2CWAA

Crystal structure of the single-stranded dna binding protein from thermus thermophilus hb8
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
226
structure length
206
Chain Sequence
RGLNRVFLIGALATRPDMRYTPAGLAILDLTLAGQDLLREVSWYHRVRLLGRQAEMWGDLLDQGQLVFVEGRLEYRQSELQIRADFLDPLDDRGKERAEDSRGQPRLRAALNQVFLMGNLTRDPELRYTPQGTAVARLGLAVNERERTHFVEVQAWRDLAEWAAELRKGDGLFVIGRLVNDSWTSSSGERRFQTRVEALRLERPTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-strand binding protein
publication title Crystal Structure Of The Single-stranded DNA Binding Protein From Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Dna binding protein
total genus 42
structure length 206
sequence length 226
ec nomenclature
pdb deposition date 2005-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2cwaA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2cwaA02
1HZ9A 2CWAA 4KI0A 1U0LA 2WAQE 1W3SA 1NY4A 5GAGC 4Y7NH 4A76A 1M90C 4JG2A 4L5TA 3CC2A 2DUDA 3CQZH 4JBMA 2OQKA 4QL5A 5J3BA 4X62Q 2Y0SG 4DV4Q 4HIOA 1XPUA 1YI2A 4NXML 2MQHA 2UXCL 2L15A 3B6YA 2EIFA 2OCEA 3PO2G 1XPOA 1WI5A 3J7ZC 2R7ZG 5JJKA 3S1QH 4JI1Q 1KD1C 4A3KH 4YY3L 4B3SQ 3J80c 4JI6L 2UUCQ 1YJWA 2JJQA 1HH2P 3CCSA 3T1HQ 2RHQB 1SMXA 1I5FA 4DV6L 1GD7A 1YEZA 2NVQH 4IJLA 3PF4A 4GS3A 1CUKA 2IX0A 1CKMA 4JBJA 1HNXL 4DR7L 4LW1A 5C3EG 4DV7Q 1L1OC 3A5UA 4A3LH 4YCVA 4DAYB 1YVCA 2EXDA 2D62A 1KRTA 1SROA 1UWVA 4A4IA 3L0OA 3PCOB 4OWTB 1VQLA 3U50C 1PVOA 4DPGA 3L7ZC 4GKJQ 2ATWA 3KF6A 5JEAJ 4BA1I 4DV3Q 4FDBA 3KYHC 3M7NA 4GKKQ 1E1TA 2JA7H 3GTOH 1HR0L 3PV0A 5IYDH 5FLMG 5C0XG 2I5MX 4JI4L 4HJAA 4A93G 4UP8A 1XNRQ 1KXLA 4MNOA 5C4JH 3CCQA 2UU9L 1IXRA 3A0JA 4KHPQ 3UDIA 4KHZA 1Q12A 1UE6A 4GN5A 2FXQA 4UP9A 1N34L 1L1OB 4WJ4A 4HIMA 2MO0A 4A3DG 2MFIA 2LXJA 3H0GG 1IBLL 1EQRA 2R7DA 4B3ML 1C9OA 4POGA 4MZ9A 4PZ6A 2E8GA 4DAMA 1ASZA 4DV0L 1EOVA 3I7FA 4R1JA 4JCVE 5EAYA 1N33Q 3K0XA 2ZTCA 2ZTEA 3E9IA 3RZDH 1QZHA 2UXDQ 5FJ8H 2JEBI 4GOPA 2BH2A 4X64Q 3PF5A 3W5OA 2NVTH 3AYHB 1NMGA 1X55A 1SE8A 2CKZB 1V43A 2Y0SE 4OXPA 5GROA 4DNIA 5IYBH 2YV5A 4LF9L 4JBWA 2QA4A 1CKOA 1VQNA 1BBWA 2JE6I 5H1SE 5C44H 3GTLH 1XTDA 2QEXA 1PYSB 2I5HA 1JE5A 3CXCA 3S1MH 2VQEL 4X65Q 1WCMG 1N36L 5M3FH 1LM0A 1HNZQ 3K8AA 2UUAQ 4HIDA 1MJCA 4LF8Q 2ID0A 1GM5A 3I2ZA 4UPAA 3GTQH 4BA2I 3I4NG 3KF6B 3NENA 4JI8L 4DR3Q 1Q46A 4A3GG 4JI2L 4B3RQ 1Y1WH 3HKSA 3TS0A 2K4KA 1TWCH 1Q1BA 1IZ6A 3U4VA 3GD7A 2UXBQ 4YHHQ 4LF6Q 3M3YH 5IY0A 2KENA 1PHJA 4LF4L 1K83H 1VQOA 5JEAG 4BXXG 2KCTA 3RLFA 1R9TH 5AJ3L 4XIGS 5LMNQ 1FVIA 3ER0A 1XMOQ 1GKHA 4A3FH 1I94Q 1XMQQ 1A0IA 2A1AA 5LMUQ 1E22A 1X9NA 2Q2UA 2IT1A 1QUQB 3EIVA 4OX9L 1AE3A 3PUWA 4LFBQ 4A3IH 1CSQA 1WFQA 1N32L 1IL2A 5M5XH 1FGUA 2AMCB 2R92G 5GQOA 1J5EL 4DUZQ 3HOUH 3S14H 4IOAA 1Q82C 3J81i 1IBKQ 3NEMA 4IFDJ 3CCLA 5GAHC 1NTGA 3GTMH 5DLQE 4DR2Q 3RR5A 4IJHA 3E0EA 3RLNA 