  3MVD A;  3AYW C;  5B40 C;  5DNN B;  3REL D;  2ARO A;  4KHA B;  4WNN A;  5G49 A;  3REK A;  3UTA B;  1ID3 B;  3AZK D;  3KSY A;  5GXQ D;  3AZF A;  1KU5 A;  1AOI C;  3AV2 A;  1P3K A;  3LJA D;  1M18 D;  3AZE A;  1R4V A;  5B32 C;  3MNN C;  3REL A;  1P34 C;  2LY8 A;  5B1L A;  3EPL A;  3W96 A;  4XZQ A;  3A1K A;  3WTP B;  3A6N C;  4ZUX A;  1KX4 C;  3WKJ C;  2FFF B;  5CPJ A;  4Z66 D;  1P3F D;  4QLC C;  1U35 A;  2HIO D;  1P3G B;  3W98 A;  5B0Y C;  5AV6 C;  3LZ0 A;  2CV5 B;  2VQR A;  3LZ1 D;  3REJ A;  1BH8 B;  3EPJ A;  5DNN D;  5CPI D;  5B0Z C;  3W97 A;  3AZL D;  3C1B B;  1S32 B;  4J8U B;  3C1C C;  5E5A B;  5DNM B;  5B2J B;  5CPK D;  1P3M C;  2XD5 A;  3UT9 A;  5BT1 C;  5AVC A;  4LD9 A;  1BH9 B;  4Z2M H;  3X1S A;  5CPI A;  5B31 G;  3MGS B;  5JRG D;  3B0C T;  4WU9 B;  4X23 B;  3B6F B;  5AY8 A;  5CP6 A;  2JE5 A;  5B31 B;  1TAF B;  4G92 C;  3AZG C;  1P3I C;  1P3O C;  5BS7 C;  2PYO C;  3LEL D;  3TU4 C;  1P3A B;  1P3B C;  1M19 C;  3KUY A;  3WAA C;  5AV9 B;  4NE6 A;  5F99 D;  5AVB B;  5GXQ C;  3KWQ C;  3X1T D;  3O62 D;  2Y2J A;  3LJA C;  3AZN C;  1ZLA D;  3AYW D;  3AFA B;  3X1U C;  3X1V B;  1JFI B;  3NQJ A;  4YS3 D;  1KX3 D;  4J8W A;  3AZM A;  4H9P B;  4XUJ B;  4WZS B;  4DRB A;  1AOI D;  3AZI B;  5B1M D;  5B31 D;  2BYK A;  1P3P B;  3F6T A;  4WU8 B;  1P3F C;  3MGQ C;  5B2I A;  5B32 D;  5B40 A;  3MNN D;  5AV5 C;  3REI C;  1P34 D;  1P3A D;  1B67 A;  5DNN C;  4Z5T B;  5B24 B;  1ID3 C;  3A6N D;  3UTA C;  1KX5 D;  1KX4 D;  4KGC B;  1TZY A;  3AZH A;  2NQB B;  4CSR A;  4QLC D;  4NE5 A;  4EO5 B;  2L5A A;  4YM6 A;  3AFA D;  1N1J A;  5GT3 B;  4H9Q A;  3MVD B;  4XUJ D;  3WKJ A;  5JA4 A;  4WNN B;  5G49 B;  3WTP C;  1M1A A;  2G5I C;  1P3M D;  1P3P D;  3AZF B;  3KFU G;  5B0Y A;  5AV6 A;  5BT1 D;  5GT0 A;  3AV2 B;  2F8N G;  4JJN A;  2CV5 C;  5B0Z A;  4UUZ B;  1P3L A;  1B6W A;  3VH6 T;  5B24 D;  3WTP E;  3VH5 A;  3C1C A;  5B1L B;  4H9N A;  3W99 A;  3C1B C;  1S32 C;  4J8U C;  3W96 B;  3O62 C;  5E5A C;  1P3B D;  3TU4 D;  2PYO D;  5B2J C;  4ZUX B;  1ZLA C;  1M19 D;  3AZJ B;  2Y2H A;  5CPJ B;  5BNV A;  3WAA D;  3WA9 B;  3REH D;  4AWL B;  5B33 A;  4YS3 C;  3AN2 A;  3W98 B;  1KX3 C;  3H0L C;  3MGS C;  4WU9 C;  3B6F C;  3KWQ D;  4X23 C;  1P3I A;  3AZG A;  5B1M C;  5B31 C;  2Y2Q A;  1P3O A;  5BS7 A;  3AZN D;  3MGR B;  3AV1 