2CVDA

Crystal structure analysis of human hematopoietic prostaglandin d synthase complexed with hql-79
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGMSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione-requiring prostaglandin D synthase
publication title Structural and Functional Characterization of HQL-79, an Orally Selective Inhibitor of Human Hematopoietic Prostaglandin D Synthase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 72
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2cvdA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2cvdA01
2XC2A 2A2SA 2PBJA 5GAND 3IE3A 3HJMA 3GSSA 3LXTA 4YQUA 2WULA 2IJYA 2IMIA 1F6MC 5D9XA 3F63A 2O8VB 1GULA 4JEDA 2FA8A 2OKAA 4GTUA 3BOAA 1VF1A 4ML1A 5DCHA 2IWTA 4I5QA 5KEJA 5HR0A 1CQHA 3F0IA 4IVFA 6GSYA 5ECMB 2DC5A 1X5CA 2VCVA 5F06A 2HRAA 2VD0A 5IMDA 2YJHA 3LFLA 2RUEA 2FA4A 4XS4A 3HXSA 5IMCA 3KM6A 3ZVJD 2GSSA 2GZYA 3FW2A 1PD21 3KD0A 2GZZA 1R5PA 3TKSA 2B7KA 2GT5A 4TXOB 1EV4A 5LD0A 2LNTA 2BTOT 5J4UA 3HVXA 10GSA 3LJRA 1FO5A 4HQSA 1UC7A 4JU5A 5ID2B 4HZ4A 4IW9A 4YQMA 5IOWA 4IKHA 2HLSA 3O6TA 1T4ZA 1PGTA 5E59A 3W8JA 3TUEA 2YV7A 4Q5QA 1OE8A 3WGEA 1Z6NA 3VFIA 4TXVA 3H4KA 3US3A 5DAKB 3L9SA 1TDIA 4J2FA 4LL1B 5J9CA 2YWNA 3S9FA 4YAPA 3GRXA 1ILOA 5D73A 4FYBA 4OCFA 2OE3A 4K9ZA 2DJ1A 3KJYA 1WP0A 4GSTA 1A8YA 4BVYB 2WDUA 2LS5A 2YP6A 1TRVA 4MH2A 5C00A 3VPQA 4F0BA 1FB0A 3MAKA 3QMXA 5EL8A 1Q4JA 2K8VA 2R6KA 1XPVA 2AV4A 3TOTA 4NPBA 1GLQA 1GH2A 5GSSA 4Q5FA 5DQYA 3GKXA 5JWQB 1Z7RA 4KE3A 1QK8A 3C8EA 4AF2A 1B48A 1W4VA 4MP4A 2H72A 2IMFA 2F9SA 1SJIA 4DEJA 5HR1A 3TKQA 1K0NA 4K7NA 1HQOA 3W8SA 1QUWA 3F4SA 3E3EA 1OYJA 1AUCA 3KMNA 4KSOA 3M1GA 1G0TA 1THOA 3FR3A 3KH9A 4K1FA 1JHBA 3HA9A 3FR6A 1RQMA 1V9WA 4K8MA 3L9UA 1ZYQB 2DMMA 1TI3A 1R7HA 1SENA 4KW6A 4K0NA 1TP9A 3EURA 4TVEA 5DJLA 5FWGA 3UVHA 5EY6A 1WOUA 3FHKA 1FVKA 1GTBA 1T4YA 2C0GA 2ALBA 1FVJA 3HKRA 2R37A 3D4MA 3HD5A 2HE3A 4POKA 3GYKA 1BX9A 4BWSA 3KP9A 5ECSA 4BA7A 19GSA 2H0IA 2F8AA 1ZL9A 2MZCA 5CAXA 1USBA 5D93A 3G7IA 1B8XA 4V2LA 1TK8B 12GSA 1ERVA 4X0XA 5DBQA 3DIEA 2C3QA 2AHEA 3RAZA 2WJUA 2HQTA 4F9ZA 1GSFA 2H1GA 5D9TA 3GNJA 1JZRA 3IRAA 4WXTA 2LJRA 1S3AA 3UARA 2LJKA 4HS1A 4BL7A 3CSHA 3KCMA 5LNKe 2L6DA 5DAKA 2H1DA 2GLRA 4EDYA 5GAPD 1DE2A 1VGLA 5DALB 3D21A 2XBQA 5IO0A 2H01A 3A2XA 5B8AA 1XVQA 2CVKA 3F6FA 2P31A 2OE1A 2GTUA 4NHZA 1LBKA 2LQQA 2L6CA 4E8HA 3FZ5A 3GTUA 1FHEA 4ZL7A 2HSNB 3PR8A 2DIZA 4PQ1A 2GS3A 1A2JA 1AC1A 5F05A 3GFKA 3E0UA 1V2AA 1XWKA 4RQXA 4NWYA 5JWRB 3UAPA 3UBKA 2N5FA 20GSA 2QKEA 4G0IA 3CXGA 4YQVA 4MF7A 1K0MA 3G7YA 2MBSA 2FWHA 1EGOA 2KHPA 1EEJA 1YZXA 1H75A 2V2GA 8GSSA 6GSWA 6GSVA 3KXOA 1AQXA 5KN2A 3HHVA 4I6XA 4RI7A 4GQFA 2MYGA 5EVOA 1XZOA 1UVZA 4FYCA 1SL0B 13GSA 2KP2A 2H71A 2YJ7A 2VM2A 5IPHA 3DVXA 3QD9A 4MMMA 4Q5RA 4N30A 2AJQB 1GLPA 3EWLA 3GKMA 1RK4A 4O92A 2K9FA 3ME7A 3APOA 4LL4B 1VF2A 5J9BA 2E2GA 3O76A 2JZTA 3ZIJA 4L5OA 4KAEA 4FYUA 1G7OA 3IAM2 2HZFA 4HI7A 1FW1A 2HSHA 3KTBA 4PNFA 2B1LA 2RM6A 2V41A 4V1Ap 4KCEA 1MD4A 5D96A 4ZL9A 22GSA 1ACVA 3QR6A 2F3MA 1QQ2A 3H79A 4EF0A 4HJ2A 2GQKA 3GURA 3ERFA 5CYYA 1TJDA 3LSZA 1Q98A 1GSEA 2FWGA 2WZ9A 1E2YA 2DSAA 3DRNA 3FEUA 2OADA 1G7EA 4RI6A 3BCKA 1TOFA 4CDOA 2C1YA 1VF4A 1GWCA 4WBRD 1ERWA 4EDZA 4HOJA 2VCZA 3QAWA 3C73A 4WF4A 3HYPA 3ZLPA 3H1NA 1T1VA 2GDRA 2VCWA 5J5NA 2EIQA 3ZITA 3HZ4A 1GP1A 2GQMA 1PKWA 4PQIA 3LQ7A 3FZ9A 2WFCA 2YPMA 3KZQA 4NV5A 9GSSA 3RPNA 1T8EB 3A5WA 4NXIA 2YWOA 1XIYA 5CRHA 2LUSA 2G2QA 4IGJA 5JCGA 5E4WA 2HRFA 1O6JA 5D9WA 5HR2A 4K7IA 2B3SA 4G10A 4L0UA 3CTGA 2H8LA 3MSZA 3WGXA 2R4VA 4L8EA 1EGRA 2PVQA 2LV3A 4NV2A 4DVCA 2TRXA 2REMA 4IELA 2ES7A 2FWEA 3VPTA 1MDKA 2MMOA 3J7Yk 4K0GA 1F37A 3UJ1A 1HNBA 4MZWA 4G19A 2VAFA 5H5SA 5B6NA 1PN9A 1JLWA 4IP6A 3CSJA 3H8QA 3IPZA 4N11A 4ZB8A 4KH7A 5ELGA 3ZFBA 4X1UA 4L0WA 1V98A 2FWFA 1SKRB 4POBA 3Q18A 2VLVA 2CZ3A 2FY6A 1M2AA 2OJLA 1WWJA 3D4TA 1VF3A 4X43A 3GV1A 2B7JA 4ACSA 5ECOB 1KBNA 1U3AA 4ULXA 2HNLA 2HZEA 2I1UA 1TU7A 3I69A 1NHOA 2IMKA 4HDEA 3EC3A 2O89A 4GSNA 3SBCA 2VO4A 5G31A 1K3LA 5CRWA 3TKSE 3ZMKA 2VL2A 1U6TA 4QL9A 4E8EA 1TRSA 1Z9HA 2LRCA 2M80A 3ISOA 2KOKA 3FZAA 2UZ8A 2G0FA 5D9VA 1HYUA 4EC0A 2NTOA 1F3BA 1BJXA 3L9VA 3HZ8A 3ZZXA 1AQVA 4D73A 4PTSA 4JBBA 3RDWA 2QGVA 2V1MA 1J08A 2A2RA 1OAZA 1XWCA 3KIJA 3M9KA 2QSIA 1TTZA 3R2QA 5HQPA 3KGKA 1TK5B 3HY2A 3DXBA 1XOAA 2MBTA 4MCUA 1GUMA 3N9JA 1ZMAA 2C0EA 1WMJA 3A2WA 1Z5YE 1F2EA 2B5YA 3KP8A 1JFUA 3P7XA 4XRAA 2DIYA 3HJOA 1SL2B 3GL3A 4GQCA 1I5GA 1PQNA 2BMXA 4WETA 3M3MA 2IMEA 2E0QA 4FO5A 5IPGA 2JZSA 5ECPB 3LXZA 5G5EA 3QAVA 2PU9C 3GA4A 2X8CA 2JACA 3UEMA 1A23A 2ZCTA 3IC8A 3RHBA 2R5GA 2LSTA 5HFGA 2CV4A 4BWQA 2NDOA 5GZZB 2JZRA 2P0GA 2EIOA 4FIWA 1EEMA 1YY7A 4KUNA 4BL7B 1HNAA 4MDCA 1LU4A 4ZBAA 3BD2A 1SKWB 5CNWA 3BJ5A 4HU9A 4O7HA 3IOSA 1GTAA 2P5RA 4I8BA 3QOUA 1Y6EA 3Q6OA 3Q19A 3CRTA 2HT9A 1MD3A 3GTUB 5IMFA 4PURA 3UOMA 5ECHB 2HXKA 5CRDA 3TJGA 4WR4A 3PGTA 3UMAA 5G5FA 5HFKA 1OC9B 1UA5A 2LJAA 2I4AA 1TU8A 1WIKA 5LCZA 3CBUA 3IK7A 1SK1A 1YF0A 2YOIA 4TR0A 1MDJA 4TKYA 2H1AA 5F0GA 1EOHA 3F6DA 1YEXA 1BQ7A 3AY8A 3F3RA 5CREA 4OMVA 1AXDA 3U6VA 4ECJA 1PMTA 1F9MA 1MDIA 3PH9A 1UN2A 2H19A 4ECCA 4ZIJA 1XFLA 4TN8A 3HVSA 2DJKA 3UIWA 1XVWA 5CRGA 5ECNB 2BJXA 1GL8A 5IOXA 3N5OA 4RUVA 4XIHA 4JE1A 4EE0A 4USSA 3CTFA 3IBHA 1XCCA 3I6AA 2H70A 4J56E 1PSQA 3DEXA 1K0CA 5AGYA 1NHYA 3A3TA 4XRDA 1SYRA 2YN1A 4AJ7A 3K8NA 5IM9A 3F3QA 1QFNA 1ZGNA 3TJBA 1A2MA 4EKZA 1XW5A 4DSQA 2VL2C 2X64A 6GSSA 4K6XA 1G6WA 2CQ9A 4OFNA 1GSQA 1U88A 3ZIVA 3WT1A 1DUGA 3VWVA 1I9DA 4WF5A 1B4QA 3VK9A 6GSTA 1XBSA 3NZNA 2R3XA 1YKCA 2R2JA 1DBYA 2HRNA 3SWLA 3D5JA 4G9HA 2LQOA 4MLYA 5G30A 1R4WA 4MJEA 3C1RA 4GWRA 4OFTA 3QDNA 3BBYA 5J41A 3FYGA 2H75A 1QMVA 5A5KA 2OBKA 1XWAA 2WRTA 1BG5A 1SK2A 3RBTA 2PERA 5ECQB 1A8LA 4N0VA 4F2IA 2PGTA 5KN0A 1MEKA 4HJMA 3ME8A 1JZWA 4MJBA 5GSTA 1NM3A 1T00A 4EUYA 1AW9A 1ERTA 1ON4A 4N0ZA 2J23A 2H74A 1U87A 3JCML 5AN1A 1OC9A 4IJIA 2I81A 3LG6A 4POLA 1TRWA 1JZOA 2FGXA 4ZXGA 1V57A 5EPFA 4MABA 2FCHA 5DDLA 2VM1A 3EU3A 2DJJA 1G6YA 4PNGA 2H1BA 3IDVA 2LRTA 1GSDA 2AB6A 4BPYA 2JSYA 2N5AA 2N5BA 4ISDA 2H0GA 4F82A 2KLXA 2YZHA 3IA1A 1KNGA 1SL1B 2RIIA 2C0FA 4TW5A 4NMUA 2M72A 4NAXA 3P8WA 3TJJA 5FHIA 1AAZA 3G7JA 2P5QA 3VURA 4MZCA 2JL4A 3ZL5A 2HZEB 2L59A 2M46A 1PKZA 2CVBA 4MJCA 4LLRA 4EVMA 3L4NA 3A2VA 4I97A 3WGDA 1SD9A 1GSUA 2LRNA 3D22A 1NSWA 2FLSA 3G9BA 4NHWA 4HQZA 4OD7A 5KN3A 3RPPA 3UBLA 2AAWA 3R3EA 4TRXA 1GSSA 3LORA 4N10A 3CSIA 4V1Ag 4D73B 2HI7A 4KCAA 5ENUA 2MMAA 1ML6A 3GN3A 1OKDA 1FOVA 4KDYA 2JADA 1TKDB 3TDGA 3VI5A 2CA8A 6GSXA 3DWVA 3GKKA 1XWBA 2WGRA 2F51A 2Z9SA 2YZUA 5DQSA 1XXUA 3IXRA 3M9JA 3ZMLA 3D6IA 4WEYA 2LEGA 2V6KA 1IYIA 4ECIA 3FKFA 1KTEA 3KTLA 2XHFA 3GL5A 4F03A 3Q74A 2H6XA 3CRUA 5IIZA 3APQA 4KB3A 1M2DA 2NVLA 1M2BA 3TKRA 3MWHA 5HFIA 5AISA 4XCSA 2GVPA 1C72A 1R5AA 5H5RA 3WYWA 2DJ2A 4ZBBA 2WS2A 4GSSA 2K6VA 2TIRA 1B9YC 4POMA 5ECKB 4KGIA 4MK3A 4GRFA 2VD1A 3GMFA 3P2AA 1PX6A 3I43A 2C0DA 2H0HA 4PGTA 4G2EA 1AIUA 3FR9A 2VOCA 1O73A 4FQUA 1QGVA 4HEA2 5G1KA 2LNSA 3UVTA 4FH8A 1EWXA 2GSTA 2AYTA 1EP8A 1ZOFA 1B4PA 1RW1A 2H6YA 3LEFA 1TRUA 1MTCA 4YH2A 2X99A 3TB2A 3ED3A 1SKSB 4KDXA 2GGTA 5IMVA 3KMOA 1TW9A 1GTUA 4KDUA 3HJPA 4MZBA 1K0OA 4GCIA 2HRKA 3ERGA 4OWYA 2FHEA 2HYXA 4WKWA 3C71A 3U5RE 3IC4A 2EC4A 2YANA 2MMZA 3DGQA 2GQLA 4LMWA 3M8NA 3IR4A 2HSYA 4EO3A 4PUFC 4ZL8A 2X8GA 1AQWA 4MPFA 3ZTLA 2V32A 3FK8A 2FUG2 2HSMB 2GSQA 1TXXA 2HFDA 2VUPA 4IQAA 5INYA 4IS0A 4ML6A 2NBSA 4PXOA 2B5XA 2L57A 4KA0A 4KF9A 5A4UA 2H76A 4CW9A 2TRCP 1ZCPA 3EVIA 2YV9A 5FT3A 2H66A 1FB6A 4OO5A 2C80A 1XWGA 1N8JA 16GSA 3WD6A 1X5EA 2CX3A 3GX8A 2GT6A 4G0LA 1M0UA 3QPMA 1X9MB 1GRXA 4CHSA 4ZB9A 1OVNA 1O85A 3HDCA 2F8FA 3EINA 1EZKA 1K0DA 2XPDA 4QQ7A 4YAVA 1GUKA 3EU4A 4LA1A 3TRPA 7GSSA 2DMLA 5ECLB 2CAIA 2DLXA 4IQ1A 3O3TA 3C1SA 1PL1A 1GTIA 5IMAA 6GSUA 1ST9A 3QAGA 3DMLA 1GSYA 2L5OA 4ZBDA 3HCZA 3DYRA 1BEDA 4O5RA 5F07A 2LTKA 3WT2A 1M99A 4KX4A 1OC3A 3TJFA 3EMPA 4I2UA 3VWUA 3PINA 2YNXA 3IHQA 5B8BA 1A0RP 4GLTA 2YCDA 1GNEA 5DJMA 1A0FA 3IAS2 4TR3A 1U3IA 4XS1A 4TR1B 4DSRA 1T7PB 3GX0A 3L0HA 2V6OA 2FD3A 3TKPA 3P90A 3H93A 1PA3A 4MF5A 4KNDA 4OCEA 1BAYA 3F8UA 5B7CA 4JRRA 4JR4A 5ABRA 4AJ6A 1TI1A 3LWAA 1OE7A 2RM5A 4G0KA 1YJ6A 3DVWA 2IL3A 5A4VA 3CYNA 4MJAA 1BYEA 1PRXA 1YDKA 1WJKA 4JR6A 3VLNA 1XW6A 1HD2A 2HSMA 5L71A 5CP1A 2WCIA 2IIYA 1E6BA 4XHMA 5DVBA 2H6ZA 1NW2A 3TJKA 3L78A 2VCQA 2ON5A 2C3TA 5COHA 4OFMA 4IBPA 4IN0A 4DSSB 2RUFA 3M0FA 3TCOA 3ZREA 3LYPA 2E7PA 3VWXA 4HZ2A 3RHCA 3PPUA 1ZZYA 4ZILA 1DSBA 3VWWA 2PUKC 5CO3A 2VL3A 3EYTA 2PWJA 1YF1A 1K3YA 1X5DA 4K2DA 5ELAA 2KUCA 1ERUA 1Y25A 1THXA 1W89A 5G2ZA 3TRXA 2VIMA 3MDKA 2ZNMA 3V1WA 4IJ3A 2H73A 2JSZA 3GH9A 3KEBA 4MF6A 1O8WA 4TXOA 17GSA 2A4VA 2CAQA 1A2LA 2IN3A 2PVOC 4ZB6A 5KN1A 4I2TA 5ID2A 2IFQB 3TGZA 1F3AA 2CX4A 1EV9A 2KP1A 3ZYWA 1A24A 5JCWA 2XBIA 2H30A 3ZRDA 2I9HA 2I3YA 1B9XC 2VCTA 3FZ4A 3EE2A 1K3OA 1Z6MA 4IP1A 4J57E 2O85A 4P3YB 1R26A 4LMVA 2EIRA 2D2ZA 3GKNA 3ZFLA 4BVYA 4Q5NA 3ERWA 4MA9A 3I9V2 4TR1A 1N2AA 5B6MA 1SK0A 2K18A 1V40A 5F8BA 2PPTA 3TKSC 1O7UA 1WPIA 4PX1A 5C04A 3FRCA 4F0CA 3DKSA 2DJ0A 2IMDA 3HVVA 4ID0A 4BVXB 5BMUA 1DE1A 2IPAA 2CZ2A 2OBIA 1H4OA 3FY7A 2L4QA 2B6MA 2VL9A 4V2MA 3EMXA 2JU5A 4MH3A 5H5QA 1PL2A 3GHAA 1YEPA 5IO2A 3OR5A 2RLIA 2PMTA 1S3DA 2QC7A 1VRSD 4TR4A 1EOGA 5J3RA 4ECBA 2OE0A 3DD3A 1J0FA 2YWMA 4HU7A 1XW9A 3LYKA 3D0ZA 2OACA 2HRKB 1IYHA 1URMA 2O7KA 4XS6A 3QFAC 2GSRA 4PQHA 1X0RA 2B5EA 1QXHA 3VI7A 4DSSA 3UL3A 1TK0B 1SYXA 3F4TA 2X8HA 3GIXA 1FAAA 4H86A 4QL7A 1M9BA 5AIVA 1PX7A 3GH6A 4EL1A 3GUSA 2L5LA 1ZYEA 1WRYA 1J9BA 2B1KA 5AIXA 1Z3EA 4EXJA 1ABAA 2E2MA 1GUHA 4Z7XA 4MPGA 2PN8A 1SU9A 2VLUA 2CT6A 11GSA 3QFBC 5D8IA 2XPEA 4GXZA 2C3NA 4KSMA 2IFQA 5ECRB 1OKTA 1FG4A 3APSA 2FNOA 1SD8A 1HNCA 1CQGA 1WE0A 4TOPA 2LKUA 1Z7PA 3C7MA 5DALA 4RQRA 4V2NA 4WBJA 4XS4B 5HR3A 1LJRA 1K0AA 1M7TA 1O8XA 1SJZA 1XOBA 5JWOB 1JZDA 2ZUPA 18GSA 3E9JB 1X9WB 3LGCA 3IK9A 3NIVA 4XTSA 3MNGA 3CMIA 4IHUA 2VCXA 5ECIB 2VLTA 4JZQA 4AJ8A 1OC8A 2O87A 2YWIA 2L4CA 1JLVA 2K8SA 1KEBA 5DCGA 5G1LA 2NPBA 2OA7A 4K7OA 4OO4A 4BVXA 3GSTA 4AGSA 14GSA 3IV4A 2WB9A 2ON7A 3BCIA 5A4WA 5IMZA 2MMNA 4O32A 2C8UA 1V58A 4WR5A 2AUVA 1GNWA 2C4JA 3W6GA 3KH7A 5JCUA 1M9AA 4ILFA 1YQ1A 1SJ6A 4HUAA 1EP7A 3F4RA 1S3CA 2DBCA 3TRQA 4PUAA 1O81A 2GZPA 4L5LA 1K0BA 2DJ3A 3TOUA 5IQYA 2J9HA 4GF0A 1YKAA 1X9SB 3F9UA 3QCPA 3ZVJA 3NOFA 2CVDA 1T3BA 3J7Yb