3D31A 3OTOL 4OONA 1OXVA 4R4TA 1PH4A 4AH6A 5IP9H 4IO9A 2HT1A 4A3EH 4BY1G 3K7AH 3AFQA 4A3MH 4MTNA 1TWGH 2A19A 4LF5L 1VQ8A 1WJJA 1YHBA 3PGZA 3CMEA 4JI0Q 3I4OA 3KFUA 2OTLA 1ASYA 1HNWL 3NBHB 3AFPA 5FLXc 1K0RA 2UXCQ 3HKZG 4DR4Q 4IPCA 1VQEA 2WP8J 1V1QA 4B3TL 2OTJA 4DK3C 4YY3Q 1QVGA 3F8TA 4HJ8A 2YU9H 1CKNA 3KJPA 1XJVA 1TWHH 4OWXB 2H5XA 3UDXA 1VQ5A 1E1OA 2LXKA 4A3CH 3HOZG 3W1GA 4UP7A 3RN5A 1YITA 1YJ9A 4DR7Q 2F3IA 3L2PA 2E5LL 4LFAL 4GN4B 2CQOA 1VQKA 4BBSH 3KLWA 3FKIG 4OWWB 4GN3B 2MNAA 5IWAL 4A3JG 1A63A 3S24A 4A3BH 4JOIA 3ULPA 1I3QH 4K0KQ 3BZCA 4UY8C 4DR6L 1E24A 4DUYL 2B63H 2OWOA 4NB3A 1YHQA 1EFWA 1HR0Q 3KOJA 4JI4Q 3PO2H 3BJUA 3OW2A 4A3KG 2UU9Q 1VQDA 2PNHA 4APVA 3CF5A 5K36G 4LF7L 1HZCA 3J81j 1OXXK 4JI5L 1TWFH 1MKHA 1RIPA 4EX5A 3M85A 3S1NH 2GVBA 1KHIA 1VQ9A 1S3OA 3H3VH 2CFMA 3PO3H 1IBLQ 1PYBA 4B3MQ 4R4OA 5C3EH 4IFDG 1Z9FA 4JBKA 4LNQA 4AIMA 4QIWE 2IY5B 1PFSA 3K81C 4YWLA 2HQLA 3TS2A 5JJLA 3CMAA 4AQYQ 4JOIC 3J80i 1HZBA 3HOYG 2JA7G 1C0AA 4DUYQ 2NN6G 1SR3A 3NELA 4R4CA 5FLMH 4GLAC 3T1YL 4LF9Q 2VUMG 3F2DA 2RCNA 3H3VI 2JA5G 3CAMA 3U4ZA 2ZJRA 1WYDA 4YCUA 3HKZE 1VQ6A 2ES2A 1EYGA 1Q81C 2JA6G 5C4XG 1SRUA 1S72A 2VQEQ 2B3GA 1HZAA 1N36Q 4A3DH 4PZ7A 3UE1A 2BA0A 1LTLA 3H0GH 2GVAA 5C0XI 3CCMA 3CC7A 2R93H 3CPFA 3JC66 4JI8Q 4C3JH 4P71A 2Q2IA 3LGJA 4JI2Q 2PQAA 1X54A 5IE8A 3HOVH 4GKJL 2VNUD 1UE1A 2K14A 4GKKL 1VCIA 1Y1VG 2KBNA 1QVFA 1YZ6A 5M5WH 1A8VA 3PIPA 2R7ZH 5JJIA 1UE7A 2XGTA 4LF4Q 2OQ0A 1X65A 3KJOA 3SGIA 3DM3A 3K7UC 5AJ3Q 3I4MH 3TRZA 4DV1L 3FHWA 1G6PA 3WWVA 4KHPL 4P74A 1AE2A 1VQHA 2F52A 4X66L 4JI3L 1X3EA 3GTGH 3ULJA 1WCMH 5ELNA 4IPGA 4GOPC 1KQSA 1N9WA 2NZHA 1VQ7A 1PH1A 4OX9Q 4DR5Q 1PH7A 4OO1I 4DV2L 1PH2A 3CCUA 1IBML 2K5NA 3F2BA 4R4QA 1N33L 4BBRG 2Z0SA 1CSPA 3HOXH 3S2DH 2IX1A 1EIFA 3KDFA 1KRSA 2VS1A 2E2JH 4NXNL 4DR1L 5IYCG 3G6EA 1VQMA 3U58A 4BXXH 4P75A 1OXTA 1UEBA 5BR8L 3JAMc 1VQBA 4XTCS 3RN2A 3STBD 2JEAI 2VQFQ 2HIVA 1YHAA 3ZJYC 1OTCA 1VQFA 1Y14B 4GOPB 2WB1G 1JJGA 4LF5Q 3CC4A 2GN5A 2ZM6Q 4DV5L 2CCZA 2YYZA 3CCJA 1HNZL 4AYBG 1H95A 4RG1A 1U5KA 4HJ9A 2JA8H 4LF8L 2NZOA 1HNWQ 2PMZE 4IOCA 3PUVA 3TQYA 2KHJA 4DK6C 3M4QA 5M5YH 2A8VA 4H02A 4HJ5A 4BY7H 1IYJB 2Z6KA 4B3TQ 4B3RL 3H15A 1KIXA 3HOUG 3RZOH 1B8AA 4HJ7A 3F1ZA 3S16H 5ELOA 3PUXA 5IP7H 4JI7L 3BU2A 2JA9A 1G51A 1YJNA 2HHHL 2UUBL 3M9BA 4NXMQ 1XMOL 4LFAQ 2E5LQ 3GDEA 4JC0A 3EN2A 1XNQL 4WJ3M 3JAMi 1N8RC 3MXNB 2VY3A 1I94L 2N78A 4KLKA 4A3EG 4BY1H 5IWAQ 4HIKA 3TEHB 1EIYB 3HOWH 4JYAL 4JI6Q 3CPWA 2YTXA 4DR6Q 5M3MH 4LFCL 4DV6Q 1MIUA 1S40A 4R4IA 4LUZA 4EQ5A 1HNXQ 1W2BA 1M1KC 3G4SA 2I5LX 2Z6KC 4J15A 1XPRA 2NVXH 3I55A 1FL0A 2YTYA 2VL6A 1SFOH 1IBKL 4LF7Q 2XTIA 2R7FA 2BH8A 3STBC 4A75A 2F4VL 4JI5Q 3HOZH 1Z47A 3PSIA 4LUOA 2EQSA 3CW2C 4GNXA 2K75A 2DGYA 1L1OA 4ME3A 2Q2HA 1EUJA 4TVAB 4YCWA 3CCEA 2PI2A 4JV5L 1B70B 3UDGA 1YIJA 4BBSG 3FKIH 