2CW5A

Crystal structure of a conserved hypothetical protein from thermus thermophilus hb8
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
255
structure length
235
Chain Sequence
MRPVYFLSDFGLEDPYVAVVKAVLAEAPGPAVVDLAHALPPQDLRRAAYALFEALPYLPEGAVVLAVVDPGVGTARRAVAALGRWTYVGPDNGLFTLAWLLDPPRRAFLLEPPGRDVFAPAAAHLALGLPPEGLGPEVPVETLARLPLALTEGPEGEVLTFDRFGNAITTLLRAPVGGFVEVGGRRVPVRRTFGEVPEGAPVAYLGSAGLLEVAVNRGSAREALGLKEGMPVRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial fluorinating enzyme homolog
publication title Crystal structure of a conserved hypothetical protein from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 59
structure length 235
sequence length 255
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2cw5A02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2cw5A01
2V7TA 2V7WA 2C5BA 4CQJA 2ZBUA 2Q6LA 2V7VA 2CC2A 5LMZA 5FIUA 2C5HA 2ZBVA 2C4UA 2V7UA 2Q6OA 1RQRA 2C2WA 2F4NA 2CW5A 2C4TA 1RQPA 1WU8A 2Q6IA 2V7XA 2Q6KA 2WR8A 5B6IA 2CBXA
chains in the Genus database with same CATH superfamily
1MT0A 1U8YA 1NVGA 1VZ2A 3CPHA 3KKNA 1GYQA 4JUAA 2XA2A 4PM4A 5IBRA 1IK6A 3IOEA 4DG8A 1U0JA 4TPKA 2QL6A 2WYVA 1GKLA 1IBRA 2GXUA 2FW6A 1Y81A 4W6QA 2RH4A 4IMJB 2NVBA 3CONA 4QZVA 1SJ9A 2OXTA 2WJZB 4RY2A 3DSRA 4NYJR 1OB0A 1YZGA 2GXAA 4ZGBA 3T4XA 1NB0A 1WZNA 1YQUA 1R88A 3HCBA 1KY4A 2FOIA 1E3SA 5LP6A 2JARA 4G2NA 4PSKA 5I7EA 3RC8A 5DX8A 4WADA 3Q4GA 2NXWA 4EUKA 5EIXA 2WIJA 5I5EA 3KQMA 3BIOA 4GI7A 2PNFA 3F6BX 5KTTA 2GJKA 2YWHA 1V5IA 1VL0A 3FRIA 1TIBA 1EM8B 3LP8A 3PICA 4RHYA 3ZZNA 4BLQA 3UYLA 4K5QA 4IIJB 4CTJA 2WMNB 3R6JA 5KOHA 3BXFA 1ZWKA 5FI3A 2AEJA 2P2SA 3P9PA 2NO5A 3H9GA 3AQIA 1X8LA 1RM3A 4LOIA 2BM0A 1HI9A 2WKPA 1YXMA 3QG5A 2YJNA 4P9SA 3SZOA 5TJHA 4NICA 4Q3NA 3A7EA 3RHZA 5LDDC 1QHFA 1Z3IX 2GPYA 4LGVA 4E31A 3U09A 2PGIA 2WB2A 4OI0A 4Z53A 3EFOA 4XJXA 4HSGA 2Z08A 1U0HC 3U7GA 4PPYA 3GZNB 2RBGA 5IASA 2AOUB 1V9SA 2E1PA 3FWNA 3OJCA 1DIOB 3F5QA 5M3BA 4G9GA 1PW5A 3FWKA 4OTZA 4U7TB 5JQGB 3O4VA 5F77A 5CP8A 2Z1MA 1MQSA 3SOZA 1NJ1A 4F4JA 3K1AB 3RYHB 4IOLA 2GDJA 1PDOA 3UAZA 2EF0A 3KEQA 3TCKA 4KXMA 4RCZA 2I3AA 4B3SB 5IT0A 2R2GA 4PQEA 5TF4A 3S2SA 2I9KA 2JK0A 2EARA 1HG1A 5CBPA 3OJ0A 3ODGA 4EBFA 1V1MA 1TXGA 1ZD8A 5ELXA 5EC8A 3Q3CA 2YVKA 1E2DA 4QFMA 5F2NA 1HQDA 4AO8A 2JLUA 3KSBC 2PRJA 3B20A 1FVOA 1PZHA 1C7JA 3FYHA 2QRLA 3RBZA 1SHZA 2XRZA 1JQAA 4H31A 2X53S 3MYYA 2BEUA 2BI7A 4BNYA 5L6LB 4X7FA 1UXOA 2WWIA 2XTZA 2ZRAA 1FYEA 3ZHZA 4OPOA 3VV2A 1CZHA 2J9RA 2I66A 4YJ2F 4A1OA 2BBWA 4C3OB 3EK2A 1O3YA 3KKOA 3PUKA 3SYNA 4B2PA 3C6ZA 5FTNA 1U90A 6PFKA 5BOSB 1MVOA 4HC4A 4XCVA 1HRKA 1R0CA 2ZWAA 3GWZA 1I80A 1H66A 2Z3VA 3PNBA 4GZ6A 1BWRA 1XJ0A 2B4YA 4K9KA 1H5NA 4BLVA 1XRQA 1C41A 5E6UA 3QJGA 4K87A 3T5DA 4HDCA 5L6MB 5BMOA 5H8WA 1ZM7A 4JXXA 2R6FA 2P65A 4CIYA 1CEYA 3RIMA 4RY8A 2PTGA 2ZT5A 1JNYA 3ETCA 3WIEA 2QRVA 1P9NA 2H9YA 5FUBA 2Z8YA 2WFLA 2JJQA 3N58A 4P1VA 3O91A 3B1KA 3OC0A 1A4UA 1CIVA 2AUTA 3WMGA 4ZN6A 4ALIA 4YAIA 3OX4A 3RT9A 2ZQZA 2VQFB 4CM8B 4ZEXA 3I4LA 4PYRA 2CXUA 3BGDA 4XOIA 5FP0A 1SUWA 1LDYA 3TH5A 2WT8A 3K20A 3IILA 4PHHA 3N8NA 1FMCA 3JVVA 2ZAGA 1QG4A 3KYBA 4G4IA 3PIRA 4JQOA 4TT3D 2PGLA 1CT9A 1H6BA 3RQSA 3FVVA 3NM5A 1T8TA 4XRGA 1U2TA 1G55A 2L2QA 2XRMA 2JLYA 3TOSA 2EKBA 2PQMA 2FUKA 3BHNA 1V4BA 2DFNA 4EX6A 3V76A 2CXTA 2CFSA 3AJ8A 3MS7A 4J91A 3SS7X 3WOHA 4MYHA 3W7AA 4BO4A 2C0PA 3O9ZA 3V4VB 3VJKA 3I3SR 7ADHA 2JI4A 1II0A 5D6NA 3F6PA 1VC2A 3V1MA 2R00A 3STVA 4GM0A 2XHEA 1YGPA 2VJAA 1X14A 2ZI9A 4KACA 4AF8A 1VRCA 3NHRA 2OC9A 4EZEA 1Z7GA 1RE1A 2YWRA 4RAOA 1XNQB 2FKNA 2TMDA 1CLEA 1CR0A 4X0CA 3WY9A 1EJ2A 2F8LA 1KPHA 2FPWA 2WG2A 3ENNA 3JTMA 4JP1A 5A7GA 3O2JA 1GAQA 4DDKA 1B14A 3K8ZA 1XAIA 4DAOA 3IAUA 4DQLA 3GR6A 3U1TA 3HSSA 4KV9A 1B6GA 5KB3A 2DY0A 1L4EA 3B5JA 3A27A 2OCPA 4AJ9A 2RGEA 3OQVA 1Y4UA 3TAUA 2JH9A 4EIWA 3UNXA 4F96A 1DFIA 2C4KA 4RD3A 4FSXA 1MJGM 1P33A 2F1KA 2HJRA 1I10A 1GV1A 3LZ6A 2WF9A 2ECFA 3SXJA 1ZW6A 4CEHA 4AJNA 1ECCA 3S1AB 1ESDA 1DXQA 2F59A 4TX1A 2YNMC 3B9RA 4F8EA 1EK2A 1RWPA 1Q17A 2C2MA 2WD7B 1ZL0A 4AZ0A 2Q2OA 1NW4A 2OK7A 2XYGA 2IEDA 1J33A 1XCPA 1TMKA 3ORRA 3EMVA 4HMQA 3TQIA 1OA0A 3TTWA 3KQYA 5DGDA 5C7IO 4NCBA 3NVKI 1UD8A 3EF1A 1LF5A 2WEKA 4G89A 2HYIC 3ZGVA 1YFJA 2A78A 3PTZA 2HL6A 5EXEA 3CCCA 4AUEA 1OR8A 1A1SA 5E9QA 4CU2A 3TZCA 3FCYA 3GD7A 3WL6A 3BTUA 3U60B 2IS6A 3ZNNA 2GEJA 3U7JA 1T91A 1TJ5A 4EKIA 4E88A 1UPFA 4RZIA 1K3TA 2D0OB 4EKEA 4NAUA 3E18A 4B73A 3UJHA 2GEDA 1CZKA 5COAA 4KQWA 1GDHA 2VPZA 5D5QA 3GOQA 4FDTA 5IUNC 1DI0A 3OOSA 4HXEB 3DL2A 3DAOA 1GQFA 1MRZA 1NY5A 2JHFA 2OILA 5TARA 2D7DA 4XDGA 3JQ8A 3P97A 1Q7EA 4YMTA 1L5SA 4YRJA 4KZKA 3FPGA 4MZXA 2ZYDA 5FB3A 3ZPXA 2ACKA 2BEVA 3NTVA 4IHAA 5AXBA 2IYPA 2I76A 2POCA 2VG8A 2XLBA 3ESYA 4JZYA 4WLOA 4BMSA 1WLYA 2DWQA 1YR9A 3C70A 4PX2A 3G5LA 5HUHA 3NV9A 3IIMA 3PUHA 3F9RA 4X65B 4HN2A 3JALA 4IEFB 4L8FA 2FMTA 2J0SA 3IQZA 1JZQA 4C22A 1HE3A 2PMBA 1QXSA 1DP4A 2FWAA 2VAPA 2OHOA 4X3PA 1BYIA 1GGVA 3GK3A 1ZY2A 3ETLA 2PVSA 2DG2A 1CB7A 1ARZA 1AS2A 2JNWA 1OILA 2ZB8A 3AHJA 4A10A 1P0FA 4KO3S 3RCBA 4E12A 1HNXB 2AJCA 1JMVA 1Q14A 2G9VA 2VP6A 3W2TA 1CDEA 3FMVA 2HMWA 2ZULA 1ILEA 