2CVRA

Nmr solution structure of sso7d mutant, k12l, 12 conformers
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
62
structure length
62
Chain Sequence
ATVKFKYKGEELQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding protein 7a
publication title Structural Determinants Responsible for the Thermostability of Sso7d and its Single Point Mutants
rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein
total genus 3
structure length 62
sequence length 62
ec nomenclature ec 3.1.27.-:
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2cvrA00
2EPBA 1G2TA 1EOTA 2JYOA 1WTQA 1RTNA 2N88A 2L12A 1MSHA 4OIJA 1EIGA 1SSOA 1O80A 1TVXA 3KUPA 4ZLTF 3LWEA 1WTRA 4QUCA 5JJZA 2K05A 1JE4A 3IL8A 4X3TA 1WTPA 1HUMA 4RA8A 2B2VC 2RA4A 4X3SA 5CMDA 1X3PA 1C8CA 1RTOA 4IUPA 2RSOA 1WTOA 3GV6A 2X6LA 4ZK9B 1HRJA 3D6WA 5AFWA 1ZXTA 3QO2A 1KNEA 1QG7A 1RODA 1RJTA 4DN4M 1BNZA 3IFDA 3N52A 1IL8A 1SAPA 2NZ1D 2MGSA 1G91A 1B4OA 4X3KA 1VMCA 3H91A 5CBAE 1EL0A 1A15A 1BO0A 1NCVA 1PFNA 1QNKA 1RHPA 4HAEA 2RSNA 1ILPA 1MSGA 1U4LA 2B2UA 5DNFA 1F2LA 1U4MA 1DOMA 4IUTA 4X3UA 4U68A 1WTVA 1F9PA 2B2TA 4CJ0B 2N55A 2SDFA 2XIWA 4HCSA 1DOKA 1F9SA 2NWGA 3HP3A 4IUQA 1DZ1A 2H1EA 3ONAB 1WD1A 4MHEA 5COYA 1KNAA 3G7LA 3I8ZA 1AZPA 1WVLA 2J7ZA 1B50A 2KEEA 1B2TA 1CA6A 4ZAIA 1HFGA 3I90A 4LMQD 2B2YA 3I3CA 3SVMA 4R8IA 5E4WC 2HDLA 2MP1A 2B2WA 5T1IA 1LV9A 2B2UC 4RAUC 1SDFA 1EQTA 1M8AA 1ICWA 1O7YA 1QE6A 2B2TC 1NR2A 2FFKB 1NR4A 2HUGA 2RVLA 5T1GA 1VMPA 3I91A 4IUVA 5EPLA 1AZQA 1G6ZA 2L4NA 2Q8TA 1HFNA 2HCCA 1ESRA 1PDQA 2MJ8A 4IUUA 5EKIA 1NAPA 2K01A 3FPUB 2B2YC 2MPMA 1EIHA 4ZKCB 2FMMA 2KECA 2EE1A 1CA5A 1J9OA 1F9QA 2B2WC 2L1BA 1PLFA 2K04A 2KVMA 1X3QA 2K03A 2FINB 2FJ2A 1MI2A 3R93A 4NW2A 4XT3B 1B53A 1XX8A 2X69A 4ZKBB 4OIKA 2DY8A 1Q3LA 4R9WA 3F2UA 1F9RA 4CJ1B 5D14A 1MGSA 4CJ2C 2B2VA 5EQ0A 1ML0D 2VXWA 2KOLA 5EJWA 2NYZD 5CBEE 2DY7A 4XT1B 3TZDA 4MN3A 2M2LA 1CM9A 1B3AA 1GUWA 2D9UA 2R3ZA 1XYIA 2EOTA 1DOLA 2BDNA 3TN2A 3Q6SA 2CVRA 1J8IA 2KEDA 1U4PA 1O7ZA 5CORA 3UI2A 3MTSA 2FHTA 4O42A 1G2SA 3DEPA 1IKMA 2L11A 1U4RA 2HCIA 4UAIA 4HEDA 2HDMA 3MWYW 3GV3A 1X32A 1PFBA 5E4XA 5D65A 4IURA 1HHVA 1HUNA 1WTXA 1HA6A 1ILQA 5EPKA 1BF4A 1WD0A 2X6GA 1AP0A 1JICA 1BBXC 1S4ZA 2K1BA 4QUFA 3KBXA 2Q8RE 1DONA 1E0BA 1IKLA 3DEOA 3P7JA 4HSVA 4RWSC 2JP1A 2K28A 2L9HA 1WTWA 1PFMA 5EPJA 3FDTA 3DM1A 4XDXA 2IL8A 2KUMA
chains in the Genus database with same CATH superfamily
1XMOL 4A3JG 3NXWA 2F3VA 5KIXA 1CKNB 4F8MA 1LT5D 1HR0L 2B2VC 3KJPA 2WV6D 4O0AA 1X3PA 2K5VA 3G48A 5ISRA 3BYTB 1TWCB 1AH9A 2JA6B 1AEXA 4PMWA 4IN3A 5FJ8H 3C1EA 3TZUA 3FEWX 1HPCA 3NELA 3RZDH 1U4MA 4EX5A 5C0XJ 4TRDA 1CKOA 4HTHA 2B2TA 5HGQA 3TS0A 1D2BA 3D31A 4K6LA 2Y0SG 1AE3A 4F87A 1KAAA 5BR8Q 3H09A 2K5HA 2B2YA 1PYWD 4A3IG 5C4XG 2IX1A 2MP1A 2WB1B 3DLLA 3NHHA 3CPWA 3F8TA 4ID6A 4XYQA 1PVOA 5LMNQ 4QCLA 1K83H 4OGQC 1AZQA 2HIXA 1KABA 1V1PA 1IYVA 2Q2IA 2Z4HA 2BH2A 2MPMA 1VQPA 2FMMA 5FOBB 2NTTA 3V05A 4GLVB 1XNQQ 3BDCA 2E2JB 5C3EB 1TR5A 2K03A 1CUKA 1LT3D 2FINB 2A6HD 5BR8L 1NY4A 4IJLA 1YHBA 1F2YA 2EY6A 2L55A 2R92G 2Z6KA 1N32L 4J6HA 5LMNL 4A75A 3Q8DA 4JI2Q 4X62L 2NVXB 2JQOA 3CCUA 3S17H 3KYHC 1SYCA 1X3GA 2YTYA 1D1IA 3CRKC 4JBJA 3TP6A 4GLAC 5GROA 1EWCA 4KLKA 1NTGA 1O7ZA 1W6KA 1XNQL 2ZXOA 1G2SA 2JN4A 3KLRA 2VS1A 4A3BB 4K0KQ 2PI2A 2RHSB 1V1QA 3GTKH 4JPBW 1K8GA 1PRTD 2TSSA 2JP1A 3QJYA 1SLJA 4L5TA 3FDTA 2YYZA 1K28A 3PF4A 3J7YW 1PRTB 4E6IA 1KDBA 4A3EH 1K8MA 1V9PA 2KCCA 1I3QH 2L12A 1MSHA 1R4PB 3IFTA 4DR1L 3S16B 2F0UA 2B29A 1WTPA 2EJFC 1Y1VG 1ONLA 2RSOA 3GV6A 4C2MB 2EQSA 1HRJA 3KF8A 5AFWA 1QG7A 5ELFA 1F2ZA 4RGNA 1IL8A 4POFA 1D1KA 3T16A 2MO1A 3S1MH 2N8NA 1TWAH 4OELB 3U9OA 1EQRA 1QNKA 2EYHA 4KKTA 3H0GH 3C46A 1EEID 1II3A 3E3XA 1F9SA 2ICEC 2XN9C 3DWAA 1SNDA 5A35A 3NE5B 1BOSA 1CHQD 3G7LA 4NB3A 4RKLA 3VA5A 1B50A 1MHWC 5KNDA 1ENCA 4B9WA 5IY0A 1J6QA 1SNMA 2IJ0A 3J80E 3GDEA 3I91A 4XIGS 1E24A 2YTXA 3CD6A 4K8JA 1JB7A 1NAPA 2K01A 2JA5G 3PUYA 1OXSC 1I4XA 4YWLA 2UUCQ 1VQKA 1SYFA 3MZ5A 3RZOB 3QOLA 5M3MH 4A76A 2MO0A 1B1ZA 1QILA 1HQRD 2DY8A 3PUZA 3F2UA 2HQEA 1CZWA 4KTAA 1F9RA 1JWSD 3DM3A 5C0XI 4BXXG 3CCRA 1KQSA 2JA8H 4GNXC 1JQYD 1PZKD 1GHKA 3FVQA 1W2BA 1XYIA 4A93B 2CVRA 2CWAA 3IAYA 1U4PA 1VQBA 4N8X1 4PZ8A 2UUCL 1IKMA 1PFBA 5JJIA 2F0OA 2XWJB 5FO8B 1BF4A 2VQEL 1FL0A 4YY3Q 4HSVA 5ELCA 5EKLA 5IYCG 3M3YB 1PFMA 2RCNA 2BOSA 1R9TB 2EPBA 2Q2HA 3VYUA 3CCVA 1W6JA 1K3RA 3A54A 3I55A 3NK9A 4WORA 1EIGA 4IZ8A 5CV9A 3S24A 1JOOA 5JEAG 1ASZA 4F88A 4QUCA 1JE4A 2V4DA 1FNUA 3CKIB 1Y1WG 3PIPA 2E2HB 3O13A 2PI2E 1R4QB 1PA6A 1C8CA 3BZCA 3TS2A 4YY3L 1PZID 5A2QL 5IGFA 4C3HG 1I50H 1CK1A 1V1PB 3W3AA 2PQAB 4DNIA 4C1NI 2K32A 4U68A 1F9PA 3MXPA 5KYIA 5HGTA 5K36H 1Q8KA 1VF7A 2SDFA 4HCSA 2A68D 4TQUS 5CV7A 5IGBA 1QB5D 1EYAA 2AUJD 2QF7A 4IPGA 3K57A 1X3EA 1S3OA 1CA6A 5C4JB 1PHJA 1D7QA 4OWWB 1FNWA 1PTOH 1ET9A 2Y0SE 1SDFA 4MTNA 1SBBB 1DXMA 1VCIA 2JA9A 4HIOA 1HFNA 2K33A 3UDIA 5JAVA 4MNOA 2ZJRA 1N8RC 1SEBD 1YJNA 1XNRQ 1RD9D 5IP9G 3ZYYX 1SMYC 2WKDA 1EIHA 3U50C 3GTOH 1PLFA 4GNXA 2NVYH 1YZ6A 2FJ2A 3TP5A 3I4MB 4H02A 2X69A 1MIUA 3T53B 1OTCA 4QIWB 2MUYA 2TMPA 4K6DA 4LWCA 3NSWA 3KF6A 3SK4A 4QJFA 1S5BD 1TWFH 1C4QA 1HJPA 1EZ8A 4DR6Q 5IE8A 3CAMA 2FMCA 1PH1A 4A3CH 4HEDA 3SK8A 3KF8B 2BA1A 2K4KA 2IY5B 3EROA 1TWHH 1AP0A 3BVGA 1Y69U 2WP8J 1E0BA 2JA6G 4GKJL 1VQAA 4KD4A 4JYAQ 1JWMD 1P8LA 4KJOA 2KQ3A 1IHZA 4JBMA 4BA2I 1DGSA 3ERQA 3PIP3 4DR6L 4NMZA 4BBRB 3A55A 4ME3A 3OIPA 3DMUA 3VR2A 2D0OA 3VA7A 2FXQA 5C3XA 1HUMA 3VR4A 4JVZA 3NEMA 2A5HA 1SMXA 4PZ6A 2IX3A 4A3MB 3RLNA 4DV1Q 1STGA 2IW3A 3PMFA 1ZXTA 2WB1G 1EY9A 3VYRA 4FP5D 1D5XC 5IT9c 4JYAL 1PH9A 1M90C 1Z6HA 1Q8IA 3CCEA 3H94A 3BVMA 2R93H 5CBAE 1EL0A 3UDFA 4LF6Q 1RHPA 1NMFA 2AQ2B 3VR5A 4C3IB 1TY0A 1KL9A 5CV5A 1A3UA 1B3QA 3R3OA 1UEBA 5C3EG 2Z8LA 3T1YL 1A62A 2F0KA 1X9NA 1FVIA 4R8IA 4HJAA 1HZ9A 1SYDA 4AQYQ 1ICWA 3PUXA 4R4CA 1N36Q 4LF6L 4LFBQ 4UY8C 1QUQB 1Q81C 3S1QB 1U9RA 2EYFA 2LMCB 3S15H 1ASYA 1CSPA 4A3BG 2R7ZH 1X3QA 1XXGA 4UP8A 1GHJA 1B53A 1C9OA 1WFQA 1LYLA 4JI4Q 1A2UA 5C3WA 3HOXH 1TWGH 2QKIC 3JC66 5ELOA 2KHSA 4CJ2C 1LACA 1DCZA 4DUYQ 1E7ZA 1FJGQ 2K5DA 1N36L 1PRTC 4C3JB 3A8JE 1T5EA 5ELBA 2ZXPA 2EXZA 2L0CA 2I5HA 5GQOA 1LTLA 1I6HB 1K9MC 2ENBA 4H0LC 3RR5A 2GN5A 3FKIB 4QQBX 3SGIA 3E9HA 2PW7A 3MEFA 3OTOQ 1G291 4OONA 2XGTA 5EPKA 4A3JH 3TSSA 1X54A 3HOUB 3DEOA 1WCMH 2E5LL 1J5EQ 1PYBA 4DUYL 2L9HA 3DM1A 4DKAC 1BCPD 4KHZA 3SDZA 3G6EA 1L0WA 1TS5A 1GVPA 2DGYA 4OIJA 4IO9A 1WTRA 2ZTCA 1BCPB 1LM0A 4QL5A 1SFOH 2F0SA 3OTOL 4KKUA 1EIYB 3HG9A 1KAWA 2JXMB 2XRSD 5CGKA 1LT4D 1WI5A 2IHEA 3CQZH 2SNMA 3G6JB 1QCBD 4S3SA 1UAPA 4K5XA 1ZKOA 2AWNA 4IPHA 4JBKA 3ER0A 3BJUA 3BVZA 5C4XH 4A3IH 1PZJD 4X3UA 3NBIA 2N55A 1C7YA 3HOWB 1E2VA 1T9HA 2I5LX 4DV6Q 2UUBQ 3I90A 3CCQA 1Q82C 3KF6B 3S1RH 4A3DB 4BS9A 4KY7A 5BN3A 2FFKB 2DJFC 1JB3A 2RVLA 1G6ZA 4A3GB 2F0VA 1EFWA 4IUUA 4A93G 2R92H 1WOCA 5JVH3 3L9AX 4B3RQ 3K7UC 4J8QA 2RBMA 4Y52H 2UUBL 1EY4A 3M4PA 4JI6Q 1NJIC 5I2XA 4YCWA 1ESFA 4RKBA 2NVQB 1QJOA 4JI7Q 3MFGA 2NYZD 3TZDA 1JWUD 2JA7H 1QNUA 4LUZA 4FYDA 4TKOB 3TN2A 1BVSA 3J7AV 4B3RL 4DAMA 1IBLQ 1U4RA 4UAIA 1KD1C 4JI6L 4IURA 4BY7G 1DJRD 1BUVT 3CF5A 1LLRD 3ITPA 3P7JA 4HMJA 5FLXL 4RWSC 1HCZA 1SNCA 2IX0A 4JI7L 1Y1VH 2CH4A 3Q24A 1CQFA 2JYOA 2PCFB 5M5YH 1I5FA 1ZEQX 2WACA 4ZUJA 1IBLL 1D8LA 3TMEA 5JJZA 2CH4W 2BH8A 1I94Q 1PH2A 3K5MA 5KGUA 2F4IA 4P72A 1SE2A 1MBYA 2A68C 1KRSA 2F3WA 4DN4M 1BNZA 5IGCA 4X3KA 4NPSA 1BO0A 2WB1E 5GAEC 4OO1G 3HFZB 4HR7B 3S2HH 1TT2A 1HA5A 3L0OA 4YCVA 2E76C 4B3TL 3UE1A 4DF7A 2WAQB 4IUQA 4LFAQ 3G4SA 1SNQA 4DUZQ 1D5ZC 4DAPA 4HIKA 1Y14B 4BBSB 4LAAA 2E8GA 3I4MG 1B2TA 1IXRA 2JA5H 5EKKA 1HNWQ 1Q12A 4CKCA 1KHIA 2HDLA 1RDPD 1QE6A 3K5OA 3RLOA 4IFDJ 5I4DA 2ASBA 1STNA 4GN3B 4HMIA 1YHAA 1WYDA 4DNRB 4RCOA 1LTAD 3V2TA 5E1FA 2KECA 1L1OA 4BXXH 2L1BA 4LFAL 4DUZL 2B39A 1CHPD 2F0LA 4CHTB 1MI2A 3NBHA 3VYSA 1HNWL 4LF8Q 3NENA 3GTQB 2NZOA 4DXGA 2LKVA 5IYDG 4FXKC 3K0XA 1Y8PB 2Q8IB 2VY3A 1JOQA 5IT9L 1Q90A 4G7HC 1YI2A 2RHQB 4XTCS 1B9MA 1EWHA 2L5TA 2F3IA 4BBRG 2XRQD 2MQHA 2PQAA 2ZM6Q 5IYCH 5KRUA 4G4KA 3WOEA 3ULPA 2ZXRA 1IBKQ 2AHOB 2C9OA 3CW2C 2V1CC 5D65A 2JEBI 3UE0A 1WTXA 4IFDG 4A3MG 4LF8L 4Q0FA 3S2DH 4FXDA 2DJGC 1S4ZA 3AB9A 3KBXA 4UP9A 5G3LF 1X3FA 5JEAH 4DAYB 1Q46A 4QB4A 1Y1WH 5C0XG 1WTQA 4C3IG 4C3HH 3S1NB 1RTNA 2F0DA 4AYBE 1O80A 1M4VA 5GAHC 3RN5A 3TRZA 3T4AC 4JOIA 1QVCA 4JI8Q 2A74C 4FF2A 2NZHA 4RA8A 4DK3C 5CYUA 3CCMA 4HCEA 1GUNA 2KHJA 4KMUC 3C2PA 5ELDA 4I65A 4H13C 1RJTA 3U9SA 2AQ3B 4JI2L 1VQCA 3OYYA 3I72A 2B3GA 1Q86C 4OO1I 3QB3A 2K14A 1KLUD 2R7DA 