chains in the Genus database with same CATH superfamily
2XC2A 2A2SA 2PBJA 5GAND 3IE3A 3HJMA 2WVYA 3GSSA 3LXTA 4YQUA 2WULA 2IJYA 5J4VA 2IMIA 1F6MC 4AKXB 5D9XA 3F63A 2O8VB 1GULA 4JEDA 2FA8A 2OKAA 4GTUA 3BOAA 1VF1A 4ML1A 5DCHA 2IWTA 4I5QA 5KEJA 5HR0A 1CQHA 3F0IA 4IVFA 6GSYA 5ECMB 2DC5A 1X5CA 2VCVA 5F06A 2HRAA 2VD0A 5IMDA 5KOXA 2YJHA 3LFLA 2RUEA 2FA4A 4XS4A 3HXSA 5IMCA 3KM6A 3ZVJD 2GSSA 2GZYA 4K2XA 3FW2A 1PD21 3KD0A 2GZZA 1R5PA 3TKSA 2B7KA 2GT5A 4TXOB 1EV4A 5LD0A 2LNTA 2BTOT 5J4UA 3HVXA 10GSA 3LJRA 1FO5A 4HQSA 1UC7A 4JU5A 5ID2B 4HZ4A 4IW9A 4YQMA 5IOWA 4IKHA 5KOWA 2HLSA 3O6TA 1T4ZA 1PGTA 5E59A 3W8JA 3TUEA 2YV7A 4Q5QA 1OE8A 3WGEA 1Z6NA 3VFIA 4TXVA 3H4KA 3US3A 5DAKB 3L9SA 1TDIA 4J2FA 4LL1B 5J9CA 2YWNA 3S9FA 4YAPA 3GRXA 1ILOA 5D73A 4FYBA 4OCFA 2OE3A 4K9ZA 2DJ1A 3KJYA 1WP0A 4GSTA 1A8YA 2X4AA 4BVYB 2WDUA 2LS5A 2YP6A 1TRVA 4MH2A 5C00A 3VPQA 4F0BA 1FB0A 3MAKA 3QMXA 5EL8A 1Q4JA 2K8VA 2R6KA 1XPVA 2AV4A 3TOTA 4NPBA 1GLQA 2EFEA 1GH2A 5GSSA 4Q5FA 5DQYA 3GKXA 5JWQB 1Z7RA 4KE3A 1QK8A 3C8EA 4AF2A 1B48A 1W4VA 4MP4A 2H72A 2IMFA 2F9SA 1SJIA 4DEJA 5A1NB 5HR1A 2EFDA 5BMUB 3TKQA 1K0NA 4K7NA 1HQOA 3W8SA 1QUWA 3F4SA 3E3EA 1OYJA 1AUCA 3KMNA 4KSOA 3M1GA 1G0TA 3TU3B 1THOA 3FR3A 3KH9A 4K1FA 1JHBA 3HA9A 3FR6A 1RQMA 1V9WA 4K8MA 4CY6A 3L9UA 1ZYQB 2DMMA 1TI3A 1R7HA 1SVMA 1SENA 4KW6A 4K0NA 1TP9A 3EURA 4TVEA 5DJLA 5FWGA 3UVHA 5EY6A 1WOUA 3FHKA 1FVKA 1GTBA 1T4YA 2C0GA 2ALBA 1FVJA 3HKRA 2R37A 3D4MA 3HD5A 2HE3A 4POKA 3GYKA 1BX9A 4BWSA 3KP9A 5ECSA 4BA7A 19GSA 2H0IA 2F8AA 1ZL9A 1I1IP 2MZCA 5CAXA 1USBA 5D93A 4GDFA 3G7IA 1B8XA 4V2LA 1TK8B 12GSA 1ERVA 4X0XA 2O5VA 5DBQA 5A5HB 3DIEA 2C3QA 2AHEA 3RAZA 2WJUA 2HQTA 4F9ZA 1GSFA 2H1GA 5D9TA 3GNJA 2DKHA 1JZRA 3IRAA 4WXTA 2LJRA 1S3AA 3UARA 2LJKA 4HS1A 2WVZA 4BL7A 3CSHA 3KCMA 5LNKe 4A5PA 2UV8G 5DAKA 2H1DA 2L6DA 2GLRA 4EDYA 5GAPD 2WVXB 1DE2A 1VGLA 5DALB 3D21A 2XBQA 5IO0A 2H01A 3A2XA 5B8AA 1XVQA 2CVKA 3F6FA 4BIKA 2P31A 2OE1A 2GTUA 4NHZA 1LBKA 2LQQA 2L6CA 4E8HA 3FZ5A 3GTUA 1FHEA 4ZL7A 2HSNB 4ICYA 3PR8A 2DIZA 5J47A 4PQ1A 2GS3A 4K5RA 1A2JA 1AC1A 5F05A 3GFKA 3E0UA 1V2AA 1XWKA 4RQXA 4NWYA 5JWRB 3UAPA 3UBKA 2N5FA 20GSA 2QKEA 4G0IA 3CXGA 2WW1A 4YQVA 4MF7A 1K0MA 3G7YA 2MBSA 2FWHA 1EGOA 2KHPA 4Z2UA 1EEJA 1YZXA 1H75A 2V2GA 8GSSA 6GSWA 6GSVA 3KXOA 1AQXA 5KN2A 3HHVA 4I6XA 4RI7A 4GQFA 2MYGA 5EVOA 1XZOA 1UVZA 4FYCA 1SL0B 13GSA 2KP2A 2H71A 2YJ7A 2VM2A 5IPHA 3DVXA 3QD9A 4MMMA 4Q5RA 4N30A 2AJQB 1GLPA 3EWLA 3GKMA 1RK4A 4O92A 2K9FA 3ME7A 3APOA 4LL4B 1VF2A 5J9BA 1S3RA 2E2GA 3O76A 2JZTA 3ZIJA 4L5OA 4KAEA 4FYUA 1G7OA 3IAM2 2HZFA 4HI7A 1FW1A 2HSHA 3KTBA 4PNFA 2B1LA 2RM6A 2V41A 4V1Ap 4KCEA 1MD4A 5D96A 4ZL9A 22GSA 1ACVA 3QR6A 2F3MA 4PI0C 1QQ2A 3H79A 4EF0A 4HJ2A 2GQKA 3GURA 5A5HA 3ERFA 5CYYA 1TJDA 2R0CA 3LSZA 1Q98A 1GSEA 2FWGA 2WZ9A 1E2YA 4FXYP 2DSAA 3DRNA 3FEUA 2OADA 1G7EA 4RI6A 3BCKA 1TOFA 4CDOA 2C1YA 1VF4A 5J4YA 1GWCA 4WBRD 1ERWA 4EDZA 4HOJA 2VCZA 3CHXC 3QAWA 3C73A 4WF4A 2X49A 3HYPA 3ZLPA 3H1NA 1T1VA 2GDRA 2VCWA 5J5NA 2EIQA 3ZITA 3HZ4A 1GP1A 2GQMA 1PKWA 4PQIA 3LQ7A 3FZ9A 2WFCA 2YPMA 3KZQA 4NV5A 9GSSA 3RPNA 1T8EB 3A5WA 4NXIA 2YWOA 1XIYA 5CRHA 2LUSA 2G2QA 4IGJA 5JCGA 5E4WA 2HRFA 1O6JA 5D9WA 5HR2A 2WZSA 4K7IA 2B3SA 4G10A 4L0UA 3CTGA 2H8LA 3MSZA 3WGXA 2R4VA 4L8EA 1EGRA 2WW2A 2PVQA 2LV3A 4NV2A 4DVCA 2TRXA 2REMA 4IELA 2ES7A 2FWEA 3VPTA 1MDKA 2MMOA 1M3JA 3J7Yk 4K0GA 1F37A 3UJ1A 4W66A 1HNBA 4MZWA 4G19A 2VAFA 5H5SA 5B6NA 1PN9A 1JLWA 3CSJA 4IP6A 3H8QA 3IPZA 4N11A 4ZB8A 4KH7A 5ELGA 3IHGA 3ZFBA 4X1UA 4L0WA 1V98A 2FWFA 1SKRB 4POBA 3Q18A 2VLVA 1M3IA 2CZ3A 2FY6A 1M2AA 4AKIA 2OJLA 1WWJA 3D4TA 1VF3A 4X43A 3GV1A 2B7JA 4ACSA 5ECOB 1KBNA 1U3AA 4ULXA 3MYDA 2HNLA 2HZEA 2I1UA 1TU7A 3I69A 1NHOA 2IMKA 4N3ZA 4HDEA 3EC3A 4CY8A 2O89A 4GSNA 4YKFA 3SBCA 2VO4A 5G31A 1K3LA 5CRWA 3TKSE 3ZMKA 2VL2A 1U6TA 4QL9A 4E8EA 1TRSA 1Z9HA 2LRCA 2M80A 3ISOA 2KOKA 3FZAA 2UZ8A 2G0FA 5D9VA 1HYUA 4EC0A 2NTOA 1F3BA 1BJXA 3L9VA 3HZ8A 3ZZXA 3RFRC 1AQVA 4D73A 5J40A 4PTSA 1PFOA 4JBBA 3RDWA 3CQFA 2QGVA 2V1MA 1J08A 2A2RA 1OAZA 1TXUA 1XWCA 3KIJA 3M9KA 2QSIA 1TTZA 3R2QA 5HQPA 3KGKA 1TK5B 3HY2A 3DXBA 1XOAA 2MBTA 4MCUA 1GUMA 3N9JA 1ZMAA 2C0EA 1WMJA 3A2WA 1Z5YE 1F2EA 2B5YA 3KP8A 1JFUA 3P7XA 4XRAA 2DIYA 3HJOA 1SL2B 3GL3A 4GQCA 1I5GA 1PQNA 2BMXA 4WETA 3M3MA 2IMEA 2E0QA 4FO5A 5IPGA 2JZSA 5ECPB 3LXZA 5G5EA 3QAVA 2PU9C 3GA4A 2X8CA 2JACA 3UEMA 1A23A 2ZCTA 5A34B 2WW0A 2R0GA 3IC8A 3RHBA 2R5GA 2LSTA 5HFGA 2CV4A 4BWQA 2NDOA 5GZZB 2JZRA 2P0GA 2EIOA 4FIWA 1EEMA 1YY7A 4KUNA 4BL7B 2QA2A 4K5SA 1HNAA 4MDCA 1LU4A 4ZBAA 3BD2A 1Y1UA 1SKWB 5CNWA 3BJ5A 4HU9A 4O7HA 3IOSA 1GTAA 2P5RA 4I8BA 3QOUA 1Y6EA 3Q6OA 3Q19A 3CRTA 2HT9A 2R0PA 1MD3A 3GTUB 5IMFA 4PURA 3UOMA 3CWGA 5ECHB 2HXKA 5CRDA 3TJGA 4WR4A 3PGTA 3UMAA 5G5FA 5HFKA 1OC9B 3A5IA 1UA5A 2LJAA 2I4AA 3LW9A 1TU8A 1WIKA 5LCZA 3CBUA 3IK7A 1SK1A 1YF0A 2YOIA 4TR0A 1MDJA 4TKYA 2H1AA 5F0GA 1EOHA 3F6DA 1YEXA 1BQ7A 3AY8A 3F3RA 1SVLA 5CREA 4OMVA 1AXDA 3U6VA 4ECJA 1PMTA 1F9MA 1MDIA 3PH9A 1UN2A 2H19A 4ECCA 4ZIJA 1XFLA 4TN8A 3HVSA 2DJKA 3UIWA 1XVWA 5CRGA 5ECNB 2BJXA 1GL8A 5IOXA 3N5OA 3FMWA 4RUVA 4XIHA 4JE1A 4EE0A 4USSA 3CTFA 3IBHA 1XCCA 3I6AA 2H70A 4J56E 1PSQA 3DEXA 1K0CA 5AGYA 1NHYA 3A3TA 4XRDA 1SYRA 2YN1A 4AJ7A 4AI6A 1FOHA 3K8NA 5IM9A 3F3QA 1QFNA 1ZGNA 3TJBA 1A2MA 4EKZA 1XW5A 4DSQA 2VL2C 2X64A 6GSSA 4K6XA 1G6WA 2CQ9A 4OFNA 1GSQA 1U88A 3ZIVA 3WT1A 5A34A 1DUGA 3VWVA 1I9DA 4WF5A 1B4QA 3VK9A 6GSTA 1XBSA 3NZNA 2R3XA 1YKCA 2R2JA 1DBYA 2HRNA 3SWLA 3D5JA 4G9HA 2LQOA 4MLYA 5G30A 1R4WA 4MJEA 5BRTA 4O5UA 3C1RA 4GWRA 4OFTA 3QDNA 3BBYA 5J41A 3FYGA 2H75A 1QMVA 5A5KA 2OBKA 1XWAA 2WRTA 1BG5A 1SK2A 3RBTA 2PERA 5ECQB 1A8LA 4N0VA 4F2IA 2PGTA 5KN0A 1MEKA 4HJMA 3ME8A 1JZWA 4MJBA 5GSTA 1NM3A 1T00A 4EUYA 1AW9A 1ERTA 1ON4A 3HVNA 2J23A 2H74A 4N0ZA 1U87A 3JCML 5AN1A 1OC9A 4IJIA 4QMKA 2I81A 3LG6A 4POLA 1TRWA 1JZOA 2FGXA 4ZXGA 1V57A 5EPFA 4MABA 2FCHA 5DDLA 2VM1A 3EU3A 2DJJA 1G6YA 4PNGA 2H1BA 3IDVA 2LRTA 1GSDA 2AB6A 4BPYA 2JSYA 2N5AA 2N5BA 4ISDA 2A2PA 4AKHA 2H0GA 4F82A 2KLXA 2YZHA 1YEWC 3IA1A 1KNGA 1SL1B 2RIIA 2C0FA 4TW5A 4NMUA 2M72A 4NAXA 3EPTA 3P8WA 3TJJA 5FHIA 1AAZA 3G7JA 2P5QA 3VURA 4MZCA 2JL4A 3ZL5A 2HZEB 2L59A 2M46A 2EFCA 1PKZA 2CVBA 4MJCA 4LLRA 4EVMA 3L4NA 3A2VA 4I97A 3WGDA 1SD9A 1GSUA 2LRNA 3D22A 1NSWA 2FLSA 3G9BA 4NHWA 4HQZA 2WW3A 4OD7A 1BF5A 5KN3A 3RPPA 3UBLA 2AAWA 3R3EA 4TRXA 1GSSA 3LORA 4N10A 3CSIA 4V1Ag 4D73B 2HI7A 4KCAA 5ENUA 2MMAA 1ML6A 3GN3A 1OKDA 1FOVA 4KDYA 2JADA 4ZB7A 1TKDB 3TDGA 3VI5A 2CA8A 6GSXA 3DWVA 3GKKA 1XWBA 2WGRA 2F51A 2Z9SA 2YZUA 5DQSA 1XXUA 3IXRA 2O36A 3M9JA 3ZMLA 2QA1A 3D6IA 4WEYA 2LEGA 2V6KA 1IYIA 4ECIA 3FKFA 1KTEA 3KTLA 2XHFA 3GL5A 4F03A 3Q74A 2H6XA 3CRUA 5IIZA 3APQA 4KB3A 1M2DA 2NVLA 1M2BA 3TKRA 3MWHA 5HFIA 5AISA 4XCSA 2GVPA 1C72A 1R5AA 5H5RA 3WYWA 2DJ2A 2A4HA 4ZBBA 2WS2A 4GSSA 2K6VA 2TIRA 1B9YC 1ZYPA 4POMA 5ECKB 4KGIA 4MK3A 4GRFA 2VD1A 3GMFA 3P2AA 1PX6A 3I43A 2C0DA 2H0HA 4PGTA 4G2EA 1AIUA 3FR9A 2VOCA 1O73A 4FQUA 1QGVA 4HEA2 5G1KA 2LNSA 3UVTA 4FH8A 1EWXA 2GSTA 2AYTA 1EP8A 1ZOFA 1B4PA 1RW1A 2H6YA 3LEFA 1TRUA 1MTCA 4YH2A 2X99A 3TB2A 3ED3A 1SKSB 4KDXA 2GGTA 5IMVA 3KMOA 4X4JA 1TW9A 1GTUA 4KDUA 3HJPA 4MZBA 1K0OA 4GCIA 2HRKA 3ERGA 4OWYA 2FHEA 2HYXA 4WKWA 3C71A 3U5RE 3IC4A 2EC4A 2YANA 2MMZA 3DGQA 2GQLA 4LMWA 3M8NA 3IR4A 2HSYA 4HSCX 4EO3A 4PUFC 4ZL8A 2X8GA 1AQWA 4MPFA 3ZTLA 2V32A 3FK8A 1YVLA 2FUG2 2HSMB 2GSQA 1TXXA 2HFDA 2VUPA 4IQAA 5INYA 4IS0A 4ML6A 2NBSA 4PXOA 2B5XA 2L57A 4KA0A 4KF9A 5A4UA 2H76A 4CW9A 2TRCP 1ZCPA 3EVIA 2YV9A 5FT3A 2H66A 1FB6A 4OO5A 2C80A 1XWGA 1N8JA 16GSA 3WD6A 1X5EA 2CX3A 3GX8A 2GT6A 4G0LA 1M0UA 3QPMA 1X9MB 1GRXA 4CHSA 4ZB9A 1OVNA 1O85A 3HDCA 2F8FA 3EINA 1EZKA 1K0DA 2XPDA 4QQ7A 4YAVA 1GUKA 3EU4A 4LA1A 3TRPA 7GSSA 2DMLA 5ECLB 2CAIA 2DLXA 4IQ1A 3O3TA 3C1SA 1PL1A 1GTIA 5IMAA 6GSUA 1ST9A 3QAGA 3DMLA 1GSYA 2L5OA 4ZBDA 3HCZA 3DYRA 1BEDA 4O5RA 5F07A 2LTKA 1PN0A 2DKIA 3WT2A 4EIPA 1M99A 4KX4A 1OC3A 3TJFA 3EMPA 3MIXA 4I2UA 3VWUA 3PINA 2YNXA 3IHQA 2OT3A 5B8BA 1A0RP 4GLTA 2YCDA 1GNEA 5DJMA 1A0FA 3IAS2 4TR3A 1U3IA 4XS1A 4TR1B 4DSRA 1T7PB 3GX0A 3L0HA 2V6OA 2FD3A 4EIQA 3TKPA 3P90A 3H93A 1PA3A 4MF5A 4KNDA 4OCEA 1BAYA 3F8UA 5B7CA 4JRRA 4Z2TA 4JR4A 5ABRA 4AJ6A 1TI1A 3LWAA 1OE7A 2RM5A 2VKZG 4G0KA 1YJ6A 3DVWA 2IL3A 5A4VA 1S4BP 3CYNA 4MJAA 1BYEA 1PRXA 1YDKA 1WJKA 4JR6A 3VLNA 1XW6A 1HD2A 2HSMA 5L71A 5CP1A 2WCIA 2IIYA 1E6BA 4XHMA 5DVBA 2H6ZA 1NW2A 3TJKA 3L78A 2VCQA 2ON5A 2C3TA 5COHA 4OFMA 4IBPA 4IN0A 4AKGA 4DSSB 2RUFA 3M0FA 3TCOA 3ZREA 3LYPA 2E7PA 2H1LA 3VWXA 4HZ2A 3RHCA 3PPUA 1ZZYA 4ZILA 1DSBA 3VWWA 2PUKC 5CO3A 2VL3A 3EYTA 2PWJA 1YF1A 4E68A 1K3YA 1X5DA 4K2DA 5ELAA 2KUCA 1ERUA 1Y25A 1THXA 1W89A 5G2ZA 3TRXA 2VIMA 3MDKA 2ZNMA 3V1WA 4IJ3A 2H73A 2JSZA 3GH9A 3KEBA 4MF6A 1O8WA 4TXOA 17GSA 2A4VA 2CAQA 1A2LA 2IN3A 1XG8A 2PVOC 4ZB6A 5KN1A 4I2TA 4O5QA 5ID2A 2IFQB 3TGZA 1F3AA 2CX4A 1EV9A 2KP1A 3ZYWA 1A24A 5JCWA 2XBIA 2H30A 3ZRDA 2I9HA 2I3YA 1B9XC 2VCTA 3FZ4A 3EE2A 1K3OA 1Z6MA 3RGBC 