3VC3A 1VJSA 2VN8A 1XLVA 2K7FA 2P40A 4YPFA 3P9ZA 1PFQA 3QM1A 3ECCA 4KIJA 4Z7OB 4AN4A 4TN5A 1UKYA 1GSOA 2YXDA 5JG7A 5LA6A 3ZLTA 4KQHA 4BATA 1CJKC 1W76A 4QOGA 3W5BA 2JKVA 1IC6A 2XECA 3NR2A 3OZRA 1OFUA 4QPNA 5EFOA 4RPBA 9MHTA 3HBLA 4PRYA 1AUVA 1T2EA 3GYBA 4RH1A 4UTVA 4FEGA 4N82A 1QAOA 1J24A 2WZDA 4UU8A 4H6VA 3SFVA 2V5VA 4DLTA 2Q99A 4M76B 5E6RA 1P6XA 4YBRA 4QGBA 3CY6A 3SZLA 1SXGA 3SLNA 2JZOA 4J0QA 3ZHYA 5MGBA 4JYBA 3HY4A 3WL4A 4CIBA 2OPHA 4P33A 2OYNA 2BFCA 2CFTA 3R9XB 3UENA 4LJAA 2IWRA 2HTEA 3N86A 4D9KA 1KERA 1RWMA 4FFVA 5C5IA 3W7BA 1OZFA 1L3BA 3CQ9A 3K0FB 4TZTA 4JJZA 3ZKAA 3D8RA 3EAGA 3T7JA 1JPNA 1NZJA 1YFZA 2HSGA 2I6XA 4OHXA 2CUKA 3QVGA 4BLTA 4D79A 8ABPA 4YFVA 4DJJA 5DOVA 3EZ9A 1PAUA 1NBOA 4GO1A 3L7DA 1SRQA 3GJZA 3I04M 1UXIA 3F8WA 1G20B 4OXIA 4GOKA 1KI1A 5BSYA 2FY8A 2ZIXB 1C7EA 3O5AA 4MR8B 3GCXA 1FFGA 4JLSA 2BGLA 3E3OA 3FY4A 5HKKA 4CKEB 3A1NA 3CF4G 4XWTA 3RBXA 4C7OB 2VJCA 3ASRA 4YDQA 1OLUA 3EN0A 1SUAA 3A3GA 2AC7A 2ZW9A 4HWKA 2AFHE 1YRBA 2OAEA 5LZ4A 5KYUB 1A0OA 4PR0A 1YBHA 2RHHA 3IAFA 2YHIA 3MPUA 1F5NA 3WQSB 5HVNA 1RRCA 3RTCA 1LH0A 1AKYA 2G17A 4D9NA 3LCVB 2ZSJA 2FZWA 4HUJA 2YOHA 3R7WA 5BN3B 4ZYYA 1W7AA 4MCAA 3QHQA 2C5BA 2IV3A 2HJSA 5AICA 1KK2A 1MUUA 4JROA 5K0ZA 3ADCA 2DQKA 5H83A 3W5IA 3NOVA 2I2CA 1ZR4A 4GE3A 1RFLA 2P3MA 3HB9A 3MCZA 5KTKA 3HXLA 1KEKA 3FMPB 1JSXA 2I4TA 2V4DA 4TL9A 1CY4A 1XCOA 1JLLA 4QYIA 1S3FA 2GN0A 1F0YA 2O2GA 3LRXA 3UAWA 5LIPA 5IJZA 2DUJA 2HSJA 3AERB 5EJMA 2EBUA 4HUTA 4JLPA 1L9XA 1N3BA 3U4GA 4CF3A 4EYQA 1RKXA 1WA5A 3KBOA 3JQPA 4KQMA 2WM3A 2FQ1A 3DLCA 2ZVDA 4TGLA 3U4MA 3E7XA 1F3OA 3GZTB 3HUUA 4DRYA 4O2RA 5HZHA 2F1OA 1L8OA 5TMEA 1OVGA 4KQGA 1G8YA 4QDZA 3ZIUA 2H4HA 1QIJA 1PR9A 2C4NA 5BRNA 4MNTA 2ZGVA 4PNZA 3UG6A 5IKEA 1SG9A 4AG5A 4QBFA 4AI6A 3GFTA 2VNAA 4IH1A 3FUUA 4UMFA 5DN6A 1ENOA 3DCYA 3HRKA 3X1YA 2R8YA 3HKDB 4XTCS 4PSUA 5AM4A 4CUKA 2R25B 4G8CA 4N03A 4A23A 1ECBA 2BKXA 2A94A 1Z2DA 3O6VA 2OOSA 3WNDA 5H80A 1NVEA 4V1CB 1YL7A 5IULC 1A8IA 1Q2UA 1MENA 5L3RA 3TSCA 2Y68A 1RMTA 3HN2A 4HB3A 3SJPA 4DIUA 4UHEA 1OYVA 5E6SA 4RKWA 1HE5A 4A91A 4Z1OA 1BMFA 4CCSA 1TADA 1RXEA 1IWBB 4G56A 3FNHA 3CBQA 1Z73A 2YTZA 1CQWA 1JSRA 2BFDB 3AKEA 2H18A 1OPXA 3H7AA 1PGNA 4UPDA 4BFLA 2P6RA 1WLSA 4QOHA 2WJAA 3HSYA 1XYYA 4J0CA 4B0PA 3H94A 5FFNA 3QHPA 2F3SA 3I23A 4DA8A 5A4KA 4UBOA 1RI5A 1BU5A 2GO7A 1IZ7A 2BMJA 4HS9A 4GUDA 4G23A 1YDGA 3MLBA 2NZ2A 2W5UA 1N7HA 1ZUNA 3DMRA 1KOLA 3MVEA 3P32A 5AYVA 1FFAA 1L5WA 2OGTA 2FCAA 3EGCA 4X5OA 1YJWB 3NEJA 4DCPA 3ROQA 3CCFA 5AVWA 4C07A 1K75A 1LSJA 1SOVA 4NZOA 2BHNA 4UVGA 5EHXA 1GR0A 1UQUA 3AIKA 1BXZA 3PC4A 1QKKA 4I9FA 1UPUA 4ROXA 3LO8A 4HAXA 3BOSA 3LWBA 2XNDA 3TCXB 4KO8A 4RV5A 3VKUA 3H75A 3WGZA 3PFWO 4BRWA 5LP6B 4HO1X 4CMEA 2FX3A 4DNQA 1KGSA 2NPOA 2Y4OA 3SNHA 2DUUA 1AS3A 5FWXA 3TE6A 5GV7A 5BQOA 1BE6A 1H6DA 2B99A 3JYHA 4FGLA 5KSYA 1G8GA 1O96A 2GJ8A 4FOOA 1IMJA 4LTMA 4BMCA 4CQLB 4EGQA 1BEZA 1P5JA 2EX4A 3AFNA 3L46A 4ZVPA 3MK31 1SBIA 4ETMA 4OBEA 3UWDA 5AVUA 3KQTA 2VDQB 2PPVA 2WVAA 3L07A 3UIEA 4F0JA 4I55A 4XM0A 1JJ7A 2D0IA 1XIVA 3BUSA 2IHVA 3CJQA 3TQQA 2EAUA 4A8TA 1K86A 4WA7A 3D7MA 3VDRA 2VZLA 2O0KA 2W6JA 1UBJS 1JG4A 3PGLA 3PUYA 4Q3AA 5I9SA 1TKBA 2ACEA 2QM8A 1LV8A 1MOQA 3M6MD 4AJEA 3R3SA 2ZUEA 1Q7GA 1QF9A 3MMPA 2X1VA 3WNCA 2YCBA 3LC2O 3EFOB 3KVNA 1I1QB 5H7XA 1F1BA 3I9OA 4BMNA 1MX1A 4P0TA 3ZIAA 4XN0A 2ZIEA 5EINA 4IKEA 1RQLA 3AR3A 2Z8XA 1L4YA 4TSFD 3ZGNA 4PXAA 2SKCA 4DTIA 3S6JA 5FPKA 1EIZA 4NBTA 1E2GA 1K7CA 3A25A 3PFGA 1UBMS 4XJSA 4ZQFA 2XY4A 3IVXA 2VT3A 3EYWA 5HM8A 2FPXA 3EPPA 4WAUA 4CKWA 1RHMA 1GGEA 4QRIA 3A6EA 1PZEA 4L5BA 2HAEA 3FLAA 3CPXA 1ZVKA 1MRSA 2FZLA 3TOZA 5FLYA 3ZWWA 1OWOA 3WZ2A 4ZALA 5CBPB 2CSXA 1V1MB 4MQUA 4QDOA 1SVIA 1SBZA 4Q39A 5I7HA 2HMSA 1S8OA 1WDWB 3D4PA 1A4XA 4WXEA 5GM1A 5J2TF 4R5HA 1F6WA 3ND9A 3C3KA 5B6JA 5C8DA 5HBRA 2BEUB 4AP6A 1N1GA 2VSNA 5DTMA 4QO7A 5EKXA 2PJUA 3EPJA 4O4LF 4BFUA 2VJJA 5F7XA 4S0ZA 4H08A 3EIEA 4LY0A 1P80A 2XAAA 4PCVA 3GVKA 3QKSA 3AHHA 4ARIA 2G80A 1W73A 4C2BA 1ZS9A 2PUJA 4RFVA 3V42A 5JD5A 1EEHA 5CDFA 4IDDA 1U0TA 4BAUA 5IANA 2IL1A 1UJMA 4JJ6A 1TLFA 2LWIA 3M6WA 4TL6A 3I09A 1GPWB 4S1TA 3D2LA 2BH2A 4IV8A 5J63A 1YVPA 2AC2A 1ZSNA 4OFBA 1LI4A 1WPGA 3OIVA 4URZR 5BNTA 4FN5A 2WFLB 1G8PA 4IAOA 1OJLA 5CFZA 3OZVA 4BLPA 1YITB 3F47A 2QLFA 2XT6A 4HAVA 4RA6A 2WF7A 3AVXA 5EOVA 1I7PA 2LKDA 4F4HA 2VUUA 3H2KA 4TOIA 4B3RB 4OKNA 1SUFA 3H5IA 2HQSA 4B3DA 1T6BY 4IRUB 1EZ4A 3AR6A 5LP6C 2EKQA 3VHLB 1NF9A 1WS6A 3HE3A 3LDUA 4GQNA 3DP7A 2WHXA 3RSOA 5A4FS 1L4UA 5K7SA 1TNDA 3UXHA 1I9CA 4TXHA 1JAXA 2AWOA 2IU3A 3KK0A 4I2VA 5DTIA 5HKOA 1KARA 3HN6A 2WSLA 3CWCA 1ODKA 4CIWA 5LVAA 5BT8A 3DEYX 2WNSA 1W5FA 3DBRA 1YE8A 1KJZA 1MU0A 3NHJA 1OXUA 1L7NA 1Z4OA 1ZP6A 2D2XA 3B53X 1NX6A 3BJRA 3PL1A 4UXHA 5JCJD 4PC1A 1WX1A 5KWJA 1RRVA 5M7EA 4PN3A 4N0QA 5DS0A 2MSCB 3CPSA 4WGFA 1QHSA 2E2WA 4QYXA 2AEEA 5DDIP 4H4CA 2ZI3A 5DWVA 3UWPA 2K87A 4EGJA 1IWPB 3TINA 1YJCA 1DIHA 4DNRB 4L1KA 3PNYA 3WRVA 4D41A 5KVAA 2J1LA 1B16A 5K0GA 2Y1KA 4YUZA 1PNRA 2JCBA 4L02A 1VSVA 2J3HA 2ZTGA 1KZYC 2IS4A 3QE2A 4RULA 3CZ5A 1G0OA 2HWXA 3QE4A 4LX8A 3OU6A 3CCEB 2YHSA 2WPDA 5FOXA 2BLNA 4F9GA 5C1PA 1GLGA 