1E3PA 4A3JH 3G48A 3I56A 1KAWA 2ALYB 3K80C 2WB1E 4JI0L 2ZJPA 4A3BG 1K8AC 2VZAA 3ULLA 2E2HH 1FJGL 2B63G 2D0OA 2LSSA 4AYBE 1N34Q 2K5VA 1VQCA 3T1YQ 1I50H 3ERSX 4DR4L 2NVYH 3DLLA 4YWKA 4POFA 4A3LG 3J7A5 5HGQA 2QGQA 3MEFA 3GO5A 4DV0Q 3S1RH 3UDFA 2ZJQA 4GLXA 1J6QA 1K3RA 3CCRA 4X62L 1YBYA 4DV4L 1RL2A 1K73C 1PH3A 2K5HA 2B29A 1PH9A 4YWMA 4GNXC 3GTPH 3PO3G 5IYDG 3GTJH 4A93H 1VQAA 1CKNB 3RLOA 2R6GA 4JI1L 4QJFA 1JT8A 4O0AA 4B3SL 2CWPA 2UUCL 2K50A 2N3SA 3T1HL 4K0KL 4NPSA 1PH6A 2RHSB 1BBUA 4L5RC 4LUVA 3HOYH 1X56A 2WFWA 4L5SA 2IHFA 4PMWA 2VUMH 1LUZA 1VQGA 3CCVA 2JA5H 1VQPA 2ASBA 4DV7L 1MJEA 4IFDI 4QGUA 4P73A 4DV1Q 4L5QA 4P72A 4X66Q 4GNXB 4JI3Q 2JA6H 5C4XH 4IPDA 2JQOA 1PV4A 1OXUA 1T9HA 5FJ8G 4DV3L 2N8NA 1Q86C 3EBEA 3M4PA 4PZ8A 3A5ZB 1YNXA 2NN6I 3OYYA 1E7ZA 1JJ2A 2D0PA 5IYBG 5LMNW 2IHEA 2AWOA 4DV2Q 1JJCB 1XNRL 2V1CC 5C44G 3AEVA 2AKWB 1C7YA 1K9MC 1QUQA 1NMFA 1IBMQ 1SLJA 3CP0A 3HOVG 2AHOB 2RF4A 3D0FA 4AQYL 1Y1VH 3HFZB 1BVSA 3KF8B 4NXNQ 5M3FG 4DR1Q 3AQQA 1QZGA 4OO1G 1Q7YC 3F2CA 5GAEC 3IRBA 3I4MG 5BR8Q 1D7QA 1Q8KA 3PUZA 3I4NH 1PH8A 1N32Q 3UE0A 2YTVA 1O7IA 3FP9A 4RMFA 1Y1WG 1J5EQ 2UXDL 4DV5Q 1NE3A 1NBWA 1D8LA 1EWIA 3A74A 4X64L 3GTKH 2WAQG 1VQIA 1P8LA 3S15H 3G71A 3S17H 1Q1EA 1X3GA 1X6OA 1JMCA 1QVCA 2KCMA 1VQJA 4PG3A 3OTOQ 3PIOA 3J81c 3HOXG 4BBRH 3PUYA 1GVPA 5IT9c 4ALPA 2N49A 1P16A 4A3FG 2JK8A 1X3FA 4X65L 5HY6A 4JI7Q 2UUAL 5IYCH 1TXYA 2HHHQ 1SN8A 2UUBQ 1GO3E 2PQAB 4A3IG 1XNQQ 2HIXA 3W1BA 4DR3L 3M4OH 2R92H 1HJPA 3VDYA 4QQBX 4JYAQ 3E9HA 2KHIA 1KL9A 4QY7A 1LYLA 1K8GA 1DGSA 1JB7A 1OXSC 2AWNA 2JA8G 3ICEA 2UXBL 1V9PA 4LWCA 4YHHL 4LF6L 4LFCQ 1AH9A 1L2FA 4DR5L 1VQ4A 3RNUA 2R93G 5LMNL 4BY7G 4IPHA 1PH5A 4C2MH 1WOCA 5GADC 5IP9G 4GLVB 4Y52H 3S2HH 1XMQL 4X6AH 1B7YB 1I6HH 4A3MG 1BKBA 4C3IH 2E2IH 1G291 2Q2TA 4A3GH 2F4VQ 5IP7G 5C0XJ 3Q8DA 1A62A 5LMUL 1PA6A 1L0WA 4TQUS 1EQQA 1KC8C 2I0QA 1HR0W 1NJIC 4LFBL 2VQFL 4JV5Q 3CD6A 3KDFB 1TWAH 2VW9A 4DKAC 3TREA 2C35B 4DUZL 2ZM6L 3HOWG 2MO1A 5E7NA 2K52A 1VS0A 2BA1A 2PI2E 3BZKA 5M3MG 1FJGQ 4A3CG 2ZTDA 4C3HH 1UE5A 4O2DA 4DR2L
chains in the Genus database with same CATH superfamily
1HZ9A 1U0LA 2WAQE 1W3SA 1F9QA 1YNNC 4A76A 1EY4A 5FOBB 3WDNA 1SMYC 1AFPA 2HUGA 1F2ZA 2OQKA 4ME5A 5J3BA 1XPUA 2MQHA 4KY6A 3CRLC 5BN3A 3BDLA 1PFNA 4YY3L 3J80c 5D3DA 3CCSA 1HH2P 1SYDA 1AEXA 2PW5A 3D6WA 2HCIA 5FLXL 4DV6L 2NVQH 3H6MA 2F0FA 1HNXL 1FNWA 4LW1A 4DV7Q 1QB5D 3H0GB 2EXDA 2F4IA 2D62A 1X32A 1CHPD 4ZKCB 4EQNA 3U9SA 1KNEA 5A35A 4GKJQ 1TQOA 2SDFA 4FDBA 3KYHC 2JXMB 5CC4A 1E1TA 2L11A 1GJXA 5IYDH 5C0XG 2I5MX 2IJ0A 4UP8A 2UU9L 3A0JA 3KUPA 1Q12A 1R4PB 2FXQA 1CZGA 3DMUA 1N34L 2DY7A 4A3DG 5KNDA 2MFIA 3GTGB 1WCMB 1PTOC 2RDFA 1QNKA 5EKIA 2E8GA 1ZYRC 3T16A 2ZXPA 2L5TA 4JCVE 2B2TA 2UXDQ 4HR7B 1QZHA 1JOQA 3S2DB 2BH2A 2EDGA 5JAVA 3PF5A 3W5OA 2NVTH 3AYHB 2SEBD 1V43A 5IYBH 2R7ZG 