2CVRA

Nmr solution structure of sso7d mutant, k12l, 12 conformers
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
62
structure length
62
Chain Sequence
b'ATVKFKYKGEELQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding protein 7a
publication title Structural Determinants Responsible for the Thermostability of Sso7d and its Single Point Mutants
rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein
total genus 3
structure length 62
sequence length 62
ec nomenclature ec 3.1.27.-:
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2cvrA00
2D9UA 2RVLA 1DOKA 3G7LA 4HEDA 3MTSA 1GUWA 5EQ0A 1NCVA 1MGSA 4ZAIA 5EPJA 4OIKA 2B2YA 2HUGA 1MI2A 1VMPA 2B2TA 2VXWA 5EKIA 1HUMA 4IUVA 2K04A 5DNFA 3I3CA 5JJZA 1X3QA 2SDFA 5EJWA 2KVMA 1O80A 4DN4M 1G2SA 1X3PA 2L4NA 2RSNA 4XT3B 3KBXA 4R8IA 1NR4A 2KOLA 5E4WC 1PFBA 2K28A 1BBXC 1XX8A 4NW2A 1EL0A 1RHPA 4RWSC 2NZ1D 2CVRA 2Q8TA 1U4RA 1PFNA 3D6WA 3IL8A 4O42A 1BNZA 2M2LA 1B50A 1F9QA 1EOTA 4R9WA 4XT1B 3FDTA 1DOLA 2B2UA 1WTVA 1B4OA 1NR2A 3H91A 1RTNA 4OIJA 2B2YC 4RA8A 2MJ8A 5E4XA 2HCCA 2L9HA 2B2TC 1U4PA 1BO0A 1QG7A 1WTOA 4IURA 4IUTA 2XIWA 2MP1A 3ONAB 1B2TA 2L11A 2X6LA 5AFWA 1DZ1A 2K03A 3DEPA 4ZLTF 2MPMA 1DONA 1KNEA 1DOMA 2B2WA 3DEOA 1G2TA 3GV6A 1NAPA 3R93A 1AP0A 2K01A 3HP3A 2Q8RE 2KUMA 2B2VA 2RSOA 4CJ2C 2L1BA 3KUPA 1WTQA 1G6ZA 4RAUC 2IL8A 4ZKBB 2K05A 1ILPA 3TN2A 1M8AA 3I8ZA 2L12A 1IL8A 1WTWA 1SDFA 2MGSA 1F9PA 2EE1A 1E0BA 1O7ZA 2DY7A 3Q6SA 4X3SA 1WTRA 1ESRA 1J8IA 5CORA 1F9SA 1HFGA 2B2UC 2FFKB 1WTXA 1HUNA 1B53A 1RODA 3TZDA 1KNAA 1U4LA 1ZXTA 1AZPA 1BF4A 4X3KA 4IUPA 3I91A 4ZKCB 4CJ0B 2RA4A 1VMCA 1G91A 5COYA 1HRJA 2KEDA 1QE6A 1CM9A 3LWEA 1ILQA 2N88A 5EPKA 2FMMA 4QUFA 3SVMA 1SAPA 5EPLA 2HCIA 2B2WC 2J7ZA 1X32A 2N55A 2X69A 1C8CA 1EQTA 4UAIA 5T1IA 1ML0D 2B2VC 5D14A 1SSOA 3IFDA 3P7JA 4U68A 1IKLA 1EIGA 1PLFA 1Q3LA 2KECA 2R3ZA 4QUCA 4CJ1B 1CA5A 1HHVA 3QO2A 1AZQA 1HA6A 1MSHA 2NWGA 2EPBA 1IKMA 1EIHA 1XYIA 4ZK9B 3FPUB 1WD0A 1WD1A 2BDNA 5CBAE 1HFNA 1TVXA 2EOTA 2JP1A 2JYOA 4HSVA 1CA6A 1RJTA 4HCSA 2HDLA 1WTPA 4LMQD 3GV3A 1S4ZA 1QNKA 2H1EA 2K1BA 4X3UA 2NYZD 2DY8A 1JICA 1O7YA 2FJ2A 5D65A 1B3AA 2X6GA 3I90A 2KEEA 3DM1A 4IUUA 5T1GA 4XDXA 1PFMA 1LV9A 2FHTA 4MN3A 4MHEA 1U4MA 4X3TA 4IUQA 1JE4A 3UI2A 1MSGA 1RTOA 3F2UA 2FINB 2HDMA 5CMDA 1WVLA 1ICWA 1PDQA 1A15A 3N52A 1F9RA 3MWYW 4HAEA 1J9OA 1F2LA 5CBEE
chains in the Genus database with same CATH superfamily
5NUCA 1JR0D 1K8AC 3S16B 4EQNA 1E24A 5EPJA 2HIXA 1LT5D 3MAQA 5AJ3Q 1IW7D 2CW0C 4DNIA 3S15H 4DV7L 5JPNC 5C4ZA 4JV5L 4K5VA 4HJAA 4WJ3M 5FLXE 4O2DA 4IFDI 2K6AA 3WWVA 1PA6A 2K50A 2CVRA 2Q8TA 4IJLA 3M7NA 4A3MG 1Y1VB 3HOVG 3M3YH 2IT1A 2DNCA 1RTNA 4DV3L 1BKBA 1JWSD 2X6LA 3Q0AA 4C2MH 2MPMA 1B3QA 1XPOA 1CHQD 2Q2IA 3F8TA 4DA2A 2EE1A 3M7GA 4H44C 5C5LA 2R7FA 1RODA 1CHPD 1AZPA 5I2YA 5C0XH 4YIJA 1W2BA 2DJFC 2NVTH 5L37A 4NXMQ 4JI6L 3S1MB 4CDEC 3PF4A 2E2IH 1KAAA 4DR6L 1ILQA 3UE1A 4A3MB 3HOVB 4K6LA 3N6RA 1LACA 3VYSA 5J39A 4A3JH 1KD1C 4U68A 1EY7A 3P7JA 2F0MA 3CMEA 3AMUA 4JI2L 3CKIB 1AZQA 3ND8A 1KTKA 1FNUA 4I7ZC 4H0LC 1RJTA 4DGZA 3E0EA 2JA6H 1QNKA 5FKAC 1DM0B 3OMCA 5IT9c 5AJ3L 1T9HA 3S1RH 3TQYA 3I90A 1SMXA 4QIWB 4C3JH 3BDLA 1DYQA 1JE5A 2MNAA 2EYPA 1HQRD 2ATWA 2R92B 4JI1Q 4GN5A 3ULJA 1KAWA 1WVLA 1UAPA 4K2LA 1OXTA 1F2LA 3D3RA 3K59A 2RVLA 5G3LF 2A8VA 1UE5A 3HKZG 3GTMH 5IP9H 2OQ0A 1MGSA 4QB4A 5EBCA 1YJWA 5KEEA 3PGZA 2WIIB 4WJ4A 1WOCA 2PZUA 3RZDH 2F0LA 4G4KA 1MIUA 1L1OB 5EJWA 4RCOA 1FGBD 1X3PA 2JQOA 4KHVA 4R8IA 4XQJA 1C7YA 3T13A 1S5FD 3DWPA 5GAGC 1Z47A 1GKHA 1SJHD 5ELCA 2NN6H 4JBMA 4FXGC 1I4RA 2Q2TA 1FNWA 1U4RA 2YTVA 5C3XA 4ME3A 2N8NA 1B4OA 1NNXA 4HIOA 2VB2X 1QOHA 1TXYA 2XIWA 3M9BA 2F3VA 1HR0Q 3CHBD 3GTJB 1K8OA 2G5DA 2NVXB 3FKIG 2KCCA 3HKZB 2B2WA 3HP3A 2B8FA 3GTOH 1V1PB 1PH3A 1ILPA 4MNOA 2C9OA 3S2HB 3MVVA 1EY9A 3A7AB 3LX0A 1ESRA 3J81j 1HUNA 2N3SA 4JBKA 4N9PA 1PRTD 1TWGB 1V9PA 5C44B 2WAQE 1VMCA 1TQOA 2VS1A 4MTKA 1B9MA 1QE6A 4LF7L 4Q0FA 1HZAA 1RKNA 2B2WC 1PH8A 2X69A 1IYUA 4B3SL 4KHPL 3JAMi 2RDFA 2SNMA 4OELB 4ME5A 5FK9C 3BZKA 3K7UC 2AUJD 2NBFA 3RLOA 3FKIB 4ZK9B 1WD0A 3KJPA 1Q90A 4GLVB 1K3BC 2K5WA 1TWFH 1TVXA 5KNDA 3VR6A 3T1HQ 2HDLA 3QOLA 2OQKA 3TEHB 2R7ZH 2DY8A 1JICA 3CRLC 3VYUA 2HQEA 1A3VA 2BA1A 5JEAJ 3H09A 1YHQA 4KD3A 1IBLQ 1FYCA 4MHEA 2I07B 1HZCA 2WB1E 1JE4A 3H3VH 3GTKB 4JG2A 1W6JA 2PO4A 1ESFA 2CQOA 1HPCA 4HEDA 1A8VA 3E9IA 5LHY1 4P72A 3URYA 1HR0L 3U9SA 1OXUA 2Q2UA 2IX0A 1STNA 1P16A 3RNUA 3H15A 1JORA 2C35B 2JA8G 4DN4M 5C5MA 5M5YB 1CKOA 1SROA 1I6HH 1OXVA 3JAMc 3S2DB 2MQHA 5F2DA 1Y8NB 1VDZA 3IKJA 4ZQ3A 3EVQA 5G3LD 4IURA 1NBWA 2MP1A 2XTIA 1M1KC 3TRZA 2JA7G 4DXFA 3J7A5 4QL5A 5ELNA 4YY3L 2OF1A 4K8IA 4BA2I 5IWAQ 3VR4A 2Z4IA 4JI8Q 1WTQA 1WCMG 2PQAA 2R92H 2BE5D 5J22A 3K5OA 3C2PA 3TP6A 1HH2P 5IYDH 4AYBG 2DY7A 2AHOB 5C4XG 4X64Q 4A3LH 3PUXA 5JEAH 3M4YA 3OTOQ 1CUKA 1YNJC 2A73B 4HJ5A 1XNRL 1S5CD 4BBSB 2KJXA 1IBLL 3E3XA 4LUOA 5IGFA 4X3TA 3FPPA 1EIGA 4F8MA 1LYLA 4JBJA 2Y0SG 2JA7B 1JQYD 3FPUB 4HTHA 4LNQA 1PTOB 3PIPA 3OYYA 1CZGA 2WV6D 3NBHB 5LMNW 4B3TQ 2F4IA 4DNTB 3PUWA 4HCSA 3VR5A 1WCMB 1S4ZA 4IFDJ 1B70B 3GD7A 5BN4A 4BBRB 4AYBB 4OX9L 1BCPF 3BU2A 4WORA 2A68D 4C3HH 1QZHA 3RZOB 1CZWA 1RTOA 2PPBC 4DV5Q 2D5DA 1XMOL 1JB3A 1PXUA 1A15A 5FLMH 1PH9A 2EIFA 1YNNC 3SE0A 1VF7A 3S2HH 1EZ8A 2LFNA 2Y0SB 2B2YA 2HUGA 2I46A 1C9OA 2VXWA 4LFCQ 4IUVA 2K04A 4UY8C 2UXBL 3J80i 5C44H 2SDFA 1S5BD 4R1JA 4NP5A 1E2VA 5IWAL 2VUMG 1O78A 3KBXA 2VW9A 2JA9A 1X3EA 1X55A 3ULPA 3P75A 4CDFC 1EL0A 2WACA 5DEHA 1AH9A 4BY7H 3NE5B 1OXXK 3J81i 2NZOA 2F03A 1XMQQ 2RQXA 2NUCA 1YIJA 3L2PA 4X64L 3H91A 2B2YC 2JK8A 2MJ8A 1FJGL 1BO0A 1QG7A 4EQPA 3ONAB 3CCVA 3VYRA 4K6DA 1K83B 1SE2A 1NAPA 1SEBD 1R9TB 1LT3D 5EBDA 1IYJB 1X65A 3BDCA 3GTKH 1EY5A 3L0OA 4IFDH 4AQYQ 2DN8A 4B3TL 4J1MA 1KNAA 4BA1I 3MEFA 4CJ0B 4JPBW 4YCUA 2D0OA 1C0AA 3DHQA 3BYYB 1EU3A 1L2FA 3NBHA 5IODA 2NVQH 1SYDA 3K80C 4POFA 3W1BA 3D0FA 3PO3H 4JOIA 3J80c 2HQLA 5M5YH 2KHJA 3M4OB 1HTLD 3DWQA 3J7AV 3OW7A 3S15B 1ZYRC 4DAYB 3S2DH 4U673 4X3UA 5FO9B 1O7YA 4A3EH 4OO1H 4HJ9A 1TY2A 1PVOA 4C1NI 4BY1G 3S14H 1QVCA 2F3IA 1LV9A 2ICEC 3WOEA 5C0XG 3T1YL 4PNYA 1A63A 5CV6A 4JOIC 5CMDA 3AU7A 3VA7A 4JI4Q 1KHIA 3K0YA 3VDYA 3IAYA 3H0GH 4HJ7A 2QEXA 3RD4A 4IPGA 4OWWB 3K5NA 2CHBD 4A3JG 2PZTA 1W3SA 3QR8A 1Z6HA 4C2MB 3OIQA 4P71A 1STYA 1J6QA 2UXCQ 1PV4A 3AYHB 4A3DH 4NDXA 3GTPB 2JA6G 5CV9A 4B3RL 1Q1BA 2I5HA 1F77A 3MA2B 4DV0L 4BBSH 1BCPD 2AQ2B 3W3AA 1I4XA 4C3JG 1SYBA 1HNWQ 4YHHL 3QIAA 3SGIA 5C3EH 1BNZA 2NVTB 1HJPA 1F9QA 4JI7Q 4AQYL 4J8QA 5DM63 4LUVA 5FLXc 1NR2A 3CCUA 1PTOH 5A35A 4OIJA 3HOUH 4L5QA 3HKSA 4GLXA 4A3JB 2EQSA 2EYHA 1U0LA 2V4DA 5CV4A 5IP9G 2F0UA 1VQ5A 3OHXC 1G2TA 3A74A 4DV4Q 4BBRH 1AP0A 4RAUC 3NQIA 3TP8A 3I7FA 2VZAA 1WTWA 4LK1C 4TRDA 5I9OA 3BVGA 1V8QA 1KRTA 2WKCA 3Q23A 3S1RB 2CCZA 1IBMQ 2F0TA 4C3JB 2B63B 2NN6G 2RA4A 1CFMA 1VQDA 1L0WA 3P20A 1CK1A 2YTXA 1I94Q 4DV2L 1PZID 4DAYA 4C56C 4Z9CB 5CV8A 4XQQA 2EPBA 4JI4L 3NSWA 3GTMB 3S17H 4MIUA 1D5XC 5KNCA 3NQTA 3NELA 1EY6A 4GN4B 2H1EA 3RZDB 1TWCB 3J80E 2KQ3A 1Y69U 3PIP3 1CKNB 3A5ZB 2QF7A 3B6YA 2UXCL 2ZJQA 3HOWH 1STAA 3SK6A 1UUPA 3I4MB 3G48A 5JAVA 4DR5Q 1MHWC 2M9VA 4C3IB 3PUVA 1HNWL 4XXEA 4HIKA 4KJNA 4JI7L 1AE3A 2ZXRA 4RHRA 1K73C 2IHEA 3KF8B 3VR2A 1EYGA 2DNEA 3I3CA 4A93H 5JJZA 4A76A 4PMWA 3HZXA 3GTOB 1LTAD 3EROA 3PV0A 2R7ZG 4ILWA 5IY0A 1YJ9A 2L5TA 2KA7A 3MXNB 1LABA 5IE8A 2ID0A 1B50A 3KYHC 1XPUA 2LMCB 5J3BA 4XT1B 4KK7A 1D2BA 1IBML 4O1NA 2HCCA 4KKTA 5C3WA 3DLLA 3M4OH 1SNDA 4FXKC 5EKLA 4IUTA 4IOAA 2OWOA 5AFWA 3CU7A 1N32Q 4KTAA 1YVCA 2EYLA 1BVSA 1I94L 4OWXB 1F2MA 4UDUC 3SDZA 2CFMA 3KUPA 2J0TD 3EA6A 1GD7A 3V96A 2FMCA 1TWFB 2O5IC 4IQZA 3C1FA 2A74C 3AQQA 2MGSA 5E1FA 1LTRD 1S40A 1SMYD 2GA4B 1PRTF 2R7ZB 4DUYQ 1JCKB 3TZDA 5GAEC 5JOBA 4HMJA 1YNND 4B3MQ 1FVIA 1KLUD 3BVZA 1VQGA 3EQLC 4QUFA 1X9NA 3D31A 1FNVA 3I4LA 2A6HC 4LF8Q 1C4QA 3IFDA 5D14A 1TR5A 3S1QH 2E2JH 1EFID 1CSQA 2ZJRA 4DR5L 2EDGA 3GTPH 2A19A 4GOPB 2UUBQ 4DNRB 1CKNA 1XNQQ 2ZXPA 1YITA 2MO1A 5H1SE 2R92G 3PIOA 4L5TA 4R4QA 1WTHA 2X6GA 1SYGA 4PZ7A 1QB5D 2KEEA 2YTYA 3I55A 1JOOA 1PFSA 4A3LG 2CWPA 3LGJA 5JEAG 4R4TA 2ZTEA 4GN3B 3FEWX 4N8X1 1I6HB 1VQ4A 2PW5A 3KF8A 2K5VA 1VQBA 3MWYW 4RH6A 4LFAQ 5IYBH 3JC66 1A3UA 1BCPB 1AW7A 2JN4A 1SNQA 1NMGA 4X6AH 5GROA 3CQZH 1WI5A 2TSSA 2K5DA 2RBMA 1B9NA 2MO0A 1K0SA 2FXQA 3KFUA 1HUMA 3MXNA 2B63H 1N33Q 3A8KE 1YI2A 2KCNA 4KD4A 4KY5A 4K8JA 1KABA 2OCEA 1XXGA 5HURA 2ASBA 1STBA 2CH4A 2D2CC 5JVH3 2F0WA 4DR1Q 5LMUQ 1GUGA 1TIID 2SNSA 2M2LA 4C3HG 1G291 2YYZA 4DUYL 3M4PA 4OXPA 1XPRA 5IGGA 