2CVRA

Nmr solution structure of sso7d mutant, k12l, 12 conformers
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
62
structure length
62
Chain Sequence
b'ATVKFKYKGEELQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding protein 7a
publication title Structural Determinants Responsible for the Thermostability of Sso7d and its Single Point Mutants
rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein
total genus 3
structure length 62
sequence length 62
ec nomenclature ec 3.1.27.-:
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2cvrA00
4OIJA 1U4PA 2B2YC 1U4RA 2Q8TA 1SDFA 2M2LA 2K05A 1X3QA 2D9UA 2X6LA 1WTRA 4HEDA 4CJ1B 1QNKA 1AZQA 2RA4A 2B2UC 2MPMA 2JP1A 3I3CA 4RA8A 4R9WA 1M8AA 2RSNA 5EJWA 1RTNA 3GV6A 1WTOA 4IUUA 5CMDA 1DZ1A 1WTPA 2B2UA 2KEDA 1HFGA 1HUNA 5AFWA 1X32A 2FJ2A 2X6GA 1HUMA 1ESRA 4OIKA 1LV9A 2EOTA 1SAPA 1HRJA 3I8ZA 1WTXA 1U4MA 1GUWA 2NYZD 1O7ZA 4RWSC 4ZKCB 3IL8A 1NAPA 1IKMA 2FINB 1ZXTA 1X3PA 1F9SA 2DY8A 2SDFA 4IUQA 5EPKA 1AP0A 2RVLA 2H1EA 4ZKBB 1G2TA 2VXWA 2KVMA 1DOKA 1BBXC 4U68A 2MJ8A 1JICA 3KUPA 1ILQA 5DNFA 1BF4A 2HUGA 1F9PA 4O42A 1HFNA 4NW2A 5JJZA 1E0BA 4XT1B 5E4XA 5EQ0A 1O7YA 1QE6A 2L11A 3G7LA 2B2TA 1NR2A 4HSVA 4MN3A 4ZLTF 2BDNA 1BNZA 3TN2A 4X3SA 5CBEE 1DONA 5EKIA 3D6WA 3MTSA 3UI2A 1PFBA 1ICWA 1F9RA 2DY7A 4HCSA 1EIHA 1G2SA 1EL0A 1WTWA 3DEPA 4X3KA 3HP3A 1B2TA 1EQTA 1IL8A 1KNEA 4XT3B 1F2LA 4ZAIA 2L4NA 3F2UA 1MGSA 2JYOA 2NWGA 1C8CA 4ZK9B 2IL8A 3H91A 1HA6A 5CORA 1F9QA 1ML0D 1MI2A 2K03A 2L9HA 2K01A 4HAEA 4LMQD 2KOLA 2NZ1D 1VMPA 5EPJA 1CA6A 1J8IA 4IUTA 3TZDA 1KNAA 2B2TC 3R93A 2EPBA 1B53A 5T1IA 5T1GA 4IUVA 2B2WA 1WTVA 2B2VA 2HCCA 1VMCA 1EOTA 1DOMA 1NCVA 1CM9A 1NR4A 1O80A 2FFKB 1EIGA 1G91A 1RHPA 1B50A 1IKLA 1G6ZA 1MSGA 2XIWA 2L1BA 3FDTA 1XX8A 3KBXA 2EE1A 1DOLA 2L12A 1SSOA 1PDQA 5COYA 2KEEA 4RAUC 4QUFA 1WD1A 1ILPA 2MGSA 2X69A 1HHVA 2R3ZA 4MHEA 3IFDA 3MWYW 5E4WC 2RSOA 4XDXA 4CJ0B 4CJ2C 1PFMA 2HDMA 2CVRA 1Q3LA 1S4ZA 4UAIA 5D14A 1CA5A 1WVLA 1U4LA 1XYIA 4DN4M 1RJTA 2B2WC 4IUPA 2B2VC 3SVMA 1WTQA 4R8IA 1B4OA 5CBAE 1A15A 1JE4A 1PLFA 2B2YA 1B3AA 3FPUB 1RTOA 2MP1A 1MSHA 2K04A 3GV3A 3P7JA 3Q6SA 1QG7A 3ONAB 2HCIA 3N52A 3QO2A 1PFNA 2KECA 1AZPA 1BO0A 2KUMA 2HDLA 3LWEA 4X3UA 2K28A 2N88A 4IURA 5EPLA 5D65A 1WD0A 3I91A 1TVXA 3I90A 2J7ZA 3DEOA 2FMMA 2K1BA 1RODA 2FHTA 3DM1A 1J9OA 4QUCA 2N55A 2Q8RE 4X3TA
chains in the Genus database with same CATH superfamily
2OT2A 4F7XA 4NB3A 1U4PA 4C2MB 1IYVA 1U4RA 4PQXA 3RLFA 1EWIA 3MHBA 5LHY1 5C4JB 2D9UA 2UXBL 1VQNA 3HOYB 1KABA 4A3GH 4IFDH 1AN8A 2QA4A 3CD6A 2E76C 3T56B 5BR8Q 1X54A 3M3YH 1E22A 4DR3L 3GTGB 1B9NA 1SNQA 4FF4A 4C3JH 1PH8A 5LMNW 1TWFB 5KRUA 1U4MA 4GLXA 2GVBA 1AP0A 3KYHC 3JAMi 4DUZQ 2VXWA 1W3SA 2J0TD 1P16A 3BVMA 4P72A 3IAYA 2MNAA 4RCNA 5JJZA 2L11A 4C3IG 5EKIA 1R4PB 4FDBA 3D0FA 4DKAC 4AYBG 1BDOA 1EL0A 4K8IA 2IX1A 4R4CA 5FJ8G 4X6AH 1VQLA 2PYKA 4JBKA 1LTRD 5EAYA 1IZ6A 4A3JG 1SE3A 2K03A 3OOCA 2PPBC 3S16H 2AMCB 5A2QE 3PUZA 1VMCA 1NR4A 5M3FH 4H13C 4FF2A 1RHPA 2NVQH 3GTPH 1BNZA 4L6TB 4H0LC 3HOWG 5K5PA 2PMZE 4FF3A 4LF5L 3GTQH 3DWAA 1GUSA 2HDMA 3J7YW 3I56A 4BBRB 1A8VA 3PUYA 2ZJRA 1ONLA 2A5HA 2E2JB 1C7YA 2B2YA 4KN4C 1SNOA 4APVA 1MSHA 3E0JA 1KRTA 4A3MB 2OEOA 3Q6SA 2HCIA 5BN5A 4B3RL 5JJLA 3HOUG 3S2DB 1WTHA 3NTHA 4YCWA 3FPPA 4UP7A 3RLNA 3HKZE 2Q8RE 2F52A 4BS9A 3PO3G 2MHVA 2VQFL 1A3TA 2WAQG 4JI1Q 3BS1A 1CTMA 2CQAA 3CCQA 4PV1C 1YZ6A 4QY7A 2Y0SB 3SK5A 3PO2B 3OMCA 2A8VA 4A93B 1J5EQ 1HZAA 5EJWA 5AJ3L 1RTNA 1K8GA 1GVPA 4GNXB 1WFQA 2B2UA 2F0OA 4KY6A 3GTJH 1HUMA 4BBSG 1AFPA 1ZYRC 1V9PA 3KK7A 4QMGA 1UEAB 3A7LA 4DK0A 1KLGD 4DR1Q 1GOZA 1KXLA 1PVOA 1F9SA 5EPKA 2EXDA 3W1BA 4DV2L 4ALPA 2BE5D 2KHIA 3SK4A 3LWUA 5IT9E 4IZ8A 1HR0W 3F2BA 2Z6BA 4FO2A 5EQ0A 4YIJA 4A75A 1DXMA 3K7AB 3K58A 3W5OA 4IJLA 4ZCKA 1CHQD 4DV3Q 3HOWH 1L0YB 1LABA 5M5WH 2UU9L 4JI8L 1PH9A 1B70B 1STEA 1HA6A 1S5CD 1VQ4A 1PH3A 1MBYA 5EPJA 1LUZA 4JBMA 2NVXH 4HMIA 2DN8A 3K0XA 1VQ8A 3E3XA 2YTVA 4IUVA 1I94L 2Q8IB 5JEAG 4DK6C 1L1OB 3R8BA 2AUKA 2A6EC 2K5VA 3NBHA 5FOBB 5IGBA 2A74C 1LTTD 2XIWA 4YHHL 3HOUH 2F0QA 1HCZA 3VA5A 4L5RC 2MGSA 1HHVA 5E4WC 4G7HC 1IBLL 2K32A 2LKVA 1IL2A 2B63G 3PO3H 4IUPA 3GTMB 1B4OA 3KDFB 5J1ZA 3FPUB 3F2DA 2AQ2B 5I6YA 1MIUA 1PZKD 3F1ZA 3P7JA 2D0OA 3A55A 4B3TL 5D3IB 4L5SA 3J81c 2QDLA 3I91A 3HOVG 4EQ5A 2GA4B 2QW7A 2FHTA 1EU3A 1UE6A 3A8JE 2Z6KA 4BBSH 1YNXA 1X56A 4DNTB 2QILA 3Q0AA 2EYLA 4JW0A 1PTOC 5C4XH 4UHVA 4X62L 1BCPB 5C3EB 2ASBA 1XMQL 5CV9A 3NPPA 4A3BH 1LT4D 4BA1I 1R4QB 5KIXA 1QNUA 4CKBA 2H4OA 1AW7A 3NWTA 4EQOA 2JXMB 1E2WA 4KD4A 1L0WA 1PH5A 4OEMB 3DM3A 1KAWA 1YIJA 1QZHA 4BY7G 1HFGA 2PNRC 1V1QA 1A2TA 1VQPA 1JJCB 1Z9FA 3EROA 3PMFA 1QZGA 1WTXA 1K83B 5I2XA 1EFID 1K9MC 5HY6A 3MEFA 4HJ9A 1VQ5A 1UUPA 4A3KB 1HTPA 2KVMA 5EBCA 2YV5A 1JICA 2C5CA 1ILQA 3BDLA 4K8JA 3WOFA 4O42A 1CZWA 1KIXA 1FNUA 3LNNA 5IYBH 1SE2A 1YNNC 1E24A 5BR8L 4LF6L 3BJUA 4JOIC 3U4VA 2F3IA 3K5LA 4IPCA 1EY9A 2DY7A 3GP7A 2JA5B 5IGGA 1NY4A 3M85A 2D0PA 3CCVA 4KN7C 1TWGB 3LGJA 1TQOA 4DUYQ 4DUZL 1F9QA 4K5XA 3CCRA 1KTKA 3EA6A 5GAGC 1KDAA 2RHSB 5C5LA 3KLWA 3NWSA 1PZJD 4MTKA 4CKEA 5T1GA 3SR1A 3HOZG 1ENFA 3S17B 2F0DA 1D1IA 4QIWB 3GTOH 3CCSA 2JA9A 4HIOA 1YHAA 1SYGA 1QVFA 1Z7TA 3S2HH 1VQBA 1ZKOA 3MWYW 4IFDI 2KCMA 4KY7A 4BXXG 2PW7A 1IW7C 2KA7A 3EVQA 3S14H 2SNMA 5IP9G 3S1MH 4K14A 1YEZA 2OXPA 4LFBQ 1A15A 4RGMA 1JE4A 5DAUA 2R92B 3W2DA 4A3IG 4UP9A 1YI2A 4RG1A 4C3HG 1Q1EA 1YNJD 3I7FA 4TQUS 2AQ3B 2B8FA 3CKIB 4X3UA 2G5DA 1H9SA 2VL6A 3QB3A 5ISRA 4KJOA 3I4MG 2O5JC 2HIVA 4BY7H 3S1RB 4DA2A 5I9PA 3NUCA 1PRTB 4MTNA 4QGUA 1GJXA 4X3TA 1FGBD 3C2PA 4MZ9A 5ELEA 1VQFA 4DXGA 2N78A 3ND8A 1JOQA 3VR6A 3SK6A 1D7QA 1BBUA 1R9TH 1ET9A 1SYBA 2EYJA 3MXUA 3V05A 3ND9A 1I50B 1N36Q 4PZ8A 3CF5A 4LFCL 5C44B 3MXNA 2LXKA 5JVH3 1Q90A 3N6RA 2IT1A 5M5XB 3BDOA 4FYDA 3G6EA 1A63A 3Q22A 1OXUA 4TRDA 4LAAA 1G291 4WORA 1FR3A 4LW1A 2M9VA 2E2HH 2E2DC 3R2IA 1WCMB 1B9MA 1Q7YC 1J5EL 5BN3A 3KF8B 2A6HC 2G9DA 3G7LA 3K5MA 2I5LX 3HOZH 4X3SA 4POFA 2FXQA 1EZ8A 5FLXc 3I2ZA 3HKZG 3CC4A 4L5TA 1WTWA 4DR1L 1H9RA 4ILWA 4KY5A 4J15A 3STBD 4DR7Q 4U673 4DV5Q 3AFPA 5IGEA 3UE1A 1ML0D 4R4TA 2R7DA 2KOLA 1Y1WG 4JPBW 1KNAA 1CKOA 1GXDC 2ZT9C 4IFDJ 4GLAC 1BVSA 1C9OA 1EOTA 4A3IH 2NN6G 3M4PA 2GN5A 3OWEB 4C3HH 2I0QA 4X66Q 4GOPC 5IY0A 3NP8A 2L12A 1T9HA 1E1TA 1PDQA 4Q0FA 3I4OA 3I4MH 2ZTEA 3G71A 4DAPA 2YTXA 1X9NA 3HS0C 4CJ2C 1I6HB 1V43A 5CYUA 4DR2Q 4KK7A 3FRPB 3SDZA 1A2UA 1V1PA 3K5NA 3CW2C 3OIPA 1PH6A 1N32Q 1S5FD 1GUOA 1PFNA 1S3OA 2DJGC 2ZJQA 1EFWA 1SBBB 2Z9HA 5KEEA 1VQMA 1BCPD 3H3VH 4I7ZC 3KJOA 4R8NA 2A1AA 4JI2L 5E7NA 3M9BA 4GN4B 4DAMA 4LF7Q 1I4HA 1RIPA 1HH2P 1P8LA 1LYLA 2X6LA 1WTRA 3T13A 1DD2A 3TREA 4DR5Q 4E6IA 4RH6A 2Y0SE 1M8AA 1WTOA 5A2QL 3CQZB 1EYGA 1NNXA 4X64L 4JI6L 3K57A 1MHWC 2MO0A 1RKNA 1AH9A 1SAPA 1CT1D 4ZKCB 2F4VQ 1TT2A 4M1UB 1IKMA 4IUQA 3HOXB 2DY8A 2H1EA 3IFTA 1ICFB 3OSOA 4CDDC 1LTBD 3QWNA 2PNHA 1TXYA 3L9AX 1Y8OB 1QE6A 4OO1G 1NR2A 2NN6H 3TN2A 3D6WA 3MTSA 2F0WA 3FKIB 3MXPA 3K6OA 4HCSA 2IJ0A 4QJFA 1LLRD 5FO8B 3TSSA 3F8TA 1KNEA 2RCFA 1SN8A 3JC66 3H0GB 1KLUD 3P1HA 3KFUA 1QB5D 3TP6A 5FO7B 4JI5L 3TMEA 2Z1CA 5JJIA 4NPSA 4OWWB 4IUTA 4JC0A 4A3GG 4ULLA 1I4QA 1RCVD 3MVVA 1LTAD 2NVYH 3KF6A 4N8FA 1EIGA 3RZDB 2IWHA 1BQQT 3CPWA 1VCIA 1YJ9A 4XDXA 1ZEQX 1LT5D 1YJWA 5D14A 3L0OA 3JAME 4RGTA 4DUYL 1G6PA 2B2WC 2RBMA 3O13A 3PIO3 3I55A 3T16A 3S1NB 2K04A 1TWCH 2JEBI 5IGCA 5IT9L 3S15B 1PRTD 3T4AC 4WJ4A 3SE0A 3CCJA 1UE1A 2JA6B 2XN9C 3RZOB 2KJXA 1FNWA 5IGFA 3K80C 1SR3A 4H7BA 3K8AA 3NBHB 2RDFA 4QUCA 4C1NK 2UUCQ 3VDYA 4DFAA 2E5LQ 3QJYA 2R61A 1AE2A 2RDGA 2RF4A 3NQIA 1PYBA 4LFBL 1UEBA 1SNPA 1X3QA 3VYTA 1W6KA 2NB0A 2R7ZB 1WYDA 2E75C 4R9WA 3CC7A 4RGNA 3D4DA 2KCTA 3PSIA 1X3FA 2LXJA 5NUCA 3SK8A 4B3SQ 4OO1H 2TSSA 2E2IB 2F0EA 2I5HA 4QCLA 4POGA 3BZCA 3BDCA 1HRJA 4N9TA 1D6EC 5CV4A 3I4NG 3SHLA 4B9XA 1JC7A 3LX0A 1Q81C 3D3RA 4RFBA 5I2YA 1PMRA 2NVTH 2OF1A 1DOKA 2AKWB 4G4KA 4N9PA 5A35A 5DM63 1BBXC 3EN2A 4RHSA 3S1QB 4A3EG 1HTLD 1E7ZA 2Q8TA 5M9OA 4LF4Q 3UDXA 2N8NA 1N36L 3AQQA 4R1JA 2BH2A 2F0TA 3I72A 2DUDA 3DEPA 4MNOA 1JWSD 4B9WA 2IL8A 3PUXA 2XTIA 3P20A 3EFXD 2CWAA 2LMCB 3RN2A 2VNUD 1EQQA 4UP8A 3HOYG 2EY2A 1HQMC 4C3IB 5C6AA 3J80E 5JPNC 2PZWA 3MFYA 2XVSA 1BCPF 2JE6I 1SXTA 4QIWE 2KCNA 3RMHA 5J39A 4QQBX 5CV7A 4CJ0B 1OXXK 4A3DH 4A3JB 3TRZA 4DR7L 2CVRA 1Q3LA 1PH4A 4IPGA 3PIP3 4XTCS 2ATWA 4HJ5A 1PA6A 1EY0A 1PYWD 2YTYA 1K8MA 1J6QA 3FMCA 2MP1A 4XQQA 1TWHH 1II3A 2MQHA 3BVZA 3TP7A 5JEAJ 4X66L 2K28A 5D65A 2RCNA 4AIMA 1TVXA 2A73B 3ER0A 2ZXPA 3NHHA 4O0AA 4M8AA 3QG1A 1B7YB 