1XWEA 4HN7A 4LF9L 3S1QH 2E2JB 1VQNA 2LY7A 1CFMA 1XTDA 4NDXA 1DYQA 4IUUA 5IOCA 1PTOB 2OT2A 3U9OA 1D5XC 4X65Q 1N36L 4V190 4OO1H 2ID0A 2JA8B 4UDUC 4UPAA 5M5YB 3NENA 4DR3Q 4BY7B 4E6IA 1A3VA 4JI2L 2IX3A 2B2TC 1Y1WH 4F88A 1MGSA 2K4KA 1TWCH 3S16B 3M3YH 2QDLA 5IY0A 1K83H 5LMNQ 3RUZA 2FMCA 4K5VA 1GKHA 5CR3A 4A3FH 1I94Q 1XMQQ 5IGBA 2Q2UA 4LFBQ 4A3IH 1N32L 3BS1A 5AFWA 2R92G 1CK1A 2CW0D 4DUZQ 3S14H 1TVXA 3ERQA 4QUFA 1I4XA 1U4RA 5DLQE 4IJHA 5FO7B 5KGUA 2MJ8A 4RKLA 5CORA 5C4ZA 2HT1A 3EJIA 1PZJD 4ZK9B 4BY1G 4LF5L 4A3MH 3PGZA 3KFUA 3CMEA 3DEOA 1BCPD 2E2HB 5C6AA 1VMCA 2K01A 3ITPA 5IT9L 1VQEA 2NVYB 4YY3Q 3IKJA 4TRDA 5EBCA 2H5XA 2H1EA 1VQ5A 1E1OA 4X3UA 2K1BA 1YITA 1YJ9A 1KLUD 4OELB 3L2PA 3DHQA 1PZID 3FKIG 3P20A 4OWWB 1A63A 4A3JG 4G7OC 4JOIA 3BYTB 4K8IA 4UY8C 4DR6L 4Q0FA 1E24A 2B63H 1I6VC 3PO2H 3BJUA 2EY2A 1RODA 3VR4A 2UU9Q 1HA5A 1TS3A 4G7HC 1F2MA 1Q3LA 1SNMA 1RIPA 5C4XB 1Y8NB 1KHIA 3MC0B 3D4RA 3DWAA 1PYBA 1MHWC 1Z9FA 2MHVA 4AIMA 3FPUB 5COYA 1QCBD 2JN4A 2HQLA 3CMAA 4JOIC 3ND9A 2RQXA 2NTSA 3T1YL 1SR3A 5FLMH 1GUSA 4LF9Q 4XT3B 3F2DA 3CAMA 2ZJRA 1QG7A 1A15A 3NWTA 1Q81C 2KECA 3NK9A 2B3GA 1N36Q 5CV9A 1E2WA 2BA0A 3H0GH 2K32A 1SJED 3M4YA 3I8ZA 3CCMA 3CC7A 1A3TA 1GXDC 3CPFA 4K14A 5KIXA 4RKBA 4JI2Q 4HMJA 1UE1A 4GKKL 1VCIA 1B44D 2L12A 4L63B 5JJIA 1DJRD 4JVZA 2OQ0A 3FHWA 4KHPL 4P74A 1AE2A 4X66L 4OHJA 1ICWA 4L6TB 3GTGH 5C5MA 1WCMH 5ELNA 4GOPC 4AYBB 3CCUA 1H9JA 2F1MA 4HTHA 3MZ5A 3GP7A 3S2DH 3BVZA 3S2HB 2VS1A 2E2JH 4A3GB 5IYCG 1JE4A 4BXXH 1J8IA 1UEBA 2AQ2B 1PTOH 3ZJYC 4GOPB 1Y14B 4LF5Q 3FDTA 3IFDA 2ZM6Q 1HNZL 1TR5A 2IWHA 5JVH3 4HJ9A 2JA8H 4LF8L 1F9SA 1EEID 5M5YH 2PYKA 2HDMA 4BY7H 1YNJD 5I4DA 1NR4A 3H15A 2C9OA 3J81E 5J22A 1B8AA 4HJ7A 5DM63 4MIUA 5T1IA 3S16H 5ELOA 3PUXA 2F0UA 4JI7L 3BU2A 1XTCD 4KK7A 3TZDA 4PNYA 1ENFA 4NXMQ 3EFXD 4QB4A 3NXWA 1K8OA 4A3EG 1SJHD 5KNBA 1RF2D 4A3KB 3T4AC 4JI6Q 1EEFD 2YTXA 3OWEB 1LT5D 4DR6Q 4C3HG 4R4IA 4LUZA 2Q8TA 4EQ5A 4DNRB 1T5EA 1LTGD 4DF7A 2VL6A 1EYAA 2DN8A 4J8QA 3STBC 5EKKA 3IAYA 1DOMA 3I3CA 2F4VL 1Z47A 2EQSA 1PXUA 2K75A 2DGYA 4ME3A 2Q2HA 2JA7B 4F7XA 4YCWA 4JV5L 4U68A 2CH4A 2VUMB 1RJTA 4BBSG 1EY9A 1E3PA 3I56A 4JI0L 3AU7A 2F0KA 3ULLA 4F87A 2E2HH 1E0BA 4AYBE 2K5VA 1WTVA 3T1YQ 4GZYC 5LL6S 2NVYH 4POFA 3J7A5 5HGQA 2QGQA 4RA8A 1ESFA 3NBIA 4GLXA 1LTBD 3RZDB 1YBYA 1PH3A 4WJWA 2AUKA 1FYCA 4JI1L 2QILA 3KLRA 4B3SL 3J80E 1EY6A 1PH6A 1STGA 5I9OA 4H7BA 3HOYH 3H94A 2EYLA 2F0SA 2IHFA 3RD4A 1WTPA 2K5DA 3DUZA 1I4GA 1EZ8A 1SBBB 1CA5A 4X66Q 5C4XH 4O1NA 4IPDA 3TP8A 4X3TA 2N8NA 3A5ZB 1YNXA 2NN6I 3DXJC 1JQYD 1IYUA 3HZXA 1SYCA 2NZ1D 1XNRL 5C44G 1QUQA 3CP0A 4AQYL 3R93A 3J7AV 1RHPA 4CJ2C 3KF8B 1IKLA 3FEWX 5M3FG 4RGOS 1QZGA 5E4XA 2A69D 3F2CA 1D7QA 1SE3A 3V96A 5M5XB 5ELBA 2YTVA 1O7IA 1NBWA 1SYBA 1PZKD 5EPJA 3SVMA 3NBHA 3OTOQ 1B9NA 3LWEA 3PUYA 4ALPA 1P16A 1V8QA 