3DMUA 1WTOA 3S1NH 1U4PA 5FLMG 2A1AA 2Z8LA 3MFYA 3ZYYX 2IX3A 4XQNA 1TWCH 1H9JA 2OEOA 3MXPA 4P73A 4LF8L 2KUMA 4UP8A 4CJ2C 1VQ8A 1YHBA 4LF6Q 3UE0A 2O2LD 4N9TA 3I4MH 4LF4Q 1VQPA 5C44G 2UUBL 4BXXH 1SJED 1LTBD 1F9PA 1XNQL 1QILA 1H9SB 2ZTCA 2RF4A 1I4GA 4B08A 4C3IH 4EQOA 2PNHA 4NXML 1SNCA 3I4NH 1STEA 2AUKA 4LWCA 4MZ9A 4C3HB 1UNSA 5GQOA 3OOCA 3P1HA 2R3ZA 1TKWB 1KXLA 1LO5D 4R4CA 1OXSC 2ZT9C 3H3VC 3CC4A 1CA6A 3TS0A 2EY6A 4DV6Q 1WTPA 1TS5A 5CYUA 5IGBA 4GNXB 1JB7A 5IYCH 4DAPA 1ET6A 2RHQB 4IPDA 4IFDG 5J1ZA 1EYDA 3I4OA 2E74C 4DK1A 3PMFA 3SK4A 1WFQA 5FJ8H 4TSSA 4I7AA 4JI1L 4UHVA 5JJKA 4BY7B 2HDMA 4IPHA 1PH2A 1PDQA 4DR1L 5LMUL 4HCEA 2A5HA 3TBIB 5DM73 3FHWA 1CKMA 5DAUA 1RDPD 3E9HA 2B8GA 1VMPA 3J81L 3C1EA 2I0QA 4S3SA 2JEAI 3NHHA 5C4JH 3NWSA 2O5JC 2QW7A 3ERSX 5E4WC 4A3EG 4LF6L 4OO1G 4A3IH 3OWFA 3VR3A 3QB3A 2XRSD 2NZ1D 2I5MX 1KLGD 2WP8J 4A3KH 2UUAQ 2RDGA 4DUZQ 1B8AA 1L1OA 2F0FA 3HEJA 2B2UA 4KHZA 3L7ZC 3S24A 3PCOB 2L9HA 4CDDC 3H0GG 4QF4A 2NVQB 1WYDA 4LUZA 1JC7A 4ZLTF 2PMZB 4G7HC 1HTPA 3PO3B 3GV6A 3R93A 3GP7A 3CW2C 3BDOA 2DUDA 4F7XA 1LTGD 3V2TA 3TP5A 1M90C 4I65A 1YJNA 1S72A 4NXNQ 4A3DG 2K5HA 4QMGA 4PV1C 1L1OC 2B2UC 1HFGA 1WTXA 2J4XA 2L15A 4BS9A 4BBSG 4DV6L 4A3EB 1JOQA 4FYDA 1V1PA 3S14B 5D3IB 5C3EG 4YCWA 4CDCC 4RGNA 5EGTA 2QCPX 3HOUG 1A6XA 1ZEQX 3H0GB 4GNXA 4L5SA 3OIPA 1HA6A 4H7BA 1QJOA 3OMGA 1RCVD 4B9XA 5FO7B 5CBAE 4HSVA 3U4ZA 1Q8KA 4BBRG 2N78A 1VQCA 3CCJA 1EIYB 4YWMA 1EY0A 3T1HL 2EJMA 1TS4A 4IN3A 4A3DB 1FR3A 3QOJA 3BZDB 3NTHA 1Y14B 2CW0D 4GKKQ 5LL6X 3PIO3 2IX1A 4H13C 4GNXC 1LT4D 2A69C 1SYCA 5C3EB 3N52A 4N8FA 4OGQC 5K36H 2MUYA 2D9UA 3HOUB 4DUZL 2CKZB 1VQ6A 4YCVA 1TY0A 1IL2A 2CQAA 3HOYB 1DD2A 3W1GA 3K7AH 4X66Q 4ALPA 2QKIC 4NPSA 3PSIA 1QWYA 1KDBA 4PMCA 3EFXD 1BBUA 2ZJPA 1K8MA 1OO9B 3BVMA 4J6HA 5A2QE 2XSCA 4APVA 5IGCA 3PO2B 1U5KA 1TU2B 3HOWG 4EGVA 4NXNL 1IW7C 1IHZA 4QCLA 2HD3A 1DOLA 3UDIA 4A3GH 2NVYH 1TS3A 3CRKC 3DWAA 1YEZA 2QA4A 4QIWE 2QGQA 3ULLA 4G7ZC 2DGYA 3CMAA 2EXDA 4K2KA 2LY7A 3DEOA 4AH6A 2IHFA 5I6WA 1SLJA 2C5CA 4JI8L 3S17B 3GTGH 1PH7A 4KMUC 1KIXA 1RF2D 2UU9Q 1A3TA 5E7NA 4GS3A 4ZKCB 4A3FH 3GTLH 3M4QA 1A2TA 3OTOL 3CF5A 1GOZA 3HOWB 3ITPA 1QUQB 2NN6I 2R6GA 1CM9A 1PRTB 2VQFQ 4EVOA 1SSOA 1BQQT 5EKIA 4GKKL 4K0KQ 4RG1A 5EAYA 3QO2A 1BR9A 4A3BH 3AFQA 4K5XA 1XYIA 1GVPA 1TT2A 1STHA 4EQ5A 3UDGA 5E3FA 1G6PA 2BA0A 2JSOA 2K1BA 1V1QA 3TZUA 2R93H 1MJEA 4A93B 1HR0W 3CCMA 3GQBA 3HKZE 1PH1A 1E2WA 3A54A 1H9MA 1RD9D 1N36Q 4IUQA 1D7QA 4P75A 4ZUJA 2K5QA 4DV5L 4X62Q 3R8BA 4A75A 3X3MA 1HNXQ 2VL6A 4WJWA 4P2CB 4ZAIA 3GDEA 1X54A 3ER0A 4ZCKA 2NB0A 2PNRC 3I73A 1PTOC 4Y7NH 4LFCL 1X3QA 3L9AX 3IRBA 1I3QH 1VS0A 4F88A 1AE2A 1BDOA 3EJIA 2K28A 3BG3A 3MC0B 4KI0A 4KLKA 4IUNA 5JJLA 4HJ8A 4KY6A 2H4OA 3M85A 1EOTA 1SFOH 1XMQL 3O13A 1HNZQ 5CV5A 5JJIA 4ULLA 3H3VI 2UU9L 3RUZA 5IYBG 1UEAB 5IT9L 3NENA 1SYEA 4LF5Q 3KF6B 3S1QB 2E2JB 2XWBB 4HIDA 4M1UB 1PYBA 4NKLA 1NUCA 4K5WA 4CGYB 2Z9HA 2B63G 4XYOA 3BJUA 2D62A 4TVAB 3F2BA 4RHSA 2QEJC 2RHSB 5CORA 3CC7A 3BYTB 1B53A 2JA8H 2HIVA 1U4LA 2Q2HA 2XRQD 1UE7A 2RCFA 2L0CA 2V1CC 3AEVA 1EEID 1NY4A 3HOZH 3E5SA 1KDCA 1F2YA 2KEDA 1UE6A 3HOYH 1VQNA 2EJGC 1I50H 1D8LA 1TWAH 1Q7YC 3L3OC 1L0YB 4DFAA 4MTNA 1HNXL 1PRTC 3CQZB 3PO2H 4OL7A 1D1KA 5D3DA 5I4DA 1E1OA 2CWAA 2K14A 3I4MG 2K32A 4BXXG 1JOKA 4FF1A 4C3IG 4ABNA 5KYLA 1PFMA 1DXMA 1SYFA 2ENBA 1GUOA 3BZCA 4M8AA 4X65Q 3UI2A 3F2CA 2ZM6Q 3I4NG 4LW1A 1ASYA 3C3LA 1ICWA 2IW3A 3RMHA 1I4PA 3LNNA 1K28A 3OWEB 1NMFA 4V0BA 3S1NB 5EQ0A 3CCSA 3U9OA 1B1ZA 4HR7B 4DV7Q 2HHHQ 3X3NA 4NB3A 4JV5Q 2WB1G 4CKCA 1IBKQ 1JWMD 1Y8OB 2WAQB 3A56A 2F0HA 2F0GA 4DKAC 2EZVA 2KVMA 1D5ZC 4XIGS 1G2SA 2B29A 2F52A 5IYCG 2BOSA 1JJ2A 2R7DA 3IL8A 3TP7A 3KF6A 3HG9A 4E6IA 5FJ8G 3D4RA 2PCFB 2XWJB 4DV3Q 4CKBA 3I4NB 2K7VA 3NEMA 1AEXA 1PH5A 4AYBE 4UPAA 2L11A 4PG3A 1DGSA 1ENCA 2QDBA 1KNEA 4JK1C 1YNJD 4DV4L 1G6ZA 4LF9Q 2WB1B 2L12A 1IL8A 3U4VA 4JI3Q 4HMIA 4NMZA 3C46A 2EYMA 1KDAA 2Y0SE 2VUMH 2B39A 4A3IG 3I91A 3CD6A 2RKSA 1VQIA 4DR6Q 3CXCA 1PHJA 3MXGA 4A3KG 2FMMA 1SAPA 2BE5C 4UP7A 1EQTA 1QVFA 4JI2Q 5ELEA 2K33A 5M3FH 1EY8A 2BCOA 4PQXA 2ZM6L 2E5LQ 1E22A 2F4VQ 3J7AF 2F0OA 1IKMA 5CR3A 1XJVA 1KL9A 5HY6A 2BDNA 2ZTDA 3HFZB 1SNOA 4HN7A 3JAML 1EZ6A 3EBEA 5CV7A 3KJOA 2HHHL 5C4JB 4XYQA 1SBBB 1Q46A 3DM1A 1IBKL 5T1GA 4A3CH 1SE8A 1A62A 3V05A 5IP7H 2JJQA 2FHTA 1R4QB 4A3IB 2CH4W 4JW0A 1Z9FA 1FD7D 4DU9A 4B9WA 1HZ9A 4A3KB 1PMRA 1XTCD 1J9OA 3D6CA 2BH2A 5CBEE 1S5ED 1K8GA 4DR2Q 1EYAA 3F1ZA 3MTSA 1GUWA 4O0AA 4YWKA 4QY7A 5K5PA 1Y1WH 2WFWA 5ELDA 2A68C 4KKUA 3Q22A 4G57A 3U58A 3G6EA 1BUVT 1NTGA 5M5XH 3K8AA 5IYDG 1EWCA 2K4KA 3FMCA 1W6KA 3S9WA 1ASZA 4QQBX 1TWHH 4RCNA 4ZUIA 2KCTA 4LF9L 1EU4A 1RIPA 5ISRA 2QILA 4FDBA 4IJHA 4OO1I 5ELBA 3HOXH 3D6WA 2ALYB 4JI3L 4BY1H 2AMCB 3FDTA 2GVAA 2L55A 5LMNQ 1H9RA 3EIVA 3TREA 4XTCS 2Z4HA 1X6OA 5K36G 3HRZC 4L63B 2F0NA 4KY7A 1DONA 3RLNA 1N32L 2XVSA 2K01A 4HSPA 2K52A 2Q8RE 2RSOA 3MFGA 2YU9H 2L1BA 5IOCA 3QJYA 4Y52H 1NSNS 1R4PB 5KGUA 1VQMA 3CPFA 2E5LL 2F4VL 3CCEA 4OEMB 4DPGA 2WINB 2AWOA 4K14A 1EOVA 5IGEA 1MBYA 1LTTD 1BBWA 1YNXA 2EYJA 4LF7Q 1PYSB 5COYA 1PZKD 4B3ML 3LWEA 3K5MA 5FOBB 1ZYRD 2F0DA 2HCIA 4B3SQ 4KHPQ 2J7ZA 1X32A 3NK9A 1C8CA 4A3GG 1YBYA 2AQ3B 4ID6A 1GO3E 1NE3A 5M3MH 3OW2A 1SRUA 2EYOA 1PTOD 2BDOA 4CJ1B 1LUZA 1CT1D 2NWGA 1VQLA 2F0SA 4DR4Q 1HFNA 4DR2L 2JYOA 3K7AB 1K0RA 4JC0A 4PZ8A 2QDLA 3GV3A 1CSPA 1U9RA 2FJ2A 5D65A 4IOCA 4BY7G 4IUUA 1SE3A 1PZJD 4GOPA 3DUZA 4MN3A 2EJFC 3TMEA 1U4MA 5JPMC 1A0IA 4QGUA 4A3FG 2FINB 1B44D 1T5EA 1QZGA 3I70A 3NWTA 1F9RA 4LFAL 4PZ6A 4A3GB 2NVYB 1HZBA 2JA5H 3STBC 1EQVA 5M5WH 2UUCQ 4PMBA 5LMNL 3A8IE 4R8NA 3KBGA 1Q81C 4A3BG 2B2TA 2F0QA 3QWNA 4GOPC 4HIMA 4EX5A 2XGTA 2E2HH 1JT8A 3BS1A 1CQFA 1N33L 2F0KA 4XT3B 3R3OA 2R93G 1AFPA 4Q5VA 3R2IA 1NR4A 5KNBA 1PFBA 2NTTA 1GXDC 3FVQA 3NUCA 1SXTA 1XX8A 3CPWA 3GTGB 1IZ6A 1Q8IA 3J80L 1QCBD 4LJZC 4DAVA 4L8JA 1A2UA 4UP9A 4A3FB 3GTLB 1AN8A 3LWUA 4GKJQ 4RA8A 2PQAB 3PO3G 2B2TC 5CC4A 2F1MA 3S16H 1B2TA 1LTLA 1BCPC 4YY3Q 3SXHA 1E2ZA 2VQEQ 4A3BB 5EKKA 5C6AA 3SK8A 4G7OC 2UXDQ 3NP8A 2F0EA 3T56B 1Q82C 2GN5A 1SDFA 4JI5Q 1JWUD 4LF4L 1CI3M 3Q6SA 3CCLA 4DR4L 5ELOA 4OWTB 1WTRA 2R93B 1J8IA 1TS2A 4IZ8A 1BOSA 1Y1VH 5I9PA 4LFBQ 1XNRQ 1ENAA 5I2XA 1VQHA 1E7ZA 2AQ1B 2N55A 3SR1A 1H9SA 4UAIA 2A6EC 3Q24A 5IT9E 2JXMB 1HHVA 1CA5A 3ERQA 1EYCA 1MJCA 2E75C 2IPKD 1WD1A 1EWIA 3K57A 2R61A 3H6MA 2EOTA 3F2DA 5M9OA 3HS0C 1EWHA 4FXDA 2UUCL 3A8JE 4LMQD 5FLXL 1VQEA 4GLAC 5KIXA 4Y7NB 1ENFA 3RR5A 1B3AA 3CCRA 4OX9Q 3S1MH 4XDXA 4F87A 4KN4C 1I3QB 3GTQB 2P5ZX 1EY4A 5DLQE 4A3MH 3HOVH 1XMOQ 1UWVA 3HOZG 1I5FA 2B3GA 3KDFB 3HOYG 3ICEA 5BN5A 1SFOB 1J5EQ 2VY3A 5GAHC 2E2DC 2BH8A 3OSOA 3G7LA 2EY5A 3CP0A 4GKJL 5HGQA 4RKBA 4OIKA 1T5XD 1MI2A 1UEBA 2F0PA 3CAMA 2PI2A 3PO2G 2UXBQ 5GADC 3WOFA 1PH4A 3TSSA 1O80A 1EFWA 3UDXA 4R4OA 2VQEL 5C0XI 2LXJA 2UXDL 3CC2A 2VNUD 2SOBA 4JBWA 1JJCB 2F0IA 1GUNA 3I2ZA 4JI5L 2JA8B 1KC8C 1D6EC 4L5RC 3A0JA 4R9WA 1I4QA 2UUAL 1LT6D 5KRUA 1FJGQ 3HOZB 3RLFA 5E4XA 2NZHA 3W2DA 1V1OA 2EY1A 2PZWA 2ZXOA 4LFBL 4JCVE 3K0XA 3RN5A 1NJIC 1LM0A 3DEPA 1I50B 2MHVA 1VQJA 1TWAB 3E0JA 5TSSA 1S5DD 2OXPA 2TMPA 1EIFA 2IL8A 1JJGA 1X3FA 2AKWB 2A6HD 3NTKA 2IJ0A 2EY2A 5IIFA 1VF5C 1E0BA 1ET9A 1O7ZA 2O4XA 3OPOA 3KK7A 3NBIA 1KQSA 1FGUA 3TS2A 2E76C 3E6ZX 4CKEA 3J7YW 1O7LA 3T16A 3K58A 1HRJA 1HA5A 4QJFA 2K5NA 5C4XB 5EPKA 1FL0A 5EPLA 2F0JA 3MHBA 1STGA 3GTJH 2NVXH 1ML0D 3SK5A 1SMYC 1PLFA 2KECA 4WRDA 2KENA 1SR3A 4A4IA 1EIHA 3Q8DA 3R2TA 1YHAA 3T4AC 4A93G 1J5EL 1EQRA 2JP1A 3I56A 2Z6KA 4RGTA 4FVMA 4RMFA 1Q1EA 2Q8IB 3KDFA 2Z6BA 1TWGH 2I5LX 4RKLA 1SNPA 2ICIA 3T1YQ 4WFN3 3AFPA 2Z1CA 1CQVA 4POGA 4BWGB 3A7LA 4FF4A 4KKSA 2NTSA 5KYIA 1N34Q 3D4DA 1DOKA 2G9DA 3FKIH 1ICFB 2Z6KC 5M3FG 1NCVA 1EUJA 1K9MC 4GZYC 2RDHA 3PUYA 3SHLA 1WJJA 4X66L 5HGTA 3JAME 1LTID 5DNFA 3NPPA 1H9KA 4B3RQ 4DK6C 1I4HA 4IALA 2L4NA 1N9WA 5ELFA 4DV0Q 3PQIA 2KOLA 3PF5A 2PW7A 1II3A 1CTMA 2YV5A 1Y8PB 2GVBA 4RGMA 4YHHQ 4NW2A 3FRPB 4A3CG 1UE1A 5IP7G 4JVZA 3G71A 1YZ6A 2VUMB 1EEFD 3HGBA 1X3GA 3ZJYC 4V190 1IYVA 3KLSA 4OONA 1DZ1A 2K03A 3NXWA 5M3FB 1DOMA 1Y1WG 2E8GA 3A5UA 1GHJA 4DXGA 3MXUA 2PI2E 3GTQH 1G8ZD 2KHSA 4ZKBB 2KCMA 1M4VA 3I8ZA 1F2ZA 5BR8Q 2IWHA 4DAMA 1QVGA 2OTLA 1SE4A 2FFKB 1ZXTA 4P74A 3TDQA 1BF4A 3J81c 2IY5B 1HCZA 1MKHA 2M00A 3STBD 3HOXG 4CBVA 1G91A 4KJOA 2N88A 4DV1Q 5JVG3 2LS01 3ND9A 1ZKOA 4DV2Q 2VQFL 4AIMA 5T1IA 2RCNA 3RN2A 2OTJA 2KHIA 1LTSD 1IKLA 1VCIA 4K0KL 1P8LA 3M3YB 5LL6S 3SEBA 1N34L 1SN8A 4OHJA 1QUQA 1Y1WB 5FO8B 2ES2A 4TQUS 4C1NK 3D8GA 4JYAQ 3W5OA 3QG1A 5M5XB 4ZYSA 1K3RA 