2CW5A

Crystal structure of a conserved hypothetical protein from thermus thermophilus hb8
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
255
structure length
235
Chain Sequence
b'MRPVYFLSDFGLEDPYVAVVKAVLAEAPGPAVVDLAHALPPQDLRRAAYALFEALPYLPEGAVVLAVVDPGVGTARRAVAALGRWTYVGPDNGLFTLAWLLDPPRRAFLLEPPGRDVFAPAAAHLALGLPPEGLGPEVPVETLARLPLALTEGPEGEVLTFDRFGNAITTLLRAPVGGFVEVGGRRVPVRRTFGEVPEGAPVAYLGSAGLLEVAVNRGSAREALGLKEGMPVRLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial fluorinating enzyme homolog
publication title Crystal structure of a conserved hypothetical protein from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 59
structure length 235
sequence length 255
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2cw5A02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2cw5A01
2C4UA 5B6IA 2Q6OA 2F4NA 4CQJA 2WR8A 2Q6LA 2C5BA 2V7WA 1WU8A 2ZBUA 2V7TA 2C2WA 2C4TA 2C5HA 2V7UA 5FIUA 2CBXA 5LMZA 2V7XA 2ZBVA 2Q6KA 2CW5A 1RQPA 2V7VA 2CC2A 2Q6IA 1RQRA
chains in the Genus database with same CATH superfamily
2B5OA 1UJ4A 5BPHA 4XGKA 3E35A 4U39A 1H8EA 1ZC3A 2IYXA 3L7KA 4Y6OA 2IYVA 4BX8A 2I1LA 4LG1A 4ANFA 1QFZA 1JL3A 1O87A 3LIPA 2PEYA 1OBOA 3C8DA 2J3JA 4YS6A 2ZSHA 3LOPA 1MMFB 5A6VA 3Q38A 1C8BA 3WYBA 1YQDA 3L8CA 4OB6A 1DL5A 2QRJA 3SBEA 5DFAA 3I39X 5FNVA 2NUTB 2HHJA 1A9PA 4FD2A 1FJ2A 1XXHE 2IPAB 2VI5A 2XADA 3KFVA 1T6NA 3AJAA 4FUTA 4IHAA 4GQNA 1G5TA 4PZDA 5JJCA 2BGGA 2P4HX 2AUNA 3G59A 1VGVA 2H31A 3JWHA 4RFSB 3TL3A 2IIBA 2QAGB 3QKRB 5HCIA 2WJ3A 5FH9A 1M2HA 4BE4A 2CJPA 5DBOA 3WLTA 1OC2A 1Z16A 2XWPA 2P77A 2ZAMA 2LZJA 1HDRA 2I76A 2IV7A 1RFGE 2P9GA 4AJ1A 1ADCA 1ZPDA 3Q3AA 5EIBD 1UKCA 1X80A 2GAJA 4DQLA 1LUAA 4I5IA 3S5UA 2C3PA 4R4JA 3LFTA 1CNEA 1PFWA 3PIRA 2NO4A 3CEAA 3WK6A 4CMKA 4NOJA 4QO8A 2WWRA 1J0EA 3EY4A 5ICGA 3LQYA 3DDZX 1HI9A 4IGFA 4KXFB 4JJ7A 1K08A 1U90A 2QD4A 4G3XA 2O8EB 3CCSB 1SBQA 3VYTB 4A2QA 1HNZB 3H2GA 1QVGB 1UDWA 2K6GA 3BCDA 4GMGA 3GHHA 5CR9A 4KKVA 4R8MA 5AXAA 4E5YA 5JBNA 1H2EA 1TGYA 2RBKA 1LFDB 1FNMA 1G0NA 3IIEA 4I1VA 3OZTA 1G3UA 2QKYA 1PJ7A 3GGCA 2DCUA 4P7GA 4PQFA 3SIRA 3WLEA 4LQLA 3WK8A 2IPXA 3DE7X 1IPEA 1JFVA 2AG5A 3SOZA 2OV6A 1XMIA 1ZHFA 2VH5R 1H2RS 3JXEA 4WZBB 3WWEA 4HUJA 4D4MA 3SDSA 4LSWA 3O31A 3DPUA 3LDUA 5SZHB 5KSOA 3F9IA 1P80A 2P7HA 1TQDA 2IY8A 4C0KA 1UZNA 1U1CA 2HDNB 1A97A 1Y8CA 4HE6A 2BEJA 4KE6A 1JLMA 3SI7A 3RC8A 1VTKA 3ZDYB 1NYRA 3WJAA 3PUVA 1WHTA 5CDHA 2HYIC 1BYIA 2R6GA 2IYFA 1A4IA 1EP9A 2Y67A 2ONZA 5EXXA 3FYHA 3ZW9A 1E5LA 1J7KA 2MINA 4PSCA 5AHXA 2J6CA 1UK7A 2NO6A 2IEBA 4ZMBA 5SYNA 2J3QA 1XZIA 1HTBA 2DWCA 5TPZD 2PLRA 3V8PA 4QT0A 1UIMA 2JAUA 1R1DA 4GOXA 1QP7A 1DGQA 1Q3TA 2FX5A 3VSDA 3A1DA 1KY5A 1PJZA 1VE7A 2BAGA 2VH1A 2G4LA 4OEHA 4MAFA 4NE2A 1NW6A 4G23A 1R0RE 4RH3A 1YOVA 3EXHB 2YINC 4LKOA 1MNAA 3PGLA 1E2DA 1EE2A 1AT1A 1PQYA 1S72B 3R6KA 1DMRA 2YASA 1YUMA 3NNSA 1N92A 2BFCB 3KAPA 5F5NA 3L7NA 4YAEA 4W99A 3BQJA 1NFFA 1U2DA 3F7MA 4WN9B 2CHUA 4HXEB 1AXEA 4NMHA 2WWTA 1ULAA 1X77A 2PPLA 1TW3A 1YU6A 2AYXA 2R44A 2X23A 4PPYA 1YX2A 4CN9A 4H6WA 3BAZA 1HYBA 2P4SA 4L74A 2ATXA 2FPKA 1GFZA 4Q1FA 4BMCA 4HR7A 2EEZA 3AM4A 1UEJA 1IWOA 4FYIA 4KH0A 4WK0B 1Z4QA 2DC1A 4DLYA 1Q7BA 1QHYA 3BZWA 3G8YA 5EAIA 4INOA 5GIOE 2V9CA 3CLRD 1ZUWA 5CJ2A 4JLPA 4LZOA 1YFZA 1TVCA 2UZ0A 3JR7A 3KPJA 3ISTA 1GA1A 1LJ8A 2CFTA 4KV7A 2PMEA 4EPRA 1ZM7A 4YMSA 1BDHA 1GCGA 4KJXA 4JC0A 2ZSAA 4XPIB 1HPLA 1XWIA 3DHNA 2CXXA 3WWZA 5KTYA 2V9PA 1MH1A 2WFZA 3EVAA 1F60A 1PW7A 4FR2A 4NS4A 5DYNA 2QB5A 4E2ZA 1XZLA 3OFSA 3U5TA 5AK5A 1T2NA 4OKIA 5JAIA 4LYHA 4JASB 3K9NA 5A8AA 2XQKA 2ZRPA 1CB7A 5E1MA 2A0WA 3OCXA 4YGXB 2VFAA 2CNWD 3V33A 4AM8A 1O6BA 3I28A 4NPHA 3A0RB 2FQXA 4RVOA 3V7YA 2JL1A 4FZRA 2EF1A 5KIAA 3LTNC 3LXXA 1MO2A 2PY6A 4J3JA 3D3KA 4D8YA 2I9KA 1GAXA 2FSVC 3K5WA 1Y6ZA 1Q0HA 3CJQA 4OK5A 2FF5A 3H9EO 4MO9A 5CX1A 3HFJA 1CJUC 2OVFA 3PGA1 1VMKA 1XB2A 4XRGA 1DINA 2IYQA 4PPFA 5DBEX 4C4XA 3O47A 4DUZB 1ZGAA 1CUBA 4UEQA 3QPDA 3TZQA 1UMCA 1F6BA 3E2MA 3RODA 1ZA2A 4XM3A 1PNTA 2HXGA 3Q3CA 4ID3A 1IG3A 4BUZA 4FFVA 1VOTA 3G5AA 1S3SA 3KSUA 1XDGA 4FPXA 4CQNA 3DV0A 1KIMA 3JWPA 4A82A 4DSNA 1AKYA 1UC9A 2FXIA 1RZUA 2FJUA 1RJWA 1R5OA 4FR0A 4IDEA 3KQTA 4YJ3A 3TM4A 2ZE7A 3SSNA 4ZZIA 1NRJB 1QFYA 1N1MA 2TMDA 2Y1FA 3CPHA 1I6KA 3LV8A 4AN1A 4WXEA 1DFIA 4ZOLF 4DM7A 2X86A 1NURA 2EJUA 1BQ3A 4Y2HA 4HLUC 3SHOA 4D92A 2X76A 4F2HA 2CYAA 5M29A 1T2EA 1X9HA 2CCGA 3LYAA 4BFXA 5EJ5A 2GVNA 1A2OA 1XF1A 4O29A 3ZDDA 4JOSA 3O7MA 1CWUA 5KNDA 2AOTB 2ZRFA 3TXXA 4QVAA 4Q9NA 1F8GA 1JIUA 4AP5A 3I4FA 1HMYA 1AHHA 1XYVA 1G6OA 1SPBS 1FSGA 4EUFA 3GUCA 3HMQA 2WMOB 3T0IA 3WJ2A 4EKEA 4ZALA 4MUGA 1ZUIA 1SOUA 4FGSA 1VZ2A 4YRTA 3PICA 4ZVSA 4XLEA 1XA4A 1XN1A 1JLRA 4HGRA 4PWYA 4JU8A 2B1JA 5BRJA 2V7QA 4OBBA 3A3YA 1QYWA 2JLUA 5AW5A 1LQUA 1Q44A 3GNLA 1W9XA 1PN3A 4LGVA 1SCKA 2EHDA 4GKKB 1ZD5A 1ZVKA 1YSCA 4DQKA 2PX6A 1ZYUA 4MPDA 4WDQA 1IUPA 1Z0IA 3HL0A 1JVBA 1RI3A 2JKVA 1COWA 3CKLA 3KS9A 2GM4A 3WNCA 3R0ZA 4GM0A 1ETHA 4V3BA 4AZTA 5I4BA 3EASA 2IHNA 3HTXA 5H9VA 2FOIA 1E9BA 2J5XA 1SKQA 1JB9A 1UC8A 4JUCA 5L3QB 2WUEA 3MAAC 2C9OA 4R0MA 1IEQA 2IEYA 4LX8A 1J99A 2PX3A 3SF8A 1C4KA 3GDWA 