1EOVA 5C0XG 1HZCA 3I4NH 3D31A 1PZID 1PXUA 2DGYA 2F0FA 4UY8C 5IIFA 1VQCA 3GTLH 5EGTA 1QNKA 1AZQA 4RA8A 1S5BD 4A3EH 5I6WA 3NQTA 3A0JA 2HQEA 1SFOH 3VR5A 1FVIA 1KDCA 3CRLC 4KHZA 1NE3A 3G4SA 1CKNA 3PF5A 4IUNA 1EY7A 1JOKA 1H9SB 4DV4Q 5ELNA 4RWSC 2VUMB 3Q24A 4ZRZA 3AEVA 4LF7L 2SDFA 1G2TA 4BBRG 3OMGA 4KHVA 1XWEA 2CHBD 1D5MC 4C2MH 2F0GA 5LMNQ 2WKCA 4DR5L 5C4JH 4A3MG 4HSVA 3HOYH 2BDNA 1VQOA 3J80i 1PHJA 4GZYC 1CSPA 2ZM6Q 1C4QA 1CK1A 1S5ED 1HJPA 3T53B 3UI2A 3CCLA 1YVCA 3OTOQ 1PH7A 4GKKQ 4GOPA 2JA8B 3HP3A 1SE8A 3GTGH 2DJFC 2EVBA 2F4VL 3R3OA 2JYOA 5IP7G 5C4XG 4O2DA 1JJ2A 2F0VA 2VS1A 1TWFH 4OX9Q 3MXNB 2EYMA 2F0NA 1I4PA 3H09A 4A3BG 4MIUA 4O1NA 1WTVA 1QWYA 1PRTF 3S24A 2Y0SG 1DOMA 3L3OC 2XSCA 4CGYB 3A5UA 1VQJA 2Q2UA 4LF9L 4A93G 1BR9A 1TIID 4FXDA 3OW7A 4AH6A 3J81i 2OCEA 3K81C 3MEHA 1WD1A 2I07B 2KEEA 1HA5A 1EY5A 1B3QA 2EJGC 2Z4IA 5IOCA 3NEMA 1S4ZA 2K33A 4XYQA 3OW2A 2I46A 5C0XH 3TQYA 3VYUA 3ZJYC 1B3AA 1D5XC 2RHQB 4OONA 5IYBG 1W2BA 3GV3A 3KLSA 1JOOA 3QO2A 2KUMA 4BY1B 1CFMA 3J7AF 4YWKA 2K14A 1F2ZA 2YU9B 1EIFA 3DM1A 3ZYYX 2B63B 1FJGQ 5I4DA 2EY5A 1YHBA 1H95A 5GAEC 3X3MA 3KOJA 2J4XA 4GN3B 4BBRH 3C46A 3U9OA 1V1PB 4DGZA 1OO9B 4KHPL 2E2JH 4JI0Q 2MFIA 1DZ1A 3HOVB 1GUGA 1X55A 2V1CC 1XTDA 4KMUC 4A3MH 1IBML 1G8ZD 2SOBA 1O7LA 1DJRD 3NK9A 2UUCL 4UDUC 4JI3L 2EOTA 3S2DH 3BU2A 4IJHA 1IBKQ 2E5LL 3T51B 1VS0A 1C0AA 1GUNA 5IP7H 5FO9B 2XWBB 2XGTA 4HIMA 1EYDA 2A69D 4CKCA 1SRUA 1F9PA 1JWUD 1TS5A 3OWFA 1O7YA 4MN3A 3EJIA 5FLXE 4B3SL 3PO2H 2D5DA 4Y7NB 1H9JA 4A93H 5KNDA 3T1YQ 1HNZQ 1AE3A 1HR0Q 3TZUA 3TEHB 4A76A 1EQTA 4ZAIA 4NXMQ 1BBWA 1Q46A 3CC2A 1YHQA 3KLRA 1EIYB 3H3VC 2B29A 2AUJD 2PZTA 5CC4A 2EZVA 2PZUA 3R93A 5C3EG 1B53A 3V2TA 3L2PA 2B2WA 1XNQQ 1VQIA 1Q1BA 5ELBA 4DR6Q 1JCKB 4LF4L 1G91A 2WACA 4IPDA 3X3NA 4JI4Q 2JA7B 2VZAA 5COYA 1PFSA 1DM0B 5M5YB 1N34Q 2X69A 3K7AH 1Q86C 5DEHA 1XJVA 3WOEA 1IYJB 1I5FA 1IHZA 5C5MA 4A3KG 2VY3A 2QEJC 5G3LD 3T1HQ 2DNEA 5JOBA 2N49A 1LT6D 3I4LA 2KECA 2CW0D 1XPOA 3UDIA 4IURA 2PQAA 4BY1H 4FVMA 4H44C 3KF6B 1BOSA 4FF1A 1HXYD 5EKKA 4ID6A 2JA5G 1EZ6A 2C9OA 3PF4A 1U9RA 1NMFA 4JBWA 3RLOA 1ENAA 2PI2A 4L5QA 5FK9C 1NTGA 4I65A 1STYA 3IKJA 1EY8A 3TP5A 3MAQA 3D8GA 3GTMH 1U0LA 5LMUQ 2F0PA 1PTOB 2R93B 4YCUA 1K8AC 4ABNA 3QIAA 4HR7B 2KHSA 1X32A 1CZGA 1LV9A 4LF8Q 3I8ZA 1I3QB 1Q8KA 1UE5A 1I4RA 3CMAA 1ZXTA 3PV0A 3JAML 3GO5A 3HEJA 2EJFC 4HJAA 3KUPA 4L63B 2R92G 5C3EH 1HPCA 1IYUA 1E0BA 4ZLTF 1EUJA 3ITPA 1DONA 3AMUA 3R2TA 1PFBA 2F3VA 3DLLA 2IHFA 3A56A 4DV4L 1B2TA 1STHA 2BDOA 2O2LD 4B3MQ 3TBIB 2BA0A 2LS01 3OIQA 1JB7A 3BVGA 1LM0A 2K4KA 4JI1L 1K83H 1E3PA 2K01A 1TWAB 4HAEA 1CA6A 4YCVA 3GTKB 2UXBQ 2K7VA 5IODA 5LMNL 2EPBA 4TVAB 4A3KH 2KENA 1TS3A 1NCVA 2CFMA 3Q8DA 2F0KA 1G51A 4HMJA 4F88A 2FFKB 5KGUA 1JB3A 4DR3Q 4OGQC 1DOLA 1SSOA 1K0SA 4JCVE 4JI7Q 1ILPA 1KQSA 2UUBQ 1RF2D 4IALA 1KAAA 2JA5H 1Y1WB 4OX9L 1DCZA 1X3GA 2BA1A 3K0YA 1TWGH 4IOAA 3J7ZC 2RQXA 1SJHD 1X6OA 1YITA 1LTLA 3TP8A 1WCMG 3N52A 2FMCA 4LK1C 1YBYA 3KBGA 4A3FB 1BUVT 3S17H 2J7ZA 2IW3A 4K0KQ 2K1BA 4HJ8A 4DV3L 1J9OA 2N55A 3MA2B 3C3LA 1FD7D 2F0UA 3BG3A 1CI3M 3OPOA 3Q23A 4J6HA 2LY7A 3C1FA 2M2LA 5FLMG 1CHPD 4XQNA 3ULPA 5JAVA 4CJ1B 4LFAQ 2B2UC 3I3CA 2XNAC 4K2KA 1OTCA 2RSNA 2R92H 2HQLA 3J80L 1TS2A 1Q8IA 1SNDA 2KEDA 5H1SE 1EEFD 2R93H 4RKBA 4OIKA 2F4IA 4DAVA 3BYTB 2AQ1B 2H5XA 3KDFA 1K0RA 1FJGL 3S1RH 2BE5C 2JK8A 2TMPA 2WB1B 2WFWA 2BOSA 2B39A 3DWQA 4PG3A 1Y1VB 1O7IA 3CCEA 1QOHA 4XT1B 5C0XI 1EY6A 1DGSA 1KC8C 4LJZC 2BCOA 5E1FA 1PH1A 4RCOA 4WJ3M 3FHWA 4FP5D 5LL6X 1EIHA 1JE5A 2QEXA 1IBKL 3RR5A 2XRSD 1I50H 1KHIA 5IYDG 4DV6Q 3MFGA 1LTSD 1OXVA 3J81j 3M4OB 1KL9A 1C8CA 1X3EA 5C44H 4ZK9B 5G3LF 1CKNB 5ELFA 1JR0D 3M4YA 1D8LA 5M5XH 1TR5A 3URYA 5M3MB 3A8KE 2F0JA 5T1IA 2EYPA 2EXZA 5CV8A 1O80A 3E9HA 1WCMH 4R4OA 1WI5A 4Z9CB 4F87A 1IKLA 1MSGA 2L1BA 5HURA 3T1YL 2BH8A 4KV6A 3HRZC 4LUVA 4AQYQ 3I73A 3RN5A 1HNZL 1TU2B 2R3ZA 1LTGD 1SEBD 1N9WA 1CQFA 4UAIA 2ICIA 3P75A 1WVLA 5EBDA 5HGTA 4GOPB 4A3GB 3HOXG 4R8IA 1WJJA 1NBWA 5FLMH 3OYYA 3QOLA 1NJIC 1XNQL 3M3YB 4OWXB 3CXCA 5CV5A 3SXHA 1AZPA 1BO0A 1QUQA 2Z6KC 5EPLA 4G57A 4C3JB 4JI4L 4Y52H 4P71A 1N34L 3DEOA 2L15A 1SYCA 3FKIG 4YWMA 4DNIA 1KDBA 3BZKA 2UXCQ 3BYYB 4NDXA 3GD7A 2F3WA 3H0GG 3HZXA 5KNBA 1I6HH 1SDFA 1PTOD 3RNUA 3T1HL 5C4HA 1STBA 4UPAA 2OTLA 1A3VA 5JVG3 4JYAQ 1STGA 2NTSA 4P2CB 3GV6A 1VQ6A 4IUUA 4KKTA 1I4GA 2GVAA 4S3SA 4A3DG 2PCFB 1X65A 3WDNA 2NYZD 5IYDH 1U5KA 5E3FA 5C0XJ 2FINB 1LACA 1X3PA 3S16B 1CUKA 1QCBD 4DV7Q 1VQHA 5M3FB 1FNVA 2HUGA 2CCZA 4PNYA 2NVQB 2PQEA 1NUCA 1XTCD 2WIIB 5LMUL 5ELCA 3GTQB 1H9KA 4A3CG 4GN5A 1YNND 2VQEQ 1HNXQ 2JA6G 1F9RA 3CQZH 1G2SA 2ALYB 4J8QA 4JOIA 3MC0B 1F77A 5IE8A 2K5HA 2PO4A 2L4NA 3F2UA 2HT1A 2F1MA 1MI2A 2L9HA 1N33Q 3DMUA 3NE5B 3CRKC 1UNSA 3M4QA 2B2TC 5IYCH 3HOXH 5KNCA 2HHHQ 1XNRQ 1JQYD 2CW0C 3M7GA 4XIGS 1W6JA 2R7ZG 4CDCC 3DUZA 1Y69U 1GHKA 3V96A 4BA2I 4KJNA 4G7OC 3KBXA 1L0XB 3VYRA 3SEBA 2F0MA 4ME3A 5J22A 3KJPA 2RSOA 4HIKA 1SE4A 3FKIH 3PIPA 4B3ML 3B6YA 2JJQA 1LO5D 4FXGC 1XYIA 3KF8A 1IW7D 2A68D 1AEXA 3H0GH 1WTQA 1PLFA 2XRQD 1EYAA 4XXEA 1YNJC 2QKIC 1Q12A 1TKWB 2F0LA 2JEAI 4LF6Q 3GTJB 2Z8LA 3PCOB 4AYBB 3I70A 4EVOA 1L2FA 4ZQ3A 3PGZA 5FLXL 3E6ZX 4JI7L 2FMMA 2UUBL 1SMXA 3RZDH 1A6XA 4KTAA 1S72A 1TS4A 3TS0A 1UAPA 3A74A 4OIJA 4GNXC 4DV5L 1VQ9A 1VQGA 1EU4A 2MUYA 5J3BA 4HJ7A 1K3BC 2K50A 4DAYA 1A0IA 2RA4A 1SYDA 3SGIA 3J81E 1D1KA 3UDFA 2CKZB 1N8RC 3S1NH 3U50C 2K5WA 3HOWB 4CDEC 5M5WB 4K0KL 3RUZA 3S15H 4A3CH 3E9IA 3FP9A 4F8MA 1ESRA 3W3AA 2O4XA 5F2DA 2JA6H 3MXGA 3RZOH 2QDBA 1JMCA 4JV5Q 2PQAB 2G9HD 2AWOA 2OQ0A 4DR2L 2WKDA 1GO3E 4I7AA 2NVXB 3MZ5A 1OXTA 2CWPA 1SNCA 2V4DA 3BZDB 2JQOA 1FL0A 4PZ6A 1E2VA 4LFAL 2EIFA 1N32L 2EY1A 2R7ZH 3HOUB 3CPFA 1K28A 4HTHA 2EQSA 2A6HD 4LWCA 1HNWQ 1ICWA 3E5SA 4ME5A 1XMOQ 3STBC 1Y8NB 2E2IH 3PO3B 1F2LA 2WAQB 1L1OC 3JAMc 2Q2HA 3DWPA 3G48A 3K59A 4R4IA 2HD3A 3D4WA 2HCCA 4PZ7A 3S1QH 4DV0Q 1SLJA 3FEWX 4EQPA 2EE1A 4BBSB 2Q2TA 4LFCQ 1GD7A 4A4IA 1STAA 4LUZA 5D3DA 4MHEA 1ENCA 3UE0A 1VQ7A 5C4XB 4OXPA 4DV6L 2SNSA 1D2BA 1PTOF 4K6LA 4A3BB 2VUMG 3H3VI 1VQDA 4NMZA 4DR4Q 1BKBA 2ZXOA 4YY3Q 5LL6S 3PO2G 1JWMD 5EKLA 1VQAA 1BCPC 3LWEA 2N88A 4C3IH 1MD2D 3I90A 2AHOB 1QJOA 1TY0A 2B8GA 2KCCA 4JK1C 4AQYL 2RKSA 2L55A 3NELA 5FJ8H 1T5XD 2JA8G 1SMYD 4NXNQ 4A3JH 3A7AB 1V1OA 4N8X1 1SYEA 3TS2A 3QR8A 1KD1C 3CU7A 2R6GA 4PMBA 4TKOB 1SNMA 2EY6A 1K73C 1HUNA 2Z4HA 2UXCL 3CHBD 3CP0A 5TSSA 1O7ZA 5KYIA 3IL8A 3H94A 2NN6I 2B3GA 2K75A 3VA7A 4ZKBB 4PMWA 2WB1E 2ES2A 2MJ8A 1VQEA 5C4ZA 2HIXA 4CBVA 3GTOB 4QL5A 4JYAL 1B44D 3KLSX 5ELOA 3EQLC 3J80c 1I6VC 3S2HB 1EQRA 4BY1G 1JORA 2OQKA 1JT8A 1QVCA 3PUVA 4K5WA 2JN4A 1Q82C 2NTTA 4JI2Q 1STNA 3S14B 2VB3X 2ICEC 3S1MB 3HKSA 1Y14B 4DXFA 5CORA 1SROA 4DV7L 2OWOA 2NZ1D 1VMPA 2JSOA 3AB9A 4JBJA 2KBNA 2VUMH 5ELDA 2EJMA 1CQVA 2WP8J 4KKUA 4DV1Q 4X64Q 4BY7B 4JI6Q 4WRDA 4JVZA 2VQEL 2K5DA 3M7NA 2C35B 4LUOA 1HNXL 1F2MA 3NSWA 2IX0A 3A5ZB 1EQVA 4QB4A 4XQJA 4DK3C 1M1KC 2JA8H 1N33L 1I4XA 1RJTA 2QF7A 2F03A 2B2VC 4XYOA 4B08A 2HHHL 2KQ3A 1XNRL 1R9TB 1RTOA 1XXGA 2D2CC 1PRTC 1HZ9A 3ONAB 4WJWA 1A3UA 3K7UC 3ULLA 1TY2A 1UWVA 2NBFA 4LNQA 4RHRA 1PH2A 1NMGA 1RODA 2OTJA 2LSSA 2UXDQ 2E8GA 3DXJC 2E2HB 4JI5Q 4OO1I 2CH4A 3HOZB 2A19A 1BXTA 2EYOA 2R7FA 2ZTDA 2MPMA 1CSQA 2JP1A 1PV4A 5CMDA 5JEAH 1UE7A 2ENBA 4K2LA 3F2CA 5CR3A 5DM73 3ERQA 2FJ2A 2JA7G 1QUQB 1EYCA 1CKMA 3QOJA 2YU9H 3TDQA 1S40A 4DNRB 2WINB 2B63H 4GKJQ 4U68A 4A3IB 3D6CA 4C3HB 3NBIA 3AU7A 4GLVB 4NW2A 1GHJA 5IT9c 2B2TA 2RDHA 4GS3A 3I4MB 2DNCA 3VYSA 3ERSX 5CV6A 3HOVH 4CHTB 5IGDA 3S9WA 4H02A 4XT3B 4JV5L 5L37A 4C56C 4HCEA 2A68C 1A62A 3G6JB 1LT3D 3VR2A 4IO9A 3C1EA 3HFZB 3TZDA 5IWAQ 2KHJA 5GROA 2PW5A 3CMEA 1M90C 5HGQA 2EYFA 1O78A 1DYQA 1G6ZA 2PMZB 5FKAC 1HNWL 2L5TA 2R93G 4QUFA 3OHXC 3WWVA 4OHJA 1XMOL 4Y7NH 1M4VA 4X65Q 2UUAQ 1Z6HA 5JJKA 4KLKA 1GM5A 5GQOA 4FNFA 4KKSA 4GNXA 4HSPA 3VR4A 3NENA 4EQNA 1QG7A 1C48A 4DV0L 2HDLA 4V190 3J7A5 1SYFA 1SJED 2K6AA 3HKZB 2ZM6L 4AYBE 5K36G 3OTOL 4GKKL 2ZTCA 4RMFA 5CGKA 1F2YA 2JA7H 1B1ZA 5M5YH 5C44G 1QVGA 1VDZA 4K6DA 2B2YC 2F0IA 1QILA 2E74C 4KD3A 4ZUIA 4DR4L 4HEDA 4Q5VA 4L8JA 2ZJPA 4YY3L 3HG9A 1T5EA 3A54A 2K52A 3GDEA 4RGOS 5JPMC 3HGBA 5AFWA 2X6GA 5C3WA 1ET6A 2IX3A 1YJNA 4DPGA 1EEID 2IPKD 4BXXH 4NXNL 1NAPA 3RD4A 2ZXRA 2RVLA 3L7ZC 2NVYB 4DU9A 2AWNA 5IP9H 1L1OA 5DNFA 2F0HA 1FYCA 1MJEA 5E4XA 3CCUA 2PI2E 1KRSA 2P5ZX 3U58A 4DAYB 2CQOA 4PMCA 2SEBD 4A3FG 2MO1A 1PTOH 2M00A 4LF5Q 4X3KA 3NTIA 1IL8A 1MGSA 2EYHA 1ZYRD 2Z0SA 3H91A 1I3QH 2WAQE 4QF4A 4V0BA 1TWCB 1V8QA 2CH4W 2NZHA 5KYLA 3K5OA 1VQKA 2K5QA 4WFN3 