1IXRA 1ONLA 1VQ9A 3U50C 1D1IA 2PMZE 1VQKA 4DR3Q 1TWHB 3T53B 2MFIA 5CGKA 2EVBA 4JI0Q 3H94A 1Q12A 2LKVA 3IFTA 1MSGA 3WDNA 1N36L 3HOXB 1H95A 1VQAA 4BY1B 1JMCA 1E3PA 4HAEA 4X62L 1X56A 3KLSX 2WAQG 1OTCA 1S3OA 2JA7H 5M3MG 4DK0A 2E2IB 3NTIA 2EXZA 1EQQA 1RL2A 4DR7Q 1VQ7A 3A55A 1XTDA 1GUTA 1WCMH 2LSSA 2OT2A 3DM3A 3AB9A 4CHTB 4KV6A 3KLRA 3VYTA 2YU9B 4R4IA 2PQEA 2RSNA 4FO2A 5C4XH 1N8RC 3FP9A 4FNFA 2G9HD 2D0PA 4H02A 4ODGA 1BBXC 2PYKA 3RZOH 1RHPA 4RWSC 4YWLA 2SEBD 2A6ED 1B7YB 1O7IA 1PFNA 2JEBI 4O42A 2JA6B 5BR8L 1KRSA 1G51A 2N49A 4RGOS 3K6OA 1C48A 1LLRD 2JE6I 1WTVA 1HNZL 2XNAC 2K75A 4TKOB 3MEHA 1SNMA 1HQMC 1Q86C 2Z0SA 2JA5G 3K81C 1PYWD 4DV1L 2H5XA 5M3MB 4IPCA 4LF5L 1DJRD 2B2VA 4J15A 1L0XB 3DXJC 2F3WA 2K05A 4DF7A 2EYFA 3TN2A 1M8AA 2XN9C 3KOJA 1BXTA 2AWNA 1DCZA 4X3SA 4KN7C 3VA5A 1F9SA 4FP5D 2WKDA 4JYAL 3UDFA 3PUZA 4X3KA 4IUPA 5A2QL 1XWEA 5I6YA 3D4WA 2HT1A 4FF2A 1GUSA 4DR3L 3SVMA 1PH6A 1PTOF 5C4HA 4JI0L 1MD2D 3KLWA 2B2VC 3J81E 1HXYD 1Q3LA 1Z7TA 4QUCA 1K83H 1QNUA 1VQOA 1MSHA 2JA5B 5BN3A 3CCQA 1R9TH 5M5WB 1GHKA 3K5LA 4FF3A 4LAAA 2A69D 1GJXA 3G6JB 2DJGC 4ZRZA 4JI6Q 5IGDA 2NYZD 2E2HB 4DR7L 5C0XJ 1I6VC 1D5MC 2F0VA 3J7ZC 3EN2A 4L6TB 1V43A 4RFBA 1Y1VG 2VB3X 3MZ5A 4X65L 3F2UA 1E1TA 1VQFA 3GO5A 2LXKA 4IO9A 2KBNA 1GM5A 4DK3C 3T51B 3I72A 3G4SA
chains in the Genus database with same CATH topology
5NUCA 1JR0D 3S16B 4EQNA 5EPJA 1LT5D 3MAQA 1IW7D 2CW0C 5JPNC 5C4ZA 4K5VA 5FLXE 4IFDI 2K6AA 2CVRA 2Q8TA 3M7NA 1Y1VB 2IT1A 2DNCA 1RTNA 1JWSD 2X6LA 3Q0AA 2MPMA 1CHQD 4DA2A 2EE1A 3M7GA 4H44C 5C5LA 1RODA 1CHPD 1AZPA 5I2YA 5C0XH 4YIJA 3S1MB 1KAAA 1ILQA 4A3MB 3HOVB 4K6LA 3N6RA 1LACA 3VYSA 5J39A 4U68A 1EY7A 3P7JA 2F0MA 3AMUA 3CKIB 1AZQA 3ND8A 1KTKA 1FNUA 4I7ZC 4H0LC 1RJTA 4DGZA 1QNKA 5FKAC 1DM0B 3OMCA 3I90A 4QIWB 3BDLA 1DYQA 2EYPA 1HQRD 2R92B 1WVLA 1UAPA 4K2LA 1OXTA 1F2LA 3D3RA 3K59A 2RVLA 5G3LF 1MGSA 4QB4A 5EBCA 5KEEA 2WIIB 2PZUA 2F0LA 4G4KA 5EJWA 4RCOA 1FGBD 1X3PA 4KHVA 4R8IA 4XQJA 3T13A 1S5FD 3DWPA 1Z47A 1SJHD 5ELCA 2NN6H 1I4RA 4FXGC 1FNWA 1U4RA 5C3XA 1B4OA 2VB2X 1QOHA 2XIWA 2F3VA 3CHBD 3GTJB 1K8OA 2NVXB 2KCCA 3HKZB 2B2WA 3HP3A 2B8FA 1V1PB 1ILPA 2C9OA 3S2HB 3MVVA 1EY9A 3A7AB 3LX0A 1ESRA 1HUNA 4N9PA 1PRTD 1TWGB 5C44B 1VMCA 1TQOA 1B9MA 1QE6A 4Q0FA 1RKNA 2B2WC 2X69A 1IYUA 2RDFA 2SNMA 4ME5A 5FK9C 2AUJD 2NBFA 3FKIB 4ZK9B 1WD0A 1Q90A 2K5WA 1TVXA 5KNDA 3VR6A 2HDLA 3QOLA 2DY8A 1JICA 3CRLC 3VYUA 2HQEA 1A3VA 2BA1A 5JEAJ 3H09A 4KD3A 1FYCA 4MHEA 2I07B 1JE4A 3GTKB 1W6JA 2PO4A 1ESFA 1HPCA 4HEDA 5LHY1 3URYA 3U9SA 1OXUA 2IX0A 1STNA 1JORA 4DN4M 5C5MA 5M5YB 1OXVA 3S2DB 5F2DA 1Y8NB 1VDZA 3IKJA 4ZQ3A 3EVQA 5G3LD 4IURA 2MP1A 4DXFA 2OF1A 4K8IA 4BA2I 3VR4A 2Z4IA 1WTQA 2BE5D 5J22A 3K5OA 3C2PA 3TP6A 2DY7A 3PUXA 5JEAH 3M4YA 1YNJC 2A73B 1S5CD 4BBSB 2KJXA 5IGFA 4X3TA 3FPPA 1EIGA 4F8MA 2JA7B 1JQYD 3FPUB 4HTHA 1PTOB 1CZGA 2WV6D 2F4IA 4DNTB 3PUWA 4HCSA 3VR5A 1WCMB 1S4ZA 4IFDJ 3GD7A 5BN4A 4BBRB 4AYBB 1BCPF 4WORA 2A68D 3RZOB 1CZWA 1RTOA 2PPBC 2D5DA 1JB3A 1PXUA 1A15A 1YNNC 3SE0A 1VF7A 1EZ8A 2LFNA 2Y0SB 2B2YA 2HUGA 2I46A 2VXWA 4IUVA 2K04A 2SDFA 1S5BD 4NP5A 1E2VA 1O78A 3KBXA 3P75A 1EL0A 2WACA 5DEHA 3NE5B 1OXXK 2F03A 2RQXA 2NUCA 3H91A 2B2YC 2MJ8A 1BO0A 1QG7A 4EQPA 3ONAB 3VYRA 4K6DA 1K83B 1SE2A 1NAPA 1SEBD 1R9TB 1LT3D 5EBDA 3BDCA 1EY5A 4IFDH 2DN8A 4J1MA 1KNAA 4BA1I 4CJ0B 3DHQA 3BYYB 1EU3A 3NBHA 5IODA 1SYDA 3M4OB 1HTLD 3DWQA 3J7AV 3OW7A 3S15B 1ZYRC 4U673 4X3UA 5FO9B 1O7YA 4OO1H 1TY2A 4C1NI 2ICEC 1LV9A 3WOEA 5C0XG 4PNYA 5CV6A 5CMDA 3AU7A 3VA7A 3K0YA 3IAYA 3RD4A 3K5NA 2CHBD 2PZTA 1Z6HA 4C2MB 3OIQA 1STYA 4NDXA 3GTPB 5CV9A 1Q1BA 1F77A 3MA2B 1BCPD 2AQ2B 3W3AA 1I4XA 4C3JG 1SYBA 3QIAA 1BNZA 2NVTB 1F9QA 4J8QA 5DM63 1NR2A 1PTOH 5A35A 4OIJA 4A3JB 2EYHA 2V4DA 5CV4A 2F0UA 3OHXC 1G2TA 1AP0A 4RAUC 3NQIA 3TP8A 1WTWA 4LK1C 4TRDA 5I9OA 3BVGA 1V8QA 2WKCA 3Q23A 3S1RB 2F0TA 4C3JB 2B63B 2NN6G 2RA4A 1CFMA 3P20A 1CK1A 1PZID 4DAYA 4C56C 4Z9CB 5CV8A 4XQQA 2EPBA 3NSWA 3GTMB 4MIUA 1D5XC 5KNCA 3NQTA 1EY6A 2H1EA 3RZDB 1TWCB 3J80E 2KQ3A 1Y69U 3PIP3 2QF7A 1STAA 3SK6A 1UUPA 3I4MB 5JAVA 2M9VA 4C3IB 3PUVA 4XXEA 4KJNA 2ZXRA 4RHRA 3VR2A 2DNEA 3I3CA 5JJZA 4PMWA 3HZXA 3GTOB 1LTAD 3EROA 3PV0A 4ILWA 2L5TA 2KA7A 1LABA 2ID0A 1B50A 2LMCB 4XT1B 4KK7A 1D2BA 4O1NA 2HCCA 4KKTA 5C3WA 1SNDA 4FXKC 5EKLA 4IUTA 5AFWA 3CU7A 4KTAA 2EYLA 1F2MA 4UDUC 3SDZA 3KUPA 2J0TD 3EA6A 3V96A 2FMCA 1TWFB 2O5IC 4IQZA 3C1FA 2A74C 5E1FA 2MGSA 1LTRD 1SMYD 2GA4B 1PRTF 2R7ZB 1JCKB 3TZDA 5JOBA 4HMJA 1YNND 1KLUD 3BVZA 3EQLC 4QUFA 3D31A 1FNVA 3I4LA 2A6HC 1C4QA 3IFDA 5D14A 1TR5A 1EFID 2EDGA 4DNRB 2ZXPA 2X6GA 1SYGA 1QB5D 2KEEA 1JOOA 5JEAG 1I6HB 3FEWX 2PW5A 3KF8A 3MWYW 4RH6A 1A3UA 1BCPB 1AW7A 1SNQA 2TSSA 2K5DA 2RBMA 1B9NA 1HUMA 3MXNA 3A8KE 2KCNA 4KD4A 4KY5A 4K8JA 1KABA 1XXGA 5HURA 1STBA 2D2CC 5JVH3 2F0WA 1GUGA 1TIID 2SNSA 2M2LA 4C3HG 1G291 2YYZA 5IGGA 3DMUA 1WTOA 1U4PA 2Z8LA 3MFYA 3ZYYX 2IX3A 4XQNA 2OEOA 1H9JA 3MXPA 2KUMA 4CJ2C 2O2LD 4N9TA 1SJED 1LTBD 1F9PA 1QILA 1H9SB 1I4GA 4B08A 4EQOA 1SNCA 1STEA 2AUKA 4C3HB 1UNSA 3OOCA 3P1HA 2R3ZA 1TKWB 1LO5D 1OXSC 2ZT9C 3H3VC 1CA6A 2EY6A 1WTPA 1TS5A 5CYUA 5IGBA 4DAPA 1ET6A 4IFDG 5J1ZA 1EYDA 2E74C 4DK1A 3PMFA 3SK4A 4TSSA 4BY7B 2HDMA 1PDQA 4HCEA 2A5HA 3TBIB 5DM73 5DAUA 1RDPD 2B8GA 1VMPA 3J81L 3C1EA 4S3SA 2JEAI 3NHHA 3NWSA 2O5JC 5E4WC 4OO1G 3OWFA 3VR3A 3QB3A 2XRSD 2NZ1D 1KLGD 2WP8J 2RDGA 4KHZA 2F0FA 3HEJA 2B2UA 3L7ZC 2L9HA 4QF4A 2NVQB 1JC7A 4ZLTF 2PMZB 4G7HC 1HTPA 3PO3B 3GV6A 3R93A 3GP7A 3BDOA 4F7XA 1LTGD 3V2TA 3TP5A 4I65A 4QMGA 4PV1C 2B2UC 1HFGA 1WTXA 2J4XA 4BS9A 4A3EB 1JOQA 4FYDA 1V1PA 3S14B 5D3IB 4RGNA 5EGTA 2QCPX 1A6XA 1ZEQX 3H0GB 3OIPA 1HA6A 4H7BA 1QJOA 3OMGA 1RCVD 4B9XA 5FO7B 5CBAE 4HSVA 1EY0A 2EJMA 1TS4A 4IN3A 4A3DB 1FR3A 3QOJA 3BZDB 3NTHA 2CW0D 5LL6X 3PIO3 2IX1A 4H13C 1LT4D 2A69C 1SYCA 5C3EB 3N52A 4OGQC 5K36H 2MUYA 2D9UA 3HOUB 1TY0A 2CQAA 3HOYB 1DD2A 2QKIC 1QWYA 1KDBA 4PMCA 3EFXD 1K8MA 1OO9B 3BVMA 4J6HA 5A2QE 2XSCA 5IGCA 3PO2B 1TU2B 4EGVA 1IW7C 1IHZA 4QCLA 1DOLA 1TS3A 3CRKC 3DWAA 4G7ZC 4K2KA 2LY7A 3DEOA 5I6WA 2C5CA 3S17B 4KMUC 1RF2D 1A3TA 4ZKCB 1A2TA 1GOZA 3HOWB 3ITPA 2NN6I 2R6GA 1CM9A 1PRTB 4EVOA 1SSOA 1BQQT 5EKIA 3QO2A 1BR9A 4K5XA 1XYIA 1TT2A 1STHA 5E3FA 2BA0A 2JSOA 2K1BA 3TZUA 4A93B 3GQBA 1E2WA 3A54A 1H9MA 1RD9D 4IUQA 4ZUJA 2K5QA 3R8BA 3X3MA 4WJWA 4P2CB 4ZAIA 2NB0A 2PNRC 3I73A 1PTOC 1X3QA 3L9AX 4F88A 1BDOA 3EJIA 2K28A 3BG3A 3MC0B 4KI0A 4IUNA 4KY6A 2H4OA 3M85A 1EOTA 3O13A 5CV5A 4ULLA 3RUZA 1UEAB 5IT9L 1SYEA 3S1QB 2E2JB 2XWBB 4M1UB 4NKLA 1NUCA 4K5WA 4CGYB 4XYOA 2D62A 4RHSA 2QEJC 5CORA 3BYTB 1B53A 1U4LA 2XRQD 2L0CA 1EEID 3E5SA 1KDCA 1F2YA 2KEDA 2EJGC 3L3OC 1L0YB 4DFAA 1PRTC 3CQZB 4OL7A 1D1KA 5D3DA 5I4DA 2K32A 1JOKA 4FF1A 4C3IG 4ABNA 5KYLA 1PFMA 1DXMA 1SYFA 2ENBA 1GUOA 4M8AA 3UI2A 3C3LA 1ICWA 2IW3A 3RMHA 1I4PA 3LNNA 3OWEB 4V0BA 3S1NB 5EQ0A 3U9OA 1B1ZA 4HR7B 3X3NA 4CKCA 1JWMD 1Y8OB 2WAQB 3A56A 2F0HA 2F0GA 2EZVA 2KVMA 1D5ZC 4XIGS 1G2SA 2BOSA 3IL8A 3TP7A 3HG9A 4E6IA 3D4RA 2PCFB 2XWJB 4CKBA 3I4NB 2K7VA 1AEXA 2L11A 1ENCA 2QDBA 1KNEA 4JK1C 1YNJD 1G6ZA 2WB1B 2L12A 1IL8A 4HMIA 4NMZA 3C46A 2EYMA 1KDAA 2B39A 3I91A 2RKSA 3MXGA 2FMMA 1SAPA 2BE5C 1EQTA 5ELEA 2K33A 1EY8A 2BCOA 4PQXA 3J7AF 2F0OA 1IKMA 5CR3A 2BDNA 1SNOA 4HN7A 3JAML 1EZ6A 5CV7A 5C4JB 4XYQA 1SBBB 3DM1A 5T1GA 3V05A 2FHTA 1R4QB 4A3IB 1FD7D 4DU9A 4B9WA 4A3KB 1PMRA 1XTCD 1J9OA 3D6CA 5CBEE 1S5ED 1EYAA 1GUWA 3MTSA 5K5PA 5ELDA 2A68C 4KKUA 3Q22A 4G57A 1BUVT 1EWCA 3FMCA 1W6KA 3S9WA 4RCNA 4ZUIA 1EU4A 5ISRA 2QILA 4OO1I 5ELBA 3D6WA 3FDTA 2L55A 1H9RA 4XTCS 2Z4HA 5K36G 3HRZC 4L63B 2F0NA 4KY7A 1DONA 2XVSA 2K01A 4HSPA 2Q8RE 2RSOA 3MFGA 2L1BA 5IOCA 3QJYA 1NSNS 1R4PB 5KGUA 2WINB 2AWOA 4K14A 5IGEA 1MBYA 1LTTD 2EYJA 5COYA 1PZKD 3LWEA 3K5MA 5FOBB 1ZYRD 2F0DA 2HCIA 2J7ZA 1X32A 3NK9A 1C8CA 2AQ3B 4ID6A 2EYOA 1PTOD 2BDOA 4CJ1B 1CT1D 2NWGA 2F0SA 1HFNA 2JYOA 3K7AB 3GV3A 1U9RA 2FJ2A 5D65A 4IUUA 1SE3A 1PZJD 3DUZA 4MN3A 2EJFC 3TMEA 1U4MA 5JPMC 2FINB 1B44D 1T5EA 3I70A 3NWTA 1F9RA 4A3GB 2NVYB 1EQVA 4PMBA 3A8IE 4R8NA 3KBGA 2B2TA 2F0QA 3QWNA 3BS1A 1CQFA 2F0KA 4XT3B 3R3OA 1AFPA 4Q5VA 3R2IA 1NR4A 5KNBA 1PFBA 2NTTA 1GXDC 3FVQA 3NUCA 1SXTA 1XX8A 3GTGB 1Q8IA 3J80L 1QCBD 4LJZC 4DAVA 4L8JA 1A2UA 4A3FB 3GTLB 1AN8A 3LWUA 4RA8A 2B2TC 5CC4A 2F1MA 1B2TA 1BCPC 3SXHA 1E2ZA 4A3BB 5EKKA 5C6AA 3SK8A 4G7OC 3NP8A 2F0EA 3T56B 1SDFA 1JWUD 1CI3M 3Q6SA 1WTRA 2R93B 1J8IA 1TS2A 4IZ8A 1BOSA 5I9PA 1ENAA 5I2XA 2AQ1B 2N55A 3SR1A 1H9SA 4UAIA 2A6EC 3Q24A 5IT9E 2JXMB 1HHVA 1CA5A 3ERQA 1EYCA 2E75C 2IPKD 1WD1A 3K57A 2R61A 