3PLNA 4PE5B 1U11A 1VYTA 4DPKA 3VPCA 5CG1A 1UWKA 1KMQA 5IT5A 1E7YA 2D0DA 3R23A 1M8KA 4GP9A 1C4OA 4ZDKA 1W9HA 4KL8S 1HDIA 3AY3A 3WMWA 1EGVB 2WP8J 4FT4A 4R1MA 2P9CA 3RAEC 1DIBA 1ISPA 4RK7A 3WZMA 3WGNA 1W87A 2CLDX 4B7ZA 1YA6A 3AR5A 3EZLA 2Z56A 5LPNA 2IODA 2AJDA 2GTPA 2PTHA 2PX2A 2AZDA 3IEMA 4NATA 5ALUA 5I6DA 5TT0A 1KZ9A 3FWZA 1XDWA 3OCVA 1P18A 3CRZA 3JQ8A 4ZCLA 3R3JA 5EXPA 4Z0PA 3SSAA 1MZVA 5TPZA 1FU7A 3LT5A 1SA0A 3SZMA 1JXAA 1YZKA 3BIFA 3C41J 2BTQB 2WSSD 1CRQA 5I9IA 1P61B 5FT9A 3EZGA 3OEHD 2ZI4A 3EAFA 4H4CA 2VG8A 1J8VA 2ZZGA 1AY0A 1JHUA 4OIFA 2NU9B 3KSBC 2G80A 2QUKA 4D4GA 2I2FA 5ALJA 4D8WA 1XZGA 2PSJA 2VJDA 3MF4A 3VPAA 4BX9A 5C37A 2F1KA 1AQJA 1B74A 4WXHA 2VWHA 2RAUA 3LBHA 2VPQA 2W9XA 4B46A 1T36A 1J2YA 1V5EA 1HZZA 1K97A 3AR2A 4I8DA 4WK6A 3MEQA 1B8PA 1F8XA 4M8LA 3U9LA 4QQNA 1GHTA 5FTMA 3RTDA 3GT4A 3ZH9B 1S2IA 3QU4A 3P2IA 3QBDA 1YK1A 5JO9A 3VZRA 5ITZB 3PKZA 2BBOA 3SYRA 3VU9A 1TPYA 1T25A 3G8CA 4ALMA 4OMDA 4JMLA 3ZBPA 2AFHE 4ZKDA 2DPMA 4F4FA 3V2IA 1FRNA 3TSOA 3WDSA 3ASQA 4B3TB 5CLIA 1UMKA 4X9XA 4QVIA 2HMAA 1IULA 3FCEA 3STWA 3IVRA 4JAVC 3ABRB 1DFHA 4PTYA 4WV3A 3KDPA 1JE0A 3QIVA 1SCUB 3RU2A 2YNMC 3V1YA 4AX8A 5LNK1 1UBFA 4MV7A 5EMKA 3M3DA 1WOMA 4UUOA 5GONF 4NYJR 3UGJA 3PHJA 4RZIA 2H2AA 2BGKA 4IDPA 2E7ZA 5F1KA 5G0UA 5BNFA 8ADHA 2YWHA 4OJYA 5ILGA 2DBRA 1S6YA 2OBMA 2J30A 2B25A 5FA6A 3UCFA 3DGFC 1MTOA 3MXTA 1A9SA 1VRVA 2V3WA 2HJRA 2CFRA 2ZVDA 4IUYA 3TIGA 4DL9A 1FA9A 2VAWA 3S2UA 5TQ2B 2PRIA 5DK4A 4BNWA 2BE9A 4PU0A 2X6YA 4DKJA 4N39A 2GN4A 1PWXA 4JXZA 1GAJA 1UQTA 4GL2A 4WEOA 3N07A 5GP1A 1ZK2A 1OBHA 2C04A 1KMHB 3K9FC 5H80A 4FYJA 4QXOA 2G7ZA 4HRVA 1HFWA 4CN8A 3NGLA 1PJ5A 5BORA 1VIAA 5DYIA 2CL5A 2RSLA 4PGMA 2XY4A 3QBTA 1BEEA 2PKRA 2PQ0A 2YHUA 1QBGA 4YJKA 5JQGF 5LOVA 2IXBA 2ACKA 3TZBA 4OUKX 4JI7B 3H9NA 4MVXA 4Q47A 1AKEA 4Q7QA 2SNIE 3G2PA 1VKJA 2RJNA 3V8BA 4A8TA 2WUGA 3AUAA 3L1JA 4CRWB 5KYWB 3NJ8A 3MBIA 3AHHA 4KGZA 1JMKC 3UAOA 1RU3A 3W5BA 3BXXA 4EF4A 2VCYA 3FMGA 4DR3B 2C54A 1OXKB 1FJXA 1POXA 1HT3A 1DKNA 2DUUA 3KQSA 4PYQA 3NJ4A 4JD5A 4KGVA 1EXNA 4W6QA 1G20B 3KLBA 1NU6A 1DI0A 2JFZA 3KJHA 4MIKA 5HILA 1YJBA 3RM3A 5I48A 3X1ZA 1QG6A 3THOA 4QU8A 4BN5A 5JSFA 1C41A 1MAHA 3QFCA 1K66A 4JUAA 4RKEA 4EO4A 2PQ2A 4K03A 1HDCA 3AI7A 2CVPA 5CFPA 2PZFA 1PR3A 4DLRA 1XZCA 4QUJA 2MT9A 2QX4A 3F9CA 1P0MA 5AKLA 2E18A 5J59A 2F4VB 1AV6A 3KDAA 2PUHA 2N1MA 3BSFA 4G65A 1R10A 5JY6A 4CHTA 4YREA 1KZ4A 4CCYA 1NBIA 4MGZR 1E1MA 2JCYA 2X2OA 3K0EA 3K0AA 4I8XA 4M8KA 4TKOB 4FP9A 4MUEA 3LQ1A 5JATA 1I30A 2BUCA 2FPXA 5HCUA 3KPWA 4PLTA 3PNOA 3VR4H 2XVZA 1WBDA 2VNIA 1LLUA 2B4TO 3E5HA 3TDMA 2WTUA 1M6VB 1Q6ZA 2A94A 3OM8A 3HY4A 3HZHA 3D8SA 4MWOA 1D9ZA 1G3IA 3FYDA 1N57A 1OGJA 3ETHA 3G5MA 2BDUA 2WSBA 3GXOA 3IV7A 1MRZA 2XMRA 3KZVA 3E9QA 4D9HA 4CJXA 1CUAA 4EBFA 5C2JB 1SQ0A 2YWEA 2IPMA 3EWNA 3I45A 2NU7B 4PRYA 4WVFA 4A8HA 1Y3CE 3OO0A 3MTDA 1JILA 1M2JA 3MTGA 1DWUA 2P4QA 3GO4A 1DO8A 1B6RA 2NO9A 4NOMA 3S70A 3SSMA 1IHMA 2UYQA 3KXLA 2BBTA 3UENA 1ILWA 1ES9A 5LIPA 2DXIA 1E92A 3C5VA 4NYJQ 3T9CA 4JX9A 2R4UA 4ED9A 5CVUA 4L9SA 5AUOB 5JDCA 2PZKA 3U61B 1F12A 2JIRA 2NACA 1RBZA 2RAFA 3VR6D 3DCYA 5G3YA 2HQSA 1NIPA 1XK7A 2RHTA 3DE6X 2A9FA 4GYKA 2BFBB 3IUQA 3F3SA 2NUPB 4RF3A 4AYXA 1BA2A 3CZCA 2F1JA 1W4ZA 4G9GA 4DSOA 1CUIA 4K9KA 1XCOA 4L7QA 1Z73A 2DSTA 2CW5A 3HGMA 4HDRB 3ZDBA 4PZZA 2ISCA 3BCFA 1X39A 4BQQA 1EFUA 4OK3A 1GPWB 2AQ8A 3TUIC 1YB5A 2IXGA 5E6TA 4M7OA 5F77A 5C51B 3OTIA 2O8NA 4WBSA 3UMMA 5T41A 3VTFA 1G6KA 3NDJA 1JR3D 3V4VB 4C7KA 1SWWA 2WSSA 1KJWA 3NP7A 3VDMA 1ADYA 4A6DA 3OEHA 1H9BA 2JVIA 3NC1C 3A6EA 2K2WA 2JS7A 3KYBA 1TJ3A 2A59A 1RWQA 3OCCA 1KMNA 3I9KA 2J0QA 5ECGC 2H63A 5D2CA 4IDAA 4I19A 3HN7A 2H4JA 1D2HA 1XKTA 3B12A 3A25A 1UFQA 4CKYA 4MPPA 3RASA 5LQUA 5MFPA 2PD3A 1QHFA 5BUZA 2XTAA 2QGGA 3N9IA 1TK9A 1WSWA 1A9OA 4C7JA 2Q3JA 3KWLA 1L5KA 1QB8A 3Q72A 3OEED 3KUDA 4ZREA 2ODAA 3VDRA 2HJ9A 3HL4A 5KO2A 1PFVA 1SUBA 3UJHA 4Q21A 5KUTA 2H08A 3D6VA 3I2HA 4E94A 4HWRA 3KR9A 2WB2A 5E8RA 4O59O 1LVHA 4MSUA 1YDEA 2BTEA 4ZEWA 2LW7A 3BB3A 2VF5X 3I76A 3Q8LA 4YK7A 3G0OA 2F1LA 1IU9A 3KHSA 1ANKA 4Z4SA 3A1UA 3Q7EA 4GYYA 4LRWA 2ZJAA 4QYSA 4D9MA 1U5BB 5BV8A 2X9VA 2CFOA 1XWWA 4O5OA 4EFKA 1J22A 3AOGA 3JWIA 2BRUA 1K3TA 5ALIA 2GJ4A 2ZRLA 4W9MC 3HSYA 1DJQA 1ETUA 4UOEA 2Q9BA 3H3JA 2W2MA 1AQLA 1EVZA 4W5JA 5GM2A 2YQ5A 2IE8A 4DARA 3OETA 3RWOA 3QUBA 4JSYA 4QBGB 3BWVA 1TD1A 2WT8A 2D0PB 1W4CA 3PGKA 4ZZ2A 2FH5B 3IR7A 3BMNB 3WADA 3ASSA 1NMXA 5EWMA 4EARA 4D46A 2QVXX 5JCOA 1G7RA 5ESDA 1BGVA 2C8VA 2VVTA 3WKEA 4ZQCB 5K4GA 4WLOA 2PUGA 2WYUA 3FI9A 3LNTA 1VP9A 5JAUA 2OM2A 2PUVA 3ENWA 4NENA 3O8QA 1GZVA 2I6SA 2CXSA 1CR0A 1E2LA 4GEKA 1RVV1 3CFYA 5IRCD 4F3TA 3CZMA 2A9KA 2H59A 3A6GA 3P97A 4MW1A 2WU4A 1VG0B 5FA5A 4E70A 1II9A 5IJZA 3AF6A 4O4HF 1GJRA 1DOAA 3HFRA 1MUUA 5KKNB 4XSVA 3PEVA 2ZB7A 1NDUA 2OZPA 3HWX1 3WGYA 4E51A 3RABA 5U9CA 1E9RA 2C1EA 2OSVA 1L5YA 2VSYA 3ELDA 5I9LA 1QYXA 3N74A 4Q1EA 1XQ9A 1MHTA 3FUUA 2W43A 5JSZA 3M6IA 3NASA 1U28A 2WMNB 2D6FA 2Y99A 1IPFA 3NRJA 4RSGA 5DTJA 2MWMA 4PGGA 5IDXA 5K0BA 5FORA 1FNBA 1DU4A 1YJCA 2XB6A 5C5IA 3O0DA 1NQOA 2G6TA 3QVXA 2WHQA 4AZ0B 1WCIB 2GARA 3OM0A 5FTWA 3VFDA 