2CVRA

Nmr solution structure of sso7d mutant, k12l, 12 conformers
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
62
structure length
62
Chain Sequence
ATVKFKYKGEELQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Determinants Responsible for the Thermostability of Sso7d and its Single Point Mutants
rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein
molecule keywords DNA-binding protein 7a
total genus 3
structure length 62
sequence length 62
ec nomenclature ec 3.1.27.-:
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2cvrA00
3G7LA 1NCVA 5D65A 1WTWA 1CA6A 1J8IA 1RTNA 1F9RA 4R8IA 1F9QA 2IL8A 4DN4M 1G6ZA 2K01A 2B2YC 5CBEE 4IUVA 2HDLA 4ZKBB 3LWEA 1XX8A 2KVMA 2XIWA 2X6GA 4NW2A 2FHTA 1CA5A 3DEOA 1U4LA 2JP1A 4RA8A 4MHEA 1G91A 1B50A 4IURA 1VMPA 1G2TA 4OIJA 4RWSC 5EQ0A 4X3TA 2BDNA 3IL8A 2K03A 1QNKA 1U4RA 2Q8TA 1EL0A 1HRJA 1MGSA 3MWYW 1EOTA 2B2UA 1F9SA 1B4OA 1F2LA 1ML0D 1ICWA 1DOMA 1LV9A 2EE1A 3FDTA 4X3UA 1ZXTA 1JICA 1A15A 2L11A 4ZAIA 4HEDA 2R3ZA 3TZDA 5EJWA 1X3QA 5E4XA 1J9OA 4XT3B 2NWGA 5EPKA 4X3KA 1F9PA 5DNFA 4OIKA 5T1GA 2KOLA 3TN2A 1B2TA 1WTQA 1NR4A 4HCSA 3HP3A 1SAPA 1KNEA 1AZQA 2DY8A 5COYA 5EKIA 3R93A 2H1EA 1WD0A 2FJ2A 5CMDA 2SDFA 1RTOA 3P7JA 4ZK9B 1EQTA 2RA4A 4HSVA 2Q8RE 1B3AA 2HUGA 2KUMA 1EIHA 5E4WC 2B2UC 2FFKB 2RVLA 1DONA 4X3SA 4IUPA 2J7ZA 3F2UA 1PFBA 2HCIA 2FMMA 1DOKA 2JYOA 1QG7A 4IUQA 5AFWA 4ZLTF 1WVLA 2X69A 1HUMA 1SDFA 1CM9A 2MJ8A 2X6LA 3H91A 1WTXA 1PLFA 1RJTA 4XT1B 1HFGA 1XYIA 1WD1A 3UI2A 1IKMA 1SSOA 3GV6A 2N88A 1PFMA 2L9HA 1Q3LA 3MTSA 2K28A 1G2SA 5CBAE 1BF4A 2EOTA 1DOLA 2L1BA 3IFDA 1BO0A 1M8AA 5JJZA 1HA6A 3I91A 3D6WA 1BBXC 4CJ0B 1ILPA 2DY7A 1DZ1A 2CVRA 1QE6A 5T1IA 3KUPA 4O42A 2B2WC 2M2LA 4UAIA 2NZ1D 2L12A 2B2YA 2VXWA 5CORA 4IUTA 1HHVA 2NYZD 1ILQA 1S4ZA 1X32A 4R9WA 3N52A 5EPLA 1B53A 3KBXA 1AP0A 4U68A 1PFNA 2FINB 4CJ1B 1AZPA 1O80A 2K05A 1MI2A 3I3CA 2MP1A 3DEPA 3GV3A 3I8ZA 4RAUC 2D9UA 2MPMA 1RHPA 1RODA 1U4MA 2HCCA 3I90A 3Q6SA 3QO2A 5EPJA 2L4NA 1MSHA 2KEEA 1WTOA 1HUNA 1O7YA 1C8CA 1JE4A 1PDQA 1VMCA 2B2TC 2B2VC 2KECA 4XDXA 4MN3A 1BNZA 1WTVA 1MSGA 1WTPA 2EPBA 1EIGA 2K1BA 2K04A 2KEDA 2MGSA 1ESRA 4QUFA 2HDMA 2RSOA 1HFNA 4IUUA 2N55A 1KNAA 4ZKCB 2B2TA 1X3PA 3FPUB 1IKLA 2B2VA 5D14A 1E0BA 1NR2A 1TVXA 1GUWA 1NAPA 3DM1A 3SVMA 4LMQD 2RSNA 1O7ZA 1U4PA 4QUCA 4CJ2C 1IL8A 3ONAB 4HAEA 1WTRA 2B2WA
chains in the Genus database with same CATH superfamily
3K0XA 3KJOA 1J8IA 2Y0SG 3A7LA 3CCJA 5CBEE 4DKAC 1CQFA 4DV7L 1X9NA 4LK1C 2JP1A 4A3IG 1IZ6A 4KHZA 3V2TA 2AUJD 2LXJA 3GD7A 3HOZG 1JOOA 1RF2D 2R92B 1HPCA 3S1MH 4Y7NB 2J0TD 5JPNC 4ZAIA 4L5TA 4FNFA 1ASYA 3TZDA 1ESFA 1X3QA 5E4XA 3TQYA 2Q2UA 1KNEA 3DWPA 1Q81C 1HQMC 5EBDA 4NPSA 1VQFA 4A3JB 2F52A 3TP6A 3VA7A 1T5EA 1N9WA 3HOXB 5KEEA 2OQ0A 3U58A 3CRKC 5CV8A 2UXBQ 3CW2C 3RZOB 4BWGB 3BJUA 4DAYB 2NVXB 1Y1VG 1KRTA 5JEAJ 4B9XA 1M1KC 1EY4A 2A6HD 3MVVA 4KJOA 2O5JC 3KFUA 2WAQB 3HG9A 4UP7A 1XMOL 4DV5L 5A2QE 5H1SE 1S5ED 2L9HA 3L2PA 4JI7L 1E2VA 1D8LA 1DOLA 2F0WA 5GAGC 5C5MA 5FLMG 3CCRA 4GNXC 3NELA 5FK9C 2AMCB 3J81j 2JA7B 4FXGC 1GKHA 1SMYC 1B53A 4PZ6A 3A55A 4U673 2AHOB 1AZPA 1BOSA 3UDGA 2R93G 1CT1D 1NBWA 4TQUS 1QJOA 4LFBL 1Q1BA 4EQOA 5C4ZA 1OXSC 1SJHD 2B2VC 2F4VL 4KY5A 1A2TA 2JK8A 1FL0A 2VUMH 1VQJA 3CD6A 4QF4A 4DV6L 1WYDA 1E7ZA 4DV2Q 5M5WH 2XRQD 1HR0L 2R7ZB 1IKLA 1L1OB 1SRUA 1JR0D 2NUCA 3C1EA 1EYDA 1GUWA 3OTOL 4TRDA 4QUCA 1YNJC 1Y1WG 2UUAL 3PGZA 1NCVA 1B44D 3ULJA 4CDDC 4KTAA 1F9QA 2K5HA 3HOYB 1YZ6A 1O78A 2GVAA 3LWEA 3OTOQ 4OHJA 2DN8A 3TS2A 1PRTB 4K0KL 5IE8A 5C0XH 2J4XA 1PYBA 1Y1VH 3LGJA 1SBBB 3ULLA 3A7AB 2R93B 4FYDA 4RGTA 2I5HA 3NHHA 3OW7A 1JJ2A 1C7YA 2WINB 2VL6A 2WIIB 1LT6D 4IOAA 1WTQA 4HCSA 5CV6A 2DY8A 1PTOD 1SJED 3CAMA 2Z8LA 3T1HQ 1VQIA 4AIMA 2JA7H 2KUMA 1SEBD 2AUKA 3D6CA 4RHRA 2RQXA 2PI2A 4AYBB 3VDYA 4X3SA 3RLOA 2R7DA 1KD1C 5CV9A 3S2DB 2JYOA 5AFWA 3PO3B 1ET6A 1KQSA 1UEAB 4AQYL 5HY6A 2Y0SB 4HJ7A 1II3A 1ICFB 3H3VH 3C3LA 2QDLA 4XT1B 1EWHA 1FD7D 1XYIA 5I6WA 4DR5L 1VQBA 4RHSA 4DR4Q 3CMAA 2IHEA 5FLXc 2ZM6L 3AMUA 1Q3LA 3RUZA 4BBSG 4B3SL 4DV3L 3M4OB 2BA1A 4K8JA 1SNDA 1D7QA 3CCSA 4PNYA 2NZ1D 1YJNA 1K9MC 1AP0A 1SYGA 5I4DA 1S72A 3NXWA 4GS3A 1O80A 4Q0FA 1CI3M 2OCEA 1U4MA 1O7IA 1MIUA 3A5UA 1CSPA 4H7BA 1H9RA 5BN4A 4DV7Q 3EQLC 4HMJA 3TBIB 4A3FG 1Q7YC 3NWTA 1SNOA 1N36Q 1M90C 4LAAA 2Z4IA 4H0LC 3PUXA 1IBML 3CC7A 4OX9Q 1NE3A 3BYTB 4P73A 2PZTA 2HQLA 2EXDA 3GTPH 1TVXA 4LMQD 1O7ZA 1VQCA 2PCFB 1WTRA 2E2HH 4B08A 4NXNL 4A3CH 2ID0A 4KI0A 4IUVA 4ZKBB 3TRZA 4HSPA 4LUVA 4C3HB 5I2YA 1XMQL 2M9VA 1KDCA 5NUCA 1GXDC 3MXUA 3QOLA 5IGCA 1VMPA 4A3MH 4DR2L 2Q2HA 2QA4A 1NSNS 2R61A 3K5LA 2ZTCA 3AEVA 2R7ZH 2EE1A 3K8AA 4KY7A 5D3IB 1SYCA 1ZXTA 4KK7A 4R4OA 1HNXL 1PH1A 3K7AH 1BBWA 1AZQA 1Q46A 4RGMA 1UE1A 3BDOA 4DA2A 2F0GA 2G9HD 1I3QB 4S3SA 3G6EA 4GKJL 3BZCA 1HNXQ 3EN2A 1EYAA 3KJPA 1OO9B 3J80E 3FP9A 4R4CA 1IYUA 1V43A 2IPKD 1UE7A 1VQAA 3DWQA 1Q82C 4OWWB 1CM9A 3D3RA 2HIXA 1WTXA 2PYKA 1IKMA 1V8QA 2I46A 3Q22A 3ND8A 3HOWB 3K81C 1PH2A 3I91A 4GOPB 1WCMH 2CVRA 2WP8J 4DAMA 2Z6KC 5IWAL 3I4NH 1HA5A 2XSCA 3CQZH 1FNUA 1OTCA 2WKDA 2F0LA 2FINB 2XRSD 5M5YH 1LO5D 1GUTA 3B6YA 3I8ZA 3L3OC 4LFAQ 4DR3Q 5C44B 2MPMA 1RODA 2DGYA 1GD7A 2Z6BA 3PUWA 4JI5L 5JPMC 2B8GA 3P20A 4WRDA 3K80C 4BY7B 2EPBA 3NENA 4R4TA 1L1OA 1E22A 4OO1G 1PVOA 2N55A 3KF8B 3NQIA 1TS3A 3OPOA 1VQNA 2DNEA 5A2QL 3A8IE 2DJFC 3PO2H 4QJFA 4YIJA 4K2LA 3RN2A 1E1TA 1RTNA 1SXTA 1PTOH 1TR5A 5ELFA 3A0JA 5M5YB 3HGBA 3T53B 3VYTA 3M9BA 4OO1H 1EZ8A 5EQ0A 4DK3C 3LX0A 2WAQG 1KTKA 2E2HB 1Y8NB 1JQYD 4KHVA 3MWYW 4C3HG 4JBJA 2OXPA 2MO0A 1DOMA 2D62A 1FVIA 2F0HA 3NBIA 4BY1H 2L11A 2K33A 4KN7C 2LMCB 3TP5A 4ME3A 1PH9A 5DNFA 4DR4L 1IW7C 1XNRQ 2HT1A 1NR4A 2M00A 4CGYB 3S1NB 2H1EA 2RHSB 3PUZA 3S2HB 3P7JA 1TS4A 4KHPQ 1B3AA 2Q2IA 2F1MA 3T1HL 3PUVA 3HOVB 5E7NA 3MEHA 1X65A 4FF1A 1X3FA 2CHBD 5IGGA 4A3BH 1JWUD 5HURA 4M1UB 4ZLTF 2PMZB 1EY7A 5GQOA 4DR7L 1KC8C 1VQ4A 3KOJA 1H95A 4JI2Q 5K5PA 4B3MQ 2VZAA 1SSOA 1MJEA 3GV6A 5IIFA 1VQ7A 4MZ9A 1MKHA 1TWCH 1A63A 1VQOA 1QUQB 3HOYG 1QE6A 1PH8A 4J6HA 4DV3Q 1YBYA 1IBMQ 4F8MA 4LF8Q 3I4NB 2A6EC 3SEBA 4QCLA 4CDCC 1SE4A 4BY1B 3OMCA 4CJ1B 3AFQA 1I4GA 4BXXH 5CV4A 1V9PA 5IT9c 4AYBE 3A74A 1WI5A 3H15A 3Q6SA 1W2BA 4IFDJ 3J7YW 4KJNA 1JE4A 2B63G 3D4WA 2CCZA 3JAME 2NN6G 4HIOA 4A75A 1CHQD 2D0PA 5C3EB 1GUOA 1R4QB 3PMFA 1TWGH 2EY5A 4JI8Q 1TWFH 1E24A 1PTOC 5EKKA 5EKLA 2GN5A 2PQEA 1DD2A 1LM0A 1NAPA 2QILA 2NVTB 1FYCA 4HAEA 4K0KQ 4A3GB 4H13C 4DF7A 1I4XA 2IL8A 1G6ZA 3V05A 2N3SA 2Z6KA 5C6AA 3T4AC 1VQEA 3QIAA 4AH6A 1YVCA 1AFPA 1XMQQ 1G2TA 4XQJA 1EFID 2JA6H 3W2DA 3PIPA 1MBYA 1YHBA 3QOJA 4BS9A 1BCPB 2B2UA 1GUGA 5BN3A 4DAVA 1AE3A 3CU7A 3RZDB 5FLXE 4J1MA 3HOXG 1TS2A 1LTSD 2LS01 1PRTF 1S3OA 2E75C 2SDFA 2RDHA 3H6MA 2KA7A 3UDIA 3PSIA 5IOCA 2JA6G 1BDOA 1PFBA 3GTJB 4A3IH 2UUCL 4DUYQ 3VR6A 1DJRD 3I7FA 3NEMA 3S16B 4R4QA 5IYDH 4X66L 1S5DD 1QZHA 2PW5A 3IFDA 1I4QA 3BZKA 1CTMA 3D6WA 5EAYA 1TQOA 1D5ZC 2M2LA 2PQAA 5F2DA 3EA6A 3MXNB 2WKCA 2F4IA 2I5MX 5ELOA 2JA5B 2UU9Q 3BG3A 3I3CA 4HMIA 1NJIC 2D9UA 1WTOA 1W6JA 4A3EB 4L63B 2F0SA 2A19A 5ELBA 1M4VA 4A3DH 2MGSA 5EBCA 2WV6D 3M3YH 3SK5A 2JEAI 3CP0A 3M4YA 1VQPA 4YWLA 4EGVA 3DM1A 1ET9A 4C3JG 3ONAB 3PO3G 1EFWA 1N32Q 2FXQA 3S16H 1F2ZA 5HGQA 1TWHH 1Y8PB 2K5WA 4B3RL 4X65Q 3PO2B 3TP8A 1PH3A 1RCVD 4DR1L 4RG1A 5LL6X 2FHTA 2XVSA 4QY7A 1L0WA 1N32L 1ZYRD 3A5ZB 1FJGL 2A5HA 4P74A 4O1NA 1G6PA 4PG3A 3R2TA 2ZXRA 2RKSA 2BDNA 4B3RQ 4JYAL 5KYIA 1U4RA 5CV7A 2ASBA 1EWCA 4J15A 2KCMA 4OWTB 3T51B 4A3KG 3NSWA 1VS0A 5GAHC 1H9KA 2K6AA 3EBEA 4MTNA 4RFBA 1BCPC 3PV0A 3S14B 5KRUA 4L5QA 5C44G 5DEHA 5C3EG 1CHPD 3W1BA 4HIMA 2BH8A 1YJWA 1WD0A 2FJ2A 4HIKA 1EQTA 1X3GA 2CFMA 3W3AA 1ASZA 5M5XH 2E2DC 2FFKB 2RVLA 2QGQA 1CK1A 1Q8IA 2HCIA 2FMMA 1U9RA 3MXPA 4WJWA 3HOWH 2OTLA 3VR5A 3T13A 3D0FA 3C46A 1STNA 4NXMQ 4IN3A 3FKIB 1XNQQ 1PFMA 4B9WA 1XMOQ 1RDPD 2F0KA 1DZ1A 1ENAA 3CCLA 4DV2L 2O4XA 4DPGA 1X54A 2PNHA 1XNQL 2OEOA 4DV4L 4KKUA 5D3DA 4BBSB 3MHBA 4QB4A 5C5LA 1IBLL 1B8AA 3TZUA 1TY0A 2K05A 1RL2A 3HS0C 1HQRD 3KBGA 3NWSA 3MZ5A 2YU9H 3WDNA 1CKOA 4DXGA 2JEBI 4A3JG 1VMCA 2N78A 1Z47A 3EFXD 4POGA 1IBLQ 1VQ5A 2MQHA 1EU3A 4PMWA 4JCVE 1UNSA 2HDMA 5KNBA 3E0JA 1PZJD 1YHAA 3C2PA 5IT9E 5J22A 4A3MB 1PRTD 1TKWB 5KNDA 3ITPA 1PTOF 2PNRC 4I7AA 1TIID 4BBRB 1NUCA 1IL8A 2CWAA 2ALYB 3L9AX 1SNQA 5M9OA 3SE0A 2I5LX 2EQSA 1S5CD 1LTID 4CDFC 1D6EC 1EY5A 1HCZA 3BZDB 3DUZA 1BUVT 4C3JB 1N33Q 1T9HA 2CQAA 4MHEA 5E3FA 4UHVA 1G91A 3PUYA 4A3EG 4KMUC 4IFDG 1ENFA 1TWHB 3H09A 3IL8A 3LWUA 1IXRA 4CDEC 2NVTH 3BYYB 5J39A 3T1YQ 2RBMA 4IJHA 1LTTD 