3H6MA 2EOTA 5M9OA 3HS0C 1EWHA 4FXDA 3A8JE 4LMQD 5FLXL 5KIXA 4Y7NB 1ENFA 1B3AA 4XDXA 4F87A 4KN4C 1I3QB 3GTQB 1EY4A 5BN5A 1SFOB 2E2DC 3OSOA 3G7LA 2EY5A 4RKBA 4OIKA 1T5XD 1MI2A 2F0PA 3WOFA 3TSSA 1O80A 5C0XI 2VNUD 2SOBA 4JBWA 2F0IA 1GUNA 2JA8B 1D6EC 4R9WA 1I4QA 1LT6D 5KRUA 3HOZB 3RLFA 5E4XA 3W2DA 1V1OA 2EY1A 2PZWA 2ZXOA 3DEPA 1I50B 2MHVA 1TWAB 3E0JA 5TSSA 1S5DD 2OXPA 2TMPA 2IL8A 2A6HD 3NTKA 2IJ0A 2EY2A 5IIFA 1VF5C 1E0BA 1ET9A 1O7ZA 2O4XA 3OPOA 3KK7A 3NBIA 2E76C 3E6ZX 4CKEA 3J7YW 1O7LA 3T16A 3K58A 1HRJA 1HA5A 5C4XB 5EPKA 5EPLA 2F0JA 3MHBA 1STGA 1ML0D 3SK5A 1SMYC 1PLFA 2KECA 4WRDA 1EIHA 3R2TA 3T4AC 2JP1A 4RGTA 4FVMA 1Q1EA 2Q8IB 4RKLA 1SNPA 2ICIA 4WFN3 2Z1CA 1CQVA 4BWGB 3A7LA 4FF4A 4KKSA 2NTSA 5KYIA 3D4DA 1DOKA 2G9DA 1NCVA 4GZYC 2RDHA 3PUYA 3SHLA 5HGTA 3JAME 1LTID 5DNFA 3NPPA 1H9KA 1I4HA 4IALA 2L4NA 5ELFA 2KOLA 2PW7A 1II3A 1CTMA 1Y8PB 4RGMA 4NW2A 3FRPB 2VUMB 1EEFD 3HGBA 4V190 1IYVA 3KLSA 1DZ1A 2K03A 3NXWA 5M3FB 1DOMA 1GHJA 4DXGA 3MXUA 1G8ZD 2KHSA 4ZKBB 1M4VA 3I8ZA 1F2ZA 2IWHA 1SE4A 2FFKB 1ZXTA 1BF4A 3TDQA 1HCZA 2M00A 4CBVA 1G91A 4KJOA 2N88A 5JVG3 2LS01 3ND9A 1ZKOA 5T1IA 1LTSD 1IKLA 1VCIA 3M3YB 5LL6S 3SEBA 4OHJA 1Y1WB 5FO8B 4TQUS 4C1NK 3D8GA 3QG1A 5M5XB 4ZYSA 1ONLA 1D1IA 1TWHB 3T53B 5CGKA 2EVBA 3H94A 1Q12A 2LKVA 3IFTA 1MSGA 3WDNA 3HOXB 4BY1B 4HAEA 3KLSX 4DK0A 2E2IB 3NTIA 2EXZA 3A55A 2OT2A 1GUTA 3AB9A 4CHTB 4KV6A 3KLRA 3VYTA 2YU9B 2PQEA 2RSNA 4FO2A 4FNFA 2G9HD 4ODGA 1BBXC 2PYKA 1RHPA 4RWSC 2SEBD 2A6ED 1PFNA 2JEBI 4O42A 2JA6B 4RGOS 3K6OA 1C48A 1LLRD 2JE6I 1WTVA 2XNAC 4TKOB 3MEHA 1SNMA 1HQMC 1PYWD 5M3MB 1DJRD 2B2VA 1L0XB 3DXJC 2F3WA 2K05A 4DF7A 2EYFA 3TN2A 1M8AA 2XN9C 1BXTA 2AWNA 1DCZA 4X3SA 4KN7C 3VA5A 1F9SA 4FP5D 2WKDA 3PUZA 4X3KA 4IUPA 5A2QL 1XWEA 5I6YA 3D4WA 4FF2A 1GUSA 3SVMA 1PTOF 5C4HA 1MD2D 2B2VC 3J81E 1HXYD 1Q3LA 1Z7TA 4QUCA 1QNUA 1MSHA 2JA5B 5BN3A 5M5WB 1GHKA 3K5LA 4FF3A 4LAAA 2A69D 1GJXA 3G6JB 4ZRZA 5IGDA 2NYZD 2E2HB 5C0XJ 1I6VC 1D5MC 2F0VA 4L6TB 1V43A 4RFBA 2VB3X 3MZ5A 3F2UA 3GO5A 3T51B 3I72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9U A;  2RVL A;  1DOK A;  3G7L A;  4HED A;  3MTS A;  1GUW A;  5EQ0 A;  1NCV A;  1MGS A;  4ZAI A;  5EPJ A;  4OIK A;  2B2Y A;  2HUG A;  1MI2 A;  1VMP A;  2B2T A;  2VXW A;  5EKI A;  1HUM A;  4IUV A;  2K04 A;  5DNF A;  3I3C A;  5JJZ A;  1X3Q A;  2SDF A;  5EJW A;  2KVM A;  1O80 A;  4DN4 M;  1G2S A;  1X3P A;  2L4N A;  2RSN A;  4XT3 B;  3KBX A;  4R8I A;  1NR4 A;  2KOL A;  5E4W C;  1PFB A;  2K28 A;  1BBX C;  1XX8 A;  4NW2 A;  1EL0 A;  1RHP A;  4RWS C;  2NZ1 D;  2CVR A;  2Q8T A;  1U4R A;  1PFN A;  3D6W A;  3IL8 A;  4O42 A;  1BNZ A;  2M2L A;  1B50 A;  1F9Q A;  1EOT A;  4R9W A;  4XT1 B;  3FDT A;  1DOL A;  2B2U A;  1WTV A;  1B4O A;  1NR2 A;  3H91 A;  1RTN A;  4OIJ A;  2B2Y C;  4RA8 A;  2MJ8 A;  5E4X A;  2HCC A;  2L9H A;  2B2T C;  1U4P A;  1BO0 A;  1QG7 A;  1WTO A;  4IUR A;  4IUT A;  2XIW A;  2MP1 A;  3ONA B;  1B2T A;  2L11 A;  2X6L A;  5AFW A;  1DZ1 A;  2K03 A;  3DEP A;  4ZLT F;  2MPM A;  1DON A;  1KNE A;  1DOM A;  2B2W A;  3DEO A;  1G2T A;  3GV6 A;  1NAP A;  3R93 A;  1AP0 A;  2K01 A;  3HP3 A;  2Q8R E;  2KUM A;  2B2V A;  2RSO A;  4CJ2 C;  2L1B A;  3KUP A;  1WTQ A;  1G6Z A;  4RAU C;  2IL8 A;  4ZKB B;  2K05 A;  1ILP A;  3TN2 A;  1M8A A;  3I8Z A;  2L12 A;  1IL8 A;  1WTW A;  1SDF A;  2MGS A;  1F9P A;  2EE1 A;  1E0B A;  1O7Z A;  2DY7 A;  3Q6S A;  4X3S A;  1WTR A;  1ESR A;  1J8I A;  5COR A;  1F9S A;  1HFG A;  2B2U C;  2FFK B;  1WTX A;  1HUN A;  1B53 A;  1ROD A;  3TZD A;  1KNA A;  1U4L A;  1ZXT A;  1AZP A;  1BF4 A;  4X3K A;  4IUP A;  3I91 A;  4ZKC B;  4CJ0 B;  2RA4 A;  1VMC A;  1G91 A;  5COY A;  1HRJ A;  2KED A;  1QE6 A;  1CM9 A;  3LWE A;  1ILQ A;  2N88 A;  5EPK A;  2FMM A;  4QUF A;  3SVM A;  1SAP A;  5EPL A;  2HCI A;  2B2W C;  2J7Z A;  1X32 A;  2N55 A;  2X69 A;  1C8C A;  1EQT A;  4UAI A;  5T1I A;  1ML0 D;  2B2V C;  5D14 A;  1SSO A;  3IFD A;  3P7J A;  4U68 A;  1IKL A;  1EIG A;  1PLF A;  1Q3L A;  2KEC A;  2R3Z A;  4QUC A;  4CJ1 B;  1CA5 A;  1HHV A;  3QO2 A;  1AZQ A;  1HA6 A;  1MSH A;  2NWG A;  2EPB A;  1IKM A;  1EIH A;  1XYI A;  4ZK9 B;  3FPU B;  1WD0 A;  1WD1 A;  2BDN A;  5CBA E;  1HFN A;  1TVX A;  2EOT A;  2JP1 A;  2JYO A;  4HSV A;  1CA6 A;  1RJT A;  4HCS A;  2HDL A;  1WTP A;  4LMQ D;  3GV3 A;  1S4Z A;  1QNK A;  2H1E A;  2K1B A;  4X3U A;  2NYZ D;  2DY8 A;  1JIC A;  1O7Y A;  2FJ2 A;  5D65 A;  1B3A A;  2X6G A;  3I90 A;  2KEE A;  3DM1 A;  4IUU A;  5T1G A;  4XDX A;  1PFM A;  1LV9 A;  2FHT A;  4MN3 A;  4MHE A;  1U4M A;  4X3T A;  4IUQ A;  1JE4 A;  3UI2 A;  1MSG A;  1RTO A;  3F2U A;  2FIN B;  2HDM A;  5CMD A;  1WVL A;  1ICW A;  1PDQ A;  1A15 A;  3N52 A;  1F9R A;  3MWY W;  4HAE A;  1J9O A;  1F2L A;  5CBE E; 
#chains in the Genus database with same CATH topology
 5NUC A;  1JR0 D;  1K8A C;  3S16 B;  4EQN A;  1E24 A;  5EPJ A;  2HIX A;  1LT5 D;  3MAQ A;  5AJ3 Q;  1IW7 D;  2CW0 C;  4DNI A;  3S15 H;  4DV7 L;  5JPN C;  5C4Z A;  4JV5 L;  4K5V A;  4HJA A;  4WJ3 M;  5FLX E;  4O2D A;  4IFD I;  2K6A A;  3WWV A;  1PA6 A;  2K50 A;  2CVR A;  2Q8T A;  4IJL A;  3M7N A;  4A3M G;  1Y1V B;  3HOV G;  3M3Y H;  2IT1 A;  2DNC A;  1RTN A;  4DV3 L;  1BKB A;  1JWS D;  2X6L A;  3Q0A A;  4C2M H;  2MPM A;  1B3Q A;  1XPO A;  1CHQ D;  2Q2I A;  3F8T A;  4DA2 A;  2EE1 A;  3M7G A;  4H44 C;  5C5L A;  2R7F A;  1ROD A;  1CHP D;  1AZP A;  5I2Y A;  5C0X H;  4YIJ A;  1W2B A;  2DJF C;  2NVT H;  5L37 A;  4NXM Q;  4JI6 L;  3S1M B;  4CDE C;  3PF4 A;  2E2I H;  1KAA A;  4DR6 L;  1ILQ A;  3UE1 A;  4A3M B;  3HOV B;  4K6L A;  3N6R A;  1LAC A;  3VYS A;  5J39 A;  4A3J H;  1KD1 C;  4U68 A;  1EY7 A;  3P7J A;  2F0M A;  3CME A;  3AMU A;  4JI2 L;  3CKI B;  1AZQ A;  3ND8 A;  1KTK A;  1FNU A;  4I7Z C;  4H0L C;  1RJT A;  4DGZ A;  3E0E A;  2JA6 H;  1QNK A;  5FKA C;  1DM0 B;  3OMC A;  5IT9 c;  5AJ3 L;  1T9H A;  3S1R H;  3TQY A;  3I90 A;  1SMX A;  4QIW B;  4C3J H;  3BDL A;  1DYQ A;  1JE5 A;  2MNA A;  2EYP A;  1HQR D;  2ATW A;  2R92 B;  4JI1 Q;  4GN5 A;  3ULJ A;  1KAW A;  1WVL A;  1UAP A;  4K2L A;  1OXT A;  1F2L A;  3D3R A;  3K59 A;  2RVL A;  5G3L F;  2A8V A;  1UE5 A;  3HKZ G;  3GTM H;  5IP9 H;  2OQ0 A;  1MGS A;  4QB4 A;  5EBC A;  1YJW A;  5KEE A;  3PGZ A;  2WII B;  4WJ4 A;  1WOC A;  2PZU A;  3RZD H;  2F0L A;  4G4K A;  1MIU A;  1L1O B;  5EJW A;  4RCO A;  1FGB D;  1X3P A;  2JQO A;  4KHV A;  4R8I A;  4XQJ A;  1C7Y A;  3T13 A;  1S5F D;  3DWP A;  5GAG C;  1Z47 A;  1GKH A;  1SJH D;  5ELC A;  2NN6 H;  4JBM A;  4FXG C;  1I4R A;  2Q2T A;  1FNW A;  1U4R A;  2YTV A;  5C3X A;  4ME3 A;  2N8N A;  1B4O A;  1NNX A;  4HIO A;  2VB2 X;  1QOH A;  1TXY A;  2XIW A;  3M9B A;  2F3V A;  1HR0 Q;  3CHB D;  3GTJ B;  1K8O A;  2G5D A;  2NVX B;  3FKI G;  2KCC A;  3HKZ B;  2B2W A;  3HP3 A;  2B8F A;  3GTO H;  1V1P B;  1PH3 A;  1ILP A;  4MNO A;  2C9O A;  3S2H B;  3MVV A;  1EY9 A;  3A7A B;  3LX0 A;  1ESR A;  3J81 j;  1HUN A;  2N3S A;  4JBK A;  4N9P A;  1PRT D;  1TWG B;  1V9P A;  5C44 B;  2WAQ E;  1VMC A;  1TQO A;  2VS1 A;  4MTK A;  1B9M A;  1QE6 A;  4LF7 L;  4Q0F A;  1HZA A;  1RKN A;  2B2W C;  1PH8 A;  2X69 A;  1IYU A;  4B3S L;  4KHP L;  3JAM i;  2RDF A;  2SNM A;  4OEL B;  4ME5 A;  5FK9 C;  3BZK A;  3K7U C;  2AUJ D;  2NBF A;  3RLO A;  3FKI B;  4ZK9 B;  1WD0 A;  3KJP A;  1Q90 A;  4GLV B;  1K3B C;  2K5W A;  1TWF H;  1TVX A;  5KND A;  3VR6 A;  3T1H Q;  2HDL A;  3QOL A;  2OQK A;  3TEH B;  2R7Z H;  2DY8 A;  1JIC A;  3CRL C;  3VYU A;  2HQE A;  1A3V A;  2BA1 A;  5JEA J;  3H09 A;  1YHQ A;  4KD3 A;  1IBL Q;  1FYC A;  4MHE A;  2I07 B;  1HZC A;  2WB1 E;  1JE4 A;  3H3V H;  3GTK B;  4JG2 A;  1W6J A;  2PO4 A;  1ESF A;  2CQO A;  1HPC A;  4HED A;  1A8V A;  3E9I A;  5LHY 1;  4P72 A;  3URY A;  1HR0 L;  3U9S A;  1OXU A;  2Q2U A;  2IX0 A;  1STN A;  1P16 A;  3RNU A;  3H15 A;  1JOR A;  2C35 B;  2JA8 G;  4DN4 M;  5C5M A;  5M5Y B;  1CKO A;  1SRO A;  1I6H H;  1OXV A;  3JAM c;  3S2D B;  2MQH A;  5F2D A;  1Y8N B;  1VDZ A;  3IKJ A;  4ZQ3 A;  3EVQ A;  5G3L D;  4IUR A;  1NBW A;  2MP1 A;  2XTI A;  1M1K C;  3TRZ A;  2JA7 G;  4DXF A;  3J7A 5;  4QL5 A;  5ELN A;  4YY3 L;  2OF1 A;  4K8I A;  4BA2 I;  5IWA Q;  3VR4 A;  2Z4I A;  4JI8 Q;  1WTQ A;  1WCM G;  2PQA A;  2R92 H;  2BE5 D;  5J22 A;  3K5O A;  3C2P A;  3TP6 A;  1HH2 P;  5IYD H;  4AYB G;  2DY7 A;  2AHO B;  5C4X G;  4X64 Q;  4A3L H;  3PUX A;  5JEA H;  3M4Y A;  3OTO Q;  1CUK A;  1YNJ C;  2A73 B;  4HJ5 A;  1XNR L;  1S5C D;  4BBS B;  2KJX A;  1IBL L;  3E3X