1STHA 4IPDA 1PH7A 1JC7A 2E2IH 1VQIA 5EBCA 4CGYB 2DN8A 2K52A 4LUOA 4QF4A 4JI8L 4K0KL 4G7OC 4MHEA 2R61A 1AZPA 2E74C 1E1OA 4ZAIA 3HOVH 4LMQD 3S14H 1XPRA 3P75A 5FO7B 4H44C 5IP9H 4HJ9A 1RF2D 2H4OA 2EZVA 3FMCA 2VNUD 3MFYA 3D4WA 3JAME 1KDCA 5J3BA 4AYBB 3K58A 4C3JG 1EYGA 3M4OB 2N3SA 3D4DA 1J9OA 3V96A 3TBIB 1YNXA 3FKIG 2OQKA 3HOUG 3M9BA 3E6ZX 4P73A 2ZT9C 3LNNA 2VXWA 2K5QA 3DXJC 1LABA 4EGVA 3CC2A 4JCVE 3GTLB 2A8VA 2PMZB 1GUWA 1NBWA 1L2FA 1TWCH 1QVFA 2RDFA 2JA6H 4LK1C 3PO3B 3MTSA 1BCPC 3DEPA 2HCIA 2A19A 2F0PA 3EQLC 1SJED 4GOPB 4IFDI 2X6GA 4JC0A 1DONA 4QUFA 3WOFA 2YU9B 1A2TA 5LL6X 2F0EA 2K28A 5M5XB 4DR5Q 5EPJA 2QEJC 2JE6I 4XDXA 5J22A 3P20A 1WTOA 3R2TA 5GAGC 3W5OA 1QOHA 2YTVA 1GOZA 1HH2P 5H1SE 3KUPA 2OXPA 4B3SQ 3HOWG 1BBUA 3RNUA 2K6AA 1QUQA 3KBGA 2UXCQ 5CMDA 2F0TA 4IUPA 1D5MC 2R6GA 2RF4A 2O4XA 2GVBA 1GM5A 2L15A 4A3DG 5ELEA 2E2JH 1I4GA 4DR5L 5C3EH 1B4OA 3UDXA 1L0YB 2OWOA 3NQIA 1X56A 4A3GG 1K3BC 1L1OB 1YEZA 1ILPA 1U4LA 1WJJA 2DUDA 4I7AA 2OEOA 3RD4A 3G71A 4ZUIA 4B3SL 4X65Q 3AFQA 1DZ1A 1EYDA 2NWGA 1I6VC 3NBHB 4K5WA 2NVXH 3J81L 3ONAB 1PRTF 4LF9Q 2UXCL 3PCOB 3I8ZA 2AQ1B 1X55A 1WVLA 2J7ZA 1MJCA 5IIFA 2PW5A 1B70B 4OEMB 3PUVA 4WJ3M 1CSQA 2EJMA 2K5WA 4NDXA 4DK1A 3SVMA 3HOZB 1OXUA 1PTOF 1CKMA 2KHIA 1LV9A 3K7AB 4A3BH 2F0QA 2K75A 5JPMC 3PGZA 2F0WA 4RGOS 1EU4A 3SK6A 3U58A 2L4NA 4QIWE 4DV0Q 4OHJA 2EY5A 3MVVA 4F7XA 5FLMG 2VW9A 4ZKCB 4JI0Q 4X65L 1S5CD 2WIIB 1LO5D 5C5MA 4LF9L 2K04A 3HRZC 5FLXc 3LX0A 2H5XA 4FF3A 3OHXC 3NTKA 3S16H 2CQOA 1JE5A 1SNOA 4K2LA 4P74A 3A5UA 1VQ7A 1LTRD 5DM63 3AFPA 4KJNA 3CC4A 3NUCA 1KTKA 4R4TA 4JI0L 5LMNW 4L5QA 4O42A 2A6ED 3H3VC 1K73C 3A7AB 4EVOA 1VQ5A 1IYJB 3MWYW 1AE2A 2QDBA 1HHVA 4X64Q 3SHLA 2PYKA 3GTPB 1BBXC 2M00A 4BY1B 1MKHA 3T1HQ 2BDOA 2IL8A 5TSSA 1UE6A 1VDZA 3I73A 1H9SB 2CWPA 3H15A 1WCMB 1XNRL 3GTGB 1SSOA 4HIMA 2UUAQ 2KCMA 2WAQG 2HQLA 5DEHA 1SE8A 1HXYD 4X3TA 1Q1BA 4BBSG 2LXKA 4X64L 1A63A 3OMGA 3H0GG 4R8NA 3SR1A 1HZAA 1VQMA 2QEXA 3SE0A 3T1HL 2OTJA 5IGDA 2VB2X 1G91A 1GUOA 3HOYB 3RZOH 1ENFA 3CCJA 1A15A 4NKLA 5NUCA 3I4NB 4L8JA 1SE3A 2EDGA 1BR9A 1SYBA 2UUAL 1DOKA 4ZCKA 4KD3A 3GD7A 1HFGA 4A93H 3RLFA 1YHQA 2C5CA 1EZ6A 3UDGA 5JJLA 1BDOA 1H9KA 1B7YB 1EYCA 1VMPA 4A3KB 3PO2B 1O7LA 3SEBA 5IP7H 1T5XD 1PDQA 2BE5C 4DFAA 3FP9A 3E9IA 4HIDA 1CA5A 1XWEA 2VUMB 3M3YH 4RCNA 3I56A 2ATWA 4U673 4RHSA 1R9TH 5IYBG 2XNAC 4FF1A 4XT3B 1PH8A 4DV1L 3S9WA 4EQ5A 2F0HA 2KENA 2Z1CA 2E2HH 4BY7B 3GTJB 1EUJA 3GQBA 4ILWA 2GVAA 4Y7NB 4EQOA 4FXGC 2D5DA 5M5WB 3NTHA 1JMCA 3Q6SA 4PMBA 2F52A 4ME5A 2LFNA 2I0QA 1O7IA 3A8IE 2CQAA 2GA4B 3H3VI 2JA7B 4JI1Q 1HUNA 1HQMC 4OWXB 4MZ9A 1ILQA 2C35B 3MAQA 4AQYL 2RDHA 3RUZA 5IWAQ 3CCLA 4JI3Q 5JJKA 2E2DC 3SXHA 5M9OA 3K59A 1B8AA 1V1OA 4JW0A 5AJ3Q 1E2ZA 5C4JH 1EOTA 1DM0B 1SRUA 4X6AH 2G5DA 4LFBL 2B63B 4A3FB 2RQXA 1IYUA 3LWEA 3OOCA 3H6MA 5FK9C 3B6YA 2EYOA 5C44B 3K5NA 1MJEA 2LSSA 4JI1L 4DR7Q 1CI3M 5JVG3 2HT1A 4K5VA 4X3SA 4OO1H 4R4IA 4JI4L 1N34Q 4V190 3J80L 3QO2A 4IPCA 1KNEA 4JI3L 5IWAL 4DV5Q 1S5DD 1FJGL 5M3FB 4AYBG 3GTMB 3I4MH 5AJ3L 3CXCA 4GN4B 4HAEA 1EY0A 4LFCQ 1F2LA 4IUTA 4MTKA 1OXXK 1WTVA 2NVTB 1EEFD 2ZTEA 4LW1A 4N9PA 2PO4A 4C1NK 4K2KA 4A3LG 4RGMA 1N34L 4KK7A 1SNPA 5HY6A 2B2UC 4DV5L 1J5EL 2JJQA 2J4XA 5T1GA 2WFWA 2Q2TA 2Q8TA 4LFCL 3K6OA 4DAYA 1S72A 1PH6A 4L5SA 5EKIA 1Z7TA 4JG2A 5IYDH 3PO3G 1SXTA 1RCVD 2KCNA 4GOPC 4ZYSA 2CHBD 3MXUA 4H7BA 2ZJQA 2EJGC 3BU2A 1FD7D 1SROA 3IKJA 2OF1A 4OIKA 4X66Q 4BBRH 3M4YA 3RZDB 5D14A 4O2DA 4EQPA 2OTLA 2PZWA 5EJWA 4WJ4A 4XT1B 2KCTA 4MN3A 4RHRA 4IFDH 4A3MH 3M85A 2I5MX 2R3ZA 1JJGA 2G9DA 2BDNA 5IGGA 1NE3A 1EY7A 5C0XH 3N6RA 4DV6L 1K83B 3GV3A 1FGBD 2PPBC 1NNXA 1HA6A 3IRBA 4C3IH 2K1BA 3W2DA 4Q5VA 1C48A 3AMUA 2F4VQ 1PMRA 2N49A 2VB3X 2UU9Q 4XQNA 1L1OC 4M8AA 1Q1EA 1CQVA 2B8FA 4P2CB 2XSCA 3TQYA 3S2DB 3J81i 3STBD 4ZLTF 4ULLA 4FF4A 1A8VA 3J81c 4DR2Q 1YNND 5K5PA 3MA2B 2B8GA 3F2CA 3S17B 4B3MQ 1UE1A 3S1QH 4J1MA 3HOZG 2WAQE 4R1JA 3QIAA 1TU2B 2F4VL 1VQ6A 3EN2A 2BA0A 2UU9L 2PZTA 1PYSB 1W3SA 2EYMA 2XTIA 1E22A 1HNXQ 1QZHA 3GTKB 3HKZG 4R4QA 2B2UA 5DNFA 1F77A 1GJXA 5D3IB 1P16A 2O5JC 4ZRZA 3OW7A 4CBVA 4C3JH 1SYEA 5E3FA 4B3ML 1DYQA 2DNEA 2ZTDA 3NWSA 4A3EB 3BG3A 1STYA 1JCKB 5T1IA 1I3QB 1I6HH 1EOVA 4GOPA 4A4IA 1EQTA 5A2QE 4WFN3 4LF7Q 5KEEA 4L6TB 3FKIH 3ICEA 1HNXL 4IUVA 4JOIC 4B08A 1XMOQ 2HCCA 3HOVB 2MJ8A 3TDQA 1I4RA 1Z9FA 1XPUA 2F0NA 3HOUH 1UEAB 2NUCA 4IQZA 2CFMA 1UWVA 2NBFA 5D3DA 3S1MB 1I94L 3TREA 3D8GA 1TWAB 4NW2A 3KDFA 2A6EC 2SNSA 3H0GB 4N9TA 4BY1G 1VQHA 2F0FA 4CJ1B 4ZQ3A 2ICIA 4LF7L 1STAA 3W1BA 1K8OA 3VDYA 4IOCA 1TS3A 2Z0SA 1WCMG 5I9PA 3K8AA 2KEDA 1Q7YC 5CORA 1NSNS 3F2DA 5IGEA 5E4XA 3URYA 1TS2A 4CDEC 2UXDQ 1OXTA 3HOWH 3KOJA 4IALA 2BE5D 4XXEA 3T13A 3U4VA 3HOYG 1SR3A 4P71A 1VQEA 3I4NG 2A69D 5M3MB 2LS01 4A3DH 3OPOA 4HSPA 2IT1A 3DHQA 4KV6A 3BDOA 2JA8B 1AN8A 1YNJC 4A3GH 3L2PA 4PMCA 5E7NA 1N32Q 1BKBA 4CDFC 5DLQE 2UXDL 1OO9B 1RODA 1YJWA 1LT6D 3K5LA 4OX9Q 5F2DA 4X62Q 2XWBB 1VQ8A 3RMHA 4HJ5A 3BDLA 4A3KG 3PO2G 3H91A 3I2ZA 4C56C 2YV5A 5C6AA 4DAVA 2ZM6L 1VQLA 2VUMG 2NVQH 4DV7Q 2N78A 1QWYA 2AKWB 4M1UB 1IBKL 2J0TD 1I4HA 1BXTA 2EVBA 1JR0D 2Q2UA 5FLMH 1CFMA 5CR3A 3CU7A 4OX9L 4WJWA 2K7VA 3MXNA 1EU3A 4NXMQ 4DXFA 3GP7A 4GS3A 2MNAA 1ESRA 1Y8OB 1LTSD 1JJ2A 4DR4Q 1GUSA 4DR1Q 1I50B 2B2WC 4DV7L 3MHBA 1JORA 1H9SA 2PMZE 4WRDA 4YWKA 4ALPA 2JA7G 2RKSA 3C3LA 3JAMi 3R93A 5FKAC 5HURA 3JAMc 1WTHA 3TP7A 3HEJA 1NMGA 1GKHA 4IJHA 5I6WA 4NXML 4AIMA 2B2VA 4K8IA 1PTOD 1H9RA 3H3VH 1CM9A 1Z47A 3K81C 4DR4L 4KHPQ 4NP5A 2B63G 1O78A 3CHBD 4HN7A 4A3FG 2O5IC 1TY2A 1YVCA 1PTOB 2NN6G 4GZYC 4RMFA 3J7A5 5C44G 2JK8A 3OIQA 1X65A 3I4OA 3J80i 3QR8A 3EBEA 3J80c 1JICA 1NUCA 2F0MA 2JSOA 3ND9A 2OT2A 3KFUA 3GTOB 5L37A 5M3FG 2NVYB 4BBSH 2MHVA 3EIVA 5IOCA 4KHPL 4DV4Q 2EIFA 3D3RA 2VQFQ 4FNFA 2PQEA 3LWUA 1VQNA 4APVA 4YHHQ 4JV5Q 2RA4A 1YBYA 4IOAA 1TWFB 3Q22A 3A5ZB 3Q0AA 2LY7A 3IFDA 3N52A 1S40A 1IL2A 1SAPA 4DK0A 4O1NA 4YWMA 4DV2Q 1VMCA 3PUWA 2F03A 4TVAB 4DV4L 1TWHB 3A8KE 3GTQH 2VQFL 1S5FD 1E2WA 1UNSA 1IW7D 3M4QA 3EA6A 1VQGA 5FJ8G 1K0RA 3PF5A 3KDFB 4YHHL 4JV5L 3HKZE 5CV4A 1H95A 2OQ0A 4HJ8A 4R4OA 5JEAJ 3MC0B 5C4ZA 2VQEQ 2B2WA 4RAUC 1SE4A 2CW0D 3QG1A 4DK6C 5KYLA 1A3VA 4DV2L 1HR0W 5IYBH 3AYHB 3BZKA 3FPUB 1EQVA 1QZGA 2P5ZX 3OWFA 1PXUA 4PV1C 5I2YA 1F9QA 3D0FA 1B44D 1RL2A 2R93B 3L7ZC 4ODGA 5BN4A 3S1NH 1YJ9A 1GXDC 3EJIA 1TS4A 1ZYRD 2ES2A 2KOLA 1KIXA 1CT1D 1EWIA 3KJOA 2M2LA 2VL6A 2AMCB 1PFSA 2D9UA 1TQOA 3CRLC 2EOTA 4G7ZC 3HKZB 2WKCA 4PQXA 5BN5A 2NN6I 1V8QA 4LF5Q 3NWTA 1YITA 1RKNA 1UE5A 3ZJYC 3STBC 1VQJA 4RH6A 1SJHD 3BS1A 3F1ZA 4DPGA 1WD0A 3AQQA 1YNNC 1K0SA 2Q8RE 1GO3E 1MD2D 3S15B 4OWTB 5CC4A 2R7ZB 1WTWA 2NB0A 2EY2A 1C0AA 3NQTA 2RCFA 4DV0L 4C2MH 3A7LA 3QOJA 4ZKBB 1OXVA 3PV0A 3HOXB 1TVXA 1TWGB 3R8BA 4JBWA 4LF5L 1KLGD 1B9NA 3K0YA 4KHVA 1E1TA 3MXNB 1UE7A 3OMCA 4A3EG 3M4OH 1BBWA 3D6WA 3TEHB 3FRPB 3D6CA 3D4RA 3Q23A 2RDGA 5FLXE 1VQDA 3CPFA 4A3LH 3HOVG 1PFNA 1MSGA 1FNVA 4A3JB 3KK7A 4BA1I 2EXDA 2QW7A 3FHWA 1YIJA 2F0IA 4CJ0B 2R7FA 2XIWA 3HP3A 3X3NA 1ENAA 5COYA 5C5LA 4CDCC 1XTCD 3PSIA 3GTLH 3GO5A 5DAUA 1IBMQ 3F2BA 5E4WC 2ZJPA 2HHHQ 4GKJQ 2IWHA 3CCSA 3PO3H 1N9WA 3A56A 1PH5A 3CMEA 1O7YA 3ULJA 3EFXD 4FDBA 3AU7A 5EPLA 4CKBA 1G51A 1GUGA 4UP7A 1SFOB 1HZBA 1XMQQ 3VYTA 2LXJA 3TP8A 2YU9H 1YNJD 2EE1A 3CQZB 5M5XH 3ULLA 3OWEB 2Z9HA 2Y0SB 1KRTA 5DM73 4GN5A 2KJXA 5LHY1 1KXLA 1VQ4A 2HD3A 1IBML 2HHHL 4A3IB 5C4XB 1F2MA 2IHFA 1VQOA 4KN7C 3X3MA 4FVMA 2F0JA 1FGUA 2E75C 1U0LA 3J7ZC 4EQNA 4V0BA 4LUVA 1B3AA 4DR3Q 5M3MG 1XMQL 3T56B 3LGJA 1V43A 2HIVA 3S1RB 1FR3A 2D2CC 4GLXA 1EFID 2A69C 1LTGD 2PZUA 3T1YQ 3HZXA 2ID0A 2QCPX 1I4QA 2JA8G 1LUZA 2JEAI 1EY6A 2AWOA 2O2LD 2R92B 3R2IA 1VQ9A 1IKLA 1LTTD 2MFIA 1EQQA 2SEBD 4DR3L 3DWQA 2D0PA 1KC8C 4KY6A 5IT9E 4BY7H 3HOZH 2I07B 1HZCA 1Y8NB 4QY7A 5KNCA 2N88A 3K7AH 1PH4A 4BWGB 2PNRC 1RIPA 1U5KA 2K05A 4RFBA 3IL8A 2NTSA 1EY5A 1TXYA 1STEA 2CCZA 3QWNA 4ABNA 1CZGA 1HTPA 3I70A 1K8AC 1DD2A 1A6XA 2X6LA 4ZK9B 2A73B 2A6HC 3C1FA 3JAML 3DWPA 3MXGA 2MGSA 5I9OA 4FO2A 3FPPA 5EAYA 2G9HD 1EY8A 4NXNQ 5EGTA 3NTIA 2RSNA 3BZDB 3A0JA 4L5RC 1DOMA 4J15A 4KI0A 3AEVA 2H1EA 1WD1A 5I6YA 1Y1VB 3K80C 2KEEA 4B9XA 1CTMA 1ET6A 3I3CA 1CKNA 3MEHA 1N33Q 3PIOA 3E5SA 5M5YB 2E5LQ 3SK5A 5K36G 4P75A 1M8AA 4YCUA 4DA2A 1NR2A 4QMGA 3P1HA 1NR4A 3HGBA 4POGA 4NXNL 3GTPH 4LNQA 2F1MA 4BY1H 1PTOC 4PNYA 4KN4C 5KNBA 4HJ7A 4DGZA 2K50A 1X6OA 3KLSA 4DR7L 4DU9A 1LTBD 2QDLA 1XX8A 3ND8A 4I7ZC 1N33L 3S2HB 2VZAA 1Q3LA 3GTGH 1G6PA 1SYGA 3VR6A 5CV8A 5J39A 2WINB 5EQ0A 2EY1A 4N8FA 1VQFA 4LJZC 4DNTB 2F0GA 2SOBA 2ALYB 1JOKA 1DOLA 2JA5B 