1EWRA 4X1YA 3IA7A 1E63A 4PIVA 5KSZA 3AL3A 1YZ3A 4EDFA 4PZ9A 4XIFA 2YINC 1IU9A 4B7UA 1T2UA 4L73A 1XNRB 3QMVA 3S99A 3EFHA 4NXMB 1LWNA 3RU2A 1K2WA 2H4XA 4ND7A 3VFDA 1IHXA 3I9NA 3JXEA 3NANA 3KAPA 2VPWA 3MTEA 4CEHB 2F00A 3I6BA 2P9FA 3NHBA 4FCVA 4ILEA 4OHOA 1V47A 4AZ0B 1A82A 1OIWA 1MZVA 3PI7A 4FFMA 3RV3A 4EQZA 2D54A 1EZ1A 3K0CC 3I2JA 3ZHUA 1UAAA 1RXIA 1Q7RA 8MHTA 3WKCA 1RKVA 5F1KA 1E1MA 5FAKA 1L5RA 2Z09A 3UHJA 4LF7B 3GCDA 4QWMA 1Z38A 5FV7A 4ZVNA 5SICE 2XGJA 1U63A 5CEJA 1K88A 3TSAA 4BFSA 1GCOA 5HSGA 3KXPA 4I9HA 4KGXA 4MICA 3W7VA 1N5KA 5HKAA 1KBOA 4N0MA 3SBDA 1R6DA 1KU0A 3PRHA 3CW8X 4ALKA 1Q6ZA 3WIUA 3CGGA 4NYIR 3ER6A 3P2OA 2SNIE 3PRJA 5T57A 2ZAOA 2X5JO 2RAPA 1FFCA 1LTQA 2QDKA 4M49A 1NM5A 3LUJA 4YP9A 1Z6AA 3BKXA 3DONA 1TQHA 1Y6GA 3KWMA 2I5PO 2ZYGA 2OV8A 1JT9A 2FXIA 1W581 1A5AB 3H1FA 1QVAA 3H6GA 3QVUA 4GAEA 3BGSA 4UZUA 1T2AA 1Z35A 3ABQB 3JQ8B 4NWIA 3UXMA 4JC8A 5JHGB 2G5TA 4ZT6A 1KYZA 4AMZA 2EQAA 2PRZA 3I4CA 2BEVB 2PUWA 2I78A 3VVLA 4JI0B 1QVFB 2I4OA 3PNVA 3HA2A 1H1TA 2AXQA 2AX4A 3PEEA 4S05A 2JBWA 3DV9A 3EDMA 4MMZB 4EJFA 3EG5A 4II3A 1HXHA 2C5GA 3T7EA 3L1HA 4B3JA 4KHPB 3RF6A 3E53A 3PPIA 3FOEC 3FI9A 1R8QA 2HV9A 2IJGX 2WIDA 1P6UA 3JALB 3NNSA 1X1DA 3OG9A 1YZTA 4MYRA 3V4PB 4N8SA 3BMXA 1J25A 3WNBA 2BRUA 1TZKA 4L95C 4XYBA 4NOJA 1G38A 1RAGA 1NVFA 4EMUA 2QE7D 621PA 4H3HB 2NX2A 4KMOA 4ZCPA 2E55A 3HPQA 2C07A 2LVBA 4PSCA 4P53A 2XD9A 3S2ZA 4OF4A 3W0LB 2OV6A 2ZSAA 2JGIA 4L51A 5ICMA 4AJIA 3OKPA 3CMCO 4EY3A 1SZPA 3DDHA 3GLUA 1F12A 5J1TB 5C9ZA 3I1JA 1R12A 4YCCA 4I4CA 5LA6B 4DFDA 1ZMXA 2EZUA 2YRXA 1ZVVA 4M1OA 5BSKA 5LQKA 1X74A 5H16A 1ORWA 4BRZA 5DCLA 1DQNA 5EI5A 4AY4A 4GEKA 1PJTA 5KBYA 2WK1A 1AU9A 1DAOA 1SOUA 1ZITA 2O2EA 2V3VA 4EW1A 3ICEA 1N06A 3ONUA 1RABA 1L6RA 3EY4A 3MUEA 4FWBA 1CNEA 1QE3A 5CHYA 4TKLA 4TTTS 4XB2A 5E6RB 3PTAA 3S44A 1YRLA 1U3WA 1LCIA 3UC5A 1GD1O 3B1VA 1CK4A 2Q3FA 3OMXA 1SD1A 2JAUA 1N2OA 3OLCX 3ETNA 4P7BA 1A7AA 1VJ1A 2BFCB 2X85A 1RLOA 4IXWA 3UJAA 1ZPDA 1MQ8B 2PAAA 5DBIA 3ZYCA 4CT0A 1ETUA 4ASUA 1QCDA 2FSPA 3HB7A 3KIPA 4Y6RA 3IXLA 5E0KB 3X1KA 1M9NA 3WL8A 2YMLA 1I18A 1E0SA 3VQTA 2FZKA 3IQXA 1EHIA 2Z6BD 2SBTA 2ZREA 3QVGB 4EB8A 3AZOA 3KYCA 1U8XX 2VH2A 4H2DA 3ZK8A 3QTBA 4YJ2A 2P75A 1NUHA 4OM7A 1DJNA 3HB1A 3R7BA 4D8XA 4CMIA 2AD1A 4CQNA 3BGIA 1S3GA 1ZQ9A 2VXCA 4MW7A 2E37A 3UK1A 2I87A 1N2JA 2PJDA 4K05A 1IXZA 3OT1A 4AJJA 2ZJBA 1OH5A 3FYUA 1X80A 1OLUB 1NJ6A 1T2VA 2DWOA 3QVXA 3OEED 4BXOA 2O2JA 2ZRNA 1YQDA 5KTNA 5BR7A 2PH5A 5BQFA 2IQ5A 3LVBA 1R6TA 2YHIB 3PGKA 2HPZA 3BFVA 4UBMA 4QHYA 1OXTA 1Q1EA 3UHOA 4FFLA 1BVHA 4Z3OA 1R00A 3DQQA 4OD0A 4Q3KA 2XNJA 3QVVA 3QFSA 4BKPA 4S04A 1KAGA 2HDOA 3CIFA 2HX1A 1CDDA 1AZSC 3H4VA 3R7WB 3WSWA 1O8CA 4PC2A 3KZVA 4AICA 3T12A 4C7VA 4EI8A 5BR1A 4L8GA 3PQ5A 1U11A 3MJHA 1EUCA 3MT0A 4I1IA 3RVNA 1GITA 3ANMA 3A1CA 3OE5A 3FW1A 3O9MA 2XXAA 4GX2A 1Q7CA 1AG9A 1LNQA 5JS2A 1NKTA 2FEOA 1G3UA 4FKBA 5BW6B 4BMOB 1H8ED 3R0VA 2ISQA 1JLLB 1UBSB 3A4MA 4QYIB 2VL7A 2VF4X 2XWSA 2A67A 5KNLA 5EIFA 5EQFA 1QP8A 2CBXA 4HNUA 1B8UA 1YCFA 3I73A 1J90A 2R96A 2NU9A 1XU4A 4FZ5A 4MYSA 4XD7D 4X06A 2PSEA 3PXUA 1C1DA 2EZ8A 5A9SB 3EFBA 3VMMA 4N5MA 2ZAYA 1P19A 4QNNA 3I62A 2MSWA 2M6SA 4K26A 2IZ6A 1EFRD 3LPDA 3VHRA 121PA 1SVNA 2R1UA 1HR0B 3KXKA 1T26A 1M75A 5F9HA 4GXTA 5KTOA 4GF5A 2V8OA 4TLBA 1F8UA 3O2QB 3EW7A 5HIJA 1ZXBA 4F8JA 2W0SA 1KWKA 4EPRA 1FNMA 3O4RA 4JC4A 2ZVPX 1TZMA 1Z22A 5JDCA 1H2RS 2OBXA 1PEAA 2G25A 3NHWA 4F3CA 2AZXA 3PFFA 4RDHA 1VQKB 1Q7TA 1VTKA 1JQLB 3FCAA 3BH4A 1Z0FA 1EDBA 1LTKA 2GWHA 3GJ8A 4LHWA 1Q0LA 2HK8A 3N2IA 4MLZA 5BQ5A 5ICSA 5IVKA 1KL7A 4E6PA 4CTOA 4H0NA 3FZNA 2VVTA 3E15A 5E6SB 3TVTA 4BHTA 3GA0A 3D4IA 3MM4A 2CVQA 3EUAA 4Q9NA 4KXYA 4BVLA 2A57A 4MGZR 4A73A 5KHLB 4UUAA 4RS4A 4JC0A 2DSNA 1G8FA 2O5EA 2G8LA 4DWVA 2DUNA 1Q74A 1PJ8A 2X9GA 1MQAA 3LFTA 1KQOA 3W6UA 4EFNA 3Q8LA 4TTPA 1GU1A 2OG2A 1X87A 2JFWA 3QKWA 1ZUNB 3T3PB 4EDHA 5AIBA 5AVYA 1Y6QA 2NO0A 1K89A 3LK6A 4U2BA 2WAXA 3QVLA 1NDUA 1C9JA 4I7EA 2EWWA 2JEYA 3FXAA 2VHTA 3D81A 1YJ9B 3GJTA 1BVYF 2XWBF 3DE7X 4MIYA 3R3VA 4ZMRA 3C24A 2AOTA 4OXQA 4X0EA 3D64A 1JR6A 4KR2A 1KMQA 2F17A 4HEQA 2W6NA 3A2LA 5C52B 5JPIA 1QAQA 4C29A 1IG3A 1NSTA 1D1QA 3Q72A 3ZOZA 3LUDA 4BJ6A 4PG4A 1Y3AA 2KX7A 4BDTA 5FWXB 5K45A 1WF6A 2VBFA 2WMYA 2FEXA 1MNQA 4ZC8A 1M6NA 1VL8A 5FPTA 1RZRD 1F7UA 1JGTA 5F76A 5M34A 1O96B 1II8A 2ATIA 2G3YA 3DZBA 1L8AA 1NBME 3CSDA 3II6X 1NQWA 2J7PA 1P18A 1QCCA 2JK1A 2F3PA 1TQ8A 1U6IA 4J0JA 3J81k 1FU7A 4X7RA 1SVKA 3CRQA 2V6GA 3MG9A 4QXRA 1C0EA 4I55B 4HL6A 4C3VA 1J56A 4K1XA 5DNAA 1KEWA 2BKLA 1EESA 1CFJA 2QDXA 5K6TA 1ENPA 1C0PA 4K0KB 1D6JA 1Z7WA 1ZOIA 2KPOA 3QG1A 4LXUA 1RQ7A 4K9QA 1CJBA 2O6HA 6ADHA 1PFYA 2R8OA 4C0JA 4JEUA 1A88A 3WGMA 1E5QA 4EY8A 1RJGA 4MKRA 2VTKA 1BEUB 2FN8A 2JBHA 3X2SA 1GTSA 2MYUA 1U9ZA 5BV2P 1EFHA 4ZPXA 4INJA 4LDPA 2E4UA 2HK6A 1IMOA 3EMKA 3A0UA 3EZLA 3FLMA 4RIFA 4CKWB 2NYUA 3JQGA 1TM5E 2G4LA 1IAQA 3OQIA 4L3WA 4DEYA 1EUYA 2HBQA 4EVIA 1PG0A 1TVKA 1ZD4A 1B76A 2WWWA 2Y92A 3GFSA 5IBCA 3TLAA 4KFCA 5KYVA 4FMDB 2R47A 1DLJA 1JR3A 3SEJA 4KIGA 4RDCA 3S27A 1GPH1 3DJYA 4QWWA 2ZZMA 4EA7A 3P5SA 4NDNE 3I12A 1SQSA 2JVKA 5H1YA 4ECAA 4MW9A 3I9JA 