A;  3X1U D;  1PZR A;  2JCH A;  1P3A C;  4WV4 B;  1EQZ B;  3AZK A;  2F8N D;  3UT9 B;  5GXQ A;  5AV9 C;  1KX5 C;  3IP4 C;  5AVB C;  3X1S B;  3VH5 T;  4H9S C;  3LJA A;  2YFV A;  3MGQ D;  4J8V B;  5AY8 B;  1M18 A;  3REI D;  5AV5 D;  2J8P A;  3B6G D;  5BNX A;  3AZJ D;  4J8X B;  3AFA C;  3WA9 D;  3B0D B;  2NZD B;  2Y2L A;  1ID3 D;  3MGP B;  3UTA D;  3NQU A;  3B0C W;  3KUY B;  4XUJ C;  4CAY B;  3AZI C;  4Z66 A;  2IO5 C;  1P3F A;  2HIO A;  3MGR D;  1P3P C;  4WU8 C;  3LZ1 A;  5DNN A;  4KHA A;  1EQZ D;  2BG1 A;  3A1I A;  4Z5T C;  3AZL A;  5B24 C;  3WTP D;  3NQJ B;  4KGC C;  4J8W B;  1H3O A;  4J8V D;  5CPK A;  5GSU B;  1P3G D;  2Y2M A;  2CV5 D;  2BYK B;  4EO5 C;  2RVQ C;  1WWS A;  2ZY5 A;  4J8X D;  3REH C;  5GT3 C;  1F66 B;  5B2I B;  5JRG A;  3MGP D;  3UTB B;  3C1B D;  3MVD C;  2RIQ A;  3P5J B;  5AV8 B;  4H9R A;  2YFW A;  4J8U D;  1S32 D;  5DNM D;  5E5A D;  5B2J D;  3KXB B;  1BFM A;  1TZY B;  3LEL A;  3AZH B;  3AZF C;  2FJ7 B;  3AV2 C;  4WU9 D;  5F99 A;  3MGS D;  3B6F D;  4YM6 B;  4X23 D;  3C1B A;  4H9Q B;  4KUD B;  3X1T A;  4R8P B;  3O62 A;  5E5A A;  2W8S A;  5B2J A;  1ZLA A;  3W96 C;  5JA4 B;  1HQ3 B;  5GSU D;  3AYW A;  1M1A B;  3B6G C;  4ZUX C;  3VH6 A;  3AZJ C;  4YS3 A;  5CPJ C;  1KX3 A;  2F8N K;  1BH9 A;  5GT0 B;  3WA9 C;  5AV9 D;  4AWL C;  1F66 D;  5AVB D;  1AOI A;  4JJN B;  2Y2N A;  5B1M A;  5B31 A;  5AV8 D;  2Y2O A;  1P3L B;  3KXB D;  3MGR C;  5KDM B;  5FUG A;  5B32 A;  3MNN A;  1P3A A;  3W99 B;  2DQN C;  1P34 A;  2BYM A;  3X1V D;  2FJ7 D;  3A6N A;  1KX5 A;  1KX4 A;  3VH6 W;  1EQZ C;  5AVB A;  3UT9 C;  2ARO B;  5CHL B;  4H9O A;  5B33 B;  3REK B;  3AZI D;  3AN2 B;  4H9S A;  4QLC A;  4KUD D;  4R8P D;  3X1S C;  4WU8 D;  4J8V C;  5AY8 C;  1P3G C;  1HQ3 D;  3AZG B;  3AFA A;  3EPH A;  5BO0 A;  1P3K B;  3AV1 B;  4J8X C;  3AZE B;  4Z5T D;  3B0D C;  3R45 A;  2NZD C;  4XUJ A;  2ZY2 A;  3MGP C;  3REL B;  4DQY B;  4KGC D;  2NQB D;  4XZQ B;  3AZK B;  1T3U A;  1P3M A;  5DNM C;  1P3P A;  2RVQ D;  1U35 B;  2YFV B;  5GT3 D;  4HGA B;  1M18 B;  1Q9C A;  3LZ0 B;  5B24 A;  3REJ B;  2ZY3 A;  3MVD D;  4KGC A;  2UWX A;  2ARO D;  4DRA A;  3REK D;  3NQU B;  3W97 B;  2ZM5 A;  2PYO A;  3VH5 W;  4J8W C;  3TU4 A;  1P3B A;  3AZF D;  4ZBJ B;  2HUE B;  4Z2M G;  1M19 A;  5GSU C;  4Z66 B;  2DF4 C;  3AV2 D;  3WAA A;  3REH