1H9JA 4XQJA 1STBA 3UI2A 4JK1C 2FHTA 2L11A 3HOYH 1ICFB 2HDMA 1X32A 3I4NH 3I4LA 1BQQT 2CKZB 4OXPA 1PV4A 2QILA 3CMAA 4IUNA 2BCOA 3VR3A 3OW2A 3CP0A 4KY5A 2Z6BA 1PH3A 3T51B 5JPNC 4A3CG 3ERSX 2XVSA 3KLWA 4UDUC 2EYLA 3E0EA 3HS0C 1HTLD 5JOBA 3J7AF 1G2TA 4GNXB 4XYOA 2KBNA 4GKKQ 3A74A 1SN8A 2KA7A 4A3KH 3PO2H 1IW7C 1RTOA 1M1KC 2UXBQ 1AFPA 4X66L 1A3TA 4JI5Q 3W1GA 1IZ6A 3EVQA 4AH6A 2VUMH 4K14A 3OSOA 4YIJA 1JT8A 4CDDC 2NZ1D 2D62A 1NCVA 3I7FA 4GKKL 2CW0C 1AW7A 2DNCA 5LL6S 1EIFA 4OL7A 1HNZQ 3PIO3 3L3OC 1VF5C 3CC7A 2EYJA 1H9MA 3GTJH 1LTID 2QGQA 1KNAA 4MIUA 1Y1WB 4Y7NH 5IP7G 2R93G 4RG1A 5M5WH 1XTDA 5ELNA 5CV6A 3WWVA 5FO9B 5GADC 2UXBL 4LF4Q 4JI5L 4C3HB 2A1AA 1FYCA 4UPAA 2B2TC 2QA4A 2HUGA 3U4ZA 4CKEA 5G3LD 2I46A 2Z4IA 5EBDA 1L0XB 1ZYRC 2B2YC 2OCEA 4UHVA 1HNZL 2M9VA 3HKSA 2KVMA 4DR2L 3NPPA 3NP8A 4Z9CB 3PQIA 3J81E 4KKSA 5LMUQ 1E3PA 4LF4L 3BYYB 2B63H 1GD7A 4R9WA 4XQQA 3M7GA 4DV3Q 4A3FH 2E2IB 4PG3A 2NN6H 2AUKA 2PNHA 3E0JA 1BCPF 1I4PA 1MGSA 4L63B 3WDNA 1QVGA 1ML0D 5C44H 2R7ZG 1XPOA 3KLSX 1SMYD 5CBEE 2DY7A 3J81j 3RN2A 1S5ED 4TSSA 5IODA 1XJVA 1UUPA 3S14B 2K5NA 1GUTA 1J8IA 1G8ZD 4PZ7A 4RGTA 4B3TQ 3HOXG 2Z6KC 4G57A 3M7NA 5M3FH 4QGUA 3GTMH 1HR0Q 1TIID 1D6EC 5LMUL 1VS0A 4DV3L 2NVTH 5C4HA 1JJCB 2EYPA 1A0IA 5J1ZA 1TKWB 2IPKD 3DUZA 2KUMA 1KDAA
chains in the Genus database with same CATH topology
3NXWA 2F3VA 5KIXA 4F8MA 1LT5D 2B2VC 2WV6D 1X3PA 5ISRA 3BYTB 1TWCB 2JA6B 1AEXA 4PMWA 4IN3A 3C1EA 3TZUA 3FEWX 1HPCA 1U4MA 5C0XJ 4TRDA 4HTHA 2B2TA 1D2BA 3D31A 4K6LA 4F87A 1KAAA 3H09A 2B2YA 1PYWD 2IX1A 2MP1A 2WB1B 3NHHA 4ID6A 4XYQA 4QCLA 4OGQC 1AZQA 1KABA 1V1PA 1IYVA 2Z4HA 2MPMA 2FMMA 5FOBB 2NTTA 3V05A 3BDCA 2E2JB 5C3EB 1TR5A 2K03A 1LT3D 2FINB 2A6HD 2EY6A 1F2YA 2L55A 4J6HA 2NVXB 1SYCA 3CRKC 1D1IA 3TP6A 1EWCA 1O7ZA 1W6KA 2ZXOA 1G2SA 3KLRA 4A3BB 1PRTD 2TSSA 2JP1A 3QJYA 3FDTA 2YYZA 3J7YW 1PRTB 4E6IA 1KDBA 1K8MA 2KCCA 2L12A 1MSHA 1R4PB 3IFTA 3S16B 2F0UA 1WTPA 2EJFC 1ONLA 2RSOA 3GV6A 4C2MB 1HRJA 3KF8A 5AFWA 1QG7A 5ELFA 1F2ZA 4RGNA 1IL8A 1D1KA 3T16A 3U9OA 1QNKA 2EYHA 4KKTA 3C46A 1EEID 1II3A 1F9SA 2ICEC 2XN9C 5A35A 3DWAA 1SNDA 3NE5B 1BOSA 1CHQD 3G7LA 4RKLA 3VA5A 1B50A 5KNDA 1ENCA 4B9WA 1SNMA 2IJ0A 3J80E 3I91A 4XIGS 4K8JA 1NAPA 2K01A 3PUYA 1OXSC 1I4XA 1SYFA 3MZ5A 3RZOB 3QOLA 1B1ZA 1QILA 1HQRD 2DY8A 3PUZA 3F2UA 2HQEA 1CZWA 4KTAA 1F9RA 1JWSD 5C0XI 1JQYD 1PZKD 1GHKA 3FVQA 1XYIA 4A93B 2CVRA 3IAYA 1U4PA 1IKMA 1PFBA 2F0OA 2XWJB 5FO8B 1BF4A 4HSVA 5ELCA 5EKLA 3M3YB 1PFMA 2BOSA 1R9TB 2EPBA 3VYUA 1W6JA 3A54A 3NK9A 4WORA 1EIGA 4IZ8A 5CV9A 1JOOA 5JEAG 4F88A 4QUCA 1JE4A 2V4DA 1FNUA 3CKIB 2E2HB 3O13A 1R4QB 1C8CA 1PZID 5A2QL 5IGFA 4C3HG 1CK1A 1V1PB 3W3AA 4C1NI 2K32A 4U68A 1F9PA 3MXPA 5KYIA 5HGTA 5K36H 1VF7A 2SDFA 4HCSA 2A68D 4TQUS 5CV7A 5IGBA 1QB5D 1EYAA 2AUJD 2QF7A 3K57A 1CA6A 5C4JB 1FNWA 1PTOH 1ET9A 1SDFA 1SBBB 1DXMA 1VCIA 1HFNA 2K33A 5JAVA 1SEBD 1RD9D 1EIHA 3ZYYX 1SMYC 2WKDA 1PLFA 2FJ2A 3TP5A 3I4MB 2X69A 3T53B 4QIWB 2MUYA 2TMPA 4K6DA 3NSWA 3SK4A 1S5BD 1C4QA 1EZ8A 2FMCA 4HEDA 3SK8A 2BA1A 3EROA 1AP0A 3BVGA 1Y69U 2WP8J 1E0BA 4KD4A 1JWMD 4KJOA 2KQ3A 1IHZA 4BA2I 3ERQA 3PIP3 4NMZA 4BBRB 3A55A 3OIPA 3DMUA 3VR2A 3VA7A 5C3XA 1HUMA 3VR4A 2A5HA 2IX3A 4A3MB 1STGA 2IW3A 3PMFA 1ZXTA 1EY9A 3VYRA 4FP5D 1D5XC 1Z6HA 1Q8IA 3H94A 3BVMA 5CBAE 1EL0A 1RHPA 2AQ2B 3VR5A 4C3IB 1TY0A 5CV5A 1A3UA 3R3OA 2Z8LA 2F0KA 4R8IA 1SYDA 1ICWA 3PUXA 3S1QB 1U9RA 2EYFA 2LMCB 1X3QA 1XXGA 1GHJA 1B53A 1A2UA 5C3WA 2QKIC 2KHSA 4CJ2C 1LACA 1DCZA 2K5DA 1PRTC 4C3JB 3A8JE 1T5EA 5ELBA 2ZXPA 2EXZA 2L0CA 1I6HB 2ENBA 4H0LC 3FKIB 2PW7A 1G291 5EPKA 3TSSA 3HOUB 3DEOA 2L9HA 3DM1A 3SDZA 1BCPD 4KHZA 1TS5A 4OIJA 1WTRA 1BCPB 2F0SA 4KKUA 3HG9A 2JXMB 2XRSD 5CGKA 1LT4D 2SNMA 3G6JB 1QCBD 4S3SA 1UAPA 4K5XA 1ZKOA 2AWNA 3BVZA 1PZJD 4X3UA 3NBIA 2N55A 3HOWB 1E2VA 3I90A 4A3DB 4BS9A 4KY7A 5BN3A 2FFKB 1JB3A 2RVLA 1G6ZA 4A3GB 2F0VA 4IUUA 5JVH3 3L9AX 4J8QA 2RBMA 1EY4A 5I2XA 1ESFA 4RKBA 2NVQB 1QJOA 3MFGA 2NYZD 3TZDA 1JWUD 1QNUA 4FYDA 4TKOB 3TN2A 3J7AV 1U4RA 4UAIA 4IURA 1DJRD 1BUVT 1LLRD 3ITPA 3P7JA 4HMJA 5FLXL 4RWSC 1HCZA 1SNCA 2IX0A 3Q24A 1CQFA 2JYOA 2PCFB 1ZEQX 2WACA 4ZUJA 3TMEA 5JJZA 3K5MA 5KGUA 2F4IA 1SE2A 1MBYA 2A68C 2F3WA 4DN4M 1BNZA 5IGCA 4X3KA 1BO0A 4OO1G 4HR7B 1TT2A 1HA5A 2E76C 4DF7A 2WAQB 4IUQA 1SNQA 1D5ZC 4DAPA 4BBSB 4LAAA 1B2TA 5EKKA 1Q12A 4CKCA 2HDLA 1RDPD 1QE6A 3K5OA 4IFDJ 5I4DA 1STNA 4HMIA 4DNRB 4RCOA 1LTAD 3V2TA 5E1FA 2KECA 2L1BA 2B39A 1CHPD 2F0LA 4CHTB 1MI2A 3NBHA 3VYSA 3GTQB 4DXGA 2LKVA 4FXKC 2Q8IB 1Y8PB 1JOQA 5IT9L 1Q90A 4G7HC 4XTCS 1B9MA 1EWHA 2L5TA 2XRQD 5KRUA 4G4KA 3WOEA 2ZXRA 2C9OA 5D65A 2JEBI 1WTXA 4IFDG 4Q0FA 4FXDA 1S4ZA 3AB9A 3KBXA 5G3LF 5JEAH 4QB4A 5C0XG 1WTQA 4C3IG 3S1NB 1RTNA 2F0DA 1O80A 1M4VA 3T4AC 4FF2A 2A74C 4RA8A 5CYUA 4HCEA 1GUNA 4KMUC 3C2PA 5ELDA 4I65A 4H13C 1RJTA 3U9SA 2AQ3B 3I72A 4OO1I 3QB3A 1KLUD 1STHA 1JC7A 5EBCA 4CGYB 2DN8A 4QF4A 4G7OC 4MHEA 2R61A 1AZPA 2E74C 4ZAIA 4LMQD 3P75A 5FO7B 4H44C 1RF2D 2H4OA 2EZVA 3FMCA 2VNUD 3MFYA 3D4WA 3JAME 1KDCA 4AYBB 3K58A 4C3JG 3M4OB 3D4DA 1J9OA 3V96A 3TBIB 3E6ZX 2ZT9C 3LNNA 2VXWA 2K5QA 3DXJC 1LABA 4EGVA 3GTLB 1GUWA 2PMZB 2RDFA 4LK1C 3PO3B 3MTSA 1BCPC 3DEPA 2HCIA 2F0PA 3EQLC 1SJED 4IFDI 2X6GA 1DONA 4QUFA 3WOFA 2YU9B 1A2TA 5LL6X 2F0EA 2K28A 5M5XB 5EPJA 2QEJC 2JE6I 4XDXA 5J22A 3P20A 1WTOA 3R2TA 1QOHA 1GOZA 3KUPA 2OXPA 2K6AA 3KBGA 5CMDA 2F0TA 4IUPA 1D5MC 2R6GA 2O4XA 5ELEA 1I4GA 1B4OA 1L0YB 3NQIA 1ILPA 1U4LA 3RD4A 2OEOA 4ZUIA 1DZ1A 1EYDA 2NWGA 1I6VC 4K5WA 3J81L 3ONAB 1PRTF 3I8ZA 2AQ1B 1WVLA 2J7ZA 5IIFA 2PW5A 3PUVA 2EJMA 2K5WA 4NDXA 3SVMA 4DK1A 3HOZB 4BY7B 1OXUA 1PTOF 1LV9A 3K7AB 2F0QA 5JPMC 2F0WA 4RGOS 1EU4A 3SK6A 2L4NA 4OHJA 2EY5A 3MVVA 4F7XA 4ZKCB 1S5CD 2WIIB 1LO5D 5C5MA 2K04A 3HRZC 3LX0A 4FF3A 3NTKA 3OHXC 1SNOA 4K2LA 1LTRD 5DM63 4KJNA 3NUCA 1KTKA 4O42A 2A6ED 3H3VC 3A7AB 4EVOA 3MWYW 2QDBA 1HHVA 3SHLA 2PYKA 3GTPB 1BBXC 2M00A 4BY1B 2BDOA 2IL8A 5TSSA 1VDZA 3I73A 1H9SB 1WCMB 3GTGB 1SSOA 5DEHA 1HXYD 4X3TA 1Q1BA 3OMGA 4R8NA 3SR1A 3SE0A 5IGDA 2VB2X 1G91A 1GUOA 3HOYB 1ENFA 1A15A 4NKLA 5NUCA 3I4NB 4L8JA 1SE3A 2EDGA 1BR9A 1SYBA 1DOKA 4KD3A 3GD7A 1HFGA 3RLFA 2C5CA 1EZ6A 1BDOA 1H9KA 1EYCA 1VMPA 4A3KB 3PO2B 1O7LA 3SEBA 1T5XD 1PDQA 2BE5C 4DFAA 1CA5A 1XWEA 2VUMB 4RCNA 4U673 4RHSA 2XNAC 4FF1A 4XT3B 3S9WA 2F0HA 2Z1CA 3GTJB 3GQBA 4ILWA 4Y7NB 4EQOA 4FXGC 2D5DA 5M5WB 3NTHA 3Q6SA 4PMBA 4ME5A 2LFNA 3A8IE 2CQAA 2GA4B 2JA7B 1HUNA 1HQMC 1ILQA 3MAQA 2RDHA 3RUZA 2E2DC 3SXHA 5M9OA 3K59A 1V1OA 1E2ZA 1EOTA 1DM0B 2B63B 4A3FB 2RQXA 1IYUA 3LWEA 3OOCA 3H6MA 5FK9C 2EYOA 5C44B 3K5NA 1CI3M 5JVG3 4K5VA 4X3SA 4OO1H 4V190 3J80L 3QO2A 1KNEA 1S5DD 5M3FB 3GTMB 4HAEA 1EY0A 1F2LA 4IUTA 1OXXK 1WTVA 2NVTB 1EEFD 4N9PA 2PO4A 4C1NK 4K2KA 4RGMA 4KK7A 1SNPA 2B2UC 2J4XA 5T1GA 2Q8TA 4DAYA 3K6OA 5EKIA 1Z7TA 1SXTA 1RCVD 2KCNA 4ZYSA 2CHBD 3MXUA 4H7BA 2EJGC 1FD7D 3IKJA 2OF1A 4OIKA 3M4YA 3RZDB 5D14A 4EQPA 2PZWA 5EJWA 4XT1B 4MN3A 4RHRA 4IFDH 3M85A 2R3ZA 2G9DA 2BDNA 5IGGA 1EY7A 5C0XH 3N6RA 1K83B 3GV3A 1FGBD 2PPBC 1HA6A 2K1BA 3W2DA 4Q5VA 1C48A 3AMUA 1PMRA 2VB3X 4XQNA 4M8AA 1Q1EA 1CQVA 2B8FA 4P2CB 2XSCA 3S2DB 4ZLTF 4ULLA 4FF4A 1YNND 5K5PA 2B8GA 3MA2B 3S17B 4J1MA 3QIAA 1TU2B 2BA0A 2PZTA 2EYMA 3GTKB 2B2UA 5DNFA 1F77A 1GJXA 5D3IB 2O5JC 4ZRZA 3OW7A 4CBVA 1SYEA 5E3FA 1DYQA 2DNEA 3NWSA 4A3EB 3BG3A 1STYA 1JCKB 5T1IA 1I3QB 5A2QE 1EQTA 4WFN3 5KEEA 4L6TB 4IUVA 4B08A 3HOVB 2HCCA 2MJ8A 3TDQA 1I4RA 2F0NA 1UEAB 2NUCA 4IQZA 2NBFA 5D3DA 3S1MB 3D8GA 1TWAB 4NW2A 2A6EC 2SNSA 3H0GB 4N9TA 2F0FA 4CJ1B 4ZQ3A 2ICIA 1STAA 1K8OA 1TS3A 5I9PA 2KEDA 5CORA 1NSNS 5IGEA 5E4XA 3URYA 1TS2A 1OXTA 4IALA 2BE5D 4XXEA 3T13A 2A69D 5M3MB 2LS01 3OPOA 4HSPA 2IT1A 3DHQA 4KV6A 3BDOA 2JA8B 1AN8A 1YNJC 4PMCA 1OO9B 1RODA 1LT6D 3K5LA 5F2DA 2XWBB 3RMHA 3BDLA 3H91A 4C56C 5C6AA 4DAVA 1QWYA 4M1UB 2J0TD 1I4HA 1BXTA 2EVBA 1JR0D 1CFMA 5CR3A 3CU7A 4WJWA 2K7VA 3MXNA 1EU3A 4DXFA 3GP7A 1ESRA 1Y8OB 1LTSD 1GUSA 1I50B 2B2WC 3MHBA 1JORA 1H9SA 4WRDA 2RKSA 3C3LA 3R93A 5FKAC 5HURA 3TP7A 3HEJA 5I6WA 2B2VA 4K8IA 1PTOD 1H9RA 1CM9A 1Z47A 4NP5A 1O78A 3CHBD 4HN7A 2O5IC 1TY2A 2NN6G 1PTOB 4GZYC 3OIQA 1JICA 1NUCA 2F0MA 2JSOA 3ND9A 2OT2A 3GTOB 2NVYB 2MHVA 5IOCA 3D3RA 4FNFA 2PQEA 3LWUA 2RA4A 1TWFB 3Q22A 3Q0AA 2LY7A 3IFDA 3N52A 1SAPA 4DK0A 4O1NA 1VMCA 3PUWA 2F03A 1TWHB 3A8KE 1S5FD 1E2WA 1UNSA 1IW7D 3EA6A 5CV4A 5JEAJ 3MC0B 5C4ZA 2B2WA 4RAUC 1SE4A 2CW0D 3QG1A 5KYLA 1A3VA 3FPUB 1EQVA 3OWFA 1PXUA 4PV1C 5I2YA 1F9QA 1B44D 2R93B 3L7ZC 4ODGA 5BN4A 1GXDC 3EJIA 1TS4A 1ZYRD 2KOLA 1CT1D 2M2LA 3CRLC 2D9UA 