1XTRA 1YRYE 1LU9A 2Q5FA 1FVFA 2RGYA 1JDUA 1UDCA 1V0FA 4KACA 5EXTA 4BGIA 1TJ4A 3ZD9A 3A6JA 1TYEB 3D7MA 5JYEA 2XBLA 4P98A 4WTOA 2ZSBA 1C0LA 3NV9A 3UTDA 4AMUA 2PUCA 4ENWA 3A8KA 1IC6A 2P90A 3R41A 1K7EB 2YYAA 3CZRA 3DBHB 3E2PA 4CODB 1F1JA 5B1EA 2AJBA 1V5WA 1Y1SA 1GKYA 4HV4A 3W6OA 1F3LA 2B7LA 2LR0A 2RAPA 4QG7A 5CEFA 2RD2A 2Z9DA 3AINA 4H77A 2VDQB 3IKVA 3MJTA 3QA9A 1LS1A 1LWOA 2ZSDA 2KYRA 4HAYA 1MAAA 1LKZA 1QAMA 1DBIA 1XRJA 1GP2A 1PZGA 1CFJA 3IAS6 1G1AA 3IHWA 4PAWA 4Q05A 3GN1A 3KLNA 3RVJA 2EZ4A 2OO5A 1R4NB 3A58B 3QUSA 3EQ8A 3ED5A 1RCUA 3RCBA 1YZTA 4UAUA 4ZIRB 4QBFA 1KQSB 1ZC4A 3TPCA 4AJEA 3OKPA 1Z8NA 2QTBA 4ZO6A 1WSBA 1JHRA 5F7ZA 1G42A 1Q91A 1YE8A 3WB1A 4MKGA 3LOQA 2C9DA 3F4BA 3R3YA 3S7ZA 2GJRA 1CZHA 1TDJA 3G6KA 4EHLA 2E4AA 5DBIA 1CQJA 1OX4B 2CSXA 3MWDB 1NE2A 4RNDB 2NSLA 2VTBA 1Q14A 2O5VA 2WK1A 1ZRNA 1AVTA 5G0WA 1I14A 3PP8A 3W34A 4EGSA 2D13A 2X3UA 1KR5A 4B3BA 3A37A 3FRHA 3UQYS 2WILA 2PT7A 3MJSA 4XOTA 4LRXA 4X61A 5CJPA 3ZCQA 1KI4A 3D3EA 4PAMA 1G38A 1SHUX 2VTDA 2F3SA 3MUNA 5HZKA 4DSTA 4MKXA 3ESBA 4GLLA 2BFNA 2ASEA 1I3CA 5ESWA 3VR6A 3AUTA 1DEXA 1YK0A 3A9CA 4KGXA 1Y0YA 4F4UA 2IHUA 3AFNA 5JCZA 3KETA 1XA0A 1BC5A 4EHIA 3BDIA 4ENUA 3UK0A 2IUFA 4YT8A 1XZPA 5DVZA 4I9UA 4AJJA 3WLJA 1BH6A 1DJOA 3QHAA 1REQA 4N5NA 1QNLA 4GU5A 5FOTA 2FG5A 3TKAA 3JQDA 2JJ8A 1TM7E 1RFLA 1T3TA 3AKYA 1CD5A 3K2QA 4CF6A 4DA4A 3HLKA 4M36A 5FHQA 1WZNA 1CZRA 2P2YA 3KHKA 4W5HA 3TUJC 3A0UA 1ML4A 2ZW9A 3BMQB 1WDMA 2ADOA 3MWEA 5LA6B 5LQRA 2HSWA 3C3JA 4OLHA 5AM0A 1L8XA 5AM4A 2I3BA 4X7CA 2XNHA 2PXCA 1BXGA 5EMJA 4JBIA 5FPTA 4UC0A 1LI5A 1JR3A 3K70C 1WOOA 4MCHA 5EXDA 4I9GA 2DAPA 3AL2A 3KOYA 5IZCC 2PKYX 1W36C 2RE8A 2R8RA 1GDTA 1RACA 3QYFA 1OT3A 3IELA 4LS3A 1Y3FE 2ZUSA 2HA3A 4DOMA 2C4WA 4PS0A 4RO0A 4AAYA 4CEJA 1Y4SA 1N6NA 3OPOA 4EQ6B 3CPEA 3NR2A 5HGXA 4PAQA 5EIXA 3N87A 2EP7A 5E6UA 4PYKA 4YFYA 3VZBA 5L3SB 3I1FA 1G8HA 2WKRA 3PI7A 3VHLB 3TLCA 3FIJA 1P2GA 3LQKA 3DMNA 4XD2A 4DYHA 2UUPA 4F6CA 1JIQA 1DRVA 4EB6B 4XWKA 2CB0A 4FTWA 3E70C 5TVGA 3OEEA 1F5SA 2RGNC 5JJLA 2XH8A 1NWHA 3F6YA 4C7BA 3W2HA 4A1FA 3G88A 2XA2A 2QRNA 1ENZA 2FW8A 4S12A 3TZCA 5A9TA 3A05A 3FSEA 4C3UA 2QJWA 3AEKB 4JSTA 3RVBA 1Y6QA 2C4TA 3PHCA 3WNQA 1Z7BA 2AG6A 5IC6A 4PBTA 4ZDIA 4S24A 4O2RA 4IIJB 1L4FA 4NBSA 2ZTLA 4IYJA 5ALDA 2W70A 4Z4EA 3Q7TA 3CZPA 4M0PA 5AVSA 3K30A 4P53A 1ZG3A 1LA2A 4XNFA 4L15A 4BIMA 4K28A 2Q5LA 3GDFA 4UJ3A 1SVMA 5ICEA 4MLDA 1Q7GA 1OBVA 3RAFC 1BS9A 2PSDA 3H8VA 4KYVA 4NBUA 1ATIA 5DO9A 1EAMA 1EVQA 1U1FA 4KYUA 1Q0ZA 2ACWA 4OJKA 1DZIA 2P79A 1N9KA 2ID4A 2O0MA 4HJXA 2FMTA 3UF0A 1EEXB 4N7JA 4R3WA 2QV0A 3WKBA 4X05A 2JFWA 5DSXA 1ZD8A 2WG2A 4NZOA 4NZZA 1Q6YA 2QJTA 2J31A 3T95A 1QHHA 1VPVA 4M6WB 4Z4QA 2NPFA 1NXXA 1PK8A 1K7FB 3BWEA 4HTFB 3O94A 2OPHA 1HX7A 4MMZB 2NSYA 1Z0KA 2JLRA 5CW2A 3OA2A 4KXLA 3SE0A 1BWSA 3RHZA 5LKRA 2ABWA 3IAFA 1Q0QA 4JBXA 3RNLA 1QO9A 2X0NA 3E81A 2AMYA 3HCNA 1QZZA 2ZI6A 3PNYA 2PD6A 4Q1DA 2OGTA 3QF4B 4NBNA 2JANA 4OKNA 3RC7A 1DTWB 4C4OA 4N41A 3ABZA 4F0JA 4DQDA 1U8FO 2ZJ4A 2ZWAA 1TTQB 2QRPA 4EHKA 4NV0A 2QXUA 4E2YA 4F45A 2QV7A 1M1ZA 5C1IA 5JAZA 5DM1A 5LSAA 1UMDA 1PTKA 5CNKA 3FVVA 2X8BA 4HN9A 4PZPA 4CW7A 2DR2A 8AT1A 3UN1A 3VYWA 4CDRA 1NUAA 1YS6A 2O2XA 4J1NA 3OZFA 4EPWA 1P74A 4Q0MA 3THXB 1FK8A 1SJ9A 2P9HA 4Q00A 4JITA 4RZXA 4X7PA 5I9NA 1QM5A 2YYSA 4US1R 3MCVA 3HUFA 3GBSA 1KL7A 1SXHA 4OGWA 3VVLA 1QFSA 3U4IA 6REQB 4PYRA 1PZHA 4HQLA 4Y98A 1FFXA 1J25A 2B1QA 3UMRA 2CDCA 3RIGA 3HR7A 3SXUB 3PYXA 2D3LA 2CN1A 5SY6A 2SCUA 3KSAC 2I87A 4UUPA 3ZWDA 3OQVA 5C7IO 2AOWA 5K2MA 1NV8A 3K09C 2VP0A 2A5YB 3O4FA 5KQRA 5HR5A 2EYUA 3BD6A 2FMKA 4MS4A 4G8BA 3IVMA 2WF6A 4NEQA 1NVBA 5HBGA 1Z29A 2WWHA 1S01A 3AFOA 2GT1A 3ADKA 3RD5A 2N1BA 2AZMA 5IW8A 1UBCA 3DEYX 4CCAA 4JEIA 2AUTA 3ONDA 2C77A 4BATA 3TLAA 3NHYA 3FLMA 1S3FA 1QCCA 2FW0A 4LXYA 4QODA 2FDCA 1HE3A 2YWXA 4BLQA 2F2TA 3OICA 1SXJD 3CGWA 4K9LA 1VE1A 4FHCA 1F2TA 4HSGA 3TLXA 1P4GA 3PYMA 2HSEA 2R8OA 3L7MA 3L7LA 3FFTA 4CKBA 4CE6A 3NVDA 3HKDB 4KN9S 3K4HA 3W5UA 4LISA 3ZI0A 1I32A 3RYFB 3PC2A 4R3UC 2F00A 4BMXA 1WPCA 2X7XA 2JFXA 2AD5A 1NBHA 4ZT7A 3E5MA 4RJTA 1FYDA 2GCIA 2ZR8A 3NOQA 3I6BA 4MQFB 3RSGA 3K8OE 1O95C 2EARA 4NJEB 2CLFB 2ZL6A 3IBYA 3OOYA 4RF2A 4ZAVA 5IBQA 4EGAA 4L3OA 5HOQA 2OGZA 5JZBA 1EUQA 3H1BA 4IJUA 3SE7A 4I4TB 4GR5A 1UIRA 2FFQA 1V6SA 2XQGA 1U3TA 3QVOA 4DLLA 5CH3A 1K27A 2I78A 2DYKA 2D5CA 2I67A 4EEXA 1T0JB 2QBYA 3DPSA 4DNTB 4G26A 4H35A 3U49A 4H1WA 2P2ZA 5IPFA 5LDGA 3TDNA 2CVZA 1JHVA 1MABA 3ICVA 3MINB 2V8BA 4P2BA 3QUCA 1DBQA 3TCXB 3J80A 3OTGA 4A0GA 1H6BA 4BXOA 3AZOA 4GGOA 1WLYA 2DEUA 4LJ4A 4MIYA 3BTVA 4ZQBA 4QQRA 3AETA 1AM4D 3AIKA 3A4VA 2RJOA 3O0TA 1ZLYA 2KWIA 2NTJA 4BX3A 3WBJA 1HT0A 3MJEA 3TEFA 3WFIA 5EPEA 4YCAA 3TQFA 2VK2A 1E3WB 4NTZA 3BTUA 2AOUB 3M6LA 3HSKA 2HF9A 3I5MA 5BVHA 2JLSA 3R5TA 1DKUA 1HUQA 4LV5B 3MCAA 2CVQA 2V03A 3EDQA 3B2EA 3CMMA 1PGOA 3C70A 5D3MB 4A2PA 2CMGA 4IIDA 1SR8A 4II2A 1E99A 4DEYA 4B09A 1ZRHA 5C1OA 1RADA 5JANA 2WLSA 1J2EA 1BMTA 2GDJA 1A4RA 1RI4A 2VSOA 4XJVA 5JC1A 4DQVA 3LCRA 4H7PA 5EE9A 2HA2A 4FHDA 3JWGA 3SQNA 1NAHA 2EDCA 2HR1A 4AIIA 3ZYZA 4JZKA 5FBZA 4N3BA 4OATA 1BCRB 1IB6A 2AYYA 2R4QA 2Z95A 1U1IA 4HX5A 4PR3A 3W4JA 5CA0B 2BMDA 3O3OB 5JNRA 1DDOA 1N3YA 3DLTA 4Y2JA 1G8FA 5FWXB 2XPCA 1EWQA 1LPNA 1UKEA 3UAVA 1SBNE 4Y6RA 3VTZA 2X9LA 1ESZA 1A5BB 2VDWA 1DFGA 4MJ3A 4N18A 2ZCVA 4IKEA 4HH1A 4HQFA 4HFNA 2JGKA 2OHFA 3VO1A 4AFNA 5CB6A 2OCDA 4YRPA 4GUAA 1J0BA 4KWCA 5AW8A 4ZQGA 2ZTSA 5BNZA 4OYYA 1LSUA 3WMEA 3WLPA 4X6UA 1MBZA 3MLBA 3WYGA 1Y0RA 4XTRA 2ZJ7A 4L0CA 2X6WA 4US0R 2IWRA 3WHPA 3HHEA 3THWA 4FJ0A 4R2JA 1M8PA 2PL9A 2RI0A 5LXTB 1T4GA 2PL1A 1NN5A 4JYBA 4EUSA 4MP8A 3NV7A 3V1MA 4DJEC 4RPHA 1HV8A 4C7OA 2V7UA 4WWVA 2FG7C 1LZKA 4M1ZA 3NH6A 3P94A 3DEFA 3U37A 2P62A 4XUEA 5AQEA 4LYYA 1T9GR 1UBOS 2BUAA 3OMWA 3GFVA 5AJZA 1ODTC 2YOHA 3KZMA 2QU8A 4IEEA 2B3TA 4DLNA 3AXTA 4R1QA 1FP2A 1XCMA 3A9UA 2DPYA 5DTIA 3A1CA 2F8SA 3LVFO 1V1RB 2C07A 2GZDA 4IDOA 4W5WA 5G1PA 5HCNA 5A1TA 4Z4YA 4X41A 3HBNA 1EK6A 3DOIA 2ZE6A 4QL3A 2NU8A 3K1YA 5J63A 3OOCA 2IYEA 3BF7A 5JS8A 3L84A 1N8RD 4W8OA 1BGWA 5T4BA 5DTQA 2VJMA 2WG1A 3B85A 3ET5A 1IVYA 2LNDA 1QYRA 4EDHA 2GM9A 5ES4B 1RIIA 2NXCA 3BGSA 5CIQA 3Q7QA 1Q15A 2DFKB 3IR5A 5G4KA 4ZVUA 3VPSA 1O58A 4A23A 3UJ7A 3M2PA 3OOSA 4H1UA 1ZI9A 3F1LA 1OF1A 2A5JA 3N70A 3TUZC 3F98A 4G4JA 4RAQA 5IYRA 2Z1DA 5AW7A 1I7LA 5AIBA 4K1XA 4QYXA 2P3MA 3WL6A 3FHJA 3LU1A 4FKBA 1GSHA 5DNAA 1J39A 2PA0A 4G09A 4XI9A 3LX5A 1RYZA 5J5AA 3TBKA 4D9BA 1PLLA 1PTJA 4LPKA 3X2SA 1ZP6A 1WQ4A 2BW0A 3FW1A 3FDZA 1BQ4A 1XALA 1Q0UA 3MD9A 4KQKA 4EJ2A 4R8KA 3LT4A 2YIVX 3RVNA 2N9UA 3JD2A 4JJZA 3T12A 1C0KA 4JQOA 1WNFA 2YDXA 3QLVA 4UREA 4C6SA 3RB8A 1UADA 2YUIA 5K8IA 3TKLA 1AF7A 2Z8YA 3AWDA 2F90A 3V3TA 4W5QA 4CZ2A 2JFYA 1EK0A 2DFVA 2VXBA 4JLAA 1DWOA 2UZIR 4RETA 3SMVA 1IZYA 2WFLA 3PDIB 3ONEA 3A35A 4PYJA 5FBLB 3D8HA 1DARA 1NXSA 1NXVA 4IRXA 3PX7A 4UEJA 4C20A 3LXMA 4IEIA 3EIUA 4MLPA 2OAGA 1UPFA 2R00A 3WGIA 4C4RA 1QS0B 1BHSA 1VI5A 2HJSA 5K8UA 5DP1A 1Q0TA 2V74B 1E6WA 4CEIA 1SXJA 3KR1A 4FX5A 4MPRA 3W90A 4QGSA 1G7SA 1EFRA 4PO1A 1WVMA 3S28A 2YTZA 3EX7C 2A78A 4G5HA 4KXUA 3HVHA 3ICPA 4PLGA 3IT2A 4B1FA 2IS2A 3QEBZ 3W7VA 4WNYA 4KXXA 5GGXA 4WXMA 5TGDA 4RM3A 5MGBA 1PZFA 5K20A 1U5AA 2OM6A 5LZ7A 3GJYA 1YI1A 3RRMA 1NJ2A 1XZEA 5G0VA 5KOHA 4CIVA 4IIXA 3K0CC 2O20A 3PXAA 5BRNA 4BP8A 2C5FA 1E6KA 1IM2A 3PA8A 1LK0A 1Z0ZA 3PSHA 2X7JA 2XOXA 5DDIP 2O57A 2FNAA 4OJTA 1OAAA 4HEHA 3R7BA 3VHXB 4B2YA 1ZUD1 4HAVA 4MA5A 2J3EA 4RDXA 3FOZA 2ODEA 3NKLA 2OHGA 1JZTA 4JBGA 1IIRA 4KW7A 5MN6A 1VHQA 1MJGM 3ZZNA 5BR8B 1CVRA 2A86A 2AEMA 3IUNA 4CUZA 4XIFA 2G88A 2OXEA 1RXWA 3IJPA 4OJQA 4L9WA 2HPZA 4MOWA 5IVHA 1ODCA 3UC5A 1HA3A 3MTIA 2IITA 5D84A 1T1GA 4HNQA 2YJ4A 4N8DA 5AR1A 5G0SA 5I7AA 2ZUDA 5JWHA 4B0OA 3P9QA 3NI2A 4ECAA 3ST7A 1FDUA 5D3ZA 1FLVA 1ZA1A 3RQIA 3T4PA 2H8GA 1GUYA 3UIEA 1H1LB 1UJ6A 2RHDA 5DX1A 2ZB8A 3A1EA 4M1OA 2PH1A 5JNSA 1NJID 3BF8A 1F20A 2I8AA 5DN6A 3C7TA 2VZEA 2QRQA 4H27A 3RHTA 3ZY6A 4URYR 3JU3A 4AS2A 5TARA 1L7AA 3Q9SA 4UUBA 1CR4A 1BPLA 3KYCA 4LHYA 4B44A 2PGDA 2VH2A 4KQ1A 4PM4A 4AMGA 1EHIA 3QOXA 1F8FA 1UT6A 2BFWA 2ZG6A 3C39A 4AY5A 5LVAA 2A5LA 2F3PA 3OESA 4R83A 1SB8A 5ECWA 4GLOA 4BWYA 2HIMA 5JW6A 4DG8A 1JUDA 1M8GA 3MQFA 5JAMA 4C6RA 4BNGA 4I55F 3TIXB 4YRJA 2V7EA 1NRIA 1QGYA 1I51A 3CC4B 3I53A 4PPQA 3QKSB 3U4HA 3S0JA 5TF0A 1G9XA 4QASA 4MR8B 1WPXA 1Z15A 1TK3A 2WYOA 2ZS9A 3IFSA 3INRA 4H0CA 1TYCA 3IESA 1K3FA 4GMFA 4W5TA 1I7QB 1E96A 1F06A 1ZUHA 1GXSA 1O54A 1CZOA 2C2YA 2G71A 3I4LA 4P4UA 3KAJA 4BWGA 5CVCA 1JZSA 3W4KA 1QIHA 1R15A 2VT7A 2X7HA 4Y0AA 3SYLA 1BJRE 2CV2A 4NH0A 5BUSA 4C43A 4YJ2F 3K0KA 1R0YA 4Q3DA 1J09A 2PMDA 4CTNA 1GTSA 2B30A 4RELA 4RVHA 1N8NA 1JSXA 4X24A 1W88A 3W4IA 3FYUC 3VU1A 1A4XA 2ANBA 1K7SN 4QD3A 1CRZA 1XPUA 1L7QA 1WMBA 2DQYA 4KAFA 5AJTA 1TEVA 3KOXA 4V0SA 3JQGB 3ESYA 4B2PA 5CDGA 1TA9A 1BWRA 1LQ2A 2BHLA 1Y5NA 2ODBA 3HN6A 2IY9A 5ELLA 5P8WA 3P71T 4RLFA 1FSFA 3HLTA 1VBFA 4NK5A 2FN8A 2PMKA 1GQQA 3WLKX 4M2LA 4J49A 1N7IA 3FLAA 3MHPA 1TPZA 4JLBA 1AXGA 1OFTA 4IGAA 3VPXA 5FBWB 4OHPA 4UXHA 3RTEA 2NXNA 3NYIA 4EATA 1F48A 3JQRA 3E9YA 1OPRA 1GL7A 4FFSA 4LMPA 1V37A 3PHHA 1YC5A 3QVGA 2A5FA 5EIFA 1WZ2A 5AFSA 3A3BA 4AQ7A 1WIWA 2ECQA 3GT0A 4OCZA 2VSFA 3ZY3A 2VHCA 1Q1QA 1I3OA 1KH1A 4MW5A 2NO0A 2QTWB 3EMDA 4ZV9A 3ZTYA 4R2KA 3OZWA 3LKDA 3EAQA 4OSOA 1SIWA 3HKBB 3MB8A 1N1GA 3O75A 4EJSB 3CESA 2X4DA 1UPCA 3F8SA 4DV3B 2Q7OE 1QJCA 1UPAA 1T3SA 3DL7A 5DTEA 3WK9A 4DIUA 1KFJB 2ZYDA 1YR2A 2GN1A 2I33A 3CPWB 3R5KA 4QDJA 1XEXB 4WXYB 2BBWA 3W3ZB 2JI4A 1E98A 4G0XA 2HPVA 4N0EA 4RYLA 5ALFA 3ROMA 1R64A 3LUCA 3AP1A 1DC4A 2QZ4A 2B34A 4J2HA 3BH7A 3ZI4A 5FTNA 4PO8A 4V0MA 3TQRA 4DMMA 2OLJA 4DVGA 3F6RA 3LPDA 1O3YA 4H6VA 5FOQA 1RQPA 2VUIB 1SXQA 3EPJA 2QK4A 3NT5A 3T3IA 3GLIB 1G55A 2ZDQA 5JUWA 4NWIA 4UQPA 4AF6A 4WZKA 1NWCA 2BGMA 3QI7A 3UWPA 4H7EA 4A8JB 2FEXA 3OVMA 5FB3A 3H5NA 3NIBA 4ABYA 3ZH2A 2IHJA 1J8MF 3R6LA 3WRXA 1N5KA 2OFOA 1WU8A 2AC2A 1XJCA 2E4WA 5K09A 3HB7A 5CXXA 2ODNA 3W8NA 5G1NA 4DCUA 4MWEA 2LXNA 1YQEA 4ER6A 4DC0A 3QXJA 3IT1A 4OM7A 5A5VA 1TQ2A 1Q57A 4FGKA 3A3OA 4F4JA 5CDSA 2DOGA 2EKQA 2F8MA 3EEFA 2G36A 4GXRA 4JUFA 5M3BA 2JLWA 3CH4B 4KDRA 4Q03A 4UATA 4H1VA 1WCXA 3REFA 5B57C 1VPTA 1RAGA 4UD6A 2OGSA 1OB0A 1DKMA 3FFXA 3GPCA 4YP6A 3PT5A 4HYYA 2UUAB 3HB5X 1S5PA 2IWHA 1ODIA 2PUTA 3D4LA 