A;  4LUO A;  5IGF A;  4X3T A;  3FPP A;  1EIG A;  4F8M A;  1LYL A;  4JBJ A;  2Y0S G;  2JA7 B;  1JQY D;  3FPU B;  4HTH A;  4LNQ A;  1PTO B;  3PIP A;  3OYY A;  1CZG A;  2WV6 D;  3NBH B;  5LMN W;  4B3T Q;  2F4I A;  4DNT B;  3PUW A;  4HCS A;  3VR5 A;  1WCM B;  1S4Z A;  4IFD J;  1B70 B;  3GD7 A;  5BN4 A;  4BBR B;  4AYB B;  4OX9 L;  1BCP F;  3BU2 A;  4WOR A;  2A68 D;  4C3H H;  1QZH A;  3RZO B;  1CZW A;  1RTO A;  2PPB C;  4DV5 Q;  2D5D A;  1XMO L;  1JB3 A;  1PXU A;  1A15 A;  5FLM H;  1PH9 A;  2EIF A;  1YNN C;  3SE0 A;  1VF7 A;  3S2H H;  1EZ8 A;  2LFN A;  2Y0S B;  2B2Y A;  2HUG A;  2I46 A;  1C9O A;  2VXW A;  4LFC Q;  4IUV A;  2K04 A;  4UY8 C;  2UXB L;  3J80 i;  5C44 H;  2SDF A;  1S5B D;  4R1J A;  4NP5 A;  1E2V A;  5IWA L;  2VUM G;  1O78 A;  3KBX A;  2VW9 A;  2JA9 A;  1X3E A;  1X55 A;  3ULP A;  3P75 A;  4CDF C;  1EL0 A;  2WAC A;  5DEH A;  1AH9 A;  4BY7 H;  3NE5 B;  1OXX K;  3J81 i;  2NZO A;  2F03 A;  1XMQ Q;  2RQX A;  2NUC A;  1YIJ A;  3L2P A;  4X64 L;  3H91 A;  2B2Y C;  2JK8 A;  2MJ8 A;  1FJG L;  1BO0 A;  1QG7 A;  4EQP A;  3ONA B;  3CCV A;  3VYR A;  4K6D A;  1K83 B;  1SE2 A;  1NAP A;  1SEB D;  1R9T B;  1LT3 D;  5EBD A;  1IYJ B;  1X65 A;  3BDC A;  3GTK H;  1EY5 A;  3L0O A;  4IFD H;  4AQY Q;  2DN8 A;  4B3T L;  4J1M A;  1KNA A;  4BA1 I;  3MEF A;  4CJ0 B;  4JPB W;  4YCU A;  2D0O A;  1C0A A;  3DHQ A;  3BYY B;  1EU3 A;  1L2F A;  3NBH A;  5IOD A;  2NVQ H;  1SYD A;  3K80 C;  4POF A;  3W1B A;  3D0F A;  3PO3 H;  4JOI A;  3J80 c;  2HQL A;  5M5Y H;  2KHJ A;  3M4O B;  1HTL D;  3DWQ A;  3J7A V;  3OW7 A;  3S15 B;  1ZYR C;  4DAY B;  3S2D H;  4U67 3;  4X3U A;  5FO9 B;  1O7Y A;  4A3E H;  4OO1 H;  4HJ9 A;  1TY2 A;  1PVO A;  4C1N I;  4BY1 G;  3S14 H;  1QVC A;  2F3I A;  1LV9 A;  2ICE C;  3WOE A;  5C0X G;  3T1Y L;  4PNY A;  1A63 A;  5CV6 A;  4JOI C;  5CMD A;  3AU7 A;  3VA7 A;  4JI4 Q;  1KHI A;  3K0Y A;  3VDY A;  3IAY A;  3H0G H;  4HJ7 A;  2QEX A;  3RD4 A;  4IPG A;  4OWW B;  3K5N A;  2CHB D;  4A3J G;  2PZT A;  1W3S A;  3QR8 A;  1Z6H A;  4C2M B;  3OIQ A;  4P71 A;  1STY A;  1J6Q A;  2UXC Q;  1PV4 A;  3AYH B;  4A3D H;  4NDX A;  3GTP B;  2JA6 G;  5CV9 A;  4B3R L;  1Q1B A;  2I5H A;  1F77 A;  3MA2 B;  4DV0 L;  4BBS H;  1BCP D;  2AQ2 B;  3W3A A;  1I4X A;  4C3J G;  1SYB A;  1HNW Q;  4YHH L;  3QIA A;  3SGI A;  5C3E H;  1BNZ A;  2NVT B;  1HJP A;  1F9Q A;  4JI7 Q;  4AQY L;  4J8Q A;  5DM6 3;  4LUV A;  5FLX c;  1NR2 A;  3CCU A;  1PTO H;  5A35 A;  4OIJ A;  3HOU H;  4L5Q A;  3HKS A;  4GLX A;  4A3J B;  2EQS A;  2EYH A;  1U0L A;  2V4D A;  5CV4 A;  5IP9 G;  2F0U A;  1VQ5 A;  3OHX C;  1G2T A;  3A74 A;  4DV4 Q;  4BBR H;  1AP0 A;  4RAU C;  3NQI A;  3TP8 A;  3I7F A;  2VZA A;  1WTW A;  4LK1 C;  4TRD A;  5I9O A;  3BVG A;  1V8Q A;  1KRT A;  2WKC A;  3Q23 A;  3S1R B;  2CCZ A;  1IBM Q;  2F0T A;  4C3J B;  2B63 B;  2NN6 G;  2RA4 A;  1CFM A;  1VQD A;  1L0W A;  3P20 A;  1CK1 A;  2YTX A;  1I94 Q;  4DV2 L;  1PZI D;  4DAY A;  4C56 C;  4Z9C B;  5CV8 A;  4XQQ A;  2EPB A;  4JI4 L;  3NSW A;  3GTM B;  3S17 H;  4MIU A;  1D5X C;  5KNC A;  3NQT A;  3NEL A;  1EY6 A;  4GN4 B;  2H1E A;  3RZD B;  1TWC B;  3J80 E;  2KQ3 A;  1Y69 U;  3PIP 3;  1CKN B;  3A5Z B;  2QF7 A;  3B6Y A;  2UXC L;  2ZJQ A;  3HOW H;  1STA A;  3SK6 A;  1UUP A;  3I4M B;  3G48 A;  5JAV A;  4DR5 Q;  1MHW C;  2M9V A;  4C3I B;  3PUV A;  1HNW L;  4XXE A;  4HIK A;  4KJN A;  4JI7 L;  1AE3 A;  2ZXR A;  4RHR A;  1K73 C;  2IHE A;  3KF8 B;  3VR2 A;  1EYG A;  2DNE A;  3I3C A;  4A93 H;  5JJZ A;  4A76 A;  4PMW A;  3HZX A;  3GTO B;  1LTA D;  3ERO A;  3PV0 A;  2R7Z G;  4ILW A;  5IY0 A;  1YJ9 A;  2L5T A;  2KA7 A;  3MXN B;  1LAB A;  5IE8 A;  2ID0 A;  1B50 A;  3KYH C;  1XPU A;  2LMC B;  5J3B A;  4XT1 B;  4KK7 A;  1D2B A;  1IBM L;  4O1N A;  2HCC A;  4KKT A;  5C3W A;  3DLL A;  3M4O H;  1SND A;  4FXK C;  5EKL A;  4IUT A;  4IOA A;  2OWO A;  5AFW A;  3CU7 A;  1N32 Q;  4KTA A;  1YVC A;  2EYL A;  1BVS A;  1I94 L;  4OWX B;  1F2M A;  4UDU C;  3SDZ A;  2CFM A;  3KUP A;  2J0T D;  3EA6 A;  1GD7 A;  3V96 A;  2FMC A;  1TWF B;  2O5I C;  4IQZ A;  3C1F A;  2A74 C;  3AQQ A;  2MGS A;  5E1F A;  1LTR D;  1S40 A;  1SMY D;  2GA4 B;  1PRT F;  2R7Z B;  4DUY Q;  1JCK B;  3TZD A;  5GAE C;  5JOB A;  4HMJ A;  1YNN D;  4B3M Q;  1FVI A;  1KLU D;  3BVZ A;  1VQG A;  3EQL C;  4QUF A;  1X9N A;  3D31 A;  1FNV A;  3I4L A;  2A6H C;  4LF8 Q;  1C4Q A;  3IFD A;  5D14 A;  1TR5 A;  3S1Q H;  2E2J H;  1EFI D;  1CSQ A;  2ZJR A;  4DR5 L;  2EDG A;  3GTP H;  2A19 A;  4GOP B;  2UUB Q;  4DNR B;  1CKN A;  1XNQ Q;  2ZXP A;  1YIT A;  2MO1 A;  5H1S E;  2R92 G;  3PIO A;  4L5T A;  4R4Q A;  1WTH A;  2X6G A;  1SYG A;  4PZ7 A;  1QB5 D;  2KEE A;  2YTY A;  3I55 A;  1JOO A;  1PFS A;  4A3L G;  2CWP A;  3LGJ A;  5JEA G;  4R4T A;  2ZTE A;  4GN3 B;  3FEW X;  4N8X 1;  1I6H B;  1VQ4 A;  2PW5 A;  3KF8 A;  2K5V A;  1VQB A;  3MWY W;  4RH6 A;  4LFA Q;  5IYB H;  3JC6 6;  1A3U A;  1BCP B;  1AW7 A;  2JN4 A;  1SNQ A;  1NMG A;  4X6A H;  5GRO A;  3CQZ H;  1WI5 A;  2TSS A;  2K5D A;  2RBM A;  1B9N A;  2MO0 A;  1K0S A;  2FXQ A;  3KFU A;  1HUM A;  3MXN A;  2B63 H;  1N33 Q;  3A8K E;  1YI2 A;  2KCN A;  4KD4 A;  4KY5 A;  4K8J A;  1KAB A;  2OCE A;  1XXG A;  5HUR A;  2ASB A;  1STB A;  2CH4 A;  2D2C C;  5JVH 3;  2F0W A;  4DR1 Q;  5LMU Q;  1GUG A;  1TII D;  2SNS A;  2M2L A;  4C3H G;  1G29 1;  2YYZ A;  4DUY L;  3M4P A;  4OXP A;  1XPR A;  5IGG A;  3DMU A;  1WTO A;  3S1N H;  1U4P A;  5FLM G;  2A1A A;  2Z8L A;  3MFY A;  3ZYY X;  2IX3 A;  4XQN A;  1TWC H;  1H9J A;  2OEO A;  3MXP A;  4P73 A;  4LF8 L;  2KUM A;  4UP8 A;  4CJ2 C;  1VQ8 A;  1YHB A;  4LF6 Q;  3UE0 A;  2O2L D;  4N9T A;  3I4M H;  4LF4 Q;  1VQP A;  5C44 G;  2UUB L;  4BXX H;  1SJE D;  1LTB D;  1F9P A;  1XNQ L;  1QIL A;  1H9S B;  2ZTC A;  2RF4 A;  1I4G A;  4B08 A;  4C3I H;  4EQO A;  2PNH A;  4NXM L;  1SNC A;  3I4N H;  1STE A;  2AUK A;  4LWC A;  4MZ9 A;  4C3H B;  1UNS A;  5GQO A;  3OOC A;  3P1H A;  2R3Z A;  1TKW B;  1KXL A;  1LO5 D;  4R4C A;  1OXS C;  2ZT9 C;  3H3V C;  3CC4 A;  1CA6 A;  3TS0 A;  2EY6 A;  4DV6 Q;  1WTP A;  1TS5 A;  5CYU A;  5IGB A;  4GNX B;  1JB7 A;  5IYC H;  4DAP A;  1ET6 A;  2RHQ B;  4IPD A;  4IFD G;  5J1Z A;  1EYD A;  3I4O A;  2E74 C;  4DK1 A;  3PMF A;  3SK4 A;  1WFQ A;  5FJ8 H;  4TSS A;  4I7A A;  4JI1 L;  4UHV A;  5JJK A;  4BY7 B;  2HDM A;  4IPH A;  1PH2 A;  1PDQ A;  4DR1 L;  5LMU L;  4HCE A;  2A5H A;  3TBI B;  5DM7 3;  3FHW A;  1CKM A;  5DAU A;  1RDP D;  3E9H A;  2B8G A;  1VMP A;  3J81 L;  3C1E A;  2I0Q A;  4S3S A;  2JEA I;  3NHH A;  5C4J H;  3NWS A;  2O5J C;  2QW7 A;  3ERS X;  5E4W C;  4A3E G;  4LF6 L;  4OO1 G;  4A3I H;  3OWF A;  3VR3 A;  3QB3 A;  2XRS D;  2NZ1 D;  2I5M X;  1KLG D;  2WP8 J;  4A3K H;  2UUA Q;  2RDG A;  4DUZ Q;  1B8A A;  1L1O A;  2F0F A;  3HEJ A;  2B2U A;  4KHZ A;  3L7Z C;  3S24 A;  3PCO B;  2L9H A;  4CDD C;  3H0G G;  4QF4 A;  2NVQ B;  1WYD A;  4LUZ A;  1JC7 A;  4ZLT F;  2PMZ B;  4G7H C;  1HTP A;  3PO3 B;  3GV6 A;  3R93 A;  3GP7 A;  3CW2 C;  3BDO A;  2DUD A;  4F7X A;  1LTG D;  3V2T A;  3TP5 A;  1M90 C;  4I65 A;  1YJN A;  1S72 A;  4NXN Q;  4A3D G;  2K5H A;  4QMG A;  4PV1 C;  1L1O C;  2B2U C;  1HFG A;  1WTX A;  2J4X A;  2L15 A;  4BS9 A;  4BBS G;  4DV6 L;  4A3E B;  1JOQ A;  4FYD A;  1V1P A;  3S14 B;  5D3I B;  5C3E G;  4YCW A;  4CDC C;  4RGN A;  5EGT A;  2QCP X;  3HOU G;  1A6X A;  1ZEQ X;  3H0G B;  4GNX A;  4L5S A;  3OIP A;  1HA6 A;  4H7B A;  1QJO A;  3OMG A;  1RCV D;  4B9X A;  5FO7 B;  5CBA E;  4HSV A;  3U4Z A;  1Q8K A;  4BBR G;  2N78 A;  1VQC A;  3CCJ A;  1EIY B;  4YWM A;  1EY0 A;  3T1H L;  2EJM A;  1TS4 A;  4IN3 A;  4A3D B;  1FR3 A;  3QOJ A;  3BZD B;  3NTH A;  1Y14 B;  2CW0 D;  4GKK Q;  5LL6 X;  3PIO 3;  2IX1 A;  4H13 C;  4GNX C;  1LT4 D;  2A69 C;  1SYC A;  5C3E B;  3N52 A;  4N8F A;  4OGQ C;  5K36 H;  2MUY A;  2D9U A;  3HOU B;  4DUZ L;  2CKZ B;  1VQ6 A;  4YCV A;  1TY0 A;  1IL2 A;  2CQA A;  3HOY B;  1DD2 A;  3W1G A;  3K7A H;  4X66 Q;  4ALP A;  2QKI C;  4NPS A;  3PSI A;  1QWY A;  1KDB A;  4PMC A;  3EFX D;  1BBU A;  2ZJP A;  1K8M A;  1OO9 B;  3BVM A;  4J6H A;  5A2Q E;  2XSC A;  4APV A;  5IGC A;  3PO2 B;  1U5K A;  1TU2 B;  3HOW G;  4EGV A;  4NXN L;  1IW7 C;  1IHZ A;  4QCL A;  2HD3 A;  1DOL A;  3UDI A;  4A3G H;  2NVY H;  1TS3 A;  3CRK C;  3DWA A;  1YEZ A;  2QA4 A;  4QIW E;  2QGQ A;  3ULL A;  4G7Z C;  2DGY A;  3CMA A;  2EXD A;  4K2K A;  2LY7 A;  3DEO A;  4AH6 A;  2IHF A;  5I6W A;  1SLJ A;  2C5C A;  4JI8 L;  3S17 B;  3GTG