1TQOA 2EOTA 4G7ZC 3HKZB 2WKCA 4PQXA 5BN5A 2NN6I 1V8QA 3NWTA 1RKNA 4RH6A 1SJHD 3BS1A 1WD0A 1YNNC 2Q8RE 1MD2D 3S15B 5CC4A 2R7ZB 1WTWA 2NB0A 2EY2A 3NQTA 3A7LA 3QOJA 4ZKBB 1OXVA 3PV0A 3HOXB 1TVXA 1TWGB 3R8BA 4JBWA 1KLGD 1B9NA 3K0YA 4KHVA 3OMCA 3D6WA 3FRPB 3D6CA 3D4RA 3Q23A 2RDGA 5FLXE 1PFNA 1MSGA 1FNVA 4A3JB 3KK7A 4BA1I 2F0IA 4CJ0B 2XIWA 3HP3A 3X3NA 1ENAA 5COYA 5C5LA 1XTCD 3GO5A 5DAUA 5E4WC 2IWHA 3A56A 1O7YA 3EFXD 3AU7A 5EPLA 4CKBA 1GUGA 1SFOB 3VYTA 3TP8A 1YNJD 2EE1A 3CQZB 3OWEB 2Y0SB 5DM73 2KJXA 5LHY1 4A3IB 5C4XB 1F2MA 4KN7C 3X3MA 4FVMA 2F0JA 2E75C 4EQNA 4V0BA 1B3AA 3T56B 1V43A 3S1RB 1FR3A 2D2CC 1EFID 2A69C 1LTGD 2PZUA 2QCPX 2ID0A 3HZXA 1I4QA 2JEAI 1EY6A 2AWOA 2O2LD 2R92B 3R2IA 1IKLA 1LTTD 2SEBD 3DWQA 4KY6A 5IT9E 2I07B 1Y8NB 5KNCA 2N88A 4BWGB 2PNRC 2K05A 4RFBA 3IL8A 2NTSA 1EY5A 1STEA 3QWNA 4ABNA 1CZGA 1HTPA 3I70A 1DD2A 1A6XA 2X6LA 4ZK9B 2A73B 2A6HC 3C1FA 3JAML 3DWPA 3MXGA 2MGSA 5I9OA 4FO2A 3FPPA 2G9HD 1EY8A 5EGTA 3NTIA 2RSNA 3BZDB 1DOMA 4KI0A 2H1EA 1WD1A 5I6YA 1Y1VB 2KEEA 4B9XA 1CTMA 1ET6A 3I3CA 3MEHA 3E5SA 5M5YB 3SK5A 5K36G 1M8AA 4DA2A 4QMGA 1NR2A 3P1HA 1NR4A 3HGBA 2F1MA 1PTOC 4PNYA 4KN4C 5KNBA 4DGZA 3KLSA 4DU9A 1LTBD 4I7ZC 1XX8A 3ND8A 3S2HB 1Q3LA 3VR6A 1SYGA 5CV8A 5J39A 2WINB 5EQ0A 2EY1A 4LJZC 4DNTB 2F0GA 2SOBA 1JOKA 1DOLA 2JA5B 1H9JA 4XQJA 1STBA 3UI2A 4JK1C 2FHTA 2L11A 2HDMA 1X32A 3I4LA 1BQQT 2QILA 4IUNA 2BCOA 3VR3A 4KY5A 3T51B 5JPNC 2XVSA 4UDUC 2EYLA 3HS0C 1HTLD 5JOBA 3J7AF 1G2TA 4XYOA 2KA7A 1IW7C 1RTOA 1AFPA 1A3TA 3EVQA 4K14A 3OSOA 4YIJA 2NZ1D 2D62A 1NCVA 2CW0C 1AW7A 2DNCA 5LL6S 4OL7A 3PIO3 3L3OC 1VF5C 2EYJA 1H9MA 1LTID 1Y1WB 1KNAA 4MIUA 5CV6A 5FO9B 4C3HB 1FYCA 2B2TC 2HUGA 4CKEA 5G3LD 2I46A 2Z4IA 5EBDA 1L0XB 1ZYRC 2B2YC 2M9VA 2KVMA 3NPPA 3NP8A 4Z9CB 3J81E 4KKSA 3BYYB 4R9WA 4XQQA 3M7GA 2E2IB 2NN6H 2AUKA 3E0JA 3WDNA 1BCPF 1I4PA 1MGSA 4L63B 1ML0D 3KLSX 1SMYD 5CBEE 2DY7A 1S5ED 4TSSA 5IODA 1UUPA 3S14B 1GUTA 1J8IA 1G8ZD 4RGTA 4G57A 3M7NA 1TIID 1D6EC 5C4HA 2EYPA 5J1ZA 1TKWB 2IPKD 3DUZA 2KUMA 1KDAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPB A;  1G2T A;  1EOT A;  2JYO A;  1WTQ A;  1RTN A;  2N88 A;  2L12 A;  1MSH A;  4OIJ A;  1EIG A;  1SSO A;  1O80 A;  1TVX A;  3KUP A;  4ZLT F;  3LWE A;  1WTR A;  4QUC A;  5JJZ A;  2K05 A;  1JE4 A;  3IL8 A;  4X3T A;  1WTP A;  1HUM A;  4RA8 A;  2B2V C;  2RA4 A;  4X3S A;  5CMD A;  1X3P A;  1C8C A;  1RTO A;  4IUP A;  2RSO A;  1WTO A;  3GV6 A;  2X6L A;  4ZK9 B;  1HRJ A;  3D6W A;  5AFW A;  1ZXT A;  3QO2 A;  1KNE A;  1QG7 A;  1ROD A;  1RJT A;  4DN4 M;  1BNZ A;  3IFD A;  3N52 A;  1IL8 A;  1SAP A;  2NZ1 D;  2MGS A;  1G91 A;  1B4O A;  4X3K A;  1VMC A;  3H91 A;  5CBA E;  1EL0 A;  1A15 A;  1BO0 A;  1NCV A;  1PFN A;  1QNK A;  1RHP A;  4HAE A;  2RSN A;  1ILP A;  1MSG A;  1U4L A;  2B2U A;  5DNF A;  1F2L A;  1U4M A;  1DOM A;  4IUT A;  4X3U A;  4U68 A;  1WTV A;  1F9P A;  2B2T A;  4CJ0 B;  2N55 A;  2SDF A;  2XIW A;  4HCS A;  1DOK A;  1F9S A;  2NWG A;  3HP3 A;  4IUQ A;  1DZ1 A;  2H1E A;  3ONA B;  1WD1 A;  4MHE A;  5COY A;  1KNA A;  3G7L A;  3I8Z A;  1AZP A;  1WVL A;  2J7Z A;  1B50 A;  2KEE A;  1B2T A;  1CA6 A;  4ZAI A;  1HFG A;  3I90 A;  4LMQ D;  2B2Y A;  3I3C A;  3SVM A;  4R8I A;  5E4W C;  2HDL A;  2MP1 A;  2B2W A;  5T1I A;  1LV9 A;  2B2U C;  4RAU C;  1SDF A;  1EQT A;  1M8A A;  1ICW A;  1O7Y A;  1QE6 A;  2B2T C;  1NR2 A;  2FFK B;  1NR4 A;  2HUG A;  2RVL A;  5T1G A;  1VMP A;  3I91 A;  4IUV A;  5EPL A;  1AZQ A;  1G6Z A;  2L4N A;  2Q8T A;  1HFN A;  2HCC A;  1ESR A;  1PDQ A;  2MJ8 A;  4IUU A;  5EKI A;  1NAP A;  2K01 A;  3FPU B;  2B2Y C;  2MPM A;  1EIH A;  4ZKC B;  2FMM A;  2KEC A;  2EE1 A;  1CA5 A;  1J9O A;  1F9Q A;  2B2W C;  2L1B A;  1PLF A;  2K04 A;  2KVM A;  1X3Q A;  2K03 A;  2FIN B;  2FJ2 A;  1MI2 A;  3R93 A;  4NW2 A;  4XT3 B;  1B53 A;  1XX8 A;  2X69 A;  4ZKB B;  4OIK A;  2DY8 A;  1Q3L A;  4R9W A;  3F2U A;  1F9R A;  4CJ1 B;  5D14 A;  1MGS A;  4CJ2 C;  2B2V A;  5EQ0 A;  1ML0 D;  2VXW A;  2KOL A;  5EJW A;  2NYZ D;  5CBE E;  2DY7 A;  4XT1 B;  3TZD A;  4MN3 A;  2M2L A;  1CM9 A;  1B3A A;  1GUW A;  2D9U A;  2R3Z A;  1XYI A;  2EOT A;  1DOL A;  2BDN A;  3TN2 A;  3Q6S A;  2CVR A;  1J8I A;  2KED A;  1U4P A;  1O7Z A;  5COR A;  3UI2 A;  3MTS A;  2FHT A;  4O42 A;  1G2S A;  3DEP A;  1IKM A;  2L11 A;  1U4R A;  2HCI A;  4UAI A;  4HED A;  2HDM A;  3MWY W;  3GV3 A;  1X32 A;  1PFB A;  5E4X A;  5D65 A;  4IUR A;  1HHV A;  1HUN A;  1WTX A;  1HA6 A;  1ILQ A;  5EPK A;  1BF4 A;  1WD0 A;  2X6G A;  1AP0 A;  1JIC A;  1BBX C;  1S4Z A;  2K1B A;  4QUF A;  3KBX A;  2Q8R E;  1DON A;  1E0B A;  1IKL A;  3DEO A;  3P7J A;  4HSV A;  4RWS C;  2JP1 A;  2K28 A;  2L9H A;  1WTW A;  1PFM A;  5EPJ A;  3FDT A;  3DM1 A;  4XDX A;  2IL8 A;  2KUM A; 
#chains in the Genus database with same CATH topology
 1XMO L;  4A3J G;  3NXW A;  2F3V A;  5KIX A;  1CKN B;  4F8M A;  1LT5 D;  1HR0 L;  2B2V C;  3KJP A;  2WV6 D;  4O0A A;  1X3P A;  2K5V A;  3G48 A;  5ISR A;  3BYT B;  1TWC B;  1AH9 A;  2JA6 B;  1AEX A;  4PMW A;  4IN3 A;  5FJ8 H;  3C1E A;  3TZU A;  3FEW X;  1HPC A;  3NEL A;  3RZD H;  1U4M A;  4EX5 A;  5C0X J;  4TRD A;  1CKO A;  4HTH A;  2B2T A;  5HGQ A;  3TS0 A;  1D2B A;  3D31 A;  4K6L A;  2Y0S G;  1AE3 A;  4F87 A;  1KAA A;  5BR8 Q;  3H09 A;  2K5H A;  2B2Y A;  1PYW D;  4A3I G;  5C4X G;  2IX1 A;  2MP1 A;  2WB1 B;  3DLL A;  3NHH A;  3CPW A;  3F8T A;  4ID6 A;  4XYQ A;  1PVO A;  5LMN Q;  4QCL A;  1K83 H;  4OGQ C;  1AZQ A;  2HIX A;  1KAB A;  1V1P A;  1IYV A;  2Q2I A;  2Z4H A;  2BH2 A;  2MPM A;  1VQP A;  2FMM A;  5FOB B;  2NTT A;  3V05 A;  4GLV B;  1XNQ Q;  3BDC A;  2E2J B;  5C3E B;  1TR5 A;  2K03 A;  1CUK A;  1LT3 D;  2FIN B;  2A6H D;  5BR8 L;  1NY4 A;  4IJL A;  1YHB A;  1F2Y A;  2EY6 A;  2L55 A;  2R92 G;  2Z6K A;  1N32 L;  4J6H A;  5LMN L;  4A75 A;  3Q8D A;  4JI2 Q;  4X62 L;  2NVX B;  2JQO A;  3CCU A;  3S17 H;  3KYH C;  1SYC A;  1X3G A;  2YTY A;  1D1I A;  3CRK C;  4JBJ A;  3TP6 A;  4GLA C;  5GRO A;  1EWC A;  4KLK A;  1NTG A;  1O7Z A;  1W6K A;  1XNQ L;  2ZXO A;  1G2S A;  2JN4 A;  3KLR A;  2VS1 A;  4A3B B;  4K0K Q;  2PI2 A;  2RHS B;  1V1Q A;  3GTK H;  4JPB W;  1K8G A;  1PRT D;  2TSS A;  2JP1 A;  3QJY A;  1SLJ A;  4L5T A;  3FDT A;  2YYZ A;  1K28 A;  3PF4 A;  3J7Y W;  1PRT B;  4E6I A;  1KDB A;  4A3E H;  1K8M A;  1V9P A;  2KCC A;  1I3Q H;  2L12 A;  1MSH A;  1R4P B;  3IFT A;  4DR1 L;  3S16 B;  2F0U A;  2B29 A;  1WTP A;  2EJF C;  1Y1V G;  1ONL A;  2RSO A;  3GV6 A;  4C2M B;  2EQS A;  1HRJ A;  3KF8 A;  5AFW A;  1QG7 A;  5ELF A;  1F2Z A;  4RGN A;  1IL8 A;  4POF A;  1D1K A;  3T16 A;  2MO1 A;  3S1M H;  2N8N A;  1TWA H;  4OEL B;  3U9O A;  1EQR A;  1QNK A;  2EYH A;  4KKT A;  3H0G H;  3C46 A;  1EEI D;  1II3 A;  3E3X A;  1F9S A;  2ICE C;  2XN9 C;  3DWA A;  1SND A;  5A35 A;  3NE5 B;  1BOS A;  1CHQ D;  3G7L A;  4NB3 A;  4RKL A;  3VA5 A;  1B50 A;  1MHW C;  5KND A;  1ENC A;  4B9W A;  5IY0 A;  1J6Q A;  1SNM A;  2IJ0 A;  3J80 E;  3GDE A;  3I91 A;  4XIG S;  1E24 A;  2YTX A;  3CD6 A;  4K8J A;  1JB7 A;  1NAP A;  2K01 A;  2JA5 G;  3PUY A;  1OXS C;  1I4X A;  4YWL A;  2UUC Q;  1VQK A;  1SYF A;  3MZ5 A;  3RZO B;  3QOL A;  5M3M H;  4A76 A;  2MO0 A;  1B1Z A;  1QIL A;  1HQR D;  2DY8 A;  3PUZ A;  3F2U A;  2HQE A;  1CZW A;  4KTA A;  1F9R A;  1JWS D;  3DM3 A;  5C0X I;  4BXX G;  3CCR A;  1KQS A;  2JA8 H;  4GNX C;  1JQY D;  1PZK D;  1GHK A;  3FVQ A;  1W2B A;  1XYI A;  4A93 B;  2CVR A;  2CWA A;  3IAY A;  1U4P A;  1VQB A;  4N8X 1;  4PZ8 A;  2UUC L;  1IKM A;  1PFB A;  5JJI A;  2F0O A;  2XWJ B;  5FO8 B;  1BF4 A;  2VQE L;  1FL0 A;  4YY3 Q;  4HSV A;  5ELC A;  5EKL A;  5IYC G;  3M3Y B;  1PFM A;  2RCN A;  2BOS A;  1R9T B;  2EPB A;  2Q2H A;  3VYU A;  3CCV A;  1W6J A;  1K3R A;  3A54 A;  3I55 A;  3NK9 A;  4WOR A;  1EIG A;  4IZ8 A;  5CV9 A;  3S24 A;  1JOO A;  5JEA G;  1ASZ A;  4F88 A;  4QUC A;  1JE4 A;  2V4D A;  1FNU A;  3CKI B;  1Y1W G;  3PIP A;  2E2H B;  3O13 A;  2PI2 E;  1R4Q B;  1PA6 A;  1C8C A;  3BZC A;  3TS2 A;  4YY3 L;  1PZI D;  5A2Q L;  5IGF A;  4C3H G;  1I50 H;  1CK1 A;  1V1P B;  3W3A A;  2PQA B;  4DNI A;  4C1N I;  2K32 A;  4U68 A;  1F9P A;  3MXP A;  5KYI A;  5HGT A;  5K36 H;  1Q8K A;  1VF7 A;  2SDF A;  4HCS A;  2A68 D;  4TQU S;  5CV7 A;  5IGB A;  1QB5 D;  1EYA A;  2AUJ D;  2QF7 A;  4IPG A;  3K57 A;  1X3E A;  1S3O A;  1CA6 A;  5C4J B;  1PHJ A;  1D7Q A;  4OWW B;  1FNW A;  1PTO H;  1ET9 A;  2Y0S E;  1SDF A;  4MTN A;  1SBB B;  1DXM A;  1VCI A;  2JA9 A;  4HIO A;  1HFN