1B4OA 5CR3A 3PF4A 2O2LD 5KNCA 1C0AA 1U0LA 4KHPL 5I6YA 2EYPA 1SNMA 2NWGA 4GZYC 5T1GA 4A3GG 1D1KA 2YV5A 1SAPA 3M3YB 5COYA 2FMCA 5KGUA 5E1FA 2DJGC 4BY7G 1CZGA 1KDAA 4OONA 1UE5A 4ZQ3A 4ABNA 2ATWA 3AQQA 4R1JA 3G4SA 2RCFA 3W5OA 1TWAB 2N49A 5ELNA 5IP7H 4GOPC 3UDFA 3EVQA 1VQMA 2CH4A 5J1ZA 1WFQA 3ZJYC 2UUCQ 4NDXA 1PLFA 4JPBW 4AYBG 1TWCB 1EQRA 1I50H 1PMRA 4GLVB 2K28A 1G2SA 4X6AH 4BY1G 5LMNL 2R7ZG 4Q5VA 1PH5A 2VXWA 3T16A 5CORA 1YI2A 1SE8A 3S1QH 2E5LQ 1JMCA 2VUMG 2UXBL 5C0XJ 2AKWB 5LMNQ 1Q8KA 2HCCA 4HN7A 4JI8L 3KYHC 4XDXA 4DR1Q 5FJ8H 1TWAH 4XYQA 1EQVA 4LF7L 1FJGQ 4HJAA 3I4MB 3FKIG 4DR2Q 1K0RA 3R3OA 5C4HA 4LJZC 1JT8A 1X3PA 2ZTEA 2EY2A 4KKSA 2LSSA 4JYAQ 1QOHA 1STBA 4A3KB 2MNAA 3RZDH 1C4QA 3U50C 1ZEQX 4IO9A 1BVSA 3KLSX 3TDQA 4X62L 3H0GH 4N9PA 4A93H 4ULLA 2G5DA 3GTOH 3RLNA 1B3QA 1CUKA 1X56A 2A68C 3SXHA 1CA5A 2DNCA 1B7YB 3ND9A 5ISRA 4DAYA 2NVYB 1STHA 1QVGA 2E2IH 4DV5Q 2Q8TA 4NMZA 1I4HA 2VQEQ 4DU9A 2B29A 4KV6A 3OYYA 1GVPA 1LYLA 1XWEA 2A6HC 1STEA 4HEDA 4C2MH 5EJWA 1HR0Q 1CKNB 1LUZA 1F9PA 1XPOA 2KOLA 1X6OA 2XN9C 1YNXA 2K4KA 5CMDA 3NBHB 4L5RC 3WWVA 3VYRA 5IYCG 5DM63 1IBKL 3LNNA 3S2DH 2HUGA 3S1RB 1QB5D 4ZUIA 1KDBA 2KBNA 3FRPB 4JK1C 4BBSH 4ALPA 2R92G 2EJFC 2X69A 1SDFA 4DR3L 2KCTA 4EQPA 4RKBA 1IBKQ 1Q86C 1UE6A 2YU9B 1BR9A 1HFGA 4DV6Q 2IX3A 5JJKA 1QILA 2MHVA 2BDOA 1K8MA 5FJ8G 2OQKA 3GTMB 1HA6A 3IRBA 4JBMA 5JJZA 1H9SA 4X64L 1WTHA 3G48A 3TP7A 1TXYA 2EVBA 2B2YA 3STBD 1ILQA 2O5IC 3KBXA 4PZ8A 2A68D 1PFNA 3Q8DA 1EYGA 2ZT9C 3VR3A 1BNZA 1I4PA 4AQYQ 3DMUA 1EWIA 3JAMc 5J3BA 2QF7A 1AN8A 2C35B 2KHSA 1A2UA 3VYSA 2ES2A 4EQNA 2JQOA 4C3IB 2K75A 4YHHL 4DNIA 4KLKA 2I0QA 2BH2A 1CA6A 2NTSA 5C4XB 5K36H 1XNRL 4ID6A 1W6KA 4WJ4A 3U4VA 2L5TA 3ULPA 3S1RH 3CC2A 2EYHA 2XWJB 1CSQA 4OIJA 4X3TA 4GOPA 2K03A 1QUQA 3I4MH 4DR5Q 3OWEB 4IZ8A 3J7ZC 2CW0D 1JJGA 4I65A 1JICA 1SR3A 4PMCA 2BOSA 3E0EA 1UAPA 2CH4W 2F3VA 4JI2L 2E8GA 4TVAB 3IAYA 3CCVA 3JAMi 1K83H 2PO4A 4C3JH 4C3IH 2K14A 2NVYH 2VQFQ 4OL7A 5IGBA 3L7ZC 4HSVA 4XQQA 4JV5L 3BS1A 4LF8L 5E4WC 1UWVA 1OXUA 1VCIA 2ICEC 4A3DB 5I2XA 2LXKA 3F2UA 2E5LL 3CF5A 1NMGA 3H3VC 1K8AC 5AJ3Q 4JC0A 2X6LA 4JV5Q 2NZOA 3EJIA 3HFZB 1JORA 4A3CG 3AYHB 4P72A 2HHHL 1SYBA 2NZHA 1K83B 4BY7H 2EOTA 2B8FA 4CJ0B 5AJ3L 1VF7A 1HNZL 2SEBD 1X55A 3J80L 3NTHA 1NNXA 1BCPF 4APVA 4YY3Q 1N34L 5EPLA 1VQ8A 4U68A 4IALA 2CWPA 3GTMH 3CXCA 4IPDA 1L1OC 2D0OA 2K5QA 4OO1I 1Q12A 2UXCL 1S40A 5C4JB 1TS5A 4FO2A 4KD4A 2B2TC 2KECA 1MJCA 4JI0Q 1K3RA 5DM73 4A3LH 4P75A 2ZJQA 3F2DA 4YCVA 2JN4A 1FR3A 2JE6I 4LW1A 2Q2TA 1KNAA 3NUCA 4UPAA 2B2VA 3FEWX 3IFTA 1E3PA 4HJ9A 2IX1A 1CKMA 5LMNW 2E2IB 4CJ2C 1YIJA 1VQ6A 2B2WA 5GADC 2A74C 1PYSB 2I07B 4X62Q 4GKJQ 4ZYSA 4LWCA 3WOEA 1YNNC 2XTIA 3K6OA 3KLRA 1I94L 4RCNA 4DK6C 3GTKB 2NN6I 2PQAB 3HKSA 1WCMG 2QDBA 3OMGA 1SLJA 4DV1L 5GROA 1PZKD 4V0BA 3RD4A 1F9SA 1LV9A 1TWFB 3OOCA 3R8BA 3GTPB 2F0QA 2K7VA 2MFIA 3X3NA 5GAEC 4KKTA 1E2ZA 2A73B 1X3EA 2Z0SA 1LT3D 5IODA 1V1PA 2EDGA 5EKIA 2JSOA 4B3TQ 4GN5A 3CCUA 4OELB 3MFYA 5HGTA 4JG2A 3L0OA 4F7XA 2CW0C 4JI5Q 3M85A 1QG7A 1J5EQ 1SMYD 5KYLA 1R4PB 1WVLA 1PH6A 4IPCA 2CKZB 2K32A 2QCPX 2HIVA 3HZXA 1PXUA 1FNVA 1Z6HA 2Z9HA 4OXPA 3ER0A 2N88A 1JCKB 1BF4A 2EJGC 4WORA 4N8X1 2KQ3A 3W1GA 2G9DA 3J81c 3M4QA 5G3LD 4X64Q 3O13A 3OSOA 2SOBA 1S4ZA 4N8FA 2B63H 2KENA 4DV0Q 3D4DA 3K0YA 4OWXB 1JWSD 4C3HH 4LF7Q 2YTVA 2UXDL 1DGSA 3K58A 4EQ5A 1MSHA 3CCQA 3NP8A 4X65L 3F2CA 4LF9L 1G51A 2F0JA 2L55A 2JA5G 2TMPA 1MSGA 4JI1Q 2E2JH 4DR7Q 2NVQH 1QZGA 1MD2D 4DR6L 3TSSA 3A8KE 4ZKCB 3E3XA 2OTJA 4A93G 4LF9Q 4GN3B 2F0OA 1HR0W 1TT2A 3JC66 3A56A 2XGTA 4JI1L 1U4PA 4ZRZA 3STBC 5KIXA 3CHBD 3BU2A 1LTBD 5ELEA 1F9RA 2KCCA 5M3FB 2EXZA 1T5XD 1KLGD 2IHFA 2Z4HA 1Y1WB 4BBRG 4KD3A 4XYOA 1XX8A 4MTKA 2RF4A 2F3WA 4HJ8A 1L2FA 1BBUA 1LTGD 2ZJPA 4CBVA 3SGIA 1JOKA 1EOVA 1PRTC 2AQ2B 4GN4B 1HRJA 1MGSA 2A8VA 3MFGA 2R93H 4BA1I 5JVG3 4X3UA 1K0SA 1HTPA 1Z9FA 2UUBL 4XIGS 4FDBA 3OWFA 5K36G 3F8TA 4XT3B 3RMHA 1SE2A 4Y52H 2OF1A 3HP3A 3GTLB 4BBRH 2E76C 2F0DA 3HKZE 5I9OA 1RIPA 3SK4A 4K5XA 2UUAQ 1RTOA 3PQIA 4IJLA 3RR5A 2WB1B 1FNWA 3NQTA 1UEBA 2JA7G 2VQFL 5FKAC 4UP8A 4LFBQ 1DONA 4A3BG 3KLWA 1N34Q 2BE5C 2J7ZA 2F4VQ 1HZ9A 4IUQA 3NPPA 4XTCS 2VNUD 4JI3L 5FLXL 3HOUB 3PO2G 3J81E 5IP9G 2WACA 2UXCQ 1WD1A 3UI2A 5IY0A 1STAA 1NTGA 3U4ZA 5JJIA 2QW7A 4EVOA 4XQNA 4H44C 5JOBA 4LF4L 1DYQA 2F0TA 1XJVA 4GKKL 1C9OA 5T1IA 2NBFA 1YNND 5LL6S 1ZKOA 4IUTA 1Y14B 2NYZD 1HHVA 1XTDA 1MHWC 2EYOA 1EIFA 1GOZA 4KY6A 1FGBD 4A3DG 2MP1A 1RHPA 3I90A 1V1QA 3M7GA 2LFNA 3NTIA 4LF6L 1WJJA 2EYFA 2NTTA 3G6JB 3OIPA 3URYA 5JEAH 4FF2A 1IHZA 2RDFA 1EIGA 2K04A 3VYUA 3PIP3 4X66Q 4R4IA 1SROA 4LUZA 3GDEA 3MXGA 1S5FD 4ZUJA 2ZM6Q 5I9PA 1C48A 2IX0A 3SHLA 1RKNA 3C1FA 4GNXA 4HTHA 4QQBX 5D65A 3HOVH 4O0AA 5IYDG 1BXTA 2SNSA 4K6LA 4IFDI 5IYBG 4V190 1B1ZA 1Z7TA 1I6HH 3S1NH 2B3GA 4NW2A 2XIWA 1WOCA 3I2ZA 3FMCA 1GM5A 1AH9A 4RA8A 1XXGA 2C5CA 3BVMA 3N6RA 1SYFA 3QWNA 4YWMA 1FGUA 1E1OA 4RWSC 2E74C 4K2KA 5C3EH 2F0PA 3S1MB 1EOTA 2K52A 4NKLA 3FDTA 2PI2E 4B3SQ 2VS1A 1I6VC 5FOBB 3P1HA 2N8NA 3ICEA 2P5ZX 5IT9L 1JWMD 5M3MH 4TKOB 4YWKA 5EGTA 3UE1A 2IJ0A 2QEXA 3GTKH 1Y1VB 5IGFA 1EY0A 4FVMA 5ELDA 3KK7A 4NP5A 3E9HA 3BDLA 5CGKA 1RD9D 4DV0L 1V1PB 2L15A 3HRZC 1LABA 4P2CB 2RDGA 4N9TA 1N36L 3GTLH 1A6XA 3H91A 3J7AV 3UDXA 1RJTA 3E9IA 1I5FA 3M4OH 1V1OA 4RGNA 5JEAG 3G71A 1Y8OB 1HXYD 2WAQE 2L1BA 1BO0A 1M8AA 1HJPA 2L0CA 4CKEA 2PMZE 1EY8A 3SK6A 3FHWA 2L12A 4UP9A 3GTGB 5LMUL 4JW0A 4R9WA 1DM0B 4DNRB 3OW2A 5IGDA 4G7ZC 4LUOA 3GV3A 1PTOB 4ODGA 2L4NA 1HUNA 1O7YA 5M3FH 1C8CA 3I56A 3V96A 1WCMB 1QVFA 1DCZA 1EY9A 1JB7A 1QWYA 4PQXA 3HEJA 3KF8A 3H3VI 2LKVA 4BA2I 2F0FA 4G7OC 2JA8B 1GHKA 3ERSX 2C9OA 1D1IA 1DXMA 1P16A 1OXTA 4XXEA 1PH7A 2EYJA 1H9SB 1JJCB 1H9JA 2IT1A 4G4KA 4LF5Q 3DWAA 3S17B 4TSSA 2JA8G 3OHXC 4G7HC 4DV4Q 2K01A 4L6TB 3Q24A 4DV1Q 1BKBA 1K8OA 4C56C 4IQZA 2WB1G 1LTRD 2KVMA 1EY6A 1KXLA 3DEOA 1U4LA 1AEXA 3FVQA 1TY2A 2IY5B 3S14H 1BQQT 3K5NA 3KF6B 1F2YA 1QNKA 3GTQH 2JA5H 2DUDA 3KDFA 1F2LA 4IPGA 2EZVA 1EEFD 2LY7A 3GQBA 1SMXA 1J9OA 1F2MA 2JA8H 3J81L 3TN2A 5IWAQ 4OIKA 3HOZH 5IP7G 1KL9A 4GKKQ 1J5EL 2F0VA 2ZXOA 1IL2A 2PPBC 4NB3A 1EEID 4ZK9B 3D8GA 2RA4A 3GTGH 2AQ3B 1EIHA 1W3SA 2JXMB 3K5MA 2VUMB 2A6ED 1D2BA 4OEMB 1I3QH 2AQ1B 3Q23A 4A76A 2D2CC 3VR4A 4MNOA 5C4XG 1U5KA 1HZAA 4UDUC 3VR2A 2JJQA 4JI6L 2IWHA 3I72A 5TSSA 3I4MG 3S15B 4J8QA 2K5VA 2TSSA 1BBXC 3KF6A 4JI4L 4QIWB 4POFA 1KAWA 4FF4A 2UXDQ 1LT4D 2ICIA 1NMFA 4LFCL 1YITA 2E2JB 2H5XA 1X32A 4IFDH 1XPRA 4C3IG 3QJYA 4YHHQ 3K57A 4IPHA 3ZYYX 1MI2A 2GVBA 5FO7B 4JI4Q 2F0UA 1LACA 5M3MB 1K28A 5C3WA 3HOXH 5EPJA 3CMEA 1PHJA 4LFCQ 4GNXB 4A3JH 1PDQA 1KRSA 1YHQA 3TEHB 1SE3A 1YEZA 3T56B 5CYUA 1N8RC 1GJXA 1HFNA 5IP9H 5A35A 4IUUA 4DUZL 5C3XA 4Y7NH 1OXXK 1CZWA 1XTCD 4RKLA 5DLQE 1NR2A 2YYZA 3RNUA 3K5OA 5ELCA 4CKBA 1UUPA 3PO3H 2RSNA 1IYJB 3BDCA 3DHQA 4CKCA 1TWGB 3CRLC 1LTLA 5C4JH 4MIUA 4CHTB 1A3TA 5JAVA 2K5DA 2K5NA 1H9MA 3MXNA 1HTLD 2A1AA 1VDZA 1B50A 1VQLA 2PZWA 1B9NA 2V4DA 4IURA 4R8NA 3RN5A 4OX9L 4DK0A 4WFN3 3J81i 1O7LA 4UY8C 4LNQA 1OXVA 4A3LG 3NBHA 3TMEA 4BXXG 1ML0D 4DN4M 1ICWA 3DM3A 1BCPD 3GO5A 5C0XG 3TS0A 3J80c 2AWOA 1D5XC 1STGA 3EROA 3GTQB 1K3BC 4ME5A 1VF5C 4K5VA 4A3FB 3F1ZA 2Q8RE 4RMFA 2B2UC 3NE5B 3SR1A 1E2WA 2Z1CA 3NK9A 3OIQA 4LF4Q 1PA6A 3CC4A 4O2DA 1HUMA 1XPUA 1JC7A 1HZBA 1PH4A 4K8IA 1ONLA 2H4OA 3RLFA 4YCWA 1QCBD 4EX5A 1GUNA 1EQQA 1GUSA 1KHIA 3S24A 3S2HH 1G8ZD 2KHJA 4JBKA 2HHHQ 2KHIA 1A0IA 4ZCKA 4PMBA 2PW7A 1B9MA 1JE5A 1SNPA 4O42A 1HNZQ 2A69D 1CQVA 2PZUA 3FPPA 2VB2X 2HD3A 4WJ3M 4LF6Q 3N52A 4QIWE 1B70B 4JI7Q 2CQOA 3DEPA 4JBWA 1SYDA 3QO2A 4C1NK 3VA5A 2BA0A 1TU2B 4A3MG 1KAAA 2F0NA 4L5SA 1Q90A 1WTPA 4DXFA 5FO8B 2VQEL 1PYWD 3GP7A 3PCOB 1HH2P 3MAQA 1HNWL 5M5XB 2MO1A 3DXJC 1PV4A 5M5WB 2B2TA 4KN4C 2IW3A 3FPUB 5D14A 1E0BA 3S17H 4C2MB 2AWNA 4HJ5A 1SFOH 5IGEA 2VB3X 1K8GA 2NN6H 4I7ZC 4LFAL 4LF5L 1WTWA 1HNWQ 3PF5A 4A93B 2ENBA 4C1NI 1Q1EA 2VY3A 4R8IA 2UU9L 4B3TL 1KABA 2X6GA 4JOIC 1K73C 5JVH3 4H02A 4DUYL 2F3IA 4Z9CB 3DLLA 1EUJA 1EL0A 5M3MG 3E5SA 2RCNA 1ILPA 3A8JE 3QR8A 1SN8A 1A15A 2R3ZA 4JVZA 4FXKC 2ZXPA 3PIO3 2EIFA 2GA4B 4L8JA 3S9WA 3R93A 3PIOA 3KDFB 4RCOA 3WOFA 3HKZG 2B63B 3IKJA 1AW7A 2Q8IB 4IOCA 3J7A5 3A54A 4DK1A 1AE2A 4IUPA 5IYBH 3JAML 1GO3E 1LT5D 2D5DA 4IUNA 4P71A 1EIYB 4A3FH 2SNMA 4F88A 3HOWG 1SYEA 1EU4A 3K59A 4B3ML 3J80i 5LMUQ 4GLXA 5BN5A 3MTSA 1PZID 4JI6Q 5CBAE 1JOQA 3F2BA 1ZYRC 2R6GA 4HR7B 2DY7A 4DR6Q 4JOIA 1D5MC 4ILWA 3RZOH 3H94A 4DFAA 3CPWA 4A3IB 2VW9A 2OT2A 4QGUA 3UE0A 5L37A 1R9TH 3EIVA 4RH6A 3CKIB 3AU7A 4RAUC 5FO9B 3BVGA 1Y1WH 5C0XI 