5C3XA 1CM9A 4JI0L 1H9MA 4NKLA 4B3RQ 1B50A 3W1GA 3EIVA 3J81L 4DF7A 4HN7A 1FGUA 4C1NI 1SMYC 3H6MA 2N3SA 5K36H 1PFMA 5DLQE 1CA5A 3IRBA 2VQFQ 1PYSB 1OXSC 1U4LA 4IN3A 4DN4M 4OL7A 4A3LG 2WB1G 3UDGA 5CBAE 2YYZA 3CAMA 1RDPD 1S5DD 1Y1VG 3PUWA 1RD9D 1TWAH 2EDGA 3AFQA 2K5NA 3GTKH 4DV1L 5AJ3Q 4DK1A 1XPRA 4OELB 5GADC 2NUCA 1WD0A 3PQIA 1EWHA 2A6ED 3NXWA 4HIDA 1Y8PB 3J7AV 1HR0L 3AYHB 1EWCA 4NXML 2NVTB 2QGQA 1XPUA 4ZUJA 4JG2A 4EX5A 2K05A 4EGVA 4DV2Q 3PIOA 1E1OA 2L0CA 5IYCG 1Y1WH 5GAHC 4YWLA 5M3MG 3EBEA 4P74A 4J1MA 3DHQA 4LF9Q 3ICEA 4DR6L 2NZOA 1WTPA 2QCPX 3FVQA 4K5VA 1GUTA 2ID0A 2UXDL 2VW9A 4A3FH 4P73A 1HZBA 2UU9Q 4JI8Q 1GUWA 4IOCA 3GQBA 2F0SA 1GKHA 2A69C 3U4ZA 1HQRD 3VR3A 1ASZA 2IHEA 4IFDG 1BF4A 1IXRA 1HFNA 1I94Q 4CDFC 4R4QA 1B8AA 4YHHQ 4A3DB 4C3JG 3D4RA 3U9SA 4BWGB 1IBLQ 2NWGA 4NP5A 4OWTB 4GKJL 1MJCA 1K8OA 4LMQD 2Q2IA 1TWHB 2I5MX 2LFNA 3H15A 1J8IA 4A3LH 1RL2A 5I9OA 2B2VA 4KHPQ 1Y1VH 3GTPB 3ULJA 4G7ZC 4B3TQ 1IBMQ 3A8IE 1LTID 3FDTA 1XX8A 5CBEE 3CCMA 4RAUC 4FXKC 1K3RA 1NSNS 4JI3Q 1VF7A 3IFDA 4IPHA 3I4NB 2D62A 4LF8L 3E0EA 1ASYA 3GTLB 4X62Q 1JJGA 3SVMA 4A3EB 3M4OH 5IWAL 1XMQQ 1VF5C 1WOCA 2XWJB 1SFOB 5M3FG 1MKHA 2VB2X 1ESFA 1Z47A 4RKLA 5M3MH 1E2ZA 2O5IC 1EY4A 2IY5B 4IQZA 3NTKA 2WV6D 4TSSA 4P75A 4KI0A 4ZYSA 5BN4A 4X65L 4ODGA 1D5ZC 2UUAL
chains in the Genus database with same CATH topology
2OT2A 4F7XA 1U4PA 4C2MB 1IYVA 1U4RA 4PQXA 3RLFA 3MHBA 5LHY1 5C4JB 2D9UA 3HOYB 1KABA 4IFDH 1AN8A 2E76C 3T56B 3GTGB 1B9NA 1SNQA 4FF4A 1TWFB 5KRUA 1U4MA 1AP0A 2VXWA 2J0TD 3BVMA 3IAYA 4RCNA 5JJZA 2L11A 4C3IG 5EKIA 1R4PB 1BDOA 1EL0A 4K8IA 2IX1A 2PYKA 1LTRD 1SE3A 2K03A 3OOCA 2PPBC 5A2QE 3PUZA 1VMCA 1NR4A 4H13C 4FF2A 1RHPA 1BNZA 4L6TB 4H0LC 5K5PA 4FF3A 3DWAA 1GUSA 2HDMA 3J7YW 4BBRB 3PUYA 1ONLA 2A5HA 2E2JB 2B2YA 4KN4C 1SNOA 1MSHA 3E0JA 4A3MB 2OEOA 3Q6SA 2HCIA 5BN5A 3S2DB 3NTHA 3FPPA 2Q8RE 4BS9A 2MHVA 1A3TA 3BS1A 1CTMA 2CQAA 4PV1C 2Y0SB 3SK5A 3PO2B 3OMCA 4A93B 5EJWA 1RTNA 2B2UA 2F0OA 4KY6A 1HUMA 1AFPA 1ZYRC 4QMGA 3KK7A 1UEAB 3A7LA 4DK0A 1KLGD 1GOZA 1F9SA 5EPKA 2BE5D 3SK4A 3LWUA 5IT9E 4IZ8A 4FO2A 5EQ0A 4YIJA 1DXMA 3K7AB 3K58A 1CHQD 1L0YB 1LABA 1STEA 1HA6A 1S5CD 1MBYA 5EPJA 4HMIA 2DN8A 4IUVA 2Q8IB 5JEAG 3R8BA 2AUKA 2A6EC 3NBHA 5FOBB 5IGBA 2A74C 1LTTD 2XIWA 2F0QA 1HCZA 3VA5A 2MGSA 1HHVA 5E4WC 4G7HC 2K32A 2LKVA 4IUPA 3GTMB 1B4OA 5J1ZA 3FPUB 2AQ2B 5I6YA 1PZKD 3P7JA 3A55A 5D3IB 3I91A 2GA4B 2FHTA 1EU3A 3A8JE 4DNTB 2QILA 3Q0AA 2EYLA 1PTOC 1BCPB 5C3EB 5CV9A 3NPPA 1LT4D 4BA1I 1R4QB 5KIXA 1QNUA 4CKBA 2H4OA 1AW7A 3NWTA 4EQOA 2JXMB 1E2WA 4KD4A 1HFGA 2PNRC 1A2TA 3EROA 3PMFA 1WTXA 1K83B 5I2XA 1EFID 1UUPA 4A3KB 1HTPA 2KVMA 5EBCA 1JICA 2C5CA 1ILQA 3BDLA 4K8JA 3WOFA 4O42A 1CZWA 1FNUA 3LNNA 1SE2A 1YNNC 3K5LA 1EY9A 2DY7A 3GP7A 2JA5B 5IGGA 3M85A 4KN7C 1TWGB 1TQOA 1F9QA 4K5XA 1KTKA 3EA6A 1KDAA 5C5LA 3NWSA 1PZJD 4CKEA 5T1GA 3SR1A 1ENFA 3S17B 2F0DA 1D1IA 4QIWB 1SYGA 1Z7TA 1ZKOA 3MWYW 4IFDI 4KY7A 2PW7A 1IW7C 2KA7A 3EVQA 2SNMA 4K14A 2OXPA 1A15A 4RGMA 1JE4A 5DAUA 2R92B 3W2DA 4C3HG 1Q1EA 1YNJD 4TQUS 2AQ3B 2B8FA 3CKIB 4X3UA 1H9SA 3QB3A 5ISRA 4KJOA 2O5JC 3S1RB 4DA2A 5I9PA 3NUCA 1PRTB 1GJXA 4X3TA 1FGBD 3C2PA 5ELEA 4DXGA 3ND8A 1JOQA 3VR6A 3SK6A 1ET9A 1SYBA 2EYJA 3MXUA 3V05A 3ND9A 1I50B 5C44B 3MXNA 5JVH3 1Q90A 3N6RA 2IT1A 5M5XB 3BDOA 4FYDA 3Q22A 1OXUA 4TRDA 4LAAA 1G291 4WORA 1FR3A 2M9VA 2E2DC 3R2IA 1WCMB 1B9MA 5BN3A 2A6HC 2G9DA 3G7LA 3K5MA 4X3SA 1EZ8A 1WTWA 1H9RA 4ILWA 4KY5A 4U673 5IGEA 1ML0D 2KOLA 1KNAA 1GXDC 2ZT9C 4IFDJ 1EOTA 2NN6G 3OWEB 3NP8A 2L12A 4Q0FA 1PDQA 4DAPA 3HS0C 4CJ2C 1I6HB 1V43A 5CYUA 4KK7A 3FRPB 3SDZA 1A2UA 1V1PA 3K5NA 3OIPA 1S5FD 1GUOA 1PFNA 1SBBB 5KEEA 1BCPD 4I7ZC 4R8NA 1I4HA 2X6LA 1WTRA 3T13A 1DD2A 4E6IA 4RH6A 1M8AA 1WTOA 5A2QL 3CQZB 3K57A 1RKNA 1SAPA 1CT1D 4ZKCB 1TT2A 4M1UB 1IKMA 4IUQA 3HOXB 2DY8A 2H1EA 3IFTA 3OSOA 1LTBD 3QWNA 3L9AX 1Y8OB 1QE6A 4OO1G 1NR2A 2NN6H 3TN2A 3D6WA 3MTSA 2F0WA 3FKIB 3MXPA 3K6OA 4HCSA 2IJ0A 5FO8B 1LLRD 3TSSA 1KNEA 3H0GB 1KLUD 3P1HA 1QB5D 3TP6A 5FO7B 3TMEA 2Z1CA 4IUTA 4ULLA 1I4QA 1RCVD 3MVVA 1LTAD 1EIGA 3RZDB 2IWHA 1BQQT 1VCIA 4XDXA 1ZEQX 1LT5D 5D14A 3JAME 4RGTA 2B2WC 2RBMA 3O13A 3PIO3 3T16A 3S1NB 2K04A 2JEBI 5IGCA 5IT9L 3S15B 1PRTD 3T4AC 3SE0A 2JA6B 2XN9C 3RZOB 2KJXA 1FNWA 5IGFA 4H7BA 4C1NK 2RDFA 4QUCA 4DFAA 3QJYA 2R61A 2RDGA 3NQIA 1SNPA 1X3QA 3VYTA 1W6KA 2NB0A 2R7ZB 2E75C 4R9WA 4RGNA 3D4DA 5NUCA 3SK8A 4OO1H 2TSSA 2E2IB 2F0EA 4QCLA 3BDCA 1HRJA 4N9TA 1D6EC 5CV4A 3SHLA 4B9XA 1JC7A 3LX0A 3D3RA 4RFBA 5I2YA 1PMRA 2OF1A 1DOKA 4G4KA 4N9PA 5A35A 5DM63 1BBXC 4RHSA 3S1QB 1HTLD 2Q8TA 5M9OA 2F0TA 3I72A 3DEPA 1JWSD 4B9WA 2IL8A 3PUXA 3P20A 3EFXD 2LMCB 2VNUD 2EY2A 1HQMC 4C3IB 5C6AA 3J80E 5JPNC 2PZWA 3MFYA 2XVSA 1BCPF 2JE6I 3RMHA 1SXTA 2KCNA 5J39A 5CV7A 4CJ0B 1OXXK 4A3JB 2CVRA 1Q3LA 3PIP3 4XTCS 1EY0A 1PYWD 1K8MA 3FMCA 2MP1A 4XQQA 1II3A 3BVZA 3TP7A 5JEAJ 2K28A 5D65A 1TVXA 2A73B 2ZXPA 3NHHA 4M8AA 3QG1A 5C0XG 3D31A 1PZID 1PXUA 2F0FA 5IIFA 5EGTA 1QNKA 1AZQA 4RA8A 1S5BD 5I6WA 3NQTA 2HQEA 3VR5A 1KDCA 3CRLC 4KHZA 4IUNA 1EY7A 1JOKA 1H9SB 4RWSC 2VUMB 3Q24A 4ZRZA 2SDFA 1G2TA 3OMGA 4KHVA 1XWEA 2CHBD 1D5MC 2F0GA 2WKCA 4HSVA 2BDNA 4GZYC 1C4QA 1CK1A 1S5ED 3UI2A 3T53B 2JA8B 3HP3A 2EVBA 3R3OA 2JYOA 2F0VA 2EYMA 2F0NA 1I4PA 3H09A 4MIUA 4O1NA 1WTVA 1QWYA 1PRTF 1DOMA 3L3OC 2XSCA 4CGYB 1BR9A 1TIID 4FXDA 3OW7A 3MEHA 1WD1A 2I07B 2KEEA 1HA5A 1EY5A 2EJGC 2Z4IA 5IOCA 1S4ZA 2K33A 4XYQA 2I46A 5C0XH 3VYUA 1B3AA 1D5XC 3GV3A 3KLSA 1JOOA 3QO2A 2KUMA 4BY1B 1CFMA 3J7AF 1F2ZA 2YU9B 3DM1A 3ZYYX 2B63B 5I4DA 2EY5A 3X3MA 2J4XA 3C46A 3U9OA 1V1PB 4DGZA 1OO9B 1DZ1A 3HOVB 1GUGA 4KMUC 1G8ZD 2SOBA 1O7LA 1DJRD 3NK9A 4UDUC 2EOTA 3T51B 1GUNA 5FO9B 2XWBB 1EYDA 2A69D 4CKCA 1F9PA 1JWUD 1TS5A 3OWFA 1O7YA 4MN3A 3EJIA 5FLXE 2D5DA 4Y7NB 1H9JA 5KNDA 3TZUA 1EQTA 4ZAIA 3KLRA 3H3VC 2AUJD 2PZTA 5CC4A 2EZVA 2PZUA 3R93A 1B53A 3V2TA 2B2WA 1Q1BA 5ELBA 1JCKB 1G91A 2WACA 3X3NA 2JA7B 5COYA 5M5YB 1DM0B 2X69A 5DEHA 3WOEA 1IHZA 5C5MA 2QEJC 5G3LD 2DNEA 5JOBA 1LT6D 3I4LA 2KECA 2CW0D 4IURA 4FVMA 4H44C 1BOSA 4FF1A 1HXYD 5EKKA 4ID6A 1EZ6A 2C9OA 1U9RA 4JBWA 1ENAA 5FK9C 4I65A 1STYA 3IKJA 1EY8A 3TP5A 3MAQA 3D8GA 2F0PA 1PTOB 2R93B 4ABNA 3QIAA 4HR7B 2KHSA 1X32A 1CZGA 1LV9A 3I8ZA 1I3QB 1I4RA 1ZXTA 3PV0A 3JAML 3GO5A 3HEJA 2EJFC 3KUPA 4L63B 1HPCA 1IYUA 1E0BA 4ZLTF 3ITPA 1DONA 3AMUA 3R2TA 1PFBA 2F3VA 3A56A 1B2TA 1STHA 2BDOA 2O2LD 3TBIB 2BA0A 2LS01 3OIQA 3BVGA 2K01A 4HAEA 1TWAB 1CA6A 3GTKB 2K7VA 5IODA 2EPBA 1TS3A 1NCVA 2F0KA 4HMJA 4F88A 2FFKB 5KGUA 1JB3A 4OGQC 1DOLA 1SSOA 1ILPA 1RF2D 4IALA 1KAAA 1Y1WB 1DCZA 2BA1A 3K0YA 2RQXA 1SJHD 3TP8A 3N52A 2FMCA 4LK1C 3KBGA 4A3FB 1BUVT 2J7ZA 2IW3A 2K1BA 1J9OA 2N55A 3MA2B 3C3LA 1FD7D 2F0UA 3BG3A 1CI3M 3OPOA 3Q23A 4J6HA 2LY7A 3C1FA 2M2LA 1CHPD 4XQNA 5JAVA 4CJ1B 2B2UC 3I3CA 2XNAC 4K2KA 2RSNA 3J80L 1TS2A 1Q8IA 1SNDA 2KEDA 1EEFD 4RKBA 4OIKA 2F4IA 4DAVA 3BYTB 2AQ1B 2BE5C 2TMPA 2WB1B 2BOSA 2B39A 3DWQA 1Y1VB 1QOHA 4XT1B 5C0XI 1EY6A 4LJZC 2BCOA 5E1FA 4RCOA 4FP5D 5LL6X 1EIHA 2XRSD 3MFGA 1LTSD 1OXVA 3M4OB 1C8CA 4ZK9B 5G3LF 5ELFA 1JR0D 3M4YA 1TR5A 3URYA 5M3MB 3A8KE 2F0JA 5T1IA 2EYPA 2EXZA 5CV8A 1O80A 4Z9CB 4F87A 1IKLA 1MSGA 2L1BA 5HURA 4KV6A 3HRZC 3I73A 1TU2B 2R3ZA 1LTGD 1SEBD 1CQFA 4UAIA 2ICIA 3P75A 1WVLA 5EBDA 5HGTA 4A3GB 4R8IA 3QOLA 3M3YB 5CV5A 3SXHA 1AZPA 1BO0A 5EPLA 4G57A 4C3JB 3DEOA 1SYCA 1KDBA 3BYYB 4NDXA 3GD7A 2F3WA 3HZXA 5KNBA 1SDFA 1PTOD 5C4HA 1STBA 1A3VA 5JVG3 1STGA 2NTSA 4P2CB 3GV6A 4IUUA 4KKTA 1I4GA 4S3SA 2PCFB 3WDNA 2NYZD 5E3FA 5C0XJ 2FINB 1LACA 1X3PA 3S16B 1QCBD 5M3FB 1FNVA 2HUGA 2NVQB 4PNYA 2PQEA 1NUCA 1XTCD 2WIIB 5ELCA 3GTQB 1H9KA 1YNND 1F9RA 1G2SA 4J8QA 3MC0B 1F77A 2PO4A 2L4NA 3F2UA 2F1MA 1MI2A 2L9HA 3DMUA 3NE5B 3CRKC 1UNSA 2B2TC 5KNCA 1JQYD 2CW0C 3M7GA 4XIGS 1W6JA 3DUZA 1Y69U 1GHKA 3V96A 4BA2I 4KJNA 4G7OC 3KBXA 1L0XB 3VYRA 3SEBA 2F0MA 5J22A 2RSOA 1SE4A 1LO5D 4FXGC 1XYIA 3KF8A 1IW7D 2A68D 1AEXA 1WTQA 1PLFA 2XRQD 1EYAA 4XXEA 1YNJC 2QKIC 1Q12A 1TKWB 2F0LA 2JEAI 3GTJB 2Z8LA 4AYBB 3I70A 4EVOA 4ZQ3A 5FLXL 3E6ZX 2FMMA 1A6XA 4KTAA 1TS4A 1UAPA 4OIJA 1EU4A 2MUYA 4DAYA 2RA4A 1SYDA 3J81E 1D1KA 2K5WA 3HOWB 5M5WB 3RUZA 4F8MA 1ESRA 3W3AA 2O4XA 5F2DA 3MXGA 2QDBA 2G9HD 2AWOA 2WKDA 2NVXB 3MZ5A 1OXTA 1SNCA 2V4DA 3BZDB 1E2VA 2EY1A 3HOUB 4HTHA 2A6HD 1ICWA 3E5SA 4ME5A 1Y8NB 3PO3B 1F2LA 2WAQB 3DWPA 3K59A 3D4WA 2HCCA 3FEWX 4EQPA 2EE1A 4BBSB 1STAA 5D3DA 4MHEA 1ENCA 5C4XB 2SNSA 1D2BA 1PTOF 4K6LA 4A3BB 4NMZA 2ZXOA 5LL6S 1JWMD 5EKLA 3LWEA 1BCPC 2N88A 1MD2D 3I90A 2KCCA 1QJOA 1TY0A 2B8GA 4JK1C 2RKSA 2L55A 