A;  2K33 A;  3UDI A;  5JAV A;  4MNO A;  2ZJR A;  1N8R C;  1SEB D;  1YJN A;  1XNR Q;  1RD9 D;  5IP9 G;  3ZYY X;  1SMY C;  2WKD A;  1EIH A;  3U50 C;  3GTO H;  1PLF A;  4GNX A;  2NVY H;  1YZ6 A;  2FJ2 A;  3TP5 A;  3I4M B;  4H02 A;  2X69 A;  1MIU A;  3T53 B;  1OTC A;  4QIW B;  2MUY A;  2TMP A;  4K6D A;  4LWC A;  3NSW A;  3KF6 A;  3SK4 A;  4QJF A;  1S5B D;  1TWF H;  1C4Q A;  1HJP A;  1EZ8 A;  4DR6 Q;  5IE8 A;  3CAM A;  2FMC A;  1PH1 A;  4A3C H;  4HED A;  3SK8 A;  3KF8 B;  2BA1 A;  2K4K A;  2IY5 B;  3ERO A;  1TWH H;  1AP0 A;  3BVG A;  1Y69 U;  2WP8 J;  1E0B A;  2JA6 G;  4GKJ L;  1VQA A;  4KD4 A;  4JYA Q;  1JWM D;  1P8L A;  4KJO A;  2KQ3 A;  1IHZ A;  4JBM A;  4BA2 I;  1DGS A;  3ERQ A;  3PIP 3;  4DR6 L;  4NMZ A;  4BBR B;  3A55 A;  4ME3 A;  3OIP A;  3DMU A;  3VR2 A;  2D0O A;  3VA7 A;  2FXQ A;  5C3X A;  1HUM A;  3VR4 A;  4JVZ A;  3NEM A;  2A5H A;  1SMX A;  4PZ6 A;  2IX3 A;  4A3M B;  3RLN A;  4DV1 Q;  1STG A;  2IW3 A;  3PMF A;  1ZXT A;  2WB1 G;  1EY9 A;  3VYR A;  4FP5 D;  1D5X C;  5IT9 c;  4JYA L;  1PH9 A;  1M90 C;  1Z6H A;  1Q8I A;  3CCE A;  3H94 A;  3BVM A;  2R93 H;  5CBA E;  1EL0 A;  3UDF A;  4LF6 Q;  1RHP A;  1NMF A;  2AQ2 B;  3VR5 A;  4C3I B;  1TY0 A;  1KL9 A;  5CV5 A;  1A3U A;  1B3Q A;  3R3O A;  1UEB A;  5C3E G;  2Z8L A;  3T1Y L;  1A62 A;  2F0K A;  1X9N A;  1FVI A;  4R8I A;  4HJA A;  1HZ9 A;  1SYD A;  4AQY Q;  1ICW A;  3PUX A;  4R4C A;  1N36 Q;  4LF6 L;  4LFB Q;  4UY8 C;  1QUQ B;  1Q81 C;  3S1Q B;  1U9R A;  2EYF A;  2LMC B;  3S15 H;  1ASY A;  1CSP A;  4A3B G;  2R7Z H;  1X3Q A;  1XXG A;  4UP8 A;  1GHJ A;  1B53 A;  1C9O A;  1WFQ A;  1LYL A;  4JI4 Q;  1A2U A;  5C3W A;  3HOX H;  1TWG H;  2QKI C;  3JC6 6;  5ELO A;  2KHS A;  4CJ2 C;  1LAC A;  1DCZ A;  4DUY Q;  1E7Z A;  1FJG Q;  2K5D A;  1N36 L;  1PRT C;  4C3J B;  3A8J E;  1T5E A;  5ELB A;  2ZXP A;  2EXZ A;  2L0C A;  2I5H A;  5GQO A;  1LTL A;  1I6H B;  1K9M C;  2ENB A;  4H0L C;  3RR5 A;  2GN5 A;  3FKI B;  4QQB X;  3SGI A;  3E9H A;  2PW7 A;  3MEF A;  3OTO Q;  1G29 1;  4OON A;  2XGT A;  5EPK A;  4A3J H;  3TSS A;  1X54 A;  3HOU B;  3DEO A;  1WCM H;  2E5L L;  1J5E Q;  1PYB A;  4DUY L;  2L9H A;  3DM1 A;  4DKA C;  1BCP D;  4KHZ A;  3SDZ A;  3G6E A;  1L0W A;  1TS5 A;  1GVP A;  2DGY A;  4OIJ A;  4IO9 A;  1WTR A;  2ZTC A;  1BCP B;  1LM0 A;  4QL5 A;  1SFO H;  2F0S A;  3OTO L;  4KKU A;  1EIY B;  3HG9 A;  1KAW A;  2JXM B;  2XRS D;  5CGK A;  1LT4 D;  1WI5 A;  2IHE A;  3CQZ H;  2SNM A;  3G6J B;  1QCB D;  4S3S A;  1UAP A;  4K5X A;  1ZKO A;  2AWN A;  4IPH A;  4JBK A;  3ER0 A;  3BJU A;  3BVZ A;  5C4X H;  4A3I H;  1PZJ D;  4X3U A;  3NBI A;  2N55 A;  1C7Y A;  3HOW B;  1E2V A;  1T9H A;  2I5L X;  4DV6 Q;  2UUB Q;  3I90 A;  3CCQ A;  1Q82 C;  3KF6 B;  3S1R H;  4A3D B;  4BS9 A;  4KY7 A;  5BN3 A;  2FFK B;  2DJF C;  1JB3 A;  2RVL A;  1G6Z A;  4A3G B;  2F0V A;  1EFW A;  4IUU A;  4A93 G;  2R92 H;  1WOC A;  5JVH 3;  3L9A X;  4B3R Q;  3K7U C;  4J8Q A;  2RBM A;  4Y52 H;  2UUB L;  1EY4 A;  3M4P A;  4JI6 Q;  1NJI C;  5I2X A;  4YCW A;  1ESF A;  4RKB A;  2NVQ B;  1QJO A;  4JI7 Q;  3MFG A;  2NYZ D;  3TZD A;  1JWU D;  2JA7 H;  1QNU A;  4LUZ A;  4FYD A;  4TKO B;  3TN2 A;  1BVS A;  3J7A V;  4B3R L;  4DAM A;  1IBL Q;  1U4R A;  4UAI A;  1KD1 C;  4JI6 L;  4IUR A;  4BY7 G;  1DJR D;  1BUV T;  3CF5 A;  1LLR D;  3ITP A;  3P7J A;  4HMJ A;  5FLX L;  4RWS C;  1HCZ A;  1SNC A;  2IX0 A;  4JI7 L;  1Y1V H;  2CH4 A;  3Q24 A;  1CQF A;  2JYO A;  2PCF B;  5M5Y H;  1I5F A;  1ZEQ X;  2WAC A;  4ZUJ A;  1IBL L;  1D8L A;  3TME A;  5JJZ A;  2CH4 W;  2BH8 A;  1I94 Q;  1PH2 A;  3K5M A;  5KGU A;  2F4I A;  4P72 A;  1SE2 A;  1MBY A;  2A68 C;  1KRS A;  2F3W A;  4DN4 M;  1BNZ A;  5IGC A;  4X3K A;  4NPS A;  1BO0 A;  2WB1 E;  5GAE C;  4OO1 G;  3HFZ B;  4HR7 B;  3S2H H;  1TT2 A;  1HA5 A;  3L0O A;  4YCV A;  2E76 C;  4B3T L;  3UE1 A;  4DF7 A;  2WAQ B;  4IUQ A;  4LFA Q;  3G4S A;  1SNQ A;  4DUZ Q;  1D5Z C;  4DAP A;  4HIK A;  1Y14 B;  4BBS B;  4LAA A;  2E8G A;  3I4M G;  1B2T A;  1IXR A;  2JA5 H;  5EKK A;  1HNW Q;  1Q12 A;  4CKC A;  1KHI A;  2HDL A;  1RDP D;  1QE6 A;  3K5O A;  3RLO A;  4IFD J;  5I4D A;  2ASB A;  1STN A;  4GN3 B;  4HMI A;  1YHA A;  1WYD A;  4DNR B;  4RCO A;  1LTA D;  3V2T A;  5E1F A;  2KEC A;  1L1O A;  4BXX H;  2L1B A;  4LFA L;  4DUZ L;  2B39 A;  1CHP D;  2F0L A;  4CHT B;  1MI2 A;  3NBH A;  3VYS A;  1HNW L;  4LF8 Q;  3NEN A;  3GTQ B;  2NZO A;  4DXG A;  2LKV A;  5IYD G;  4FXK C;  3K0X A;  1Y8P B;  2Q8I B;  2VY3 A;  1JOQ A;  5IT9 L;  1Q90 A;  4G7H C;  1YI2 A;  2RHQ B;  4XTC S;  1B9M A;  1EWH A;  2L5T A;  2F3I A;  4BBR G;  2XRQ D;  2MQH A;  2PQA A;  2ZM6 Q;  5IYC H;  5KRU A;  4G4K A;  3WOE A;  3ULP A;  2ZXR A;  1IBK Q;  2AHO B;  2C9O A;  3CW2 C;  2V1C C;  5D65 A;  2JEB I;  3UE0 A;  1WTX A;  4IFD G;  4A3M G;  4LF8 L;  4Q0F A;  3S2D H;  4FXD A;  2DJG C;  1S4Z A;  3AB9 A;  3KBX A;  4UP9 A;  5G3L F;  1X3F A;  5JEA H;  4DAY B;  1Q46 A;  4QB4 A;  1Y1W H;  5C0X G;  1WTQ A;  4C3I G;  4C3H H;  3S1N B;  1RTN A;  2F0D A;  4AYB E;  1O80 A;  1M4V A;  5GAH C;  3RN5 A;  3TRZ A;  3T4A C;  4JOI A;  1QVC A;  4JI8 Q;  2A74 C;  4FF2 A;  2NZH A;  4RA8 A;  4DK3 C;  5CYU A;  3CCM A;  4HCE A;  1GUN A;  2KHJ A;  4KMU C;  3C2P A;  5ELD A;  4I65 A;  4H13 C;  1RJT A;  3U9S A;  2AQ3 B;  4JI2 L;  1VQC A;  3OYY A;  3I72 A;  2B3G A;  1Q86 C;  4OO1 I;  3QB3 A;  2K14 A;  1KLU D;  2R7D A;  1STH A;  4IPD A;  1PH7 A;  1JC7 A;  2E2I H;  1VQI A;  5EBC A;  4CGY B;  2DN8 A;  2K52 A;  4LUO A;  4QF4 A;  4JI8 L;  4K0K L;  4G7O C;  4MHE A;  2R61 A;  1AZP A;  2E74 C;  1E1O A;  4ZAI A;  3HOV H;  4LMQ D;  3S14 H;  1XPR A;  3P75 A;  5FO7 B;  4H44 C;  5IP9 H;  4HJ9 A;  1RF2 D;  2H4O A;  2EZV A;  3FMC A;  2VNU D;  3MFY A;  3D4W A;  3JAM E;  1KDC A;  5J3B A;  4AYB B;  3K58 A;  4C3J G;  1EYG A;  3M4O B;  2N3S A;  3D4D A;  1J9O A;  3V96 A;  3TBI B;  1YNX A;  3FKI G;  2OQK A;  3HOU G;  3M9B A;  3E6Z X;  4P73 A;  2ZT9 C;  3LNN A;  2VXW A;  2K5Q A;  3DXJ C;  1LAB A;  4EGV A;  3CC2 A;  4JCV E;  3GTL B;  2A8V A;  2PMZ B;  1GUW A;  1NBW A;  1L2F A;  1TWC H;  1QVF A;  2RDF A;  2JA6 H;  4LK1 C;  3PO3 B;  3MTS A;  1BCP C;  3DEP A;  2HCI A;  2A19 A;  2F0P A;  3EQL C;  1SJE D;  4GOP B;  4IFD I;  2X6G A;  4JC0 A;  1DON A;  4QUF A;  3WOF A;  2YU9 B;  1A2T A;  5LL6 X;  2F0E A;  2K28 A;  5M5X B;  4DR5 Q;  5EPJ A;  2QEJ C;  2JE6 I;  4XDX A;  5J22 A;  3P20 A;  1WTO A;  3R2T A;  5GAG C;  3W5O A;  1QOH A;  2YTV A;  1GOZ A;  1HH2 P;  5H1S E;  3KUP A;  2OXP A;  4B3S Q;  3HOW G;  1BBU A;  3RNU A;  2K6A A;  1QUQ A;  3KBG A;  2UXC Q;  5CMD A;  2F0T A;  4IUP A;  1D5M C;  2R6G A;  2RF4 A;  2O4X A;  2GVB A;  1GM5 A;  2L15 A;  4A3D G;  5ELE A;  2E2J H;  1I4G A;  4DR5 L;  5C3E H;  1B4O A;  3UDX A;  1L0Y B;  2OWO A;  3NQI A;  1X56 A;  4A3G G;  1K3B C;  1L1O B;  1YEZ A;  1ILP A;  1U4L A;  1WJJ A;  2DUD A;  4I7A A;  2OEO A;  3RD4 A;  3G71 A;  4ZUI A;  4B3S L;  4X65 Q;  3AFQ A;  1DZ1 A;  1EYD A;  2NWG A;  1I6V C;  3NBH B;  4K5W A;  2NVX H;  3J81 L;  3ONA B;  1PRT F;  4LF9 Q;  2UXC L;  3PCO B;  3I8Z A;  2AQ1 B;  1X55 A;  1WVL A;  2J7Z A;  1MJC A;  5IIF A;  2PW5 A;  1B70 B;  4OEM B;  3PUV A;  4WJ3 M;  1CSQ A;  2EJM A;  2K5W A;  4NDX A;  4DK1 A;  3SVM A;  3HOZ B;  1OXU A;  1PTO F;  1CKM A;  2KHI A;  1LV9 A;  3K7A B;  4A3B H;  2F0Q A;  2K75 A;  5JPM C;  3PGZ A;  2F0W A;  4RGO S;  1EU4 A;  3SK6 A;  3U58 A;  2L4N A;  4QIW E;  4DV0 Q;  4OHJ A;  2EY5 A;  3MVV A;  4F7X A;  5FLM G;  2VW9 A;  4ZKC B;  4JI0 Q;  4X65 L;  1S5C D;  2WII B;  1LO5 D;  5C5M A;  4LF9 L;  2K04 A;  3HRZ C;  5FLX c;  3LX0 A;  2H5X A;  4FF3 A;  3OHX C;  3NTK A;  3S16 H;  2CQO A;  1JE5 A;  1SNO A;  4K2L A;  4P74 A;  3A5U A;  1VQ7 A;  1LTR D;  5DM6 3;  3AFP A;  4KJN A;  3CC4 A;  3NUC A;  1KTK A;  4R4T A;  4JI0 L;  5LMN W;  4L5Q A;  4O42 A;  2A6E D;  3H3V C;  1K73 C;  3A7A B;  4EVO A;  1VQ5 A;  1IYJ B;  3MWY W;  1AE2 A;  2QDB A;  1HHV A;  4X64 Q;  3SHL A;  2PYK A;  3GTP B;  1BBX C;  2M00 A;  4BY1 B;  1MKH A;  3T1H Q;  2BDO A;  2IL8 A;  5TSS A;  1UE6 A;  1VDZ A;  3I73 A;  1H9S B;  2CWP A;  3H15 A;  1WCM B;  1XNR L;  3GTG B;  1SSO A;  4HIM A;  2UUA Q;  2KCM A;  2WAQ G;  2HQL A;  5DEH A;  1SE8 A;  1HXY D;  4X3T A;  1Q1B A;  4BBS G;  2LXK A;  4X64 L;  1A63 A;  3OMG A;  3H0G G;  4R8N A;  3SR1 A;  1HZA A;  1VQM A;  2QEX A;  3SE0 A;  3T1H L;  2OTJ A;  5IGD A;  2VB2 X;  1G91 A;  1GUO A;  3HOY B;  3RZO H;  1ENF A;  3CCJ A;  1A15 A;  4NKL A;  5NUC