3IC5A 3U4IA 2I6QA 4R84A 4BCCA 3DTYA 3WE7A 4RGQA 2E5LB 1D1PA 4YP6A 1KRHA 1J1IA 4R5MA 4OYHA 3M1IA 1I2BA 3MT8A 1ZU4A 1P3Y1 1QMPA 3QKSB 2OD9A 1E7RA 2HHAA 3V8QA 1N2SA 2HLPA 1KJJA 1E4OA 3BRQA 3KDAA 1UPAA 2Z43A 4ND2A 3RODA 3CWZA 5EKUA 2FPOA 2IYSA 2J07A 2VPYA 4ZAXA 5LZ5A 4P3KA 4UEJA 2W4IA 5T8KC 5TS3A 3FSGD 3TQFA 2OY0A 3EPRA 3WYCA 4YRBA 5JCOC 3GT7A 4LTDA 2G72A 5AI6A 4AKIA 3IUBA 5DW3A 2COEA 4DCGA 4M8NE 1CBUA 4O2BF 4UW9A 2ZRKA 4FUTA 4UVEA 3HR8A 4N7BA 3OETA 4A1FA 1HDOA 4RA6B 3QWIA 4EF5A 1XMJA 2IYZA 3EGWA 2FP3A 2GPBA 2ZDGA 3SHTA 1V9LA 1E3LA 5JXIA 4UNSA 4GX1A 3VU8A 3U61B 5DYGA 2RJOA 2A9RA 4L4YA 1MTZA 2HMUA 4ZAZA 1NFFA 1C7ZA 5EAIA 2CB9A 2IHZA 4LISA 3I72A 4E33A 3NBMA 4YXWD 1I7LA 4B48A 2JVIA 2HEIA 2LZ0A 5NLLA 3KNZA 4CDMA 1CY2A 3DBRB 1NQ5A 2OV1A 5DM1A 3TDMA 5IH3A 2VTEA 3DKPA 4I50A 3GT3A 4NBLA 5HG0A 4ZK6A 5KTMA 2SHKA 1VHEA 1DO0A 1MEEA 4X24A 4OG2A 3OZSA 4P4TA 4E2ZA 1HNNA 2DETA 4KLRA 4RM2A 2IP2A 4KVGA 1DMSA 1UT5A 4XVQA 4M9QA 4UATA 2EQBA 1E9CA 3E6AA 1C9KA 3W9YA 4NPHA 1R0XA 2M6KA 1VQLB 3ON5A 2D6FA 2RK6A 2W42A 1OKKD 2REXB 2RHBA 1W5EA 1CX9B 2C03A 4FZVA 3W6NA 1XZFA 4XFJA 3OPNA 3SIRA 3KUUA 4JFAA 4ENUA 3HY6A 4BFWA 1JG6A 3WYFA 5E2IA 1RP1A 1N78A 1JKMA 1FUUA 2QAJA 2YV4A 3IJ5A 3U44A 4X1YB 2V3CC 2CHEA 5F4JA 1GEGA 1NQTA 2O7QA 5ALDA 3NS7A 3WZMA 1D07A 5L3VA 2CLHB 1NRIA 1Z8DA 4YCAA 3LIPA 2A14A 3KYIB 1XQ6A 1LRJA 1BE0A 2VUTA 3VTAA 2PX2A 2B9VA 3AZQA 4UAUA 1IBKB 1WU7A 1OSNA 2BYTA 5EN4A 1N4AA 4TQGA 3RVBA 2G6TA 2YJTD 5ICGA 1PHRA 2QMQA 3EHDA 4NU0A 4E15A 3RFXA 2CL0X 3W4IA 5K0BA 2X1HA 4CKZA 2NAFA 4EJSB 3IUPA 5A89A 5ICCA 3A1PA 1RQXA 3SCZA 1QWOA 1PZXA 1QHXA 4FGKA 2AF3C 4QQNA 1FDVA 2R60A 5H9VA 4ZJYA 2RMKA 3D43A 5TLSA 2DCMA 3BREA 2A0UA 3V80A 4F4CA 1Q0PA 3B6EA 2Y99A 3Q6RA 4BB5A 3W5CA 2Y66A 2KM1A 3DUWA 3PXAA 1SIUA 2YWEA 2EKLA 3BE8A 2X6WA 3A0RB 4X1OA 1L5HA 1NBEA 1R6VA 4D4GA 5AW4A 1EWQA 5AM5A 3DDNA 1NUTA 1DADA 1EJ0A 1XA3A 5ECGC 4W5HA 5DMHA 4BMVA 4FPXA 2PQ6A 4BX2A 5A6VA 3GCWA 1FIUA 1ZRHA 2J9XB 8AT1A 3JQDA 4D4MA 3VOBA 1Q22A 4CF6A 5KWEA 5KZMB 3WIOA 1JHZA 1KDVA 3UG7A 1XZBA 4LV6A 4CW7A 2AE1A 1OREA 7REQA 4N12A 1HRDA 2BSQA 1BKDR 2HIGA 4CMKA 4B80A 3BWXA 2WHRA 3EIWA 4WQMA 4JOQA 2VP5A 1J49A 1VJDA 3I9MA 1NV9A 4ZRMA 2ZZGA 2BE9A 1H4VB 4QUIA 1XPRA 4DHWA 1YQ9A 3RS0A 2VDVE 3F4LA 2BGRA 3PA6A 3O0TA 4HDOB 4NRDA 5FULA 1E5XA 1GL9B 1A7UA 3RU3A 1IHOA 4FJ2A 1YKFA 2F1RA 5LZ9A 2ZOSA 3PWTA 4G0UA 2CXRA 4DHEA 4RX1A 4RZHA 1CY0A 4GZ5A 3PXBA 4UFNA 2X8BA 5DFAA 3T5BA 3PX7A 1AHPA 421PA 4UM9D 2W48A 3HCPA 3HU5A 1YR1A 1ZGJA 1PP4A 2I55A 2QF7A 2WKSA 3BYZA 3LX4A 5EEHA 5B36A 1DGQA 4P3PA 2FP4A 3RC7A 1H6AA 1M54A 4PYMA 1Y7LA 2UKDA 2BTOA 1KA9H 3KXIA 4E3ZA 4DARA 3RVSA 1G18A 2HIMA 3RG2A 4ER3A 2AJBA 3E2IA 1Z8FA 1JDBC 2CJWA 1ZICA 3GVPA 1DUSA 3PPXA 5AVQA 2R4QA 2OHXA 3T4PA 1JQ5A 2EF1A 3Q7EA 4E6EA 1YNOA 3C7AA 1DDIA 5HXBA 4M53A 1IEQA 3DE3X 4HEJA 5M5BA 2Y0PA 5AOAA 3QXSA 3REGA 3NGMA 3ZV4A 1RPJA 2WA1A 4PAGA 1GPYA 4PRKA 1JDTA 3C1AA 1XB2A 1V5VA 4OK6A 1T5DX 2VA9A 3TBHA 3Q2IA 3BA6A 1DPFA 2JLRA 1ZYUA 4WCFA 2ZL7A 1PIWA 3DXFA 3EZFA 2WZQA 4MI6A 4AXBA 3OHPA 3DE4X 3I55B 1R7RA 5DP2A 3IP3A 4LJYA 5DI9A 5A5DA 3VDXA 2H51A 2PUHA 4ND1A 4AQ7A 5J2TA 1O95A 1RQRA 1M10A 4O2LA 2OSVA 4OUKX 3GPLA 3EJWA 4RKQA 3EZYA 3WBJA 4EM6A 2Q3DA 9LDTA 4FWTA 3KYCB 5CITA 2ZUWA 4O4LA 1I0ZA 1W4AA 4IWNA 1K63A 1SA0A 2O1EA 4YJ2B 4GMHA 2DFKB 2Y1CA 3HWSA 3F5MA 2IIVA 1H2WA 3LZCA 2PYDA 4U0JA 1WXQA 4LV8B 1CHDA 2FEPA 3OT1B 4UUMA 5F33A 3FYUB 1Q84A 1MD9A 1X80B 4DDWA 4PGMA 4FW9A 5DLEA 1KVQA 5MDHA 3CE9A 4WXYB 4YB8A 1AT1A 1U9YA 1FBNA 1B8OA 2W4MA 4RVDA 4GLOA 2VNIA 1JX6A 1YNSA 3OAAA 2P9GA 3AUAA 4OHPA 5CFOA 5LR6A 2NV0A 2O0MA 4NNPA 2JLWA 3KZXA 1VCNA 1Z34A 4JBGA 3C7DB 1UFRA 1UAYA 1ZX1A 1AM4D 2HWWA 1JEDA 2ECQA 1EUCB 3DKKA 3TNDA 3I1FA 3JQFA 1BOOA 4EG1A 4AO6A 4K9OA 3ZZ1A 4XYLA 4AZWA 3M3PA 1MW8X 2XXAB 2LXNA 2I2FA 4TV9F 6NULA 2GHRA 1PV4A 3ISTA 5FBZA 1P1JA 4C0LA 1ND5A 4Z0TA 1NI3A 3G1TA 1J9EA 2CV2A 2X0NA 4MKGA 1DAFA 1S9DA 2CLDX 4RF2A 4B5LA 1M2HA 3ESZA 4YREA 1NOKA 2VAMA 2CFOA 4P35A 2NU9B 2WWGA 4Z4YA 1VFPA 3IAS6 4N40A 1C1DB 1TT5B 2CB0A 2OVFA 2UYYA 2K4MA 5CGZA 3T3DA 4KVAA 2D5CA 3H9BA 2R8XA 4UEOA 5LP1A 2Q0QA 4G09A 2QNRA 1P2TA 3UF0A 1DCMA 1LQTA 3HJUA 4JHLA 2IPLA 1H42A 1E6EA 3OF3A 2IHNA 4O5AA 4AYWA 1D5CA 2UZAA 5L4SA 1NP6A 1XCJA 4TS3A 2C5LA 3IFSA 3T0FA 1HLDA 3JAKA 3I0ZA 2MMGA 3M5WA 2NOAA 1ZG3A 5B12A 1WV0A 3JAMA 2IEYA 1L4LA 2C57A 4O4IA 4CMHA 1TC2A 3RUEA 1DB3A 4IPTA 1FUIA 1SZDA 5JEEA 3HM9A 3NHSA 4W1SA 4XCQA 1YZFA 1GO2A 1QZUA 3KFXA 3RFUA 4FDUA 2BHTA 4BO3A 4W9MC 1SXHA 3U9LA 3AY0A 5EUCA 5TB5A 3FWHA 3PT5A 1AGPA 4R6XA 3S4YA 3R7FA 2XZTA 4FX5A 3H8JA 4F04A 3NEAA 1T9DA 4UHJA 1UWKA 3SR4A 3MGAA 2C9DA 2J3JA 4QG7A 5C3UA 5EERA 3JYOA 5FOUA 1QFZA 4X07A 3GB9A 3KKEA 1PT7A 3AKCA 3OSZA 4OP2A 1QTIA 2IF2A 1F8FA 1JEAA 3VNBA 5J4KA 3A2MA 5JBNA 2V7QA 1TDJA 4DA7A 5AN9A 1BD3A 1E2HA 4K6CA 3ILSA 4RH0A 4DE5A 2DB3A 2WFAA 1YONA 4F6CA 5EP4A 1DQZA 1TAUA 4ZOLF 4X84A 5IC5A 1EA5A 3PA8A 3FIUA 4E5PA 4J43A 4ENVA 4AWAA 2W6ZA 2YXEA 4WTOA 2YXLA 2XYHA 3RRFA 3DLTA 1CY6A 3ZCPA 1T9CA 1BJRE 2AOTB 2P30A 4R98A 2PUGA 721PA 1NG9A 2NZUG 3H0EA 3L7JA 1D6MA 4YACA 1TU3A 4ZPJA 2KLHA 3MSXA 3V7WA 2F8SA 