1EZ6A 2KEEA 2EJMA 2R7FA 3I4LA 1QNUA 4M8AA 1G291 1I6HB 1JB3A 3MC0B 3S15H 5G3LF 3AFPA 4NXML 2K1BA 3FKIH 3D31A 1CFMA 3MEFA 4QL5A 5C4XH 2F0IA 4PV1C 3KLSA 5CV5A 3I55A 4DGZA 3HOVG 3R2IA 1HZCA 1L0XB 1VQ9A 1KLUD 1J6QA 3SVMA 4DNTB 1GHJA 2NVQB 3D4RA 2JA6B 3SK8A 3SDZA 2UUBQ 3G7LA 4FXDA 4G57A 3CCMA 3ERQA 4RGOS 3H0GG 4FF3A 3K7UC 4YY3L 2EY6A 1PFSA 2B2YC 1SNCA 1L0YB 2HDLA 3U9OA 2V1CC 1LLRD 2NB0A 1YNJD 3U9SA 2EY1A 3HOZB 2QEJC 3S1QB 5CC4A 2F0EA 4K5WA 2OWOA 5M3FG 1SFOB 2F03A 3P75A 4JI0L 5BR8Q 1A3UA 3HOYH 1VQGA 2YTXA 1VQDA 2KJXA 5EPKA 3QG1A 4X3KA 2WB1E 1CKNA 1S5BD 1A8VA 2EYMA 4A3GH 5BR8L 1B2TA 4PZ7A 4A4IA 2ZTDA 2XWBB 2BCOA 3NTKA 2JA9A 4A3KH 3CQZB 1QVCA 5LHY1 3E6ZX 5IYCH 4K6DA 1LTAD 1I4RA 2HQEA 3TREA 3HKZB 2EYLA 1YJ9A 1VQKA 1N33L 5C44H 1DOKA 3GTJH 1KIXA 3GTOB 2MJ8A 2ZJRA 1IW7D 1ENCA 3H0GB 4JI3Q 1Y69U 3I4OA 3AB9A 5DAUA 4GLAC 4HCEA 4QMGA 1EYCA 3X3MA 2F0MA 1F77A 4A3EH 4E6IA 3KUPA 2Y0SE 4HIDA 2B2WC 4UAIA 1IYVA 3MA2B 3HOUH 3QB3A 2RHQB 2KCNA 5JJLA 1VQHA 2K50A 3CCEA 2MUYA 1STYA 4OGQC 1I94Q 2NVXH 2BE5D 1R9TB 1I50B 3K7AB 3I4NG 4YCUA 4DUZQ 2YTYA 3M4PA 3M7NA 2WFWA 4MN3A 4F87A 2XNAC 1A3VA 1P8LA 3CPFA 3BVZA 1WTVA 1NY4A 3T1YL 3I73A 4A3BB 4QUFA 2KEDA 3I70A 4FP5D 1ESRA 2RSOA 4DAPA 5FLMH 1A62A 3Q0AA 3J7AF 3HOUG 2B39A 2R92H 2QKIC 2A69C 4K14A 4NXNQ
chains in the Genus database with same CATH topology
1J8IA 3A7LA 5CBEE 1CQFA 4LK1C 2JP1A 4KHZA 3V2TA 2AUJD 3GD7A 1JOOA 1RF2D 2R92B 1HPCA 4Y7NB 2J0TD 5JPNC 4ZAIA 4FNFA 3TZDA 1ESFA 1X3QA 5E4XA 1KNEA 3DWPA 1HQMC 5EBDA 4A3JB 3TP6A 3VA7A 1T5EA 3HOXB 5KEEA 3CRKC 5CV8A 3RZOB 4BWGB 2NVXB 4B9XA 5JEAJ 1EY4A 2A6HD 3MVVA 4KJOA 2O5JC 2WAQB 3HG9A 5A2QE 1S5ED 2L9HA 1E2VA 1DOLA 2F0WA 5C5MA 5FK9C 2JA7B 4FXGC 1SMYC 1B53A 3A55A 4U673 1AZPA 1BOSA 1CT1D 4TQUS 1QJOA 1Q1BA 4EQOA 5C4ZA 1OXSC 1SJHD 2B2VC 4KY5A 1A2TA 4QF4A 2XRQD 2R7ZB 1IKLA 1JR0D 2NUCA 3C1EA 1EYDA 1GUWA 4TRDA 4QUCA 1YNJC 1NCVA 1B44D 4KTAA 1F9QA 3HOYB 1O78A 3LWEA 4OHJA 2DN8A 1PRTB 5C0XH 2J4XA 1SBBB 3A7AB 2R93B 4FYDA 4RGTA 3NHHA 3OW7A 2WINB 2WIIB 1LT6D 1WTQA 4HCSA 5CV6A 2DY8A 1PTOD 1SJED 2Z8LA 2KUMA 1SEBD 2AUKA 3D6CA 4RHRA 2RQXA 4AYBB 4X3SA 5CV9A 3S2DB 2JYOA 5AFWA 3PO3B 1ET6A 1UEAB 2Y0SB 1II3A 3C3LA 4XT1B 1EWHA 1FD7D 1XYIA 5I6WA 4RHSA 3AMUA 1Q3LA 3RUZA 3M4OB 2BA1A 4K8JA 1SNDA 4PNYA 2NZ1D 1AP0A 1SYGA 5I4DA 3NXWA 1O80A 4Q0FA 1CI3M 1U4MA 4H7BA 1H9RA 5BN4A 3EQLC 4HMJA 3TBIB 3NWTA 1SNOA 4LAAA 2Z4IA 4H0LC 3PUXA 3BYTB 2PZTA 1TVXA 4LMQD 1O7ZA 2PCFB 1WTRA 4B08A 2ID0A 4KI0A 4IUVA 4ZKBB 4HSPA 4C3HB 5I2YA 2M9VA 1KDCA 5NUCA 1GXDC 3MXUA 3QOLA 5IGCA 1VMPA 1NSNS 2R61A 3K5LA 2EE1A 5D3IB 4KY7A 1SYCA 1ZXTA 4KK7A 1AZQA 4RGMA 3BDOA 4DA2A 2F0GA 2G9HD 1I3QB 4S3SA 1EYAA 1OO9B 3J80E 1IYUA 1V43A 2IPKD 3DWQA 1CM9A 3D3RA 1WTXA 2PYKA 1IKMA 1V8QA 2I46A 3Q22A 3ND8A 3HOWB 3I91A 2CVRA 2WP8J 1HA5A 2XSCA 1FNUA 2WKDA 2F0LA 2FINB 2XRSD 1LO5D 1GUTA 3I8ZA 3L3OC 5C44B 2MPMA 1RODA 3PUWA 5JPMC 2B8GA 3P20A 4WRDA 4BY7B 2EPBA 4OO1G 2N55A 3NQIA 1TS3A 3OPOA 2DNEA 5A2QL 3A8IE 4YIJA 4K2LA 1RTNA 1SXTA 1PTOH 1TR5A 5ELFA 5M5YB 3HGBA 3T53B 3VYTA 4OO1H 1EZ8A 5EQ0A 3LX0A 1KTKA 2E2HB 1Y8NB 1JQYD 4KHVA 3MWYW 4C3HG 2OXPA 1DOMA 2D62A 2F0HA 3NBIA 2L11A 2K33A 4KN7C 2LMCB 3TP5A 5DNFA 1IW7C 1NR4A 2M00A 4CGYB 3S1NB 2H1EA 3PUZA 3S2HB 3P7JA 1TS4A 1B3AA 2F1MA 3PUVA 3HOVB 3MEHA 4FF1A 2CHBD 5IGGA 1JWUD 5HURA 4M1UB 4ZLTF 2PMZB 1EY7A 5K5PA 1SSOA 3GV6A 5IIFA 1QE6A 4J6HA 4F8MA 3I4NB 2A6EC 3SEBA 4QCLA 1SE4A 4BY1B 3OMCA 4CJ1B 1I4GA 5CV4A 3Q6SA 4IFDJ 3J7YW 4KJNA 1JE4A 3D4WA 3JAME 2NN6G 5C3EB 1CHQD 1GUOA 1R4QB 3PMFA 2EY5A 1PTOC 5EKKA 5EKLA 2PQEA 1DD2A 1NAPA 2QILA 2NVTB 1FYCA 4HAEA 4A3GB 4H13C 4DF7A 1I4XA 2IL8A 1G6ZA 3V05A 5C6AA 3T4AC 3QIAA 1AFPA 1G2TA 4XQJA 1EFID 3W2DA 1MBYA 3QOJA 4BS9A 1BCPB 2B2UA 1GUGA 5BN3A 4DAVA 3CU7A 3RZDB 5FLXE 4J1MA 1TS2A 1LTSD 2LS01 1PRTF 2E75C 2SDFA 2RDHA 3H6MA 2KA7A 5IOCA 1BDOA 1PFBA 3GTJB 3VR6A 1DJRD 3S16B 1S5DD 2PW5A 3IFDA 1I4QA 1CTMA 3D6WA 1TQOA 1D5ZC 2M2LA 5F2DA 3EA6A 2WKCA 2F4IA 2JA5B 3BG3A 3I3CA 4HMIA 2D9UA 1WTOA 1W6JA 4A3EB 4L63B 2F0SA 5ELBA 1M4VA 2MGSA 5EBCA 2WV6D 3SK5A 2JEAI 3M4YA 4EGVA 3DM1A 1ET9A 4C3JG 3ONAB 1F2ZA 1Y8PB 2K5WA 3PO2B 3TP8A 1RCVD 5LL6X 2FHTA 2XVSA 1ZYRD 2A5HA 4O1NA 3R2TA 2ZXRA 2RKSA 2BDNA 5KYIA 1U4RA 5CV7A 1EWCA 3T51B 3NSWA 1H9KA 2K6AA 4RFBA 1BCPC 3PV0A 3S14B 5KRUA 5DEHA 1CHPD 1WD0A 2FJ2A 1EQTA 3W3AA 2E2DC 2FFKB 2RVLA 1CK1A 1Q8IA 2HCIA 2FMMA 1U9RA 3MXPA 4WJWA 3VR5A 3T13A 3C46A 1STNA 4IN3A 3FKIB 1PFMA 4B9WA 1RDPD 2F0KA 1DZ1A 1ENAA 2O4XA 2OEOA 4KKUA 5D3DA 4BBSB 3MHBA 4QB4A 5C5LA 3TZUA 1TY0A 2K05A 3HS0C 1HQRD 3KBGA 3NWSA 3MZ5A 3WDNA 4DXGA 2JEBI 1VMCA 1Z47A 3EFXD 1EU3A 4PMWA 1UNSA 2HDMA 5KNBA 3E0JA 1PZJD 3C2PA 5IT9E 5J22A 4A3MB 1PRTD 1TKWB 5KNDA 3ITPA 1PTOF 2PNRC 1TIID 4BBRB 1NUCA 1IL8A 3L9AX 1SNQA 5M9OA 3SE0A 1S5CD 1LTID 1D6EC 1EY5A 1HCZA 3BZDB 3DUZA 1BUVT 4C3JB 2CQAA 4MHEA 5E3FA 1G91A 3PUYA 4KMUC 4IFDG 1ENFA 1TWHB 3H09A 3IL8A 3LWUA 3BYYB 5J39A 2RBMA 1LTTD 1B4OA 5CR3A 2O2LD 5KNCA 5I6YA 2EYPA 1SNMA 2NWGA 4GZYC 5T1GA 1D1KA 1SAPA 3M3YB 5COYA 2FMCA 5KGUA 5E1FA 1CZGA 1KDAA 4ZQ3A 4ABNA 1TWAB 3EVQA 5J1ZA 4NDXA 1PLFA 1TWCB 1PMRA 2K28A 1G2SA 4Q5VA 2VXWA 3T16A 5CORA 5C0XJ 2HCCA 4HN7A 4XDXA 4XYQA 1EQVA 3I4MB 3R3OA 5C4HA 4LJZC 1X3PA 2EY2A 4KKSA 1STBA 1QOHA 4A3KB 1C4QA 1ZEQX 3KLSX 3TDQA 4N9PA 4ULLA 2A68C 3SXHA 1CA5A 2DNCA 3ND9A 5ISRA 4DAYA 2NVYB 1STHA 2Q8TA 4NMZA 1I4HA 4DU9A 4KV6A 1XWEA 2A6HC 1STEA 4HEDA 5EJWA 1F9PA 2KOLA 2XN9C 5CMDA 5DM63 3VYRA 3LNNA 2HUGA 3S1RB 1QB5D 4ZUIA 1KDBA 3FRPB 4JK1C 2EJFC 2X69A 1SDFA 4EQPA 4RKBA 2YU9B 1BR9A 1HFGA 2IX3A 1QILA 2MHVA 2BDOA 1K8MA 3GTMB 1HA6A 5JJZA 1H9SA 3TP7A 2EVBA 2B2YA 1ILQA 2O5IC 3KBXA 2A68D 1PFNA 2ZT9C 3VR3A 1BNZA 1I4PA 3DMUA 2QF7A 1AN8A 2KHSA 1A2UA 3VYSA 4EQNA 4C3IB 1CA6A 2NTSA 5C4XB 5K36H 4ID6A 1W6KA 2L5TA 2EYHA 2XWJB 4OIJA 4X3TA 2K03A 3OWEB 4IZ8A 2CW0D 4I65A 1JICA 4PMCA 2BOSA 1UAPA 2F3VA 3IAYA 2PO4A 4OL7A 5IGBA 3L7ZC 4HSVA 4XQQA 3BS1A 5E4WC 1OXUA 1VCIA 2ICEC 4A3DB 5I2XA 3F2UA 3H3VC 2X6LA 3EJIA 1JORA 1SYBA 1K83B 2EOTA 2B8FA 4CJ0B 1VF7A 2SEBD 3J80L 3NTHA 1BCPF 5EPLA 4U68A 4IALA 2K5QA 4OO1I 1Q12A 5C4JB 1TS5A 4FO2A 4KD4A 2B2TC 2KECA 5DM73 1FR3A 2JE6I 1KNAA 3NUCA 2B2VA 3FEWX 3IFTA 2IX1A 2E2IB 4CJ2C 2B2WA 2A74C 2I07B 4ZYSA 3WOEA 1YNNC 3K6OA 3KLRA 4RCNA 3GTKB 2NN6I 2QDBA 3OMGA 1PZKD 4V0BA 3RD4A 1F9SA 1LV9A 1TWFB 3OOCA 3R8BA 3GTPB 2F0QA 2K7VA 3X3NA 4KKTA 1E2ZA 2A73B 1LT3D 5IODA 1V1PA 2EDGA 5EKIA 2JSOA 3MFYA 5HGTA 4F7XA 2CW0C 3M85A 1QG7A 1SMYD 5KYLA 1R4PB 1WVLA 2K32A 2QCPX 3HZXA 1PXUA 1FNVA 1Z6HA 2N88A 1JCKB 1BF4A 2EJGC 4WORA 2KQ3A 2G9DA 5G3LD 3O13A 3OSOA 2SOBA 1S4ZA 3D4DA 3K0YA 1JWSD 3K58A 1MSHA 3NP8A 2F0JA 2L55A 2TMPA 1MSGA 1MD2D 3TSSA 3A8KE 4ZKCB 2F0OA 1TT2A 3A56A 1U4PA 4ZRZA 5KIXA 3CHBD 5ELEA 1LTBD 5M3FB 1F9RA 2KCCA 2EXZA 1T5XD 1KLGD 2Z4HA 1Y1WB 4KD3A 4XYOA 1XX8A 2F3WA 1LTGD 4CBVA 1JOKA 2AQ2B 1PRTC 1HRJA 1MGSA 3MFGA 4BA1I 5JVG3 4X3UA 1HTPA 4XIGS 3OWFA 5K36G 4XT3B 3RMHA 1SE2A 2OF1A 3HP3A 3GTLB 2E76C 2F0DA 5I9OA 3SK4A 4K5XA 1RTOA 2WB1B 1FNWA 3NQTA 5FKAC 1DONA 2BE5C 2J7ZA 4IUQA 3NPPA 4XTCS 2VNUD 5FLXL 3HOUB 3J81E 2WACA 1WD1A 3UI2A 1STAA 4EVOA 4XQNA 4H44C 5JOBA 1DYQA 2F0TA 5T1IA 2NBFA 1YNND 5LL6S 1ZKOA 4IUTA 1HHVA 2NYZD 2EYOA 1GOZA 4KY6A 1FGBD 2MP1A 1RHPA 3I90A 3M7GA 2LFNA 3NTIA 2EYFA 2NTTA 3G6JB 3OIPA 3URYA 5JEAH 4FF2A 1IHZA 2RDFA 1EIGA 2K04A 3VYUA 3PIP3 3MXGA 1S5FD 4ZUJA 5I9PA 1C48A 2IX0A 3SHLA 1RKNA 3C1FA 4HTHA 5D65A 1BXTA 2SNSA 4K6LA 4IFDI 4V190 1B1ZA 1Z7TA 2XIWA 4NW2A 3FMCA 4RA8A 1XXGA 2C5CA 3BVMA 3N6RA 1SYFA 3QWNA 4RWSC 2E74C 4K2KA 2F0PA 3S1MB 1EOTA 4NKLA 3FDTA 1I6VC 5FOBB 3P1HA 5IT9L 1JWMD 4TKOB 5EGTA 2IJ0A 1Y1VB 5IGFA 1EY0A 4FVMA 5ELDA 3KK7A 4NP5A 3BDLA 5CGKA 1RD9D 1V1PB 3HRZC 1LABA 4P2CB 2RDGA 4N9TA 1A6XA 3H91A 3J7AV 1RJTA 1V1OA 4RGNA 5JEAG 1Y8OB 1HXYD 2L1BA 1BO0A 1M8AA 2L0CA 4CKEA 1EY8A 3SK6A 2L12A 3GTGB 4R9WA 1DM0B 4DNRB 5IGDA 4G7ZC 3GV3A 1PTOB 4ODGA 2L4NA 1HUNA 1O7YA 1C8CA 3V96A 1WCMB 1DCZA 1EY9A 1QWYA 4PQXA 3HEJA 3KF8A 2LKVA 4BA2I 2F0FA 4G7OC 2JA8B 1GHKA 2C9OA 1D1IA 1DXMA 4XXEA 1OXTA 2EYJA 1H9SB 1H9JA 2IT1A 4G4KA 3DWAA 3S17B 4TSSA 3OHXC 4G7HC 2K01A 4L6TB 3Q24A 1K8OA 4C56C 4IQZA 1LTRD 2KVMA 1EY6A 3DEOA 1U4LA 1AEXA 3FVQA 1TY2A 1BQQT 3K5NA 1F2YA 1QNKA 1F2LA 2EZVA 1EEFD 2LY7A 3GQBA 1J9OA 1F2MA 3J81L 3TN2A 4OIKA 2F0VA 2ZXOA 2PPBC 1EEID 4ZK9B 3D8GA 2RA4A 2AQ3B 1EIHA 2JXMB 3K5MA 2VUMB 2A6ED 1D2BA 2AQ1B 3Q23A 2D2CC 3VR4A 4UDUC 3VR2A 2IWHA 3I72A 5TSSA 3S15B 4J8QA 2TSSA 1BBXC 4QIWB 4FF4A 1LT4D 2ICIA 2E2JB 1X32A 4IFDH 4C3IG 3QJYA 3K57A 3ZYYX 