A;  3I4N B;  4L8J A;  1SE3 A;  2EDG A;  1BR9 A;  1SYB A;  2UUA L;  1DOK A;  4ZCK A;  4KD3 A;  3GD7 A;  1HFG A;  4A93 H;  3RLF A;  1YHQ A;  2C5C A;  1EZ6 A;  3UDG A;  5JJL A;  1BDO A;  1H9K A;  1B7Y B;  1EYC A;  1VMP A;  4A3K B;  3PO2 B;  1O7L A;  3SEB A;  5IP7 H;  1T5X D;  1PDQ A;  2BE5 C;  4DFA A;  3FP9 A;  3E9I A;  4HID A;  1CA5 A;  1XWE A;  2VUM B;  3M3Y H;  4RCN A;  3I56 A;  2ATW A;  4U67 3;  4RHS A;  1R9T H;  5IYB G;  2XNA C;  4FF1 A;  4XT3 B;  1PH8 A;  4DV1 L;  3S9W A;  4EQ5 A;  2F0H A;  2KEN A;  2Z1C A;  2E2H H;  4BY7 B;  3GTJ B;  1EUJ A;  3GQB A;  4ILW A;  2GVA A;  4Y7N B;  4EQO A;  4FXG C;  2D5D A;  5M5W B;  3NTH A;  1JMC A;  3Q6S A;  4PMB A;  2F52 A;  4ME5 A;  2LFN A;  2I0Q A;  1O7I A;  3A8I E;  2CQA A;  2GA4 B;  3H3V I;  2JA7 B;  4JI1 Q;  1HUN A;  1HQM C;  4OWX B;  4MZ9 A;  1ILQ A;  2C35 B;  3MAQ A;  4AQY L;  2RDH A;  3RUZ A;  5IWA Q;  3CCL A;  4JI3 Q;  5JJK A;  2E2D C;  3SXH A;  5M9O A;  3K59 A;  1B8A A;  1V1O A;  4JW0 A;  5AJ3 Q;  1E2Z A;  5C4J H;  1EOT A;  1DM0 B;  1SRU A;  4X6A H;  2G5D A;  4LFB L;  2B63 B;  4A3F B;  2RQX A;  1IYU A;  3LWE A;  3OOC A;  3H6M A;  5FK9 C;  3B6Y A;  2EYO A;  5C44 B;  3K5N A;  1MJE A;  2LSS A;  4JI1 L;  4DR7 Q;  1CI3 M;  5JVG 3;  2HT1 A;  4K5V A;  4X3S A;  4OO1 H;  4R4I A;  4JI4 L;  1N34 Q;  4V19 0;  3J80 L;  3QO2 A;  4IPC A;  1KNE A;  4JI3 L;  5IWA L;  4DV5 Q;  1S5D D;  1FJG L;  5M3F B;  4AYB G;  3GTM B;  3I4M H;  5AJ3 L;  3CXC A;  4GN4 B;  4HAE A;  1EY0 A;  4LFC Q;  1F2L A;  4IUT A;  4MTK A;  1OXX K;  1WTV A;  2NVT B;  1EEF D;  2ZTE A;  4LW1 A;  4N9P A;  2PO4 A;  4C1N K;  4K2K A;  4A3L G;  4RGM A;  1N34 L;  4KK7 A;  1SNP A;  5HY6 A;  2B2U C;  4DV5 L;  1J5E L;  2JJQ A;  2J4X A;  5T1G A;  2WFW A;  2Q2T A;  2Q8T A;  4LFC L;  3K6O A;  4DAY A;  1S72 A;  1PH6 A;  4L5S A;  5EKI A;  1Z7T A;  4JG2 A;  5IYD H;  3PO3 G;  1SXT A;  1RCV D;  2KCN A;  4GOP C;  4ZYS A;  2CHB D;  3MXU A;  4H7B A;  2ZJQ A;  2EJG C;  3BU2 A;  1FD7 D;  1SRO A;  3IKJ A;  2OF1 A;  4OIK A;  4X66 Q;  4BBR H;  3M4Y A;  3RZD B;  5D14 A;  4O2D A;  4EQP A;  2OTL A;  2PZW A;  5EJW A;  4WJ4 A;  4XT1 B;  2KCT A;  4MN3 A;  4RHR A;  4IFD H;  4A3M H;  3M85 A;  2I5M X;  2R3Z A;  1JJG A;  2G9D A;  2BDN A;  5IGG A;  1NE3 A;  1EY7 A;  5C0X H;  3N6R A;  4DV6 L;  1K83 B;  3GV3 A;  1FGB D;  2PPB C;  1NNX A;  1HA6 A;  3IRB A;  4C3I H;  2K1B A;  3W2D A;  4Q5V A;  1C48 A;  3AMU A;  2F4V Q;  1PMR A;  2N49 A;  2VB3 X;  2UU9 Q;  4XQN A;  1L1O C;  4M8A A;  1Q1E A;  1CQV A;  2B8F A;  4P2C B;  2XSC A;  3TQY A;  3S2D B;  3J81 i;  3STB D;  4ZLT F;  4ULL A;  4FF4 A;  1A8V A;  3J81 c;  4DR2 Q;  1YNN D;  5K5P A;  3MA2 B;  2B8G A;  3F2C A;  3S17 B;  4B3M Q;  1UE1 A;  3S1Q H;  4J1M A;  3HOZ G;  2WAQ E;  4R1J A;  3QIA A;  1TU2 B;  2F4V L;  1VQ6 A;  3EN2 A;  2BA0 A;  2UU9 L;  2PZT A;  1PYS B;  1W3S A;  2EYM A;  2XTI A;  1E22 A;  1HNX Q;  1QZH A;  3GTK B;  3HKZ G;  4R4Q A;  2B2U A;  5DNF A;  1F77 A;  1GJX A;  5D3I B;  1P16 A;  2O5J C;  4ZRZ A;  3OW7 A;  4CBV A;  4C3J H;  1SYE A;  5E3F A;  4B3M L;  1DYQ A;  2DNE A;  2ZTD A;  3NWS A;  4A3E B;  3BG3 A;  1STY A;  1JCK B;  5T1I A;  1I3Q B;  1I6H H;  1EOV A;  4GOP A;  4A4I A;  1EQT A;  5A2Q E;  4WFN 3;  4LF7 Q;  5KEE A;  4L6T B;  3FKI H;  3ICE A;  1HNX L;  4IUV A;  4JOI C;  4B08 A;  1XMO Q;  2HCC A;  3HOV B;  2MJ8 A;  3TDQ A;  1I4R A;  1Z9F A;  1XPU A;  2F0N A;  3HOU H;  1UEA B;  2NUC A;  4IQZ A;  2CFM A;  1UWV A;  2NBF A;  5D3D A;  3S1M B;  1I94 L;  3TRE A;  3D8G A;  1TWA B;  4NW2 A;  3KDF A;  2A6E C;  2SNS A;  3H0G B;  4N9T A;  4BY1 G;  1VQH A;  2F0F A;  4CJ1 B;  4ZQ3 A;  2ICI A;  4LF7 L;  1STA A;  3W1B A;  1K8O A;  3VDY A;  4IOC A;  1TS3 A;  2Z0S A;  1WCM G;  5I9P A;  3K8A A;  2KED A;  1Q7Y C;  5COR A;  1NSN S;  3F2D A;  5IGE A;  5E4X A;  3URY A;  1TS2 A;  4CDE C;  2UXD Q;  1OXT A;  3HOW H;  3KOJ A;  4IAL A;  2BE5 D;  4XXE A;  3T13 A;  3U4V A;  3HOY G;  1SR3 A;  4P71 A;  1VQE A;  3I4N G;  2A69 D;  5M3M B;  2LS0 1;  4A3D H;  3OPO A;  4HSP A;  2IT1 A;  3DHQ A;  4KV6 A;  3BDO A;  2JA8 B;  1AN8 A;  1YNJ C;  4A3G H;  3L2P A;  4PMC A;  5E7N A;  1N32 Q;  1BKB A;  4CDF C;  5DLQ E;  2UXD L;  1OO9 B;  1ROD A;  1YJW A;  1LT6 D;  3K5L A;  4OX9 Q;  5F2D A;  4X62 Q;  2XWB B;  1VQ8 A;  3RMH A;  4HJ5 A;  3BDL A;  4A3K G;  3PO2 G;  3H91 A;  3I2Z A;  4C56 C;  2YV5 A;  5C6A A;  4DAV A;  2ZM6 L;  1VQL A;  2VUM G;  2NVQ H;  4DV7 Q;  2N78 A;  1QWY A;  2AKW B;  4M1U B;  1IBK L;  2J0T D;  1I4H A;  1BXT A;  2EVB A;  1JR0 D;  2Q2U A;  5FLM H;  1CFM A;  5CR3 A;  3CU7 A;  4OX9 L;  4WJW A;  2K7V A;  3MXN A;  1EU3 A;  4NXM Q;  4DXF A;  3GP7 A;  4GS3 A;  2MNA A;  1ESR A;  1Y8O B;  1LTS D;  1JJ2 A;  4DR4 Q;  1GUS A;  4DR1 Q;  1I50 B;  2B2W C;  4DV7 L;  3MHB A;  1JOR A;  1H9S A;  2PMZ E;  4WRD A;  4YWK A;  4ALP A;  2JA7 G;  2RKS A;  3C3L A;  3JAM i;  3R93 A;  5FKA C;  5HUR A;  3JAM c;  1WTH A;  3TP7 A;  3HEJ A;  1NMG A;  1GKH A;  4IJH A;  5I6W A;  4NXM L;  4AIM A;  2B2V A;  4K8I A;  1PTO D;  1H9R A;  3H3V H;  1CM9 A;  1Z47 A;  3K81 C;  4DR4 L;  4KHP Q;  4NP5 A;  2B63 G;  1O78 A;  3CHB D;  4HN7 A;  4A3F G;  2O5I C;  1TY2 A;  1YVC A;  1PTO B;  2NN6 G;  4GZY C;  4RMF A;  3J7A 5;  5C44 G;  2JK8 A;  3OIQ A;  1X65 A;  3I4O A;  3J80 i;  3QR8 A;  3EBE A;  3J80 c;  1JIC A;  1NUC A;  2F0M A;  2JSO A;  3ND9 A;  2OT2 A;  3KFU A;  3GTO B;  5L37 A;  5M3F G;  2NVY B;  4BBS H;  2MHV A;  3EIV A;  5IOC A;  4KHP L;  4DV4 Q;  2EIF A;  3D3R A;  2VQF Q;  4FNF A;  2PQE A;  3LWU A;  1VQN A;  4APV A;  4YHH Q;  4JV5 Q;  2RA4 A;  1YBY A;  4IOA A;  1TWF B;  3Q22 A;  3A5Z B;  3Q0A A;  2LY7 A;  3IFD A;  3N52 A;  1S40 A;  1IL2 A;  1SAP A;  4DK0 A;  4O1N A;  4YWM A;  4DV2 Q;  1VMC A;  3PUW A;  2F03 A;  4TVA B;  4DV4 L;  1TWH B;  3A8K E;  3GTQ H;  2VQF L;  1S5F D;  1E2W A;  1UNS A;  1IW7 D;  3M4Q A;  3EA6 A;  1VQG A;  5FJ8 G;  1K0R A;  3PF5 A;  3KDF B;  4YHH L;  4JV5 L;  3HKZ E;  5CV4 A;  1H95 A;  2OQ0 A;  4HJ8 A;  4R4O A;  5JEA J;  3MC0 B;  5C4Z A;  2VQE Q;  2B2W A;  4RAU C;  1SE4 A;  2CW0 D;  3QG1 A;  4DK6 C;  5KYL A;  1A3V A;  4DV2 L;  1HR0 W;  5IYB H;  3AYH B;  3BZK A;  3FPU B;  1EQV A;  1QZG A;  2P5Z X;  3OWF A;  1PXU A;  4PV1 C;  5I2Y A;  1F9Q A;  3D0F A;  1B44 D;  1RL2 A;  2R93 B;  3L7Z C;  4ODG A;  5BN4 A;  3S1N H;  1YJ9 A;  1GXD C;  3EJI A;  1TS4 A;  1ZYR D;  2ES2 A;  2KOL A;  1KIX A;  1CT1 D;  1EWI A;  3KJO A;  2M2L A;  2VL6 A;  2AMC B;  1PFS A;  2D9U A;  1TQO A;  3CRL C;  2EOT A;  4G7Z C;  3HKZ B;  2WKC A;  4PQX A;  5BN5 A;  2NN6 I;  1V8Q A;  4LF5 Q;  3NWT A;  1YIT A;  1RKN A;  1UE5 A;  3ZJY C;  3STB C;  1VQJ A;  4RH6 A;  1SJH D;  3BS1 A;  3F1Z A;  4DPG A;  1WD0 A;  3AQQ A;  1YNN C;  1K0S A;  2Q8R E;  1GO3 E;  1MD2 D;  3S15 B;  4OWT B;  5CC4 A;  2R7Z B;  1WTW A;  2NB0 A;  2EY2 A;  1C0A A;  3NQT A;  2RCF A;  4DV0 L;  4C2M H;  3A7L A;  3QOJ A;  4ZKB B;  1OXV A;  3PV0 A;  3HOX B;  1TVX A;  1TWG B;  3R8B A;  4JBW A;  4LF5 L;  1KLG D;  1B9N A;  3K0Y A;  4KHV A;  1E1T A;  3MXN B;  1UE7 A;  3OMC A;  4A3E G;  3M4O H;  1BBW A;  3D6W A;  3TEH B;  3FRP B;  3D6C A;  3D4R A;  3Q23 A;  2RDG A;  5FLX E;  1VQD A;  3CPF A;  4A3L H;  3HOV G;  1PFN A;  1MSG A;  1FNV A;  4A3J B;  3KK7 A;  4BA1 I;  2EXD A;  2QW7 A;  3FHW A;  1YIJ A;  2F0I A;  4CJ0 B;  2R7F A;  2XIW A;  3HP3 A;  3X3N A;  1ENA A;  5COY A;  5C5L A;  4CDC C;  1XTC D;  3PSI A;  3GTL H;  3GO5 A;  5DAU A;  1IBM Q;  3F2B A;  5E4W C;  2ZJP A;  2HHH Q;  4GKJ Q;  2IWH A;  3CCS A;  3PO3 H;  1N9W A;  3A56 A;  1PH5 A;  3CME A;  1O7Y A;  3ULJ A;  3EFX D;  4FDB A;  3AU7 A;  5EPL A;  4CKB A;  1G51 A;  1GUG A;  4UP7 A;  1SFO B;  1HZB A;  1XMQ Q;  3VYT A;  2LXJ A;  3TP8 A;  2YU9 H;  1YNJ D;  2EE1 A;  3CQZ B;  5M5X H;  3ULL A;  3OWE B;  2Z9H A;  2Y0S B;  1KRT A;  5DM7 3;  4GN5 A;  2KJX A;  5LHY 1;  1KXL A;  1VQ4 A;  2HD3 A;  1IBM L;  2HHH L;  4A3I B;  5C4X B;  1F2M A;  2IHF A;  1VQO A;  4KN7 C;  3X3M A;  4FVM A;  2F0J A;  1FGU A;  2E75 C;  1U0L A;  3J7Z C;  4EQN A;  4V0B A;  4LUV A;  1B3A A;  4DR3 Q;  5M3M G;  1XMQ L;  3T56 B;  3LGJ A;  1V43 A;  2HIV A;  3S1R B;  1FR3 A;  2D2C C;  4GLX A;  1EFI D;  2A69 C;  1LTG D;  2PZU A;  3T1Y Q;  3HZX A;  2ID0 A;  2QCP X;  1I4Q A;  2JA8 G;  1LUZ A;  2JEA I;  1EY6 A;  2AWO A;  2O2L D;  2R92 B;  3R2I A;  1VQ9 A;  1IKL A;  1LTT D;  2MFI A;  1EQQ A;  2SEB D;  4DR3 L;  3DWQ A;  2D0P A;  1KC8 C;  4KY6 A;  5IT9 E;  4BY7 H;  3HOZ H;  2I07 B;  1HZC A;  1Y8N B;  4QY7 