3K7AB 2E2DC 1ZKOA 4JI7Q 1SYFA 1YNND 2CHBD 2P5ZX 5EQ0A 3NSWA 1QILA 1AZPA 1GO3E 2PQAB 3W1BA 3EVQA 2KHIA 1D6EC 1JWUD 1LYLA 2UXBL 3ICEA 1RKNA 1V9PA 1WTRA 1L2FA 4QCLA 3N52A 2J0TD 1PRTF 2WKDA 3PIO3 3S2HH 2Q2TA 3H3VC 4A3GH 2F4VQ 5IP7G 5LMUL 1G2SA 1HFGA 1L0WA 4A3BB 1EQQA 1I3QB 2I0QA 5I2XA 4TKOB 4JV5Q 3KLSA 1T5XD 1I4RA 3HOWG 2K52A 5ELFA 3R8BA 3Q22A 2MPMA 2BA1A 1MSGA 5CYUA 3IFTA 4A3CG 4FNFA 2TMPA 1TWFB 4O2DA 1XX8A 4KN4C 5KYLA 3S1NB 1NY4A 5GAGC 1G8ZD 3NTHA 3PO3B 2RA4A 4JG2A 1WTQA 4RWSC 3NTKA 1PTOD 1Z6HA 1YI2A 2UXCL 2L15A 1S5FD 4IN3A 2IPKD 5JJKA 4JI1Q 4A3KH 4B3SQ 3KBGA 4HSVA 5D14A 5EBDA 1SMXA 2O4XA 1BF4A 2B2UA 1GD7A 1YEZA 5F2DA 1F77A 2X69A 4X3SA 3R2TA 2IX0A 4GS3A 3PF4A 4A3DB 3P75A 2KOLA 4DAYB 2NBFA 1KRTA 2MP1A 4A4IA 2R93B 4DPGA 4C3JB 1S5CD 3HOVB 5JEAJ 4HCSA 2JA7H 4H13C 1B1ZA 3PV0A 4S3SA 1HR0L 1BUVT 4A93G 1JICA 4G57A 2R7ZB 1XNRQ 4MNOA 1PMRA 4KD3A 1IXRA 2ZXRA 3VYRA 4KHZA 1UE6A 1ZXTA 3HRZC 2B2UC 3I70A 1NSNS 4HIMA 1KAAA 1BXTA 4B3ML 1EQRA 2R7DA 5CBAE 1C9OA 3SK6A 3OWFA 4DAMA 4IURA 1HHVA 3RZDH 2ZTEA 3NP8A 1IKMA 2AQ1B 1S5DD 2CKZB 1D1KA 1S5BD 1CKOA 5H1SE 2EYPA 2G9DA 1IHZA 2EJGC 1CQFA 4DU9A 1V1PA 1LM0A 4ODGA 3K8AA 5E4WC 1W6JA 3SDZA 3H09A 2IL8A 1K28A 4X3KA 1Y69U 3OSOA 2NYZD 3M7GA 4MHEA 2UXBQ 4KN7C 4RCNA 2AUJD 5DEHA 3VR6A 5E1FA 4LF4L 3D4WA 1VQOA 2D2CC 5A2QE 5AJ3L 4XIGS 1KLGD 1FVIA 4CKBA 5CBEE 1CQVA 4BY1B 4XQNA 5LMUQ 3PIP3 2IT1A 1I4PA 3PUWA 3QOLA 1HQRD 1IL2A 5M5XH 2AMCB 1LT6D 3N6RA 5GQOA 1ILPA 2RBMA 2NVXB 1STAA 2L4NA 3J81i 2RDHA 3LX0A 2EOTA 1SFOB 4IFDJ 5GAHC 1NTGA 1JB3A 2RDGA 4K2KA 1LTAD 1OXVA 4R4TA 1PH4A 4K2LA 4AH6A 4IO9A 2ICIA 3L3OC 3K7AH 3AFQA 3FKIB 4MTNA 4A3JB 1VQ8A 4ZQ3A 3J7YW 1NCVA 1HNWL 4ZAIA 2XRQD 3A8IE 4ZYSA 5C5LA 2UXCQ 3MXGA 1I50B 4IPCA 4CJ1B 4DK3C 2LKVA 1QVGA 3KJPA 1ICFB 4OWXB 1HUNA 2LXKA 3HOZG 4FXGC 4UP7A 2F3IA 4O42A 3GTJB 3EQLC 1VQKA 3KLWA 3D3RA 1EL0A 4A3BH 1I3QH 3KK7A 1HR0Q 1QNUA 1VF7A 4DFAA 1SSOA 2B2VA 3CF5A 2PNHA 5K36G 1HZCA 1KDBA 1OXXK 4C1NK 4I7ZC 1TWFH 2N55A 3S1NH 2GVBA 3H3VH 1ZEQX 3PO3H 4B3MQ 5ELDA 2IY5B 2M9VA 1SDFA 3J80i 1GUOA 5IIFA 2ZT9C 1HZBA 2OXPA 2NN6G 5C0XH 2RCNA 2JA5G 3U4ZA 1WYDA 4IUVA 2B2VC 1EYGA 4L8JA 2PPBC 3I4NB 2F03A 3L9AX 3W3AA 2JA6G 1SRUA 1S72A 5KNCA 4A3DH 1FGBD 2EYOA 1A3UA 2R93H 4C3JH 1EFID 1SYGA 3HOVH 1X54A 2K14A 3BYYB 3SHLA 1Y1VG 3PIPA 2R7ZH 1UE7A 1CZWA 4LF4Q 1X65A 5AJ3Q 1ML0D 1G6PA 3I4LA 2F52A 3CRKC 1ONLA 1GUGA 4FF1A 1H9MA 4IPGA 1KQSA 1HA6A 2EY5A 1PH1A 4R8NA 2F0LA 1HFNA 4DV2L 3G7LA 2MUYA 1Q8IA 1N33L 4BBRG 3SE0A 2IX1A 3KDFA 5DM73 2V4DA 3AB9A 1I6HB 1O7ZA 4NXNL 3G6EA 1VQMA 2B8FA 3U58A 4XTCS 1R4QB 3E6ZX 2O2LD 2R3ZA 3STBD 3TN2A 3BG3A 1YHAA 3W2DA 1OTCA 1VQFA 2WB1G 3K59A 1TWAB 3CC4A 2GN5A 2YYZA 4RGMA 4B9WA 1HNWQ 3PUVA 3M4QA 4C3HB 4RAUC 4H0LC 5EJWA 2WINB 1EY7A 4B3RL 4JW0A 2VB3X 4CKEA 4C3IG 3NHHA 2JA9A 2HHHL 1M4VA 2UUBL 2Z8LA 5IGEA 