H;  1PH7 A;  4KMU C;  1KIX A;  1RF2 D;  2UU9 Q;  1A3T A;  5E7N A;  4GS3 A;  4ZKC B;  4A3F H;  3GTL H;  3M4Q A;  1A2T A;  3OTO L;  3CF5 A;  1GOZ A;  3HOW B;  3ITP A;  1QUQ B;  2NN6 I;  2R6G A;  1CM9 A;  1PRT B;  2VQF Q;  4EVO A;  1SSO A;  1BQQ T;  5EKI A;  4GKK L;  4K0K Q;  4RG1 A;  5EAY A;  3QO2 A;  1BR9 A;  4A3B H;  3AFQ A;  4K5X A;  1XYI A;  1GVP A;  1TT2 A;  1STH A;  4EQ5 A;  3UDG A;  5E3F A;  1G6P A;  2BA0 A;  2JSO A;  2K1B A;  1V1Q A;  3TZU A;  2R93 H;  1MJE A;  4A93 B;  1HR0 W;  3CCM A;  3GQB A;  3HKZ E;  1PH1 A;  1E2W A;  3A54 A;  1H9M A;  1RD9 D;  1N36 Q;  4IUQ A;  1D7Q A;  4P75 A;  4ZUJ A;  2K5Q A;  4DV5 L;  4X62 Q;  3R8B A;  4A75 A;  3X3M A;  1HNX Q;  2VL6 A;  4WJW A;  4P2C B;  4ZAI A;  3GDE A;  1X54 A;  3ER0 A;  4ZCK A;  2NB0 A;  2PNR C;  3I73 A;  1PTO C;  4Y7N H;  4LFC L;  1X3Q A;  3L9A X;  3IRB A;  1I3Q H;  1VS0 A;  4F88 A;  1AE2 A;  1BDO A;  3EJI A;  2K28 A;  3BG3 A;  3MC0 B;  4KI0 A;  4KLK A;  4IUN A;  5JJL A;  4HJ8 A;  4KY6 A;  2H4O A;  3M85 A;  1EOT A;  1SFO H;  1XMQ L;  3O13 A;  1HNZ Q;  5CV5 A;  5JJI A;  4ULL A;  3H3V I;  2UU9 L;  3RUZ A;  5IYB G;  1UEA B;  5IT9 L;  3NEN A;  1SYE A;  4LF5 Q;  3KF6 B;  3S1Q B;  2E2J B;  2XWB B;  4HID A;  4M1U B;  1PYB A;  4NKL A;  1NUC A;  4K5W A;  4CGY B;  2Z9H A;  2B63 G;  4XYO A;  3BJU A;  2D62 A;  4TVA B;  3F2B A;  4RHS A;  2QEJ C;  2RHS B;  5COR A;  3CC7 A;  3BYT B;  1B53 A;  2JA8 H;  2HIV A;  1U4L A;  2Q2H A;  2XRQ D;  1UE7 A;  2RCF A;  2L0C A;  2V1C C;  3AEV A;  1EEI D;  1NY4 A;  3HOZ H;  3E5S A;  1KDC A;  1F2Y A;  2KED A;  1UE6 A;  3HOY H;  1VQN A;  2EJG C;  1I50 H;  1D8L A;  1TWA H;  1Q7Y C;  3L3O C;  1L0Y B;  4DFA A;  4MTN A;  1HNX L;  1PRT C;  3CQZ B;  3PO2 H;  4OL7 A;  1D1K A;  5D3D A;  5I4D A;  1E1O A;  2CWA A;  2K14 A;  3I4M G;  2K32 A;  4BXX G;  1JOK A;  4FF1 A;  4C3I G;  4ABN A;  5KYL A;  1PFM A;  1DXM A;  1SYF A;  2ENB A;  1GUO A;  3BZC A;  4M8A A;  4X65 Q;  3UI2 A;  3F2C A;  2ZM6 Q;  3I4N G;  4LW1 A;  1ASY A;  3C3L A;  1ICW A;  2IW3 A;  3RMH A;  1I4P A;  3LNN A;  1K28 A;  3OWE B;  1NMF A;  4V0B A;  3S1N B;  5EQ0 A;  3CCS A;  3U9O A;  1B1Z A;  4HR7 B;  4DV7 Q;  2HHH Q;  3X3N A;  4NB3 A;  4JV5 Q;  2WB1 G;  4CKC A;  1IBK Q;  1JWM D;  1Y8O B;  2WAQ B;  3A56 A;  2F0H A;  2F0G A;  4DKA C;  2EZV A;  2KVM A;  1D5Z C;  4XIG S;  1G2S A;  2B29 A;  2F52 A;  5IYC G;  2BOS A;  1JJ2 A;  2R7D A;  3IL8 A;  3TP7 A;  3KF6 A;  3HG9 A;  4E6I A;  5FJ8 G;  3D4R A;  2PCF B;  2XWJ B;  4DV3 Q;  4CKB A;  3I4N B;  2K7V A;  3NEM A;  1AEX A;  1PH5 A;  4AYB E;  4UPA A;  2L11 A;  4PG3 A;  1DGS A;  1ENC A;  2QDB A;  1KNE A;  4JK1 C;  1YNJ D;  4DV4 L;  1G6Z A;  4LF9 Q;  2WB1 B;  2L12 A;  1IL8 A;  3U4V A;  4JI3 Q;  4HMI A;  4NMZ A;  3C46 A;  2EYM A;  1KDA A;  2Y0S E;  2VUM H;  2B39 A;  4A3I G;  3I91 A;  3CD6 A;  2RKS A;  1VQI A;  4DR6 Q;  3CXC A;  1PHJ A;  3MXG A;  4A3K G;  2FMM A;  1SAP A;  2BE5 C;  4UP7 A;  1EQT A;  1QVF A;  4JI2 Q;  5ELE A;  2K33 A;  5M3F H;  1EY8 A;  2BCO A;  4PQX A;  2ZM6 L;  2E5L Q;  1E22 A;  2F4V Q;  3J7A F;  2F0O A;  1IKM A;  5CR3 A;  1XJV A;  1KL9 A;  5HY6 A;  2BDN A;  2ZTD A;  3HFZ B;  1SNO A;  4HN7 A;  3JAM L;  1EZ6 A;  3EBE A;  5CV7 A;  3KJO A;  2HHH L;  5C4J B;  4XYQ A;  1SBB B;  1Q46 A;  3DM1 A;  1IBK L;  5T1G A;  4A3C H;  1SE8 A;  1A62 A;  3V05 A;  5IP7 H;  2JJQ A;  2FHT A;  1R4Q B;  4A3I B;  2CH4 W;  4JW0 A;  1Z9F A;  1FD7 D;  4DU9 A;  4B9W A;  1HZ9 A;  4A3K B;  1PMR A;  1XTC D;  1J9O A;  3D6C A;  2BH2 A;  5CBE E;  1S5E D;  1K8G A;  4DR2 Q;  1EYA A;  3F1Z A;  3MTS A;  1GUW A;  4O0A A;  4YWK A;  4QY7 A;  5K5P A;  1Y1W H;  2WFW A;  5ELD A;  2A68 C;  4KKU A;  3Q22 A;  4G57 A;  3U58 A;  3G6E A;  1BUV T;  1NTG A;  5M5X H;  3K8A A;  5IYD G;  1EWC A;  2K4K A;  3FMC A;  1W6K A;  3S9W A;  1ASZ A;  4QQB X;  1TWH H;  4RCN A;  4ZUI A;  2KCT A;  4LF9 L;  1EU4 A;  1RIP A;  5ISR A;  2QIL A;  4FDB A;  4IJH A;  4OO1 I;  5ELB A;  3HOX H;  3D6W A;  2ALY B;  4JI3 L;  4BY1 H;  2AMC B;  3FDT A;  2GVA A;  2L55 A;  5LMN Q;  1H9R A;  3EIV A;  3TRE A;  4XTC S;  2Z4H A;  1X6O A;  5K36 G;  3HRZ C;  4L63 B;  2F0N A;  4KY7 A;  1DON A;  3RLN A;  1N32 L;  2XVS A;  2K01 A;  4HSP A;  2K52 A;  2Q8R E;  2RSO A;  3MFG A;  2YU9 H;  2L1B A;  5IOC A;  3QJY A;  4Y52 H;  1NSN S;  1R4P B;  5KGU A;  1VQM A;  3CPF A;  2E5L L;  2F4V L;  3CCE A;  4OEM B;  4DPG A;  2WIN B;  2AWO A;  4K14 A;  1EOV A;  5IGE A;  1MBY A;  1LTT D;  1BBW A;  1YNX A;  2EYJ A;  4LF7 Q;  1PYS B;  5COY A;  1PZK D;  4B3M L;  3LWE A;  3K5M A;  5FOB B;  1ZYR D;  2F0D A;  2HCI A;  4B3S Q;  4KHP Q;  2J7Z A;  1X32 A;  3NK9 A;  1C8C A;  4A3G G;  1YBY A;  2AQ3 B;  4ID6 A;  1GO3 E;  1NE3 A;  5M3M H;  3OW2 A;  1SRU A;  2EYO A;  1PTO D;  2BDO A;  4CJ1 B;  1LUZ A;  1CT1 D;  2NWG A;  1VQL A;  2F0S A;  4DR4 Q;  1HFN A;  4DR2 L;  2JYO A;  3K7A B;  1K0R A;  4JC0 A;  4PZ8 A;  2QDL A;  3GV3 A;  1CSP A;  1U9R A;  2FJ2 A;  5D65 A;  4IOC A;  4BY7 G;  4IUU A;  1SE3 A;  1PZJ D;  4GOP A;  3DUZ A;  4MN3 A;  2EJF C;  3TME A;  1U4M A;  5JPM C;  1A0I A;  4QGU A;  4A3F G;  2FIN B;  1B44 D;  1T5E A;  1QZG A;  3I70 A;  3NWT A;  1F9R A;  4LFA L;  4PZ6 A;  4A3G B;  2NVY B;  1HZB A;  2JA5 H;  3STB C;  1EQV A;  5M5W H;  2UUC Q;  4PMB A;  5LMN L;  3A8I E;  4R8N A;  3KBG A;  1Q81 C;  4A3B G;  2B2T A;  2F0Q A;  3QWN A;  4GOP C;  4HIM A;  4EX5 A;  2XGT A;  2E2H H;  1JT8 A;  3BS1 A;  1CQF A;  1N33 L;  2F0K A;  4XT3 B;  3R3O A;  2R93 G;  1AFP A;  4Q5V A;  3R2I A;  1NR4 A;  5KNB A;  1PFB A;  2NTT A;  1GXD C;  3FVQ A;  3NUC A;  1SXT A;  1XX8 A;  3CPW A;  3GTG B;  1IZ6 A;  1Q8I A;  3J80 L;  1QCB D;  4LJZ C;  4DAV A;  4L8J A;  1A2U A;  4UP9 A;  4A3F B;  3GTL B;  1AN8 A;  3LWU A;  4GKJ Q;  4RA8 A;  2PQA B;  3PO3 G;  2B2T C;  5CC4 A;  2F1M A;  3S16 H;  1B2T A;  1LTL A;  1BCP C;  4YY3 Q;  3SXH A;  1E2Z A;  2VQE Q;  4A3B B;  5EKK A;  5C6A A;  3SK8 A;  4G7O C;  2UXD Q;  3NP8 A;  2F0E A;  3T56 B;  1Q82 C;  2GN5 A;  1SDF A;  4JI5 Q;  1JWU D;  4LF4 L;  1CI3 M;  3Q6S A;  3CCL A;  4DR4 L;  5ELO A;  4OWT B;  1WTR A;  2R93 B;  1J8I A;  1TS2 A;  4IZ8 A;  1BOS A;  1Y1V H;  5I9P A;  4LFB Q;  1XNR Q;  1ENA A;  5I2X A;  1VQH A;  1E7Z A;  2AQ1 B;  2N55 A;  3SR1 A;  1H9S A;  4UAI A;  2A6E C;  3Q24 A;  5IT9 E;  2JXM B;  1HHV A;  1CA5 A;  3ERQ A;  1EYC A;  1MJC A;  2E75 C;  2IPK D;  1WD1 A;  1EWI A;  3K57 A;  2R61 A;  3H6M A;  2EOT A;  3F2D A;  5M9O A;  3HS0 C;  1EWH A;  4FXD A;  2UUC L;  3A8J E;  4LMQ D;  5FLX L;  1VQE A;  4GLA C;  5KIX A;  4Y7N B;  1ENF A;  3RR5 A;  1B3A A;  3CCR A;  4OX9 Q;  3S1M H;  4XDX A;  4F87 A;  4KN4 C;  1I3Q B;  3GTQ B;  2P5Z X;  1EY4 A;  5DLQ E;  4A3M H;  3HOV H;  1XMO Q;  1UWV A;  3HOZ G;  1I5F A;  2B3G A;  3KDF B;  3HOY G;  3ICE A;  5BN5 A;  1SFO B;  1J5E Q;  2VY3 A;  5GAH C;  2E2D C;  2BH8 A;  3OSO A;  3G7L A;  2EY5 A;  3CP0 A;  4GKJ L;  5HGQ A;  4RKB A;  4OIK A;  1T5X D;  1MI2 A;  1UEB A;  2F0P A;  3CAM A;  2PI2 A;  3PO2 G;  2UXB Q;  5GAD C;  3WOF A;  1PH4 A;  3TSS A;  1O80 A;  1EFW A;  3UDX A;  4R4O A;  2VQE L;  5C0X I;  2LXJ A;  2UXD L;  3CC2 A;  2VNU D;  2SOB A;  4JBW A;  1JJC B;  2F0I A;  1GUN A;  3I2Z A;  4JI5 L;  2JA8 B;  1KC8 C;  1D6E C;  4L5R C;  3A0J A;  4R9W A;  1I4Q A;  2UUA L;  1LT6 D;  5KRU A;  1FJG Q;  3HOZ B;  3RLF A;  5E4X A;  2NZH A;  3W2D A;  1V1O A;  2EY1 A;  2PZW A;  2ZXO A;  4LFB L;  4JCV E;  3K0X A;  3RN5 A;  1NJI C;  1LM0 A;  3DEP A;  1I50 B;  2MHV A;  1VQJ A;  1TWA B;  3E0J A;  5TSS A;  1S5D D;  2OXP A;  2TMP A;  1EIF A;  2IL8 A;  1JJG A;  1X3F A;  2AKW B;  2A6H D;  3NTK A;  2IJ0 A;  2EY2 A;  5IIF A;  1VF5 C;  1E0B A;  1ET9 A;  1O7Z A;  2O4X A;  3OPO A;  3KK7 A;  3NBI A;  1KQS A;  1FGU A;  3TS2 A;  2E76 C;  3E6Z X;  4CKE A;  3J7Y W;  1O7L A;  3T16 A;  3K58 A;  1HRJ A;  1HA5 A;  4QJF A;  2K5N A;  5C4X B;  5EPK A;  1FL0 A;  5EPL A;  2F0J A;  3MHB A;  1STG A;  3GTJ H;  2NVX H;  1ML0 D;  3SK5 A;  1SMY C;  1PLF A;  2KEC A;  4WRD A;  2KEN A;  1SR3 A;  4A4I A;  1EIH A;  3Q8D A;  3R2T A;  1YHA A;  3T4A C;  4A93 G;  1J5E L;  1EQR A;  2JP1 A;  3I56 A;  2Z6K A;  4RGT A;  4FVM A;  4RMF A;  1Q1E A;  2Q8I B;  3KDF A;  2Z6B A;  1TWG H;  2I5L X;  4RKL A;  1SNP A;  2ICI A;  3T1Y Q;  4WFN 3;  3AFP A;  2Z1C A;  1CQV A;  4POG A;  4BWG B;  3A7L A;  4FF4 A;  4KKS A;  2NTS A;  5KYI A;  1N34 Q;  3D4D A;  1DOK A;  2G9D A;  3FKI H;  1ICF B;  2Z6K C;  5M3F G;  1NCV A;  1EUJ A;  1K9M C;  4GZY C;  2RDH A;  3PUY A;  3SHL A;  1WJJ A;  4X66 L;  5HGT A;  3JAM E;  1LTI D;  5DNF A;  3NPP A;  1H9K A;  4B3R Q;  4DK6 C;  1I4H A;  4IAL A;  2L4N A;  1N9W A;  5ELF A;  4DV0 Q;  3PQI A;  2KOL A;  3PF5 A;  2PW7 A;  1II3 A;  1CTM A;  2YV5 A;  1Y8P B;  2GVB A;  4RGM A;  4YHH Q;  4NW2 A;  3FRP B;  4A3C G;  1UE1 A;  5IP7 G;  4JVZ A;  3G71 A;  1YZ6 A;  2VUM B;  1EEF D;  3HGB A;  1X3G A;  3ZJY C;  4V19 0;  1IYV A;  3KLS A;  4OON A;  1DZ1 A;  2K03 A;  3NXW A;  5M3F B;  1DOM A;  1Y1W G;  2E8G A;  3A5U A;  1GHJ A;  4DXG A;  3MXU A;  2PI2 E;  3GTQ H;  1G8Z D;  2KHS A;  4ZKB B;  2KCM A;  1M4V A;  3I8Z A;  1F2Z A;  5BR8 Q;  2IWH A;  4DAM A;  1QVG A;  2OTL A;  1SE4 A;  2FFK B;  1ZXT A;  4P74 A;  3TDQ A;  1BF4 A;  3J81 c;  2IY5 B;  1HCZ A;  1MKH A;  2M00 A;  3STB D;  3HOX G;  4CBV A;  1G91 A;  4KJO A;  2N88 A;  4DV1 Q;  5JVG 3;  2LS0 1;  3ND9 A;  1ZKO A;  4DV2 Q;  2VQF L;  4AIM A;  5T1I A;  2RCN A;  3RN2 A;  2OTJ A;  2KHI A;  1LTS D;  1IKL A;  1VCI A;  4K0K L;  1P8L A;  3M3Y B;  5LL6 S;  3SEB A;  1N34 L;  1SN8 A;  4OHJ A;  1QUQ A;  1Y1W B;  5FO8 B;  2ES2 A;  4TQU S;  4C1N K;  3D8G A;  4JYA Q;  3W5O A;  3QG1 A;  5M5X B;  4ZYS A;  1K3R A;  1IXR A;  1ONL A;  1VQ9 A;  3U50 C;  1D1I A;  2PMZ E;  1VQK A;  4DR3 Q;  1TWH B;  3T53 B;  2MFI A;  5CGK A;  2EVB A;  4JI0 Q;  3H94 A;  1Q12 A;  2LKV A;  3IFT A;  1MSG A;  3WDN A;  1N36 L;  3HOX B;  1H95 A;  1VQA A;  4BY1 B;  1JMC A;  1E3P A;  4HAE A;  4X62 L;  1X56 A;  3KLS X;  2WAQ G;  1OTC A;  1S3O A;  2JA7 H;  5M3M G;  4DK0 A;  2E2I B;  3NTI A;  2EXZ A;  1EQQ A;  1RL2 A;  4DR7 Q;  1VQ7 A;  3A55 A;  1XTD A;  1GUT A;  1WCM H;  2LSS A;  2OT2 A;  3DM3 A;  3AB9 A;  4CHT B;  4KV6 A;  3KLR A;  3VYT A;  2YU9 B;  4R4I A;  2PQE A;  2RSN A;  4FO2 A;  5C4X H;  1N8R C;  3FP9 A;  4FNF A;  2G9H D;  2D0P A;  4H02 A;  4ODG A;  1BBX C;  2PYK A;  3RZO H;  1RHP A;  4RWS C;  4YWL A;  2SEB D;  2A6E D;  1B7Y B;  1O7I A;  1PFN A;  2JEB I;  4O42 A;  2JA6 B;  5BR8 L;  1KRS A;  1G51 A;  2N49 A;  4RGO S;  3K6O A;  1C48 A;  1LLR D;  2JE6 I;  1WTV A;  1HNZ L;  2XNA C;  2K75 A;  4TKO B;  3MEH A;  1SNM A;  1HQM C;  1Q86 C;  2Z0S A;  2JA5 G;  3K81 C;  1PYW D;  4DV1 L;  2H5X A;  5M3M B;  4IPC A;  4LF5 L;  1DJR D;  2B2V A;  4J15 A;  1L0X B;  3DXJ C;  2F3W A;  2K05 A;  4DF7 A;  2EYF A;  3TN2 A;  1M8A A;  2XN9 C;  3KOJ A;  1BXT A;  2AWN A;  1DCZ A;  4X3S A;  4KN7 C;  3VA5 A;  1F9S A;  4FP5 D;  2WKD A;  4JYA L;  3UDF A;  3PUZ A;  4X3K A;  4IUP A;  5A2Q L;  1XWE A;  5I6Y A;  3D4W A;  2HT1 A;  4FF2 A;  1GUS A;  4DR3 L;  3SVM A;  1PH6 A;  1PTO F;  5C4H A;  4JI0 L;  1MD2 D;  3KLW A;  2B2V C;  3J81 E;  1HXY D;  1Q3L A;  1Z7T A;  4QUC A;  1K83 H;  1QNU A;  1VQO A;  1MSH A;  2JA5 B;  5BN3 A;  3CCQ A;  1R9T H;  5M5W B;  1GHK A;  3K5L A;  4FF3 A;  4LAA A;  2A69 D;  1GJX A;  3G6J B;  2DJG C;  4ZRZ A;  4JI6 Q;  5IGD A;  2NYZ D;  2E2H B;  4DR7 L;  5C0X J;  1I6V C;  1D5M C;  2F0V A;  3J7Z C;  3EN2 A;  4L6T B;  1V43 A;  4RFB A;  1Y1V G;  2VB3 X;  3MZ5 A;  4X65 L;  3F2U A;  1E1T A;  1VQF A;  3GO5 A;  2LXK A;  4IO9 A;  2KBN A;  1GM5 A;  4DK3 C;  3T51 B;  3I72 A;  3G4S A; 
#chains in the Genus database with same CATH homology
 5NUC A;  1JR0 D;  3S16 B;  4EQN A;  5EPJ A;  1LT5 D;  3MAQ A;  1IW7 D;  2CW0 C;  5JPN C;  5C4Z A;  4K5V A;  5FLX E;  4IFD I;  2K6A A;  2CVR A;  2Q8T A;  3M7N A;  1Y1V B;  2IT1 A;  2DNC A;  1RTN A;  1JWS D;  2X6L A;  3Q0A A;  2MPM A;  1CHQ D;  4DA2 A;  2EE1 A;  3M7G A;  4H44 C;  5C5L A;  1ROD A;  1CHP D;  1AZP A;  5I2Y A;  5C0X H;  4YIJ A;  3S1M B;  1KAA A;  1ILQ A;  4A3M B;  3HOV B;  4K6L A;  3N6R A;  1LAC A;  3VYS A;  5J39 A;  4U68 A;  1EY7 A;  3P7J A;  2F0M A;  3AMU A;  3CKI B;  1AZQ A;  3ND8 A;  1KTK A;  1FNU A;  4I7Z C;  4H0L C;  1RJT A;  4DGZ A;  1QNK A;  5FKA C;  1DM0 B;  3OMC A;  3I90 A;  4QIW B;  3BDL A;  1DYQ A;  2EYP A;  1HQR D;  2R92 B;  1WVL A;  1UAP A;  4K2L A;  1OXT A;  1F2L A;  3D3R A;  3K59 A;  2RVL A;  5G3L F;  1MGS A;  4QB4 A;  5EBC A;  5KEE A;  2WII B;  2PZU A;  2F0L A;  4G4K A;  5EJW A;  4RCO A;  1FGB D;  1X3P A;  4KHV A;  4R8I A;  4XQJ A;  3T13 A;  1S5F D;  3DWP A;  1Z47 A;  1SJH D;  5ELC A;  2NN6 H;  1I4R A;  4FXG C;  1FNW A;  1U4R A;  5C3X A;  1B4O A;  2VB2 X;  1QOH A;  2XIW A;  2F3V A;  3CHB D;  3GTJ B;  1K8O A;  2NVX B;  2KCC A;  3HKZ B;  2B2W A;  3HP3 A;  2B8F A;  1V1P B;  1ILP A;  2C9O A;  3S2H B;  3MVV A;  1EY9 A;  3A7A B;  3LX0 A;  1ESR A;  1HUN A;  4N9P A;  1PRT D;  1TWG B;  5C44 B;  1VMC A;  1TQO A;  1B9M A;  1QE6 A;  4Q0F A;  1RKN A;  2B2W C;  2X69 A;  1IYU A;  2RDF A;  2SNM A;  4ME5 A;  5FK9 C;  2AUJ D;  2NBF A;  3FKI B;  4ZK9 B;  1WD0 A;  1Q90 A;  2K5W A;  1TVX A;  5KND A;  3VR6 A;  2HDL A;  3QOL A;  2DY8 A;  1JIC A;  3CRL C;  3VYU A;  2HQE A;  1A3V A;  2BA1 A;  5JEA J;  3H09 A;  4KD3 A;  1FYC A;  4MHE A;  2I07 B;  1JE4 A;  3GTK B;  1W6J A;  2PO4 A;  1ESF A;  1HPC A;  4HED A;  5LHY 1;  3URY A;  3U9S A;  1OXU A;  2IX0 A;  1STN A;  1JOR A;  4DN4 M;  5C5M A;  5M5Y B;  1OXV A;  3S2D B;  5F2D A;  1Y8N B;  1VDZ A;  3IKJ A;  4ZQ3 A;  3EVQ A;  5G3L D;  4IUR A;  2MP1 A;  4DXF A;  2OF1 A;  4K8I A;  4BA2 I;  3VR4 A;  2Z4I A;  1WTQ A;  2BE5 D;  5J22 A;  3K5O A;  3C2P A;  3TP6 A;  2DY7 A;  3PUX A;  5JEA H;  3M4Y A;  1YNJ C;  2A73 B;  1S5C D;  4BBS B;  2KJX A;  5IGF A;  4X3T A;  3FPP A;  1EIG A;  4F8M A;  2JA7 B;  1JQY D;  3FPU B;  4HTH A;  1PTO B;  1CZG A;  2WV6 D;  2F4I A;  4DNT B;  3PUW A;  4HCS A;  3VR5 A;  1WCM B;  1S4Z A;  4IFD J;  3GD7 A;  5BN4 A;  4BBR B;  4AYB B;  1BCP F;  4WOR A;  2A68 D;  3RZO B;  1CZW A;  1RTO A;  2PPB C;  2D5D A;  1JB3 A;  1PXU A;  1A15 A;  1YNN C;  3SE0 A;  1VF7 A;  1EZ8 A;  2LFN A;  2Y0S B;  2B2Y A;  2HUG A;  2I46 A;  2VXW A;  4IUV A;  2K04 A;  2SDF A;  1S5B D;  4NP5 A;  1E2V A;  1O78 A;  3KBX A;  3P75 A;  1EL0 A;  2WAC A;  5DEH A;  3NE5 B;  1OXX K;  2F03 A;  2RQX A;  2NUC A;  3H91 A;  2B2Y C;  2MJ8 A;  1BO0 A;  1QG7 A;  4EQP A;  3ONA B;  3VYR A;  4K6D A;  1K83 B;  1SE2 A;  1NAP A;  1SEB D;  1R9T B;  1LT3 D;  5EBD A;  3BDC A;  1EY5 A;  4IFD H;  2DN8 A;  4J1M A;  1KNA A;  4BA1 I;  4CJ0 B;  3DHQ A;  3BYY B;  1EU3 A;  3NBH A;  5IOD A;  1SYD A;  3M4O B;  1HTL D;  3DWQ A;  3J7A V;  3OW7 A;  3S15 B;  1ZYR C;  4U67 3;  4X3U A;  5FO9 B;  1O7Y A;  4OO1 H;  1TY2 A;  4C1N I;  2ICE C;  1LV9 A;  3WOE A;  5C0X G;  4PNY A;  5CV6 A;  5CMD A;  3AU7 A;  3VA7 A;  3K0Y A;  3IAY A;  3RD4 A;  3K5N A;  2CHB D;  2PZT A;  1Z6H A;  4C2M B;  3OIQ A;  1STY A;  4NDX A;  3GTP B;  5CV9 A;  1Q1B A;  1F77 A;  3MA2 B;  1BCP D;  2AQ2 B;  3W3A A;  1I4X A;  4C3J G;  1SYB A;  3QIA A;  1BNZ A;  2NVT B;  1F9Q A;  4J8Q A;  5DM6 3;  1NR2 A;  1PTO H;  5A35 A;  4OIJ A;  4A3J B;  2EYH A;  2V4D A;  5CV4 A;  2F0U A;  3OHX C;  1G2T A;  1AP0 A;  4RAU C;  3NQI A;  3TP8 A;  1WTW A;  4LK1 C;  4TRD A;  5I9O A;  3BVG A;  1V8Q A;  2WKC A;  3Q23 A;  3S1R B;  2F0T A;  4C3J B;  2B63 B;  2NN6 G;  2RA4 A;  1CFM A;  3P20 A;  1CK1 A;  1PZI D;  4DAY A;  4C56 C;  4Z9C B;  5CV8 A;  4XQQ A;  2EPB A;  3NSW A;  3GTM B;  4MIU A;  1D5X C;  5KNC A;  3NQT A;  1EY6 A;  2H1E A;  3RZD B;  1TWC B;  3J80 E;  2KQ3 A;  1Y69 U;  3PIP 3;  2QF7 A;  1STA A;  3SK6 A;  1UUP A;  3I4M B;  5JAV A;  2M9V A;  4C3I B;  3PUV A;  4XXE A;  4KJN A;  2ZXR A;  4RHR A;  3VR2 A;  2DNE A;  3I3C A;  5JJZ A;  4PMW A;  3HZX A;  3GTO B;  1LTA D;  3ERO A;  3PV0 A;  4ILW A;  2L5T A;  2KA7 A;  1LAB A;  2ID0 A;  1B50 A;  2LMC B;  4XT1 B;  4KK7 A;  1D2B A;  4O1N A;  2HCC A;  4KKT A;  5C3W A;  1SND A;  4FXK C;  5EKL A;  4IUT A;  5AFW A;  3CU7 A;  4KTA A;  2EYL A;  1F2M A;  4UDU C;  3SDZ A;  3KUP A;  2J0T D;  3EA6 A;  3V96 A;  2FMC A;  1TWF B;  2O5I C;  4IQZ A;  3C1F A;  2A74 C;  5E1F A;  2MGS A;  1LTR D;  1SMY D;  2GA4 B;  1PRT F;  2R7Z B;  1JCK B;  3TZD A;  5JOB A;  4HMJ A;  1YNN D;  1KLU D;  3BVZ A;  3EQL C;  4QUF A;  3D31 A;  1FNV A;  3I4L A;  2A6H C;  1C4Q A;  3IFD A;  5D14 A;  1TR5 A;  1EFI D;  2EDG A;  4DNR B;  2ZXP A;  2X6G A;  1SYG A;  1QB5 D;  2KEE A;  1JOO A;  5JEA G;  1I6H B;  3FEW X;  2PW5 A;  3KF8 A;  3MWY W;  4RH6 A;  1A3U A;  1BCP B;  1AW7 A;  1SNQ A;  2TSS A;  2K5D A;  2RBM A;  1B9N A;  1HUM A;  3MXN A;  3A8K E;  2KCN A;  4KD4 A;  4KY5 A;  4K8J A;  1KAB A;  1XXG A;  5HUR A;  1STB A;  2D2C C;  5JVH 3;  2F0W A;  1GUG A;  1TII D;  2SNS A;  2M2L A;  4C3H G;  1G29 1;  2YYZ A;  5IGG A;  3DMU A;  1WTO A;  1U4P A;  2Z8L A;  3MFY A;  3ZYY X;  2IX3 A;  4XQN A;  2OEO A;  1H9J A;  3MXP