A;  5KNC A;  2N88 A;  3K7A H;  1PH4 A;  4BWG B;  2PNR C;  1RIP A;  1U5K A;  2K05 A;  4RFB A;  3IL8 A;  2NTS A;  1EY5 A;  1TXY A;  1STE A;  2CCZ A;  3QWN A;  4ABN A;  1CZG A;  1HTP A;  3I70 A;  1K8A C;  1DD2 A;  1A6X A;  2X6L A;  4ZK9 B;  2A73 B;  2A6H C;  3C1F A;  3JAM L;  3DWP A;  3MXG A;  2MGS A;  5I9O A;  4FO2 A;  3FPP A;  5EAY A;  2G9H D;  1EY8 A;  4NXN Q;  5EGT A;  3NTI A;  2RSN A;  3BZD B;  3A0J A;  4L5R C;  1DOM A;  4J15 A;  4KI0 A;  3AEV A;  2H1E A;  1WD1 A;  5I6Y A;  1Y1V B;  3K80 C;  2KEE A;  4B9X A;  1CTM A;  1ET6 A;  3I3C A;  1CKN A;  3MEH A;  1N33 Q;  3PIO A;  3E5S A;  5M5Y B;  2E5L Q;  3SK5 A;  5K36 G;  4P75 A;  1M8A A;  4YCU A;  4DA2 A;  1NR2 A;  4QMG A;  3P1H A;  1NR4 A;  3HGB A;  4POG A;  4NXN L;  3GTP H;  4LNQ A;  2F1M A;  4BY1 H;  1PTO C;  4PNY A;  4KN4 C;  5KNB A;  4HJ7 A;  4DGZ A;  2K50 A;  1X6O A;  3KLS A;  4DR7 L;  4DU9 A;  1LTB D;  2QDL A;  1XX8 A;  3ND8 A;  4I7Z C;  1N33 L;  3S2H B;  2VZA A;  1Q3L A;  3GTG H;  1G6P A;  1SYG A;  3VR6 A;  5CV8 A;  5J39 A;  2WIN B;  5EQ0 A;  2EY1 A;  4N8F A;  1VQF A;  4LJZ C;  4DNT B;  2F0G A;  2SOB A;  2ALY B;  1JOK A;  1DOL A;  2JA5 B;  1H9J A;  4XQJ A;  1STB A;  3UI2 A;  4JK1 C;  2FHT A;  2L11 A;  3HOY H;  1ICF B;  2HDM A;  1X32 A;  3I4N H;  3I4L A;  1BQQ T;  2CKZ B;  4OXP A;  1PV4 A;  2QIL A;  3CMA A;  4IUN A;  2BCO A;  3VR3 A;  3OW2 A;  3CP0 A;  4KY5 A;  2Z6B A;  1PH3 A;  3T51 B;  5JPN C;  4A3C G;  3ERS X;  2XVS A;  3KLW A;  4UDU C;  2EYL A;  3E0E A;  3HS0 C;  1HTL D;  5JOB A;  3J7A F;  1G2T A;  4GNX B;  4XYO A;  2KBN A;  4GKK Q;  3A74 A;  1SN8 A;  2KA7 A;  4A3K H;  3PO2 H;  1IW7 C;  1RTO A;  1M1K C;  2UXB Q;  1AFP A;  4X66 L;  1A3T A;  4JI5 Q;  3W1G A;  1IZ6 A;  3EVQ A;  4AH6 A;  2VUM H;  4K14 A;  3OSO A;  4YIJ A;  1JT8 A;  4CDD C;  2NZ1 D;  2D62 A;  1NCV A;  3I7F A;  4GKK L;  2CW0 C;  1AW7 A;  2DNC A;  5LL6 S;  1EIF A;  4OL7 A;  1HNZ Q;  3PIO 3;  3L3O C;  1VF5 C;  3CC7 A;  2EYJ A;  1H9M A;  3GTJ H;  1LTI D;  2QGQ A;  1KNA A;  4MIU A;  1Y1W B;  4Y7N H;  5IP7 G;  2R93 G;  4RG1 A;  5M5W H;  1XTD A;  5ELN A;  5CV6 A;  3WWV A;  5FO9 B;  5GAD C;  2UXB L;  4LF4 Q;  4JI5 L;  4C3H B;  2A1A A;  1FYC A;  4UPA A;  2B2T C;  2QA4 A;  2HUG A;  3U4Z A;  4CKE A;  5G3L D;  2I46 A;  2Z4I A;  5EBD A;  1L0X B;  1ZYR C;  2B2Y C;  2OCE A;  4UHV A;  1HNZ L;  2M9V A;  3HKS A;  2KVM A;  4DR2 L;  3NPP A;  3NP8 A;  4Z9C B;  3PQI A;  3J81 E;  4KKS A;  5LMU Q;  1E3P A;  4LF4 L;  3BYY B;  2B63 H;  1GD7 A;  4R9W A;  4XQQ A;  3M7G A;  4DV3 Q;  4A3F H;  2E2I B;  4PG3 A;  2NN6 H;  2AUK A;  2PNH A;  3E0J A;  1BCP F;  1I4P A;  1MGS A;  4L63 B;  3WDN A;  1QVG A;  1ML0 D;  5C44 H;  2R7Z G;  1XPO A;  3KLS X;  1SMY D;  5CBE E;  2DY7 A;  3J81 j;  3RN2 A;  1S5E D;  4TSS A;  5IOD A;  1XJV A;  1UUP A;  3S14 B;  2K5N A;  1GUT A;  1J8I A;  1G8Z D;  4PZ7 A;  4RGT A;  4B3T Q;  3HOX G;  2Z6K C;  4G57 A;  3M7N A;  5M3F H;  4QGU A;  3GTM H;  1HR0 Q;  1TII D;  1D6E C;  5LMU L;  1VS0 A;  4DV3 L;  2NVT H;  5C4H A;  1JJC B;  2EYP A;  1A0I A;  5J1Z A;  1TKW B;  2IPK D;  3DUZ A;  2KUM A;  1KDA A; 
#chains in the Genus database with same CATH homology
 3NXW A;  2F3V A;  5KIX A;  4F8M A;  1LT5 D;  2B2V C;  2WV6 D;  1X3P A;  5ISR A;  3BYT B;  1TWC B;  2JA6 B;  1AEX A;  4PMW A;  4IN3 A;  3C1E A;  3TZU A;  3FEW X;  1HPC A;  1U4M A;  5C0X J;  4TRD A;  4HTH A;  2B2T A;  1D2B A;  3D31 A;  4K6L A;  4F87 A;  1KAA A;  3H09 A;  2B2Y A;  1PYW D;  2IX1 A;  2MP1 A;  2WB1 B;  3NHH A;  4ID6 A;  4XYQ A;  4QCL A;  4OGQ C;  1AZQ A;  1KAB A;  1V1P A;  1IYV A;  2Z4H A;  2MPM A;  2FMM A;  5FOB B;  2NTT A;  3V05 A;  3BDC A;  2E2J B;  5C3E B;  1TR5 A;  2K03 A;  1LT3 D;  2FIN B;  2A6H D;  2EY6 A;  1F2Y A;  2L55 A;  4J6H A;  2NVX B;  1SYC A;  3CRK C;  1D1I A;  3TP6 A;  1EWC A;  1O7Z A;  1W6K A;  2ZXO A;  1G2S A;  3KLR A;  4A3B B;  1PRT D;  2TSS A;  2JP1 A;  3QJY A;  3FDT A;  2YYZ A;  3J7Y W;  1PRT B;  4E6I A;  1KDB A;  1K8M A;  2KCC A;  2L12 A;  1MSH A;  1R4P B;  3IFT A;  3S16 B;  2F0U A;  1WTP A;  2EJF C;  1ONL A;  2RSO A;  3GV6 A;  4C2M B;  1HRJ A;  3KF8 A;  5AFW A;  1QG7 A;  5ELF A;  1F2Z A;  4RGN A;  1IL8 A;  1D1K A;  3T16 A;  3U9O A;  1QNK A;  2EYH A;  4KKT A;  3C46 A;  1EEI D;  1II3 A;  1F9S A;  2ICE C;  2XN9 C;  5A35 A;  3DWA A;  1SND A;  3NE5 B;  1BOS A;  1CHQ D;  3G7L A;  4RKL A;  3VA5 A;  1B50 A;  5KND A;  1ENC A;  4B9W A;  1SNM A;  2IJ0 A;  3J80 E;  3I91 A;  4XIG S;  4K8J A;  1NAP A;  2K01 A;  3PUY A;  1OXS C;  1I4X A;  1SYF A;  3MZ5 A;  3RZO B;  3QOL A;  1B1Z A;  1QIL A;  1HQR D;  2DY8 A;  3PUZ A;  3F2U A;  2HQE A;  1CZW A;  4KTA A;  1F9R A;  1JWS D;  5C0X I;  1JQY D;  1PZK D;  1GHK A;  3FVQ A;  1XYI A;  4A93 B;  2CVR A;  3IAY A;  1U4P A;  1IKM A;  1PFB A;  2F0O A;  2XWJ B;  5FO8 B;  1BF4 A;  4HSV A;  5ELC A;  5EKL A;  3M3Y B;  1PFM A;  2BOS A;  1R9T B;  2EPB A;  3VYU A;  1W6J A;  3A54 A;  3NK9 A;  4WOR A;  1EIG A;  4IZ8 A;  5CV9 A;  1JOO A;  5JEA G;  4F88 A;  4QUC A;  1JE4 A;  2V4D A;  1FNU A;  3CKI B;  2E2H B;  3O13 A;  1R4Q B;  1C8C A;  1PZI D;  5A2Q L;  5IGF A;  4C3H G;  1CK1 A;  1V1P B;  3W3A A;  4C1N I;  2K32 A;  4U68 A;  1F9P A;  3MXP A;  5KYI A;  5HGT A;  5K36 H;  1VF7 A;  2SDF A;  4HCS A;  2A68 D;  4TQU S;  5CV7 A;  5IGB A;  1QB5 D;  1EYA A;  2AUJ D;  2QF7 A;  3K57 A;  1CA6 A;  5C4J B;  1FNW A;  1PTO H;  1ET9 A;  1SDF A;  1SBB B;  1DXM A;  1VCI A;  1HFN A;  2K33 A;  5JAV A;  1SEB D;  1RD9 D;  1EIH A;  3ZYY X;  1SMY C;  2WKD A;  1PLF A;  2FJ2 A;  3TP5 A;  3I4M B;  2X69 A;  3T53 B;  4QIW B;  2MUY A;  2TMP A;  4K6D A;  3NSW A;  3SK4 A;  1S5B D;  1C4Q A;  1EZ8 A;  2FMC A;  4HED A;  3SK8 A;  2BA1 A;  3ERO A;  1AP0 A;  3BVG A;  1Y69 U;  2WP8 J;  1E0B A;  4KD4 A;  1JWM D;  4KJO A;  2KQ3 A;  1IHZ A;  4BA2 I;  3ERQ A;  3PIP 3;  4NMZ A;  4BBR B;  3A55 A;  3OIP A;  3DMU A;  3VR2 A;  3VA7 A;  5C3X A;  1HUM A;  3VR4 A;  2A5H A;  2IX3 A;  4A3M B;  1STG A;  2IW3 A;  3PMF A;  1ZXT A;  1EY9 A;  3VYR A;  4FP5 D;  1D5X C;  1Z6H A;  1Q8I A;  3H94 A;  3BVM A;  5CBA E;  1EL0 A;  1RHP A;  2AQ2 B;  3VR5 A;  4C3I B;  1TY0 A;  5CV5 A;  1A3U A;  3R3O A;  2Z8L A;  2F0K A;  4R8I A;  1SYD A;  1ICW A;  3PUX A;  3S1Q B;  1U9R A;  2EYF A;  2LMC B;  1X3Q A;  1XXG A;  1GHJ A;  1B53 A;  1A2U A;  5C3W A;  2QKI C;  2KHS A;  4CJ2 C;  1LAC A;  1DCZ A;  2K5D A;  1PRT C;  4C3J B;  3A8J E;  1T5E A;  5ELB A;  2ZXP A;  2EXZ A;  2L0C A;  1I6H B;  2ENB A;  4H0L C;  3FKI B;  2PW7 A;  1G29 1;  5EPK A;  3TSS A;  3HOU B;  3DEO A;  2L9H A;  3DM1 A;  3SDZ A;  1BCP D;  4KHZ A;  1TS5 A;  4OIJ A;  1WTR A;  1BCP B;  2F0S A;  4KKU A;  3HG9 A;  2JXM B;  2XRS D;  5CGK A;  1LT4 D;  2SNM A;  3G6J B;  1QCB D;  4S3S A;  1UAP A;  4K5X A;  1ZKO A;  2AWN A;  3BVZ A;  1PZJ D;  4X3U A;  3NBI A;  2N55 A;  3HOW B;  1E2V A;  3I90 A;  4A3D B;  4BS9 A;  4KY7 A;  5BN3 A;  2FFK B;  1JB3 A;  2RVL A;  1G6Z A;  4A3G B;  2F0V A;  4IUU A;  5JVH 3;  3L9A X;  4J8Q A;  2RBM A;  1EY4 A;  5I2X A;  1ESF A;  4RKB A;  2NVQ B;  1QJO A;  3MFG A;  2NYZ D;  3TZD A;  1JWU D;  1QNU A;  4FYD A;  4TKO B;  3TN2 A;  3J7A V;  1U4R A;  4UAI A;  4IUR A;  1DJR D;  1BUV T;  1LLR D;  3ITP A;  3P7J A;  4HMJ A;  5FLX L;  4RWS C;  1HCZ A;  1SNC A;  2IX0 A;  3Q24 A;  1CQF A;  2JYO A;  2PCF B;  1ZEQ X;  2WAC A;  4ZUJ A;  3TME A;  5JJZ A;  3K5M A;  5KGU A;  2F4I A;  1SE2 A;  1MBY A;  2A68 C;  2F3W A;  4DN4 M;  1BNZ A;  5IGC A;  4X3K A;  1BO0 A;  4OO1 G;  4HR7 B;  1TT2 A;  1HA5 A;  2E76 C;  4DF7 A;  2WAQ B;  4IUQ A;  1SNQ A;  1D5Z C;  4DAP A;  4BBS B;  4LAA A;  1B2T A;  5EKK A;  1Q12 A;  4CKC A;  2HDL A;  1RDP D;  1QE6 A;  3K5O A;  4IFD J;  5I4D A;  1STN A;  4HMI A;  4DNR B;  4RCO A;  1LTA D;  3V2T A;  5E1F A;  2KEC A;  2L1B A;  2B39 A;  1CHP D;  2F0L A;  4CHT B;  1MI2 A;  3NBH A;  3VYS A;  3GTQ B;  4DXG A;  2LKV A;  4FXK C;  2Q8I B;  1Y8P B;  1JOQ A;  5IT9 L;  1Q90 A;  4G7H C;  4XTC S;  1B9M A;  1EWH A;  2L5T A;  2XRQ D;  5KRU A;  4G4K A;  3WOE A;  2ZXR A;  2C9O A;  5D65 A;  2JEB I;  1WTX A;  4IFD G;  4Q0F A;  4FXD A;  1S4Z A;  3AB9 A;  3KBX A;  5G3L F;  5JEA H;  4QB4 A;  5C0X G;  1WTQ A;  4C3I G;  3S1N B;  1RTN A;  2F0D A;  1O80 A;  1M4V A;  3T4A C;  4FF2 A;  2A74 C;  4RA8 A;  5CYU A;  4HCE A;  1GUN A;  4KMU C;  3C2P A;  5ELD A;  4I65 A;  4H13 C;  1RJT A;  3U9S A;  2AQ3 B;  3I72 A;  4OO1 I;  3QB3 A;  1KLU D;  1STH A;  1JC7 A;  5EBC A;  4CGY B;  2DN8 A;  4QF4 A;  4G7O C;  4MHE A;  2R61 A;  1AZP