1XMOL 3J81L 3GDEA 2M00A 4JC0A 4Q5VA 1XNQL 4WJ3M 2VY3A 4BY1H 4HIKA 1EIYB 3TEHB 1EYCA 2BE5C 5JPNC 3A7AB 4DV6Q 2OF1A 2GA4B 2B2YA 1HNXQ 1M1KC 2I5LX 2NVXH 2YTYA 1SFOH 1IBKL 4R8IA 2XTIA 2R7FA 2FHTA 1CM9A 2I07B 2LS01 4GNXA 3CW2C 3O13A 1L1OA 3HOYB 3GTOB 3CCEA 2XIWA 1B70B 3FKIH 4A3JH 3G48A 4UHVA 3K5NA 5C4JB 4IUQA 3ND8A 3MFYA 1FJGL 2B63G 1N34Q 5FLXE 1I50H 4DR4L 2EYFA 4A3LG 1STNA 3A55A 2ZJQA 5TSSA 2F0VA 1K73C 1RL2A 1B50A 3OHXC 4YWMA 4GNXC 3I72A 3GTJH 4TSSA 1XYIA 1VQAA 1CT1D 1LV9A 1JT8A 5C44B 3GTLB 2UUCL 2N3SA 3QB3A 4K0KL 2RHSB 1BBUA 4L5RC 2Q8RE 1JR0D 4FVMA 2RSNA 3OMGA 3S1MB 3OPOA 3KBXA 3A56A 4PMWA 2Q8IB 4KTAA 5IGDA 4CDDC 4KKUA 5M3FB 1VQPA 4IFDI 1MJEA 4DGZA 3J80L 1O7LA 4P73A 5G3LF 4R9WA 4FF3A 3GTQB 4GNXB 1BCPF 1WTWA 1PV4A 1CA6A 3F2UA 4DV3L 1LT3D 5FJ8G 3EBEA 4PZ8A 2WIIB 1E7ZA 4DV2Q 3NQTA 2V1CC 5ELEA 1BO0A 1NMFA 1R9TB 1K9MC 1H9RA 2AHOB 2RF4A 1O80A 5M9OA 2A73B 5JOBA 4NXNQ 4OEMB 3AQQA 1GOZA 1Q7YC 3D4DA 1ENAA 3IRBA 3BZDB 3PUZA 1MBYA 3I4NH 3VYUA 1N32Q 2VB2X 1L0XB 2EYMA 5FO8B 4KJNA 5I6YA 2K28A 3HOUB 1NE3A 2F0TA 3A74A 2B2WA 3DM1A 2FJ2A 3G71A 3GTMB 1JMCA 2KCMA 4HAEA 2D9UA 1STYA 2NUCA 2PCFB 2FINB 2UUAL 5IYCH 1TXYA 2HHHQ 1WTOA 2UUBQ 1DD2A 1VDZA 2O5IC 1XNQQ 2HIXA 2BOSA 1NNXA 3VDYA 4XYQA 4HSPA 4QY7A 2YU9B 1JB7A 4ZCKA 2AWNA 2AQ3B 2JA8G 4YHHL 4LF6L 5KRUA 1VQ4A 4DR5L 3RNUA 4BY7G 1PH5A 3MA2B 5IP9G 2QKIC 1B7YB 1I6HH 1BKBA 4FXDA 1EOTA 1HPCA 3Q8DA 1A62A 1PA6A 1F2YA 1A6XA 1NJIC 2VQFL 3VR3A 4G7ZC 1TWAH 2VW9A 5E7NA 1VS0A 1HTPA 3T53B 3K5MA 1FJGQ 4C3HH 4KHVA 4KI0A 1M90C 2A6ED 2DUDA 3K58A 4DAVA 5CV8A 4QL5A 2Y0SG 3A7LA 4RCOA 3B6YA 2EIFA 2OCEA 2KEDA 1XPOA 1WI5A 1RCVD 1KD1C 2UUCQ 1YJWA 2JJQA 2JP1A 1I5FA 3Q24A 1OO9B 2XVSA 4IJLA 4NMZA 4XYOA 5C3EG 1JOKA 3A5UA 1SROA 1UWVA 3L0OA 4OWTB 3D8GA 1VQLA 3U50C 4PQXA 3L7ZC 1AP0A 1KABA 3KF6A 4BA1I 4DV3Q 3M7NA 4GKKQ 3GTOH 5J1ZA 3VA5A 1LTTD 1BCPC 4KKTA 2A68D 5M5WB 4JI4L 2K04A 3WOEA 3QJYA 5ELCA 3CCQA 5C4JH 3I4MB 4KHPQ 3UDIA 5KYIA 4WJ4A 2MO0A 4B08A 4MZ9A 1G2TA 4PZ6A 1ASZA 4OGQC 4DV0L 3FRPB 1EOVA 3E5SA 3I7FA 1CTMA 3K0XA 2ZTCA 3CU7A 3HOXB 2JEBI 4N8FA 1NMGA 1X55A 1SE8A 3TSSA 4OXPA 5GROA 2L1BA 1BQQT 2QA4A 2IW3A 1BBWA 2JYOA 3HG9A 5C44H 3GTLH 2SNMA 4C56C 2QEXA 3KLSX 4J1MA 1JE5A 3CXCA 3NUCA 3S1MH 4PV1C 4M8AA 5M3FH 1E2ZA 3FMCA 1HNZQ 2UUAQ 4HIDA 4LF8Q 3QR8A 2Z6BA 3GTQH 4BA2I 3KF6B 1Q46A 2DJGC 2EVBA 3MWYW 3X3MA 3FVQA 3LWUA 2CH4W 3HKSA 3MXNA 4KV6A 3U4VA 3GD7A 4YHHQ 4LF6Q 2KENA 1PHJA 2KVMA 5JEAG 2KCTA 1R9TH 2L0CA 1SMYD 4QIWB 2E74C 3PQIA 1A2TA 1A0IA 1JOOA 3MXPA 1DZ1A 1E22A 1QUQB 5M3MB 4OX9L 1AE3A 4DA2A 1WFQA 1FGUA 2DNCA 2EJMA 5I6WA 1J5EL 2Z1CA 3SEBA 3HOUH 4FXKC 2ICEC 3DWPA 1SXTA 3GTMH 3HOZB 3RMHA 3RR5A 1U4LA 3E0EA 3I91A 1C4QA 4OONA 1STBA 2A19A 4A3GG 1WJJA 1YHBA 4JI0Q 2HCCA 4OIKA 2WACA 4HEDA 2OTLA 1ASYA 5C3XA 1LTSD 2EYHA 3NBHB 5FLXc 2HDLA 1BR9A 1K0RA 1SNPA 