4D7AA 2IE8A 1E2IA 2KJQA 3PUWA 1IPFA 1N2BA 1UKVY 1HTBA 1DC3A 1MC8A 1Y1KE 3L8HA 3A58B 1JG2A 2CLOB 3O1HB 4HEA1 3L04A 3ZHOA 3G49A 1II8B 4TMZA 3C3CA 4XLCA 4DMLA 3HC7A 3RGGA 4FOPA 2CHVA 3WGKA 1VXRA 1XDDA 2ZRBA 4AJOA 1H5QA 4H17A 4K6HA 1O94A 3LQRA 4Y6SA 1DT3A 2H9AA 4OXYA 3VOTA 4GKKB 4CKCA 2BR4A 3KP1A 1WULS 3EE6A 4HK4A 4EB0A 4DKXA 3FM9A 3K96A 4NMMA 2ZJ1A 4JLUA 3PWSA 1JHVA 4KMRA 3V97A 4IXTA 1IHYA 5FOQA 1RQPA 1DBWA 1XRJA 2IVZA 3K0HA 5FBWB 4KFRA 4B47A 4XX0A 4DIMA 2IT1A 3PGMA 1YK0A 1V37A 5DYWA 3SF8A 4A82A 4NOLA 1M8PA 1PFVA 3L6RA 1GRNA 1QPGA 2NTYC 3G71B 4L4SA 1VJTA 4DLVA 1YMUA 3RSLA 3THYA 1Q0RA 1YS4A 3EULA 1GM5A 4ZDKA 3CCRB 1T2DA 4JVLA 4V3BA 5IBQA 2ZSBA 2OV2A 3A1SA 4MRRA 3D0RA 3JQGB 3OQIB 5AJUA 1CYEA 4I5IA 1DRWA 1JHQA 2JJMA 1FRNA 4RS3A 1UJNA 4TS1A 1TVKB 5LUBA 2XWQA 4YAKA 4JR0A 4BUZA 1GTVA 2W2LD 4FIDA 1XNJA 5IZ4A 1AXRA 1X8KA 3EWAA 2I8AA 1CLUA 4GYJA 2NZXA 1US8A 2Q4BA 4TM8A 1NVMB 3ZXSA 5JALA 3GW8A 3WBKA 4G6IA 3EC1A 2O7VA 3L1KA 3KE8A 4UTXA 2QRPA 5JCJA 3WAKA 4FINA 1K9MD 3H16A 3BXZA 4L72A 3E05A 5IPFA 5EP3A 4CN8A 5IZCA 1X86B 3A8IA 2X6RA 2REOA 4DV2B 4UBNA 3EVEA 1Y6FA 3RS7A 2UVPA 2PKCA 2XQIA 3AOGA 4WXMA 5TQJA 5LB4A 5U4QA 2QBYA 4JASB 1WIWA 2RJNA 3WMWA 4L8YA 5F9MA 2Z5VA 1Z6YA 3OFND 4OHUA 4CQLA 2PU7A 2NSHA 1BZYA 2WUWE 3BMQA 2P6NA 3GEGA 1IXKA 3WFIA 3RK1A 4M89A 4CEIA 1YS1X 5ED4A 1PKXA 3A05A 2ZIGA 2GM5A 5AKKA 5AP9A 2GDZA 1XROA 4UEQA 2AF4C 6AT1A 4R71A 4DCJA 3E9YA 2H4ZA 4IJMA 3X1ZA 2PMWB 3DVAA 2P0AA 3ZHQA 4MWSA 4OU5A 3R23A 4HFNA 1QONA 4RF3A 1RI4A 5ENVA 2V7EA 3MQ4A 4FKMA 1EVZA 5GPBA 3D3JA 2YIJA 2GZ1A 1TFRA 2AR9A 1UOOA 3SG0A 4W5QA 3OM0A 1CJUC 3T5AA 3ICPA 2BGIA 1YAJA 3ROZA 4Y2JA 4OA8A 2Q29A 3W5SA 2LUOA 4I50B 5AVRA 2R8BA 3L7AA 1USVA 4XUCA 2P67A 3HXOA 4ZWNA 3P19A 1P7PA 3RYIA 5CLGA 1VIMA 4BO0A 4PC7A 2FETA 5ILQA 4S1OA 1VXOA 2DECA 2WU3A 2GREA 3T9EA 4DTCA 2L18A 4UTOA 1KBZA 3MTBA 3ZD6A 1KDZA 3DHVA 2IZZA 3LOUA 4O8ZA 2J3LA 1CRLA 2F1JA 1MGPA 5HQ3A 1ZRSA 2LIVA 5IYWA 4JCCA 1JPVA 2PXCA 3Q8KA 1CY1A 4HQRA 1EB9A 2BBOA 1Y80A 4KE9A 2YX1A 3QLVA 4WZBA 2R1TA 2Y2UA 1Y9DA 3AYZB 3N2NA 5T6BA 1ZJZA 2Q0HA 5KJ1A 3U44B 3PDIA 2HWYA 3UQYS 2NO1A 4GI5A 1D2MA 1NJ8A 2P4SA 5LD2C 1W0KA 3RUCA 1PZNA 2OBRA 1C9EA 4XE5A 1UPCA 2ISCA 4XWWA 4CU5A 1ZGBA 2R85A 2E6KA 1WOYA 2L69A 2OCAA 1NVBA 3R4VA 4B6OA 1BQ3A 2BSXA 4BKUA 3CVXA 2IEZA 3EEQA 4KBGA 2NP7A 3UB2A 2JKZA 4QVGA 2V7WA 1HFKA 1KFJB 1XZPA 1Q1GA 2KSQA 2YZKA 3VR5A 4UMEA 5IN4A 3QMPA 2JS7A 5DCWA 4QUAA 4ALNA 4L9WA 4JLBA 1YDWA 1UFOA 2G9NA 2OHIA 5A0FA 3OZEA 1I3LA 2VJYA 3EFEA 3VZSA 2BW0A 1ZO8A 4YHBA 5CM2Z 1N6NA 1M74A 1RRMA 3QFRA 5T6MA 4OQMA 4AX8A 3COSA 4I19A 3KQPA 1KF0A 1AIPA 3IOBA 2PSDA 4WKPA 4Q4DA 1L5HB 3G2KA 4HAZA 4CM5A 4FZRA 3DZHA 4Q24A 2G7MC 5J58A 1B26A 1QHIA 3IQEA 4FGSA 2H9IA 4Q66C 3CGWA 3TLEA 5HNKA 2EFDB 3JVDA 2QJTA 1DEHA 4JUIA 3BRWD 3HBMA 4Q05A 4TRRA 3VTZA 1UP7A 4RE6A 2IYFA 3IJEB 4BBAA 2FSSA 1J70A 3OZIA 7REQB 1DRUA 1MLDA 1Q1ZA 1G5RA 5JCZA 4FM9A 3HI4A 1YZQA 5ALWA 3NDBB 1Y9JA 3V4SA 2R751 1FVXA 1D2CA 4QXMA 4Q1AA 2DWPA 1XFAA 5IDXA 2GD1O 2OQ2A 4PLHA 5B1SA 2JATA 4O4HF 4COOA 5B6IA 1X70A 2GVNA 3N76A 1G7RA 3JSXA 1SG6A 1PS9A 1DEAA 1ZHFA 2PH7A 3D5QA 3FRJA 4LS3A 4OQNA 4X8HA 5HIIA 3ZS9A 4DGSA 1DQRA 4DJ5X 2CFIA 4QKQA 4JSRA 5JI2E 1RZUA 3GY0A 4YGYA 4F6RA 3F6CA 1Y1PA 3EAFA 4BWGA 5A06A 1QB8A 2VNKA 2ASVA 3QTTA 1G8JA 1JDVA 4CLOA 3H9JA 1EFPA 2LV8A 1X42A 2W93A 1ORDA 3R7AA 1VL1A 1M1UA 3ITDA 2R6DA 4E3WA 2DYKA 1W5TA 2CNWD 2H5JA 3NRJA 2FP4B 4HAIA 1UBHS 5ER9A 4ZIRA 2O3UA 2FSFA 1VYUA 3WADA 3GN2A 3FGZA 3T6KA 1BCRA 1U5BA 2AMFA 4A8JC 1O4WA 1E9RA 1VPVA 4I3GA 2H7VA 2W11A 3GAAA 4HDNA 2I71A 3PZRA 4JLAA 4Q5IA 5EIEA 2SCUA 3A1TA 2CJWB 5COQA 1DQYA 1IY1A 3N0TA 5EGNA 4FFRA 3TJZA 2X5NA 4LWZA 4P7FA 1V3TA 2YR0A 3G2NA 2GJPA 2HLHA 3CN9A 3NC1C 4AKEA 2PFKA 2PXAA 1WJGA 3L1UA 3B85A 4H7DA 5SYAA 3ZX4A 1YZKA 5F78A 2C7RA 2GEKA 3DJFA 2JZNA 1QQAA 3Q0EA 4G5YA 5KOYA 3W77A 4A92A 4U9UA 1NU6A 4WCFB 4BN4A 1VLOA 1KGDA 1M1NA 2CYAA 1QGED 3GJYA 2HA2A 3CZMA 4FE4A 3VR6D 3JD0A 2B7BA 1YE3A 4EFDA 4HQOA 1Z62A 3DMGA 3TZBA 3VSEA 4DXHA 5CJ2A 2SECE 3IELA 3KOXA 5J2TB 1WDTA 1ECLA 1BQEA 3K73O 1NLFA 4EGFA 1TIKA 1VB5A 4MLCA 4RO0A 1P7YA 1AUQA 5AKLA 3P0JA 3K9NA 1GT91 5C8VA 1JFRA 3BXHA 2FHPA 4O4LB 3LYUA 5AW8A 1SA0B 5L3QA 5EJ6A 2CF4A 3NATA 1MP0A 1B0ZA 3QYFA 1QNFA 3LPMA 4WT7A 1VYTA 5EMKA 4N9WA 1WCIA 4ZCIA 5SZKB 3VGJA 3O7WA 5FIUA 1EK1A 4AB1A 4WXHA 1P73A 4TYPA 2JRLA 5BYJA 1WPRA 1SUEA 4Q1VA 2O23A 5TSDA 4CQMD 4DMFA 2UUPA 2GZSA 4ZU6X 2Z2KA 3SM9A 2JLCA 1RM5A 1M2VA 4FX2A 1Z4JA 3CLVA 3PK0A 2N3ZA 3INGA 3ELDA 2HNAA 1KSGA 2O8FA 1OFGA 1P1CA 4Q1BA 5F5XA 4O2BA 3K6RA 3T3HA 5J9FA 4Y2SA 3PC8C 2F3QA 1JF8A 2PS3A 3S70A 1YCDA 3U26A 1V3QE 5LM3A 3GXOA 4FT4A 3NJ8A 1Z6GA 3LQYA 3QPUA 3DFKA 3TK1A 5CIQA 3SK0A 2GI4A 3R24A 1USUA 3DFIA 1HA3A 3K7EA 3P4XA 4MQEA 4Q02A 4YRGA 3BIFA 2DH6A 2ZJ8A 2IXDA 2UVDA 3PFIA 3WWPA 2H2DA 1KR2A 1X92A 4MRSA 1Z4MA 2OD7A 2V9PA 5AK4A 3UOGA 1R6UA 1T8UA 4WASA 1A72A 4MV4A 3KQOA 1OAAA 1YS7A 2FPGA 2W71A 5DNVA 5T4HA 5ULLA 5CA1F 3V8PA 2WY2D 3HAGA 3DYIA 2OXEA 3O2NA 3MTQA 4U3JB 4KIWA 4KK4A 2V6BA 5HF9A 3IESA 2P3SA 3V9PA 3QEKA 3WP1B 3PQ3A 3QTLA 4RV4A 4WJLA 1HT0A 2WB4A 1QVGB 2IXAA 3QWFA 