A;  2E74 C;  4ZAI A;  4LMQ D;  3P75 A;  5FO7 B;  4H44 C;  1RF2 D;  2H4O A;  2EZV A;  3FMC A;  2VNU D;  3MFY A;  3D4W A;  3JAM E;  1KDC A;  4AYB B;  3K58 A;  4C3J G;  3M4O B;  3D4D A;  1J9O A;  3V96 A;  3TBI B;  3E6Z X;  2ZT9 C;  3LNN A;  2VXW A;  2K5Q A;  3DXJ C;  1LAB A;  4EGV A;  3GTL B;  1GUW A;  2PMZ B;  2RDF A;  4LK1 C;  3PO3 B;  3MTS A;  1BCP C;  3DEP A;  2HCI A;  2F0P A;  3EQL C;  1SJE D;  4IFD I;  2X6G A;  1DON A;  4QUF A;  3WOF A;  2YU9 B;  1A2T A;  5LL6 X;  2F0E A;  2K28 A;  5M5X B;  5EPJ A;  2QEJ C;  2JE6 I;  4XDX A;  5J22 A;  3P20 A;  1WTO A;  3R2T A;  1QOH A;  1GOZ A;  3KUP A;  2OXP A;  2K6A A;  3KBG A;  5CMD A;  2F0T A;  4IUP A;  1D5M C;  2R6G A;  2O4X A;  5ELE A;  1I4G A;  1B4O A;  1L0Y B;  3NQI A;  1ILP A;  1U4L A;  3RD4 A;  2OEO A;  4ZUI A;  1DZ1 A;  1EYD A;  2NWG A;  1I6V C;  4K5W A;  3J81 L;  3ONA B;  1PRT F;  3I8Z A;  2AQ1 B;  1WVL A;  2J7Z A;  5IIF A;  2PW5 A;  3PUV A;  2EJM A;  2K5W A;  4NDX A;  3SVM A;  4DK1 A;  3HOZ B;  4BY7 B;  1OXU A;  1PTO F;  1LV9 A;  3K7A B;  2F0Q A;  5JPM C;  2F0W A;  4RGO S;  1EU4 A;  3SK6 A;  2L4N A;  4OHJ A;  2EY5 A;  3MVV A;  4F7X A;  4ZKC B;  1S5C D;  2WII B;  1LO5 D;  5C5M A;  2K04 A;  3HRZ C;  3LX0 A;  4FF3 A;  3NTK A;  3OHX C;  1SNO A;  4K2L A;  1LTR D;  5DM6 3;  4KJN A;  3NUC A;  1KTK A;  4O42 A;  2A6E D;  3H3V C;  3A7A B;  4EVO A;  3MWY W;  2QDB A;  1HHV A;  3SHL A;  2PYK A;  3GTP B;  1BBX C;  2M00 A;  4BY1 B;  2BDO A;  2IL8 A;  5TSS A;  1VDZ A;  3I73 A;  1H9S B;  1WCM B;  3GTG B;  1SSO A;  5DEH A;  1HXY D;  4X3T A;  1Q1B A;  3OMG A;  4R8N A;  3SR1 A;  3SE0 A;  5IGD A;  2VB2 X;  1G91 A;  1GUO A;  3HOY B;  1ENF A;  1A15 A;  4NKL A;  5NUC A;  3I4N B;  4L8J A;  1SE3 A;  2EDG A;  1BR9 A;  1SYB A;  1DOK A;  4KD3 A;  3GD7 A;  1HFG A;  3RLF A;  2C5C A;  1EZ6 A;  1BDO A;  1H9K A;  1EYC A;  1VMP A;  4A3K B;  3PO2 B;  1O7L A;  3SEB A;  1T5X D;  1PDQ A;  2BE5 C;  4DFA A;  1CA5 A;  1XWE A;  2VUM B;  4RCN A;  4U67 3;  4RHS A;  2XNA C;  4FF1 A;  4XT3 B;  3S9W A;  2F0H A;  2Z1C A;  3GTJ B;  3GQB A;  4ILW A;  4Y7N B;  4EQO A;  4FXG C;  2D5D A;  5M5W B;  3NTH A;  3Q6S A;  4PMB A;  4ME5 A;  2LFN A;  3A8I E;  2CQA A;  2GA4 B;  2JA7 B;  1HUN A;  1HQM C;  1ILQ A;  3MAQ A;  2RDH A;  3RUZ A;  2E2D C;  3SXH A;  5M9O A;  3K59 A;  1V1O A;  1E2Z A;  1EOT A;  1DM0 B;  2B63 B;  4A3F B;  2RQX A;  1IYU A;  3LWE A;  3OOC A;  3H6M A;  5FK9 C;  2EYO A;  5C44 B;  3K5N A;  1CI3 M;  5JVG 3;  4K5V A;  4X3S A;  4OO1 H;  4V19 0;  3J80 L;  3QO2 A;  1KNE A;  1S5D D;  5M3F B;  3GTM B;  4HAE A;  1EY0 A;  1F2L A;  4IUT A;  1OXX K;  1WTV A;  2NVT B;  1EEF D;  4N9P A;  2PO4 A;  4C1N K;  4K2K A;  4RGM A;  4KK7 A;  1SNP A;  2B2U C;  2J4X A;  5T1G A;  2Q8T A;  4DAY A;  3K6O A;  5EKI A;  1Z7T A;  1SXT A;  1RCV D;  2KCN A;  4ZYS A;  2CHB D;  3MXU A;  4H7B A;  2EJG C;  1FD7 D;  3IKJ A;  2OF1 A;  4OIK A;  3M4Y A;  3RZD B;  5D14 A;  4EQP A;  2PZW A;  5EJW A;  4XT1 B;  4MN3 A;  4RHR A;  4IFD H;  3M85 A;  2R3Z A;  2G9D A;  2BDN A;  5IGG A;  1EY7 A;  5C0X H;  3N6R A;  1K83 B;  3GV3 A;  1FGB D;  2PPB C;  1HA6 A;  2K1B A;  3W2D A;  4Q5V A;  1C48 A;  3AMU A;  1PMR A;  2VB3 X;  4XQN A;  4M8A A;  1Q1E A;  1CQV A;  2B8F A;  4P2C B;  2XSC A;  3S2D B;  4ZLT F;  4ULL A;  4FF4 A;  1YNN D;  5K5P A;  2B8G A;  3MA2 B;  3S17 B;  4J1M A;  3QIA A;  1TU2 B;  2BA0 A;  2PZT A;  2EYM A;  3GTK B;  2B2U A;  5DNF A;  1F77 A;  1GJX A;  5D3I B;  2O5J C;  4ZRZ A;  3OW7 A;  4CBV A;  1SYE A;  5E3F A;  1DYQ A;  2DNE A;  3NWS A;  4A3E B;  3BG3 A;  1STY A;  1JCK B;  5T1I A;  1I3Q B;  5A2Q E;  1EQT A;  4WFN 3;  5KEE A;  4L6T B;  4IUV A;  4B08 A;  3HOV B;  2HCC A;  2MJ8 A;  3TDQ A;  1I4R A;  2F0N A;  1UEA B;  2NUC A;  4IQZ A;  2NBF A;  5D3D A;  3S1M B;  3D8G A;  1TWA B;  4NW2 A;  2A6E C;  2SNS A;  3H0G B;  4N9T A;  2F0F A;  4CJ1 B;  4ZQ3 A;  2ICI A;  1STA A;  1K8O A;  1TS3 A;  5I9P A;  2KED A;  5COR A;  1NSN S;  5IGE A;  5E4X A;  3URY A;  1TS2 A;  1OXT A;  4IAL A;  2BE5 D;  4XXE A;  3T13 A;  2A69 D;  5M3M B;  2LS0 1;  3OPO A;  4HSP A;  2IT1 A;  3DHQ A;  4KV6 A;  3BDO A;  2JA8 B;  1AN8 A;  1YNJ C;  4PMC A;  1OO9 B;  1ROD A;  1LT6 D;  3K5L A;  5F2D A;  2XWB B;  3RMH A;  3BDL A;  3H91 A;  4C56 C;  5C6A A;  4DAV A;  1QWY A;  4M1U B;  2J0T D;  1I4H A;  1BXT A;  2EVB A;  1JR0 D;  1CFM A;  5CR3 A;  3CU7 A;  4WJW A;  2K7V A;  3MXN A;  1EU3 A;  4DXF A;  3GP7 A;  1ESR A;  1Y8O B;  1LTS D;  1GUS A;  1I50 B;  2B2W C;  3MHB A;  1JOR A;  1H9S A;  4WRD A;  2RKS A;  3C3L A;  3R93 A;  5FKA C;  5HUR A;  3TP7 A;  3HEJ A;  5I6W A;  2B2V A;  4K8I A;  1PTO D;  1H9R A;  1CM9 A;  1Z47 A;  4NP5 A;  1O78 A;  3CHB D;  4HN7 A;  2O5I C;  1TY2 A;  2NN6 G;  1PTO B;  4GZY C;  3OIQ A;  1JIC A;  1NUC A;  2F0M A;  2JSO A;  3ND9 A;  2OT2 A;  3GTO B;  2NVY B;  2MHV A;  5IOC A;  3D3R A;  4FNF A;  2PQE A;  3LWU A;  2RA4 A;  1TWF B;  3Q22 A;  3Q0A A;  2LY7 A;  3IFD A;  3N52 A;  1SAP A;  4DK0 A;  4O1N A;  1VMC A;  3PUW A;  2F03 A;  1TWH B;  3A8K E;  1S5F D;  1E2W A;  1UNS A;  1IW7 D;  3EA6 A;  5CV4 A;  5JEA J;  3MC0 B;  5C4Z A;  2B2W A;  4RAU C;  1SE4 A;  2CW0 D;  3QG1 A;  5KYL A;  1A3V A;  3FPU B;  1EQV A;  3OWF A;  1PXU A;  4PV1 C;  5I2Y A;  1F9Q A;  1B44 D;  2R93 B;  3L7Z C;  4ODG A;  5BN4 A;  1GXD C;  3EJI A;  1TS4 A;  1ZYR D;  2KOL A;  1CT1 D;  2M2L A;  3CRL C;  2D9U A;  1TQO A;  2EOT A;  4G7Z C;  3HKZ B;  2WKC A;  4PQX A;  5BN5 A;  2NN6 I;  1V8Q A;  3NWT A;  1RKN A;  4RH6 A;  1SJH D;  3BS1 A;  1WD0 A;  1YNN C;  2Q8R E;  1MD2 D;  3S15 B;  5CC4 A;  2R7Z B;  1WTW A;  2NB0 A;  2EY2 A;  3NQT A;  3A7L A;  3QOJ A;  4ZKB B;  1OXV A;  3PV0 A;  3HOX B;  1TVX A;  1TWG B;  3R8B A;  4JBW A;  1KLG D;  1B9N A;  3K0Y A;  4KHV A;  3OMC A;  3D6W A;  3FRP B;  3D6C A;  3D4R A;  3Q23 A;  2RDG A;  5FLX E;  1PFN A;  1MSG A;  1FNV A;  4A3J B;  3KK7 A;  4BA1 I;  2F0I A;  4CJ0 B;  2XIW A;  3HP3 A;  3X3N A;  1ENA A;  5COY A;  5C5L A;  1XTC D;  3GO5 A;  5DAU A;  5E4W C;  2IWH A;  3A56 A;  1O7Y A;  3EFX D;  3AU7 A;  5EPL A;  4CKB A;  1GUG A;  1SFO B;  3VYT A;  3TP8 A;  1YNJ D;  2EE1 A;  3CQZ B;  3OWE B;  2Y0S B;  5DM7 3;  2KJX A;  5LHY 1;  4A3I B;  5C4X B;  1F2M A;  4KN7 C;  3X3M A;  4FVM A;  2F0J A;  2E75 C;  4EQN A;  4V0B A;  1B3A A;  3T56 B;  1V43 A;  3S1R B;  1FR3 A;  2D2C C;  1EFI D;  2A69 C;  1LTG D;  2PZU A;  2QCP X;  2ID0 A;  3HZX A;  1I4Q A;  2JEA I;  1EY6 A;  2AWO A;  2O2L D;  2R92 B;  3R2I A;  1IKL A;  1LTT D;  2SEB D;  3DWQ A;  4KY6 A;  5IT9 E;  2I07 B;  1Y8N B;  5KNC A;  2N88 A;  4BWG B;  2PNR C;  2K05 A;  4RFB A;  3IL8 A;  2NTS A;  1EY5 A;  1STE A;  3QWN A;  4ABN A;  1CZG A;  1HTP A;  3I70 A;  1DD2 A;  1A6X A;  2X6L A;  4ZK9 B;  2A73 B;  2A6H C;  3C1F A;  3JAM L;  3DWP A;  3MXG A;  2MGS A;  5I9O A;  4FO2 A;  3FPP A;  2G9H D;  1EY8 A;  5EGT A;  3NTI A;  2RSN A;  3BZD B;  1DOM A;  4KI0 A;  2H1E A;  1WD1 A;  5I6Y A;  1Y1V B;  2KEE A;  4B9X A;  1CTM A;  1ET6 A;  3I3C A;  3MEH A;  3E5S A;  5M5Y B;  3SK5 A;  5K36 G;  1M8A A;  4DA2 A;  4QMG A;  1NR2 A;  3P1H A;  1NR4 A;  3HGB A;  2F1M A;  1PTO C;  4PNY A;  4KN4 C;  5KNB A;  4DGZ A;  3KLS A;  4DU9 A;  1LTB D;  4I7Z C;  1XX8 A;  3ND8 A;  3S2H B;  1Q3L A;  3VR6 A;  1SYG A;  5CV8 A;  5J39 A;  2WIN B;  5EQ0 A;  2EY1 A;  4LJZ C;  4DNT B;  2F0G A;  2SOB A;  1JOK A;  1DOL A;  2JA5 B;  1H9J A;  4XQJ A;  1STB A;  3UI2 A;  4JK1 C;  2FHT A;  2L11 A;  2HDM A;  1X32 A;  3I4L A;  1BQQ T;  2QIL A;  4IUN A;  2BCO A;  3VR3 A;  4KY5 A;  3T51 B;  5JPN C;  2XVS A;  4UDU C;  2EYL A;  3HS0 C;  1HTL D;  5JOB A;  3J7A F;  1G2T A;  4XYO A;  2KA7 A;  1IW7 C;  1RTO A;  1AFP A;  1A3T A;  3EVQ A;  4K14 A;  3OSO A;  4YIJ A;  2NZ1 D;  2D62 A;  1NCV A;  2CW0 C;  1AW7 A;  2DNC A;  5LL6 S;  4OL7 A;  3PIO 3;  3L3O C;  1VF5 C;  2EYJ A;  1H9M A;  1LTI D;  1Y1W B;  1KNA A;  4MIU A;  5CV6 A;  5FO9 B;  4C3H B;  1FYC A;  2B2T C;  2HUG A;  4CKE A;  5G3L D;  2I46 A;  2Z4I A;  5EBD A;  1L0X B;  1ZYR C;  2B2Y C;  2M9V A;  2KVM A;  3NPP A;  3NP8 A;  4Z9C B;  3J81 E;  4KKS A;  3BYY B;  4R9W A;  4XQQ A;  3M7G A;  2E2I B;  2NN6 H;  2AUK A;  3E0J A;  3WDN A;  1BCP F;  1I4P A;  1MGS A;  4L63 B;  1ML0 D;  3KLS X;  1SMY D;  5CBE E;  2DY7 A;  1S5E D;  4TSS A;  5IOD A;  1UUP A;  3S14 B;  1GUT A;  1J8I A;  1G8Z D;  4RGT A;  4G57 A;  3M7N A;  1TII D;  1D6E C;  5C4H A;  2EYP A;  5J1Z A;  1TKW B;  2IPK D;  3DUZ A;  2KUM A;  1KDA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...