4IP1A 4J57E 2O85A 2EFHA 4P3YB 1R26A 4LMVA 2EIRA 2D2ZA 3GKNA 3ZFLA 4BVYA 4Q5NA 3ERWA 4MA9A 3I9V2 4TR1A 1N2AA 5B6MA 1SK0A 2K18A 1V40A 5F8BA 2PPTA 3TKSC 1O7UA 1WPIA 4PX1A 5C04A 3FRCA 4F0CA 3DKSA 2DJ0A 2IMDA 3HVVA 4ID0A 5A1NA 4BVXB 5BMUA 4YKGA 1DE1A 2IPAA 2CZ2A 2OBIA 1H4OA 3FY7A 2L4QA 2B6MA 2VL9A 4V2MA 3EMXA 2JU5A 4MH3A 5H5QA 1PL2A 3GHAA 1YEPA 5IO2A 3OR5A 2RLIA 2PMTA 1S3DA 1BG1A 2QC7A 1VRSD 4TR4A 1EOGA 5J3RA 4ECBA 2OE0A 3DD3A 1J0FA 2YWMA 4HU7A 1XW9A 3LYKA 3D0ZA 2OACA 2HRKB 1IYHA 1URMA 2O7KA 4XS6A 2GSRA 4PQHA 1X0RA 3QFAC 2B5EA 1QXHA 3VI7A 4DSSA 3UL3A 1TK0B 1SYXA 3F4TA 2X8HA 3GIXA 4G01A 1FAAA 4H86A 4QL7A 1M9BA 5AIVA 1PX7A 3GH6A 4EL1A 3GUSA 2L5LA 1ZYEA 1WRYA 1J9BA 2B1KA 5AIXA 1Z3EA 4EXJA 1ABAA 2E2MA 1GUHA 4Z7XA 4MPGA 2PN8A 1SU9A 2VLUA 2CT6A 11GSA 3QFBC 5D8IA 2XPEA 4GXZA 2C3NA 4KSMA 2IFQA 5ECRB 1OKTA 1FG4A 3APSA 2FNOA 1SD8A 1HNCA 1CQGA 1WE0A 4TOPA 2WVXA 2LKUA 1Z7PA 3C7MA 5DALA 4RQRA 4V2NA 4WBJA 4XS4B 5HR3A 1LJRA 1K0AA 1M7TA 1O8XA 1SJZA 1XOBA 5JWOB 1JZDA 2ZUPA 18GSA 3E9JB 1X9WB 3LGCA 3IK9A 3NIVA 4XTSA 3MNGA 2HSNA 3CMIA 4IHUA 2VCXA 5ECIB 2VLTA 4JZQA 4AJ8A 1OC8A 2O87A 2YWIA 2L4CA 1JLVA 2K8SA 1KEBA 5DCGA 5G1LA 2NPBA 2OA7A 4K7OA 4OO4A 4BVXA 3GSTA 4AGSA 14GSA 3IV4A 2WB9A 1SVOA 2ON7A 4MNNA 3BCIA 5A4WA 5IMZA 2MMNA 4O32A 2C8UA 4PHZC 1V58A 4WR5A 2AUVA 1GNWA 2C4JA 2O3EA 3W6GA 3KH7A 5JCUA 1M9AA 4ILFA 1YQ1A 1SJ6A 4HUAA 1EP7A 3F4RA 1S3CA 3HMJG 2DBCA 1N25A 3TRQA 4PUAA 1ZYNA 1O81A 2GZPA 4L5LA 1K0BA 2DJ3A 3TOUA 5IQYA 2J9HA 4GF0A 4PI2C 1YKAA 1X9SB 3F9UA 3QCPA 3ZVJA 3NOFA 2CVDA 4Z2RA 1T3BA 3J7Yb
chains in the Genus database with same CATH topology
2XC2A 2A2SA 2PBJA 5GAND 3IE3A 3HJMA 3GSSA 3LXTA 4YQUA 2WULA 2IJYA 5J4VA 2IMIA 1F6MC 4AKXB 5D9XA 3F63A 2O8VB 1GULA 4JEDA 2FA8A 2OKAA 4GTUA 3BOAA 1VF1A 4ML1A 5DCHA 2IWTA 4I5QA 5KEJA 5HR0A 1CQHA 3F0IA 4IVFA 6GSYA 5ECMB 2DC5A 1X5CA 2VCVA 5F06A 2HRAA 2VD0A 5IMDA 5KOXA 2YJHA 3LFLA 2RUEA 2FA4A 4XS4A 3HXSA 5IMCA 3KM6A 3ZVJD 2GSSA 2GZYA 4K2XA 3FW2A 1PD21 3KD0A 2GZZA 1R5PA 3TKSA 2B7KA 2GT5A 4TXOB 1EV4A 5LD0A 2LNTA 2BTOT 5J4UA 3HVXA 10GSA 3LJRA 1FO5A 4HQSA 1UC7A 4JU5A 5ID2B 4HZ4A 4IW9A 4YQMA 5IOWA 4IKHA 5KOWA 2HLSA 3O6TA 1T4ZA 1PGTA 5E59A 3W8JA 3TUEA 2YV7A 4Q5QA 1OE8A 3WGEA 1Z6NA 3VFIA 4TXVA 3H4KA 3US3A 5DAKB 3L9SA 1TDIA 4J2FA 4LL1B 5J9CA 2YWNA 3S9FA 4YAPA 3GRXA 1ILOA 5D73A 4FYBA 4OCFA 2OE3A 4K9ZA 2DJ1A 3KJYA 1WP0A 4GSTA 1A8YA 2X4AA 4BVYB 2WDUA 2LS5A 2YP6A 1TRVA 4MH2A 5C00A 3VPQA 4F0BA 1FB0A 3MAKA 3QMXA 5EL8A 1Q4JA 2K8VA 2R6KA 1XPVA 2AV4A 3TOTA 4NPBA 1GLQA 2EFEA 1GH2A 5GSSA 4Q5FA 5DQYA 3GKXA 5JWQB 1Z7RA 4KE3A 1QK8A 3C8EA 4AF2A 1B48A 1W4VA 4MP4A 2H72A 2IMFA 2F9SA 1SJIA 4DEJA 5A1NB 5HR1A 2EFDA 5BMUB 3TKQA 1K0NA 4K7NA 1HQOA 3W8SA 1QUWA 3F4SA 3E3EA 1OYJA 1AUCA 3KMNA 4KSOA 3M1GA 1G0TA 3TU3B 1THOA 3FR3A 3KH9A 4K1FA 1JHBA 3HA9A 3FR6A 1RQMA 1V9WA 4K8MA 4CY6A 3L9UA 1ZYQB 2DMMA 1TI3A 1R7HA 1SVMA 1SENA 4KW6A 4K0NA 1TP9A 3EURA 4TVEA 5DJLA 5FWGA 3UVHA 5EY6A 1WOUA 3FHKA 1FVKA 1GTBA 1T4YA 2C0GA 2ALBA 1FVJA 3HKRA 2R37A 3D4MA 3HD5A 2HE3A 4POKA 3GYKA 1BX9A 4BWSA 3KP9A 5ECSA 4BA7A 19GSA 2H0IA 2F8AA 1ZL9A 2MZCA 5CAXA 1USBA 5D93A 4GDFA 3G7IA 1B8XA 4V2LA 1TK8B 12GSA 1ERVA 4X0XA 2O5VA 5DBQA 5A5HB 3DIEA 2C3QA 2AHEA 3RAZA 2WJUA 2HQTA 4F9ZA 1GSFA 2H1GA 5D9TA 3GNJA 2DKHA 1JZRA 3IRAA 4WXTA 2LJRA 1S3AA 3UARA 2LJKA 4HS1A 4BL7A 3CSHA 3KCMA 5LNKe 4A5PA 2UV8G 5DAKA 2H1DA 2L6DA 2GLRA 4EDYA 5GAPD 1DE2A 1VGLA 5DALB 3D21A 2XBQA 5IO0A 2H01A 3A2XA 5B8AA 1XVQA 2CVKA 3F6FA 2P31A 2OE1A 2GTUA 4NHZA 1LBKA 2LQQA 2L6CA 4E8HA 3FZ5A 3GTUA 1FHEA 4ZL7A 2HSNB 4ICYA 3PR8A 2DIZA 5J47A 4PQ1A 2GS3A 4K5RA 1A2JA 1AC1A 5F05A 3GFKA 3E0UA 1V2AA 1XWKA 4RQXA 4NWYA 5JWRB 3UAPA 3UBKA 2N5FA 20GSA 2QKEA 4G0IA 3CXGA 4YQVA 4MF7A 1K0MA 3G7YA 2MBSA 2FWHA 1EGOA 2KHPA 4Z2UA 1EEJA 1YZXA 1H75A 2V2GA 8GSSA 6GSWA 6GSVA 3KXOA 1AQXA 5KN2A 3HHVA 4I6XA 4RI7A 4GQFA 2MYGA 5EVOA 1XZOA 1UVZA 4FYCA 1SL0B 13GSA 2KP2A 2H71A 2YJ7A 2VM2A 5IPHA 3DVXA 3QD9A 4MMMA 4Q5RA 4N30A 2AJQB 1GLPA 3EWLA 3GKMA 1RK4A 4O92A 2K9FA 3ME7A 3APOA 4LL4B 1VF2A 5J9BA 2E2GA 3O76A 2JZTA 3ZIJA 4L5OA 4KAEA 4FYUA 1G7OA 3IAM2 2HZFA 4HI7A 1FW1A 2HSHA 3KTBA 4PNFA 2B1LA 2RM6A 2V41A 4V1Ap 4KCEA 1MD4A 5D96A 4ZL9A 22GSA 1ACVA 3QR6A 2F3MA 1QQ2A 3H79A 4EF0A 4HJ2A 2GQKA 3GURA 5A5HA 3ERFA 5CYYA 1TJDA 2R0CA 3LSZA 1Q98A 1GSEA 2FWGA 2WZ9A 1E2YA 2DSAA 3DRNA 3FEUA 2OADA 1G7EA 4RI6A 3BCKA 1TOFA 4CDOA 2C1YA 1VF4A 5J4YA 1GWCA 4WBRD 1ERWA 4EDZA 4HOJA 2VCZA 3QAWA 3C73A 4WF4A 2X49A 3HYPA 3ZLPA 3H1NA 1T1VA 2GDRA 2VCWA 5J5NA 2EIQA 3ZITA 3HZ4A 1GP1A 2GQMA 1PKWA 4PQIA 3LQ7A 3FZ9A 2WFCA 2YPMA 3KZQA 4NV5A 9GSSA 3RPNA 1T8EB 3A5WA 4NXIA 2YWOA 1XIYA 5CRHA 2LUSA 2G2QA 4IGJA 5JCGA 5E4WA 2HRFA 1O6JA 5D9WA 5HR2A 4K7IA 2B3SA 4G10A 4L0UA 3CTGA 2H8LA 3MSZA 3WGXA 2R4VA 4L8EA 1EGRA 2PVQA 2LV3A 4NV2A 4DVCA 2TRXA 2REMA 4IELA 2ES7A 2FWEA 3VPTA 1MDKA 2MMOA 3J7Yk 4K0GA 1F37A 3UJ1A 4W66A 1HNBA 4MZWA 4G19A 2VAFA 5H5SA 5B6NA 1PN9A 1JLWA 3CSJA 4IP6A 3H8QA 3IPZA 4N11A 4ZB8A 4KH7A 5ELGA 3IHGA 3ZFBA 4X1UA 4L0WA 1V98A 2FWFA 1SKRB 4POBA 3Q18A 2VLVA 2CZ3A 2FY6A 1M2AA 4AKIA 2OJLA 1WWJA 3D4TA 1VF3A 4X43A 3GV1A 2B7JA 4ACSA 5ECOB 1KBNA 1U3AA 4ULXA 3MYDA 2HNLA 2HZEA 2I1UA 1TU7A 3I69A 1NHOA 2IMKA 4N3ZA 4HDEA 3EC3A 4CY8A 2O89A 4GSNA 4YKFA 3SBCA 2VO4A 5G31A 1K3LA 5CRWA 3TKSE 3ZMKA 2VL2A 1U6TA 4QL9A 4E8EA 1TRSA 1Z9HA 2LRCA 2M80A 3ISOA 2KOKA 3FZAA 2UZ8A 2G0FA 5D9VA 1HYUA 4EC0A 2NTOA 1F3BA 1BJXA 3L9VA 3HZ8A 3ZZXA 1AQVA 4D73A 5J40A 4PTSA 4JBBA 3RDWA 2QGVA 2V1MA 1J08A 2A2RA 1OAZA 1TXUA 1XWCA 3KIJA 3M9KA 2QSIA 1TTZA 3R2QA 5HQPA 3KGKA 1TK5B 3HY2A 3DXBA 1XOAA 2MBTA 4MCUA 1GUMA 3N9JA 1ZMAA 2C0EA 1WMJA 3A2WA 1Z5YE 1F2EA 2B5YA 3KP8A 1JFUA 3P7XA 4XRAA 2DIYA 3HJOA 1SL2B 3GL3A 4GQCA 1I5GA 1PQNA 2BMXA 4WETA 3M3MA 2IMEA 2E0QA 4FO5A 5IPGA 2JZSA 5ECPB 3LXZA 5G5EA 3QAVA 2PU9C 3GA4A 2X8CA 2JACA 3UEMA 1A23A 2ZCTA 5A34B 2R0GA 3IC8A 3RHBA 2R5GA 2LSTA 5HFGA 2CV4A 4BWQA 2NDOA 5GZZB 2JZRA 2P0GA 2EIOA 4FIWA 1EEMA 1YY7A 4KUNA 4BL7B 2QA2A 4K5SA 1HNAA 4MDCA 1LU4A 4ZBAA 3BD2A 1Y1UA 1SKWB 5CNWA 3BJ5A 4HU9A 4O7HA 3IOSA 1GTAA 2P5RA 4I8BA 3QOUA 1Y6EA 3Q6OA 3Q19A 3CRTA 2HT9A 2R0PA 1MD3A 3GTUB 5IMFA 4PURA 3UOMA 3CWGA 5ECHB 2HXKA 5CRDA 3TJGA 4WR4A 3PGTA 3UMAA 5G5FA 5HFKA 1OC9B 3A5IA 1UA5A 2LJAA 2I4AA 3LW9A 1TU8A 1WIKA 5LCZA 3CBUA 3IK7A 1SK1A 1YF0A 2YOIA 4TR0A 1MDJA 4TKYA 2H1AA 5F0GA 1EOHA 3F6DA 1YEXA 1BQ7A 3AY8A 3F3RA 1SVLA 5CREA 4OMVA 1AXDA 3U6VA 4ECJA 1PMTA 1F9MA 1MDIA 3PH9A 1UN2A 2H19A 4ECCA 4ZIJA 1XFLA 4TN8A 3HVSA 2DJKA 3UIWA 1XVWA 5CRGA 5ECNB 2BJXA 1GL8A 5IOXA 3N5OA 3FMWA 4RUVA 4XIHA 4JE1A 4EE0A 4USSA 3CTFA 3IBHA 1XCCA 3I6AA 2H70A 4J56E 1PSQA 3DEXA 1K0CA 5AGYA 1NHYA 3A3TA 4XRDA 1SYRA 2YN1A 4AJ7A 4AI6A 1FOHA 3K8NA 5IM9A 3F3QA 1QFNA 1ZGNA 3TJBA 1A2MA 4EKZA 1XW5A 4DSQA 2VL2C 2X64A 6GSSA 4K6XA 1G6WA 2CQ9A 4OFNA 1GSQA 1U88A 3ZIVA 3WT1A 5A34A 1DUGA 3VWVA 1I9DA 4WF5A 1B4QA 3VK9A 6GSTA 1XBSA 3NZNA 2R3XA 1YKCA 2R2JA 1DBYA 2HRNA 3SWLA 3D5JA 4G9HA 2LQOA 4MLYA 5G30A 1R4WA 4MJEA 5BRTA 4O5UA 3C1RA 4GWRA 4OFTA 3QDNA 3BBYA 5J41A 3FYGA 2H75A 1QMVA 5A5KA 2OBKA 1XWAA 2WRTA 1BG5A 1SK2A 3RBTA 2PERA 5ECQB 1A8LA 4N0VA 4F2IA 2PGTA 5KN0A 1MEKA 4HJMA 3ME8A 1JZWA 4MJBA 5GSTA 1NM3A 1T00A 4EUYA 1AW9A 1ERTA 1ON4A 4N0ZA 2J23A 2H74A 1U87A 3JCML 5AN1A 1OC9A 4IJIA 4QMKA 2I81A 3LG6A 4POLA 1TRWA 1JZOA 2FGXA 4ZXGA 1V57A 5EPFA 4MABA 2FCHA 5DDLA 2VM1A 3EU3A 2DJJA 1G6YA 4PNGA 2H1BA 3IDVA 2LRTA 1GSDA 2AB6A 4BPYA 2JSYA 2N5AA 2N5BA 4ISDA 2A2PA 4AKHA 2H0GA 4F82A 2KLXA 2YZHA 3IA1A 1KNGA 1SL1B 2RIIA 2C0FA 4TW5A 4NMUA 2M72A 4NAXA 3EPTA 3P8WA 3TJJA 5FHIA 1AAZA 3G7JA 2P5QA 3VURA 4MZCA 2JL4A 3ZL5A 2HZEB 2L59A 2M46A 2EFCA 1PKZA 2CVBA 4MJCA 4LLRA 4EVMA 3L4NA 3A2VA 4I97A 3WGDA 1SD9A 1GSUA 2LRNA 3D22A 1NSWA 2FLSA 3G9BA 4NHWA 4HQZA 4OD7A 1BF5A 5KN3A 3RPPA 3UBLA 2AAWA 3R3EA 4TRXA 1GSSA 3LORA 4N10A 3CSIA 4V1Ag 4D73B 2HI7A 4KCAA 5ENUA 2MMAA 1ML6A 3GN3A 1OKDA 1FOVA 4KDYA 2JADA 4ZB7A 1TKDB 3TDGA 3VI5A 2CA8A 6GSXA 3DWVA 3GKKA 1XWBA 2WGRA 2F51A 2Z9SA 2YZUA 5DQSA 1XXUA 3IXRA 3M9JA 3ZMLA 2QA1A 3D6IA 4WEYA 2LEGA 2V6KA 1IYIA 4ECIA 3FKFA 1KTEA 3KTLA 2XHFA 3GL5A 4F03A 3Q74A 2H6XA 3CRUA 5IIZA 3APQA 4KB3A 1M2DA 2NVLA 1M2BA 3TKRA 3MWHA 5HFIA 5AISA 4XCSA 2GVPA 1C72A 1R5AA 5H5RA 3WYWA 2DJ2A 2A4HA 4ZBBA 2WS2A 4GSSA 2K6VA 2TIRA 1B9YC 1ZYPA 4POMA 5ECKB 4KGIA 4MK3A 4GRFA 2VD1A 3GMFA 3P2AA 1PX6A 3I43A 2C0DA 2H0HA 4PGTA 4G2EA 1AIUA 3FR9A 2VOCA 1O73A 4FQUA 1QGVA 4HEA2 5G1KA 2LNSA 3UVTA 4FH8A 1EWXA 2GSTA 2AYTA 1EP8A 1ZOFA 1B4PA 1RW1A 2H6YA 3LEFA 1TRUA 1MTCA 4YH2A 2X99A 3TB2A 3ED3A 1SKSB 4KDXA 2GGTA 5IMVA 3KMOA 4X4JA 1TW9A 1GTUA 4KDUA 3HJPA 4MZBA 1K0OA 4GCIA 2HRKA 3ERGA 4OWYA 2FHEA 2HYXA 4WKWA 3C71A 3U5RE 3IC4A 2EC4A 2YANA 2MMZA 3DGQA 2GQLA 4LMWA 3M8NA 3IR4A 2HSYA 4EO3A 4PUFC 4ZL8A 2X8GA 1AQWA 4MPFA 3ZTLA 2V32A 3FK8A 1YVLA 2FUG2 2HSMB 2GSQA 1TXXA 2HFDA 2VUPA 4IQAA 5INYA 4IS0A 4ML6A 2NBSA 4PXOA 2B5XA 2L57A 4KA0A 4KF9A 5A4UA 2H76A 4CW9A 2TRCP 1ZCPA 3EVIA 2YV9A 5FT3A 2H66A 1FB6A 4OO5A 2C80A 1XWGA 1N8JA 16GSA 3WD6A 1X5EA 2CX3A 3GX8A 2GT6A 4G0LA 1M0UA 3QPMA 1X9MB 1GRXA 4CHSA 4ZB9A 1OVNA 1O85A 3HDCA 2F8FA 3EINA 1EZKA 1K0DA 2XPDA 4QQ7A 4YAVA 1GUKA 3EU4A 4LA1A 3TRPA 7GSSA 2DMLA 5ECLB 2CAIA 2DLXA 4IQ1A 3O3TA 3C1SA 1PL1A 1GTIA 5IMAA 6GSUA 1ST9A 3QAGA 3DMLA 1GSYA 2L5OA 4ZBDA 3HCZA 3DYRA 1BEDA 4O5RA 5F07A 2LTKA 1PN0A 2DKIA 3WT2A 4EIPA 1M99A 4KX4A 1OC3A 3TJFA 3EMPA 3MIXA 4I2UA 3VWUA 3PINA 2YNXA 3IHQA 2OT3A 5B8BA 1A0RP 4GLTA 2YCDA 1GNEA 5DJMA 1A0FA 3IAS2 4TR3A 1U3IA 4XS1A 4TR1B 4DSRA 1T7PB 3GX0A 3L0HA 2V6OA 2FD3A 4EIQA 3TKPA 3P90A 3H93A 1PA3A 4MF5A 4KNDA 4OCEA 1BAYA 3F8UA 5B7CA 4JRRA 4Z2TA 4JR4A 5ABRA 4AJ6A 1TI1A 3LWAA 1OE7A 2RM5A 