4BQEA 3L1VA 3P2OA 5EVCA 1NW4A 1YQTA 2GESA 3MAGA 2BN4A 1RHMA 4MI9A 1M1YB 4UZFA 1L4EA 3N2NA 4M99A 5AHKA 1RM5A 3COJA 3GAZA 3QF7A 1NBEA 1VSTA 3I6IA 4NBRA 4YJHA 1KAEA 1RXUA 1LC3A 1MQAA 2R47A 3IIKA 1GPNA 4NMMA 4R2WA 5CUQA 3TTVA 1NT4A 1SG0A 3V48A 3ZGVA 5LWQA 4B3RB 1A96A 1YACA 4IO1A 4F2WA 2XUFA 3HKEA 3I23A 4F92B 1K8ZB 5EFZA 1ISJA 1NY6A 2XUOA 1Z0JA 3A4TA 2Z57A 3K2EA 2HWYA 4CR6A 2O8CA 2F8LA 2HIAA 4GMHA 5EWJA 3UKDA 1ULHA 3QENA 4EA6A 4DQXA 4RHUA 5E2BA 1ZM3A 1KS2A 3HXMA 1FSPA 1F2UA 3BTSA 3EGXA 3F6BX 3KKNA 4BAUA 4RM0A 3GJTA 3AM1A 1QBKC 3JAKA 1QR2A 4QRIA 4TL7A 4GXNA 1PFUA 2FYTA 1S8OA 5FNZA 1E60A 3OT5A 4WFKA 1K8QA 3WAKA 5JMOA 1C14A 1G2OA 2PO7A 2I4IA 2YJTD 3KG2A 4YHBA 3I32A 4HUQA 4X91A 4D7AA 1W6UA 2P6OA 2A9RA 4NJMA 1V16A 4BAZA 2FR0A 4ZP1A 4JK3A 1TNDA 5AM5A 1QP8A 2B92A 2XD9A 3BGOS 4F5YA 4R2MA 1WWKA 3J7TA 3LPLA 1V43A 1ZM4A 5BWOA 4XCXA 2B8WA 7MDHA 1LCIA 5KYXA 1NM5C 1JPNA 2LV8A 1CJBA 2PTGA 2CLIB 4WN3A 1A71A 3R7LA 1D09A 1VECA 3BQMB 3IOMA 4YYZA 5KNDH 5KX5B 3O8OB 5MN4A 4D4JA 3LMKA 4GGMX 3N8IA 4R1SA 2IXAA 5EOVA 1GUFA 1J00A 1GGJA 1G291 2GEDA 1OH5A 2CKMA 3FRJA 2APJA 2IHZA 3L43A 1AF4A 1KRXA 4ALKA 4EVSA 4DIMA 5JTTA 2CCKA 2UUOA 3AHDA 1UD3A 4M1YA 3RK0A 3QEMB 1YMVA 1Q5PA 4FS3A 3WQBA 1UP7A 1QX4A 2PMBA 3GFRA 3OJFA 1ZNYA 3PWTA 4Z3DA 4A1OA 3HC7A 1JR2A 4MYSA 5B3JA 1F14A 4EW1A 4ZOQI 1RYEA 1B26A 1TKAA 5JVDA 4RA9B 1TX4B 3MC1A 3K6KA 2VHEA 5F2EA 5H9WA 1KOGA 1ZINA 3DAOA 3INGA 1O08A 5FPQA 4CIAA 4LEIA 4EITA 4NPCA 3HDVA 4MTCA 1A7KA 1U8ZA 4W7HA 3CEPB 1SC4A 4R9RA 2ZJFA 3LH5A 1KAHA 4MS1A 3U3DA 3EVTA 1JLHA 2YXDA 4OP2A 2FEAA 4Q3LA 3VISA 4C2AA 2RHOA 4LJYA 3HXPA 1F38A 1JG1A 1X6VA 2IGTA 2PR2A 3JARA 2ZRQA 1Y5MA 1NUTA 4JBWA 1MC8A 1PWZA 1X38A 2XUHA 3QJ5A 1ZICA 4UM8B 4UVEA 5EJGA 3T5DA 2HB6A 3L8MA 3B82A 3Q9UA 4ARUA 4EB8A 2QXTA 3L01A 2CT8A 1V3VA 1BFUA 4YIKA 3LO8A 2ZYUX 3A8IA 3N6VA 1ONSA 2Q41A 5ALRA 1U2GA 5HJ2A 2NGRA 2WUWE 4AO7A 3OKAA 3WZLA 1D0VA 1GQFA 1RR6A 4RHCA 3QTLA 2DJ5A 4BMSA 4R1NA 2RG1A 2RGCA 4N47A 2NYVA 4UMVA 1TO2E 2CXUA 4MVWA 3MGCA 1WPGA 4N01A 5MF6A 1D2NA 1GDDA 1YHZA 2N47A 4B6SA 2D4AA 3E03A 4FC7A 3C6ZA 3DUFB 5KVCA 3WFZA 5A4DA 1QGDA 4ZCPA 3VSAA 2RARA 3HA5A 3TNDA 4JDUA 3RU9A 1V7ZA 2E49A 5EJEA 2I65A 3WNZA 4EFMA 1K4KA 3ELWA 3K4QA 3EQ9A 2O7VA 5GOZA 2O4UX 2QF7A 1GG9A 2YN2A 2E4VA 3AYZB 1PD1A 3UXMA 3AI2A 2P0EA 4P0QB 4WZ6A 3LWBA 3QYJA 5AI9A 4EKNB 5DKFA 3VTKA 4Z1OA 3EIEA 5E6SB 3CX4A 4OD0A 1DUSA 2CFIA 4QYIA 3VZDA 2Z2ZA 1U31A 2XJ4A 2IH5A 4QSHA 1O5TA 4EHJA 1X15A 1WCWA 1JQDA 3EZFA 5E4FA 3PHGA 1SHZA 5E4TA 2JFOA 1IZ7A 2O52A 1L7NA 1UWVA 2WOJA 3L6OO 4WAUA 3T7KA 5FTKA 3C0KA 1GG8A 2IC5A 3VOBA 3WWCA 3ZGXA 1OLSB 3WAGA 2VRCA 1U7PA 2GN0A 2RI6A 1WQ1R 2JFVA 1UKAA 2FEOA 2ZAGA 3FNGA 2J3DA 3JW8A 3LA8A 4LCEA 1NJSA 3QOFA 1FVOA 3H3XA 4I1OA 4QPDA 1MZPA 1AKWA 2X77A 3OQBA 5ABPA 1EJBA 4IXDA 4JLKA 4CKWB 4DDWA 1S02A 2CDNA 2Q2OA 2IDKA 2IXTA 3AERA 4UHBA 5EZYA 2Q3MA 4IDHA 2PKQO 2BEKA 4LYAA 1R6AA 3GBPA 4BRZA 3O9VA 3FHTA 1W5SA 4C89A 5KTSA 1WUKS 3RYCA 1YZ3A 1J2TA 4WCFB 3D2AA 5DNEA 1KSHA 4OSPA 5C9ZA 2VK4A 2QTVA 5JLJA 2YJ6A 1WXQA 1CZUA 1F3OA 1SFRA 1IQ0A 1ZQ9A 2FXVA 3ILYA 2IP2A 1XCPA 5IK2A 3D3JA 3KT6A 3T15A 3SYNA 3EEBA 1YT5A 2O2IA 1ZZGA 2ZS7A 5AHWA 4BRUA 4BTLA 1D6SA 2WP0A 1JKXA 2G06A 5JH7B 1E0KA 5JRDS 5EKXA 2OBTA 2XMDA 1H5QA 3R74A 3U6KA 1KO8A 4J0FA 3B8HA 2CRVA 1EDBA 2W2QA 5KAPA 3TLJA 3JTMA 3DE1X 4P1ZA 3U3XA 1Z35A 1T2CA 4O63O 4XQCA 5LB4A 4MA0A 3DVLA 3IKLA 4P3OA 4D25A 3HBAA 1B15A 5K51A 4H08A 2FWMX 2PFSA 4JMPA 5TX7A 3NHSA 2DGDA 1IJFA 2Q28A 1NKSA 4LY3A 2CL6X 1SH7A 1R8SA 4ZYWA 1R3DA 4MQUA 3MTEA 3G0GA 3GFGA 4ZVNA 3A14A 4RTMA 2EFDB 1X7WA 2CDBA 2GZ2A 2Q5QA 3GJ6A 1G7TA 4KDEA 1D9XA 1HMPA 1AN0A 1WO8A 3MS4A 1ZW6A 2WNIA 1XC7A 2D3TA 4A10A 4BP1A 1ORVA 3R5FA 1Q9SA 2WJZB 4L50A 1G21E 1UZMA 5HZAA 1U8TA 5E8JA 4MRVA 5J5VA 5SV2A 5B6JA 3QHQA 3PEWA 1CF4A 2YV3A 1ENPA 1LNQA 3E0XA 1WXHA 1D2MA 1EFPB 3N28A 2V5UA 4IOLA 4M1TA 4RZUA 4ETNA 3GJ8A 3CNHA 3LUKA 1BEUB 3QVLA 4BJ3A 4XR9A 5TQ0A 1N0IA 3QFFA 3BWCA 5FLYA 2KLHA 3KWMA 2NTYC 4AP9A 1JHDA 1NW9B 3RRBA 2XVXA 4BUCA 1D2AA 4D82A 3U81A 1H66A 2H5JA 5HUHA 1ADJA 4KRFA 4LF5B 2GBGA 2QLLA 3AJEA 1Z7WA 4JGIA 1Q1AA 5AJWA 1DLIA 1QHNA 1BMFA 2VC2B 4PBRA 3GH1A 3BHMA 5A2GA 2D00A 1TFRA 2FPIB 3HBFA 4IVPA 4MW0A 4S3MA 4YGYA 4BKUA 4TKVA 3H1FA 1IEWA 4UJ5A 4FGUA 1OLUB 4PLFA 4CG0A 4G8JA 4RPDA 1ISIA 5CCDA 1C7FA 1ISRA 3E2IA 1SG9A 2FRXA 2XT6A 3GGSA 3CMAB 1N0UA 3IJ5A 1M74A 3UJDA 4K81B 4MV0A 4A26A 1ILEA 4I1SA 4QXQA 4MDHA 5KYUA 2BELA 3VPFA 4RD3A 2R48A 3MUEA 4GH5A 2XXBA 3O3NB 3GF4A 5L7TA 2O59A 2PYIA 3NAGA 2V0GA 3Q12A 10MHA 2H3HA 2XKBA 5EGNA 3O8LA 3S3TA 3C1OA 4R69A 4EY6A 1N2CB 1I4LD 3PF9A 2UKDA 4NRDA 3RT7A 3VYRB 4NVRA 3D7NA 2UYGA 1V8BA 1IWBB 3BHJA 4UBOA 5F4BA 1ZK0A 1TC2A 3BIOA 4Y9RA 4PRZA 1PJCA 2ON6A 4R51A 1X74A 2MSNA 1WULS 5AJHA 3WYNA 4B83A 4EHNA 2B21A 4EL5A 1CNMA 4JEUA 1MHPA 3VR2A 1ABBA 1XCBA 3H2HA 1SEPA 1J5XA 5EZQA 4HMPA 3K6SA 2PGXA 1GV0A 2GPYA 3K1AA 3PRHA 4PSUA 2VPYA 2X0IA 3IAHA 3SQDA 3FPBA 2AN9A 1FBTA 5C31A 3RSOA 5KOIA 2IP1A 3Q1KA 3SIXA 4YCSA 2I03A 4LCJA 3G17A 4KPUA 2DWUA 2E37A 3OJEA 3VYSB 3CC8A 3KKOA 4HXYA 4Q9HA 1NRKA 2QRHA 9LDBA 2HCJB 5GV7A 5FHRA 4WOBA 3G2LA 3T7IA 2ZDHA 