1T5XD 1SMYD 3A7AB 1V1OA 1SYEA 3CU7A 2R6GA 4PMBA 4TKOB 1SNMA 2EY6A 1HUNA 2Z4HA 3CHBD 5TSSA 1O7ZA 5KYIA 3IL8A 3H94A 2NN6I 3VA7A 4ZKBB 4PMWA 2MJ8A 5C4ZA 3GTOB 4CBVA 1B44D 3KLSX 3EQLC 1I6VC 3S2HB 1JORA 3PUVA 4K5WA 2NTTA 1STNA 3S14B 2VB3X 2ICEC 3S1MB 4DXFA 5CORA 2NZ1D 1VMPA 2JSOA 3AB9A 5ELDA 2EJMA 1CQVA 2WP8J 4KKUA 4BY7B 4WRDA 2K5DA 3M7NA 1F2MA 3NSWA 2IX0A 1EQVA 4QB4A 4XQJA 1I4XA 1RJTA 2QF7A 2F03A 2B2VC 4XYOA 4B08A 2KQ3A 1R9TB 1RTOA 1XXGA 2D2CC 1PRTC 3ONAB 4WJWA 1A3UA 1TY2A 2NBFA 4RHRA 1RODA 3DXJC 2E2HB 4OO1I 3HOZB 1BXTA 2EYOA 2MPMA 2JP1A 5CMDA 5JEAH 2ENBA 4K2LA 5CR3A 5DM73 3ERQA 2FJ2A 1EYCA 3QOJA 3TDQA 4DNRB 2WINB 4U68A 4A3IB 3D6CA 4C3HB 3NBIA 3AU7A 4NW2A 1GHJA 2B2TA 2RDHA 3I4MB 2DNCA 3VYSA 5CV6A 4CHTB 5IGDA 3S9WA 4XT3B 4C56C 4HCEA 2A68C 3G6JB 1LT3D 3VR2A 3C1EA 3TZDA 2PW5A 2EYFA 1O78A 1DYQA 1G6ZA 2PMZB 5FKAC 2L5TA 4QUFA 3OHXC 4OHJA 1M4VA 1Z6HA 4FNFA 4KKSA 4HSPA 3VR4A 4EQNA 1QG7A 1C48A 2HDLA 4V190 1SYFA 1SJED 2K6AA 3HKZB 5K36G 5CGKA 1F2YA 1B1ZA 1VDZA 4K6DA 2B2YC 2F0IA 1QILA 2E74C 4KD3A 4ZUIA 4HEDA 4Q5VA 4L8JA 3HG9A 1T5EA 3A54A 4RGOS 5JPMC 3HGBA 5AFWA 2X6GA 5C3WA 1ET6A 2IX3A 1EEID 2IPKD 1NAPA 3RD4A 2ZXRA 2RVLA 3L7ZC 2NVYB 4DU9A 2AWNA 5DNFA 2F0HA 1FYCA 5E4XA 4PMCA 2SEBD 1PTOH 2M00A 4X3KA 3NTIA 1IL8A 1MGSA 2EYHA 1ZYRD 3H91A 4QF4A 4V0BA 1TWCB 1V8QA 5KYLA 3K5OA 2K5QA 4WFN3 5C3XA 1CM9A 1H9MA 4NKLA 1B50A 3J81L 4DF7A 4HN7A 4C1NI 1SMYC 3H6MA 5K36H 1PFMA 1CA5A 1OXSC 1U4LA 4IN3A 4DN4M 4OL7A 5CBAE 2YYZA 1RDPD 1S5DD 3PUWA 1RD9D 2EDGA 4DK1A 2NUCA 1WD0A 1EWHA 2A6ED 3NXWA 3J7AV 1Y8PB 1EWCA 2NVTB 4ZUJA 2K05A 4EGVA 2L0CA 4J1MA 3DHQA 1WTPA 2QCPX 3FVQA 4K5VA 1GUTA 2ID0A 1GUWA 3GQBA 2F0SA 2A69C 1HQRD 3VR3A 4IFDG 1BF4A 1HFNA 4A3DB 4C3JG 3D4RA 3U9SA 4BWGB 2NWGA 4NP5A 1K8OA 4LMQD 1TWHB 2LFNA 1J8IA 5I9OA 2B2VA 3GTPB 4G7ZC 3A8IE 1LTID 3FDTA 1XX8A 5CBEE 4RAUC 4FXKC 1NSNS 1VF7A 3IFDA 3I4NB 2D62A 3GTLB 3SVMA 4A3EB 1VF5C 2XWJB 1SFOB 2VB2X 1ESFA 1Z47A 4RKLA 1E2ZA 2O5IC 1EY4A 4IQZA 3NTKA 2WV6D 4TSSA 4KI0A 4ZYSA 5BN4A 4ODGA 1D5ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OIJ A;  1U4P A;  2B2Y C;  1U4R A;  2Q8T A;  1SDF A;  2M2L A;  2K05 A;  1X3Q A;  2D9U A;  2X6L A;  1WTR A;  4HED A;  4CJ1 B;  1QNK A;  1AZQ A;  2RA4 A;  2B2U C;  2MPM A;  2JP1 A;  3I3C A;  4RA8 A;  4R9W A;  1M8A A;  2RSN A;  5EJW A;  1RTN A;  3GV6 A;  1WTO A;  4IUU A;  5CMD A;  1DZ1 A;  1WTP A;  2B2U A;  2KED A;  1HFG A;  1HUN A;  5AFW A;  1X32 A;  2FJ2 A;  2X6G A;  1HUM A;  1ESR A;  4OIK A;  1LV9 A;  2EOT A;  1SAP A;  1HRJ A;  3I8Z A;  1WTX A;  1U4M A;  1GUW A;  2NYZ D;  1O7Z A;  4RWS C;  4ZKC B;  3IL8 A;  1NAP A;  1IKM A;  2FIN B;  1ZXT A;  1X3P A;  1F9S A;  2DY8 A;  2SDF A;  4IUQ A;  5EPK A;  1AP0 A;  2RVL A;  2H1E A;  4ZKB B;  1G2T A;  2VXW A;  2KVM A;  1DOK A;  1BBX C;  4U68 A;  2MJ8 A;  1JIC A;  3KUP A;  1ILQ A;  5DNF A;  1BF4 A;  2HUG A;  1F9P A;  4O42 A;  1HFN A;  4NW2 A;  5JJZ A;  1E0B A;  4XT1 B;  5E4X A;  5EQ0 A;  1O7Y A;  1QE6 A;  2L11 A;  3G7L A;  2B2T A;  1NR2 A;  4HSV A;  4MN3 A;  4ZLT F;  2BDN A;  1BNZ A;  3TN2 A;  4X3S A;  5CBE E;  1DON A;  5EKI A;  3D6W A;  3MTS A;  3UI2 A;  1PFB A;  1ICW A;  1F9R A;  2DY7 A;  4HCS A;  1EIH A;  1G2S A;  1EL0 A;  1WTW A;  3DEP A;  4X3K A;  3HP3 A;  1B2T A;  1EQT A;  1IL8 A;  1KNE A;  4XT3 B;  1F2L A;  4ZAI A;  2L4N A;  3F2U A;  1MGS A;  2JYO A;  2NWG A;  1C8C A;  4ZK9 B;  2IL8 A;  3H91 A;  1HA6 A;  5COR A;  1F9Q A;  1ML0 D;  1MI2 A;  2K03 A;  2L9H A;  2K01 A;  4HAE A;  4LMQ D;  2KOL A;  2NZ1 D;  1VMP A;  5EPJ A;  1CA6 A;  1J8I A;  4IUT A;  3TZD A;  1KNA A;  2B2T C;  3R93 A;  2EPB A;  1B53 A;  5T1I A;  5T1G A;  4IUV A;  2B2W A;  1WTV A;  2B2V A;  2HCC A;  1VMC A;  1EOT A;  1DOM A;  1NCV A;  1CM9 A;  1NR4 A;  1O80 A;  2FFK B;  1EIG A;  1G91 A;  1RHP A;  1B50 A;  1IKL A;  1G6Z A;  1MSG A;  2XIW A;  2L1B A;  3FDT A;  1XX8 A;  3KBX A;  2EE1 A;  1DOL A;  2L12 A;  1SSO A;  1PDQ A;  5COY A;  2KEE A;  4RAU C;  4QUF A;  1WD1 A;  1ILP A;  2MGS A;  2X69 A;  1HHV A;  2R3Z A;  4MHE A;  3IFD A;  3MWY W;  5E4W C;  2RSO A;  4XDX A;  4CJ0 B;  4CJ2 C;  1PFM A;  2HDM A;  2CVR A;  1Q3L A;  1S4Z A;  4UAI A;  5D14 A;  1CA5 A;  1WVL A;  1U4L A;  1XYI A;  4DN4 M;  1RJT A;  2B2W C;  4IUP A;  2B2V C;  3SVM A;  1WTQ A;  4R8I A;  1B4O A;  5CBA E;  1A15 A;  1JE4 A;  1PLF A;  2B2Y A;  1B3A A;  3FPU B;  1RTO A;  2MP1 A;  1MSH A;  2K04 A;  3GV3 A;  3P7J A;  3Q6S A;  1QG7 A;  3ONA B;  2HCI A;  3N52 A;  3QO2 A;  1PFN A;  2KEC A;  1AZP A;  1BO0 A;  2KUM A;  2HDL A;  3LWE A;  4X3U A;  2K28 A;  2N88 A;  4IUR A;  5EPL A;  5D65 A;  1WD0 A;  3I91 A;  1TVX A;  3I90 A;  2J7Z A;  3DEO A;  2FMM A;  2K1B A;  1ROD A;  2FHT A;  3DM1 A;  1J9O A;  4QUC A;  2N55 A;  2Q8R E;  4X3T A; 
#chains in the Genus database with same CATH topology
 2OT2 A;  4F7X A;  4NB3 A;  1U4P A;  4C2M B;  1IYV A;  1U4R A;  4PQX A;  3RLF A;  1EWI A;  3MHB A;  5LHY 1;  5C4J B;  2D9U A;  2UXB L;  1VQN A;  3HOY B;  1KAB A;  4A3G H;  4IFD H;  1AN8 A;  2QA4 A;  3CD6 A;  2E76 C;  3T56 B;  5BR8 Q;  1X54 A;  3M3Y H;  1E22 A;  4DR3 L;  3GTG B;  1B9N A;  1SNQ A;  4FF4 A;  4C3J H;  1PH8 A;  5LMN W;  1TWF B;  5KRU A;  1U4M A;  4GLX A;  2GVB A;  1AP0 A;  3KYH C;  3JAM i;  4DUZ Q;  2VXW A;  1W3S A;  2J0T D;  1P16 A;  3BVM A;  4P72 A;  3IAY A;  2MNA A;  4RCN A;  5JJZ A;  2L11 A;  4C3I G;  5EKI A;  1R4P B;  4FDB A;  3D0F A;  4DKA C;  4AYB G;  1BDO A;  1EL0 A;  4K8I A;  2IX1 A;  4R4C A;  5FJ8 G;  4X6A H;  1VQL A;  2PYK A;  4JBK A;  1LTR D;  5EAY A;  1IZ6 A;  4A3J G;  1SE3 A;  2K03 A;  3OOC A;  2PPB C;  3S16 H;  2AMC B;  5A2Q E;  3PUZ A;  1VMC A;  1NR4 A;  5M3F H;  4H13 C;  4FF2 A;  1RHP A;  2NVQ H;  3GTP H;  1BNZ A;  4L6T B;  4H0L C;  3HOW G;  5K5P A;  2PMZ E;  4FF3 A;  4LF5 L;  3GTQ H;  3DWA A;  1GUS A;  2HDM A;  3J7Y W;  3I56 A;  4BBR B;  1A8V A;  3PUY A;  2ZJR A;  1ONL A;  2A5H A;  2E2J B;  1C7Y A;  2B2Y A;  4KN4 C;  1SNO A;  4APV A;  1MSH A;  3E0J A;  1KRT A;  4A3M B;  2OEO A;  3Q6S A;  2HCI A;  5BN5 A;  4B3R L;  5JJL A;  3HOU G;  3S2D B;  1WTH A;  3NTH A;  4YCW A;  3FPP A;  4UP7 A;  3RLN A;  3HKZ E;  2Q8R E;  2F52 A;  4BS9 A;  3PO3 G;  2MHV A;  2VQF L;  1A3T A;  2WAQ G;  4JI1 Q;  3BS1 A;  1CTM A;  2CQA A;  3CCQ A;  4PV1 C;  1YZ6 A;  4QY7 A;  2Y0S B;  3SK5 A;  3PO2 B;  3OMC A;  2A8V A;  4A93 B;  1J5E Q;  1HZA A;  5EJW A;  5AJ3 L;  1RTN A;  1K8G A;  1GVP A;  4GNX B;  1WFQ A;  2B2U A;  2F0O A;  4KY6 A;  3GTJ H;  1HUM A;  4BBS G;  1AFP A;  1ZYR C;  1V9P A;  3KK7 A;  4QMG A;  1UEA B;  3A7L A;  4DK0 A;  1KLG D;  4DR1 Q;  1GOZ A;  1KXL A;  1PVO A;  1F9S A;  5EPK A;  2EXD A;  3W1B A;  4DV2 L;  4ALP A;  2BE5 D;  2KHI A;  3SK4 A;  3LWU A;  5IT9 E;  4IZ8 A;  1HR0 W;  3F2B A;  2Z6B A;  4FO2 A;  5EQ0 A;  4YIJ A;  4A75 A;  1DXM A;  3K7A B;  3K58 A;  3W5O A;  4IJL A;  4ZCK A;  1CHQ D;  4DV3 Q;  3HOW H;  1L0Y B;  1LAB A;  5M5W H;  2UU9 L;  4JI8 L;  1PH9 A;  1B70 B;  1STE A;  1HA6 A;  1S5C D;  1VQ4 A;  1PH3 A;  1MBY A;  5EPJ A;  1LUZ A;  4JBM A;  2NVX H;  4HMI A;  2DN8 A;  3K0X A;  1VQ8 A;  3E3X A;  2YTV A;  4IUV A;  1I94 L;  2Q8I B;  5JEA G;  4DK6 C;  1L1O B;  3R8B A;  2AUK A;  2A6E C;  2K5V A;  3NBH A;  5FOB B;  5IGB A;  2A74 C;  1LTT D;  2XIW A;  4YHH L;  3HOU H;  2F0Q A;  1HCZ A;  3VA5 A;  4L5R C;  2MGS A;  1HHV A;  5E4W C;  4G7H C;  1IBL L;  2K32 A;  2LKV A;  1IL2 A;  2B63 G;  3PO3 H;  4IUP A;  3GTM B;  1B4O A;  3KDF B;  5J1Z A;  3FPU B;  3F2D A;  2AQ2 B;  5I6Y A;  1MIU A;  1PZK D;  3F1Z A;  3P7J A;  2D0O A;  3A55 A;  4B3T L;  5D3I B;  4L5S A;  3J81 c;  2QDL A;  3I91 A;  3HOV G;  4EQ5 A;  2GA4 B;  2QW7 A;  2FHT A;  1EU3 A;  1UE6 A;  3A8J E;  2Z6K A;  4BBS H;  1YNX A;  1X56 A;  4DNT B;  2QIL A;  3Q0A A;  2EYL A;  4JW0 A;  1PTO C;  5C4X H;  4UHV A;  4X62 L;  1BCP B;  5C3E B;  2ASB A;  1XMQ L;  5CV9 A;  3NPP A;  4A3B H;  1LT4 D;  4BA1 I;  1R4Q B;  5KIX A;  1QNU A;  4CKB A;  2H4O A;  1AW7 A;  3NWT A;  4EQO A;  2JXM B;  1E2W A;  4KD4 A;  1L0W A;  1PH5 A;  4OEM B;  3DM3 A;  1KAW A;  1YIJ A;  1QZH A;  4BY7 G;  1HFG A;  2PNR C;  1V1Q A;  1A2T A;  1VQP A;  1JJC B;  1Z9F A;  3ERO A;  3PMF A;  1QZG A;  1WTX A;  1K83 B;  5I2X A;  1EFI D;  1K9M C;  5HY6 A;  3MEF A;  4HJ9 A;  1VQ5 A;  1UUP A;  4A3K B;  1HTP A;  2KVM A;  5EBC A;  2YV5 A;  1JIC A;  2C5C A;  1ILQ A;  3BDL A;  4K8J A;  3WOF A;  4O42 A;  1CZW A;  1KIX A;  1FNU A;  3LNN A;  5IYB H;  1SE2 A;  1YNN C;  1E24 A;  5BR8 L;  4LF6 L;  3BJU A;  4JOI C;  3U4V