2BJWA 1RHJA 1VQOB 3M6LA 4AM8A 4AN1A 3ZD8A 4CNQA 1NBWB 1Z74A 2PD3A 4PBTA 5IYZF 4YPOA 1NVUQ 3FVRA 3LYLA 1PWYE 2F64A 3BXPA 4KWEA 4PHTA 4U00A 1OWPA 4XIYA 4Y7CA 4US2R 2OCXA 3EWIA 3JAKB 3AOEA 1FTNA 5EQTA 3HU1A 1Y5LA 1XLTA 5DCUA 4IDHA 3ANSA 3R20A 1BA2A 4V24A 5K8LA 4AL4A 2ILTA 4EHNA 4J4TA 5EXDA 1JBKA 4OH1A 4Z54A 2HPAA 2XNHA 1U7DA 4U8HA 5JANA 3PJDA 1GTRA 4DBLC 2X0RA 1FVFA 5AH0A 1O0CA 4KRYA 2OENG 4KN5A 1VZ3A 3BWEA 3FNQA 1YFKA 2XZPA 2WYRA 3NQ41 3T1OA 2W7TA 3EXIA 3V8MA 5DYTA 3SICE 3O3OB 5BWOA 1SWVA 2GYYA 3FTPA 1L9KA 4L57A 5TXGA 3P2JA 4REQA 2YW9A 4D5GA 3K9GA 1RHUA 1R0WA 3JWIA 1J42A 4C0KA 1QVRA 3OC6A 2EC5A 4BZXA 1EVJA 4YYEA 1HDCA 4KYVA 2VIIA 1E2KA 3LI2A 3LRTA 4XKVA 1JIKA 1GUYA 3MW8A 2IUUA 5IM4F 2KHZA 2PK3A 4YMWA 3G68A 4IHJF 1Y82A 5JBIA 4YHHB 3MB8A 4C6TA 1KJIA 3USCS 4PAAA 3E5MA 4MEAA 3D6AA 3OBIA 5FA5A 4JA0A 4K9NA 4X63A 2IE0A 2G0AA 3UOAB 4P36A 1HC7A 1XHLA 3HGQA 4BJ1A 2X1LA 2VYFA 4A36A 1JECA 2Y76A 1SUSA 3P2KA 2IXFA 4OJTA 5DCYA 4MEJA 1G3RA 1ECPA 5FI5A 1TYZA 3UPTA 3AM1A 1CZRA 2QMZA 1GGFA 2ST1A 1W8IA 3V8RA 4A2WA 1SH7A 3QSGA 4R6WA 3TD2A 4FQ8A 3MAAC 1LZKA 1PKVA 3T1HB 4BMXA 2P68A 5EIHA 3IO3A 3ZW9A 1X77A 3AT1A 4GKAA 1CR6A 4UHFA 1IPEA 4AKHA 1T4BA 1LBTA 1P2DA 2FDCA 3RSHA 2C94A 1MTOA 4Z1MD 2O3RA 5LDHA 3NBZC 3PC7A 1B23P 3KS9A 3P94A 2CLCX 1HWYA 4I1OA 3BXEA 5A1TA 1QV9A 5CH8A 2D9RA 5FLEX 5BNIA 1F17A 1LPSA 2O8DA 5JASA 4I5FA 1X9HA 5I7FA 4FEYA 4PVDA 3I39X 3IT2A 4TV8F 4CKCB 1U7HA 4FTWA 4RVHA 3V4FA 3OZWA 3GEEA 4GI2A 1IHDA 1NYTA 1HURA 1MKYA 1E79D 3ENWA 3AVUA 3OMWA 3L41A 4YVFA 2WUGA 3UB3A 2J6CA 4AS1A 2XUFA 1XDZA 3H5VA 1XTTA 2C9YA 4TTJA 3HRIA 3I01A 3IT0A 4BMPB 4Q82A 4XX0B 5ALFA 4R7GA 4Y9RA 4URXR 2CDBA 4RLHA 4F38A 2X0KA 1J8DA 1JJFA 3UH1A 3THYB 1GZUA 1U28C 2O05A 3CF2A 3IQIX 4OP7A 3FDIA 2RHGB 3N2GA 3NHUA 4N49A 4JWKA 5JRDS 4LBYA 2OXFA 2VCYA 3A6HA 3PR3A 4FNAA 3AJ9A 4WACA 4DLAA 4IMPA 5BRAA 1GPNA 1MC4A 3L1JA 5HMMA 3FOZA 5ALVA 1Z29A 1OX5A 1K7EB 5JADA 4WK2B 1ZD1A 2ZUFA 4YEJA 3S0JA 1OOEA 1XTSA 4Q9LA 5KJ6A 1RAHA 2N46A 3NPMA 1US8B 5KKCA 4OIMA 4CMBA 4ZI3A 3GRZA 1J0EA 2VQDA 3GGJA 3OLWA 4IO1A 4K46A 1P4RA 1L7DA 2PO7A 2PGNA 2FMUA 5K0EA 4OQPA 2B7LA 3OX2A 4LVUA 4XSHA 5DSTA 4EGSA 5JCXA 5E4TA 3GEMA 4JKOA 3RC1A 4CDRA 2B9EA 4HYQA 3PE6A 5MHTA 1P7VA 1Q0UA 1SGWA 3CZRA 3HH8A 4GYYA 2FXVA 2W6CX 4GZ3A 5B1YA 1CP3A 2WT9A 1MXFA 3QYPA 4LOHA 3A9SA 1VBFA 2UVPB 3WRYC 5IP5A 2QBYB 2AKEA 1GY8A 4E7PA 3K1TA 5CW1A 2GN8A 2D3LA 4BVKA 1PR4A 2P2CA 5JD4A 4NMXB 1GQSA 3IA2A 3R0IA 3RWOA 2BCGY 1ZCAA 3BMQB 3OHMA 4Q1CA 5GP1A 1NJ5A 4HDQB 3GJRA 5SY4A 1T9ZA 3UCFA 4MULA 4ZO6A 4R8LA 4CEIB 4YLYA 2ZDQA 2G5PA 2YIMA 3L92A 5JTUA 3HXMA 1RR6A 1F2VA 3KQQA 4PYNA 2IYXA 3NJRA 1P4GA 3K6SA 5ALKA 2BF7A 3BGVA 4BTVA 1SQGA 4UUNA 1CUVA 4ODIA 1RXSA 5HDBB 3DVAB 3IPLA 1XPOA 3RROA 5JRZA 1LBEA 3S8EA 1DAEA 1UEJA 5LJIA 1R4NA 5EHZA 3R6GA 4LRQA 5HMLA 1U04A 1W85A 1C3EA 3CA8A 3SSNA 3DFMA 5KJCA 4RTSA 3COPA 3OW2B 1RLJA 2DT8A 2C8KA 4GSYA 1N5DA 2XLCA 4Q03A 4UOZA 1HM5A 3V4RA 3CT4A 1TB4A 2P1ZA 1S9HA 1Y1SA 1SBHA 4B87A 1GZ6A 3RYIB 1Q21A 3OFKA 3CTMA 4XOUA 4YMSA 4JNCA 1R27A 3PC3A 3X43A 4BVJA 2XOKA 1K5PA 1GNVA 3FZYA 3V2HA 3A6LA 5CAEA 4Q4AA 4GE0A 2ZAIA 1SN7A 2JHCA 2Q2VA 1IFXA 2BLLA 3M49A 4YQZA 2C4UA 2FDRA 2IUTA 3H8SA 4M54A 4PTZA 4BUCA 1G3QA 1K08A 1MO3A 2QW1A 4YUXA 4X00A 3UQZA 2EJCA 3EZ6A 4B35A 4UTNA 2QMYA 2RHOA 2PS0A 4WZBB 2R1TB 2G1JA 2QG6A 3NIBA 4JNKA 3IVCA 4L5CA 4TTVA 1HKHA 2JCYA 1WG8A 4IGIA 3PDIB 2O1XA 4E1VA 3SFZA 3AF6A 2H4YA 2P11A 2O7RA 1RRPA 3TG2A 1SC3A 3I5YA 4N9QA 1O54A 1CJTC 2WYWA 4OOVA 1O0BA 1EQUA 2BR5A 2CXNA 2ODAA 1PV1A 3SJBA 3VJLA 4Q47A 3HCOA 1K68A 1HT2E 2YZMA 1BHJA 1SCDA 2ZSKA 4DUGD 1B2RA 4ZOQI 4BX0A 4P38A 3WWCA 2WIBA 4A5OA 5IBPA 4NFYA 4YRZA 1J07A 3KVOA 1FDIA 1G6KA 1GZSA 2A9PA 3FH0A 2DPGA 1N77A 5EHQA 3I6ZA 1E2UA 2BI4A 3DM9B 1HY3A 3ANLA 4DG9A 1T36B 2P2ZA 4YWJA 1YD7A 4Q3BA 1C0LA 3VUFA 4DQ0A 5CFPA 3TTVA 4PC3A 3RAEC 3F3SA 4L7QA 2DF8A 3UAOA 2Q28A 1UQTA 2EFCB 3F5FA 1AHHA 4BKOA 3BTSA 1KDYA 4LZZA 4X3OA 2ZJ2A 1NTRA 4H1VA 4N0DA 4AKTA 1QHYA 1L1EA 1SBTA 1UBFA 5K8CA 4FB4A 3GPDG 1NAIA 1P1KA 1C9YA 1NVXQ 4RD1A 3AILA 3BAZA 1VLYA 3OM9A 4PX5A 5CB6A 1GKIA 4CXMA 1SVLA 5HS6A 3GLIE 5FBRB 2A2ZA 4JJIA 1VKNA 2EEPA 1R0SA 3G0OA 3VH4A 4O4JF 2IHBA 3Q41A 5JCPA 1YBFA 3ONWA 4QSHA 3BJEA 4PLWA 4F7WA 1F8XA 1R5JA 4E32A 2XSZA 2K5UA 2JJ2A 4LRXA 1JR4A 2GH1A 3GPBA 4GYWA 1W52X 3OEWA 4MR9A 1OFUX 4RKYA 4RD2A 3IMEA 4I3FA 1TA4A 4ICIA 2F62A 3WO0A 2XUPA 4RUKA 2IPNA 3DBVO 3SBXA 3IIEA 6GPBA 2BMDA 3LY8A 2BR3A 3EDCA 5DLQC 3KL9A 3GA5A 5DBGA 1B15A 1JDUA 1XXHE 3FPCA 1WSDA 1Y33E 5PNTA 5CB0A 4H3KB 2V7BA 3LC0A 3KAKA 2DC1A 4DYDA 2PIDA 5JY1A 1UWCA 3TJRA 4F6RB 1EGMB 2EW8A 1K4YA 5F73A 4GOJA 2QP9X 4GLFA 2OV3A 1JLMA 3QLUC 4YCDA 5D00A 4KR9A 3UMRA 3UVEA 4HP8A 1EFPB 2ATVA 2C4WA 4N5LA 2P91A 4PAMA 4KLZA 5EUQB 5JSYA 4F45A 3MJFA 1PR6A 4XIGS 1BN6A 3W05A 4RFLA 2FPLA 1ZESA 3OTIA 4C30A 2N1MA 3QX7A 2QVBA 1ZINA 3W6PA 4EPXA 4KQ6A 2A0YA 5ALIA 5DXAA 4F9EA 4ZIRB 3E9RA 3FOFC 2P1RA 4LSZA 1BCRB 1EU1A 1U5BB 4F72A 4IQ4A 4HDNB 3AM4A 2OKCA 4QICA 3R76A 2SCUB 3D54D 3H2HA 3NUZA 4LZAA 4M1SA 5K9ZA 1PL0A 5TT0A 4EI2A 4XPIA 2GPJA 1P8JA 2ET6A 4C3UA 1W36B 1H8HD 4IG9A 3OZCA 2AWNA 