2VKZG 4G0KA 1YJ6A 3DVWA 2IL3A 5A4VA 3CYNA 4MJAA 1BYEA 1PRXA 1YDKA 1WJKA 4JR6A 3VLNA 1XW6A 1HD2A 2HSMA 5L71A 5CP1A 2WCIA 2IIYA 1E6BA 4XHMA 5DVBA 2H6ZA 1NW2A 3TJKA 3L78A 2VCQA 2ON5A 2C3TA 5COHA 4OFMA 4IBPA 4IN0A 4AKGA 4DSSB 2RUFA 3M0FA 3TCOA 3ZREA 3LYPA 2E7PA 2H1LA 3VWXA 4HZ2A 3RHCA 3PPUA 1ZZYA 4ZILA 1DSBA 3VWWA 2PUKC 5CO3A 2VL3A 3EYTA 2PWJA 1YF1A 4E68A 1K3YA 1X5DA 4K2DA 5ELAA 2KUCA 1ERUA 1Y25A 1THXA 1W89A 5G2ZA 3TRXA 2VIMA 3MDKA 2ZNMA 3V1WA 4IJ3A 2H73A 2JSZA 3GH9A 3KEBA 4MF6A 1O8WA 4TXOA 17GSA 2A4VA 2CAQA 1A2LA 2IN3A 2PVOC 4ZB6A 5KN1A 4I2TA 4O5QA 5ID2A 2IFQB 3TGZA 1F3AA 2CX4A 1EV9A 2KP1A 3ZYWA 1A24A 5JCWA 2XBIA 2H30A 3ZRDA 2I9HA 2I3YA 1B9XC 2VCTA 3FZ4A 3EE2A 1K3OA 1Z6MA 4IP1A 4J57E 2O85A 2EFHA 4P3YB 1R26A 4LMVA 2EIRA 2D2ZA 3GKNA 3ZFLA 4BVYA 4Q5NA 3ERWA 4MA9A 3I9V2 4TR1A 1N2AA 5B6MA 1SK0A 2K18A 1V40A 5F8BA 2PPTA 3TKSC 1O7UA 1WPIA 4PX1A 5C04A 3FRCA 4F0CA 3DKSA 2DJ0A 2IMDA 3HVVA 4ID0A 5A1NA 4BVXB 5BMUA 4YKGA 1DE1A 2IPAA 2CZ2A 2OBIA 1H4OA 3FY7A 2L4QA 2B6MA 2VL9A 4V2MA 3EMXA 2JU5A 4MH3A 5H5QA 1PL2A 3GHAA 1YEPA 5IO2A 3OR5A 2RLIA 2PMTA 1S3DA 1BG1A 2QC7A 1VRSD 4TR4A 1EOGA 5J3RA 4ECBA 2OE0A 3DD3A 1J0FA 2YWMA 4HU7A 1XW9A 3LYKA 3D0ZA 2OACA 2HRKB 1IYHA 1URMA 2O7KA 4XS6A 2GSRA 4PQHA 1X0RA 3QFAC 2B5EA 1QXHA 3VI7A 4DSSA 3UL3A 1TK0B 1SYXA 3F4TA 2X8HA 3GIXA 4G01A 1FAAA 4H86A 4QL7A 1M9BA 5AIVA 1PX7A 3GH6A 4EL1A 3GUSA 2L5LA 1ZYEA 1WRYA 1J9BA 2B1KA 5AIXA 1Z3EA 4EXJA 1ABAA 2E2MA 1GUHA 4Z7XA 4MPGA 2PN8A 1SU9A 2VLUA 2CT6A 11GSA 3QFBC 5D8IA 2XPEA 4GXZA 2C3NA 4KSMA 2IFQA 5ECRB 1OKTA 1FG4A 3APSA 2FNOA 1SD8A 1HNCA 1CQGA 1WE0A 4TOPA 2LKUA 1Z7PA 3C7MA 5DALA 4RQRA 4V2NA 4WBJA 4XS4B 5HR3A 1LJRA 1K0AA 1M7TA 1O8XA 1SJZA 1XOBA 5JWOB 1JZDA 2ZUPA 18GSA 3E9JB 1X9WB 3LGCA 3IK9A 3NIVA 4XTSA 3MNGA 2HSNA 3CMIA 4IHUA 2VCXA 5ECIB 2VLTA 4JZQA 4AJ8A 1OC8A 2O87A 2YWIA 2L4CA 1JLVA 2K8SA 1KEBA 5DCGA 5G1LA 2NPBA 2OA7A 4K7OA 4OO4A 4BVXA 3GSTA 4AGSA 14GSA 3IV4A 2WB9A 1SVOA 2ON7A 4MNNA 3BCIA 5A4WA 5IMZA 2MMNA 4O32A 2C8UA 1V58A 4WR5A 2AUVA 1GNWA 2C4JA 3W6GA 3KH7A 5JCUA 1M9AA 4ILFA 1YQ1A 1SJ6A 4HUAA 1EP7A 3F4RA 1S3CA 3HMJG 2DBCA 1N25A 3TRQA 4PUAA 1ZYNA 1O81A 2GZPA 4L5LA 1K0BA 2DJ3A 3TOUA 5IQYA 2J9HA 4GF0A 1YKAA 1X9SB 3F9UA 3QCPA 3ZVJA 3NOFA 2CVDA 4Z2RA 1T3BA 3J7Yb
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XC2 A;  2A2S A;  2PBJ A;  5GAN D;  3IE3 A;  3HJM A;  3GSS A;  3LXT A;  4YQU A;  2WUL A;  2IJY A;  2IMI A;  1F6M C;  5D9X A;  3F63 A;  2O8V B;  1GUL A;  4JED A;  2FA8 A;  2OKA A;  4GTU A;  3BOA A;  1VF1 A;  4ML1 A;  5DCH A;  2IWT A;  4I5Q A;  5KEJ A;  5HR0 A;  1CQH A;  3F0I A;  4IVF A;  6GSY A;  5ECM B;  2DC5 A;  1X5C A;  2VCV A;  5F06 A;  2HRA A;  2VD0 A;  5IMD A;  2YJH A;  3LFL A;  2RUE A;  2FA4 A;  4XS4 A;  3HXS A;  5IMC A;  3KM6 A;  3ZVJ D;  2GSS A;  2GZY A;  3FW2 A;  1PD2 1;  3KD0 A;  2GZZ A;  1R5P A;  3TKS A;  2B7K A;  2GT5 A;  4TXO B;  1EV4 A;  5LD0 A;  2LNT A;  2BTO T;  5J4U A;  3HVX A;  10GS A;  3LJR A;  1FO5 A;  4HQS A;  1UC7 A;  4JU5 A;  5ID2 B;  4HZ4 A;  4IW9 A;  4YQM A;  5IOW A;  4IKH A;  2HLS A;  3O6T A;  1T4Z A;  1PGT A;  5E59 A;  3W8J A;  3TUE A;  2YV7 A;  4Q5Q A;  1OE8 A;  3WGE A;  1Z6N A;  3VFI A;  4TXV A;  3H4K A;  3US3 A;  5DAK B;  3L9S A;  1TDI A;  4J2F A;  4LL1 B;  5J9C A;  2YWN A;  3S9F A;  4YAP A;  3GRX A;  1ILO A;  5D73 A;  4FYB A;  4OCF A;  2OE3 A;  4K9Z A;  2DJ1 A;  3KJY A;  1WP0 A;  4GST A;  1A8Y A;  4BVY B;  2WDU A;  2LS5 A;  2YP6 A;  1TRV A;  4MH2 A;  5C00 A;  3VPQ A;  4F0B A;  1FB0 A;  3MAK A;  3QMX A;  5EL8 A;  1Q4J A;  2K8V A;  2R6K A;  1XPV A;  2AV4 A;  3TOT A;  4NPB A;  1GLQ A;  1GH2 A;  5GSS A;  4Q5F A;  5DQY A;  3GKX A;  5JWQ B;  1Z7R A;  4KE3 A;  1QK8 A;  3C8E A;  4AF2 A;  1B48 A;  1W4V A;  4MP4 A;  2H72 A;  2IMF A;  2F9S A;  1SJI A;  4DEJ A;  5HR1 A;  3TKQ A;  1K0N A;  4K7N A;  1HQO A;  3W8S A;  1QUW A;  3F4S A;  3E3E A;  1OYJ A;  1AUC A;  3KMN A;  4KSO A;  3M1G A;  1G0T A;  1THO A;  3FR3 A;  3KH9 A;  4K1F A;  1JHB A;  3HA9 A;  3FR6 A;  1RQM A;  1V9W A;  4K8M A;  3L9U A;  1ZYQ B;  2DMM A;  1TI3 A;  1R7H A;  1SEN A;  4KW6 A;  4K0N A;  1TP9 A;  3EUR A;  4TVE A;  5DJL A;  5FWG A;  3UVH A;  5EY6 A;  1WOU A;  3FHK A;  1FVK A;  1GTB A;  1T4Y A;  2C0G A;  2ALB A;  1FVJ A;  3HKR A;  2R37 A;  3D4M A;  3HD5 A;  2HE3 A;  4POK A;  3GYK A;  1BX9 A;  4BWS A;  3KP9 A;  5ECS A;  4BA7 A;  19GS A;  2H0I A;  2F8A A;  1ZL9 A;  2MZC A;  5CAX A;  1USB A;  5D93 A;  3G7I A;  1B8X A;  4V2L A;  1TK8 B;  12GS A;  1ERV A;  4X0X A;  5DBQ A;  3DIE A;  2C3Q A;  2AHE A;  3RAZ A;  2WJU A;  2HQT A;  4F9Z A;  1GSF A;  2H1G A;  5D9T A;  3GNJ A;  1JZR A;  3IRA A;  4WXT A;  2LJR A;  1S3A A;  3UAR A;  2LJK A;  4HS1 A;  4BL7 A;  3CSH A;  3KCM A;  5LNK e;  2L6D A;  5DAK A;  2H1D A;  2GLR A;  4EDY A;  5GAP D;  1DE2 A;  1VGL A;  5DAL B;  3D21 A;  2XBQ A;  5IO0 A;  2H01 A;  3A2X A;  5B8A A;  1XVQ A;  2CVK A;  3F6F A;  2P31 A;  2OE1 A;  2GTU A;  4NHZ A;  1LBK A;  2LQQ A;  2L6C A;  4E8H A;  3FZ5 A;  3GTU A;  1FHE A;  4ZL7 A;  2HSN B;  3PR8 A;  2DIZ A;  4PQ1 A;  2GS3 A;  1A2J A;  1AC1 A;  5F05 A;  3GFK A;  3E0U A;  1V2A A;  1XWK A;  4RQX A;  4NWY A;  5JWR B;  3UAP A;  3UBK A;  2N5F A;  20GS A;  2QKE A;  4G0I A;  3CXG A;  4YQV A;  4MF7 A;  1K0M A;  3G7Y A;  2MBS A;  2FWH A;  1EGO A;  2KHP A;  1EEJ A;  1YZX A;  1H75 A;  2V2G A;  8GSS A;  6GSW A;  6GSV A;  3KXO A;  1AQX A;  5KN2 A;  3HHV A;  4I6X A;  4RI7 A;  4GQF A;  2MYG A;  5EVO A;  1XZO A;  1UVZ A;  4FYC A;  1SL0 B;  13GS A;  2KP2 A;  2H71 A;  2YJ7 A;  2VM2 A;  5IPH A;  3DVX A;  3QD9 A;  4MMM A;  4Q5R A;  4N30 A;  2AJQ B;  1GLP A;  3EWL A;  3GKM A;  1RK4 A;  4O92 A;  2K9F A;  3ME7 A;  3APO A;  4LL4 B;  1VF2 A;  5J9B A;  2E2G A;  3O76 A;  2JZT A;  3ZIJ A;  4L5O A;  4KAE A;  4FYU A;  1G7O A;  3IAM 2;  2HZF A;  4HI7 A;  1FW1 A;  2HSH A;  3KTB A;  4PNF A;  2B1L A;  2RM6 A;  2V41 A;  4V1A p;  4KCE A;  1MD4 A;  5D96 A;  4ZL9 A;  22GS A;  1ACV A;  3QR6 A;  2F3M A;  1QQ2 A;  3H79 A;  4EF0 A;  4HJ2 A;  2GQK A;  3GUR A;  3ERF A;  5CYY A;  1TJD A;  3LSZ A;  1Q98 A;  1GSE A;  2FWG A;  2WZ9 A;  1E2Y A;  2DSA A;  3DRN A;  3FEU A;  2OAD A;  1G7E A;  4RI6 A;  3BCK A;  1TOF A;  4CDO A;  2C1Y A;  1VF4 A;  1GWC A;  4WBR D;  1ERW A;  4EDZ A;  4HOJ A;  2VCZ A;  3QAW A;  3C73 A;  4WF4 A;  3HYP A;  3ZLP A;  3H1N A;  1T1V A;  2GDR A;  2VCW A;  5J5N A;  2EIQ A;  3ZIT A;  3HZ4 A;  1GP1 A;  2GQM A;  1PKW A;  4PQI A;  3LQ7 A;  3FZ9 A;  2WFC A;  2YPM A;  3KZQ A;  4NV5 A;  9GSS A;  3RPN A;  1T8E B;  3A5W A;  4NXI A;  2YWO A;  1XIY A;  5CRH A;  2LUS A;  2G2Q A;  4IGJ A;  5JCG A;  5E4W A;  2HRF A;  1O6J A;  5D9W A;  5HR2 A;  4K7I A;  2B3S A;  4G10 A;  4L0U A;  3CTG A;  2H8L A;  3MSZ A;  3WGX A;  2R4V A;  4L8E A;  1EGR A;  2PVQ A;  2LV3 A;  4NV2 A;  4DVC A;  2TRX A;  2REM A;  4IEL A;  2ES7 A;  2FWE A;  3VPT A;  1MDK A;  2MMO A;  3J7Y k;  4K0G A;  1F37 A;  3UJ1 A;  1HNB A;  4MZW A;  4G19 A;  2VAF A;  5H5S A;  5B6N A;  1PN9 A;  1JLW A;  4IP6 A;  3CSJ A;  3H8Q A;  3IPZ A;  4N11 A;  4ZB8 A;  4KH7 A;  5ELG A;  3ZFB A;  4X1U A;  4L0W A;  1V98 A;  2FWF A;  1SKR B;  4POB A;  3Q18 A;  2VLV A;  2CZ3 A;  2FY6 A;  1M2A A;  2OJL A;  1WWJ A;  3D4T A;  1VF3 A;  4X43 A;  3GV1 A;  2B7J A;  4ACS A;  5ECO B;  1KBN A;  1U3A A;  4ULX A;  2HNL A;  2HZE A;  2I1U A;  1TU7 A;  3I69 A;  1NHO A;  2IMK A;  4HDE A;  3EC3 A;  2O89 A;  4GSN A;  3SBC A;  2VO4 A;  5G31 A;  1K3L A;  5CRW A;  3TKS E;  3ZMK A;  2VL2 A;  1U6T A;  4QL9 A;  4E8E A;  1TRS A;  1Z9H A;  2LRC A;  2M80 A;  3ISO A;  2KOK A;  3FZA A;  2UZ8 A;  2G0F A;  5D9V A;  1HYU A;  4EC0 A;  2NTO A;  1F3B A;  1BJX A;  3L9V A;  3HZ8 A;  3ZZX A;  1AQV A;  4D73 A;  4PTS A;  4JBB A;  3RDW A;  2QGV A;  2V1M A;  1J08 A;  2A2R A;  1OAZ A;  1XWC A;  3KIJ A;  3M9K A;  2QSI A;  1TTZ A;  3R2Q A;  5HQP A;  3KGK A;  1TK5 B;  3HY2 A;  3DXB A;  1XOA A;  2MBT A;  4MCU A;  1GUM A;  3N9J A;  1ZMA A;  2C0E A;  1WMJ A;  3A2W A;  1Z5Y E;  1F2E A;  2B5Y A;  3KP8 A;  1JFU A;  3P7X A;  4XRA A;  2DIY A;  3HJO A;  1SL2 B;  3GL3 A;  4GQC A;  1I5G A;  1PQN A;  2BMX A;  4WET A;  3M3M A;  2IME A;  2E0Q A;  4FO5 A;  5IPG A;  2JZS A;  5ECP B;  3LXZ A;  5G5E A;  3QAV A;  2PU9 C;  3GA4 A;  2X8C A;  2JAC A;  3UEM A;  1A23 A;  2ZCT A;  3IC8 A;  3RHB A;  2R5G A;  2LST A;  5HFG A;  2CV4 A;  4BWQ A;  2NDO A;  5GZZ B;  2JZR A;  2P0G A;  2EIO A;  4FIW A;  1EEM A;  1YY7 A;  4KUN A;  4BL7 B;  1HNA A;  4MDC A;  1LU4 A;  4ZBA A;  3BD2 A;  1SKW B;  5CNW A;  3BJ5 A;  4HU9 A;  4O7H A;  3IOS A;  1GTA A;  2P5R A;  4I8B A;  3QOU A;  1Y6E A;  3Q6O A;  3Q19 A;  3CRT A;  2HT9 A;  1MD3 A;  3GTU B;  5IMF A;  4PUR A;  3UOM A;  5ECH B;  2HXK A;  5CRD A;  3TJG A;  4WR4 A;  3PGT A;  3UMA A;  5G5F A;  5HFK A;  1OC9 B;  1UA5 A;  2LJA A;  2I4A A;  1TU8 A;  1WIK A;  5LCZ A;  3CBU A;  3IK7 A;  1SK1 A;  1YF0 A;  2YOI A;  4TR0 A;  1MDJ A;  4TKY A;  2H1A A;  5F0G A;  1EOH A;  3F6D A;  1YEX A;  1BQ7 A;  3AY8 A;  3F3R A;  5CRE A;  4OMV A;  1AXD A;  3U6V A;  4ECJ A;  1PMT A;  1F9M A;  1MDI A;  3PH9 A;  1UN2 A;  2H19 A;  4ECC A;  4ZIJ A;  1XFL A;  4TN8 A;  3HVS A;  2DJK A;  3UIW A;  1XVW A;  5CRG A;  5ECN B;  2BJX A;  1GL8 A;  5IOX A;  3N5O A;  4RUV A;  4XIH A;  4JE1 A;  4EE0 A;  4USS A;  3CTF A;  3IBH A;  1XCC A;  3I6A A;  2H70 A;  4J56 E;  1PSQ A;  3DEX A;  1K0C A;  5AGY A;  1NHY A;  3A3T A;  4XRD A;  1SYR A;  2YN1 A;  4AJ7 A;  3K8N A;  5IM9 A;  3F3Q A;  1QFN A;  1ZGN A;  3TJB A;  1A2M A;  4EKZ A;  1XW5 A;  4DSQ A;  2VL2 C;  2X64 A;  6GSS A;  4K6X A;  1G6W A;  2CQ9 A;  4OFN A;  1GSQ A;  1U88 A;  3ZIV A;  3WT1 