A;  2F3I A;  3K5L A;  4IPC A;  1EY9 A;  2DY7 A;  3GP7 A;  2JA5 B;  5IGG A;  1NY4 A;  3M85 A;  2D0P A;  3CCV A;  4KN7 C;  1TWG B;  3LGJ A;  1TQO A;  4DUY Q;  4DUZ L;  1F9Q A;  4K5X A;  3CCR A;  1KTK A;  3EA6 A;  5GAG C;  1KDA A;  2RHS B;  5C5L A;  3KLW A;  3NWS A;  1PZJ D;  4MTK A;  4CKE A;  5T1G A;  3SR1 A;  3HOZ G;  1ENF A;  3S17 B;  2F0D A;  1D1I A;  4QIW B;  3GTO H;  3CCS A;  2JA9 A;  4HIO A;  1YHA A;  1SYG A;  1QVF A;  1Z7T A;  3S2H H;  1VQB A;  1ZKO A;  3MWY W;  4IFD I;  2KCM A;  4KY7 A;  4BXX G;  2PW7 A;  1IW7 C;  2KA7 A;  3EVQ A;  3S14 H;  2SNM A;  5IP9 G;  3S1M H;  4K14 A;  1YEZ A;  2OXP A;  4LFB Q;  1A15 A;  4RGM A;  1JE4 A;  5DAU A;  2R92 B;  3W2D A;  4A3I G;  4UP9 A;  1YI2 A;  4RG1 A;  4C3H G;  1Q1E A;  1YNJ D;  3I7F A;  4TQU S;  2AQ3 B;  2B8F A;  3CKI B;  4X3U A;  2G5D A;  1H9S A;  2VL6 A;  3QB3 A;  5ISR A;  4KJO A;  3I4M G;  2O5J C;  2HIV A;  4BY7 H;  3S1R B;  4DA2 A;  5I9P A;  3NUC A;  1PRT B;  4MTN A;  4QGU A;  1GJX A;  4X3T A;  1FGB D;  3C2P A;  4MZ9 A;  5ELE A;  1VQF A;  4DXG A;  2N78 A;  3ND8 A;  1JOQ A;  3VR6 A;  3SK6 A;  1D7Q A;  1BBU A;  1R9T H;  1ET9 A;  1SYB A;  2EYJ A;  3MXU A;  3V05 A;  3ND9 A;  1I50 B;  1N36 Q;  4PZ8 A;  3CF5 A;  4LFC L;  5C44 B;  3MXN A;  2LXK A;  5JVH 3;  1Q90 A;  3N6R A;  2IT1 A;  5M5X B;  3BDO A;  4FYD A;  3G6E A;  1A63 A;  3Q22 A;  1OXU A;  4TRD A;  4LAA A;  1G29 1;  4WOR A;  1FR3 A;  4LW1 A;  2M9V A;  2E2H H;  2E2D C;  3R2I A;  1WCM B;  1B9M A;  1Q7Y C;  1J5E L;  5BN3 A;  3KF8 B;  2A6H C;  2G9D A;  3G7L A;  3K5M A;  2I5L X;  3HOZ H;  4X3S A;  4POF A;  2FXQ A;  1EZ8 A;  5FLX c;  3I2Z A;  3HKZ G;  3CC4 A;  4L5T A;  1WTW A;  4DR1 L;  1H9R A;  4ILW A;  4KY5 A;  4J15 A;  3STB D;  4DR7 Q;  4U67 3;  4DV5 Q;  3AFP A;  5IGE A;  3UE1 A;  1ML0 D;  4R4T A;  2R7D A;  2KOL A;  1Y1W G;  4JPB W;  1KNA A;  1CKO A;  1GXD C;  2ZT9 C;  4IFD J;  4GLA C;  1BVS A;  1C9O A;  1EOT A;  4A3I H;  2NN6 G;  3M4P A;  2GN5 A;  3OWE B;  4C3H H;  2I0Q A;  4X66 Q;  4GOP C;  5IY0 A;  3NP8 A;  2L12 A;  1T9H A;  1E1T A;  1PDQ A;  4Q0F A;  3I4O A;  3I4M H;  2ZTE A;  3G71 A;  4DAP A;  2YTX A;  1X9N A;  3HS0 C;  4CJ2 C;  1I6H B;  1V43 A;  5CYU A;  4DR2 Q;  4KK7 A;  3FRP B;  3SDZ A;  1A2U A;  1V1P A;  3K5N A;  3CW2 C;  3OIP A;  1PH6 A;  1N32 Q;  1S5F D;  1GUO A;  1PFN A;  1S3O A;  2DJG C;  2ZJQ A;  1EFW A;  1SBB B;  2Z9H A;  5KEE A;  1VQM A;  1BCP D;  3H3V H;  4I7Z C;  3KJO A;  4R8N A;  2A1A A;  4JI2 L;  5E7N A;  3M9B A;  4GN4 B;  4DAM A;  4LF7 Q;  1I4H A;  1RIP A;  1HH2 P;  1P8L A;  1LYL A;  2X6L A;  1WTR A;  3T13 A;  1DD2 A;  3TRE A;  4DR5 Q;  4E6I A;  4RH6 A;  2Y0S E;  1M8A A;  1WTO A;  5A2Q L;  3CQZ B;  1EYG A;  1NNX A;  4X64 L;  4JI6 L;  3K57 A;  1MHW C;  2MO0 A;  1RKN A;  1AH9 A;  1SAP A;  1CT1 D;  4ZKC B;  2F4V Q;  1TT2 A;  4M1U B;  1IKM A;  4IUQ A;  3HOX B;  2DY8 A;  2H1E A;  3IFT A;  1ICF B;  3OSO A;  4CDD C;  1LTB D;  3QWN A;  2PNH A;  1TXY A;  3L9A X;  1Y8O B;  1QE6 A;  4OO1 G;  1NR2 A;  2NN6 H;  3TN2 A;  3D6W A;  3MTS A;  2F0W A;  3FKI B;  3MXP A;  3K6O A;  4HCS A;  2IJ0 A;  4QJF A;  1LLR D;  5FO8 B;  3TSS A;  3F8T A;  1KNE A;  2RCF A;  1SN8 A;  3JC6 6;  3H0G B;  1KLU D;  3P1H A;  3KFU A;  1QB5 D;  3TP6 A;  5FO7 B;  4JI5 L;  3TME A;  2Z1C A;  5JJI A;  4NPS A;  4OWW B;  4IUT A;  4JC0 A;  4A3G G;  4ULL A;  1I4Q A;  1RCV D;  3MVV A;  1LTA D;  2NVY H;  3KF6 A;  4N8F A;  1EIG A;  3RZD B;  2IWH A;  1BQQ T;  3CPW A;  1VCI A;  1YJ9 A;  4XDX A;  1ZEQ X;  1LT5 D;  1YJW A;  5D14 A;  3L0O A;  3JAM E;  4RGT A;  4DUY L;  1G6P A;  2B2W C;  2RBM A;  3O13 A;  3PIO 3;  3I55 A;  3T16 A;  3S1N B;  2K04 A;  1TWC H;  2JEB I;  5IGC A;  5IT9 L;  3S15 B;  1PRT D;  3T4A C;  4WJ4 A;  3SE0 A;  3CCJ A;  1UE1 A;  2JA6 B;  2XN9 C;  3RZO B;  2KJX A;  1FNW A;  5IGF A;  3K80 C;  1SR3 A;  4H7B A;  3K8A A;  3NBH B;  2RDF A;  4QUC A;  4C1N K;  2UUC Q;  3VDY A;  4DFA A;  2E5L Q;  3QJY A;  2R61 A;  1AE2 A;  2RDG A;  2RF4 A;  3NQI A;  1PYB A;  4LFB L;  1UEB A;  1SNP A;  1X3Q A;  3VYT A;  1W6K A;  2NB0 A;  2R7Z B;  1WYD A;  2E75 C;  4R9W A;  3CC7 A;  4RGN A;  3D4D A;  2KCT A;  3PSI A;  1X3F A;  2LXJ A;  5NUC A;  3SK8 A;  4B3S Q;  4OO1 H;  2TSS A;  2E2I B;  2F0E A;  2I5H A;  4QCL A;  4POG A;  3BZC A;  3BDC A;  1HRJ A;  4N9T A;  1D6E C;  5CV4 A;  3I4N G;  3SHL A;  4B9X A;  1JC7 A;  3LX0 A;  1Q81 C;  3D3R A;  4RFB A;  5I2Y A;  1PMR A;  2NVT H;  2OF1 A;  1DOK A;  2AKW B;  4G4K A;  4N9P A;  5A35 A;  5DM6 3;  1BBX C;  3EN2 A;  4RHS A;  3S1Q B;  4A3E G;  1HTL D;  1E7Z A;  2Q8T A;  5M9O A;  4LF4 Q;  3UDX A;  2N8N A;  1N36 L;  3AQQ A;  4R1J A;  2BH2 A;  2F0T A;  3I72 A;  2DUD A;  3DEP A;  4MNO A;  1JWS D;  4B9W A;  2IL8 A;  3PUX A;  2XTI A;  3P20 A;  3EFX D;  2CWA A;  2LMC B;  3RN2 A;  2VNU D;  1EQQ A;  4UP8 A;  3HOY G;  2EY2 A;  1HQM C;  4C3I B;  5C6A A;  3J80 E;  5JPN C;  2PZW A;  3MFY A;  2XVS A;  1BCP F;  2JE6 I;  1SXT A;  4QIW E;  2KCN A;  3RMH A;  5J39 A;  4QQB X;  5CV7 A;  4CJ0 B;  1OXX K;  4A3D H;  4A3J B;  3TRZ A;  4DR7 L;  2CVR A;  1Q3L A;  1PH4 A;  4IPG A;  3PIP 3;  4XTC S;  2ATW A;  4HJ5 A;  1PA6 A;  1EY0 A;  1PYW D;  2YTY A;  1K8M A;  1J6Q A;  3FMC A;  2MP1 A;  4XQQ A;  1TWH H;  1II3 A;  2MQH A;  3BVZ A;  3TP7 A;  5JEA J;  4X66 L;  2K28 A;  5D65 A;  2RCN A;  4AIM A;  1TVX A;  2A73 B;  3ER0 A;  2ZXP A;  3NHH A;  4O0A A;  4M8A A;  3QG1 A;  1B7Y B;  1EOV A;  5C0X G;  1HZC A;  3I4N H;  3D31 A;  1PZI D;  1PXU A;  2DGY A;  2F0F A;  4UY8 C;  5IIF A;  1VQC A;  3GTL H;  5EGT A;  1QNK A;  1AZQ A;  4RA8 A;  1S5B D;  4A3E H;  5I6W A;  3NQT A;  3A0J A;  2HQE A;  1SFO H;  3VR5 A;  1FVI A;  1KDC A;  3CRL C;  4KHZ A;  1NE3 A;  3G4S A;  1CKN A;  3PF5 A;  4IUN A;  1EY7 A;  1JOK A;  1H9S B;  4DV4 Q;  5ELN A;  4RWS C;  2VUM B;  3Q24 A;  4ZRZ A;  3AEV A;  4LF7 L;  2SDF A;  1G2T A;  4BBR G;  3OMG A;  4KHV A;  1XWE A;  2CHB D;  1D5M C;  4C2M H;  2F0G A;  5LMN Q;  2WKC A;  4DR5 L;  5C4J H;  4A3M G;  4HSV A;  3HOY H;  2BDN A;  1VQO A;  3J80 i;  1PHJ A;  4GZY C;  1CSP A;  2ZM6 Q;  1C4Q A;  1CK1 A;  1S5E D;  1HJP A;  3T53 B;  3UI2 A;  3CCL A;  1YVC A;  3OTO Q;  1PH7 A;  4GKK Q;  4GOP A;  2JA8 B;  3HP3 A;  1SE8 A;  3GTG H;  2DJF C;  2EVB A;  2F4V L;  3R3O A;  2JYO A;  5IP7 G;  5C4X G;  4O2D A;  1JJ2 A;  2F0V A;  2VS1 A;  1TWF H;  4OX9 Q;  3MXN B;  2EYM A;  2F0N A;  1I4P A;  3H09 A;  4A3B G;  4MIU A;  4O1N A;  1WTV A;  1QWY A;  1PRT F;  3S24 A;  2Y0S G;  1DOM A;  3L3O C;  2XSC A;  4CGY B;  3A5U A;  1VQJ A;  2Q2U A;  4LF9 L;  4A93 G;  1BR9 A;  1TII D;  4FXD A;  3OW7 A;  4AH6 A;  3J81 i;  2OCE A;  3K81 C;  3MEH A;  1WD1 A;  2I07 B;  2KEE A;  1HA5 A;  1EY5 A;  1B3Q A;  2EJG C;  2Z4I A;  5IOC A;  3NEM A;  1S4Z A;  2K33 A;  4XYQ A;  3OW2 A;  2I46 A;  5C0X H;  3TQY A;  3VYU A;  3ZJY C;  1B3A A;  1D5X C;  2RHQ B;  4OON A;  5IYB G;  1W2B A;  3GV3 A;  3KLS A;  1JOO A;  3QO2 A;  2KUM A;  4BY1 B;  1CFM A;  3J7A F;  4YWK A;  2K14 A;  1F2Z A;  2YU9 B;  1EIF A;  3DM1 A;  3ZYY X;  2B63 B;  1FJG Q;  5I4D A;  2EY5 A;  1YHB A;  1H95 A;  5GAE C;  3X3M A;  3KOJ A;  2J4X A;  4GN3 B;  4BBR H;  3C46 A;  3U9O A;  1V1P B;  4DGZ A;  1OO9 B;  4KHP L;  2E2J H;  4JI0 Q;  2MFI A;  1DZ1 A;  3HOV B;  1GUG A;  1X55 A;  2V1C C;  1XTD A;  4KMU C;  4A3M H;  1IBM L;  1G8Z D;  2SOB A;  1O7L A;  1DJR D;  3NK9 A;  2UUC L;  4UDU C;  4JI3 L;  2EOT A;  3S2D H;  3BU2 A;  4IJH A;  1IBK Q;  2E5L L;  3T51 B;  1VS0 A;  1C0A A;  1GUN A;  5IP7 H;  5FO9 B;  2XWB B;  2XGT A;  4HIM A;  1EYD A;  2A69 D;  4CKC A;  1SRU A;  1F9P A;  1JWU D;  1TS5 A;  3OWF A;  1O7Y A;  4MN3 A;  3EJI A;  5FLX E;  4B3S L;  3PO2 H;  2D5D A;  4Y7N B;  1H9J A;  4A93 H;  5KND A;  3T1Y Q;  1HNZ Q;  1AE3 A;  1HR0 Q;  3TZU A;  3TEH B;  4A76 A;  1EQT A;  4ZAI A;  4NXM Q;  1BBW A;  1Q46 A;  3CC2 A;  1YHQ A;  3KLR A;  1EIY B;  3H3V C;  2B29 A;  2AUJ D;  2PZT A;  5CC4 A;  2EZV A;  2PZU A;  3R93 A;  5C3E G;  1B53 A;  3V2T A;  3L2P A;  2B2W A;  1XNQ Q;  1VQI A;  1Q1B A;  5ELB A;  4DR6 Q;  1JCK B;  4LF4 L;  1G91 A;  2WAC A;  4IPD A;  3X3N A;  4JI4 Q;  2JA7 B;  2VZA A;  5COY A;  1PFS A;  1DM0 B;  5M5Y B;  1N34 Q;  2X69 A;  3K7A H;  1Q86 C;  5DEH A;  1XJV A;  3WOE A;  1IYJ B;  1I5F A;  1IHZ A;  5C5M A;  4A3K G;  2VY3 A;  2QEJ C;  5G3L D;  3T1H Q;  2DNE A;  5JOB A;  2N49 A;  1LT6 D;  3I4L A;  2KEC A;  2CW0 D;  1XPO A;  3UDI A;  4IUR A;  2PQA A;  4BY1 H;  4FVM A;  4H44 C;  3KF6 B;  1BOS A;  4FF1 A;  1HXY D;  5EKK A;  4ID6 