1JWMD 3HKZG 5CV5A 4U673 1X3PA 1Y8OB 1AW7A 1V1QA 4YIJA 2F0PA 4UAIA 3F8TA 4HJ8A 2YU9H 1CKNA 1XJVA 3UDXA 4A3CH 1Q90A 1LTID 3RN5A 2PO4A 1LT4D 1ZYRD 1FNUA 2E5LL 4LFAL 2QW7A 2MNAA 3CHBD 3WOFA 3ULPA 3GV3A 3BZCA 1B3QA 2OWOA 4NB3A 1YHQA 1EFWA 4JI4Q 1LTRD 5T1GA 2JA5B 1WTHA 5C3WA 2E75C 4A3KG 4APVA 3SR1A 3J81j 2N88A 3I90A 2F3WA 1B2TA 1WTXA 2JA6B 2F0EA 1S3OA 2K05A 2PMZB 4IFDG 1UNSA 2KCCA 3EA6A 3QOJA 4JBKA 4QIWE 3MVVA 2QF7A 4YWLA 3TS2A 3MXUA 4CDFC 4JPBW 4AQYQ 2EJFC 1JWSD 2JA7G 3X3NA 4R4CA 2VUMG 4YCUA 1CHQD 3OIPA 1H9SA 2ES2A 1STEA 1EY5A 3BDOA 5BN5A 2Z9HA 5E3FA 5DNFA 2GVAA 4RFBA 3OW7A 3S15B 3D6CA 3JC66 3S17B 3G6JB 4P71A 1TS5A 3LGJA 3K5LA 4GKJL 5IGGA 1J9OA 1A2UA 4BBRB 5DAUA 3C46A 1QVFA 4JK1C 5M5WH 1A8VA 1B9MA 2XGTA 1GUTA 2R61A 3OMCA 3Q0AA 1ILQA 3DM3A 3I4MH 1AZQA 3WWVA 4IUPA 2F0GA 1IW7C 1PTOF 1VQHA 4JI3L 3M4OB 2R92B 1X3EA 3UI2A 2WB1B 3ULJA 1E2VA 1UAPA 2NZHA 4OX9Q 1PH2A 3HS0C 1IBML 2L9HA 2K5NA 3F2BA 3BVMA 4R4QA 4J6HA 3HOXH 2Z0SA 1EIFA 1KRSA 4ZKBB 2E2IB 4C3IB 4DR1L 1PRTC 1WD0A 2J4XA 1H9SB 1RTNA 1OXTA 3SK5A 3RN2A 1VQBA 3V2TA 2JEAI 3VA7A 2HIVA 1IL8A 3HP3A 3NQIA 5LHY1 4CJ0B 4DV5L 2CCZA 3CCJA 1H95A 2A5HA 2K5WA 5IGFA 3DEPA 1PLFA 2PMZE 3TQYA 4FF2A 2KHJA 3HGBA 2DNEA 4DK6C 2G5DA 4NP5A 5EKLA 3T51B 1STHA 4H02A 4K6LA 2RSOA 2KEEA 4Y7NB 1PRTB 1V1PB 3F1ZA 4DXFA 3CQZB 2RVLA 4QMGA 1G51A 3LNNA 1HUMA 1TY0A 4LFAQ 2E5LQ 4EQPA 4MN3A 1N8RC 1I94L 2N78A 4KLKA 1LO5D 4HCEA 3A54A 3H91A 5M3MH 3BVGA 4LFCL 1MIUA 1S40A 3SK8A 1KTKA 3GQBA 2DJFC 3MEHA 1PFBA 1XPRA 3I55A 4OL7A 1FL0A 2L55A 2BH8A 5EGTA 3VYTA 1D1IA 1FD7D 1QOHA 3HOZH 2F0OA 1DONA 1EUJA 1V1OA 2PI2A 1YIJA 5IGCA 1KAWA 3K80C 2WB1E 4A3BG 1ET9A 1K8AC 2VZAA 3K0YA 1BBXC 1ENCA 1AN8A 2ZXOA 4LAAA 3DLLA 1KNAA 1SYEA 2K33A 4YWKA 5K36H 3GO5A 5EPKA 1J6QA 1K3RA 4X62L 4DV4L 1K8MA 2B29A 3PO3G 2NWGA 4IUTA 5IYDG 2EZVA 3TZUA 2J7ZA 3RLOA 1U4PA 2HD3A 1NUCA 4K5WA 3GV6A 1ET6A 2K50A 3T1HL 3EROA 2WFWA 4L5SA 4EVOA 4IALA 2NN6H 3A8KE 3AMUA 1VQGA 3CCVA 2JA5H 2ASBA 4QGUA 4XT1B 3TP7A 1EIHA 3TMEA 3DWQA 4NKLA 2F0JA 1NAPA 1DOLA 3QG1A 4JI3Q 2JA6H 3OIQA 1OXUA 1T9HA 3OYYA 1JJ2A 5IYBG 3IL8A 5LMNW 2IHEA 1RDPD 2R93G 2O5JC 1TU2B 2ENBA 3AEVA 1IBMQ 1C7YA 1KDCA 4C3JG 1SLJA 2EY6A 3HOVG 1VF5C 3D0FA 4ULLA 1Y1VH 1F2LA 2C5CA 3E0JA 3URYA 4DR1Q 4OO1G 5GAEC 1D5ZC 4N9PA 1Y1WG 4EQOA 4RMFA 1HQMC 2SOBA 4XXEA 4DV5Q 4X64L 1EWIA 3MAQA 2F3VA 2WAQG 1VQIA 1P8LA 1D5MC 1F9PA 3S15H 3S17H 3P7JA 1Q1EA 1X3GA 1VQJA 4BBRH 1JC7A 1GVPA 4FP5D 4A3FG 2N49A 2JK8A 4A3EB 4P2CB 3C2PA 5HY6A 1TWGB 2SNSA 4DAPA 1SN8A 4A3IG 3M4OH 2R92H 1HJPA 4N8X1 4QQBX 1EY0A 3E9HA 1DGSA 2KJXA 1OXSC 1TWHB 4ID6A 4LWCA 1AH9A 4LFCQ 1LABA 2KA7A 4IPHA 5J39A 2K5QA 4CKCA 5K5PA 4Y52H 3S9WA 4X6AH 4A3MG 4G4KA 4C3IH 2E2IH 1G291 4BBSB 1O78A 5C0XJ 2H4OA 1KC8C 2Y0SB 3JAME 1W6KA 1SE4A 3QO2A 3KDFB 4DKAC 4KY7A 2ZM6L 5G3LD 3BZKA 2PI2E 1SNOA 2ZTDA 