1MI2A 5FO7B 2F0UA 1LACA 5M3MB 5C3WA 5EPJA 1PDQA 1SE3A 3T56B 5CYUA 1GJXA 1HFNA 5A35A 4IUUA 5C3XA 1OXXK 1CZWA 1XTCD 4RKLA 1NR2A 2YYZA 3K5OA 5ELCA 4CKBA 1UUPA 2RSNA 3BDCA 3DHQA 4CKCA 1TWGB 3CRLC 4MIUA 4CHTB 1A3TA 5JAVA 2K5DA 3MXNA 1H9MA 1HTLD 1VDZA 1B50A 2PZWA 1B9NA 2V4DA 4IURA 4R8NA 4DK0A 4WFN3 1O7LA 1OXVA 3NBHA 3TMEA 1ML0D 4DN4M 1ICWA 3GO5A 1BCPD 5C0XG 2AWOA 1D5XC 1STGA 3EROA 3GTQB 4ME5A 1VF5C 4K5VA 4A3FB 2Q8RE 2B2UC 3NE5B 3SR1A 1E2WA 2Z1CA 3NK9A 3OIQA 1HUMA 1JC7A 4K8IA 1ONLA 2H4OA 3RLFA 1QCBD 1GUNA 1GUSA 1G8ZD 4PMBA 2PW7A 1B9MA 1SNPA 4O42A 2A69D 1CQVA 2PZUA 3FPPA 2VB2X 3N52A 3DEPA 4JBWA 1SYDA 3QO2A 4C1NK 3VA5A 2BA0A 1TU2B 1KAAA 2F0NA 1Q90A 1WTPA 4DXFA 5FO8B 1PYWD 3GP7A 3MAQA 5M5XB 3DXJC 5M5WB 2B2TA 4KN4C 2IW3A 3FPUB 5D14A 1E0BA 4C2MB 2AWNA 5IGEA 2VB3X 2NN6H 4I7ZC 1WTWA 4A93B 2ENBA 4C1NI 1Q1EA 4R8IA 1KABA 2X6GA 5JVH3 4Z9CB 1EL0A 3E5SA 1ILPA 3A8JE 1A15A 2R3ZA 4FXKC 2ZXPA 3PIO3 2GA4B 4L8JA 3S9WA 3R93A 4RCOA 3WOFA 2B63B 3IKJA 1AW7A 2Q8IB 3A54A 4DK1A 4IUPA 3JAML 1LT5D 2D5DA 4IUNA 2SNMA 4F88A 1SYEA 1EU4A 3K59A 5BN5A 3MTSA 1PZID 5CBAE 1JOQA 1ZYRC 2R6GA 4HR7B 2DY7A 1D5MC 4ILWA 3H94A 4DFAA 4A3IB 2OT2A 4RH6A 3CKIB 3AU7A 4RAUC 5FO9B 3BVGA 5C0XI 1EZ6A 2KEEA 2EJMA 3I4LA 1QNUA 4M8AA 1G291 1I6HB 1JB3A 3MC0B 5G3LF 2K1BA 3D31A 1CFMA 2F0IA 4PV1C 3KLSA 5CV5A 4DGZA 3R2IA 1L0XB 1KLUD 3SVMA 4DNTB 1GHJA 2NVQB 3D4RA 2JA6B 3SK8A 3SDZA 3G7LA 4FXDA 4G57A 3ERQA 4RGOS 4FF3A 2EY6A 2B2YC 1SNCA 1L0YB 2HDLA 3U9OA 1LLRD 2NB0A 1YNJD 3U9SA 2EY1A 3HOZB 2QEJC 3S1QB 5CC4A 2F0EA 4K5WA 1SFOB 2F03A 3P75A 1A3UA 2KJXA 5EPKA 3QG1A 4X3KA 1S5BD 2EYMA 1B2TA 2XWBB 2BCOA 3NTKA 3CQZB 5LHY1 3E6ZX 4K6DA 1LTAD 1I4RA 2HQEA 3HKZB 2EYLA 1DOKA 3GTOB 2MJ8A 1IW7D 1ENCA 3H0GB 1Y69U 3AB9A 5DAUA 4HCEA 4QMGA 1EYCA 3X3MA 2F0MA 1F77A 4E6IA 3KUPA 2B2WC 4UAIA 1IYVA 3MA2B 3QB3A 2KCNA 2MUYA 1STYA 4OGQC 2BE5D 1R9TB 1I50B 3K7AB 3M7NA 4MN3A 4F87A 2XNAC 1A3VA 1WTVA 3BVZA 3I73A 4A3BB 4QUFA 2KEDA 3I70A 1ESRA 4FP5D 2RSOA 4DAPA 3Q0AA 3J7AF 2B39A 2QKIC 2A69C 4K14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G7L A;  1NCV A;  5D65 A;  1WTW A;  1CA6 A;  1J8I A;  1RTN A;  1F9R A;  4R8I A;  1F9Q A;  2IL8 A;  4DN4 M;  1G6Z A;  2K01 A;  2B2Y C;  5CBE E;  4IUV A;  2HDL A;  4ZKB B;  3LWE A;  1XX8 A;  2KVM A;  2XIW A;  2X6G A;  4NW2 A;  2FHT A;  1CA5 A;  3DEO A;  1U4L A;  2JP1 A;  4RA8 A;  4MHE A;  1G91 A;  1B50 A;  4IUR A;  1VMP A;  1G2T A;  4OIJ A;  4RWS C;  5EQ0 A;  4X3T A;  2BDN A;  3IL8 A;  2K03 A;  1QNK A;  1U4R A;  2Q8T A;  1EL0 A;  1HRJ A;  1MGS A;  3MWY W;  1EOT A;  2B2U A;  1F9S A;  1B4O A;  1F2L A;  1ML0 D;  1ICW A;  1DOM A;  1LV9 A;  2EE1 A;  3FDT A;  4X3U A;  1ZXT A;  1JIC A;  1A15 A;  2L11 A;  4ZAI A;  4HED A;  2R3Z A;  3TZD A;  5EJW A;  1X3Q A;  5E4X A;  1J9O A;  4XT3 B;  2NWG A;  5EPK A;  4X3K A;  1F9P A;  5DNF A;  4OIK A;  5T1G A;  2KOL A;  3TN2 A;  1B2T A;  1WTQ A;  1NR4 A;  4HCS A;  3HP3 A;  1SAP A;  1KNE A;  1AZQ A;  2DY8 A;  5COY A;  5EKI A;  3R93 A;  2H1E A;  1WD0 A;  2FJ2 A;  5CMD A;  2SDF A;  1RTO A;  3P7J A;  4ZK9 B;  1EQT A;  2RA4 A;  4HSV A;  2Q8R E;  1B3A A;  2HUG A;  2KUM A;  1EIH A;  5E4W C;  2B2U C;  2FFK B;  2RVL A;  1DON A;  4X3S A;  4IUP A;  2J7Z A;  3F2U A;  1PFB A;  2HCI A;  2FMM A;  1DOK A;  2JYO A;  1QG7 A;  4IUQ A;  5AFW A;  4ZLT F;  1WVL A;  2X69 A;  1HUM A;  1SDF A;  1CM9 A;  2MJ8 A;  2X6L A;  3H91 A;  1WTX A;  1PLF A;  1RJT A;  4XT1 B;  1HFG A;  1XYI A;  1WD1 A;  3UI2 A;  1IKM A;  1SSO A;  3GV6 A;  2N88 A;  1PFM A;  2L9H A;  1Q3L A;  3MTS A;  2K28 A;  1G2S A;  5CBA E;  1BF4 A;  2EOT A;  1DOL A;  2L1B A;  3IFD A;  1BO0 A;  1M8A A;  5JJZ A;  1HA6 A;  3I91 A;  3D6W A;  1BBX C;  4CJ0 B;  1ILP A;  2DY7 A;  1DZ1 A;  2CVR A;  1QE6 A;  5T1I A;  3KUP A;  4O42 A;  2B2W C;  2M2L A;  4UAI A;  2NZ1 D;  2L12 A;  2B2Y A;  2VXW A;  5COR A;  4IUT A;  1HHV A;  2NYZ D;  1ILQ A;  1S4Z A;  1X32 A;  4R9W A;  3N52 A;  5EPL A;  1B53 A;  3KBX A;  1AP0 A;  4U68 A;  1PFN A;  2FIN B;  4CJ1 B;  1AZP A;  1O80 A;  2K05 A;  1MI2 A;  3I3C A;  2MP1 A;  3DEP A;  3GV3 A;  3I8Z A;  4RAU C;  2D9U A;  2MPM A;  1RHP A;  1ROD A;  1U4M A;  2HCC A;  3I90 A;  3Q6S A;  3QO2 A;  5EPJ A;  2L4N A;  1MSH A;  2KEE A;  1WTO A;  1HUN A;  1O7Y A;  1C8C A;  1JE4 A;  1PDQ A;  1VMC A;  2B2T C;  2B2V C;  2KEC A;  4XDX A;  4MN3 A;  1BNZ A;  1WTV A;  1MSG A;  1WTP A;  2EPB A;  1EIG A;  2K1B A;  2K04 A;  2KED A;  2MGS A;  1ESR A;  4QUF A;  2HDM A;  2RSO A;  1HFN A;  4IUU A;  2N55 A;  1KNA A;  4ZKC B;  2B2T A;  1X3P A;  3FPU B;  1IKL A;  2B2V A;  5D14 A;  1E0B A;  1NR2 A;  1TVX A;  1GUW A;  1NAP A;  3DM1 A;  3SVM A;  4LMQ D;  2RSN A;  1O7Z A;  1U4P A;  4QUC A;  4CJ2 C;  1IL8 A;  3ONA B;  4HAE A;  1WTR A;  2B2W A; 
#chains in the Genus database with same CATH topology
 3K0X A;  3KJO A;  1J8I A;  2Y0S G;  3A7L A;  3CCJ A;  5CBE E;  4DKA C;  1CQF A;  4DV7 L;  1X9N A;  4LK1 C;  2JP1 A;  4A3I G;  1IZ6 A;  4KHZ A;  3V2T A;  2AUJ D;  2LXJ A;  3GD7 A;  3HOZ G;  1JOO A;  1RF2 D;  2R92 B;  1HPC A;  3S1M H;  4Y7N B;  2J0T D;  5JPN C;  4ZAI A;  4L5T A;  4FNF A;  1ASY A;  3TZD A;  1ESF A;  1X3Q A;  5E4X A;  3TQY A;  2Q2U A;  1KNE A;  3DWP A;  1Q81 C;  1HQM C;  5EBD A;  4NPS A;  1VQF A;  4A3J B;  2F52 A;  3TP6 A;  3VA7 A;  1T5E A;  1N9W A;  3HOX B;  5KEE A;  2OQ0 A;  3U58 A;  3CRK C;  5CV8 A;  2UXB Q;  3CW2 C;  3RZO B;  4BWG B;  3BJU A;  4DAY B;  2NVX B;  1Y1V G;  1KRT A;  5JEA J;  4B9X A;  1M1K C;  1EY4 A;  2A6H D;  3MVV A;  4KJO A;  2O5J C;  3KFU A;  2WAQ B;  3HG9 A;  4UP7 A;  1XMO L;  4DV5 L;  5A2Q E;  5H1S E;  1S5E D;  2L9H A;  3L2P A;  4JI7 L;  1E2V A;  1D8L A;  1DOL A;  2F0W A;  5GAG C;  5C5M A;  5FLM G;  3CCR A;  4GNX C;  3NEL A;  5FK9 C;  2AMC B;  3J81 j;  2JA7 B;  4FXG C;  1GKH A;  1SMY C;  1B53 A;  4PZ6 A;  3A55 A;  4U67 3;  2AHO B;  1AZP A;  1BOS A;  3UDG A;  2R93 G;  1CT1 D;  1NBW A;  4TQU S;  1QJO A;  4LFB L;  1Q1B A;  4EQO A;  5C4Z A;  1OXS C;  1SJH D;  2B2V C;  2F4V L;  4KY5 A;  1A2T A;  2JK8 A;  1FL0 A;  2VUM H;  1VQJ A;  3CD6 A;  4QF4 A;  4DV6 L;  1WYD A;  1E7Z A;  4DV2 Q;  5M5W H;  2XRQ D;  1HR0 L;  2R7Z B;  1IKL A;  1L1O B;  1SRU A;  1JR0 D;  2NUC A;  3C1E A;  1EYD A;  1GUW A;  3OTO L;  4TRD A;  4QUC A;  1YNJ C;  1Y1W G;  2UUA L;  3PGZ A;  1NCV A;  1B44 D;  3ULJ A;  4CDD C;  4KTA A;  1F9Q A;  2K5H A;  3HOY B;  1YZ6 A;  1O78 A;  2GVA A;  3LWE A;  3OTO Q;  4OHJ A;  2DN8 A;  3TS2 A;  1PRT B;  4K0K L;  5IE8 A;  5C0X H;  2J4X A;  1PYB A;  1Y1V H;  3LGJ A;  1SBB B;  3ULL A;  3A7A B;  2R93 B;  4FYD A;  4RGT A;  2I5H A;  3NHH A;  3OW7 A;  1JJ2 A;  1C7Y A;  2WIN B;  2VL6 A;  2WII B;  1LT6 D;  4IOA A;  1WTQ A;  4HCS A;  5CV6 A;  2DY8 A;  1PTO D;  1SJE D;  3CAM A;  2Z8L A;  3T1H Q;  1VQI A;  4AIM A;  2JA7 H;  2KUM A;  1SEB D;  2AUK A;  3D6C A;  4RHR A;  2RQX A;  2PI2 A;  4AYB B;  3VDY A;  4X3S A;  3RLO A;  2R7D A;  1KD1 C;  5CV9 A;  3S2D B;  2JYO A;  5AFW A;  3PO3 B;  1ET6 A;  1KQS A;  1UEA B;  4AQY L;  5HY6 A;  2Y0S B;  4HJ7 A;  1II3 A;  1ICF B;  3H3V H;  3C3L A;  2QDL A;  4XT1 B;  1EWH A;  1FD7 D;  1XYI A;  5I6W A;  4DR5 L;  1VQB A;  4RHS A;  4DR4 Q;  3CMA A;  2IHE A;  5FLX c;  2ZM6 L;  3AMU A;  1Q3L A;  3RUZ A;  4BBS G;  4B3S L;  4DV3 L;  3M4O B;  2BA1 A;  4K8J A;  1SND A;  1D7Q A;  3CCS A;  4PNY A;  2NZ1 D;  1YJN A;  1K9M C;  1AP0 A;  1SYG A;  5I4D A;  1S72 A;  3NXW A;  4GS3 A;  1O80 A;  4Q0F A;  1CI3 M;  2OCE A;  1U4M A;  1O7I A;  1MIU A;  3A5U A;  1CSP A;  4H7B A;  1H9R A;  5BN4 A;  4DV7 Q;  3EQL C;  4HMJ A;  3TBI B;  4A3F G;  1Q7Y C;  3NWT A;  1SNO A;  1N36 Q;  1M90 C;  4LAA A;  2Z4I A;  4H0L C;  3PUX A;  1IBM L;  3CC7 A;  4OX9 Q;  1NE3 A;  3BYT B;  4P73 A;  2PZT A;  2HQL A;  2EXD A;  3GTP H;  1TVX A;  4LMQ D;  1O7Z A;  1VQC A;  2PCF B;  1WTR A;  2E2H H;  4B08 A;  4NXN L;  4A3C H;  2ID0 A;  4KI0 A;  4IUV A;  4ZKB B;  3TRZ A;  4HSP A;  4LUV A;  4C3H B;  5I2Y A;  1XMQ L;  2M9V A;  1KDC A;  5NUC A;  1GXD C;  3MXU A;  3QOL A;  5IGC A;  1VMP A;  4A3M H;  4DR2 L;  2Q2H A;  2QA4 A;  1NSN S;  2R61 A;  3K5L A;  2ZTC A;  3AEV A;  2R7Z H;  2EE1 A;  3K8A A;  4KY7 A;  5D3I B;  1SYC A;  1ZXT A;  4KK7 A;  4R4O A;  1HNX L;  1PH1 A;  3K7A H;  1BBW A;  1AZQ A;  1Q46 A;  4RGM A;  1UE1 A;  3BDO A;  4DA2 A;  2F0G A;  2G9H D;  1I3Q B;  4S3S A;  3G6E A;  4GKJ L;  3BZC A;  1HNX Q;  3EN2 A;  1EYA A;  3KJP A;  1OO9 B;  3J80 E;  3FP9 A;  4R4C A;  1IYU A;  1V43 A;  2IPK D;  1UE7 A;  1VQA A;  3DWQ A;  1Q82 C;  