A;  2JA5 G;  1EZ6 A;  2C9O A;  3PF4 A;  1U9R A;  1NMF A;  4JBW A;  3RLO A;  1ENA A;  2PI2 A;  4L5Q A;  5FK9 C;  1NTG A;  4I65 A;  1STY A;  3IKJ A;  1EY8 A;  3TP5 A;  3MAQ A;  3D8G A;  3GTM H;  1U0L A;  5LMU Q;  2F0P A;  1PTO B;  2R93 B;  4YCU A;  1K8A C;  4ABN A;  3QIA A;  4HR7 B;  2KHS A;  1X32 A;  1CZG A;  1LV9 A;  4LF8 Q;  3I8Z A;  1I3Q B;  1Q8K A;  1UE5 A;  1I4R A;  3CMA A;  1ZXT A;  3PV0 A;  3JAM L;  3GO5 A;  3HEJ A;  2EJF C;  4HJA A;  3KUP A;  4L63 B;  2R92 G;  5C3E H;  1HPC A;  1IYU A;  1E0B A;  4ZLT F;  1EUJ A;  3ITP A;  1DON A;  3AMU A;  3R2T A;  1PFB A;  2F3V A;  3DLL A;  2IHF A;  3A56 A;  4DV4 L;  1B2T A;  1STH A;  2BDO A;  2O2L D;  4B3M Q;  3TBI B;  2BA0 A;  2LS0 1;  3OIQ A;  1JB7 A;  3BVG A;  1LM0 A;  2K4K A;  4JI1 L;  1K83 H;  1E3P A;  2K01 A;  1TWA B;  4HAE A;  1CA6 A;  4YCV A;  3GTK B;  2UXB Q;  2K7V A;  5IOD A;  5LMN L;  2EPB A;  4TVA B;  4A3K H;  2KEN A;  1TS3 A;  1NCV A;  2CFM A;  3Q8D A;  2F0K A;  1G51 A;  4HMJ A;  4F88 A;  2FFK B;  5KGU A;  1JB3 A;  4DR3 Q;  4OGQ C;  1DOL A;  1SSO A;  1K0S A;  4JCV E;  4JI7 Q;  1ILP A;  1KQS A;  2UUB Q;  1RF2 D;  4IAL A;  1KAA A;  2JA5 H;  1Y1W B;  4OX9 L;  1DCZ A;  1X3G A;  2BA1 A;  3K0Y A;  1TWG H;  4IOA A;  3J7Z C;  2RQX A;  1SJH D;  1X6O A;  1YIT A;  1LTL A;  3TP8 A;  1WCM G;  3N52 A;  2FMC A;  4LK1 C;  1YBY A;  3KBG A;  4A3F B;  1BUV T;  3S17 H;  2J7Z A;  2IW3 A;  4K0K Q;  2K1B A;  4HJ8 A;  4DV3 L;  1J9O A;  2N55 A;  3MA2 B;  3C3L A;  1FD7 D;  2F0U A;  3BG3 A;  1CI3 M;  3OPO A;  3Q23 A;  4J6H A;  2LY7 A;  3C1F A;  2M2L A;  5FLM G;  1CHP D;  4XQN A;  3ULP A;  5JAV A;  4CJ1 B;  4LFA Q;  2B2U C;  3I3C A;  2XNA C;  4K2K A;  1OTC A;  2RSN A;  2R92 H;  2HQL A;  3J80 L;  1TS2 A;  1Q8I A;  1SND A;  2KED A;  5H1S E;  1EEF D;  2R93 H;  4RKB A;  4OIK A;  2F4I A;  4DAV A;  3BYT B;  2AQ1 B;  2H5X A;  3KDF A;  1K0R A;  1FJG L;  3S1R H;  2BE5 C;  2JK8 A;  2TMP A;  2WB1 B;  2WFW A;  2BOS A;  2B39 A;  3DWQ A;  4PG3 A;  1Y1V B;  1O7I A;  3CCE A;  1QOH A;  4XT1 B;  5C0X I;  1EY6 A;  1DGS A;  1KC8 C;  4LJZ C;  2BCO A;  5E1F A;  1PH1 A;  4RCO A;  4WJ3 M;  3FHW A;  4FP5 D;  5LL6 X;  1EIH A;  1JE5 A;  2QEX A;  1IBK L;  3RR5 A;  2XRS D;  1I50 H;  1KHI A;  5IYD G;  4DV6 Q;  3MFG A;  1LTS D;  1OXV A;  3J81 j;  3M4O B;  1KL9 A;  1C8C A;  1X3E A;  5C44 H;  4ZK9 B;  5G3L F;  1CKN B;  5ELF A;  1JR0 D;  3M4Y A;  1D8L A;  5M5X H;  1TR5 A;  3URY A;  5M3M B;  3A8K E;  2F0J A;  5T1I A;  2EYP A;  2EXZ A;  5CV8 A;  1O80 A;  3E9H A;  1WCM H;  4R4O A;  1WI5 A;  4Z9C B;  4F87 A;  1IKL A;  1MSG A;  2L1B A;  5HUR A;  3T1Y L;  2BH8 A;  4KV6 A;  3HRZ C;  4LUV A;  4AQY Q;  3I73 A;  3RN5 A;  1HNZ L;  1TU2 B;  2R3Z A;  1LTG D;  1SEB D;  1N9W A;  1CQF A;  4UAI A;  2ICI A;  3P75 A;  1WVL A;  5EBD A;  5HGT A;  4GOP B;  4A3G B;  3HOX G;  4R8I A;  1WJJ A;  1NBW A;  5FLM H;  3OYY A;  3QOL A;  1NJI C;  1XNQ L;  3M3Y B;  4OWX B;  3CXC A;  5CV5 A;  3SXH A;  1AZP A;  1BO0 A;  1QUQ A;  2Z6K C;  5EPL A;  4G57 A;  4C3J B;  4JI4 L;  4Y52 H;  4P71 A;  1N34 L;  3DEO A;  2L15 A;  1SYC A;  3FKI G;  4YWM A;  4DNI A;  1KDB A;  3BZK A;  2UXC Q;  3BYY B;  4NDX A;  3GD7 A;  2F3W A;  3H0G G;  3HZX A;  5KNB A;  1I6H H;  1SDF A;  1PTO D;  3RNU A;  3T1H L;  5C4H A;  1STB A;  4UPA A;  2OTL A;  1A3V A;  5JVG 3;  4JYA Q;  1STG A;  2NTS A;  4P2C B;  3GV6 A;  1VQ6 A;  4IUU A;  4KKT A;  1I4G A;  2GVA A;  4S3S A;  4A3D G;  2PCF B;  1X65 A;  3WDN A;  2NYZ D;  5IYD H;  1U5K A;  5E3F A;  5C0X J;  2FIN B;  1LAC A;  1X3P A;  3S16 B;  1CUK A;  1QCB D;  4DV7 Q;  1VQH A;  5M3F B;  1FNV A;  2HUG A;  2CCZ A;  4PNY A;  2NVQ B;  2PQE A;  1NUC A;  1XTC D;  2WII B;  5LMU L;  5ELC A;  3GTQ B;  1H9K A;  4A3C G;  4GN5 A;  1YNN D;  2VQE Q;  1HNX Q;  2JA6 G;  1F9R A;  3CQZ H;  1G2S A;  2ALY B;  4J8Q A;  4JOI A;  3MC0 B;  1F77 A;  5IE8 A;  2K5H A;  2PO4 A;  2L4N A;  3F2U A;  2HT1 A;  2F1M A;  1MI2 A;  2L9H A;  1N33 Q;  3DMU A;  3NE5 B;  3CRK C;  1UNS A;  3M4Q A;  2B2T C;  5IYC H;  3HOX H;  5KNC A;  2HHH Q;  1XNR Q;  1JQY D;  2CW0 C;  3M7G A;  4XIG S;  1W6J A;  2R7Z G;  4CDC C;  3DUZ A;  1Y69 U;  1GHK A;  3V96 A;  4BA2 I;  4KJN A;  4G7O C;  3KBX A;  1L0X B;  3VYR A;  3SEB A;  2F0M A;  4ME3 A;  5J22 A;  3KJP A;  2RSO A;  4HIK A;  1SE4 A;  3FKI H;  3PIP A;  4B3M L;  3B6Y A;  2JJQ A;  1LO5 D;  4FXG C;  1XYI A;  3KF8 A;  1IW7 D;  2A68 D;  1AEX A;  3H0G H;  1WTQ A;  1PLF A;  2XRQ D;  1EYA A;  4XXE A;  1YNJ C;  2QKI C;  1Q12 A;  1TKW B;  2F0L A;  2JEA I;  4LF6 Q;  3GTJ B;  2Z8L A;  3PCO B;  4AYB B;  3I70 A;  4EVO A;  1L2F A;  4ZQ3 A;  3PGZ A;  5FLX L;  3E6Z X;  4JI7 L;  2FMM A;  2UUB L;  1SMX A;  3RZD H;  1A6X A;  4KTA A;  1S72 A;  1TS4 A;  3TS0 A;  1UAP A;  3A74 A;  4OIJ A;  4GNX C;  4DV5 L;  1VQ9 A;  1VQG A;  1EU4 A;  2MUY A;  5J3B A;  4HJ7 A;  1K3B C;  2K50 A;  4DAY A;  1A0I A;  2RA4 A;  1SYD A;  3SGI A;  3J81 E;  1D1K A;  3UDF A;  2CKZ B;  1N8R C;  3S1N H;  3U50 C;  2K5W A;  3HOW B;  4CDE C;  5M5W B;  4K0K L;  3RUZ A;  3S15 H;  4A3C H;  3E9I A;  3FP9 A;  4F8M A;  1ESR A;  3W3A A;  2O4X A;  5F2D A;  2JA6 H;  3MXG A;  3RZO H;  2QDB A;  1JMC A;  4JV5 Q;  2PQA B;  2G9H D;  2AWO A;  2OQ0 A;  4DR2 L;  2WKD A;  1GO3 E;  4I7A A;  2NVX B;  3MZ5 A;  1OXT A;  2CWP A;  1SNC A;  2V4D A;  3BZD B;  2JQO A;  1FL0 A;  4PZ6 A;  1E2V A;  4LFA L;  2EIF A;  1N32 L;  2EY1 A;  2R7Z H;  3HOU B;  3CPF A;  1K28 A;  4HTH A;  2EQS A;  2A6H D;  4LWC A;  1HNW Q;  1ICW A;  3E5S A;  4ME5 A;  1XMO Q;  3STB C;  1Y8N B;  2E2I H;  3PO3 B;  1F2L A;  2WAQ B;  1L1O C;  3JAM c;  2Q2H A;  3DWP A;  3G48 A;  3K59 A;  4R4I A;  2HD3 A;  3D4W A;  2HCC A;  4PZ7 A;  3S1Q H;  4DV0 Q;  1SLJ A;  3FEW X;  4EQP A;  2EE1 A;  4BBS B;  2Q2T A;  4LFC Q;  1GD7 A;  4A4I A;  1STA A;  4LUZ A;  5D3D A;  4MHE A;  1ENC A;  3UE0 A;  1VQ7 A;  5C4X B;  4OXP A;  4DV6 L;  2SNS A;  1D2B A;  1PTO F;  4K6L A;  4A3B B;  2VUM G;  3H3V I;  1VQD A;  4NMZ A;  4DR4 Q;  1BKB A;  2ZXO A;  4YY3 Q;  5LL6 S;  3PO2 G;  1JWM D;  5EKL A;  1VQA A;  1BCP C;  3LWE A;  2N88 A;  4C3I H;  1MD2 D;  3I90 A;  2AHO B;  1QJO A;  1TY0 A;  2B8G A;  2KCC A;  4JK1 C;  4AQY L;  2RKS A;  2L55 A;  3NEL A;  5FJ8 H;  1T5X D;  2JA8 G;  1SMY D;  4NXN Q;  4A3J H;  3A7A B;  1V1O A;  4N8X 1;  1SYE A;  3TS2 A;  3QR8 A;  1KD1 C;  3CU7 A;  2R6G A;  4PMB A;  4TKO B;  1SNM A;  2EY6 A;  1K73 C;  1HUN A;  2Z4H A;  2UXC L;  3CHB D;  3CP0 A;  5TSS A;  1O7Z A;  5KYI A;  3IL8 A;  3H94 A;  2NN6 I;  2B3G A;  2K75 A;  3VA7 A;  4ZKB B;  4PMW A;  2WB1 E;  2ES2 A;  2MJ8 A;  1VQE A;  5C4Z A;  2HIX A;  4CBV A;  3GTO B;  4QL5 A;  4JYA L;  1B44 D;  3KLS X;  5ELO A;  3EQL C;  3J80 c;  1I6V C;  3S2H B;  1EQR A;  4BY1 G;  1JOR A;  2OQK A;  1JT8 A;  1QVC A;  3PUV A;  4K5W A;  2JN4 A;  1Q82 C;  2NTT A;  4JI2 Q;  1STN A;  3S14 B;  2VB3 X;  2ICE C;  3S1M B;  3HKS A;  1Y14 B;  4DXF A;  5COR A;  1SRO A;  4DV7 L;  2OWO A;  2NZ1 D;  1VMP A;  2JSO A;  3AB9 A;  4JBJ A;  2KBN A;  2VUM H;  5ELD A;  2EJM A;  1CQV A;  2WP8 J;  4KKU A;  4DV1 Q;  4X64 Q;  4BY7 B;  4JI6 Q;  4WRD A;  4JVZ A;  2VQE L;  2K5D A;  3M7N A;  2C35 B;  4LUO A;  1HNX L;  1F2M A;  3NSW A;  2IX0 A;  3A5Z B;  1EQV A;  4QB4 A;  4XQJ A;  4DK3 C;  1M1K C;  2JA8 H;  1N33 L;  1I4X A;  1RJT A;  2QF7 A;  2F03 A;  2B2V C;  4XYO A;  4B08 A;  2HHH L;  2KQ3 A;  1XNR L;  1R9T B;  1RTO A;  1XXG A;  2D2C C;  1PRT C;  1HZ9 A;  3ONA B;  4WJW A;  1A3U A;  3K7U C;  3ULL A;  1TY2 A;  1UWV A;  2NBF A;  4LNQ A;  4RHR A;  1PH2 A;  1NMG A;  1ROD A;  2OTJ A;  2LSS A;  2UXD Q;  2E8G A;  3DXJ C;  2E2H B;  4JI5 Q;  4OO1 I;  2CH4 A;  3HOZ B;  2A19 A;  1BXT A;  2EYO A;  2R7F A;  2ZTD A;  2MPM A;  1CSQ A;  2JP1 A;  1PV4 A;  5CMD A;  5JEA H;  1UE7 A;  2ENB A;  4K2L A;  3F2C A;  5CR3 A;  5DM7 3;  3ERQ A;  2FJ2 A;  2JA7 G;  1QUQ B;  1EYC A;  1CKM A;  3QOJ A;  2YU9 H;  3TDQ A;  1S40 A;  4DNR B;  2WIN B;  2B63 H;  4GKJ Q;  4U68 A;  4A3I B;  3D6C A;  4C3H B;  3NBI A;  3AU7 A;  4GLV B;  4NW2 A;  1GHJ A;  5IT9 c;  2B2T A;  2RDH A;  4GS3 A;  3I4M B;  2DNC A;  3VYS A;  3ERS X;  5CV6 A;  3HOV H;  4CHT B;  5IGD A;  3S9W A;  4H02 A;  4XT3 B;  4JV5 L;  5L37 A;  4C56 C;  4HCE A;  2A68 C;  1A62 A;  3G6J B;  1LT3 D;  3VR2 A;  4IO9 A;  3C1E A;  3HFZ B;  3TZD A;  5IWA Q;  2KHJ A;  5GRO A;  2PW5 A;  3CME A;  1M90 C;  5HGQ A;  2EYF A;  1O78 A;  1DYQ A;  1G6Z A;  2PMZ B;  5FKA C;  1HNW L;  2L5T A;  2R93 G;  4QUF A;  3OHX C;  3WWV A;  4OHJ A;  1XMO L;  4Y7N