A;  1DUG A;  3VWV A;  1I9D A;  4WF5 A;  1B4Q A;  3VK9 A;  6GST A;  1XBS A;  3NZN A;  2R3X A;  1YKC A;  2R2J A;  1DBY A;  2HRN A;  3SWL A;  3D5J A;  4G9H A;  2LQO A;  4MLY A;  5G30 A;  1R4W A;  4MJE A;  3C1R A;  4GWR A;  4OFT A;  3QDN A;  3BBY A;  5J41 A;  3FYG A;  2H75 A;  1QMV A;  5A5K A;  2OBK A;  1XWA A;  2WRT A;  1BG5 A;  1SK2 A;  3RBT A;  2PER A;  5ECQ B;  1A8L A;  4N0V A;  4F2I A;  2PGT A;  5KN0 A;  1MEK A;  4HJM A;  3ME8 A;  1JZW A;  4MJB A;  5GST A;  1NM3 A;  1T00 A;  4EUY A;  1AW9 A;  1ERT A;  1ON4 A;  4N0Z A;  2J23 A;  2H74 A;  1U87 A;  3JCM L;  5AN1 A;  1OC9 A;  4IJI A;  2I81 A;  3LG6 A;  4POL A;  1TRW A;  1JZO A;  2FGX A;  4ZXG A;  1V57 A;  5EPF A;  4MAB A;  2FCH A;  5DDL A;  2VM1 A;  3EU3 A;  2DJJ A;  1G6Y A;  4PNG A;  2H1B A;  3IDV A;  2LRT A;  1GSD A;  2AB6 A;  4BPY A;  2JSY A;  2N5A A;  2N5B A;  4ISD A;  2H0G A;  4F82 A;  2KLX A;  2YZH A;  3IA1 A;  1KNG A;  1SL1 B;  2RII A;  2C0F A;  4TW5 A;  4NMU A;  2M72 A;  4NAX A;  3P8W A;  3TJJ A;  5FHI A;  1AAZ A;  3G7J A;  2P5Q A;  3VUR A;  4MZC A;  2JL4 A;  3ZL5 A;  2HZE B;  2L59 A;  2M46 A;  1PKZ A;  2CVB A;  4MJC A;  4LLR A;  4EVM A;  3L4N A;  3A2V A;  4I97 A;  3WGD A;  1SD9 A;  1GSU A;  2LRN A;  3D22 A;  1NSW A;  2FLS A;  3G9B A;  4NHW A;  4HQZ A;  4OD7 A;  5KN3 A;  3RPP A;  3UBL A;  2AAW A;  3R3E A;  4TRX A;  1GSS A;  3LOR A;  4N10 A;  3CSI A;  4V1A g;  4D73 B;  2HI7 A;  4KCA A;  5ENU A;  2MMA A;  1ML6 A;  3GN3 A;  1OKD A;  1FOV A;  4KDY A;  2JAD A;  1TKD B;  3TDG A;  3VI5 A;  2CA8 A;  6GSX A;  3DWV A;  3GKK A;  1XWB A;  2WGR A;  2F51 A;  2Z9S A;  2YZU A;  5DQS A;  1XXU A;  3IXR A;  3M9J A;  3ZML A;  3D6I A;  4WEY A;  2LEG A;  2V6K A;  1IYI A;  4ECI A;  3FKF A;  1KTE A;  3KTL A;  2XHF A;  3GL5 A;  4F03 A;  3Q74 A;  2H6X A;  3CRU A;  5IIZ A;  3APQ A;  4KB3 A;  1M2D A;  2NVL A;  1M2B A;  3TKR A;  3MWH A;  5HFI A;  5AIS A;  4XCS A;  2GVP A;  1C72 A;  1R5A A;  5H5R A;  3WYW A;  2DJ2 A;  4ZBB A;  2WS2 A;  4GSS A;  2K6V A;  2TIR A;  1B9Y C;  4POM A;  5ECK B;  4KGI A;  4MK3 A;  4GRF A;  2VD1 A;  3GMF A;  3P2A A;  1PX6 A;  3I43 A;  2C0D A;  2H0H A;  4PGT A;  4G2E A;  1AIU A;  3FR9 A;  2VOC A;  1O73 A;  4FQU A;  1QGV A;  4HEA 2;  5G1K A;  2LNS A;  3UVT A;  4FH8 A;  1EWX A;  2GST A;  2AYT A;  1EP8 A;  1ZOF A;  1B4P A;  1RW1 A;  2H6Y A;  3LEF A;  1TRU A;  1MTC A;  4YH2 A;  2X99 A;  3TB2 A;  3ED3 A;  1SKS B;  4KDX A;  2GGT A;  5IMV A;  3KMO A;  1TW9 A;  1GTU A;  4KDU A;  3HJP A;  4MZB A;  1K0O A;  4GCI A;  2HRK A;  3ERG A;  4OWY A;  2FHE A;  2HYX A;  4WKW A;  3C71 A;  3U5R E;  3IC4 A;  2EC4 A;  2YAN A;  2MMZ A;  3DGQ A;  2GQL A;  4LMW A;  3M8N A;  3IR4 A;  2HSY A;  4EO3 A;  4PUF C;  4ZL8 A;  2X8G A;  1AQW A;  4MPF A;  3ZTL A;  2V32 A;  3FK8 A;  2FUG 2;  2HSM B;  2GSQ A;  1TXX A;  2HFD A;  2VUP A;  4IQA A;  5INY A;  4IS0 A;  4ML6 A;  2NBS A;  4PXO A;  2B5X A;  2L57 A;  4KA0 A;  4KF9 A;  5A4U A;  2H76 A;  4CW9 A;  2TRC P;  1ZCP A;  3EVI A;  2YV9 A;  5FT3 A;  2H66 A;  1FB6 A;  4OO5 A;  2C80 A;  1XWG A;  1N8J A;  16GS A;  3WD6 A;  1X5E A;  2CX3 A;  3GX8 A;  2GT6 A;  4G0L A;  1M0U A;  3QPM A;  1X9M B;  1GRX A;  4CHS A;  4ZB9 A;  1OVN A;  1O85 A;  3HDC A;  2F8F A;  3EIN A;  1EZK A;  1K0D A;  2XPD A;  4QQ7 A;  4YAV A;  1GUK A;  3EU4 A;  4LA1 A;  3TRP A;  7GSS A;  2DML A;  5ECL B;  2CAI A;  2DLX A;  4IQ1 A;  3O3T A;  3C1S A;  1PL1 A;  1GTI A;  5IMA A;  6GSU A;  1ST9 A;  3QAG A;  3DML A;  1GSY A;  2L5O A;  4ZBD A;  3HCZ A;  3DYR A;  1BED A;  4O5R A;  5F07 A;  2LTK A;  3WT2 A;  1M99 A;  4KX4 A;  1OC3 A;  3TJF A;  3EMP A;  4I2U A;  3VWU A;  3PIN A;  2YNX A;  3IHQ A;  5B8B A;  1A0R P;  4GLT A;  2YCD A;  1GNE A;  5DJM A;  1A0F A;  3IAS 2;  4TR3 A;  1U3I A;  4XS1 A;  4TR1 B;  4DSR A;  1T7P B;  3GX0 A;  3L0H A;  2V6O A;  2FD3 A;  3TKP A;  3P90 A;  3H93 A;  1PA3 A;  4MF5 A;  4KND A;  4OCE A;  1BAY A;  3F8U A;  5B7C A;  4JRR A;  4JR4 A;  5ABR A;  4AJ6 A;  1TI1 A;  3LWA A;  1OE7 A;  2RM5 A;  4G0K A;  1YJ6 A;  3DVW A;  2IL3 A;  5A4V A;  3CYN A;  4MJA A;  1BYE A;  1PRX A;  1YDK A;  1WJK A;  4JR6 A;  3VLN A;  1XW6 A;  1HD2 A;  2HSM A;  5L71 A;  5CP1 A;  2WCI A;  2IIY A;  1E6B A;  4XHM A;  5DVB A;  2H6Z A;  1NW2 A;  3TJK A;  3L78 A;  2VCQ A;  2ON5 A;  2C3T A;  5COH A;  4OFM A;  4IBP A;  4IN0 A;  4DSS B;  2RUF A;  3M0F A;  3TCO A;  3ZRE A;  3LYP A;  2E7P A;  3VWX A;  4HZ2 A;  3RHC A;  3PPU A;  1ZZY A;  4ZIL A;  1DSB A;  3VWW A;  2PUK C;  5CO3 A;  2VL3 A;  3EYT A;  2PWJ A;  1YF1 A;  1K3Y A;  1X5D A;  4K2D A;  5ELA A;  2KUC A;  1ERU A;  1Y25 A;  1THX A;  1W89 A;  5G2Z A;  3TRX A;  2VIM A;  3MDK A;  2ZNM A;  3V1W A;  4IJ3 A;  2H73 A;  2JSZ A;  3GH9 A;  3KEB A;  4MF6 A;  1O8W A;  4TXO A;  17GS A;  2A4V A;  2CAQ A;  1A2L A;  2IN3 A;  2PVO C;  4ZB6 A;  5KN1 A;  4I2T A;  5ID2 A;  2IFQ B;  3TGZ A;  1F3A A;  2CX4 A;  1EV9 A;  2KP1 A;  3ZYW A;  1A24 A;  5JCW A;  2XBI A;  2H30 A;  3ZRD A;  2I9H A;  2I3Y A;  1B9X C;  2VCT A;  3FZ4 A;  3EE2 A;  1K3O A;  1Z6M A;  4IP1 A;  4J57 E;  2O85 A;  4P3Y B;  1R26 A;  4LMV A;  2EIR A;  2D2Z A;  3GKN A;  3ZFL A;  4BVY A;  4Q5N A;  3ERW A;  4MA9 A;  3I9V 2;  4TR1 A;  1N2A A;  5B6M A;  1SK0 A;  2K18 A;  1V40 A;  5F8B A;  2PPT A;  3TKS C;  1O7U A;  1WPI A;  4PX1 A;  5C04 A;  3FRC A;  4F0C A;  3DKS A;  2DJ0 A;  2IMD A;  3HVV A;  4ID0 A;  4BVX B;  5BMU A;  1DE1 A;  2IPA A;  2CZ2 A;  2OBI A;  1H4O A;  3FY7 A;  2L4Q A;  2B6M A;  2VL9 A;  4V2M A;  3EMX A;  2JU5 A;  4MH3 A;  5H5Q A;  1PL2 A;  3GHA A;  1YEP A;  5IO2 A;  3OR5 A;  2RLI A;  2PMT A;  1S3D A;  2QC7 A;  1VRS D;  4TR4 A;  1EOG A;  5J3R A;  4ECB A;  2OE0 A;  3DD3 A;  1J0F A;  2YWM A;  4HU7 A;  1XW9 A;  3LYK A;  3D0Z A;  2OAC A;  2HRK B;  1IYH A;  1URM A;  2O7K A;  4XS6 A;  3QFA C;  2GSR A;  4PQH A;  1X0R A;  2B5E A;  1QXH A;  3VI7 A;  4DSS A;  3UL3 A;  1TK0 B;  1SYX A;  3F4T A;  2X8H A;  3GIX A;  1FAA A;  4H86 A;  4QL7 A;  1M9B A;  5AIV A;  1PX7 A;  3GH6 A;  4EL1 A;  3GUS A;  2L5L A;  1ZYE A;  1WRY A;  1J9B A;  2B1K A;  5AIX A;  1Z3E A;  4EXJ A;  1ABA A;  2E2M A;  1GUH A;  4Z7X A;  4MPG A;  2PN8 A;  1SU9 A;  2VLU A;  2CT6 A;  11GS A;  3QFB C;  5D8I A;  2XPE A;  4GXZ A;  2C3N A;  4KSM A;  2IFQ A;  5ECR B;  1OKT A;  1FG4 A;  3APS A;  2FNO A;  1SD8 A;  1HNC A;  1CQG A;  1WE0 A;  4TOP A;  2LKU A;  1Z7P A;  3C7M A;  5DAL A;  4RQR A;  4V2N A;  4WBJ A;  4XS4 B;  5HR3 A;  1LJR A;  1K0A A;  1M7T A;  1O8X A;  1SJZ A;  1XOB A;  5JWO B;  1JZD A;  2ZUP A;  18GS A;  3E9J B;  1X9W B;  3LGC A;  3IK9 A;  3NIV A;  4XTS A;  3MNG A;  3CMI A;  4IHU A;  2VCX A;  5ECI B;  2VLT A;  4JZQ A;  4AJ8 A;  1OC8 A;  2O87 A;  2YWI A;  2L4C A;  1JLV A;  2K8S A;  1KEB A;  5DCG A;  5G1L A;  2NPB A;  2OA7 A;  4K7O A;  4OO4 A;  4BVX A;  3GST A;  4AGS A;  14GS A;  3IV4 A;  2WB9 A;  2ON7 A;  3BCI A;  5A4W A;  5IMZ A;  2MMN A;  4O32 A;  2C8U A;  1V58 A;  4WR5 A;  2AUV A;  1GNW A;  2C4J A;  3W6G A;  3KH7 A;  5JCU A;  1M9A A;  4ILF A;  1YQ1 A;  1SJ6 A;  4HUA A;  1EP7 A;  3F4R A;  1S3C A;  2DBC A;  3TRQ A;  4PUA A;  1O81 A;  2GZP A;  4L5L A;  1K0B A;  2DJ3 A;  3TOU A;  5IQY A;  2J9H A;  4GF0 A;  1YKA A;  1X9S B;  3F9U A;  3QCP A;  3ZVJ A;  3NOF A;  2CVD A;  1T3B A;  3J7Y b; 
#chains in the Genus database with same CATH topology
 2XC2 A;  2A2S A;  2PBJ A;  5GAN D;  3IE3 A;  3HJM A;  2WVY A;  3GSS A;  3LXT A;  4YQU A;  2WUL A;  2IJY A;  5J4V A;  2IMI A;  1F6M C;  4AKX B;  5D9X A;  3F63 A;  2O8V B;  1GUL A;  4JED A;  2FA8 A;  2OKA A;  4GTU A;  3BOA A;  1VF1 A;  4ML1 A;  5DCH A;  2IWT A;  4I5Q A;  5KEJ A;  5HR0 A;  1CQH A;  3F0I A;  4IVF A;  6GSY A;  5ECM B;  2DC5 A;  1X5C A;  2VCV A;  5F06 A;  2HRA A;  2VD0 A;  5IMD A;  5KOX A;  2YJH A;  3LFL A;  2RUE A;  2FA4 A;  4XS4 A;  3HXS A;  5IMC A;  3KM6 A;  3ZVJ D;  2GSS A;  2GZY A;  4K2X A;  3FW2 A;  1PD2 1;  3KD0 A;  2GZZ A;  1R5P A;  3TKS A;  2B7K A;  2GT5 A;  4TXO B;  1EV4 A;  5LD0 A;  2LNT A;  2BTO T;  5J4U A;  3HVX A;  10GS A;  3LJR A;  1FO5 A;  4HQS A;  1UC7 A;  4JU5 A;  5ID2 B;  4HZ4 A;  4IW9 A;  4YQM A;  5IOW A;  4IKH A;  5KOW A;  2HLS A;  3O6T A;  1T4Z A;  1PGT A;  5E59 A;  3W8J A;  3TUE A;  2YV7 A;  4Q5Q A;  1OE8 A;  3WGE A;  1Z6N A;  3VFI A;  4TXV A;  3H4K A;  3US3 A;  5DAK B;  3L9S A;  1TDI A;  4J2F A;  4LL1 B;  5J9C A;  2YWN A;  3S9F A;  4YAP A;  3GRX A;  1ILO A;  5D73 A;  4FYB A;  4OCF A;  2OE3 A;  4K9Z A;  2DJ1 A;  3KJY A;  1WP0 A;  4GST A;  1A8Y A;  2X4A A;  4BVY B;  2WDU A;  2LS5 A;  2YP6 A;  1TRV A;  4MH2 A;  5C00 A;  3VPQ A;  4F0B A;  1FB0 A;  3MAK A;  3QMX A;  5EL8 A;  1Q4J A;  2K8V A;  2R6K A;  1XPV A;  2AV4 A;  3TOT A;  4NPB A;  1GLQ A;  2EFE A;  1GH2 A;  5GSS A;  4Q5F A;  5DQY A;  3GKX A;  5JWQ B;  1Z7R A;  4KE3 A;  1QK8 A;  3C8E A;  4AF2 A;  1B48 A;  1W4V A;  4MP4 A;  2H72 A;  2IMF A;  2F9S A;  1SJI A;  4DEJ A;  5A1N B;  5HR1 A;  2EFD A;  5BMU B;  3TKQ A;  1K0N A;  4K7N A;  1HQO A;  3W8S A;  1QUW A;  3F4S A;  3E3E A;  1OYJ A;  1AUC A;  3KMN A;  4KSO A;  3M1G A;  1G0T A;  3TU3 B;  1THO A;  3FR3 A;  3KH9 A;  4K1F A;  1JHB A;  3HA9 A;  3FR6 A;  1RQM A;  1V9W A;  4K8M A;  4CY6 A;  3L9U A;  1ZYQ B;  2DMM A;  1TI3 A;  1R7H A;  1SVM A;  1SEN A;  4KW6 A;  4K0N A;  1TP9 A;  3EUR A;  4TVE A;  5DJL A;  5FWG A;  3UVH A;  5EY6 A;  1WOU A;  3FHK A;  1FVK A;  1GTB A;  1T4Y A;  2C0G A;  2ALB A;  1FVJ A;  3HKR A;  2R37 A;  3D4M A;  3HD5 A;  2HE3 A;  4POK A;  3GYK A;  1BX9 A;  4BWS A;  3KP9 A;  5ECS A;  4BA7 A;  19GS A;  2H0I A;  2F8A A;  1ZL9 A;  1I1I P;  2MZC A;  5CAX A;  1USB A;  5D93 A;  4GDF A;  3G7I A;  1B8X A;  4V2L A;  