A;  2KUM A;  4CJ2 C;  2O2L D;  4N9T A;  1SJE D;  1LTB D;  1F9P A;  1QIL A;  1H9S B;  1I4G A;  4B08 A;  4EQO A;  1SNC A;  1STE A;  2AUK A;  4C3H B;  1UNS A;  3OOC A;  3P1H A;  2R3Z A;  1TKW B;  1LO5 D;  1OXS C;  2ZT9 C;  3H3V C;  1CA6 A;  2EY6 A;  1WTP A;  1TS5 A;  5CYU A;  5IGB A;  4DAP A;  1ET6 A;  4IFD G;  5J1Z A;  1EYD A;  2E74 C;  4DK1 A;  3PMF A;  3SK4 A;  4TSS A;  4BY7 B;  2HDM A;  1PDQ A;  4HCE A;  2A5H A;  3TBI B;  5DM7 3;  5DAU A;  1RDP D;  2B8G A;  1VMP A;  3J81 L;  3C1E A;  4S3S A;  2JEA I;  3NHH A;  3NWS A;  2O5J C;  5E4W C;  4OO1 G;  3OWF A;  3VR3 A;  3QB3 A;  2XRS D;  2NZ1 D;  1KLG D;  2WP8 J;  2RDG A;  4KHZ A;  2F0F A;  3HEJ A;  2B2U A;  3L7Z C;  2L9H A;  4QF4 A;  2NVQ B;  1JC7 A;  4ZLT F;  2PMZ B;  4G7H C;  1HTP A;  3PO3 B;  3GV6 A;  3R93 A;  3GP7 A;  3BDO A;  4F7X A;  1LTG D;  3V2T A;  3TP5 A;  4I65 A;  4QMG A;  4PV1 C;  2B2U C;  1HFG A;  1WTX A;  2J4X A;  4BS9 A;  4A3E B;  1JOQ A;  4FYD A;  1V1P A;  3S14 B;  5D3I B;  4RGN A;  5EGT A;  2QCP X;  1A6X A;  1ZEQ X;  3H0G B;  3OIP A;  1HA6 A;  4H7B A;  1QJO A;  3OMG A;  1RCV D;  4B9X A;  5FO7 B;  5CBA E;  4HSV A;  1EY0 A;  2EJM A;  1TS4 A;  4IN3 A;  4A3D B;  1FR3 A;  3QOJ A;  3BZD B;  3NTH A;  2CW0 D;  5LL6 X;  3PIO 3;  2IX1 A;  4H13 C;  1LT4 D;  2A69 C;  1SYC A;  5C3E B;  3N52 A;  4OGQ C;  5K36 H;  2MUY A;  2D9U A;  3HOU B;  1TY0 A;  2CQA A;  3HOY B;  1DD2 A;  2QKI C;  1QWY A;  1KDB A;  4PMC A;  3EFX D;  1K8M A;  1OO9 B;  3BVM A;  4J6H A;  5A2Q E;  2XSC A;  5IGC A;  3PO2 B;  1TU2 B;  4EGV A;  1IW7 C;  1IHZ A;  4QCL A;  1DOL A;  1TS3 A;  3CRK C;  3DWA A;  4G7Z C;  4K2K A;  2LY7 A;  3DEO A;  5I6W A;  2C5C A;  3S17 B;  4KMU C;  1RF2 D;  1A3T A;  4ZKC B;  1A2T A;  1GOZ A;  3HOW B;  3ITP A;  2NN6 I;  2R6G A;  1CM9 A;  1PRT B;  4EVO A;  1SSO A;  1BQQ T;  5EKI A;  3QO2 A;  1BR9 A;  4K5X A;  1XYI A;  1TT2 A;  1STH A;  5E3F A;  2BA0 A;  2JSO A;  2K1B A;  3TZU A;  4A93 B;  3GQB A;  1E2W A;  3A54 A;  1H9M A;  1RD9 D;  4IUQ A;  4ZUJ A;  2K5Q A;  3R8B A;  3X3M A;  4WJW A;  4P2C B;  4ZAI A;  2NB0 A;  2PNR C;  3I73 A;  1PTO C;  1X3Q A;  3L9A X;  4F88 A;  1BDO A;  3EJI A;  2K28 A;  3BG3 A;  3MC0 B;  4KI0 A;  4IUN A;  4KY6 A;  2H4O A;  3M85 A;  1EOT A;  3O13 A;  5CV5 A;  4ULL A;  3RUZ A;  1UEA B;  5IT9 L;  1SYE A;  3S1Q B;  2E2J B;  2XWB B;  4M1U B;  4NKL A;  1NUC A;  4K5W A;  4CGY B;  4XYO A;  2D62 A;  4RHS A;  2QEJ C;  5COR A;  3BYT B;  1B53 A;  1U4L A;  2XRQ D;  2L0C A;  1EEI D;  3E5S A;  1KDC A;  1F2Y A;  2KED A;  2EJG C;  3L3O C;  1L0Y B;  4DFA A;  1PRT C;  3CQZ B;  4OL7 A;  1D1K A;  5D3D A;  5I4D A;  2K32 A;  1JOK A;  4FF1 A;  4C3I G;  4ABN A;  5KYL A;  1PFM A;  1DXM A;  1SYF A;  2ENB A;  1GUO A;  4M8A A;  3UI2 A;  3C3L A;  1ICW A;  2IW3 A;  3RMH A;  1I4P A;  3LNN A;  3OWE B;  4V0B A;  3S1N B;  5EQ0 A;  3U9O A;  1B1Z A;  4HR7 B;  3X3N A;  4CKC A;  1JWM D;  1Y8O B;  2WAQ B;  3A56 A;  2F0H A;  2F0G A;  2EZV A;  2KVM A;  1D5Z C;  4XIG S;  1G2S A;  2BOS A;  3IL8 A;  3TP7 A;  3HG9 A;  4E6I A;  3D4R A;  2PCF B;  2XWJ B;  4CKB A;  3I4N B;  2K7V A;  1AEX A;  2L11 A;  1ENC A;  2QDB A;  1KNE A;  4JK1 C;  1YNJ D;  1G6Z A;  2WB1 B;  2L12 A;  1IL8 A;  4HMI A;  4NMZ A;  3C46 A;  2EYM A;  1KDA A;  2B39 A;  3I91 A;  2RKS A;  3MXG A;  2FMM A;  1SAP A;  2BE5 C;  1EQT A;  5ELE A;  2K33 A;  1EY8 A;  2BCO A;  4PQX A;  3J7A F;  2F0O A;  1IKM A;  5CR3 A;  2BDN A;  1SNO A;  4HN7 A;  3JAM L;  1EZ6 A;  5CV7 A;  5C4J B;  4XYQ A;  1SBB B;  3DM1 A;  5T1G A;  3V05 A;  2FHT A;  1R4Q B;  4A3I B;  1FD7 D;  4DU9 A;  4B9W A;  4A3K B;  1PMR A;  1XTC D;  1J9O A;  3D6C A;  5CBE E;  1S5E D;  1EYA A;  1GUW A;  3MTS A;  5K5P A;  5ELD A;  2A68 C;  4KKU A;  3Q22 A;  4G57 A;  1BUV T;  1EWC A;  3FMC A;  1W6K A;  3S9W A;  4RCN A;  4ZUI A;  1EU4 A;  5ISR A;  2QIL A;  4OO1 I;  5ELB A;  3D6W A;  3FDT A;  2L55 A;  1H9R A;  4XTC S;  2Z4H A;  5K36 G;  3HRZ C;  4L63 B;  2F0N A;  4KY7 A;  1DON A;  2XVS A;  2K01 A;  4HSP A;  2Q8R E;  2RSO A;  3MFG A;  2L1B A;  5IOC A;  3QJY A;  1NSN S;  1R4P B;  5KGU A;  2WIN B;  2AWO A;  4K14 A;  5IGE A;  1MBY A;  1LTT D;  2EYJ A;  5COY A;  1PZK D;  3LWE A;  3K5M A;  5FOB B;  1ZYR D;  2F0D A;  2HCI A;  2J7Z A;  1X32 A;  3NK9 A;  1C8C A;  2AQ3 B;  4ID6 A;  2EYO A;  1PTO D;  2BDO A;  4CJ1 B;  1CT1 D;  2NWG A;  2F0S A;  1HFN A;  2JYO A;  3K7A B;  3GV3 A;  1U9R A;  2FJ2 A;  5D65 A;  4IUU A;  1SE3 A;  1PZJ D;  3DUZ A;  4MN3 A;  2EJF C;  3TME A;  1U4M A;  5JPM C;  2FIN B;  1B44 D;  1T5E A;  3I70 A;  3NWT A;  1F9R A;  4A3G B;  2NVY B;  1EQV A;  4PMB A;  3A8I E;  4R8N A;  3KBG A;  2B2T A;  2F0Q A;  3QWN A;  3BS1 A;  1CQF A;  2F0K A;  4XT3 B;  3R3O A;  1AFP A;  4Q5V A;  3R2I A;  1NR4 A;  5KNB A;  1PFB A;  2NTT A;  1GXD C;  3FVQ A;  3NUC A;  1SXT A;  1XX8 A;  3GTG B;  1Q8I A;  3J80 L;  1QCB D;  4LJZ C;  4DAV A;  4L8J A;  1A2U A;  4A3F B;  3GTL B;  1AN8 A;  3LWU A;  4RA8 A;  2B2T C;  5CC4 A;  2F1M A;  1B2T A;  1BCP C;  3SXH A;  1E2Z A;  4A3B B;  5EKK A;  5C6A A;  3SK8 A;  4G7O C;  3NP8 A;  2F0E A;  3T56 B;  1SDF A;  1JWU D;  1CI3 M;  3Q6S A;  1WTR A;  2R93 B;  1J8I A;  1TS2 A;  4IZ8 A;  1BOS A;  5I9P A;  1ENA A;  5I2X A;  2AQ1 B;  2N55 A;  3SR1 A;  1H9S A;  4UAI A;  2A6E C;  3Q24 A;  5IT9 E;  2JXM B;  1HHV A;  1CA5 A;  3ERQ A;  1EYC A;  2E75 C;  2IPK D;  1WD1 A;  3K57 A;  2R61 A;  3H6M A;  2EOT A;  5M9O A;  3HS0 C;  1EWH A;  4FXD A;  3A8J E;  4LMQ D;  5FLX L;  5KIX A;  4Y7N B;  1ENF A;  1B3A A;  4XDX A;  4F87 A;  4KN4 C;  1I3Q B;  3GTQ B;  1EY4 A;  5BN5 A;  1SFO B;  2E2D C;  3OSO A;  3G7L A;  2EY5 A;  4RKB A;  4OIK A;  1T5X D;  1MI2 A;  2F0P A;  3WOF A;  3TSS A;  1O80 A;  5C0X I;  2VNU D;  2SOB A;  4JBW A;  2F0I A;  1GUN A;  2JA8 B;  1D6E C;  4R9W A;  1I4Q A;  1LT6 D;  5KRU A;  3HOZ B;  3RLF A;  5E4X A;  3W2D A;  1V1O A;  2EY1 A;  2PZW A;  2ZXO A;  3DEP A;  1I50 B;  2MHV A;  1TWA B;  3E0J A;  5TSS A;  1S5D D;  2OXP A;  2TMP A;  2IL8 A;  2A6H D;  3NTK A;  2IJ0 A;  2EY2 A;  5IIF A;  1VF5 C;  1E0B A;  1ET9 A;  1O7Z A;  2O4X A;  3OPO A;  3KK7 A;  3NBI A;  2E76 C;  3E6Z X;  4CKE A;  3J7Y W;  1O7L A;  3T16 A;  3K58 A;  1HRJ A;  1HA5 A;  5C4X B;  5EPK A;  5EPL A;  2F0J A;  3MHB A;  1STG A;  1ML0 D;  3SK5 A;  1SMY C;  1PLF A;  2KEC A;  4WRD A;  1EIH A;  3R2T A;  3T4A C;  2JP1 A;  4RGT A;  4FVM A;  1Q1E A;  2Q8I B;  4RKL A;  1SNP A;  2ICI A;  4WFN 3;  2Z1C A;  1CQV A;  4BWG B;  3A7L A;  4FF4 A;  4KKS A;  2NTS A;  5KYI A;  3D4D A;  1DOK A;  2G9D A;  1NCV A;  4GZY C;  2RDH A;  3PUY A;  3SHL A;  5HGT A;  3JAM E;  1LTI D;  5DNF A;  3NPP A;  1H9K A;  1I4H A;  4IAL A;  2L4N A;  5ELF A;  2KOL A;  2PW7 A;  1II3 A;  1CTM A;  1Y8P B;  4RGM A;  4NW2 A;  3FRP B;  2VUM B;  1EEF D;  3HGB A;  4V19 0;  1IYV A;  3KLS A;  1DZ1 A;  2K03 A;  3NXW A;  5M3F B;  1DOM A;  1GHJ A;  4DXG A;  3MXU A;  1G8Z D;  2KHS A;  4ZKB B;  1M4V A;  3I8Z A;  1F2Z A;  2IWH A;  1SE4 A;  2FFK B;  1ZXT A;  1BF4 A;  3TDQ A;  1HCZ A;  2M00 A;  4CBV A;  1G91 A;  4KJO A;  2N88 A;  5JVG 3;  2LS0 1;  3ND9 A;  1ZKO A;  5T1I A;  1LTS D;  1IKL A;  1VCI A;  3M3Y B;  5LL6 S;  3SEB A;  4OHJ A;  1Y1W B;  5FO8 B;  4TQU S;  4C1N K;  3D8G A;  3QG1 A;  5M5X B;  4ZYS A;  1ONL A;  1D1I A;  1TWH B;  3T53 B;  5CGK A;  2EVB A;  3H94 A;  1Q12 A;  2LKV A;  3IFT A;  1MSG A;  3WDN A;  3HOX B;  4BY1 B;  4HAE A;  3KLS X;  4DK0 A;  2E2I B;  3NTI A;  2EXZ A;  3A55 A;  2OT2 A;  1GUT A;  3AB9 A;  4CHT B;  4KV6 A;  3KLR A;  3VYT A;  2YU9 B;  2PQE A;  2RSN A;  4FO2 A;  4FNF A;  2G9H D;  4ODG A;  1BBX C;  2PYK A;  1RHP A;  4RWS C;  2SEB D;  2A6E D;  1PFN A;  2JEB I;  4O42 A;  2JA6 B;  4RGO S;  3K6O A;  1C48 A;  1LLR D;  2JE6 I;  1WTV A;  2XNA C;  4TKO B;  3MEH A;  1SNM A;  1HQM C;  1PYW D;  5M3M B;  1DJR D;  2B2V A;  1L0X B;  3DXJ C;  2F3W A;  2K05 A;  4DF7 A;  2EYF A;  3TN2 A;  1M8A A;  2XN9 C;  1BXT A;  2AWN A;  1DCZ A;  4X3S A;  4KN7 C;  3VA5 A;  1F9S A;  4FP5 D;  2WKD A;  3PUZ A;  4X3K A;  4IUP A;  5A2Q L;  1XWE A;  5I6Y A;  3D4W A;  4FF2 A;  1GUS A;  3SVM A;  1PTO F;  5C4H A;  1MD2 D;  2B2V C;  3J81 E;  1HXY D;  1Q3L A;  1Z7T A;  4QUC A;  1QNU A;  1MSH A;  2JA5 B;  5BN3 A;  5M5W B;  1GHK A;  3K5L A;  4FF3 A;  4LAA A;  2A69 D;  1GJX A;  3G6J B;  4ZRZ A;  5IGD A;  2NYZ D;  2E2H B;  5C0X J;  1I6V C;  1D5M C;  2F0V A;  4L6T B;  1V43 A;  4RFB A;  2VB3 X;  3MZ5 A;  3F2U A;  3GO5 A;  3T51 B;  3I72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...