H;  1M4V A;  4X65 Q;  2UUA Q;  1Z6H A;  5JJK A;  4KLK A;  1GM5 A;  5GQO A;  4FNF A;  4KKS A;  4GNX A;  4HSP A;  3VR4 A;  3NEN A;  4EQN A;  1QG7 A;  1C48 A;  4DV0 L;  2HDL A;  4V19 0;  3J7A 5;  1SYF A;  1SJE D;  2K6A A;  3HKZ B;  2ZM6 L;  4AYB E;  5K36 G;  3OTO L;  4GKK L;  2ZTC A;  4RMF A;  5CGK A;  1F2Y A;  2JA7 H;  1B1Z A;  5M5Y H;  5C44 G;  1QVG A;  1VDZ A;  4K6D A;  2B2Y C;  2F0I A;  1QIL A;  2E74 C;  4KD3 A;  4ZUI A;  4DR4 L;  4HED A;  4Q5V A;  4L8J A;  2ZJP A;  4YY3 L;  3HG9 A;  1T5E A;  3A54 A;  2K52 A;  3GDE A;  4RGO S;  5JPM C;  3HGB A;  5AFW A;  2X6G A;  5C3W A;  1ET6 A;  2IX3 A;  1YJN A;  4DPG A;  1EEI D;  2IPK D;  4BXX H;  4NXN L;  1NAP A;  3RD4 A;  2ZXR A;  2RVL A;  3L7Z C;  2NVY B;  4DU9 A;  2AWN A;  5IP9 H;  1L1O A;  5DNF A;  2F0H A;  1FYC A;  1MJE A;  5E4X A;  3CCU A;  2PI2 E;  1KRS A;  2P5Z X;  3U58 A;  4DAY B;  2CQO A;  4PMC A;  2SEB D;  4A3F G;  2MO1 A;  1PTO H;  2M00 A;  4LF5 Q;  4X3K A;  3NTI A;  1IL8 A;  1MGS A;  2EYH A;  1ZYR D;  2Z0S A;  3H91 A;  1I3Q H;  2WAQ E;  4QF4 A;  4V0B A;  1TWC B;  1V8Q A;  2CH4 W;  2NZH A;  5KYL A;  3K5O A;  1VQK A;  2K5Q A;  4WFN 3;  5C3X A;  1CM9 A;  4JI0 L;  1H9M A;  4NKL A;  4B3R Q;  1B50 A;  3W1G A;  3EIV A;  3J81 L;  4DF7 A;  4HN7 A;  1FGU A;  4C1N I;  1SMY C;  3H6M A;  2N3S A;  5K36 H;  1PFM A;  5DLQ E;  1CA5 A;  3IRB A;  2VQF Q;  1PYS B;  1OXS C;  1U4L A;  4IN3 A;  4DN4 M;  4OL7 A;  4A3L G;  2WB1 G;  3UDG A;  5CBA E;  2YYZ A;  3CAM A;  1RDP D;  1S5D D;  1Y1V G;  3PUW A;  1RD9 D;  1TWA H;  2EDG A;  3AFQ A;  2K5N A;  3GTK H;  4DV1 L;  5AJ3 Q;  4DK1 A;  1XPR A;  4OEL B;  5GAD C;  2NUC A;  1WD0 A;  3PQI A;  1EWH A;  2A6E D;  3NXW A;  4HID A;  1Y8P B;  3J7A V;  1HR0 L;  3AYH B;  1EWC A;  4NXM L;  2NVT B;  2QGQ A;  1XPU A;  4ZUJ A;  4JG2 A;  4EX5 A;  2K05 A;  4EGV A;  4DV2 Q;  3PIO A;  1E1O A;  2L0C A;  5IYC G;  1Y1W H;  5GAH C;  4YWL A;  5M3M G;  3EBE A;  4P74 A;  4J1M A;  3DHQ A;  4LF9 Q;  3ICE A;  4DR6 L;  2NZO A;  1WTP A;  2QCP X;  3FVQ A;  4K5V A;  1GUT A;  2ID0 A;  2UXD L;  2VW9 A;  4A3F H;  4P73 A;  1HZB A;  2UU9 Q;  4JI8 Q;  1GUW A;  4IOC A;  3GQB A;  2F0S A;  1GKH A;  2A69 C;  3U4Z A;  1HQR D;  3VR3 A;  1ASZ A;  2IHE A;  4IFD G;  1BF4 A;  1IXR A;  1HFN A;  1I94 Q;  4CDF C;  4R4Q A;  1B8A A;  4YHH Q;  4A3D B;  4C3J G;  3D4R A;  3U9S A;  4BWG B;  1IBL Q;  2NWG A;  4NP5 A;  4OWT B;  4GKJ L;  1MJC A;  1K8O A;  4LMQ D;  2Q2I A;  1TWH B;  2I5M X;  2LFN A;  3H15 A;  1J8I A;  4A3L H;  1RL2 A;  5I9O A;  2B2V A;  4KHP Q;  1Y1V H;  3GTP B;  3ULJ A;  4G7Z C;  4B3T Q;  1IBM Q;  3A8I E;  1LTI D;  3FDT A;  1XX8 A;  5CBE E;  3CCM A;  4RAU C;  4FXK C;  1K3R A;  1NSN S;  4JI3 Q;  1VF7 A;  3IFD A;  4IPH A;  3I4N B;  2D62 A;  4LF8 L;  3E0E A;  1ASY A;  3GTL B;  4X62 Q;  1JJG A;  3SVM A;  4A3E B;  3M4O H;  5IWA L;  1XMQ Q;  1VF5 C;  1WOC A;  2XWJ B;  1SFO B;  5M3F G;  1MKH A;  2VB2 X;  1ESF A;  1Z47 A;  4RKL A;  5M3M H;  1E2Z A;  2O5I C;  1EY4 A;  2IY5 B;  4IQZ A;  3NTK A;  2WV6 D;  4TSS A;  4P75 A;  4KI0 A;  4ZYS A;  5BN4 A;  4X65 L;  4ODG A;  1D5Z C;  2UUA L; 
#chains in the Genus database with same CATH homology
 2OT2 A;  4F7X A;  1U4P A;  4C2M B;  1IYV A;  1U4R A;  4PQX A;  3RLF A;  3MHB A;  5LHY 1;  5C4J B;  2D9U A;  3HOY B;  1KAB A;  4IFD H;  1AN8 A;  2E76 C;  3T56 B;  3GTG B;  1B9N A;  1SNQ A;  4FF4 A;  1TWF B;  5KRU A;  1U4M A;  1AP0 A;  2VXW A;  2J0T D;  3BVM A;  3IAY A;  4RCN A;  5JJZ A;  2L11 A;  4C3I G;  5EKI A;  1R4P B;  1BDO A;  1EL0 A;  4K8I A;  2IX1 A;  2PYK A;  1LTR D;  1SE3 A;  2K03 A;  3OOC A;  2PPB C;  5A2Q E;  3PUZ A;  1VMC A;  1NR4 A;  4H13 C;  4FF2 A;  1RHP A;  1BNZ A;  4L6T B;  4H0L C;  5K5P A;  4FF3 A;  3DWA A;  1GUS A;  2HDM A;  3J7Y W;  4BBR B;  3PUY A;  1ONL A;  2A5H A;  2E2J B;  2B2Y A;  4KN4 C;  1SNO A;  1MSH A;  3E0J A;  4A3M B;  2OEO A;  3Q6S A;  2HCI A;  5BN5 A;  3S2D B;  3NTH A;  3FPP A;  2Q8R E;  4BS9 A;  2MHV A;  1A3T A;  3BS1 A;  1CTM A;  2CQA A;  4PV1 C;  2Y0S B;  3SK5 A;  3PO2 B;  3OMC A;  4A93 B;  5EJW A;  1RTN A;  2B2U A;  2F0O A;  4KY6 A;  1HUM A;  1AFP A;  1ZYR C;  4QMG A;  3KK7 A;  1UEA B;  3A7L A;  4DK0 A;  1KLG D;  1GOZ A;  1F9S A;  5EPK A;  2BE5 D;  3SK4 A;  3LWU A;  5IT9 E;  4IZ8 A;  4FO2 A;  5EQ0 A;  4YIJ A;  1DXM A;  3K7A B;  3K58 A;  1CHQ D;  1L0Y B;  1LAB A;  1STE A;  1HA6 A;  1S5C D;  1MBY A;  5EPJ A;  4HMI A;  2DN8 A;  4IUV A;  2Q8I B;  5JEA G;  3R8B A;  2AUK A;  2A6E C;  3NBH A;  5FOB B;  5IGB A;  2A74 C;  1LTT D;  2XIW A;  2F0Q A;  1HCZ A;  3VA5 A;  2MGS A;  1HHV A;  5E4W C;  4G7H C;  2K32 A;  2LKV A;  4IUP A;  3GTM B;  1B4O A;  5J1Z A;  3FPU B;  2AQ2 B;  5I6Y A;  1PZK D;  3P7J A;  3A55 A;  5D3I B;  3I91 A;  2GA4 B;  2FHT A;  1EU3 A;  3A8J E;  4DNT B;  2QIL A;  3Q0A A;  2EYL A;  1PTO C;  1BCP B;  5C3E B;  5CV9 A;  3NPP A;  1LT4 D;  4BA1 I;  1R4Q B;  5KIX A;  1QNU A;  4CKB A;  2H4O A;  1AW7 A;  3NWT A;  4EQO A;  2JXM B;  1E2W A;  4KD4 A;  1HFG A;  2PNR C;  1A2T A;  3ERO A;  3PMF A;  1WTX A;  1K83 B;  5I2X A;  1EFI D;  1UUP A;  4A3K B;  1HTP A;  2KVM A;  5EBC A;  1JIC A;  2C5C A;  1ILQ A;  3BDL A;  4K8J A;  3WOF A;  4O42 A;  1CZW A;  1FNU A;  3LNN A;  1SE2 A;  1YNN C;  3K5L A;  1EY9 A;  2DY7 A;  3GP7 A;  2JA5 B;  5IGG A;  3M85 A;  4KN7 C;  1TWG B;  1TQO A;  1F9Q A;  4K5X A;  1KTK A;  3EA6 A;  1KDA A;  5C5L A;  3NWS A;  1PZJ D;  4CKE A;  5T1G A;  3SR1 A;  1ENF A;  3S17 B;  2F0D A;  1D1I A;  4QIW B;  1SYG A;  1Z7T A;  1ZKO A;  3MWY W;  4IFD I;  4KY7 A;  2PW7 A;  1IW7 C;  2KA7 A;  3EVQ A;  2SNM A;  4K14 A;  2OXP A;  1A15 A;  4RGM A;  1JE4 A;  5DAU A;  2R92 B;  3W2D A;  4C3H G;  1Q1E A;  1YNJ D;  4TQU S;  2AQ3 B;  2B8F A;  3CKI B;  4X3U A;  1H9S A;  3QB3 A;  5ISR A;  4KJO A;  2O5J C;  3S1R B;  4DA2 A;  5I9P A;  3NUC A;  1PRT B;  1GJX A;  4X3T A;  1FGB D;  3C2P A;  5ELE A;  4DXG A;  3ND8 A;  1JOQ A;  3VR6 A;  3SK6 A;  1ET9 A;  1SYB A;  2EYJ A;  3MXU A;  3V05 A;  3ND9 A;  1I50 B;  5C44 B;  3MXN A;  5JVH 3;  1Q90 A;  3N6R A;  2IT1 A;  5M5X B;  3BDO A;  4FYD A;  3Q22 A;  1OXU A;  4TRD A;  4LAA A;  1G29 1;  4WOR A;  1FR3 A;  2M9V A;  2E2D C;  3R2I A;  1WCM B;  1B9M A;  5BN3 A;  2A6H C;  2G9D A;  3G7L A;  3K5M A;  4X3S A;  1EZ8 A;  1WTW A;  1H9R A;  4ILW A;  4KY5 A;  4U67 3;  5IGE A;  1ML0 D;  2KOL A;  1KNA A;  1GXD C;  2ZT9 C;  4IFD J;  1EOT A;  2NN6 G;  3OWE B;  3NP8 A;  2L12 A;  4Q0F A;  1PDQ A;  4DAP A;  3HS0 C;  4CJ2 C;  1I6H B;  1V43 A;  5CYU A;  4KK7 A;  3FRP B;  3SDZ A;  1A2U A;  1V1P A;  3K5N A;  3OIP A;  1S5F D;  1GUO A;  1PFN A;  1SBB B;  5KEE A;  1BCP D;  4I7Z C;  4R8N A;  1I4H A;  2X6L A;  1WTR A;  3T13 A;  1DD2 A;  4E6I A;  4RH6 A;  1M8A A;  1WTO A;  5A2Q L;  3CQZ B;  3K57 A;  1RKN A;  1SAP A;  1CT1 D;  4ZKC B;  1TT2 A;  4M1U B;  1IKM A;  4IUQ A;  3HOX B;  2DY8 A;  2H1E A;  3IFT A;  3OSO A;  1LTB D;  3QWN A;  3L9A X;  1Y8O B;  1QE6 A;  4OO1 G;  1NR2 A;  2NN6 H;  3TN2 A;  3D6W A;  3MTS A;  2F0W A;  3FKI B;  3MXP A;  3K6O A;  4HCS A;  2IJ0 A;  5FO8 B;  1LLR D;  3TSS A;  1KNE A;  3H0G B;  1KLU D;  3P1H A;  1QB5 D;  3TP6 A;  5FO7 B;  3TME A;  2Z1C A;  4IUT A;  4ULL A;  1I4Q A;  1RCV D;  3MVV A;  1LTA D;  1EIG A;  3RZD B;  2IWH A;  1BQQ T;  1VCI A;  4XDX A;  1ZEQ X;  1LT5 D;  5D14 A;  3JAM E;  4RGT A;  2B2W C;  2RBM A;  3O13 A;  3PIO 3;  3T16 A;  3S1N B;  2K04 A;  2JEB I;  5IGC A;  5IT9 L;  3S15 B;  1PRT D;  3T4A C;  3SE0 A;  2JA6 B;  2XN9 C;  3RZO B;  2KJX A;  1FNW A;  5IGF A;  4H7B A;  4C1N K;  2RDF A;  4QUC A;  4DFA A;  3QJY A;  2R61 A;  2RDG A;  3NQI A;  1SNP A;  1X3Q A;  3VYT A;  1W6K A;  2NB0 A;  2R7Z B;  2E75 C;  4R9W A;  4RGN A;  3D4D A;  5NUC A;  3SK8 A;  4OO1 H;  2TSS A;  2E2I B;  2F0E A;  4QCL A;  3BDC A;  1HRJ A;  4N9T A;  1D6E C;  5CV4 A;  3SHL A;  4B9X A;  1JC7 A;  3LX0 A;  3D3R A;  4RFB A;  5I2Y A;  1PMR A;  2OF1 A;  1DOK A;  4G4K A;  4N9P A;  5A35 A;  5DM6 3;  1BBX C;  4RHS A;  3S1Q B;  1HTL D;  2Q8T A;  5M9O A;  2F0T A;  3I72 A;  3DEP A;  1JWS D;  4B9W A;  2IL8 A;  3PUX A;  3P20 A;  3EFX D;  2LMC B;  2VNU D;  2EY2 A;  1HQM C;  4C3I B;  5C6A A;  3J80 E;  5JPN C;  2PZW A;  3MFY A;  2XVS A;  1BCP F;  2JE6 I;  3RMH A;  1SXT A;  2KCN A;  5J39 A;  5CV7 A;  4CJ0 B;  1OXX K;  4A3J B;  2CVR A;  1Q3L A;  3PIP 3;  4XTC S;  1EY0 A;  1PYW D;  1K8M A;  3FMC A;  2MP1 A;  4XQQ A;  1II3 A;  3BVZ A;  3TP7 A;  5JEA J;  2K28 A;  5D65 A;  1TVX A;  2A73 B;  2ZXP A;  3NHH A;  4M8A A;  3QG1 A;  5C0X