A;  1P3K D;  2HIO B;  1A7W A;  4NFT A;  3AZE D;  1F66 C;  5AVC B;  3LZ1 B;  3KWQ A;  4LD9 B;  3UTB C;  5B1L D;  5CPI B;  2ZY4 A;  3V9R A;  3AZN A;  5AV8 C;  4E44 A;  5CP6 B;  4XZQ D;  3AZL B;  3W96 D;  3X1U A;  3KXB C;  4ZUX D;  1HTA A;  1TZY C;  3AZH C;  1H3O B;  5CPJ D;  4UPK A;  5CPK B;  3X1V C;  1U35 D;  2FJ7 C;  2F8N A;  3W98 D;  4UUZ A;  3LZ0 D;  3REJ D;  4YM6 C;  4G91 B;  5JRG B;  4KUD C;  2F8N H;  3MGQ A;  3W97 D;  4R8P C;  3REI A;  5AV5 A;  3B6G A;  2YFW B;  4H9R B;  3AZJ A;  1HQ3 C;  1M1A C;  3WA9 A;  1ID3 A;  3LEL B;  3UTA A;  3UT9 D;  5GT0 C;  5AVC D;  4LD9 D;  5C3I B;  4JJN C;  3AZM B;  3X1S D;  2NQB C;  5F99 B;  3MGR A;  5AY8 D;  5CP6 D;  1P3L C;  3X1T B;  3O62 B;  3EPK A;  3W99 C;  1ZLA B;  2NZD D;  3AYW B;  5B40 B;  1EQZ A;  3WTP A;  4YS3 B;  3KUY D;  1KX3 B;  3FDD A;  1W2E A;  2ARO C;  5B33 C;  3REK C;  3AN2 C;  4J8V A;  1P3G A;  1AOI B;  5B1M B;  4CSR B;  2CV5 A;  5B32 G;  1BH8 A;  4J8X A;  1P3K C;  2NZD A;  5FUG B;  5B32 B;  3MNN B;  2Y2K A;  3MGP A;  3AV1 C;  3AZE C;  1P34 B;  2BYM B;  1N1J B;  1S32 A;  4J8U A;  4CAY A;  3REL C;  5DNM A;  5B1L C;  4J8W D;  3AZM D;  4WJ3 C;  3A6N B;  1KX5 B;  4XZQ C;  1KX4 B;  3AZK C;  3WKJ B;  1Z2C B;  4H9O B;  4QLC B;  5B0Y B;  5AV6 B;  1U35 C;  4HGA C;  1M18 C;  5B2I D;  3MGS A;  4WU9 A;  3B6F A;  5B40 D;  4X23 A;  3UTB D;  3W98 C;  5BO0 B;  4NE3 A;  3LZ0 C;  4E45 A;  3AL0 C;  1ULY A;  5B0Z B;  3REJ C;  1TAF A;  1F1E A;  3R45 B;  3C1C B;  3W97 C;  1TZY D;  5GSU A;  3AZH D;  4H9N B;  2IO5 B;  4ZBJ C;  2HUE C;  1P3M B;  4Z66 C;  5AV9 A;  2HIO C;  1F66 A;  2Y2G A;  5BNV B;  3UTB A;  4YM6 D;  5AVC C;  3LZ1 C;  4LD9 C;  5AV8 A;  5CPI C;  1WWI A;  3KXB A;  3WKJ D;  5CP6 C;  3AZL C;  4G92 B;  1P3I B;  1P3O B;  1M1A D;  3X1V A;  1JFI A;  2PYO B;  1P3B B;  3TU4 B;  2FJ7 A;  5B0Y D;  5AV6 D;  5GT0 D;  5CPK C;  1M19 B;  4H9P A;  3H0M C;  2JSS A;  3WAA B;  3REH B;  4JJN D;  3AZI A;  4M6B A;  5B0Z D;  3KUY C;  4KUD A;  4R8P A;  5GXQ B;  1P3L D;  4G91 C;  5JRG C;  4WU8 A;  3KWQ B;  3H0R C;  3C1C D;  2XD1 A;  1HQ3 A;  2Y2I A;  3W99 D;  2Y2P A;  3EG5 B;  3V9R B;  3LJA B;  3AZN B;  3X1U B;  3B0B A;  4Z5T A;  5BNX B;  3LEL C;  2G5H C;  5B33 D;  2NQB A;  3AN2 D;  2F8N B;  5C3I C;  3AZM C;  5F99 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...