4RK4A 3QLJA 2JHPA 1GDHA 4IIUA 3MILA 3WIOA 2O48X 4Q12A 6AT1A 4TMZA 1PX0A 3GRRA 2XOKD 2BFDA 3L49A 5FNVB 2PWPA 2O2HA 3AU8A 1DIAA 16PKA 1U0FA 3S81A 3RF7A 4XWWA 2ZJ1A 3QE9Y 1YS9A 4Z9FA 1NRWA 4OXRA 3DXXA 3GRCA 1WV1A 4RDIA 3HO8A 1NP6A 1QVWA 1BXKA 3I9OA 4GOLD 3IMCA 4NHOA 1BN7A 1T4CA 4URFA 1RAFA 2OFXA 3BD7A 4UMEA 5DT9A 4AD8A 2AYZA 2H1SA 3UT5A 1I7DA 3NPAA 1N78A 3H8WA 3TEMA 3ZTWA 3VNUA 2D54A 2PQMA 2V3VA 3IAUA 1NR7A 3DMTA 1JU4A 2PXHA 2W6ID 1N34B 1NLUA 2NM0A 3B1KA 1UJMA 2R97A 4LXIA 3Q6IA 3ZWPA 4FLFA 3LZCA 1RM3A 4KQMA 3WX0A 3P2KA 3W5IA 4J0QA 1X80B 1IBKB 2FEMA 1GT91 5IEJA 1TF2A 3MTJA 1ZOPA 4DBVO 4DJDC 2FMFA 3CUVA 3HZZA 4HNTA 5JYCA 3TXAA 5H7XA 3V8MA 3PJGA 3TE6A 2C5HA 4B4VA 2WY2D 2H7VA 4NCHA 4QATA 5CYPA 1J42A 4ARCA 5AW4A 1DT3A 2HKIA 3ZKWA 2EIXA 1IHYA 1KJYA 1O97D 2DTXA 2HZ7A 2QAJA 5DZSA 3TSAA 3HPRA 4M1MA 2ZJBA 2MYTA 1ZWKA 5FWDA 4FB4A 2JN9A 2ZCUA 2MCFA 3V8NA 1HC7A 1SKYE 3PL1A 4G85A 3CJTA 2Z1NA 3OZSA 4UVGA 4DNXA 3IMFA 2LKCA 1QF9A 2HK7A 3GEEA 4AQYB 3ZDEA 2C96A 1S2NA 3KX2A 4B6PA 4CM9A 5JWOA 1PD0A 1Y1RA 5FOXA 2HMUA 4TLCA 4CEHA 3PENA 3GWZA 3IVCA 4DV4B 3ZUPA 3VNSA 4ZGWA 5C32A 1YIOA 5L95A 1LPMA 3IJEB 3MT7A 1JU3A 1CEXA 4XDZA 1VMEA 3PT9A 3JS5A 3Q3HA 4DB2A 4YPFA 3ZWNA 4F2DA 1DB3A 1WHTB 4FDUA 2OE2A 4EUHA 5HBRA 4CV0A 2GCPA 2X8LA 2WICA 1SBHA 1D4ZA 1KI2A 4YC7A 2XYGA 2I3DA 2MINB 2VTEA 3EHDA 2RB5A 3FJYA 4G81A 1RJ9A 1ODFA 3STVA 4C6TA 3OH8A 4UW9A 3WZ2A 4LJSA 1P2VA 4NG4A 4D6XA 3WQZA 5E38A 2M6RA 5HHTA 2O1XA 1N1EA 3I8SA 5ES3A 2ZUFA 2YV2A 1EGHA 5A88A 2MIIA 2O07A 3TOCA 1YQXA 1EA5A 1GPJA 3L0PA 4ZAGA 5LU9A 2F3UA 3I9JA 1CJSA 1ELOA 3CLTD 4GOMD 4MXDA 1EVKA 1EP2B 1KAOA 3IOBA 4X8LA 3O8NA 1YOVB 3OP4A 3UOGA 5C4GB 1MFPA 3P0IA 2ZYGA 3NNDA 4MW9A 3V3KA 3SS7X 1WG8A 2IHKA 3FWHA 2XYRA 3MGBA 4V1CI 2R9VA 5JT1A 2J33A 3NBQA 3FWKA 3ZJUA 4HJRA 1ZW1A 2G63A 2AI3A 1ZBQA 2W4QA 4E14A 1GNPA 1NL3A 3FOWA 3ENNA 3S2IA 1P7VA 2X8JB 5ENVA 4NEGA 5C81A 3KK0A 4P4GA 5CEJA 1M2NA 1KEVA 1P8AA 3JYQA 1UKBA 4AF8A 5FPKA 3PUJA 4M8IA 3SC2A 1RW4A 1G5QA 2PT9A 3FZGA 2RBEA 1VHWA 1CHDA 4LI3X 2Q07A 1GKKA 1KNXA 1E3XA 4BNLA 1OXBB 4KDFA 4DRXA 3UEOA 1C2TA 3BCUA 3E82A 3HYSA 4LECA 5DIFA 3GD5A 1TQ8A 4GHWA 1PUIA 1BFDA 5G41A 4U2BA 3JD3A 4G8DA 5ALMA 4ZU3A 3OCYA 1H85A 3CVWA 3PE3A 2GK4A 4U2FA 3EIQA 4HH3C 1YIDA 2OXRA 1RHQA 2FVXA 1A8PA 4IQGA 3TGWA 1JFSA 4QDZA 4Z5XA 4QUBA 1N5OX 2DWQA 4JLDA 2Q6OA 4WOKA 2P9TA 1CB0A 1P4JA 1K06A 2BLLA 1LW7A 1WAMA 2UYYA 2XTNA 2YXBA 1PKEA 3GOQA 3RG2A 3V42A 5KQMA 4QPJC 2FMIA 3DC2A 4DXAA 4PBSA 4BNZA 3EN0A 1AOXA 3IPYA 4FXOA 4RDCA 1V5VA 4RHEA 5HOEA 5LM3A 1UQUA 5KZMB 3K6JA 4CIBA 1RXVA 4YP0A 1V9CA 2DQSA 2NZ8A 5BSKA 2LE0A 1RJFA 1AC5A 1IEXA 1YOBA 1KI6A 2FZVA 2NO1A 4FI3F 4KE9A 4GW3A 3HGTA 4RMNA 4XUDA 3W6NA 3VKHA 1RZRD 2OORC 4M76B 5HDQA 2Q6KA 1ULSA 5CBPA 1VRCA 4PPNA 4KPEC 4WY2A 1TJYA 4FC6A 4ILKA 4CKXA 3MMSA 5CX1B 3HU1A 1QH0A 1RIFA 4RS3A 1DMSA 5BN4A 2NZYA 2VJBA 3AR9A 3BWMA 5CT4A 1U9ZA 1Y7PA 3GRAA 1PDVA 2C2BA 2FGKA 2X0JA 4ITVA 1VLVA 2WQ6A 2BZGA 1AUQA 1UMCB 2QNIA 3KIPA 3ICCA 2Q4TA 2XVYA 2YWJA 1GU7A 1H3NA 2ECPA 4IGKA 1FTGA 4JCOA 4U7PB 1E6MA 2QZZA 3LHSA 4GVPA 1BKYA 2PRKA 3PNSA 4DPMA 5IJ9A 3ACBA 3PD1A 1XK6A 3DV0B 1Q1ZA 2P9JA 3DZHA 2XOKA 5EJ6A 5FAKA 1XLVA 3JQ7A 1XMJA 3EVNA 3CRW1 1H2ZA 1WW2A 4X3PA 4YJ3B 1H0SA 3TL2A 2KE5A 4PICA 3MT0A 3ZD8A 5IHPA 2OESA 5JRZA 4RK6A 1VA5A 4IQ8A 2CLHB 1T6ZA 1HQKA 2NLOA 2GAOA 1NC3A 5BSTA 4F8JA 2X4GA 2VDMB 3CA8A 2JGDA 3H2YA 3BBPA 4DNRB 4H3VA 2QA5A 4LTMA 4RENA 4DIOA 4OHRA 4XQ9A 1K9SA 4LZNA 1XQYA 4HATA 2WUVA 5THQA 4RC9A 1I5OA 1TKRA 2ZRAA 4JN6B 4NV1A 3BMXA 4P4TA 4D79A 4DRZA 3GLIA 3B6KA 4E07A 4OFWA 3LA6A 4FZJA 4XYMA 2B4AA 5YASA 2WHRA 4L75A 5EE1A 1NKTA 1UMBA 1QIKA 1Z6ZA 2OLKA 3V7WA 2NZJA 1QMGA 3P8ZA 4TTRA 2BZ0A 4QPPA 4GICA 5I9MA 4D3XA 5C1PA 2IX3A 2H07A 3BD8A 4LY0A 4ABTA 3TL6A 4QWWA 3OZDA 5MN5A 3EDRA 2A1IA 4MYUA 3D31A 2J45A 1GG2A 3FOEC 2Q6IA 1R4ZA 1M66A 1HNWB 1OKKA 5IXJA 1CUZA 2SECE 1MEOA 1DXOA 2E85A 3V46A 4M38A 2HV8A 1INLA 3IEPA 1U04A 3PEEA 3A3NA 5KDDA 1YE3A 4ZT2A 1WXEA 1R88A 4PXAA 2Q3DA 3P7MA 4ARBA 1QQ5A 1U02A 2Z0MA 3JQAD 4EHHA 4EJ0A 1J4AA 4P93A 3P9YA 3FLEA 4TMYA 3TAUA 2RHLA 4IHJF 1OLXA 1PV2A 2JW5A 4RJJA 4S1NA 5DISB 3SF8B 5JFGA 4S1PA 1WBJB 3PDHA 4JEMA 4WZBE 1L6RA 2WAMA 2EBUA 3LCJA 3E7XA 5ALKA 5EI5A 2DTEA 3TZKA 1JALA 3AEYA 4RKFA 3OFVA 2WF5A 4LSGA 5CW1A 2X8KA 2YMLA 1FVHA 2JK1A 2LP4Y 1R27A 3GGJA 3OIVA 4A5OA 4K87A 3SVZA 1J06A 1L7EA 3N76A 3OLVA 5REQA 4EUKA 2I1QA 4E4TA 3NWJA 1KE2A 3TBHA 5AUNB 5AK0A 1NHWA 4J0HA 4O2BA 2PXAA 1YTLA 3BTOA 3WGGA 4GYJA 1TZBA 3HUTA 2I99A 2QRZA 5FOVA 1OJLA 3JQ8B 2W83A 5B37A 1DV1A 2EAUA 3OCWA 4DZTA 1EWKA 2JHGA 5AM2A 2GF9A 5CLFA 1SA0B 3O8CA 5I3ZA 4H7JA 3GLTA 4JQYA 1YRHA 2IEAA 3EEYA 2DETA 1ZKDA 5HRUA 4XFKA 2R1ZA 1HKUA 1XNHA 2X8AA 2GPJA 1QH8A 1RWOA 2UVQA 3BRQA 4JA0A 4WUTA 5A6SA 3AVTA 1SZCA 1XD8A 2PLAA 4JJKA 5FL7D 1QHGA 2GAFA 4F4HA 5G3ZA 3O26A 1LSJA 1Z6GA 1I1HA 2POQX 5DM2A 1P45A 3HJRA 3VOAA 4CM1A 2WWXA 2PWAA 1UXIA 4X6YA 4N48A 3G82C 1T36B 1DHTA 1ZH2A 5JEDA 1G3MA 4F21A 5L3VA 3PE4A 2QAGC 3FPGA 4XJTA 1XDUA 2L18A 3RKUA 1FFGA 1OPXA 3GK3A 3VKGA 4GP6A 1QG0A 3EPRA 1J9EA 4RF5A 1GQYA 3CN9A 3EG9A 5FFMA 3REOA 3IBGA 2EV9A 5KJCA 3VU9B 