G;  3D31 A;  1PZI D;  1PXU A;  2F0F A;  5IIF A;  5EGT A;  1QNK A;  1AZQ A;  4RA8 A;  1S5B D;  5I6W A;  3NQT A;  2HQE A;  3VR5 A;  1KDC A;  3CRL C;  4KHZ A;  4IUN A;  1EY7 A;  1JOK A;  1H9S B;  4RWS C;  2VUM B;  3Q24 A;  4ZRZ A;  2SDF A;  1G2T A;  3OMG A;  4KHV A;  1XWE A;  2CHB D;  1D5M C;  2F0G A;  2WKC A;  4HSV A;  2BDN A;  4GZY C;  1C4Q A;  1CK1 A;  1S5E D;  3UI2 A;  3T53 B;  2JA8 B;  3HP3 A;  2EVB A;  3R3O A;  2JYO A;  2F0V A;  2EYM A;  2F0N A;  1I4P A;  3H09 A;  4MIU A;  4O1N A;  1WTV A;  1QWY A;  1PRT F;  1DOM A;  3L3O C;  2XSC A;  4CGY B;  1BR9 A;  1TII D;  4FXD A;  3OW7 A;  3MEH A;  1WD1 A;  2I07 B;  2KEE A;  1HA5 A;  1EY5 A;  2EJG C;  2Z4I A;  5IOC A;  1S4Z A;  2K33 A;  4XYQ A;  2I46 A;  5C0X H;  3VYU A;  1B3A A;  1D5X C;  3GV3 A;  3KLS A;  1JOO A;  3QO2 A;  2KUM A;  4BY1 B;  1CFM A;  3J7A F;  1F2Z A;  2YU9 B;  3DM1 A;  3ZYY X;  2B63 B;  5I4D A;  2EY5 A;  3X3M A;  2J4X A;  3C46 A;  3U9O A;  1V1P B;  4DGZ A;  1OO9 B;  1DZ1 A;  3HOV B;  1GUG A;  4KMU C;  1G8Z D;  2SOB A;  1O7L A;  1DJR D;  3NK9 A;  4UDU C;  2EOT A;  3T51 B;  1GUN A;  5FO9 B;  2XWB B;  1EYD A;  2A69 D;  4CKC A;  1F9P A;  1JWU D;  1TS5 A;  3OWF A;  1O7Y A;  4MN3 A;  3EJI A;  5FLX E;  2D5D A;  4Y7N B;  1H9J A;  5KND A;  3TZU A;  1EQT A;  4ZAI A;  3KLR A;  3H3V C;  2AUJ D;  2PZT A;  5CC4 A;  2EZV A;  2PZU A;  3R93 A;  1B53 A;  3V2T A;  2B2W A;  1Q1B A;  5ELB A;  1JCK B;  1G91 A;  2WAC A;  3X3N A;  2JA7 B;  5COY A;  5M5Y B;  1DM0 B;  2X69 A;  5DEH A;  3WOE A;  1IHZ A;  5C5M A;  2QEJ C;  5G3L D;  2DNE A;  5JOB A;  1LT6 D;  3I4L A;  2KEC A;  2CW0 D;  4IUR A;  4FVM A;  4H44 C;  1BOS A;  4FF1 A;  1HXY D;  5EKK A;  4ID6 A;  1EZ6 A;  2C9O A;  1U9R A;  4JBW A;  1ENA A;  5FK9 C;  4I65 A;  1STY A;  3IKJ A;  1EY8 A;  3TP5 A;  3MAQ A;  3D8G A;  2F0P A;  1PTO B;  2R93 B;  4ABN A;  3QIA A;  4HR7 B;  2KHS A;  1X32 A;  1CZG A;  1LV9 A;  3I8Z A;  1I3Q B;  1I4R A;  1ZXT A;  3PV0 A;  3JAM L;  3GO5 A;  3HEJ A;  2EJF C;  3KUP A;  4L63 B;  1HPC A;  1IYU A;  1E0B A;  4ZLT F;  3ITP A;  1DON A;  3AMU A;  3R2T A;  1PFB A;  2F3V A;  3A56 A;  1B2T A;  1STH A;  2BDO A;  2O2L D;  3TBI B;  2BA0 A;  2LS0 1;  3OIQ A;  3BVG A;  2K01 A;  4HAE A;  1TWA B;  1CA6 A;  3GTK B;  2K7V A;  5IOD A;  2EPB A;  1TS3 A;  1NCV A;  2F0K A;  4HMJ A;  4F88 A;  2FFK B;  5KGU A;  1JB3 A;  4OGQ C;  1DOL A;  1SSO A;  1ILP A;  1RF2 D;  4IAL A;  1KAA A;  1Y1W B;  1DCZ A;  2BA1 A;  3K0Y A;  2RQX A;  1SJH D;  3TP8 A;  3N52 A;  2FMC A;  4LK1 C;  3KBG A;  4A3F B;  1BUV T;  2J7Z A;  2IW3 A;  2K1B A;  1J9O A;  2N55 A;  3MA2 B;  3C3L A;  1FD7 D;  2F0U A;  3BG3 A;  1CI3 M;  3OPO A;  3Q23 A;  4J6H A;  2LY7 A;  3C1F A;  2M2L A;  1CHP D;  4XQN A;  5JAV A;  4CJ1 B;  2B2U C;  3I3C A;  2XNA C;  4K2K A;  2RSN A;  3J80 L;  1TS2 A;  1Q8I A;  1SND A;  2KED A;  1EEF D;  4RKB A;  4OIK A;  2F4I A;  4DAV A;  3BYT B;  2AQ1 B;  2BE5 C;  2TMP A;  2WB1 B;  2BOS A;  2B39 A;  3DWQ A;  1Y1V B;  1QOH A;  4XT1 B;  5C0X I;  1EY6 A;  4LJZ C;  2BCO A;  5E1F A;  4RCO A;  4FP5 D;  5LL6 X;  1EIH A;  2XRS D;  3MFG A;  1LTS D;  1OXV A;  3M4O B;  1C8C A;  4ZK9 B;  5G3L F;  5ELF A;  1JR0 D;  3M4Y A;  1TR5 A;  3URY A;  5M3M B;  3A8K E;  2F0J A;  5T1I A;  2EYP A;  2EXZ A;  5CV8 A;  1O80 A;  4Z9C B;  4F87 A;  1IKL A;  1MSG A;  2L1B A;  5HUR A;  4KV6 A;  3HRZ C;  3I73 A;  1TU2 B;  2R3Z A;  1LTG D;  1SEB D;  1CQF A;  4UAI A;  2ICI A;  3P75 A;  1WVL A;  5EBD A;  5HGT A;  4A3G B;  4R8I A;  3QOL A;  3M3Y B;  5CV5 A;  3SXH A;  1AZP A;  1BO0 A;  5EPL A;  4G57 A;  4C3J B;  3DEO A;  1SYC A;  1KDB A;  3BYY B;  4NDX A;  3GD7 A;  2F3W A;  3HZX A;  5KNB A;  1SDF A;  1PTO D;  5C4H A;  1STB A;  1A3V A;  5JVG 3;  1STG A;  2NTS A;  4P2C B;  3GV6 A;  4IUU A;  4KKT A;  1I4G A;  4S3S A;  2PCF B;  3WDN A;  2NYZ D;  5E3F A;  5C0X J;  2FIN B;  1LAC A;  1X3P A;  3S16 B;  1QCB D;  5M3F B;  1FNV A;  2HUG A;  2NVQ B;  4PNY A;  2PQE A;  1NUC A;  1XTC D;  2WII B;  5ELC A;  3GTQ B;  1H9K A;  1YNN D;  1F9R A;  1G2S A;  4J8Q A;  3MC0 B;  1F77 A;  2PO4 A;  2L4N A;  3F2U A;  2F1M A;  1MI2 A;  2L9H A;  3DMU A;  3NE5 B;  3CRK C;  1UNS A;  2B2T C;  5KNC A;  1JQY D;  2CW0 C;  3M7G A;  4XIG S;  1W6J A;  3DUZ A;  1Y69 U;  1GHK A;  3V96 A;  4BA2 I;  4KJN A;  4G7O C;  3KBX A;  1L0X B;  3VYR A;  3SEB A;  2F0M A;  5J22 A;  2RSO A;  1SE4 A;  1LO5 D;  4FXG C;  1XYI A;  3KF8 A;  1IW7 D;  2A68 D;  1AEX A;  1WTQ A;  1PLF A;  2XRQ D;  1EYA A;  4XXE A;  1YNJ C;  2QKI C;  1Q12 A;  1TKW B;  2F0L A;  2JEA I;  3GTJ B;  2Z8L A;  4AYB B;  3I70 A;  4EVO A;  4ZQ3 A;  5FLX L;  3E6Z X;  2FMM A;  1A6X A;  4KTA A;  1TS4 A;  1UAP A;  4OIJ A;  1EU4 A;  2MUY A;  4DAY A;  2RA4 A;  1SYD A;  3J81 E;  1D1K A;  2K5W A;  3HOW B;  5M5W B;  3RUZ A;  4F8M A;  1ESR A;  3W3A A;  2O4X A;  5F2D A;  3MXG A;  2QDB A;  2G9H D;  2AWO A;  2WKD A;  2NVX B;  3MZ5 A;  1OXT A;  1SNC A;  2V4D A;  3BZD B;  1E2V A;  2EY1 A;  3HOU B;  4HTH A;  2A6H D;  1ICW A;  3E5S A;  4ME5 A;  1Y8N B;  3PO3 B;  1F2L A;  2WAQ B;  3DWP A;  3K59 A;  3D4W A;  2HCC A;  3FEW X;  4EQP A;  2EE1 A;  4BBS B;  1STA A;  5D3D A;  4MHE A;  1ENC A;  5C4X B;  2SNS A;  1D2B A;  1PTO F;  4K6L A;  4A3B B;  4NMZ A;  2ZXO A;  5LL6 S;  1JWM D;  5EKL A;  3LWE A;  1BCP C;  2N88 A;  1MD2 D;  3I90 A;  2KCC A;  1QJO A;  1TY0 A;  2B8G A;  4JK1 C;  2RKS A;  2L55 A;  1T5X D;  1SMY D;  3A7A B;  1V1O A;  1SYE A;  3CU7 A;  2R6G A;  4PMB A;  4TKO B;  1SNM A;  2EY6 A;  1HUN A;  2Z4H A;  3CHB D;  5TSS A;  1O7Z A;  5KYI A;  3IL8 A;  3H94 A;  2NN6 I;  3VA7 A;  4ZKB B;  4PMW A;  2MJ8 A;  5C4Z A;  3GTO B;  4CBV A;  1B44 D;  3KLS X;  3EQL C;  1I6V C;  3S2H B;  1JOR A;  3PUV A;  4K5W A;  2NTT A;  1STN A;  3S14 B;  2VB3 X;  2ICE C;  3S1M B;  4DXF A;  5COR A;  2NZ1 D;  1VMP A;  2JSO A;  3AB9 A;  5ELD A;  2EJM A;  1CQV A;  2WP8 J;  4KKU A;  4BY7 B;  4WRD A;  2K5D A;  3M7N A;  1F2M A;  3NSW A;  2IX0 A;  1EQV A;  4QB4 A;  4XQJ A;  1I4X A;  1RJT A;  2QF7 A;  2F03 A;  2B2V C;  4XYO A;  4B08 A;  2KQ3 A;  1R9T B;  1RTO A;  1XXG A;  2D2C C;  1PRT C;  3ONA B;  4WJW A;  1A3U A;  1TY2 A;  2NBF A;  4RHR A;  1ROD A;  3DXJ C;  2E2H B;  4OO1 I;  3HOZ B;  1BXT A;  2EYO A;  2MPM A;  2JP1 A;  5CMD A;  5JEA H;  2ENB A;  4K2L A;  5CR3 A;  5DM7 3;  3ERQ A;  2FJ2 A;  1EYC A;  3QOJ A;  3TDQ A;  4DNR B;  2WIN B;  4U68 A;  4A3I B;  3D6C A;  4C3H B;  3NBI A;  3AU7 A;  4NW2 A;  1GHJ A;  2B2T A;  2RDH A;  3I4M B;  2DNC A;  3VYS A;  5CV6 A;  4CHT B;  5IGD A;  3S9W A;  4XT3 B;  4C56 C;  4HCE A;  2A68 C;  3G6J B;  1LT3 D;  3VR2 A;  3C1E A;  3TZD A;  2PW5 A;  2EYF A;  1O78 A;  1DYQ A;  1G6Z A;  2PMZ B;  5FKA C;  2L5T A;  4QUF A;  3OHX C;  4OHJ A;  1M4V A;  1Z6H A;  4FNF A;  4KKS A;  4HSP A;  3VR4 A;  4EQN A;  1QG7 A;  1C48 A;  2HDL A;  4V19 0;  1SYF A;  1SJE D;  2K6A A;  3HKZ B;  5K36 G;  5CGK A;  1F2Y A;  1B1Z A;  1VDZ A;  4K6D A;  2B2Y C;  2F0I A;  1QIL A;  2E74 C;  4KD3 A;  4ZUI A;  4HED A;  4Q5V A;  4L8J A;  3HG9 A;  1T5E A;  3A54 A;  4RGO S;  5JPM C;  3HGB A;  5AFW A;  2X6G A;  5C3W A;  1ET6 A;  2IX3 A;  1EEI D;  2IPK D;  1NAP A;  3RD4 A;  2ZXR A;  2RVL A;  3L7Z C;  2NVY B;  4DU9 A;  2AWN A;  5DNF A;  2F0H A;  1FYC A;  5E4X A;  4PMC A;  2SEB D;  1PTO H;  2M00 A;  4X3K A;  3NTI A;  1IL8 A;  1MGS A;  2EYH A;  1ZYR D;  3H91 A;  4QF4 A;  4V0B A;  1TWC B;  1V8Q A;  5KYL A;  3K5O A;  2K5Q A;  4WFN 3;  5C3X A;  1CM9 A;  1H9M A;  4NKL A;  1B50 A;  3J81 L;  4DF7 A;  4HN7 A;  4C1N I;  1SMY C;  3H6M A;  5K36 H;  1PFM A;  1CA5 A;  1OXS C;  1U4L A;  4IN3 A;  4DN4 M;  4OL7 A;  5CBA E;  2YYZ A;  1RDP D;  1S5D D;  3PUW A;  1RD9 D;  2EDG A;  4DK1 A;  2NUC A;  1WD0 A;  1EWH A;  2A6E D;  3NXW A;  3J7A V;  1Y8P B;  1EWC A;  2NVT B;  4ZUJ A;  2K05 A;  4EGV A;  2L0C A;  4J1M A;  3DHQ A;  1WTP A;  2QCP X;  3FVQ A;  4K5V A;  1GUT A;  2ID0 A;  1GUW A;  3GQB A;  2F0S A;  2A69 C;  1HQR D;  3VR3 A;  4IFD G;  1BF4 A;  1HFN A;  4A3D B;  4C3J G;  3D4R A;  3U9S A;  4BWG B;  2NWG A;  4NP5 A;  1K8O A;  4LMQ D;  1TWH B;  2LFN A;  1J8I A;  5I9O A;  2B2V A;  3GTP B;  4G7Z C;  3A8I E;  1LTI D;  3FDT A;  1XX8 A;  5CBE E;  4RAU C;  4FXK C;  1NSN S;  1VF7 A;  3IFD A;  3I4N B;  2D62 A;  3GTL B;  3SVM A;  4A3E B;  1VF5 C;  2XWJ B;  1SFO B;  2VB2 X;  1ESF A;  1Z47 A;  4RKL A;  1E2Z A;  2O5I C;  1EY4 A;  4IQZ A;  3NTK A;  2WV6 D;  4TSS A;  4KI0 A;  4ZYS A;  5BN4 A;  4ODG A;  1D5Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...