2BFEA 2PX0A 2KI5A 4ECEA 4KLNA 1RJFA 3L0BA 2OZKA 1ZD2P 3Q1KA 3UV7A 1ISSA 5TEVA 3WXMA 1PGPA 3NYQA 2LD4A 4RXMA 3VYTB 1PE0A 3W9BA 2FG7C 4M1ZA 1R0YA 1OZAA 1JIXA 1SR8A 2Q5FA 2VYNA 3TRJA 1M1NB 2PBRA 4ZYXA 3ME5A 3A04A 1LJUA 4HF7A 4AWBA 3ABSB 4N48A 4V03A 3HABA 1I30A 5ENDA 2GSWA 5LZ8A 3MT9A 1YB1A 4UCWA 3HXTA 1A04A 3ZGZA 1IATA 4R8RA 5HCNA 1E1RA 1QK3A 3LQEA 1ULHA 1K7SN 2OUIA 2PWYA 5CJJA 1ZGCA 2OHVA 5L3QB 2VDWA 4MPJA 1E43A 4OXRA 2DGDA 4UKDA 1NXQA 1UUFA 4MV8A 1GTZA 2MYPA 1HVXA 1I0IA 4NMHA 1EQAA 4UFOA 1X1EA 3DAHA 1WCIB 4TMTA 3UJ9A 4B5KA 4EZBA 3D4NA 4BWYA 1EP1B 4C4OA 3ZJVA 3I32A 2C54A 5FDFA 1QGAA 3CJRA 4G5HA 4M1TA 3OFJA 3Q6MA 2Z4TA 5EL0A 3HKBA 4OSEA 1M2VB 2V7TA 4IRXA 3VR5H 2G9UA 3KQHA 2O8FB 3PYMA 2FWBA 4O2BB 3K70C 4K40A 4PG8A 4OJMX 4CPDA 5L4LA 4UJ3A 4UZFA 3GBSA 4QJ5A 1X13A 2ZR8A 3FYTA 5BY2A 2QX4A 2HSEA 5CFRA 1MC5A 1TA0A 4RU1A 4MEBA 5B1EA 4MQEB 5J4HA 1NT2A 3BHIA 1FX1A 4LCJA 4W99A 4BKQA 1KZ7B 4X05A 4K6GA 4WDRA 1N36B 1E6UA 1TC1A 4HKTA 1E1KA 3K0SA 4NL4H 2FPGB 4AIRA 1ZBQA 3A4NA 4UQOA 2C3MA 2CNNA 3JWHA 2QN6A 1H2ZA 1TJNA 4J7CA 4W7IA 5LLDA 1V48A 3ZWBA 4ZTBA 4E14A 2ZJ0A 4MPPA 3LGAA 3MJ4A 4JB2A 1DAKA 2JIBA 4DT1A 1ZD3A 3NVMB 5EYPA 2EBHX 2Q27A 1X9GA 1ZWLA 4U6QA 3SQNA 3V34A 1YE5A 5JNTA 1AV7A 5K2OA 1EM6A 1L5VA 2DE0X 2R8RA 3B13B 2O8BA 1CR4A 4OREX 2PGAA 4BV8A 2PZAA 3WKAA 5JXWA 4U6SA 1YH3A 1Z4PX 2M1XA 2C7OA 3FUWA 3KB8A 4BECA 4I9NA 1NN0A 1XVLA 5B58T 4FGWA 4F60A 4NPCA 1KVUA 4HATA 1GA4A 4L0QA 2QUHA 1FSPA 2A92A 4AMVA 3AFGA 3BCHA 1KY2A 1KYYA 1Y8ZA 2BFWA 3ZHVA 1M34E 3IE1A 3O3CA 3WAGA 1MX9A 3EXIB 3NGLA 5EUBA 3KWLA 1PTJC 3OOEA 4FWIB 4XMYA 1H2EA 1JTVA 2FW9A 2RH8A 3FR7A 4REQB 1PR0A 1QZXA 5JE8A 5TEWA 2QMHA 2OBBA 2CWWA 1U31A 3LQ1A 2OTJB 3PQ6A 5G1OA 2GGSA 4FXOA 2WWFA 3DXZA 3ZCQA 4R16A 2D74A 3HEBA 3GLHE 3LWDA 4FXUA 1XAJA 3KOYA 1NXSA 3P9NA 4PE5B 4RFSA 4B7XA 1RXUA 2GFIA 4GR9A 3IE2A 4EI7A 4HLUA 1JJAA 4Z0PA 3FDXA 1MT3A 1ODCA 4AG3A 2YOFA 2WA2A 3IBFA 2VBIA 4D8WA 3C1UA 1QIFA 4C6TB 1IM8A 4C08A 1ZC3A 1I2DA 2ZQ5A 1FEZA 2G9RA 4BL5A 1N0IA 3K0AA 1ECGA 1AN9A 2JGEA 2EP5A 1I5OA 1SHUX 3SZMA 4HRYA 1TJYA 1UBOS 4D5EA 3VM6A 2IOQA 3G9XA 3FOBA 1X7YA 3GFVA 4FQ7A 4IUYA 4DPMA 2OCDA 2MOKA 4L50A 1UANA 4H3VA 1CJSA 2N75A 1VSTA 3RUFA 1DCTA 2AFRA 3INRA 4IX1A 4YI5A 4FZ3A 2Y1GA 1BKSB 1ZK0A 4JLKA 2GPWA 4KRXA 3WWDA 1CF9A 4PZCA 1YI2B 3B78A 1IVYA 4GZMA 2ZBDA 2CN1A 3EARA 4CM7A 1XDSA 4AVYA 3EGVA 1A3CA 5AI0A 2QN8A 3HL4A 4HFRA 5GVSA 3AEUA 3FUCA 4KL8S 5I9MA 4RJLA 4D81A 1IN7A 3G6WA 2X3YA 2HY7A 3JTEA 5LLTA 3ONDA 2HJ9A 5CTAA 3U3KA 2DLCX 3ICOA 5BSMA 5THQA 2CK3D 1YSCA 3DEZA 4IH4A 3RNOA 3O92A 5CLFA 2PX5A 1FSGA 3B9QA 4O4HA 5FFMA 4F5ZA 3RTBA 3RAFC 4LYEA 4QPDA 3V2GA 2B8WA 4IQ0A 1I36A 1K6MA 3OZUA 2PIAA 1WABA 3K5WA 4QGHA 1XZEA 2R6CA 1T0PA 3H9NA 4AROA 3TMYA 1O9GA 4MIKA 1MQ9A 1W2GA 1HYHA 1GQ2A 3N2GB 4BQRA 1U4OA 1YWGO 2D2IA 3SLKA 5B5SA 5JZOA 5DHSA 3ZLBA 4KUGA 1V45E 2IYVA 2GN6A 1VL5A 4DEVA 5A3RA 1LFDB 4JOBA 5BOVA 4YALA 3AUYA 3WHPA 5BYAA 1GRVA 2HMVA 2HOQA 3Q98A 3RK0A 6ABPA 4CR6A 2XRFA 4URHA 1MF7A 3RFCA 4QBKA 5JARA 4QSMA 1J2TA 1Q7BA 4WWHA 2PZFA 3R41A 5IJXA 3FMIA 1YFLA 4AY2A 2HKIA 3QHAA 3BCFA 4K3VA 2O2ZA 4RMJA 3C6YA 2XE7A 3H2IA 3N87A 4L9AA 4QXQA 4XZ3A 5DN9A 3RPEA 3TPZA 2IX3A 2CXQA 4QOFA 5GOZA 3WL5A 1XMVA 3A1DA 4F4DA 2A9QA 4Y3UA 3CVOA 3ZXYA 3E82A 4EGAA 5JNVA 4H7JA 2H00A 1A5BB 3RRZA 3GQVA 1FP7A 3DZFA 4QUKA 1YKGA 3N0XA 2YWBA 3KOZA 4L74A 1H2XA 4NEQA 2HR1A 3SQWA 1YR8A 2D06A 3KJGA 4HRVA 3AKZA 2AN5A 1YRAA 1CZUA 2Y77A 3SF0A 2YYYA 2IS1A 5FKJA 3QFFA 3FBTA 2NNLD 2VPQA 4B3XA 2HMTA 4FGZA 1Z5PA 4QBIA 3V4OA 2O8DB 1CPYA 3LUKA 1D4OA 2XUKA 4KSCA 2OWEA 1X7GA 2G76A 2JI7A 2X6YA 4XUDA 2IF0A 3I52A 4JBNA 3IGFA 4DSOA 5FH9A 3K6SB 2NNWB 1ZJ5A 4PSAA 4JYAB 1NDQA 2IYOA 2CL7X 2EVWX 2C82A 3P9YA 4M4SA 4A8HA 4RKEA 4MUKA 3M4JA 1NUPA 2FMFA 4Q0MA 1A9SA 3H3JA 5DGIA 2PT5A 3AETA 1TYDE 4IP0A 5C0OE 2YNMD 3V4LA 4XN3A 4RXUA 2IZ0A 1NXTA 4C7KA 2TECE 1R4NB 5H4GA 3KJQA 3DMTC 4KFTA 1W85B 2NZWA 3HJTA 4D0RA 1SPBS 4FDMA 4N3GA 2QP3A 5U1PA 3K9FC 5JOQA 1Z5UA 3G8AA 1Q5PA 2ZRHA 1E7YA 1L7PA 1AF7A 3L05A 4I9GA 4PICA 3ZY6A 4PZAA 2FOLA 5JLAA 5LZ7A 3ZH9B 2HCBA 3I2HA 3MUNA 1NURA 2HCFA 2DBRA 4Q7QA 2GM9A 4OAOA 1AHIA 2I7DA 2ID7A 4RENA 1TPZA 1SUPA 1WETA 4FFNA 4PSDA 3O1IC 3P52A 1F14A 5GJWC 1M90D 3FZQA 2EL7A 4P7KA 1KI6A 2PRIA 4TV9B 4TMFA 5AVZA 5CAEB 4Q4AB 2KB0A 3E3LA 1MW9X 5E7MA 2GHQA 3OOWA 4YUWA 2ZU0C 1YB4A 2NT3A 1U0FA 3OE4A 4PXSA 2FFJA 3R9IA 3WLFA 1S3IA 1LPAB 4TLEA 4YCNA 2GESA 3W34A 5CA1A 4G4SP 3D4LA 3LOPA 5EHNA 4U2FA 3RC9A 1M1KD 1K8ZB 4EUFA 2O54A 2X5KO 4RACA 2XWJI 3SLDA 3N07A 5IVPA 3VKGA 4HJRA 2X6TA 3THOA 4TMVA 5EVCA 3ZWMA 3NHAA 4N47A 1BWSA 1RYNA 3OURA 2E18A 1YS9A 1WMDA 3FVQA 3WK6A 4N7RA 2J0UA 4KPUA 1AKWA 4CGYA 1KSJA 1I5EA 4W8HA 1W4RA 3ONEA 5DWQA 3H5WA 1C8BA 3VV3A 3QKIA 4Z4WA 4UD6A 3LCMA 4LYGA 4R9NA 1F7VA 5FORA 2JIOA 3DW1X 3G5AA 2JAXA 5CLLA 1ONNA 4PQFA 1Z2AA 4IIVA 2HD4A 3NO4A 4LCBA 2CJFA 4KH1A 3UM9A 1QVWA 1TLLA 4KKTA 1EWTA 3DPIA 1HPLA 4LZOA 3UJ7A 2JF0A 3UJNA 1RM0A 5I8ZA 1DIRA 2LDXA 2AS0A 4P58A 4MV0A 6LDHA 2KLBA 3K31A 3TPCA 3EJ6A 3TGLA 2XOXA 1E1CA 2DPHA 5KDDA 2OFXA 4FYMA 5JZBA 2AG8A 3H19A 2GAIA 2P9JA 4M7WA 3KU1A 4GRAA 3R8CA 3EB9A 