1TK8 B;  12GS A;  1ERV A;  4X0X A;  2O5V A;  5DBQ A;  5A5H B;  3DIE A;  2C3Q A;  2AHE A;  3RAZ A;  2WJU A;  2HQT A;  4F9Z A;  1GSF A;  2H1G A;  5D9T A;  3GNJ A;  2DKH A;  1JZR A;  3IRA A;  4WXT A;  2LJR A;  1S3A A;  3UAR A;  2LJK A;  4HS1 A;  2WVZ A;  4BL7 A;  3CSH A;  3KCM A;  5LNK e;  4A5P A;  2UV8 G;  5DAK A;  2H1D A;  2L6D A;  2GLR A;  4EDY A;  5GAP D;  2WVX B;  1DE2 A;  1VGL A;  5DAL B;  3D21 A;  2XBQ A;  5IO0 A;  2H01 A;  3A2X A;  5B8A A;  1XVQ A;  2CVK A;  3F6F A;  4BIK A;  2P31 A;  2OE1 A;  2GTU A;  4NHZ A;  1LBK A;  2LQQ A;  2L6C A;  4E8H A;  3FZ5 A;  3GTU A;  1FHE A;  4ZL7 A;  2HSN B;  4ICY A;  3PR8 A;  2DIZ A;  5J47 A;  4PQ1 A;  2GS3 A;  4K5R A;  1A2J A;  1AC1 A;  5F05 A;  3GFK A;  3E0U A;  1V2A A;  1XWK A;  4RQX A;  4NWY A;  5JWR B;  3UAP A;  3UBK A;  2N5F A;  20GS A;  2QKE A;  4G0I A;  3CXG A;  2WW1 A;  4YQV A;  4MF7 A;  1K0M A;  3G7Y A;  2MBS A;  2FWH A;  1EGO A;  2KHP A;  4Z2U A;  1EEJ A;  1YZX A;  1H75 A;  2V2G A;  8GSS A;  6GSW A;  6GSV A;  3KXO A;  1AQX A;  5KN2 A;  3HHV A;  4I6X A;  4RI7 A;  4GQF A;  2MYG A;  5EVO A;  1XZO A;  1UVZ A;  4FYC A;  1SL0 B;  13GS A;  2KP2 A;  2H71 A;  2YJ7 A;  2VM2 A;  5IPH A;  3DVX A;  3QD9 A;  4MMM A;  4Q5R A;  4N30 A;  2AJQ B;  1GLP A;  3EWL A;  3GKM A;  1RK4 A;  4O92 A;  2K9F A;  3ME7 A;  3APO A;  4LL4 B;  1VF2 A;  5J9B A;  1S3R A;  2E2G A;  3O76 A;  2JZT A;  3ZIJ A;  4L5O A;  4KAE A;  4FYU A;  1G7O A;  3IAM 2;  2HZF A;  4HI7 A;  1FW1 A;  2HSH A;  3KTB A;  4PNF A;  2B1L A;  2RM6 A;  2V41 A;  4V1A p;  4KCE A;  1MD4 A;  5D96 A;  4ZL9 A;  22GS A;  1ACV A;  3QR6 A;  2F3M A;  4PI0 C;  1QQ2 A;  3H79 A;  4EF0 A;  4HJ2 A;  2GQK A;  3GUR A;  5A5H A;  3ERF A;  5CYY A;  1TJD A;  2R0C A;  3LSZ A;  1Q98 A;  1GSE A;  2FWG A;  2WZ9 A;  1E2Y A;  4FXY P;  2DSA A;  3DRN A;  3FEU A;  2OAD A;  1G7E A;  4RI6 A;  3BCK A;  1TOF A;  4CDO A;  2C1Y A;  1VF4 A;  5J4Y A;  1GWC A;  4WBR D;  1ERW A;  4EDZ A;  4HOJ A;  2VCZ A;  3CHX C;  3QAW A;  3C73 A;  4WF4 A;  2X49 A;  3HYP A;  3ZLP A;  3H1N A;  1T1V A;  2GDR A;  2VCW A;  5J5N A;  2EIQ A;  3ZIT A;  3HZ4 A;  1GP1 A;  2GQM A;  1PKW A;  4PQI A;  3LQ7 A;  3FZ9 A;  2WFC A;  2YPM A;  3KZQ A;  4NV5 A;  9GSS A;  3RPN A;  1T8E B;  3A5W A;  4NXI A;  2YWO A;  1XIY A;  5CRH A;  2LUS A;  2G2Q A;  4IGJ A;  5JCG A;  5E4W A;  2HRF A;  1O6J A;  5D9W A;  5HR2 A;  2WZS A;  4K7I A;  2B3S A;  4G10 A;  4L0U A;  3CTG A;  2H8L A;  3MSZ A;  3WGX A;  2R4V A;  4L8E A;  1EGR A;  2WW2 A;  2PVQ A;  2LV3 A;  4NV2 A;  4DVC A;  2TRX A;  2REM A;  4IEL A;  2ES7 A;  2FWE A;  3VPT A;  1MDK A;  2MMO A;  1M3J A;  3J7Y k;  4K0G A;  1F37 A;  3UJ1 A;  4W66 A;  1HNB A;  4MZW A;  4G19 A;  2VAF A;  5H5S A;  5B6N A;  1PN9 A;  1JLW A;  3CSJ A;  4IP6 A;  3H8Q A;  3IPZ A;  4N11 A;  4ZB8 A;  4KH7 A;  5ELG A;  3IHG A;  3ZFB A;  4X1U A;  4L0W A;  1V98 A;  2FWF A;  1SKR B;  4POB A;  3Q18 A;  2VLV A;  1M3I A;  2CZ3 A;  2FY6 A;  1M2A A;  4AKI A;  2OJL A;  1WWJ A;  3D4T A;  1VF3 A;  4X43 A;  3GV1 A;  2B7J A;  4ACS A;  5ECO B;  1KBN A;  1U3A A;  4ULX A;  3MYD A;  2HNL A;  2HZE A;  2I1U A;  1TU7 A;  3I69 A;  1NHO A;  2IMK A;  4N3Z A;  4HDE A;  3EC3 A;  4CY8 A;  2O89 A;  4GSN A;  4YKF A;  3SBC A;  2VO4 A;  5G31 A;  1K3L A;  5CRW A;  3TKS E;  3ZMK A;  2VL2 A;  1U6T A;  4QL9 A;  4E8E A;  1TRS A;  1Z9H A;  2LRC A;  2M80 A;  3ISO A;  2KOK A;  3FZA A;  2UZ8 A;  2G0F A;  5D9V A;  1HYU A;  4EC0 A;  2NTO A;  1F3B A;  1BJX A;  3L9V A;  3HZ8 A;  3ZZX A;  3RFR C;  1AQV A;  4D73 A;  5J40 A;  4PTS A;  1PFO A;  4JBB A;  3RDW A;  3CQF A;  2QGV A;  2V1M A;  1J08 A;  2A2R A;  1OAZ A;  1TXU A;  1XWC A;  3KIJ A;  3M9K A;  2QSI A;  1TTZ A;  3R2Q A;  5HQP A;  3KGK A;  1TK5 B;  3HY2 A;  3DXB A;  1XOA A;  2MBT A;  4MCU A;  1GUM A;  3N9J A;  1ZMA A;  2C0E A;  1WMJ A;  3A2W A;  1Z5Y E;  1F2E A;  2B5Y A;  3KP8 A;  1JFU A;  3P7X A;  4XRA A;  2DIY A;  3HJO A;  1SL2 B;  3GL3 A;  4GQC A;  1I5G A;  1PQN A;  2BMX A;  4WET A;  3M3M A;  2IME A;  2E0Q A;  4FO5 A;  5IPG A;  2JZS A;  5ECP B;  3LXZ A;  5G5E A;  3QAV A;  2PU9 C;  3GA4 A;  2X8C A;  2JAC A;  3UEM A;  1A23 A;  2ZCT A;  5A34 B;  2WW0 A;  2R0G A;  3IC8 A;  3RHB A;  2R5G A;  2LST A;  5HFG A;  2CV4 A;  4BWQ A;  2NDO A;  5GZZ B;  2JZR A;  2P0G A;  2EIO A;  4FIW A;  1EEM A;  1YY7 A;  4KUN A;  4BL7 B;  2QA2 A;  4K5S A;  1HNA A;  4MDC A;  1LU4 A;  4ZBA A;  3BD2 A;  1Y1U A;  1SKW B;  5CNW A;  3BJ5 A;  4HU9 A;  4O7H A;  3IOS A;  1GTA A;  2P5R A;  4I8B A;  3QOU A;  1Y6E A;  3Q6O A;  3Q19 A;  3CRT A;  2HT9 A;  2R0P A;  1MD3 A;  3GTU B;  5IMF A;  4PUR A;  3UOM A;  3CWG A;  5ECH B;  2HXK A;  5CRD A;  3TJG A;  4WR4 A;  3PGT A;  3UMA A;  5G5F A;  5HFK A;  1OC9 B;  3A5I A;  1UA5 A;  2LJA A;  2I4A A;  3LW9 A;  1TU8 A;  1WIK A;  5LCZ A;  3CBU A;  3IK7 A;  1SK1 A;  1YF0 A;  2YOI A;  4TR0 A;  1MDJ A;  4TKY A;  2H1A A;  5F0G A;  1EOH A;  3F6D A;  1YEX A;  1BQ7 A;  3AY8 A;  3F3R A;  1SVL A;  5CRE A;  4OMV A;  1AXD A;  3U6V A;  4ECJ A;  1PMT A;  1F9M A;  1MDI A;  3PH9 A;  1UN2 A;  2H19 A;  4ECC A;  4ZIJ A;  1XFL A;  4TN8 A;  3HVS A;  2DJK A;  3UIW A;  1XVW A;  5CRG A;  5ECN B;  2BJX A;  1GL8 A;  5IOX A;  3N5O A;  3FMW A;  4RUV A;  4XIH A;  4JE1 A;  4EE0 A;  4USS A;  3CTF A;  3IBH A;  1XCC A;  3I6A A;  2H70 A;  4J56 E;  1PSQ A;  3DEX A;  1K0C A;  5AGY A;  1NHY A;  3A3T A;  4XRD A;  1SYR A;  2YN1 A;  4AJ7 A;  4AI6 A;  1FOH A;  3K8N A;  5IM9 A;  3F3Q A;  1QFN A;  1ZGN A;  3TJB A;  1A2M A;  4EKZ A;  1XW5 A;  4DSQ A;  2VL2 C;  2X64 A;  6GSS A;  4K6X A;  1G6W A;  2CQ9 A;  4OFN A;  1GSQ A;  1U88 A;  3ZIV A;  3WT1 A;  5A34 A;  1DUG A;  3VWV A;  1I9D A;  4WF5 A;  1B4Q A;  3VK9 A;  6GST A;  1XBS A;  3NZN A;  2R3X A;  1YKC A;  2R2J A;  1DBY A;  2HRN A;  3SWL A;  3D5J A;  4G9H A;  2LQO A;  4MLY A;  5G30 A;  1R4W A;  4MJE A;  5BRT A;  4O5U A;  3C1R A;  4GWR A;  4OFT A;  3QDN A;  3BBY A;  5J41 A;  3FYG A;  2H75 A;  1QMV A;  5A5K A;  2OBK A;  1XWA A;  2WRT A;  1BG5 A;  1SK2 A;  3RBT A;  2PER A;  5ECQ B;  1A8L A;  4N0V A;  4F2I A;  2PGT A;  5KN0 A;  1MEK A;  4HJM A;  3ME8 A;  1JZW A;  4MJB A;  5GST A;  1NM3 A;  1T00 A;  4EUY A;  1AW9 A;  1ERT A;  1ON4 A;  3HVN A;  2J23 A;  2H74 A;  4N0Z A;  1U87 A;  3JCM L;  5AN1 A;  1OC9 A;  4IJI A;  4QMK A;  2I81 A;  3LG6 A;  4POL A;  1TRW A;  1JZO A;  2FGX A;  4ZXG A;  1V57 A;  5EPF A;  4MAB A;  2FCH A;  5DDL A;  2VM1 A;  3EU3 A;  2DJJ A;  1G6Y A;  4PNG A;  2H1B A;  3IDV A;  2LRT A;  1GSD A;  2AB6 A;  4BPY A;  2JSY A;  2N5A A;  2N5B A;  4ISD A;  2A2P A;  4AKH A;  2H0G A;  4F82 A;  2KLX A;  2YZH A;  1YEW C;  3IA1 A;  1KNG A;  1SL1 B;  2RII A;  2C0F A;  4TW5 A;  4NMU A;  2M72 A;  4NAX A;  3EPT A;  3P8W A;  3TJJ A;  5FHI A;  1AAZ A;  3G7J A;  2P5Q A;  3VUR A;  4MZC A;  2JL4 A;  3ZL5 A;  2HZE B;  2L59 A;  2M46 A;  2EFC A;  1PKZ A;  2CVB A;  4MJC A;  4LLR A;  4EVM A;  3L4N A;  3A2V A;  4I97 A;  3WGD A;  1SD9 A;  1GSU A;  2LRN A;  3D22 A;  1NSW A;  2FLS A;  3G9B A;  4NHW A;  4HQZ A;  2WW3 A;  4OD7 A;  1BF5 A;  5KN3 A;  3RPP A;  3UBL A;  2AAW A;  3R3E A;  4TRX A;  1GSS A;  3LOR A;  4N10 A;  3CSI A;  4V1A g;  4D73 B;  2HI7 A;  4KCA A;  5ENU A;  2MMA A;  1ML6 A;  3GN3 A;  1OKD A;  1FOV A;  4KDY A;  2JAD A;  4ZB7 A;  1TKD B;  3TDG A;  3VI5 A;  2CA8 A;  6GSX A;  3DWV A;  3GKK A;  1XWB A;  2WGR A;  2F51 A;  2Z9S A;  2YZU A;  5DQS A;  1XXU A;  3IXR A;  2O36 A;  3M9J A;  3ZML A;  2QA1 A;  3D6I A;  4WEY A;  2LEG A;  2V6K A;  1IYI A;  4ECI A;  3FKF A;  1KTE A;  3KTL A;  2XHF A;  3GL5 A;  4F03 A;  3Q74 A;  2H6X A;  3CRU A;  5IIZ A;  3APQ A;  4KB3 A;  1M2D A;  2NVL A;  1M2B A;  3TKR A;  3MWH A;  5HFI A;  5AIS A;  4XCS A;  2GVP A;  1C72 A;  1R5A A;  5H5R A;  3WYW A;  2DJ2 A;  2A4H A;  4ZBB A;  2WS2 A;  4GSS A;  2K6V A;  2TIR A;  1B9Y C;  1ZYP A;  4POM A;  5ECK B;  4KGI A;  4MK3 A;  4GRF A;  2VD1 A;  3GMF A;  3P2A A;  1PX6 A;  3I43 A;  2C0D A;  2H0H A;  4PGT A;  4G2E A;  1AIU A;  3FR9 A;  2VOC A;  1O73 A;  4FQU A;  1QGV A;  4HEA 2;  5G1K A;  2LNS A;  3UVT A;  4FH8 A;  1EWX A;  2GST A;  2AYT A;  1EP8 A;  1ZOF A;  1B4P A;  1RW1 A;  2H6Y A;  3LEF A;  1TRU A;  1MTC A;  4YH2 A;  2X99 A;  3TB2 A;  3ED3 A;  1SKS B;  4KDX A;  2GGT A;  5IMV A;  3KMO A;  4X4J A;  1TW9 A;  1GTU A;  4KDU A;  3HJP A;  4MZB A;  1K0O A;  4GCI A;  2HRK A;  3ERG A;  4OWY A;  2FHE A;  2HYX A;  4WKW A;  3C71 A;  3U5R E;  3IC4 A;  2EC4 A;  2YAN A;  2MMZ A;  3DGQ A;  2GQL A;  4LMW A;  3M8N A;  3IR4 A;  2HSY A;  4HSC X;  4EO3 A;  4PUF C;  4ZL8 A;  2X8G A;  1AQW A;  4MPF A;  3ZTL A;  2V32 A;  3FK8 A;  1YVL A;  2FUG 2;  2HSM B;  2GSQ A;  1TXX A;  2HFD A;  2VUP A;  4IQA A;  5INY A;  4IS0 A;  4ML6 A;  2NBS A;  4PXO A;  2B5X A;  2L57 A;  4KA0 A;  4KF9 A;  5A4U A;  2H76 A;  4CW9 A;  2TRC P;  1ZCP A;  3EVI A;  2YV9 A;  5FT3 A;  2H66 A;  1FB6 A;  4OO5 A;  2C80 A;  1XWG A;  1N8J A;  16GS A;  3WD6 A;  1X5E A;  2CX3 A;  3GX8 A;  2GT6 A;  4G0L A;  1M0U A;  3QPM A;  1X9M B;  1GRX A;  4CHS A;  4ZB9 A;  1OVN A;  1O85 A;  3HDC A;  2F8F A;  3EIN A;  1EZK A;  1K0D A;  2XPD A;  4QQ7 A;  4YAV A;  1GUK A;  3EU4 A;  4LA1 A;  3TRP A;  7GSS A;  2DML A;  5ECL B;  2CAI A;  2DLX A;  4IQ1 A;  3O3T A;  3C1S A;  1PL1 A;  1GTI A;  5IMA A;  6GSU A;  1ST9 A;  3QAG A;  3DML A;  1GSY A;  2L5O A;  4ZBD A;  3HCZ A;  3DYR A;  1BED A;  4O5R A;  5F07 A;  2LTK A;  1PN0 A;  2DKI A;  3WT2 A;  4EIP A;  1M99 A;  4KX4 A;  1OC3 A;  3TJF A;  3EMP A;  3MIX A;  4I2U A;  3VWU A;  3PIN A;  2YNX A;  3IHQ A;  2OT3 A;  5B8B A;  1A0R P;  4GLT A;  2YCD A;  1GNE A;  5DJM A;  1A0F A;  3IAS 2;  4TR3 A;  1U3I