4OWW B;  1CM9 A;  3D3R A;  2HIX A;  1WTX A;  2PYK A;  1IKM A;  1V8Q A;  2I46 A;  3Q22 A;  3ND8 A;  3HOW B;  3K81 C;  1PH2 A;  3I91 A;  4GOP B;  1WCM H;  2CVR A;  2WP8 J;  4DAM A;  2Z6K C;  5IWA L;  3I4N H;  1HA5 A;  2XSC A;  3CQZ H;  1FNU A;  1OTC A;  2WKD A;  2F0L A;  2FIN B;  2XRS D;  5M5Y H;  1LO5 D;  1GUT A;  3B6Y A;  3I8Z A;  3L3O C;  4LFA Q;  4DR3 Q;  5C44 B;  2MPM A;  1ROD A;  2DGY A;  1GD7 A;  2Z6B A;  3PUW A;  4JI5 L;  5JPM C;  2B8G A;  3P20 A;  4WRD A;  3K80 C;  4BY7 B;  2EPB A;  3NEN A;  4R4T A;  1L1O A;  1E22 A;  4OO1 G;  1PVO A;  2N55 A;  3KF8 B;  3NQI A;  1TS3 A;  3OPO A;  1VQN A;  2DNE A;  5A2Q L;  3A8I E;  2DJF C;  3PO2 H;  4QJF A;  4YIJ A;  4K2L A;  3RN2 A;  1E1T A;  1RTN A;  1SXT A;  1PTO H;  1TR5 A;  5ELF A;  3A0J A;  5M5Y B;  3HGB A;  3T53 B;  3VYT A;  3M9B A;  4OO1 H;  1EZ8 A;  5EQ0 A;  4DK3 C;  3LX0 A;  2WAQ G;  1KTK A;  2E2H B;  1Y8N B;  1JQY D;  4KHV A;  3MWY W;  4C3H G;  4JBJ A;  2OXP A;  2MO0 A;  1DOM A;  2D62 A;  1FVI A;  2F0H A;  3NBI A;  4BY1 H;  2L11 A;  2K33 A;  4KN7 C;  2LMC B;  3TP5 A;  4ME3 A;  1PH9 A;  5DNF A;  4DR4 L;  1IW7 C;  1XNR Q;  2HT1 A;  1NR4 A;  2M00 A;  4CGY B;  3S1N B;  2H1E A;  2RHS B;  3PUZ A;  3S2H B;  3P7J A;  1TS4 A;  4KHP Q;  1B3A A;  2Q2I A;  2F1M A;  3T1H L;  3PUV A;  3HOV B;  5E7N A;  3MEH A;  1X65 A;  4FF1 A;  1X3F A;  2CHB D;  5IGG A;  4A3B H;  1JWU D;  5HUR A;  4M1U B;  4ZLT F;  2PMZ B;  1EY7 A;  5GQO A;  4DR7 L;  1KC8 C;  1VQ4 A;  3KOJ A;  1H95 A;  4JI2 Q;  5K5P A;  4B3M Q;  2VZA A;  1SSO A;  1MJE A;  3GV6 A;  5IIF A;  1VQ7 A;  4MZ9 A;  1MKH A;  1TWC H;  1A63 A;  1VQO A;  1QUQ B;  3HOY G;  1QE6 A;  1PH8 A;  4J6H A;  4DV3 Q;  1YBY A;  1IBM Q;  4F8M A;  4LF8 Q;  3I4N B;  2A6E C;  3SEB A;  4QCL A;  4CDC C;  1SE4 A;  4BY1 B;  3OMC A;  4CJ1 B;  3AFQ A;  1I4G A;  4BXX H;  5CV4 A;  1V9P A;  5IT9 c;  4AYB E;  3A74 A;  1WI5 A;  3H15 A;  3Q6S A;  1W2B A;  4IFD J;  3J7Y W;  4KJN A;  1JE4 A;  2B63 G;  3D4W A;  2CCZ A;  3JAM E;  2NN6 G;  4HIO A;  4A75 A;  1CHQ D;  2D0P A;  5C3E B;  1GUO A;  1R4Q B;  3PMF A;  1TWG H;  2EY5 A;  4JI8 Q;  1TWF H;  1E24 A;  1PTO C;  5EKK A;  5EKL A;  2GN5 A;  2PQE A;  1DD2 A;  1LM0 A;  1NAP A;  2QIL A;  2NVT B;  1FYC A;  4HAE A;  4K0K Q;  4A3G B;  4H13 C;  4DF7 A;  1I4X A;  2IL8 A;  1G6Z A;  3V05 A;  2N3S A;  2Z6K A;  5C6A A;  3T4A C;  1VQE A;  3QIA A;  4AH6 A;  1YVC A;  1AFP A;  1XMQ Q;  1G2T A;  4XQJ A;  1EFI D;  2JA6 H;  3W2D A;  3PIP A;  1MBY A;  1YHB A;  3QOJ A;  4BS9 A;  1BCP B;  2B2U A;  1GUG A;  5BN3 A;  4DAV A;  1AE3 A;  3CU7 A;  3RZD B;  5FLX E;  4J1M A;  3HOX G;  1TS2 A;  1LTS D;  2LS0 1;  1PRT F;  1S3O A;  2E75 C;  2SDF A;  2RDH A;  3H6M A;  2KA7 A;  3UDI A;  3PSI A;  5IOC A;  2JA6 G;  1BDO A;  1PFB A;  3GTJ B;  4A3I H;  2UUC L;  4DUY Q;  3VR6 A;  1DJR D;  3I7F A;  3NEM A;  3S16 B;  4R4Q A;  5IYD H;  4X66 L;  1S5D D;  1QZH A;  2PW5 A;  3IFD A;  1I4Q A;  3BZK A;  1CTM A;  3D6W A;  5EAY A;  1TQO A;  1D5Z C;  2M2L A;  2PQA A;  5F2D A;  3EA6 A;  3MXN B;  2WKC A;  2F4I A;  2I5M X;  5ELO A;  2JA5 B;  2UU9 Q;  3BG3 A;  3I3C A;  4HMI A;  1NJI C;  2D9U A;  1WTO A;  1W6J A;  4A3E B;  4L63 B;  2F0S A;  2A19 A;  5ELB A;  1M4V A;  4A3D H;  2MGS A;  5EBC A;  2WV6 D;  3M3Y H;  3SK5 A;  2JEA I;  3CP0 A;  3M4Y A;  1VQP A;  4YWL A;  4EGV A;  3DM1 A;  1ET9 A;  4C3J G;  3ONA B;  3PO3 G;  1EFW A;  1N32 Q;  2FXQ A;  3S16 H;  1F2Z A;  5HGQ A;  1TWH H;  1Y8P B;  2K5W A;  4B3R L;  4X65 Q;  3PO2 B;  3TP8 A;  1PH3 A;  1RCV D;  4DR1 L;  4RG1 A;  5LL6 X;  2FHT A;  2XVS A;  4QY7 A;  1L0W A;  1N32 L;  1ZYR D;  3A5Z B;  1FJG L;  2A5H A;  4P74 A;  4O1N A;  1G6P A;  4PG3 A;  3R2T A;  2ZXR A;  2RKS A;  2BDN A;  4B3R Q;  4JYA L;  5KYI A;  1U4R A;  5CV7 A;  2ASB A;  1EWC A;  4J15 A;  2KCM A;  4OWT B;  3T51 B;  4A3K G;  3NSW A;  1VS0 A;  5GAH C;  1H9K A;  2K6A A;  3EBE A;  4MTN A;  4RFB A;  1BCP C;  3PV0 A;  3S14 B;  5KRU A;  4L5Q A;  5C44 G;  5DEH A;  5C3E G;  1CHP D;  3W1B A;  4HIM A;  2BH8 A;  1YJW A;  1WD0 A;  2FJ2 A;  4HIK A;  1EQT A;  1X3G A;  2CFM A;  3W3A A;  1ASZ A;  5M5X H;  2E2D C;  2FFK B;  2RVL A;  2QGQ A;  1CK1 A;  1Q8I A;  2HCI A;  2FMM A;  1U9R A;  3MXP A;  4WJW A;  3HOW H;  2OTL A;  3VR5 A;  3T13 A;  3D0F A;  3C46 A;  1STN A;  4NXM Q;  4IN3 A;  3FKI B;  1XNQ Q;  1PFM A;  4B9W A;  1XMO Q;  1RDP D;  2F0K A;  1DZ1 A;  1ENA A;  3CCL A;  4DV2 L;  2O4X A;  4DPG A;  1X54 A;  2PNH A;  1XNQ L;  2OEO A;  4DV4 L;  4KKU A;  5D3D A;  4BBS B;  3MHB A;  4QB4 A;  5C5L A;  1IBL L;  1B8A A;  3TZU A;  1TY0 A;  2K05 A;  1RL2 A;  3HS0 C;  1HQR D;  3KBG A;  3NWS A;  3MZ5 A;  2YU9 H;  3WDN A;  1CKO A;  4DXG A;  2JEB I;  4A3J G;  1VMC A;  2N78 A;  1Z47 A;  3EFX D;  4POG A;  1IBL Q;  1VQ5 A;  2MQH A;  1EU3 A;  4PMW A;  4JCV E;  1UNS A;  2HDM A;  5KNB A;  3E0J A;  1PZJ D;  1YHA A;  3C2P A;  5IT9 E;  5J22 A;  4A3M B;  1PRT D;  1TKW B;  5KND A;  3ITP A;  1PTO F;  2PNR C;  4I7A A;  1TII D;  4BBR B;  1NUC A;  1IL8 A;  2CWA A;  2ALY B;  3L9A X;  1SNQ A;  5M9O A;  3SE0 A;  2I5L X;  2EQS A;  1S5C D;  1LTI D;  4CDF C;  1D6E C;  1EY5 A;  1HCZ A;  3BZD B;  3DUZ A;  1BUV T;  4C3J B;  1N33 Q;  1T9H A;  2CQA A;  4MHE A;  5E3F A;  4UHV A;  1G91 A;  3PUY A;  4A3E G;  4KMU C;  4IFD G;  1ENF A;  1TWH B;  3H09 A;  3IL8 A;  3LWU A;  1IXR A;  4CDE C;  2NVT H;  3BYY B;  5J39 A;  3T1Y Q;  2RBM A;  4IJH A;  1LTT D;  1B4O A;  5CR3 A;  3PF4 A;  2O2L D;  5KNC A;  1C0A A;  1U0L A;  4KHP L;  5I6Y A;  2EYP A;  1SNM A;  2NWG A;  4GZY C;  5T1G A;  4A3G G;  1D1K A;  2YV5 A;  1SAP A;  3M3Y B;  5COY A;  2FMC A;  5KGU A;  5E1F A;  2DJG C;  4BY7 G;  1CZG A;  1KDA A;  4OON A;  1UE5 A;  4ZQ3 A;  4ABN A;  2ATW A;  3AQQ A;  4R1J A;  3G4S A;  2RCF A;  3W5O A;  1TWA B;  2N49 A;  5ELN A;  5IP7 H;  4GOP C;  3UDF A;  3EVQ A;  1VQM A;  2CH4 A;  5J1Z A;  1WFQ A;  3ZJY C;  2UUC Q;  4NDX A;  1PLF A;  4JPB W;  4AYB G;  1TWC B;  1EQR A;  1I50 H;  1PMR A;  4GLV B;  2K28 A;  1G2S A;  4X6A H;  4BY1 G;  5LMN L;  2R7Z G;  4Q5V A;  1PH5 A;  2VXW A;  3T16 A;  5COR A;  1YI2 A;  1SE8 A;  3S1Q H;  2E5L Q;  1JMC A;  2VUM G;  2UXB L;  5C0X J;  2AKW B;  5LMN Q;  1Q8K A;  2HCC A;  4HN7 A;  4JI8 L;  3KYH C;  4XDX A;  4DR1 Q;  5FJ8 H;  1TWA H;  4XYQ A;  1EQV A;  4LF7 L;  1FJG Q;  4HJA A;  3I4M B;  3FKI G;  4DR2 Q;  1K0R A;  3R3O A;  5C4H A;  4LJZ C;  1JT8 A;  1X3P A;  2ZTE A;  2EY2 A;  4KKS A;  2LSS A;  4JYA Q;  1QOH A;  1STB A;  4A3K B;  2MNA A;  3RZD H;  1C4Q A;  3U50 C;  1ZEQ X;  4IO9 A;  1BVS A;  3KLS X;  3TDQ A;  4X62 L;  3H0G H;  4N9P A;  4A93 H;  4ULL A;  2G5D A;  3GTO H;  3RLN A;  1B3Q A;  1CUK A;  1X56 A;  2A68 C;  3SXH A;  1CA5 A;  2DNC A;  1B7Y B;  3ND9 A;  5ISR A;  4DAY A;  2NVY B;  1STH A;  1QVG A;  2E2I H;  4DV5 Q;  2Q8T A;  4NMZ A;  1I4H A;  2VQE Q;  4DU9 A;  2B29 A;  4KV6 A;  3OYY A;  1GVP A;  1LYL A;  1XWE A;  2A6H C;  1STE A;  4HED A;  4C2M H;  5EJW A;  1HR0 Q;  1CKN B;  1LUZ A;  1F9P A;  1XPO A;  2KOL A;  1X6O A;  2XN9 C;  1YNX A;  2K4K A;  5CMD A;  3NBH B;  4L5R C;  3WWV A;  3VYR A;  5IYC G;  5DM6 3;  1IBK L;  3LNN A;  3S2D H;  2HUG A;  3S1R B;  1QB5 D;  4ZUI A;  1KDB A;  2KBN A;  3FRP B;  4JK1 C;  4BBS H;  4ALP A;  2R92 G;  2EJF C;  2X69 A;  1SDF A;  4DR3 L;  2KCT A;  4EQP A;  4RKB A;  1IBK Q;  1Q86 C;  1UE6 A;  2YU9 B;  1BR9 A;  1HFG A;  4DV6 Q;  2IX3 A;  5JJK A;  1QIL A;  2MHV A;  2BDO A;  1K8M A;  5FJ8 G;  2OQK A;  3GTM B;  1HA6 A;  3IRB A;  4JBM A;  5JJZ A;  1H9S A;  4X64 L;  1WTH A;  3G48 A;  3TP7 A;  1TXY A;  2EVB A;  2B2Y A;  3STB D;  1ILQ A;  2O5I C;  3KBX A;  4PZ8 A;  2A68 D;  1PFN A;  3Q8D A;  1EYG A;  2ZT9 C;  3VR3 A;  1BNZ A;  1I4P A;  4AQY Q;  3DMU A;  1EWI A;  3JAM c;  5J3B A;  2QF7 A;  1AN8 A;  2C35 B;  2KHS A;  1A2U A;  3VYS A;  2ES2 A;  4EQN A;  2JQO A;  4C3I B;  2K75 A;  4YHH L;  4DNI A;  4KLK A;  2I0Q A;  2BH2 A;  1CA6 A;  2NTS A;  5C4X B;  5K36 H;  1XNR L;  4ID6 A;  1W6K A;  4WJ4 A;  3U4V A;  2L5T A;  3ULP A;  3S1R H;  3CC2 A;  2EYH A;  2XWJ B;  1CSQ A;  4OIJ A;  4X3T A;  4GOP A;  2K03 A;  1QUQ A;  3I4M H;  4DR5 Q;  3OWE B;  4IZ8 A;  3J7Z C;  2CW0 D;  1JJG A;  4I65 A;  1JIC A;  1SR3 A;  4PMC A;  2BOS A;  3E0E A;  1UAP A;  2CH4 W;  2F3V A;  4JI2 L;  2E8G A;  4TVA B;  3IAY A;  3CCV A;  3JAM i;  1K83 H;  2PO4 A;  4C3J H;  4C3I H;  2K14 A;  2NVY H;  2VQF Q;  4OL7 A;  5IGB A;  3L7Z C;  4HSV A;  4XQQ A;  4JV5 L;  3BS1 A;  4LF8 L;  5E4W C;  1UWV A;  1OXU A;  1VCI A;  2ICE C;  