2VA8A 1BHO1 1L4GA 4KSCA 3GG9A 3LWDA 3CW8X 2CFSA 2O1SA 4TTVA 1AV7A 4TUYA 4MRRA 5BYBA 1CJKC 4WLVA 4F91B 4PNZA 1G8KA 4NCBA 4MDEA 2VT2A 1OBCA 2XYVA 2V6MA 4GO1A 4K46A 1TL7C 1X94A 2WHPA 4G63A 1C1XA 1KI9A 2CEAA 2GXUA 4RWZA 4YN3A 1SVSA 3K9GA 3S2EA 3G5LA 1NVKA 4I5FA 1QCZA 4RMGA 3V2UA 2H29A 1NMYA 1AG9A 5L7YA 2QYOA 4KK3A 3T0GA 2H18A 2OAP1 2UVPA 5C8DA 3ZXXA 1O6CA 1FMJA 1EK5A 2P5UA 1JF8A 2BJWA 4GMKA 4EPVA 4Z9BA 5JALA 1DIRA 1DBSA 4IV5A 4PFQA 1DEKA 3I8OA 4P81A 2IU4A 2QMQA 3AIIA 2ATVA 2ZTNA 1U0SY 5FD8A 2OCKA 3B78A 1XZHA 2FMHA 1YS2X 2YS7A 4JYMA 4GT1A 4M60A 2V7VA 4KX5A 2FR8C 5AVVA 4GI5A 1Y5RA 1O4WA 1P7WA 3EWIA 4XSHA 5IHXA 1QDLB 2QTCA 2NIPA 3DZ8A 1W0JD 4C3ZA 1UXGA 4HGZA 4RDKA 1A1SA 3GJZA 4DQ0A 3SOPA 4URXR 5LOVB 3KJGA 4ESHA 4DIBA 5DIZA 2ZXIA 5A7GA 2P9BA 1Q50A 1HYHA 4C4TA 1HM5A 5CNMA 3ROQA 5LQKA 2QMZA 3KQLA 3GY0A 1K5PA 3B6IA 4M9QA 3SU8A 2JNWA 1T9GS 3H2ZA 3V2GA 4JMQA 4AULA 4DBLE 5BVGA 1OREA 3GZ4A 4F46A 1DCMA 1IY1A 3VXKA 4BNNA 4ZYTA 3RUAA 3WP1B 2GRUA 2ID9A 2VF8A 2QGNA 1OBFO 3DFZA 3TJMA 3B3GA 1ECFA 5KB3A 1UPTA 5CJJA 4IKOA 5E95A 5AICA 3L0OA 4BFVA 3K9WA 2J32A 4ZVOA 3EISA 3O91A 1DJLA 2O3SA 3TQHA 5K2OA 1K3UB 1LPBB 3VR5D 3EE6A 4LAFA 3ZK7A 2XNDD 3E9EA 3DWFA 2HHLA 3M5DA 5HS4A 4RTLA 3WY9A 4I6JA 3AY6A 2H16A 3K16A 3EXHC 4LXUA 4H7FA 4QVKA 4MYRA 1DXHA 3TYXA 5LZ8A 3UHFA 1YZFA 521PA 2CD9A 4R9SA 3PWSA 1GFSA 4H6XA 5FBQB 3HB4X 1FXWF 3NPMA 4AICA 1WXDA 2YQZA 2WEKA 4CCYB 3BCSA 3TVDA 3WIVA 1FBNA 1BX0A 3V80A 1EDZA 3K0AB 4QOSA 1R6VA 1P2FA 5HIAA 2XB4A 3GFPA 1K0FA 1JEOA 3PJRA 1W5FA 2R6AA 2O0HA 4KQIA 3GCDA 2QG9A 2I71A 4HMOA 5CRIA 3TRFA 1P4SA 4KO3S 4ZOBA 3LWZA 3GSIA 2W42A 2OBYA 4P33A 2R6ZA 1O94D 1P72A 3CSUA 1VQ7B 2M2IA 5LA6F 4ZDJA 3UV6A 3GJ7A 3W5VA 5GZ6A 2YZNA 2JIDA 3UHJA 4D42A 3RY8A 3CT6A 4OGGA 5KMGA 1MOPA 4WD3A 3NS7A 4G5QA 4U0JA 4GPZA 2OK8A 1H4QA 3L05A 5JS6A 1B6SA 2QSYA 3H2IA 4KSYA 3M34A 4W5NA 4WLEA 1SN7A 5BSHA 1BJTA 3TLGA 3VPHA 2JZNA 2PSSA 4UFNA 1JAHA 2GTIA 3JQAA 4XAQA 4CFSA 2XCUA 3OOEA 5EA2A 1UDRA 1JXOA 3O8RA 5JAOA 4YEDA 5KCZA 1WEKA 4LIPD 4XB1A 5HWSA 3B1YA 1PL8A 3V4LA 4IZOA 1MXHA 2WIKA 4HAIA 1H9CA 1N7JA 5I7VA 5FXMA 4FIDA 4J2OA 3WGTA 1FRZA 2HHAA 5K3FA 4HVCA 5ISMA 2F3RA 1JAYA 1SBTA 2ETVA 3ETGA 5DHAA 1P77A 3CVJA 1P4RA 4BNYA 4CLHA 3EIWA 2H2DA 3BS4A 3WLFA 3OQOA 3LBAA 1X8KA 1VKOA 3MJRA 1COZA 3OECA 4Y1RA 4Y9TA 1JV2B 2E87A 3BUSA 3CXRA 3FUVA 4K3UA 4K9OA 5AVXA 3UUFA 2AZTA 4YECA 3HLYA 4IIJF 4ND7A 4ZHQA 1HYQA 2GZHA 3PGJA 1YI2B 2JKYA 2XWSA 3A8TA 3D5TA 4D0LB 5JDIC 1PJLA 2AXPA 4EKYA 1XVVA 1H6AA 1FUYB 3AKDA 2X0RA 5I5GA 1W2GA 3B1XA 4R1TA 3VKWA 4DT1A 2GWHA 3OKFA 4KR2A 3I09A 4PZUA 3BFXA 5DJ5A 2ZR7A 4XLZA 3CLSD 4PF1A 4JI3B 1JA9A 3ES9A 1B8UA 8GPBA 4MPTA 4G25A 5FL7A 4JYPA 3W2FA 3CRMA 3SYKA 4WCVA 2YVUA 4H3SA 1ACMA 3GDHA 5A9SA 3EPPA 4L57A 3FYCA 5C3UA 4V0OA 3WLSA 4Z3OA 3PFBA 4P3KA 2CJWA 4X44A 2AFVA 2GBLA 3B20A 1Z37A 1H2YA 3VV2A 4UHJA 4ZKEA 2VZ9A 2LKDA 4E5DA 3UYLA 1PJRA 3ME5A 1T2AA 1P91A 2GEFA 4FINA 3RS5A 2Z4TA 3E05A 2GCOA 3MJ4A 221PA 2JJ2D 4LV8B 4X3CA 1OGYA 2I4TA 3CCBA 2DP4E 3DYVA 3UMSA 1UD6A 1ULBA 2SICE 2Y77A 1BS1A 3ZLBA 4CQJA 2IOHA 1ZD9A 1TC1A 3AR7A 1IEVA 2QRVA 3GN2A 4KXWA 3OURA 2GHTA 3JWEA 3JQBA 4G2NA 5ADVA 1ZJZA 2YOFA 2XE4A 2VCEA 4FKZA 2CXTA 4LKRA 4BYGA 5EJ9A 1FMFA 4RD2A 2L0XA 3VR0A 4LYDA 4TT3D 4FXPA 2QM8A 1FNSA 1OZGA 1J1ZA 1NXPA 2MJLA 3M6AA 3PDWA 3Q98A 3RVSA 4MICA 3I5YA 4ZAFA 2C7RA 2IHTA 1I5RA 3F47A 2NP6A 1SIOA 4DFDA 3DVAA 3PL5A 1BX1A 5E6RA 3ZG6A 5CXSA 2RI1A 5IM4A 3K9BA 3T3PB 4DMGA 3QE2A 1LTKA 5A4KA 1U0GA 3C7CB 4NENB 3O8QB 4QYMA 3KUXA 4B2IA 4MJ7A 4CF4A 4E13A 5CT9A 5E3JA 4CMJA 3EH1A 1HNXB 1QIEA 2JH9A 1EUCA 5A5FA 4QQKA 2UAGA 4HXFB 3FJ1A 4MWBA 5KQSA 1V8DA 3ASYA 1W0JA 3W05A 4E2FA 1IN5A 4BP9A 3A28A 2LCQA 2ZJ6A 2O8VA 3EVGA 1FMTA 2NPIA 1QIDA 4P58A 1E32A 4Q3KA 3PQEA 4UFPA 1OLOA 1GT6A 3QKWA 1IBCA 4S1OA 1R4AA 1JAZA 1NX9A 1E2PA 4QOJA 5GMOA 3ZGLA 5JSZB 3COVA 3ZVMA 1OZFA 4B80A 3R3SA 3ZUGA 2OV8A 1C3LA 1P2SA 2CLCX 3UB2A 1BFKA 5FBRB 3W7BA 2R86A 7ADHA 1FSZA 3RS2A 2QUIA 1PP4A 3JRWA 1VE3A 3NBMA 3ORFA 3UNXA 5LQDA 1L5OA 3GUHA 3CX6A 3E22A 3LHIA 2UYHA 3G5UA 4Q39A 4B84A 1JHYA 1VG1A 1PS0A 5AOVA 3D1JA 1G20E 9GPBA 1NXTA 1XVIA 2HOQA 5ALNA 5FAXA 4TS1A 5GOTA 3PC6A 3DOEA 4OREX 2VL7A 3ESQA 3KPVA 3HACA 4XN0A 4JZYA 3RTCA 1PQUA 3ZWKA 4DZZA 3EC1A 1NG1A 4XARA 4AJLA 1H0HA 3MTQA 1GZ6A 2C3UA 2Y05A 4I4TF 3ROZA 2EFEB 3WYCA 2QRLA 3L79A 4NDAA 4FYKA 2ST1A 4B6QA 3OAAD 4FFOA 1FXSA 2WINI 1JZQA 2HSGA 4RY8A 1SCQA 4LDQA 4EY8A 1RAEA 1L4MA 2PKWA 1IZ9A 3LL4A 3AR4A 4RA6A 3RVPA 4AI6A 4PGOA 3CISA 1T0PA 1E1RD 3GU3A 6CHYA 1E2IA 1PT9A 1QC5A 1PFQA 3CINA 3FZYA 4MV6A 3KOZA 4YV2A 1XQ1A 3B6ZA 3OU2A 1I9GA 5GJCA 4IMRA 3TLKA 4EG4A 1KEKA 3B51X 4N54A 4QAJA 1KARA 1TIPA 3OIGA 4KQHA 1M2FA 2ZJ0A 3GJ5A 2B9EA 4CTJA 4UHKA 1RQNA 2CE7A 2O2EA 1CQJB 1PFGA 3NATA 4N7BA 3PV0A 4ACBA 2BGUA 2GEKA 5C53B 1RWVA 1G5FA 2AJ8A 3EUFA 4FBMA 4AN0A 2VTBB 3PXCX 2E4YA 1NR5A 5LD2B 4JP5A 1PBNA 5FEMA 5LZ2A 1QGOA 2YHSA 4P82A 5GVSA 4JC4A 4FWIB 1IWPB 1MR3F 1SIUA 1DQYA 4M9XA 4ZODA 4MP3A 3ZE0B 4F5EA 1V5FA 3BBLA 3LF2A 3P5BA 2G9VA 2OFPA 3HNPA 2M9MA 1W52X 3OCZA 3OZCA 5D51S 4JV5B 3I30X 2PLNA 4YAGA 4KXMA 3NE5B 5JISA 5B3KA 3OG9A 5CA0F 