A;  4XS1 A;  4TR1 B;  4DSR A;  1T7P B;  3GX0 A;  3L0H A;  2V6O A;  2FD3 A;  4EIQ A;  3TKP A;  3P90 A;  3H93 A;  1PA3 A;  4MF5 A;  4KND A;  4OCE A;  1BAY A;  3F8U A;  5B7C A;  4JRR A;  4Z2T A;  4JR4 A;  5ABR A;  4AJ6 A;  1TI1 A;  3LWA A;  1OE7 A;  2RM5 A;  2VKZ G;  4G0K A;  1YJ6 A;  3DVW A;  2IL3 A;  5A4V A;  1S4B P;  3CYN A;  4MJA A;  1BYE A;  1PRX A;  1YDK A;  1WJK A;  4JR6 A;  3VLN A;  1XW6 A;  1HD2 A;  2HSM A;  5L71 A;  5CP1 A;  2WCI A;  2IIY A;  1E6B A;  4XHM A;  5DVB A;  2H6Z A;  1NW2 A;  3TJK A;  3L78 A;  2VCQ A;  2ON5 A;  2C3T A;  5COH A;  4OFM A;  4IBP A;  4IN0 A;  4AKG A;  4DSS B;  2RUF A;  3M0F A;  3TCO A;  3ZRE A;  3LYP A;  2E7P A;  2H1L A;  3VWX A;  4HZ2 A;  3RHC A;  3PPU A;  1ZZY A;  4ZIL A;  1DSB A;  3VWW A;  2PUK C;  5CO3 A;  2VL3 A;  3EYT A;  2PWJ A;  1YF1 A;  4E68 A;  1K3Y A;  1X5D A;  4K2D A;  5ELA A;  2KUC A;  1ERU A;  1Y25 A;  1THX A;  1W89 A;  5G2Z A;  3TRX A;  2VIM A;  3MDK A;  2ZNM A;  3V1W A;  4IJ3 A;  2H73 A;  2JSZ A;  3GH9 A;  3KEB A;  4MF6 A;  1O8W A;  4TXO A;  17GS A;  2A4V A;  2CAQ A;  1A2L A;  2IN3 A;  1XG8 A;  2PVO C;  4ZB6 A;  5KN1 A;  4I2T A;  4O5Q A;  5ID2 A;  2IFQ B;  3TGZ A;  1F3A A;  2CX4 A;  1EV9 A;  2KP1 A;  3ZYW A;  1A24 A;  5JCW A;  2XBI A;  2H30 A;  3ZRD A;  2I9H A;  2I3Y A;  1B9X C;  2VCT A;  3FZ4 A;  3EE2 A;  1K3O A;  1Z6M A;  3RGB C;  4IP1 A;  4J57 E;  2O85 A;  2EFH A;  4P3Y B;  1R26 A;  4LMV A;  2EIR A;  2D2Z A;  3GKN A;  3ZFL A;  4BVY A;  4Q5N A;  3ERW A;  4MA9 A;  3I9V 2;  4TR1 A;  1N2A A;  5B6M A;  1SK0 A;  2K18 A;  1V40 A;  5F8B A;  2PPT A;  3TKS C;  1O7U A;  1WPI A;  4PX1 A;  5C04 A;  3FRC A;  4F0C A;  3DKS A;  2DJ0 A;  2IMD A;  3HVV A;  4ID0 A;  5A1N A;  4BVX B;  5BMU A;  4YKG A;  1DE1 A;  2IPA A;  2CZ2 A;  2OBI A;  1H4O A;  3FY7 A;  2L4Q A;  2B6M A;  2VL9 A;  4V2M A;  3EMX A;  2JU5 A;  4MH3 A;  5H5Q A;  1PL2 A;  3GHA A;  1YEP A;  5IO2 A;  3OR5 A;  2RLI A;  2PMT A;  1S3D A;  1BG1 A;  2QC7 A;  1VRS D;  4TR4 A;  1EOG A;  5J3R A;  4ECB A;  2OE0 A;  3DD3 A;  1J0F A;  2YWM A;  4HU7 A;  1XW9 A;  3LYK A;  3D0Z A;  2OAC A;  2HRK B;  1IYH A;  1URM A;  2O7K A;  4XS6 A;  2GSR A;  4PQH A;  1X0R A;  3QFA C;  2B5E A;  1QXH A;  3VI7 A;  4DSS A;  3UL3 A;  1TK0 B;  1SYX A;  3F4T A;  2X8H A;  3GIX A;  4G01 A;  1FAA A;  4H86 A;  4QL7 A;  1M9B A;  5AIV A;  1PX7 A;  3GH6 A;  4EL1 A;  3GUS A;  2L5L A;  1ZYE A;  1WRY A;  1J9B A;  2B1K A;  5AIX A;  1Z3E A;  4EXJ A;  1ABA A;  2E2M A;  1GUH A;  4Z7X A;  4MPG A;  2PN8 A;  1SU9 A;  2VLU A;  2CT6 A;  11GS A;  3QFB C;  5D8I A;  2XPE A;  4GXZ A;  2C3N A;  4KSM A;  2IFQ A;  5ECR B;  1OKT A;  1FG4 A;  3APS A;  2FNO A;  1SD8 A;  1HNC A;  1CQG A;  1WE0 A;  4TOP A;  2WVX A;  2LKU A;  1Z7P A;  3C7M A;  5DAL A;  4RQR A;  4V2N A;  4WBJ A;  4XS4 B;  5HR3 A;  1LJR A;  1K0A A;  1M7T A;  1O8X A;  1SJZ A;  1XOB A;  5JWO B;  1JZD A;  2ZUP A;  18GS A;  3E9J B;  1X9W B;  3LGC A;  3IK9 A;  3NIV A;  4XTS A;  3MNG A;  2HSN A;  3CMI A;  4IHU A;  2VCX A;  5ECI B;  2VLT A;  4JZQ A;  4AJ8 A;  1OC8 A;  2O87 A;  2YWI A;  2L4C A;  1JLV A;  2K8S A;  1KEB A;  5DCG A;  5G1L A;  2NPB A;  2OA7 A;  4K7O A;  4OO4 A;  4BVX A;  3GST A;  4AGS A;  14GS A;  3IV4 A;  2WB9 A;  1SVO A;  2ON7 A;  4MNN A;  3BCI A;  5A4W A;  5IMZ A;  2MMN A;  4O32 A;  2C8U A;  4PHZ C;  1V58 A;  4WR5 A;  2AUV A;  1GNW A;  2C4J A;  2O3E A;  3W6G A;  3KH7 A;  5JCU A;  1M9A A;  4ILF A;  1YQ1 A;  1SJ6 A;  4HUA A;  1EP7 A;  3F4R A;  1S3C A;  3HMJ G;  2DBC A;  1N25 A;  3TRQ A;  4PUA A;  1ZYN A;  1O81 A;  2GZP A;  4L5L A;  1K0B A;  2DJ3 A;  3TOU A;  5IQY A;  2J9H A;  4GF0 A;  4PI2 C;  1YKA A;  1X9S B;  3F9U A;  3QCP A;  3ZVJ A;  3NOF A;  2CVD A;  4Z2R A;  1T3B A;  3J7Y b; 
#chains in the Genus database with same CATH homology
 2XC2 A;  2A2S A;  2PBJ A;  5GAN D;  3IE3 A;  3HJM A;  3GSS A;  3LXT A;  4YQU A;  2WUL A;  2IJY A;  5J4V A;  2IMI A;  1F6M C;  4AKX B;  5D9X A;  3F63 A;  2O8V B;  1GUL A;  4JED A;  2FA8 A;  2OKA A;  4GTU A;  3BOA A;  1VF1 A;  4ML1 A;  5DCH A;  2IWT A;  4I5Q A;  5KEJ A;  5HR0 A;  1CQH A;  3F0I A;  4IVF A;  6GSY A;  5ECM B;  2DC5 A;  1X5C A;  2VCV A;  5F06 A;  2HRA A;  2VD0 A;  5IMD A;  5KOX A;  2YJH A;  3LFL A;  2RUE A;  2FA4 A;  4XS4 A;  3HXS A;  5IMC A;  3KM6 A;  3ZVJ D;  2GSS A;  2GZY A;  4K2X A;  3FW2 A;  1PD2 1;  3KD0 A;  2GZZ A;  1R5P A;  3TKS A;  2B7K A;  2GT5 A;  4TXO B;  1EV4 A;  5LD0 A;  2LNT A;  2BTO T;  5J4U A;  3HVX A;  10GS A;  3LJR A;  1FO5 A;  4HQS A;  1UC7 A;  4JU5 A;  5ID2 B;  4HZ4 A;  4IW9 A;  4YQM A;  5IOW A;  4IKH A;  5KOW A;  2HLS A;  3O6T A;  1T4Z A;  1PGT A;  5E59 A;  3W8J A;  3TUE A;  2YV7 A;  4Q5Q A;  1OE8 A;  3WGE A;  1Z6N A;  3VFI A;  4TXV A;  3H4K A;  3US3 A;  5DAK B;  3L9S A;  1TDI A;  4J2F A;  4LL1 B;  5J9C A;  2YWN A;  3S9F A;  4YAP A;  3GRX A;  1ILO A;  5D73 A;  4FYB A;  4OCF A;  2OE3 A;  4K9Z A;  2DJ1 A;  3KJY A;  1WP0 A;  4GST A;  1A8Y A;  2X4A A;  4BVY B;  2WDU A;  2LS5 A;  2YP6 A;  1TRV A;  4MH2 A;  5C00 A;  3VPQ A;  4F0B A;  1FB0 A;  3MAK A;  3QMX A;  5EL8 A;  1Q4J A;  2K8V A;  2R6K A;  1XPV A;  2AV4 A;  3TOT A;  4NPB A;  1GLQ A;  2EFE A;  1GH2 A;  5GSS A;  4Q5F A;  5DQY A;  3GKX A;  5JWQ B;  1Z7R A;  4KE3 A;  1QK8 A;  3C8E A;  4AF2 A;  1B48 A;  1W4V A;  4MP4 A;  2H72 A;  2IMF A;  2F9S A;  1SJI A;  4DEJ A;  5A1N B;  5HR1 A;  2EFD A;  5BMU B;  3TKQ A;  1K0N A;  4K7N A;  1HQO A;  3W8S A;  1QUW A;  3F4S A;  3E3E A;  1OYJ A;  1AUC A;  3KMN A;  4KSO A;  3M1G A;  1G0T A;  3TU3 B;  1THO A;  3FR3 A;  3KH9 A;  4K1F A;  1JHB A;  3HA9 A;  3FR6 A;  1RQM A;  1V9W A;  4K8M A;  4CY6 A;  3L9U A;  1ZYQ B;  2DMM A;  1TI3 A;  1R7H A;  1SVM A;  1SEN A;  4KW6 A;  4K0N A;  1TP9 A;  3EUR A;  4TVE A;  5DJL A;  5FWG A;  3UVH A;  5EY6 A;  1WOU A;  3FHK A;  1FVK A;  1GTB A;  1T4Y A;  2C0G A;  2ALB A;  1FVJ A;  3HKR A;  2R37 A;  3D4M A;  3HD5 A;  2HE3 A;  4POK A;  3GYK A;  1BX9 A;  4BWS A;  3KP9 A;  5ECS A;  4BA7 A;  19GS A;  2H0I A;  2F8A A;  1ZL9 A;  2MZC A;  5CAX A;  1USB A;  5D93 A;  4GDF A;  3G7I A;  1B8X A;  4V2L A;  1TK8 B;  12GS A;  1ERV A;  4X0X A;  2O5V A;  5DBQ A;  5A5H B;  3DIE A;  2C3Q A;  2AHE A;  3RAZ A;  2WJU A;  2HQT A;  4F9Z A;  1GSF A;  2H1G A;  5D9T A;  3GNJ A;  2DKH A;  1JZR A;  3IRA A;  4WXT A;  2LJR A;  1S3A A;  3UAR A;  2LJK A;  4HS1 A;  4BL7 A;  3CSH A;  3KCM A;  5LNK e;  4A5P A;  2UV8 G;  5DAK A;  2H1D A;  2L6D A;  2GLR A;  4EDY A;  5GAP D;  1DE2 A;  1VGL A;  5DAL B;  3D21 A;  2XBQ A;  5IO0 A;  2H01 A;  3A2X A;  5B8A A;  1XVQ A;  2CVK A;  3F6F A;  2P31 A;  2OE1 A;  2GTU A;  4NHZ A;  1LBK A;  2LQQ A;  2L6C A;  4E8H A;  3FZ5 A;  3GTU A;  1FHE A;  4ZL7 A;  2HSN B;  4ICY A;  3PR8 A;  2DIZ A;  5J47 A;  4PQ1 A;  2GS3 A;  4K5R A;  1A2J A;  1AC1 A;  5F05 A;  3GFK A;  3E0U A;  1V2A A;  1XWK A;  4RQX A;  4NWY A;  5JWR B;  3UAP A;  3UBK A;  2N5F A;  20GS A;  2QKE A;  4G0I A;  3CXG A;  4YQV A;  4MF7 A;  1K0M A;  3G7Y A;  2MBS A;  2FWH A;  1EGO A;  2KHP A;  4Z2U A;  1EEJ A;  1YZX A;  1H75 A;  2V2G A;  8GSS A;  6GSW A;  6GSV A;  3KXO A;  1AQX A;  5KN2 A;  3HHV A;  4I6X A;  4RI7 A;  4GQF A;  2MYG A;  5EVO A;  1XZO A;  1UVZ A;  4FYC A;  1SL0 B;  13GS A;  2KP2 A;  2H71 A;  2YJ7 A;  2VM2 A;  5IPH A;  3DVX A;  3QD9 A;  4MMM A;  4Q5R A;  4N30 A;  2AJQ B;  1GLP A;  3EWL A;  3GKM A;  1RK4 A;  4O92 A;  2K9F A;  3ME7 A;  3APO A;  4LL4 B;  1VF2 A;  5J9B A;  2E2G A;  3O76 A;  2JZT A;  3ZIJ A;  4L5O A;  4KAE A;  4FYU A;  1G7O A;  3IAM 2;  2HZF A;  4HI7 A;  1FW1 A;  2HSH A;  3KTB A;  4PNF A;  2B1L A;  2RM6 A;  2V41 A;  4V1A p;  4KCE A;  1MD4 A;  5D96 A;  4ZL9 A;  22GS A;  1ACV A;  3QR6 A;  2F3M A;  1QQ2 A;  3H79 A;  4EF0 A;  4HJ2 A;  2GQK A;  3GUR A;  5A5H A;  3ERF A;  5CYY A;  1TJD A;  2R0C A;  3LSZ A;  1Q98 A;  1GSE A;  2FWG A;  2WZ9 A;  1E2Y A;  2DSA A;  3DRN A;  3FEU A;  2OAD A;  1G7E A;  4RI6 A;  3BCK A;  1TOF A;  4CDO A;  2C1Y A;  1VF4 A;  5J4Y A;  1GWC A;  4WBR D;  1ERW A;  4EDZ A;  4HOJ A;  2VCZ A;  3QAW A;  3C73 A;  4WF4 A;  2X49 A;  3HYP A;  3ZLP A;  3H1N A;  1T1V A;  2GDR A;  2VCW A;  5J5N A;  2EIQ A;  3ZIT A;  3HZ4 A;  1GP1 A;  2GQM A;  1PKW A;  4PQI A;  3LQ7 A;  3FZ9 A;  2WFC A;  2YPM A;  3KZQ A;  4NV5 A;  9GSS A;  3RPN A;  1T8E B;  3A5W A;  4NXI A;  2YWO A;  1XIY A;  5CRH A;  2LUS A;  2G2Q A;  4IGJ A;  5JCG A;  5E4W A;  2HRF A;  1O6J A;  5D9W A;  5HR2 A;  4K7I A;  2B3S A;  4G10 A;  4L0U A;  3CTG A;  2H8L A;  3MSZ A;  3WGX A;  2R4V A;  4L8E A;  1EGR A;  2PVQ A;  2LV3 A;  4NV2 A;  4DVC A;  2TRX A;  2REM A;  4IEL A;  2ES7 A;  2FWE A;  3VPT A;  1MDK A;  2MMO A;  3J7Y k;  4K0G A;  1F37 A;  3UJ1 A;  4W66 A;  1HNB A;  4MZW A;  4G19 A;  2VAF A;  5H5S A;  5B6N A;  1PN9 A;  1JLW A;  3CSJ A;  4IP6 A;  3H8Q A;  3IPZ A;  4N11 A;  4ZB8 A;  4KH7 A;  5ELG A;  3IHG A;  3ZFB A;  4X1U A;  4L0W A;  1V98 A;  2FWF A;  1SKR B;  4POB A;  3Q18 A;  2VLV A;  2CZ3 A;  2FY6 A;  1M2A A;  4AKI A;  2OJL A;  1WWJ A;  3D4T A;  1VF3 A;  4X43 A;  3GV1 A;  2B7J A;  4ACS A;  5ECO B;  1KBN A;  1U3A A;  4ULX A;  3MYD A;  2HNL A;  2HZE A;  2I1U A;  1TU7 A;  3I69 A;  1NHO A;  2IMK A;  4N3Z A;  4HDE A;  3EC3 A;  4CY8 A;  2O89 A;  4GSN A;  4YKF A;  3SBC A;  2VO4 A;  5G31 A;  1K3L A;  5CRW A;  3TKS E;  3ZMK A;  2VL2 A;  1U6T A;  4QL9 A;  4E8E A;  1TRS A;  1Z9H A;  2LRC A;  2M80 A;  3ISO A;  2KOK A;  3FZA A;  2UZ8 A;  2G0F A;  5D9V A;  1HYU A;  4EC0 A;  2NTO A;  1F3B A;  1BJX A;  3L9V A;  3HZ8 A;  3ZZX A;  1AQV A;  4D73 A;  5J40 A;  4PTS A;  4JBB A;  3RDW A;  2QGV A;  2V1M A;  1J08 A;  2A2R A;  1OAZ A;  1TXU A;  1XWC A;  3KIJ A;  3M9K