4A3D B;  5I2X A;  2LXK A;  3F2U A;  2E5L L;  3CF5 A;  1NMG A;  3H3V C;  1K8A C;  5AJ3 Q;  4JC0 A;  2X6L A;  4JV5 Q;  2NZO A;  3EJI A;  3HFZ B;  1JOR A;  4A3C G;  3AYH B;  4P72 A;  2HHH L;  1SYB A;  2NZH A;  1K83 B;  4BY7 H;  2EOT A;  2B8F A;  4CJ0 B;  5AJ3 L;  1VF7 A;  1HNZ L;  2SEB D;  1X55 A;  3J80 L;  3NTH A;  1NNX A;  1BCP F;  4APV A;  4YY3 Q;  1N34 L;  5EPL A;  1VQ8 A;  4U68 A;  4IAL A;  2CWP A;  3GTM H;  3CXC A;  4IPD A;  1L1O C;  2D0O A;  2K5Q A;  4OO1 I;  1Q12 A;  2UXC L;  1S40 A;  5C4J B;  1TS5 A;  4FO2 A;  4KD4 A;  2B2T C;  2KEC A;  1MJC A;  4JI0 Q;  1K3R A;  5DM7 3;  4A3L H;  4P75 A;  2ZJQ A;  3F2D A;  4YCV A;  2JN4 A;  1FR3 A;  2JE6 I;  4LW1 A;  2Q2T A;  1KNA A;  3NUC A;  4UPA A;  2B2V A;  3FEW X;  3IFT A;  1E3P A;  4HJ9 A;  2IX1 A;  1CKM A;  5LMN W;  2E2I B;  4CJ2 C;  1YIJ A;  1VQ6 A;  2B2W A;  5GAD C;  2A74 C;  1PYS B;  2I07 B;  4X62 Q;  4GKJ Q;  4ZYS A;  4LWC A;  3WOE A;  1YNN C;  2XTI A;  3K6O A;  3KLR A;  1I94 L;  4RCN A;  4DK6 C;  3GTK B;  2NN6 I;  2PQA B;  3HKS A;  1WCM G;  2QDB A;  3OMG A;  1SLJ A;  4DV1 L;  5GRO A;  1PZK D;  4V0B A;  3RD4 A;  1F9S A;  1LV9 A;  1TWF B;  3OOC A;  3R8B A;  3GTP B;  2F0Q A;  2K7V A;  2MFI A;  3X3N A;  5GAE C;  4KKT A;  1E2Z A;  2A73 B;  1X3E A;  2Z0S A;  1LT3 D;  5IOD A;  1V1P A;  2EDG A;  5EKI A;  2JSO A;  4B3T Q;  4GN5 A;  3CCU A;  4OEL B;  3MFY A;  5HGT A;  4JG2 A;  3L0O A;  4F7X A;  2CW0 C;  4JI5 Q;  3M85 A;  1QG7 A;  1J5E Q;  1SMY D;  5KYL A;  1R4P B;  1WVL A;  1PH6 A;  4IPC A;  2CKZ B;  2K32 A;  2QCP X;  2HIV A;  3HZX A;  1PXU A;  1FNV A;  1Z6H A;  2Z9H A;  4OXP A;  3ER0 A;  2N88 A;  1JCK B;  1BF4 A;  2EJG C;  4WOR A;  4N8X 1;  2KQ3 A;  3W1G A;  2G9D A;  3J81 c;  3M4Q A;  5G3L D;  4X64 Q;  3O13 A;  3OSO A;  2SOB A;  1S4Z A;  4N8F A;  2B63 H;  2KEN A;  4DV0 Q;  3D4D A;  3K0Y A;  4OWX B;  1JWS D;  4C3H H;  4LF7 Q;  2YTV A;  2UXD L;  1DGS A;  3K58 A;  4EQ5 A;  1MSH A;  3CCQ A;  3NP8 A;  4X65 L;  3F2C A;  4LF9 L;  1G51 A;  2F0J A;  2L55 A;  2JA5 G;  2TMP A;  1MSG A;  4JI1 Q;  2E2J H;  4DR7 Q;  2NVQ H;  1QZG A;  1MD2 D;  4DR6 L;  3TSS A;  3A8K E;  4ZKC B;  3E3X A;  2OTJ A;  4A93 G;  4LF9 Q;  4GN3 B;  2F0O A;  1HR0 W;  1TT2 A;  3JC6 6;  3A56 A;  2XGT A;  4JI1 L;  1U4P A;  4ZRZ A;  3STB C;  5KIX A;  3CHB D;  3BU2 A;  1LTB D;  5ELE A;  1F9R A;  2KCC A;  5M3F B;  2EXZ A;  1T5X D;  1KLG D;  2IHF A;  2Z4H A;  1Y1W B;  4BBR G;  4KD3 A;  4XYO A;  1XX8 A;  4MTK A;  2RF4 A;  2F3W A;  4HJ8 A;  1L2F A;  1BBU A;  1LTG D;  2ZJP A;  4CBV A;  3SGI A;  1JOK A;  1EOV A;  1PRT C;  2AQ2 B;  4GN4 B;  1HRJ A;  1MGS A;  2A8V A;  3MFG A;  2R93 H;  4BA1 I;  5JVG 3;  4X3U A;  1K0S A;  1HTP A;  1Z9F A;  2UUB L;  4XIG S;  4FDB A;  3OWF A;  5K36 G;  3F8T A;  4XT3 B;  3RMH A;  1SE2 A;  4Y52 H;  2OF1 A;  3HP3 A;  3GTL B;  4BBR H;  2E76 C;  2F0D A;  3HKZ E;  5I9O A;  1RIP A;  3SK4 A;  4K5X A;  2UUA Q;  1RTO A;  3PQI A;  4IJL A;  3RR5 A;  2WB1 B;  1FNW A;  3NQT A;  1UEB A;  2JA7 G;  2VQF L;  5FKA C;  4UP8 A;  4LFB Q;  1DON A;  4A3B G;  3KLW A;  1N34 Q;  2BE5 C;  2J7Z A;  2F4V Q;  1HZ9 A;  4IUQ A;  3NPP A;  4XTC S;  2VNU D;  4JI3 L;  5FLX L;  3HOU B;  3PO2 G;  3J81 E;  5IP9 G;  2WAC A;  2UXC Q;  1WD1 A;  3UI2 A;  5IY0 A;  1STA A;  1NTG A;  3U4Z A;  5JJI A;  2QW7 A;  4EVO A;  4XQN A;  4H44 C;  5JOB A;  4LF4 L;  1DYQ A;  2F0T A;  1XJV A;  4GKK L;  1C9O A;  5T1I A;  2NBF A;  1YNN D;  5LL6 S;  1ZKO A;  4IUT A;  1Y14 B;  2NYZ D;  1HHV A;  1XTD A;  1MHW C;  2EYO A;  1EIF A;  1GOZ A;  4KY6 A;  1FGB D;  4A3D G;  2MP1 A;  1RHP A;  3I90 A;  1V1Q A;  3M7G A;  2LFN A;  3NTI A;  4LF6 L;  1WJJ A;  2EYF A;  2NTT A;  3G6J B;  3OIP A;  3URY A;  5JEA H;  4FF2 A;  1IHZ A;  2RDF A;  1EIG A;  2K04 A;  3VYU A;  3PIP 3;  4X66 Q;  4R4I A;  1SRO A;  4LUZ A;  3GDE A;  3MXG A;  1S5F D;  4ZUJ A;  2ZM6 Q;  5I9P A;  1C48 A;  2IX0 A;  3SHL A;  1RKN A;  3C1F A;  4GNX A;  4HTH A;  4QQB X;  5D65 A;  3HOV H;  4O0A A;  5IYD G;  1BXT A;  2SNS A;  4K6L A;  4IFD I;  5IYB G;  4V19 0;  1B1Z A;  1Z7T A;  1I6H H;  3S1N H;  2B3G A;  4NW2 A;  2XIW A;  1WOC A;  3I2Z A;  3FMC A;  1GM5 A;  1AH9 A;  4RA8 A;  1XXG A;  2C5C A;  3BVM A;  3N6R A;  1SYF A;  3QWN A;  4YWM A;  1FGU A;  1E1O A;  4RWS C;  2E74 C;  4K2K A;  5C3E H;  2F0P A;  3S1M B;  1EOT A;  2K52 A;  4NKL A;  3FDT A;  2PI2 E;  4B3S Q;  2VS1 A;  1I6V C;  5FOB B;  3P1H A;  2N8N A;  3ICE A;  2P5Z X;  5IT9 L;  1JWM D;  5M3M H;  4TKO B;  4YWK A;  5EGT A;  3UE1 A;  2IJ0 A;  2QEX A;  3GTK H;  1Y1V B;  5IGF A;  1EY0 A;  4FVM A;  5ELD A;  3KK7 A;  4NP5 A;  3E9H A;  3BDL A;  5CGK A;  1RD9 D;  4DV0 L;  1V1P B;  2L15 A;  3HRZ C;  1LAB A;  4P2C B;  2RDG A;  4N9T A;  1N36 L;  3GTL H;  1A6X A;  3H91 A;  3J7A V;  3UDX A;  1RJT A;  3E9I A;  1I5F A;  3M4O H;  1V1O A;  4RGN A;  5JEA G;  3G71 A;  1Y8O B;  1HXY D;  2WAQ E;  2L1B A;  1BO0 A;  1M8A A;  1HJP A;  2L0C A;  4CKE A;  2PMZ E;  1EY8 A;  3SK6 A;  3FHW A;  2L12 A;  4UP9 A;  3GTG B;  5LMU L;  4JW0 A;  4R9W A;  1DM0 B;  4DNR B;  3OW2 A;  5IGD A;  4G7Z C;  4LUO A;  3GV3 A;  1PTO B;  4ODG A;  2L4N A;  1HUN A;  1O7Y A;  5M3F H;  1C8C A;  3I56 A;  3V96 A;  1WCM B;  1QVF A;  1DCZ A;  1EY9 A;  1JB7 A;  1QWY A;  4PQX A;  3HEJ A;  3KF8 A;  3H3V I;  2LKV A;  4BA2 I;  2F0F A;  4G7O C;  2JA8 B;  1GHK A;  3ERS X;  2C9O A;  1D1I A;  1DXM A;  1P16 A;  1OXT A;  4XXE A;  1PH7 A;  2EYJ A;  1H9S B;  1JJC B;  1H9J A;  2IT1 A;  4G4K A;  4LF5 Q;  3DWA A;  3S17 B;  4TSS A;  2JA8 G;  3OHX C;  4G7H C;  4DV4 Q;  2K01 A;  4L6T B;  3Q24 A;  4DV1 Q;  1BKB A;  1K8O A;  4C56 C;  4IQZ A;  2WB1 G;  1LTR D;  2KVM A;  1EY6 A;  1KXL A;  3DEO A;  1U4L A;  1AEX A;  3FVQ A;  1TY2 A;  2IY5 B;  3S14 H;  1BQQ T;  3K5N A;  3KF6 B;  1F2Y A;  1QNK A;  3GTQ H;  2JA5 H;  2DUD A;  3KDF A;  1F2L A;  4IPG A;  2EZV A;  1EEF D;  2LY7 A;  3GQB A;  1SMX A;  1J9O A;  1F2M A;  2JA8 H;  3J81 L;  3TN2 A;  5IWA Q;  4OIK A;  3HOZ H;  5IP7 G;  1KL9 A;  4GKK Q;  1J5E L;  2F0V A;  2ZXO A;  1IL2 A;  2PPB C;  4NB3 A;  1EEI D;  4ZK9 B;  3D8G A;  2RA4 A;  3GTG H;  2AQ3 B;  1EIH A;  1W3S A;  2JXM B;  3K5M A;  2VUM B;  2A6E D;  1D2B A;  4OEM B;  1I3Q H;  2AQ1 B;  3Q23 A;  4A76 A;  2D2C C;  3VR4 A;  4MNO A;  5C4X G;  1U5K A;  1HZA A;  4UDU C;  3VR2 A;  2JJQ A;  4JI6 L;  2IWH A;  3I72 A;  5TSS A;  3I4M G;  3S15 B;  4J8Q A;  2K5V A;  2TSS A;  1BBX C;  3KF6 A;  4JI4 L;  4QIW B;  4POF A;  1KAW A;  4FF4 A;  2UXD Q;  1LT4 D;  2ICI A;  1NMF A;  4LFC L;  1YIT A;  2E2J B;  2H5X A;  1X32 A;  4IFD H;  1XPR A;  4C3I G;  3QJY A;  4YHH Q;  3K57 A;  4IPH A;  3ZYY X;  1MI2 A;  2GVB A;  5FO7 B;  4JI4 Q;  2F0U A;  1LAC A;  5M3M B;  1K28 A;  5C3W A;  3HOX H;  5EPJ A;  3CME A;  1PHJ A;  4LFC Q;  4GNX B;  4A3J H;  1PDQ A;  1KRS A;  1YHQ A;  3TEH B;  1SE3 A;  1YEZ A;  3T56 B;  5CYU A;  1N8R C;  1GJX A;  1HFN A;  5IP9 H;  5A35 A;  4IUU A;  4DUZ L;  5C3X A;  4Y7N H;  1OXX K;  1CZW A;  1XTC D;  4RKL A;  5DLQ E;  1NR2 A;  2YYZ A;  3RNU A;  3K5O A;  5ELC A;  4CKB A;  1UUP A;  3PO3 H;  2RSN A;  1IYJ B;  3BDC A;  3DHQ A;  4CKC A;  1TWG B;  3CRL C;  1LTL A;  5C4J H;  4MIU A;  4CHT B;  1A3T A;  5JAV A;  2K5D A;  2K5N A;  1H9M A;  3MXN A;  1HTL D;  2A1A A;  1VDZ A;  1B50 A;  1VQL A;  2PZW A;  1B9N A;  2V4D A;  4IUR A;  4R8N A;  3RN5 A;  4OX9 L;  4DK0 A;  4WFN 3;  3J81 i;  1O7L A;  4UY8 C;  4LNQ A;  1OXV A;  4A3L G;  3NBH A;  3TME A;  4BXX G;  1ML0 D;  4DN4 M;  1ICW A;  3DM3 A;  1BCP D;  3GO5 A;  5C0X G;  3TS0 A;  3J80 c;  2AWO A;  1D5X C;  1STG A;  3ERO A;  3GTQ B;  1K3B C;  4ME5 A;  1VF5 C;  4K5V A;  4A3F B;  3F1Z A;  2Q8R E;  4RMF A;  2B2U C;  3NE5 B;  3SR1 A;  1E2W A;  2Z1C A;  3NK9 A;  3OIQ A;  4LF4 Q;  1PA6 A;  3CC4 A;  4O2D A;  1HUM A;  1XPU A;  1JC7 A;  1HZB A;  1PH4 A;  4K8I A;  1ONL A;  2H4O A;  3RLF A;  4YCW A;  1QCB D;  4EX5 A;  1GUN A;  1EQQ A;  1GUS A;  1KHI A;  3S24 A;  3S2H H;  1G8Z D;  2KHJ A;  4JBK A;  2HHH Q;  2KHI A;  1A0I A;  4ZCK A;  4PMB A;  2PW7 A;  1B9M A;  1JE5 A;  1SNP A;  4O42 A;  1HNZ Q;  2A69 D;  1CQV A;  2PZU A;  3FPP A;  2VB2 X;  2HD3 A;  4WJ3 M;  4LF6 Q;  3N52 A;  4QIW E;  1B70 B;  4JI7 Q;  2CQO A;  3DEP A;  4JBW A;  1SYD A;  3QO2 A;  4C1N K;  3VA5 A;  2BA0 A;  1TU2 B;  4A3M G;  1KAA A;  2F0N A;  4L5S A;  1Q90 A;  1WTP A;  4DXF A;  5FO8 B;  2VQE L;  1PYW D;  3GP7 A;  3PCO B;  1HH2 P;  3MAQ A;  1HNW L;  5M5X B;  2MO1 A;  3DXJ C;  1PV4 A;  5M5W B;  2B2T A;  4KN4 C;  2IW3 A;  3FPU B;  5D14 A;  