4P86A 4C0AC 1G64A 2X1VA 3M4JA 3L1KA 3I0ZA 3LRTA 3CGGA 2IA5A 2AFIA 2EG9A 4R1OA 4ARZA 3PTAA 4YA6A 1REQB 2TRSB 3PA1A 2QA4B 1M6HA 4PC1A 1KXJA 4DWJA 1SUIA 3AEQA 2GJAA 1JG4A 4DEVA 4HX2A 1HY3A 3MWEB 4L8VA 4LSMA 4BTVA 4MV8A 1ZH0A 2GN8A 1TTHA 1BXGB 5IAAA 2PZEA 2DF8A 3CZ5A 4FFBB 2RH5A 1IJBA 2W4IA 4H17A 4R2LA 4WK2B 2BEVA 1FDSA 3P1JA 5EKSA 6YASA 5LXTF 4TQAA 2ZKIA 4I5DA 4B32A 4D57A 4DB4A 3AG5A 1WP6A 3R09A 3OPMA 4RHXA 3MWFA 2X41A 2VA9A 4XB2A 1RI1A 5E6UB 1H5NA 3ZQUA 4ERXA 2ZPAA 4X7MA 4QWMA 4F84A 4KVAA 1VLLA 3IEXA 3PGVA 1PEAA 2ZI9A 3A7EA 3GELA 4MUAA 4ZAYA 2NX2A 4FI3C 2AOXA 4OX9B 2VRNA 3VZPA 5BO5A 2C1ZA 3MWKA 1KRHA 4ESOA 1H9AA 3N0RA 1WVGA 1P1KA 2X42A 4QPZA 4B71A 5A7FA 4J03A 2ZK7A 4N1AA 3ILSA 4B3GA 1C7EA 1IUNA 1T5TA 4R81A 2RC5A 4CMHA 3GI1A 2ADFA 3HB0A 3I42A 3PQ3A 4QBIA 2JJ2A 1QKJA 3H5TA 4ZZ1A 4M86A 2QQGA 1MORA 3ND5A 1P0FA 4M0FA 3NEPX 2QMHA 3ABOB 1K6XA 1RMTA 1ULUA 3M89A 3NM6B 4ENTA 1VQKB 3L4BA 1G41A 2O4CA 5F52A 3EZ9A 1P2TA 5DU2A 1U8UA 1JFTA 3ZJTA 1OVMA 3EZNA 3K9LA 4TT3A 3N2EA 4HIZA 3HPQA 3NANA 3ENZA 4ZAWA 3WTBA 1DRUA 4Z9YA 4EYSA 5ERGB 1DAHA 1QK4A 2IDJA 4LJ7A 1KFBB 1E18A 1T0IA 5AVYA 2ZXFA 4MW2A 4TMKA 3WLLA 5KNCA 1PT6A 3CCRB 2H00A 1C7ZA 4L8FA 3ZY5A 1QHHB 4J0GA 4E30A 1J5PA 4M49A 1R37A 2ET6A 1EGMB 1DIGA 4DNQA 4DR7B 4MI6A 3CLSC 1LB1B 5IYQA 3AVYA 1GLGA 2D5LA 1UKVY 3GIDA 4NFHA 1HOTA 4OFBA 1HORA 1U7TA 1TUGA 3R0IA 5H3CA 3LL7A 2IOQA 2BY4A 1SO8A 1E79D 1DE0A 3DP7A 3C87A 5FUXA 2J0SA 4P9SA 2WJAA 5LZ9A 4GL4A 1YDGA 1ZITA 1HTWA 4JR0A 1H05A 2OMEA 2FX3A 4KFUA 1D1QA 3D4PA 5CH8A 5EMHA 5C7YA 4U7DA 1WZEA 4YMLA 2FEWB 4U02A 4PHGA 3WWDA 2CV1A 1W96A 2PS3A 4XGQA 1PV4A 2O5RA 3U1TA 1UMDB 3C7DB 3QU7A 2ZIEA 3UKOA 4F4CA 2W5UA 2D2XA 2LPMA 3B3FA 1JIXA 1B16A 2GM3A 2HNAA 2WAYA 3HNRA 3NOOA 4XLTA 5H8WA 3QEJA 1Z0SA 3Q5GA 4ENVA 2OTCA 2RGXA 2C5GA 2QOEA 4HNVA 5BYAA 4XLHA 2BDEA 2PKQP 3IQIX 1T3LA 4NS1A 4V0LA 4QEKA 4BO6A 2ENUA 1KH3A 4HVTA 4J91A 4Z9AA 4PQEA 2HADA 1CQWA 1MA0A 5AI0A 3I72A 1FFXB 3HU2A 1NOKA 3C8ZA 1L5FA 1URPA 3QYAA 4Z51A 3FN4A 4X71A 2SCUB 3RARA 1APBA 4UZSA 2XRZA 5FBHA 4TMWA 4CTKA 1HG0A 4A36A 1C0IA 3A2NA 1YE5A 2PV7A 4RFLA 1EWVA 2OENG 3T1QA 2R8EA 4MS4B 5JPCA 1TQ6A 5EIWA 5EMLA 3CN7A 3OAAA 3FBGA 2ZJZA 4LDRA 4A91A 3HV0A 3V7UA 1JJAA 4ZN6A 3C4QA 1U0BB 2AEFA 4M55A 3Q41A 4P3IA 3ZHYA 5FO0A 5CTJA 4HFRA 1E1RA 1KBOA 1YA4A 4XRRA 3U3KA 5JZSA 2WZPP 3H9UA 3VRHA 2P2LA 2XUJA 2H7CA 1EFLA 5BYKA 5EUBA 2IVZA 4AY6A 3F7OA 3TI9A 4PFKA 2QVGA 3D8NA 1QK3A 3R3HA 3KB6A 2O8DA 3NHWA 2F67A 4JELA 5BYJA 4EI2A 1F2TB 4NNOA 1ZJYA 2JIQA 3CIFA 3IAXA 4MROA 4LXHA 1MRNA 4CKBB 1OAKA 1W2WB 4OHCA 4S35A 1SC9A 2C1XA 2QRMA 2PUEA 3MHTA 4TSRA 3T1VA 1XMSA 1Q20A 4YLEA 3S27A 2WHXA 1RWBA 2AJCA 4RY9A 4CG1A 4XXHA 4XFDA 3G8DA 4XOUA 2PZ8A 2Z98A 2HRZA 1N2HA 1NJ1A 3JALA 4TLMB 5IYZF 5BSUA 1KEEA 4K2HA 5F35A 4DV5B 2BTOA 2QPOA 3CR7A 1U3CA 3G68A 2ZIXA 1RXEA 3E61A 3W7AA 3PU6A 4P7JA 3T1OA 2Y6VA 5CVVA 3K9CA 3TNFA 4MYTA 4BRSA 1JJ7A 3QOWA 2DCMA 4KSBA 1MX3A 4M0CA 2QBYB 2FSHA 4JJ4A 4Q1CA 3ZHXA 3HEBA 5CD9A 2QY6A 2Q3HA 2ZTHA 3QG1A 4XWAA 3ZV5A 1LK5A 1MABB 4BWVA 1Y6FA 2V1UA 4UCFA 3B5IA 3QKTA 3SZRA 3F8TA 4Z3KA 3A4IA 4B2LA 2ZBPA 4BXOB 2ONKA 2VXCA 4JY7A 1RC0A 4QM7A 4G7XA 2WTAA 3W2TA 3NW9A 4AY2A 1UEIA 2VAVA 5FPPA 2FSUA 1A4UA 3IVXA 5CM8B 1BD3A 3AVWA 1I1NA 4YUXA 4TXNA 5LDHA 4I6EA 5BVHB 4W1PA 3FTNA 2X0EA 2FFAA 3DAYA 4OA8A 1DO2A 3PLAE 1UOQA 4KGDA 1CPYA 1LW6E 5I8ZA 1JKMA 3IXMA 5GWXA 2JRCA 1GL6A 3RQSA 2QN8A 1DC7A 1M1XB 4Y9DA 4ARSA 5DRTA 4MB2A 4ME6A 4HNUA 4FKMA 1AK9A 1EJ2A 2BMEA 1Z07A 5H70A 3EBOA 4GKJB 1HVXA 1KK1A 3EQ7A 3PR1A 3BA6A 2Q99A 1YWGO 4CR8A 3PC8A 2HJHA 2C7QA 4F9EA 1ZMTA 2NZ2A 2UXDB 2CMFA 2VP2A 3QJYA 1V8ZA 3VJRA 1FDRA 4WLUA 2BVNA 1XVLA 5M7EA 1H2AS 3A8JA 1GZ7A 3IEIA 5J4LA 1VJDA 4J1TA 2I6QA 2ZBRA 4PAGA 2E4UA 3GRUA 4V24A 4KK4A 1PEDA 2NSJA 3ADOA 3G1UA 2PGAA 3VH4A 2ACEA 2VDWB 3T3NA 5D3KA 4KWTA 4JJEA 2B7BA 3UWOA 5L4NA 1V8PA 3L6BA 5EE3A 4OAPA 1GTJ1 1DUIA 1KVUA 2XE6A 4ZYLA 4L6CA 1EBFA 2AVDA 3THWB 1GUAA 2WJHA 1K1EA 2CD7A 2IUSA 1SURA 1FYFA 1L1QA 5HIMA 3U7IA 5I4KA 1DLJA 2GEUA 2I5PO 2VIIA 2QVLA 3RTBA 3I73A 4TWIA 2ECKA 4OI0A 3QQ5A 9MHTA 4HHEA 4MVCA 2FR1A 3EDCA 2LWIA 2AGVA 1M33A 1TVKA 3E7DA 1JN0A 3LUDA 5SZJA 5I8PA 1F2VA 4MV9A 4ER7A 3UPTA 1X3LA 2CXPA 2DWPA 3MTAA 4IDFA 1W9MA 2XUDA 3VR4D 4L1KA 4E1BA 2GYYA 1JSZA 1V71A 4XVHA 3K32A 3STXA 3QFTA 1C9JA 3HQ4O 5JBIA 2BFEA 1IXZA 2XDWA 1NJ5A 1ADGA 2C58A 3M6FA 2OBLA 4X6XA 2A4KA 4NP6A 2A0FA 4HDCA 5IT0A 3WV5A 4D4IA 1W5TA 1N75A 2ZZMA 4N0PA 1SVKA 2Y66A 1E79A 1ZOOA 3RVMA 5HZMA 2A33A 2NU8B 3UBTA 3FOAA 1RP1A 2G5CA 3USCS 4U6SA 1PKVA 5IZ4A 3VR1A 1ZY2A 1XTVA 1CQZA 4XD7D 1E3SA 1PR0A 3R2JA 3A1WA 3UUWA 4FUQA 3VSEA 4EAAA 2FHSA 2IPLA 2DY0A 2FPGA 2ZSUA 2VJMB 5CT8A 4QFCA 3WJ1A 2V6JA 4OQFA 4HEA6 5J9FA 1CCWA 3ZHCA 4W5RA 1EX7A 4HZGA 2WKSA 3ASZA 2ZR0A 3NOXA 4EWLA 3EGDA 3IC5A 5G4KB 4Q5IA 2A9JA 4DYVA 2OQRA 3Q11A 3N8HA 5JJIA 4L0MA 2PE3A 5C80A 2QN3A 4BLRA 4WSOA 4L0DA 1D4AA 3PNLA 2CVHA 2ZWOA 3C3DA 1DWPA 3HDJA 1D2EA 1WEHA 1LNSA 2ZULA 3N6XA 3OQPA 3UM9A 1HEIA 5PNTA 2NQ8A 5C8YA 3QVSA 3EH2A 3FDZB 1Z0AA 4X06A 3FCSB 3PQ5A 4GM4A 1E77A 4XIIA 3NBKA 3WL5A 2PLFA 4RMJA 4WKPA 3SMQA 2ECOA 2J5QA 3T4EA 5CDUA