A;  2QSI A;  1TTZ A;  3R2Q A;  5HQP A;  3KGK A;  1TK5 B;  3HY2 A;  3DXB A;  1XOA A;  2MBT A;  4MCU A;  1GUM A;  3N9J A;  1ZMA A;  2C0E A;  1WMJ A;  3A2W A;  1Z5Y E;  1F2E A;  2B5Y A;  3KP8 A;  1JFU A;  3P7X A;  4XRA A;  2DIY A;  3HJO A;  1SL2 B;  3GL3 A;  4GQC A;  1I5G A;  1PQN A;  2BMX A;  4WET A;  3M3M A;  2IME A;  2E0Q A;  4FO5 A;  5IPG A;  2JZS A;  5ECP B;  3LXZ A;  5G5E A;  3QAV A;  2PU9 C;  3GA4 A;  2X8C A;  2JAC A;  3UEM A;  1A23 A;  2ZCT A;  5A34 B;  2R0G A;  3IC8 A;  3RHB A;  2R5G A;  2LST A;  5HFG A;  2CV4 A;  4BWQ A;  2NDO A;  5GZZ B;  2JZR A;  2P0G A;  2EIO A;  4FIW A;  1EEM A;  1YY7 A;  4KUN A;  4BL7 B;  2QA2 A;  4K5S A;  1HNA A;  4MDC A;  1LU4 A;  4ZBA A;  3BD2 A;  1Y1U A;  1SKW B;  5CNW A;  3BJ5 A;  4HU9 A;  4O7H A;  3IOS A;  1GTA A;  2P5R A;  4I8B A;  3QOU A;  1Y6E A;  3Q6O A;  3Q19 A;  3CRT A;  2HT9 A;  2R0P A;  1MD3 A;  3GTU B;  5IMF A;  4PUR A;  3UOM A;  3CWG A;  5ECH B;  2HXK A;  5CRD A;  3TJG A;  4WR4 A;  3PGT A;  3UMA A;  5G5F A;  5HFK A;  1OC9 B;  3A5I A;  1UA5 A;  2LJA A;  2I4A A;  3LW9 A;  1TU8 A;  1WIK A;  5LCZ A;  3CBU A;  3IK7 A;  1SK1 A;  1YF0 A;  2YOI A;  4TR0 A;  1MDJ A;  4TKY A;  2H1A A;  5F0G A;  1EOH A;  3F6D A;  1YEX A;  1BQ7 A;  3AY8 A;  3F3R A;  1SVL A;  5CRE A;  4OMV A;  1AXD A;  3U6V A;  4ECJ A;  1PMT A;  1F9M A;  1MDI A;  3PH9 A;  1UN2 A;  2H19 A;  4ECC A;  4ZIJ A;  1XFL A;  4TN8 A;  3HVS A;  2DJK A;  3UIW A;  1XVW A;  5CRG A;  5ECN B;  2BJX A;  1GL8 A;  5IOX A;  3N5O A;  3FMW A;  4RUV A;  4XIH A;  4JE1 A;  4EE0 A;  4USS A;  3CTF A;  3IBH A;  1XCC A;  3I6A A;  2H70 A;  4J56 E;  1PSQ A;  3DEX A;  1K0C A;  5AGY A;  1NHY A;  3A3T A;  4XRD A;  1SYR A;  2YN1 A;  4AJ7 A;  4AI6 A;  1FOH A;  3K8N A;  5IM9 A;  3F3Q A;  1QFN A;  1ZGN A;  3TJB A;  1A2M A;  4EKZ A;  1XW5 A;  4DSQ A;  2VL2 C;  2X64 A;  6GSS A;  4K6X A;  1G6W A;  2CQ9 A;  4OFN A;  1GSQ A;  1U88 A;  3ZIV A;  3WT1 A;  5A34 A;  1DUG A;  3VWV A;  1I9D A;  4WF5 A;  1B4Q A;  3VK9 A;  6GST A;  1XBS A;  3NZN A;  2R3X A;  1YKC A;  2R2J A;  1DBY A;  2HRN A;  3SWL A;  3D5J A;  4G9H A;  2LQO A;  4MLY A;  5G30 A;  1R4W A;  4MJE A;  5BRT A;  4O5U A;  3C1R A;  4GWR A;  4OFT A;  3QDN A;  3BBY A;  5J41 A;  3FYG A;  2H75 A;  1QMV A;  5A5K A;  2OBK A;  1XWA A;  2WRT A;  1BG5 A;  1SK2 A;  3RBT A;  2PER A;  5ECQ B;  1A8L A;  4N0V A;  4F2I A;  2PGT A;  5KN0 A;  1MEK A;  4HJM A;  3ME8 A;  1JZW A;  4MJB A;  5GST A;  1NM3 A;  1T00 A;  4EUY A;  1AW9 A;  1ERT A;  1ON4 A;  4N0Z A;  2J23 A;  2H74 A;  1U87 A;  3JCM L;  5AN1 A;  1OC9 A;  4IJI A;  4QMK A;  2I81 A;  3LG6 A;  4POL A;  1TRW A;  1JZO A;  2FGX A;  4ZXG A;  1V57 A;  5EPF A;  4MAB A;  2FCH A;  5DDL A;  2VM1 A;  3EU3 A;  2DJJ A;  1G6Y A;  4PNG A;  2H1B A;  3IDV A;  2LRT A;  1GSD A;  2AB6 A;  4BPY A;  2JSY A;  2N5A A;  2N5B A;  4ISD A;  2A2P A;  4AKH A;  2H0G A;  4F82 A;  2KLX A;  2YZH A;  3IA1 A;  1KNG A;  1SL1 B;  2RII A;  2C0F A;  4TW5 A;  4NMU A;  2M72 A;  4NAX A;  3EPT A;  3P8W A;  3TJJ A;  5FHI A;  1AAZ A;  3G7J A;  2P5Q A;  3VUR A;  4MZC A;  2JL4 A;  3ZL5 A;  2HZE B;  2L59 A;  2M46 A;  2EFC A;  1PKZ A;  2CVB A;  4MJC A;  4LLR A;  4EVM A;  3L4N A;  3A2V A;  4I97 A;  3WGD A;  1SD9 A;  1GSU A;  2LRN A;  3D22 A;  1NSW A;  2FLS A;  3G9B A;  4NHW A;  4HQZ A;  4OD7 A;  1BF5 A;  5KN3 A;  3RPP A;  3UBL A;  2AAW A;  3R3E A;  4TRX A;  1GSS A;  3LOR A;  4N10 A;  3CSI A;  4V1A g;  4D73 B;  2HI7 A;  4KCA A;  5ENU A;  2MMA A;  1ML6 A;  3GN3 A;  1OKD A;  1FOV A;  4KDY A;  2JAD A;  4ZB7 A;  1TKD B;  3TDG A;  3VI5 A;  2CA8 A;  6GSX A;  3DWV A;  3GKK A;  1XWB A;  2WGR A;  2F51 A;  2Z9S A;  2YZU A;  5DQS A;  1XXU A;  3IXR A;  3M9J A;  3ZML A;  2QA1 A;  3D6I A;  4WEY A;  2LEG A;  2V6K A;  1IYI A;  4ECI A;  3FKF A;  1KTE A;  3KTL A;  2XHF A;  3GL5 A;  4F03 A;  3Q74 A;  2H6X A;  3CRU A;  5IIZ A;  3APQ A;  4KB3 A;  1M2D A;  2NVL A;  1M2B A;  3TKR A;  3MWH A;  5HFI A;  5AIS A;  4XCS A;  2GVP A;  1C72 A;  1R5A A;  5H5R A;  3WYW A;  2DJ2 A;  2A4H A;  4ZBB A;  2WS2 A;  4GSS A;  2K6V A;  2TIR A;  1B9Y C;  1ZYP A;  4POM A;  5ECK B;  4KGI A;  4MK3 A;  4GRF A;  2VD1 A;  3GMF A;  3P2A A;  1PX6 A;  3I43 A;  2C0D A;  2H0H A;  4PGT A;  4G2E A;  1AIU A;  3FR9 A;  2VOC A;  1O73 A;  4FQU A;  1QGV A;  4HEA 2;  5G1K A;  2LNS A;  3UVT A;  4FH8 A;  1EWX A;  2GST A;  2AYT A;  1EP8 A;  1ZOF A;  1B4P A;  1RW1 A;  2H6Y A;  3LEF A;  1TRU A;  1MTC A;  4YH2 A;  2X99 A;  3TB2 A;  3ED3 A;  1SKS B;  4KDX A;  2GGT A;  5IMV A;  3KMO A;  4X4J A;  1TW9 A;  1GTU A;  4KDU A;  3HJP A;  4MZB A;  1K0O A;  4GCI A;  2HRK A;  3ERG A;  4OWY A;  2FHE A;  2HYX A;  4WKW A;  3C71 A;  3U5R E;  3IC4 A;  2EC4 A;  2YAN A;  2MMZ A;  3DGQ A;  2GQL A;  4LMW A;  3M8N A;  3IR4 A;  2HSY A;  4EO3 A;  4PUF C;  4ZL8 A;  2X8G A;  1AQW A;  4MPF A;  3ZTL A;  2V32 A;  3FK8 A;  1YVL A;  2FUG 2;  2HSM B;  2GSQ A;  1TXX A;  2HFD A;  2VUP A;  4IQA A;  5INY A;  4IS0 A;  4ML6 A;  2NBS A;  4PXO A;  2B5X A;  2L57 A;  4KA0 A;  4KF9 A;  5A4U A;  2H76 A;  4CW9 A;  2TRC P;  1ZCP A;  3EVI A;  2YV9 A;  5FT3 A;  2H66 A;  1FB6 A;  4OO5 A;  2C80 A;  1XWG A;  1N8J A;  16GS A;  3WD6 A;  1X5E A;  2CX3 A;  3GX8 A;  2GT6 A;  4G0L A;  1M0U A;  3QPM A;  1X9M B;  1GRX A;  4CHS A;  4ZB9 A;  1OVN A;  1O85 A;  3HDC A;  2F8F A;  3EIN A;  1EZK A;  1K0D A;  2XPD A;  4QQ7 A;  4YAV A;  1GUK A;  3EU4 A;  4LA1 A;  3TRP A;  7GSS A;  2DML A;  5ECL B;  2CAI A;  2DLX A;  4IQ1 A;  3O3T A;  3C1S A;  1PL1 A;  1GTI A;  5IMA A;  6GSU A;  1ST9 A;  3QAG A;  3DML A;  1GSY A;  2L5O A;  4ZBD A;  3HCZ A;  3DYR A;  1BED A;  4O5R A;  5F07 A;  2LTK A;  1PN0 A;  2DKI A;  3WT2 A;  4EIP A;  1M99 A;  4KX4 A;  1OC3 A;  3TJF A;  3EMP A;  3MIX A;  4I2U A;  3VWU A;  3PIN A;  2YNX A;  3IHQ A;  2OT3 A;  5B8B A;  1A0R P;  4GLT A;  2YCD A;  1GNE A;  5DJM A;  1A0F A;  3IAS 2;  4TR3 A;  1U3I A;  4XS1 A;  4TR1 B;  4DSR A;  1T7P B;  3GX0 A;  3L0H A;  2V6O A;  2FD3 A;  4EIQ A;  3TKP A;  3P90 A;  3H93 A;  1PA3 A;  4MF5 A;  4KND A;  4OCE A;  1BAY A;  3F8U A;  5B7C A;  4JRR A;  4Z2T A;  4JR4 A;  5ABR A;  4AJ6 A;  1TI1 A;  3LWA A;  1OE7 A;  2RM5 A;  2VKZ G;  4G0K A;  1YJ6 A;  3DVW A;  2IL3 A;  5A4V A;  3CYN A;  4MJA A;  1BYE A;  1PRX A;  1YDK A;  1WJK A;  4JR6 A;  3VLN A;  1XW6 A;  1HD2 A;  2HSM A;  5L71 A;  5CP1 A;  2WCI A;  2IIY A;  1E6B A;  4XHM A;  5DVB A;  2H6Z A;  1NW2 A;  3TJK A;  3L78 A;  2VCQ A;  2ON5 A;  2C3T A;  5COH A;  4OFM A;  4IBP A;  4IN0 A;  4AKG A;  4DSS B;  2RUF A;  3M0F A;  3TCO A;  3ZRE A;  3LYP A;  2E7P A;  2H1L A;  3VWX A;  4HZ2 A;  3RHC A;  3PPU A;  1ZZY A;  4ZIL A;  1DSB A;  3VWW A;  2PUK C;  5CO3 A;  2VL3 A;  3EYT A;  2PWJ A;  1YF1 A;  4E68 A;  1K3Y A;  1X5D A;  4K2D A;  5ELA A;  2KUC A;  1ERU A;  1Y25 A;  1THX A;  1W89 A;  5G2Z A;  3TRX A;  2VIM A;  3MDK A;  2ZNM A;  3V1W A;  4IJ3 A;  2H73 A;  2JSZ A;  3GH9 A;  3KEB A;  4MF6 A;  1O8W A;  4TXO A;  17GS A;  2A4V A;  2CAQ A;  1A2L A;  2IN3 A;  2PVO C;  4ZB6 A;  5KN1 A;  4I2T A;  4O5Q A;  5ID2 A;  2IFQ B;  3TGZ A;  1F3A A;  2CX4 A;  1EV9 A;  2KP1 A;  3ZYW A;  1A24 A;  5JCW A;  2XBI A;  2H30 A;  3ZRD A;  2I9H A;  2I3Y A;  1B9X C;  2VCT A;  3FZ4 A;  3EE2 A;  1K3O A;  1Z6M A;  4IP1 A;  4J57 E;  2O85 A;  2EFH A;  4P3Y B;  1R26 A;  4LMV A;  2EIR A;  2D2Z A;  3GKN A;  3ZFL A;  4BVY A;  4Q5N A;  3ERW A;  4MA9 A;  3I9V 2;  4TR1 A;  1N2A A;  5B6M A;  1SK0 A;  2K18 A;  1V40 A;  5F8B A;  2PPT A;  3TKS C;  1O7U A;  1WPI A;  4PX1 A;  5C04 A;  3FRC A;  4F0C A;  3DKS A;  2DJ0 A;  2IMD A;  3HVV A;  4ID0 A;  5A1N A;  4BVX B;  5BMU A;  4YKG A;  1DE1 A;  2IPA A;  2CZ2 A;  2OBI A;  1H4O A;  3FY7 A;  2L4Q A;  2B6M A;  2VL9 A;  4V2M A;  3EMX A;  2JU5 A;  4MH3 A;  5H5Q A;  1PL2 A;  3GHA A;  1YEP A;  5IO2 A;  3OR5 A;  2RLI A;  2PMT A;  1S3D A;  1BG1 A;  2QC7 A;  1VRS D;  4TR4 A;  1EOG A;  5J3R A;  4ECB A;  2OE0 A;  3DD3 A;  1J0F A;  2YWM A;  4HU7 A;  1XW9 A;  3LYK A;  3D0Z A;  2OAC A;  2HRK B;  1IYH A;  1URM A;  2O7K A;  4XS6 A;  2GSR A;  4PQH A;  1X0R A;  3QFA C;  2B5E A;  1QXH A;  3VI7 A;  4DSS A;  3UL3 A;  1TK0 B;  1SYX A;  3F4T A;  2X8H A;  3GIX A;  4G01 A;  1FAA A;  4H86 A;  4QL7 A;  1M9B A;  5AIV A;  1PX7 A;  3GH6 A;  4EL1 A;  3GUS A;  2L5L A;  1ZYE A;  1WRY A;  1J9B A;  2B1K A;  5AIX A;  1Z3E A;  4EXJ A;  1ABA A;  2E2M A;  1GUH A;  4Z7X A;  4MPG A;  2PN8 A;  1SU9 A;  2VLU A;  2CT6 A;  11GS A;  3QFB C;  5D8I A;  2XPE A;  4GXZ A;  2C3N A;  4KSM A;  2IFQ A;  5ECR B;  1OKT A;  1FG4 A;  3APS A;  2FNO A;  1SD8 A;  1HNC A;  1CQG A;  1WE0 A;  4TOP A;  2LKU A;  1Z7P A;  3C7M A;  5DAL A;  4RQR A;  4V2N A;  4WBJ A;  4XS4 B;  5HR3 A;  1LJR A;  1K0A A;  1M7T A;  1O8X A;  1SJZ A;  1XOB A;  5JWO B;  1JZD A;  2ZUP A;  18GS A;  3E9J B;  1X9W B;  3LGC A;  3IK9 A;  3NIV A;  4XTS A;  3MNG A;  2HSN A;  3CMI A;  4IHU A;  2VCX A;  5ECI B;  2VLT A;  4JZQ A;  4AJ8 A;  1OC8 A;  2O87 A;  2YWI A;  2L4C A;  1JLV A;  2K8S A;  1KEB A;  5DCG A;  5G1L A;  2NPB A;  2OA7 A;  4K7O A;  4OO4 A;  4BVX A;  3GST A;  4AGS A;  14GS A;  3IV4 A;  2WB9 A;  1SVO A;  2ON7 A;  4MNN A;  3BCI A;  5A4W A;  5IMZ A;  2MMN A;  4O32 A;  2C8U A;  1V58 A;  4WR5 A;  2AUV A;  1GNW A;  2C4J A;  3W6G A;  3KH7 A;  5JCU A;  1M9A A;  4ILF A;  1YQ1 A;  1SJ6 A;  4HUA A;  1EP7 A;  3F4R A;  1S3C A;  3HMJ G;  2DBC A;  1N25 A;  3TRQ A;  4PUA A;  1ZYN A;  1O81 A;  2GZP A;  4L5L A;  1K0B A;  2DJ3 A;  3TOU A;  5IQY A;  2J9H A;  4GF0 A;  1YKA A;  1X9S B;  3F9U A;  3QCP A;  3ZVJ A;  3NOF A;  2CVD A;  4Z2R A;  1T3B A;  3J7Y b; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...