1E0B A;  3S17 H;  4C2M B;  2AWN A;  4HJ5 A;  1SFO H;  5IGE A;  2VB3 X;  1K8G A;  2NN6 H;  4I7Z C;  4LFA L;  4LF5 L;  1WTW A;  1HNW Q;  3PF5 A;  4A93 B;  2ENB A;  4C1N I;  1Q1E A;  2VY3 A;  4R8I A;  2UU9 L;  4B3T L;  1KAB A;  2X6G A;  4JOI C;  1K73 C;  5JVH 3;  4H02 A;  4DUY L;  2F3I A;  4Z9C B;  3DLL A;  1EUJ A;  1EL0 A;  5M3M G;  3E5S A;  2RCN A;  1ILP A;  3A8J E;  3QR8 A;  1SN8 A;  1A15 A;  2R3Z A;  4JVZ A;  4FXK C;  2ZXP A;  3PIO 3;  2EIF A;  2GA4 B;  4L8J A;  3S9W A;  3R93 A;  3PIO A;  3KDF B;  4RCO A;  3WOF A;  3HKZ G;  2B63 B;  3IKJ A;  1AW7 A;  2Q8I B;  4IOC A;  3J7A 5;  3A54 A;  4DK1 A;  1AE2 A;  4IUP A;  5IYB H;  3JAM L;  1GO3 E;  1LT5 D;  2D5D A;  4IUN A;  4P71 A;  1EIY B;  4A3F H;  2SNM A;  4F88 A;  3HOW G;  1SYE A;  1EU4 A;  3K59 A;  4B3M L;  3J80 i;  5LMU Q;  4GLX A;  5BN5 A;  3MTS A;  1PZI D;  4JI6 Q;  5CBA E;  1JOQ A;  3F2B A;  1ZYR C;  2R6G A;  4HR7 B;  2DY7 A;  4DR6 Q;  4JOI A;  1D5M C;  4ILW A;  3RZO H;  3H94 A;  4DFA A;  3CPW A;  4A3I B;  2VW9 A;  2OT2 A;  4QGU A;  3UE0 A;  5L37 A;  1R9T H;  3EIV A;  4RH6 A;  3CKI B;  3AU7 A;  4RAU C;  5FO9 B;  3BVG A;  1Y1W H;  5C0X I;  1EZ6 A;  2KEE A;  2EJM A;  2R7F A;  3I4L A;  1QNU A;  4M8A A;  1G29 1;  1I6H B;  1JB3 A;  3MC0 B;  3S15 H;  5G3L F;  3AFP A;  4NXM L;  2K1B A;  3FKI H;  3D31 A;  1CFM A;  3MEF A;  4QL5 A;  5C4X H;  2F0I A;  4PV1 C;  3KLS A;  5CV5 A;  3I55 A;  4DGZ A;  3HOV G;  3R2I A;  1HZC A;  1L0X B;  1VQ9 A;  1KLU D;  1J6Q A;  3SVM A;  4DNT B;  1GHJ A;  2NVQ B;  3D4R A;  2JA6 B;  3SK8 A;  3SDZ A;  2UUB Q;  3G7L A;  4FXD A;  4G57 A;  3CCM A;  3ERQ A;  4RGO S;  3H0G G;  4FF3 A;  3K7U C;  4YY3 L;  2EY6 A;  1PFS A;  2B2Y C;  1SNC A;  1L0Y B;  2HDL A;  3U9O A;  2V1C C;  1LLR D;  2NB0 A;  1YNJ D;  3U9S A;  2EY1 A;  3HOZ B;  2QEJ C;  3S1Q B;  5CC4 A;  2F0E A;  4K5W A;  2OWO A;  5M3F G;  1SFO B;  2F03 A;  3P75 A;  4JI0 L;  5BR8 Q;  1A3U A;  3HOY H;  1VQG A;  2YTX A;  1VQD A;  2KJX A;  5EPK A;  3QG1 A;  4X3K A;  2WB1 E;  1CKN A;  1S5B D;  1A8V A;  2EYM A;  4A3G H;  5BR8 L;  1B2T A;  4PZ7 A;  4A4I A;  2ZTD A;  2XWB B;  2BCO A;  3NTK A;  2JA9 A;  4A3K H;  3CQZ B;  1QVC A;  5LHY 1;  3E6Z X;  5IYC H;  4K6D A;  1LTA D;  1I4R A;  2HQE A;  3TRE A;  3HKZ B;  2EYL A;  1YJ9 A;  1VQK A;  1N33 L;  5C44 H;  1DOK A;  3GTJ H;  1KIX A;  3GTO B;  2MJ8 A;  2ZJR A;  1IW7 D;  1ENC A;  3H0G B;  4JI3 Q;  1Y69 U;  3I4O A;  3AB9 A;  5DAU A;  4GLA C;  4HCE A;  4QMG A;  1EYC A;  3X3M A;  2F0M A;  1F77 A;  4A3E H;  4E6I A;  3KUP A;  2Y0S E;  4HID A;  2B2W C;  4UAI A;  1IYV A;  3MA2 B;  3HOU H;  3QB3 A;  2RHQ B;  2KCN A;  5JJL A;  1VQH A;  2K50 A;  3CCE A;  2MUY A;  1STY A;  4OGQ C;  1I94 Q;  2NVX H;  2BE5 D;  1R9T B;  1I50 B;  3K7A B;  3I4N G;  4YCU A;  4DUZ Q;  2YTY A;  3M4P A;  3M7N A;  2WFW A;  4MN3 A;  4F87 A;  2XNA C;  1A3V A;  1P8L A;  3CPF A;  3BVZ A;  1WTV A;  1NY4 A;  3T1Y L;  3I73 A;  4A3B B;  4QUF A;  2KED A;  3I70 A;  4FP5 D;  1ESR A;  2RSO A;  4DAP A;  5FLM H;  1A62 A;  3Q0A A;  3J7A F;  3HOU G;  2B39 A;  2R92 H;  2QKI C;  2A69 C;  4K14 A;  4NXN Q; 
#chains in the Genus database with same CATH homology
 1J8I A;  3A7L A;  5CBE E;  1CQF A;  4LK1 C;  2JP1 A;  4KHZ A;  3V2T A;  2AUJ D;  3GD7 A;  1JOO A;  1RF2 D;  2R92 B;  1HPC A;  4Y7N B;  2J0T D;  5JPN C;  4ZAI A;  4FNF A;  3TZD A;  1ESF A;  1X3Q A;  5E4X A;  1KNE A;  3DWP A;  1HQM C;  5EBD A;  4A3J B;  3TP6 A;  3VA7 A;  1T5E A;  3HOX B;  5KEE A;  3CRK C;  5CV8 A;  3RZO B;  4BWG B;  2NVX B;  4B9X A;  5JEA J;  1EY4 A;  2A6H D;  3MVV A;  4KJO A;  2O5J C;  2WAQ B;  3HG9 A;  5A2Q E;  1S5E D;  2L9H A;  1E2V A;  1DOL A;  2F0W A;  5C5M A;  5FK9 C;  2JA7 B;  4FXG C;  1SMY C;  1B53 A;  3A55 A;  4U67 3;  1AZP A;  1BOS A;  1CT1 D;  4TQU S;  1QJO A;  1Q1B A;  4EQO A;  5C4Z A;  1OXS C;  1SJH D;  2B2V C;  4KY5 A;  1A2T A;  4QF4 A;  2XRQ D;  2R7Z B;  1IKL A;  1JR0 D;  2NUC A;  3C1E A;  1EYD A;  1GUW A;  4TRD A;  4QUC A;  1YNJ C;  1NCV A;  1B44 D;  4KTA A;  1F9Q A;  3HOY B;  1O78 A;  3LWE A;  4OHJ A;  2DN8 A;  1PRT B;  5C0X H;  2J4X A;  1SBB B;  3A7A B;  2R93 B;  4FYD A;  4RGT A;  3NHH A;  3OW7 A;  2WIN B;  2WII B;  1LT6 D;  1WTQ A;  4HCS A;  5CV6 A;  2DY8 A;  1PTO D;  1SJE D;  2Z8L A;  2KUM A;  1SEB D;  2AUK A;  3D6C A;  4RHR A;  2RQX A;  4AYB B;  4X3S A;  5CV9 A;  3S2D B;  2JYO A;  5AFW A;  3PO3 B;  1ET6 A;  1UEA B;  2Y0S B;  1II3 A;  3C3L A;  4XT1 B;  1EWH A;  1FD7 D;  1XYI A;  5I6W A;  4RHS A;  3AMU A;  1Q3L A;  3RUZ A;  3M4O B;  2BA1 A;  4K8J A;  1SND A;  4PNY A;  2NZ1 D;  1AP0 A;  1SYG A;  5I4D A;  3NXW A;  1O80 A;  4Q0F A;  1CI3 M;  1U4M A;  4H7B A;  1H9R A;  5BN4 A;  3EQL C;  4HMJ A;  3TBI B;  3NWT A;  1SNO A;  4LAA A;  2Z4I A;  4H0L C;  3PUX A;  3BYT B;  2PZT A;  1TVX A;  4LMQ D;  1O7Z A;  2PCF B;  1WTR A;  4B08 A;  2ID0 A;  4KI0 A;  4IUV A;  4ZKB B;  4HSP A;  4C3H B;  5I2Y A;  2M9V A;  1KDC A;  5NUC A;  1GXD C;  3MXU A;  3QOL A;  5IGC A;  1VMP A;  1NSN S;  2R61 A;  3K5L A;  2EE1 A;  5D3I B;  4KY7 A;  1SYC A;  1ZXT A;  4KK7 A;  1AZQ A;  4RGM A;  3BDO A;  4DA2 A;  2F0G A;  2G9H D;  1I3Q B;  4S3S A;  1EYA A;  1OO9 B;  3J80 E;  1IYU A;  1V43 A;  2IPK D;  3DWQ A;  1CM9 A;  3D3R A;  1WTX A;  2PYK A;  1IKM A;  1V8Q A;  2I46 A;  3Q22 A;  3ND8 A;  3HOW B;  3I91 A;  2CVR A;  2WP8 J;  1HA5 A;  2XSC A;  1FNU A;  2WKD A;  2F0L A;  2FIN B;  2XRS D;  1LO5 D;  1GUT A;  3I8Z A;  3L3O C;  5C44 B;  2MPM A;  1ROD A;  3PUW A;  5JPM C;  2B8G A;  3P20 A;  4WRD A;  4BY7 B;  2EPB A;  4OO1 G;  2N55 A;  3NQI A;  1TS3 A;  3OPO A;  2DNE A;  5A2Q L;  3A8I E;  4YIJ A;  4K2L A;  1RTN A;  1SXT A;  1PTO H;  1TR5 A;  5ELF A;  5M5Y B;  3HGB A;  3T53 B;  3VYT A;  4OO1 H;  1EZ8 A;  5EQ0 A;  3LX0 A;  1KTK A;  2E2H B;  1Y8N B;  1JQY D;  4KHV A;  3MWY W;  4C3H G;  2OXP A;  1DOM A;  2D62 A;  2F0H A;  3NBI A;  2L11 A;  2K33 A;  4KN7 C;  2LMC B;  3TP5 A;  5DNF A;  1IW7 C;  1NR4 A;  2M00 A;  4CGY B;  3S1N B;  2H1E A;  3PUZ A;  3S2H B;  3P7J A;  1TS4 A;  1B3A A;  2F1M A;  3PUV A;  3HOV B;  3MEH A;  4FF1 A;  2CHB D;  5IGG A;  1JWU D;  5HUR A;  4M1U B;  4ZLT F;  2PMZ B;  1EY7 A;  5K5P A;  1SSO A;  3GV6 A;  5IIF A;  1QE6 A;  4J6H A;  4F8M A;  3I4N B;  2A6E C;  3SEB A;  4QCL A;  1SE4 A;  4BY1 B;  3OMC A;  4CJ1 B;  1I4G A;  5CV4 A;  3Q6S A;  4IFD J;  3J7Y W;  4KJN A;  1JE4 A;  3D4W A;  3JAM E;  2NN6 G;  5C3E B;  1CHQ D;  1GUO A;  1R4Q B;  3PMF A;  2EY5 A;  1PTO C;  5EKK A;  5EKL A;  2PQE A;  1DD2 A;  1NAP A;  2QIL A;  2NVT B;  1FYC A;  4HAE A;  4A3G B;  4H13 C;  4DF7 A;  1I4X A;  2IL8 A;  1G6Z A;  3V05 A;  5C6A A;  3T4A C;  3QIA A;  1AFP A;  1G2T A;  4XQJ A;  1EFI D;  3W2D A;  1MBY A;  3QOJ A;  4BS9 A;  1BCP B;  2B2U A;  1GUG A;  5BN3 A;  4DAV A;  3CU7 A;  3RZD B;  5FLX E;  4J1M A;  1TS2 A;  1LTS D;  2LS0 1;  1PRT F;  2E75 C;  2SDF A;  2RDH A;  3H6M A;  2KA7 A;  5IOC A;  1BDO A;  1PFB A;  3GTJ B;  3VR6 A;  1DJR D;  3S16 B;  1S5D D;  2PW5 A;  3IFD A;  1I4Q A;  1CTM A;  3D6W A;  1TQO A;  1D5Z C;  2M2L A;  5F2D A;  3EA6 A;  2WKC A;  2F4I A;  2JA5 B;  3BG3 A;  3I3C A;  4HMI A;  2D9U A;  1WTO A;  1W6J A;  4A3E B;  4L63 B;  2F0S A;  5ELB A;  1M4V A;  2MGS A;  5EBC A;  2WV6 D;  3SK5 A;  2JEA I;  3M4Y A;  4EGV A;  3DM1 A;  1ET9 A;  4C3J G;  3ONA B;  1F2Z A;  1Y8P B;  2K5W A;  3PO2 B;  3TP8 A;  1RCV D;  5LL6 X;  2FHT A;  2XVS A;  1ZYR D;  2A5H A;  4O1N A;  3R2T A;  2ZXR A;  2RKS A;  2BDN A;  5KYI A;  1U4R A;  5CV7 A;  1EWC A;  3T51 B;  3NSW A;  1H9K A;  2K6A A;  4RFB A;  1BCP C;  3PV0 A;  3S14 B;  5KRU A;  5DEH A;  1CHP D;  1WD0 A;  2FJ2 A;  1EQT A;  3W3A A;  2E2D C;  2FFK B;  2RVL A;  1CK1 A;  1Q8I A;  2HCI A;  2FMM A;  1U9R A;  3MXP A;  4WJW A;  3VR5 A;  3T13 A;  3C46 A;  1STN A;  4IN3 A;  3FKI B;  1PFM A;  4B9W A;  1RDP D;  2F0K A;  1DZ1 A;  1ENA A;  2O4X A;  2OEO A;  4KKU A;  5D3D A;  4BBS B;  3MHB A;  4QB4 A;  5C5L A;  3TZU A;  1TY0 A;  2K05 A;  3HS0 C;  1HQR D;  3KBG A;  3NWS A;  3MZ5 A;  3WDN A;  4DXG A;  2JEB I;  1VMC A;  1Z47 A;  3EFX D;  1EU3 A;  4PMW A;  1UNS A;  2HDM A;  5KNB A;  3E0J A;  1PZJ D;  3C2P A;  5IT9 E;  5J22 A;  4A3M B;  1PRT D;  1TKW B;  5KND A;  3ITP A;  1PTO F;  2PNR C;  1TII D;  4BBR B;  1NUC A;  1IL8 A;  3L9A X;  1SNQ A;  5M9O A;  3SE0 A;  1S5C D;  1LTI D;  1D6E C;  1EY5 A;  1HCZ A;  3BZD B;  3DUZ A;  1BUV T;  4C3J B;  2CQA A;  4MHE A;  5E3F A;  1G91 A;  3PUY A;  4KMU C;  4IFD G;  1ENF A;  1TWH B;  3H09 A;  3IL8 A;  3LWU