5F7ZA 2II6A 4JUDX 4BNWA 3RADC 1ID1A 2FN7A 2VDLB 2WSBA 3H05A 3MA0A 2RBKA 2P6UA 2D8AA 3QPWA 4GM1A 4IHJA 5HCIA 5NULA 1EBFA 2RGDA 4BIMA 3ZYZA 2W90A 4K6KA 2C7QA 2ES4A 3IVMA 4ZOLB 3TIXB 3G79A 3TW6A 1QKJA 3D26A 2GQFA 2H1FA 4IYRA 1KFKB 1R10A 4QDKA 4WPGA 4MR9B 3UJ8A 4N5IX 1ENYA 4OJYA 3CWQA 2KQUA 4PFQA 2GN2A 4DNXA 2FLKA 3NAMA 4W5NA 1PO7A 4NI5A 1GUAA 4AY3A 1TKRA 3B52X 2AYXA 5BSFA 2M9MA 3KTDA 3C3JA 4PLTA 4EPTA 2X4LA 1UAGA 4R8SA 1D4FA 5G0TA 4F3YA 3IP1A 1ZEJA 4V1CI 4FYPA 5CUQA 5JAUA 2QXYA 3T5MA 4IO0A 3OT5A 2J3KA 2M98A 4HNTA 5AKXA 1J6UA 4DANA 1AK9A 2D5AA 3AYXB 3WGQA 1ULTA 3KKMA 4OI1A 2AMLA 3U7EB 3RK4A 1R3DA 4J1NA 3V1LA 1ZD9A 3DEKA 5IXSA 1GL7A 2Y0BA 5KTSA 4E1AA 4TV8A 1JI3A 1KP9A 4XWYA 2BI8A 4WVLA 1P5ZB 3UO8B 3GLGA 2APJA 3FUXA 1AK2A 3LA6A 1XZIA 4F06A 2A7QA 2HNKA 1P5FA 3E5NA 4HCJA 1FTSA 4WINA 3VR3D 4Y1RA 2FYTA 1GSHA 1UBLS 1JHRA 3OZBA 4YYZA 5KOIA 2CVPA 2VT7A 2OZLA 3I92A 3L84A 4PQGA 4XPIB 5E7IA 4YY3B 1JL3A 2PUCA 4UUQA 1FDTA 1D2HA 1XZHA 2X3FA 4JGBA 4OMUA 4UTZA 5E2AA 1QYIA 2BFEB 3SXPA 3CNEA 5DBEX 1RYYA 2QRUA 5D3MA 3MJVA 4RMGA 1V3UA 2OCLA 4NYIQ 3ABRB 4M0LA 4PZPA 2NVOA 1FDOA 1JU9A 2WINI 4RVGA 4NOMA 3OPOA 2CYBA 2ZB2A 3ESQA 2B83A 3OLYA 2CY0A 2QRHA 3QFTA 1T34A 2V65A 3OZ7A 4P32A 5DULA 3R40A 3UXYA 1KOGA 5KVQA 2H63A 3KKZA 2FQXA 3TWOA 1UBKS 2VPXA 2YFYA 3QKUA 4BNHA 2DUMA 2EGUA 2P1DA 4A3SA 5I9BA 4EVSA 4XCXA 4B33A 4J6FA 2VJDA 3PVCA 1U81A 1DRJA 1JSCA 2FLVA 4Z4ZA 4RVUA 2VDWB 2C5FA 2E4YA 2QYOA 2Q0XA 4G5XA 1AKUA 4JJGA 3L0ZA 1KVSA 2QTNA 5FA6A 4MKFA 2J33A 1EE2A 1TOAA 2Z9CA 3KAJA 1YO6A 1BC5A 4QLAA 3H9EO 4GPBA 4L6AA 1Q82D 2UDPA 5EE5B 1Q81D 1Y63A 5F1YA 4DC9A 5KYNA 5FOVA 1G8MA 4L9SA 4LQLA 4XLAA 3PFNA 4EUHA 2E9SA 3N28A 3I3OA 3N7TA 4IHQA 2MHCA 3RASA 2UXBB 2X15A 2QRJA 3T61A 4TLCA 4FYXA 3D5TA 2FX5A 2PH1A 4IEEA 2ZUTA 4PR3A 2WRZA 5J2UF 3JRWA 1WSRA 1LVGA 3NTUA 1QUFA 1UDAA 3HKBB 4V0RA 1YT5A 1GAXA 4Z2YA 4ZV4A 4OEHA 3RABA 3FZGA 3EXFA 5K1ZA 4LRTB 5JSUA 4DLBA 4B9AA 1EHCA 3UICA 3WRWA 1EH5A 3HVHA 4HQNA 4B7CA 3T1TA 1FLVA 4H7PA 3L7NA 2XUZA 4IHKA 4OLBA 3ROTA 3SQXA 3UGKA 5DT2A 1L8QA 3FPHA 3I45A 3DOIA 5EGSA 1JAHA 1FSFA 3RS9A 1A2OA 3PVZA 4Q1DA 1GGJA 1LS1A 2VT2A 5JPCA 3ZU5A 2IRWA 5DHAA 1HMYA 4TS9A 3U48A 4I2NA 1JEYA 2XKAA 2ZTSA 4U2EA 4CTMA 5AKHA 4GBGA 4LZLA 2FF7A 5KCMA 2Y27A 1FLNA 3VA7A 1YS6A 3KT6A 4HGOA 4W9NA 3B1XA 2B2XA 5LYYA 1X8JA 4KXFB 4JKYA 4D4IA 3AVYA 2GCGA 4DT1B 3T7AA 1T10A 1T15A 4PZZA 2PUDA 1UD5A 5JAOA 4LXGA 5EYPB 5L40A 1OYYA 1GPBA 1YR2A 3EDOA 2VP9A 4PGHA 2ZJ6A 3JCZA 4UVHA 4G0YA 4XM2A 1T6NA 1Y3IA 2FZ4A 4J2HA 3VX3A 2FAXA 1WXDA 2CLSA 4LF4B 2O8BB 2HA7A 3OIFA 1THTA 2VBUA 1XNHA 2EOAA 4ZANA 4GYKA 1H5UA 1L3IA 3LHDA 4KNWA 5ESDA 3AESB 5HKLA 1N57A 5L9AA 5SYMA 4OPVA 4G4GA 4MB0A 5ABPA 4OHYA 5F3DA 3CX6A 3JPYA 3ADKA 2I6UA 1MIHA 4IUCS 3PIIA 1KJQA 2YHBA 1OV6A 3DF9A 5CPBA 4BZZA 1ZUWA 4I5EA 4KX3A 2GD0A 4PYJA 1IJEA 4RH3A 1T13A 2JGKA 1R8JA 1QGDA 3PX3A 4GKBA 1PSWA 5JIBA 3GVJA 2ODTX 3P2IA 5K8JB 5ALTA 3JD4A 4D25A 4AJ4A 1NHGA 3TFQA 1R6BX 4MW5A 1W1UA 2IYRA 4RFSB 1SCQA 3L7YA 3Q12A 4RKFA 1NJFA 2IH2A 4KEAA 1ZH8A 4ZGNB 3WK5A 5IYPA 2HJHA 1U1EA 4GP6A 2XNKA 4OI2A 5IUJC 5JZSA 4REMA 1O58A 3N1UA 3CO5A 3I9KA 3VPHA 1SC6A 1B7GO 1HORA 4AT1A 3K0AB 4HLQB 1RPZA 3AGQA 4AFNA 2JFPA 2DZDA 4B81A 2XJ4A 4M1EA 2QD4A 2ZXHA 5GOTA 2FEAA 3WGLA 3N2KA 4KAAA 1AKNA 1QLWA 2WTBA 2L19A 3RIYA 1X7YB 1T9AA 2MU1A 3P7MA 3R74A 2DPLA 1VI6A 1XTUA 3R4CA 1SZCA 4D42A 3W6OA 1KKUA 2V9ZA 5K01A 1I4WA 1NGSA 3CISA 4FD2A 1I8TA 3U49A 1TU4A 4ISCA 4JYPA 1SULA 1KS2A 2RI1A 2X5XA 1D1TA 3ED1A 3IP8A 2WSSD 3JYLA 3PT9A 4OAPA 5DGCA 3RY8A 2IPMA 2RD2A 4O4JA 3PRKE 5B7NA 3L3BA 1RVV1 1WCXA 1ZW1A 1GPJA 1TM2A 2WDPA 5C1IA 3L4KA 2A1IA 4R1QA 3JS5A 1YKSA 2QL9A 2Z6UA 3KB6A 4CM4B 1RM4A 4GICA 1NBMA 4DXAA 3Q11A 1QYXA 4XQ0A 5EMHA 4ER5A 2LDBA 2Q07A 3ET5A 1K28D 1BOFA 1QFJA 3AEUB 3PDUA 3ILVA 1RI3A 1C3VA 3T35A 3N59A 4QYMA 3C6KA 3WLMA 4WZAE 2YUTA 3O3MB 3EH1A 3N75A 4JBWA 2B8TA 1P4JA 4U6NA 4D3YA 3X2EA 1R0ZA 2BCJQ 2X7JA 3EXEA 2KS6A 3FOCA 4O4HB 4WESA 5F3WB 3CUTA 1G5QA 3QOXA 3TZ6A 3DEJA 4F5EA 3ELYA 4BVHA 1X9IA 4AJHA 3AY7A 4DQUA 3L5OA 3QEAZ 3MSCA 4ZVTA 5IXJA 2A9FA 2Z5FA 2CXOA 3EUEA 3HCDA 3DCNA 3BD7A 3RWBA 4BE4A 3NC4A 4QNMA 4ZJZA 1A2KC 1XDUA 2JIQA 3IPXA 4XNFA 2Z8YM 2GBIA 5B1HA 3W8RA 5KS2A 4X60A 2FJ0A 5TC4A 2QRKA 4PPFA 4QOIA 1PVVA 2R5NA 4ZKEA 1Q2XA 4EPVA 4HNVA 3KSMA 5FL3A 1OA1A 1QO0A 2TRSB 1Y1TA 1OFTA 4FP9A 2AKAB 2QSJA 5KSPA 1XV5A 5B3KA 1P60A 2B5VA 4HNQA 2BMVA 2F67A 1JDNA 4C0HA 4W5RA 1T8RA 3CC4B 5DX0A 2WJPA 5EP2A 3T7RA 3VZQA 4B3HA 3ZDCA 4JP5A 2VK1A 4Q01A 3L6CA 1XA0A 1UD6A 4HDSA 1Q1QA 4OHWA 3IKVA 1AQNA 1PQWA 4KOAA 1G5IA 1WWKA 1T6XA 1TE2A 1WUKS 1Y5MA 2VSOA 3OD1A 1E62A 1NXXA 1W96A 3P2MA 3NE5B 1D03A 1QV7A 4IJKA 4C0WA 4EVRA 2QVZX 1L4FA 5H68A 1P8AA 2FJUA 1IPHA 2FGKA 5I9IA 4JI3B 4UJ5A 3BFJA 4V39A 4YUVA 2BGUA 3OZXA 4O1MA 4ZYTA 1MMFB 2R87A 1R18A 1XVUA 5IJAA 2PWAA 4Y0VA 3NBAA 2O48X 2I7XA 1G5FA 3KJIA 4GC5A 3NH9A 5ALQA 3S2YA 5KPJA 2V3WA 5BSHA 1J1UA 1LEHA 3COVA 1UXGA 4YELA 3IJPA 3VU1A 4HB4A 4A27A 1N92A 4DLNA 2EIXA 3AM3A 1T0JB 3JQBC 2Q4EA 1BMDA 3HDQA 3PF9A 3RTAA 4KVFA 5JDIA 5GINE 2WQ6A 1FS6A 4NAHA 4NV3A 1F5SA 1UFVA 1BS1A 4CWAA 1HH4A 2WQ7A 3BSSA