A;  3BYY B;  5J39 A;  2RBM A;  1LTT D;  1B4O A;  5CR3 A;  2O2L D;  5KNC A;  5I6Y A;  2EYP A;  1SNM A;  2NWG A;  4GZY C;  5T1G A;  1D1K A;  1SAP A;  3M3Y B;  5COY A;  2FMC A;  5KGU A;  5E1F A;  1CZG A;  1KDA A;  4ZQ3 A;  4ABN A;  1TWA B;  3EVQ A;  5J1Z A;  4NDX A;  1PLF A;  1TWC B;  1PMR A;  2K28 A;  1G2S A;  4Q5V A;  2VXW A;  3T16 A;  5COR A;  5C0X J;  2HCC A;  4HN7 A;  4XDX A;  4XYQ A;  1EQV A;  3I4M B;  3R3O A;  5C4H A;  4LJZ C;  1X3P A;  2EY2 A;  4KKS A;  1STB A;  1QOH A;  4A3K B;  1C4Q A;  1ZEQ X;  3KLS X;  3TDQ A;  4N9P A;  4ULL A;  2A68 C;  3SXH A;  1CA5 A;  2DNC A;  3ND9 A;  5ISR A;  4DAY A;  2NVY B;  1STH A;  2Q8T A;  4NMZ A;  1I4H A;  4DU9 A;  4KV6 A;  1XWE A;  2A6H C;  1STE A;  4HED A;  5EJW A;  1F9P A;  2KOL A;  2XN9 C;  5CMD A;  5DM6 3;  3VYR A;  3LNN A;  2HUG A;  3S1R B;  1QB5 D;  4ZUI A;  1KDB A;  3FRP B;  4JK1 C;  2EJF C;  2X69 A;  1SDF A;  4EQP A;  4RKB A;  2YU9 B;  1BR9 A;  1HFG A;  2IX3 A;  1QIL A;  2MHV A;  2BDO A;  1K8M A;  3GTM B;  1HA6 A;  5JJZ A;  1H9S A;  3TP7 A;  2EVB A;  2B2Y A;  1ILQ A;  2O5I C;  3KBX A;  2A68 D;  1PFN A;  2ZT9 C;  3VR3 A;  1BNZ A;  1I4P A;  3DMU A;  2QF7 A;  1AN8 A;  2KHS A;  1A2U A;  3VYS A;  4EQN A;  4C3I B;  1CA6 A;  2NTS A;  5C4X B;  5K36 H;  4ID6 A;  1W6K A;  2L5T A;  2EYH A;  2XWJ B;  4OIJ A;  4X3T A;  2K03 A;  3OWE B;  4IZ8 A;  2CW0 D;  4I65 A;  1JIC A;  4PMC A;  2BOS A;  1UAP A;  2F3V A;  3IAY A;  2PO4 A;  4OL7 A;  5IGB A;  3L7Z C;  4HSV A;  4XQQ A;  3BS1 A;  5E4W C;  1OXU A;  1VCI A;  2ICE C;  4A3D B;  5I2X A;  3F2U A;  3H3V C;  2X6L A;  3EJI A;  1JOR A;  1SYB A;  1K83 B;  2EOT A;  2B8F A;  4CJ0 B;  1VF7 A;  2SEB D;  3J80 L;  3NTH A;  1BCP F;  5EPL A;  4U68 A;  4IAL A;  2K5Q A;  4OO1 I;  1Q12 A;  5C4J B;  1TS5 A;  4FO2 A;  4KD4 A;  2B2T C;  2KEC A;  5DM7 3;  1FR3 A;  2JE6 I;  1KNA A;  3NUC A;  2B2V A;  3FEW X;  3IFT A;  2IX1 A;  2E2I B;  4CJ2 C;  2B2W A;  2A74 C;  2I07 B;  4ZYS A;  3WOE A;  1YNN C;  3K6O A;  3KLR A;  4RCN A;  3GTK B;  2NN6 I;  2QDB A;  3OMG A;  1PZK D;  4V0B A;  3RD4 A;  1F9S A;  1LV9 A;  1TWF B;  3OOC A;  3R8B A;  3GTP B;  2F0Q A;  2K7V A;  3X3N A;  4KKT A;  1E2Z A;  2A73 B;  1LT3 D;  5IOD A;  1V1P A;  2EDG A;  5EKI A;  2JSO A;  3MFY A;  5HGT A;  4F7X A;  2CW0 C;  3M85 A;  1QG7 A;  1SMY D;  5KYL A;  1R4P B;  1WVL A;  2K32 A;  2QCP X;  3HZX A;  1PXU A;  1FNV A;  1Z6H A;  2N88 A;  1JCK B;  1BF4 A;  2EJG C;  4WOR A;  2KQ3 A;  2G9D A;  5G3L D;  3O13 A;  3OSO A;  2SOB A;  1S4Z A;  3D4D A;  3K0Y A;  1JWS D;  3K58 A;  1MSH A;  3NP8 A;  2F0J A;  2L55 A;  2TMP A;  1MSG A;  1MD2 D;  3TSS A;  3A8K E;  4ZKC B;  2F0O A;  1TT2 A;  3A56 A;  1U4P A;  4ZRZ A;  5KIX A;  3CHB D;  5ELE A;  1LTB D;  5M3F B;  1F9R A;  2KCC A;  2EXZ A;  1T5X D;  1KLG D;  2Z4H A;  1Y1W B;  4KD3 A;  4XYO A;  1XX8 A;  2F3W A;  1LTG D;  4CBV A;  1JOK A;  2AQ2 B;  1PRT C;  1HRJ A;  1MGS A;  3MFG A;  4BA1 I;  5JVG 3;  4X3U A;  1HTP A;  4XIG S;  3OWF A;  5K36 G;  4XT3 B;  3RMH A;  1SE2 A;  2OF1 A;  3HP3 A;  3GTL B;  2E76 C;  2F0D A;  5I9O A;  3SK4 A;  4K5X A;  1RTO A;  2WB1 B;  1FNW A;  3NQT A;  5FKA C;  1DON A;  2BE5 C;  2J7Z A;  4IUQ A;  3NPP A;  4XTC S;  2VNU D;  5FLX L;  3HOU B;  3J81 E;  2WAC A;  1WD1 A;  3UI2 A;  1STA A;  4EVO A;  4XQN A;  4H44 C;  5JOB A;  1DYQ A;  2F0T A;  5T1I A;  2NBF A;  1YNN D;  5LL6 S;  1ZKO A;  4IUT A;  1HHV A;  2NYZ D;  2EYO A;  1GOZ A;  4KY6 A;  1FGB D;  2MP1 A;  1RHP A;  3I90 A;  3M7G A;  2LFN A;  3NTI A;  2EYF A;  2NTT A;  3G6J B;  3OIP A;  3URY A;  5JEA H;  4FF2 A;  1IHZ A;  2RDF A;  1EIG A;  2K04 A;  3VYU A;  3PIP 3;  3MXG A;  1S5F D;  4ZUJ A;  5I9P A;  1C48 A;  2IX0 A;  3SHL A;  1RKN A;  3C1F A;  4HTH A;  5D65 A;  1BXT A;  2SNS A;  4K6L A;  4IFD I;  4V19 0;  1B1Z A;  1Z7T A;  2XIW A;  4NW2 A;  3FMC A;  4RA8 A;  1XXG A;  2C5C A;  3BVM A;  3N6R A;  1SYF A;  3QWN A;  4RWS C;  2E74 C;  4K2K A;  2F0P A;  3S1M B;  1EOT A;  4NKL A;  3FDT A;  1I6V C;  5FOB B;  3P1H A;  5IT9 L;  1JWM D;  4TKO B;  5EGT A;  2IJ0 A;  1Y1V B;  5IGF A;  1EY0 A;  4FVM A;  5ELD A;  3KK7 A;  4NP5 A;  3BDL A;  5CGK A;  1RD9 D;  1V1P B;  3HRZ C;  1LAB A;  4P2C B;  2RDG A;  4N9T A;  1A6X A;  3H91 A;  3J7A V;  1RJT A;  1V1O A;  4RGN A;  5JEA G;  1Y8O B;  1HXY D;  2L1B A;  1BO0 A;  1M8A A;  2L0C A;  4CKE A;  1EY8 A;  3SK6 A;  2L12 A;  3GTG B;  4R9W A;  1DM0 B;  4DNR B;  5IGD A;  4G7Z C;  3GV3 A;  1PTO B;  4ODG A;  2L4N A;  1HUN A;  1O7Y A;  1C8C A;  3V96 A;  1WCM B;  1DCZ A;  1EY9 A;  1QWY A;  4PQX A;  3HEJ A;  3KF8 A;  2LKV A;  4BA2 I;  2F0F A;  4G7O C;  2JA8 B;  1GHK A;  2C9O A;  1D1I A;  1DXM A;  4XXE A;  1OXT A;  2EYJ A;  1H9S B;  1H9J A;  2IT1 A;  4G4K A;  3DWA A;  3S17 B;  4TSS A;  3OHX C;  4G7H C;  2K01 A;  4L6T B;  3Q24 A;  1K8O A;  4C56 C;  4IQZ A;  1LTR D;  2KVM A;  1EY6 A;  3DEO A;  1U4L A;  1AEX A;  3FVQ A;  1TY2 A;  1BQQ T;  3K5N A;  1F2Y A;  1QNK A;  1F2L A;  2EZV A;  1EEF D;  2LY7 A;  3GQB A;  1J9O A;  1F2M A;  3J81 L;  3TN2 A;  4OIK A;  2F0V A;  2ZXO A;  2PPB C;  1EEI D;  4ZK9 B;  3D8G A;  2RA4 A;  2AQ3 B;  1EIH A;  2JXM B;  3K5M A;  2VUM B;  2A6E D;  1D2B A;  2AQ1 B;  3Q23 A;  2D2C C;  3VR4 A;  4UDU C;  3VR2 A;  2IWH A;  3I72 A;  5TSS A;  3S15 B;  4J8Q A;  2TSS A;  1BBX C;  4QIW B;  4FF4 A;  1LT4 D;  2ICI A;  2E2J B;  1X32 A;  4IFD H;  4C3I G;  3QJY A;  3K57 A;  3ZYY X;  1MI2 A;  5FO7 B;  2F0U A;  1LAC A;  5M3M B;  5C3W A;  5EPJ A;  1PDQ A;  1SE3 A;  3T56 B;  5CYU A;  1GJX A;  1HFN A;  5A35 A;  4IUU A;  5C3X A;  1OXX K;  1CZW A;  1XTC D;  4RKL A;  1NR2 A;  2YYZ A;  3K5O A;  5ELC A;  4CKB A;  1UUP A;  2RSN A;  3BDC A;  3DHQ A;  4CKC A;  1TWG B;  3CRL C;  4MIU A;  4CHT B;  1A3T A;  5JAV A;  2K5D A;  3MXN A;  1H9M A;  1HTL D;  1VDZ A;  1B50 A;  2PZW A;  1B9N A;  2V4D A;  4IUR A;  4R8N A;  4DK0 A;  4WFN 3;  1O7L A;  1OXV A;  3NBH A;  3TME A;  1ML0 D;  4DN4 M;  1ICW A;  3GO5 A;  1BCP D;  5C0X G;  2AWO A;  1D5X C;  1STG A;  3ERO A;  3GTQ B;  4ME5 A;  1VF5 C;  4K5V A;  4A3F B;  2Q8R E;  2B2U C;  3NE5 B;  3SR1 A;  1E2W A;  2Z1C A;  3NK9 A;  3OIQ A;  1HUM A;  1JC7 A;  4K8I A;  1ONL A;  2H4O A;  3RLF A;  1QCB D;  1GUN A;  1GUS A;  1G8Z D;  4PMB A;  2PW7 A;  1B9M A;  1SNP A;  4O42 A;  2A69 D;  1CQV A;  2PZU A;  3FPP A;  2VB2 X;  3N52 A;  3DEP A;  4JBW A;  1SYD A;  3QO2 A;  4C1N K;  3VA5 A;  2BA0 A;  1TU2 B;  1KAA A;  2F0N A;  1Q90 A;  1WTP A;  4DXF A;  5FO8 B;  1PYW D;  3GP7 A;  3MAQ A;  5M5X B;  3DXJ C;  5M5W B;  2B2T A;  4KN4 C;  2IW3 A;  3FPU B;  5D14 A;  1E0B A;  4C2M B;  2AWN A;  5IGE A;  2VB3 X;  2NN6 H;  4I7Z C;  1WTW A;  4A93 B;  2ENB A;  4C1N I;  1Q1E A;  4R8I A;  1KAB A;  2X6G A;  5JVH 3;  4Z9C B;  1EL0 A;  3E5S A;  1ILP A;  3A8J E;  1A15 A;  2R3Z A;  4FXK C;  2ZXP A;  3PIO 3;  2GA4 B;  4L8J A;  3S9W A;  3R93 A;  4RCO A;  3WOF A;  2B63 B;  3IKJ A;  1AW7 A;  2Q8I B;  3A54 A;  4DK1 A;  4IUP A;  3JAM L;  1LT5 D;  2D5D A;  4IUN A;  2SNM A;  4F88 A;  1SYE A;  1EU4 A;  3K59 A;  5BN5 A;  3MTS A;  1PZI D;  5CBA E;  1JOQ A;  1ZYR C;  2R6G A;  4HR7 B;  2DY7 A;  1D5M C;  4ILW A;  3H94 A;  4DFA A;  4A3I B;  2OT2 A;  4RH6 A;  3CKI B;  3AU7 A;  4RAU C;  5FO9 B;  3BVG A;  5C0X I;  1EZ6 A;  2KEE A;  2EJM A;  3I4L A;  1QNU A;  4M8A A;  1G29 1;  1I6H B;  1JB3 A;  3MC0 B;  5G3L F;  2K1B A;  3D31 A;  1CFM A;  2F0I A;  4PV1 C;  3KLS A;  5CV5 A;  4DGZ A;  3R2I A;  1L0X B;  1KLU D;  3SVM A;  4DNT B;  1GHJ A;  2NVQ B;  3D4R A;  2JA6 B;  3SK8 A;  3SDZ A;  3G7L A;  4FXD A;  4G57 A;  3ERQ A;  4RGO S;  4FF3 A;  2EY6 A;  2B2Y C;  1SNC A;  1L0Y B;  2HDL A;  3U9O A;  1LLR D;  2NB0 A;  1YNJ D;  3U9S A;  2EY1 A;  3HOZ B;  2QEJ C;  3S1Q B;  5CC4 A;  2F0E A;  4K5W A;  1SFO B;  2F03 A;  3P75 A;  1A3U A;  2KJX A;  5EPK A;  3QG1 A;  4X3K A;  1S5B D;  2EYM A;  1B2T A;  2XWB B;  2BCO A;  3NTK A;  3CQZ B;  5LHY 1;  3E6Z X;  4K6D A;  1LTA D;  1I4R A;  2HQE A;  3HKZ B;  2EYL A;  1DOK A;  3GTO B;  2MJ8 A;  1IW7 D;  1ENC A;  3H0G B;  1Y69 U;  3AB9 A;  5DAU A;  4HCE A;  4QMG A;  1EYC A;  3X3M A;  2F0M A;  1F77 A;  4E6I A;  3KUP A;  2B2W C;  4UAI A;  1IYV A;  3MA2 B;  3QB3 A;  2KCN A;  2MUY A;  1STY A;  4OGQ C;  2BE5 D;  1R9T B;  1I50 B;  3K7A B;  3M7N A;  4MN3 A;  4F87 A;  2XNA C;  1A3V A;  1WTV A;  3BVZ A;  3I73 A;  4A3B B;  4QUF A;  2KED A;  3I70 A;  1ESR A;  4FP5 D;  2RSO A;  4DAP A;  3Q0A A;  3J7A F;  2B39 A;  2QKI C;  2A69 C;  4K14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...