4RGTA 1UE5A 4DR2L 2CWAA 2LMCB 4Y7NH 5C3EB 4KJOA 4L5TA 3CC2A 2F0IA 3CQZH 2F0DA 1B4OA 2A6HC 2KHSA 4JBMA 2K03A 4X62Q 4DV4Q 4HIOA 4NXML 5ISRA 1HTLD 1EY8A 1TT2A 3PO2G 3J7ZC 5LL6X 2B2YC 2PW7A 2A74C 4JI6L 3T1HQ 2RHQB 4PMBA 3Q23A 5JJZA 3VR2A 2PZTA 4JBJA 1CUKA 2DY8A 1CKMA 3K6OA 2PNRC 4DR7L 4A3LH 1L1OC 4WORA 4YCVA 1YVCA 2FMMA 3I73A 2KCNA 4IUNA 3PCOB 3R2IA 1PVOA 2XWJB 3P1HA 2ATWA 2K7VA 2WKCA 3Q6SA 5FLMG 4HJAA 4DK1A 2E76C 1KXLA 4KMUC 1TS2A 4RHRA 2F0NA 4GN5A 5CV6A 4KY5A 1EU3A 4K6DA 4UP9A 5NUCA 4BWGB 1L1OB 1GUNA 1TKWB 2LXJA 5CV4A 4WFN3 3H0GG 1IBLL 2Z4IA 4POGA 1JORA 2F0HA 4R1JA 5EAYA 4LJZC 4CGYB 4MTKA 1N33Q 3E9IA 5FJ8H 4GOPA 4X64Q 4DUYL 4KKSA 2Y0SE 4QUCA 4B9XA 4DNIA 2YV5A 4JBWA 2JE6I 3TDQA 1GUWA 3MTSA 1TS4A 3C3LA 1PYSB 2I5HA 3HEJA 5D3IB 2VQEL 2B39A 1WCMG 2F0WA 1MJCA 3J7AF 1GM5A 3I2ZA 3I4NG 4JI8L 4B3RQ 3V05A 3TS0A 3RZOB 4CBVA 1Q1BA 1IZ6A 2QCPX 4DXGA 4BXXG 3RLFA 2HQEA 2WV6D 4HMIA 1II3A 3ER0A 5BN4A 1XMOQ 2VXWA 4ABNA 4ZUJA 2B8GA 2A1AA 3HOWB 1HRJA 5CMDA 1X9NA 1IYVA 2B2WC 1EQVA 3EIVA 1MI2A 4EGVA 4FO2A 1U4MA 1CSQA 3TBIB 4FF4A 3HKZB 4IOAA 5CGKA 2EXZA 1Q82C 1IBKQ 3NEMA 5L37A 3CCLA 4Z9CB 4DR2Q 3RLNA 3D31A 3OTOL 5IP9H 3BDCA 4NW2A 3MHBA 5IT9E 4A3EH 1B3AA 1TWGH 2BDOA 2VNUD 3I4OA 3TP6A 1MSHA 1I4QA 3AFPA 2RCFA 4DR4Q 2WP8J 4B3TL 2OTJA 1S5ED 1G91A 1TWHH 2XSCA 3S1RB 2KUMA 3W1GA 4QF4A 4DR7Q 4XDXA 3GTPB 4GN4B 5JVG3 4IQZA 2CQOA 4LMQD 4A93B 4BBSH 4ILWA 4GN3B 5IWAL 3S24A 2EPBA 4C1NI 2CW0C 1MD2D 4K0KQ 1NR2A 1G6ZA 1UEAB 2CVRA 1DCZA 3KOJA 3OW2A 2F0QA 5D65A 1VQDA 1X3QA 4LF7L 4JI5L 1MKHA 3K57A 4EX5A 3M85A 3NPPA 2X6GA 1VQ9A 2CFMA 1IBLQ 3KF8A 4R4OA 5C3EH 1IW7D 4LNQA 1DOKA 1PFSA 3FPPA 1HXYD 3K81C 1WD1A 5JJLA 5FO9B 2D5DA 1DXMA 3HOYG 5I2YA 4WRDA 1C0AA 4IZ8A 4DUYQ 3NELA 4GLAC 3H3VI 1U9RA 2G9HD 2NTTA 3HKZE 1VQ6A 4RHSA 5IODA 1PRTD 5C4XG 1BCPB 4DK0A 2VQEQ 1HZAA 4PZ7A 3UE1A 4DNTB 1LTLA 3GTKB 5C0XI 1S4ZA 4XQJA 4K5XA 4JI8Q 2X6LA 3NE5B 2Q2IA 2PQAA 5IE8A 1UUPA 2KBNA 1EIGA 2PQEA 1YZ6A 3E3XA 4DN4M 4N9TA 3VR5A 3KJOA 3SGIA 3TRZA 3K7UC 4DV1L 4CHTB 1EQTA 1EWHA 4ZUIA 1N9WA 1VQ7A 4DR5Q 1PH7A 4OO1I 1SNDA 2Z4HA 1QWYA 3OOCA 1LLRD 1SNCA 1CSPA 4C2MB 1K0SA 3QIAA 5FK9C 3VYSA 4RH6A 5A2QL 3R3OA 5JEAH 4P75A 4CDCC 4K8JA 4RGNA 3JAMc 5BR8L 1GHJA 2VQFQ 3C1FA 2JSOA 1KDAA 1JJGA 4F8MA 2EE1A 3ZYYX 3C1EA 4AYBG 4RG1A 1U5KA 2EY1A 2NZOA 4IOCA 2A8VA 4HJ5A 1IYJB 1RTOA 2NB0A 2Z6KA 4B3TQ 1KIXA 3HOUG 3RZOH 5IP7H 1TIID 1EZ6A 1YJNA 4PMCA 3M9BA 1D2BA 5FKAC 3EN2A 3SK4A 3JAMi 3MXNB 2MGSA 5IWAQ 3HOWH 4JYAL 4DAYA 2KQ3A 3CPWA 4M1UB 2CQAA 3MFGA 3T13A 2NVQB 1H9KA 1W2BA 4XQQA 3G4SA 2Z6KC 4J15A 1BNZA 1VMPA 4LF7Q 4A75A 4JI5Q 5JPMC 3PSIA 2F0MA 4LUOA 5EPLA 4TVAB 4ZRZA 3UDGA 1M8AA 1YNJC 2ALYB 1SAPA 2ZJPA 2PZWA 5CV7A 2D0OA 2LSSA 1K3BC 1VQCA 3ERSX 4CDEC 3CKIB 3MEFA 4DV0Q 3S1RH 1CI3M 3UDFA 1QJOA 1B53A 2XNAC 1SE2A 3CCRA 3ONAB 1JCKB 1PH9A 2K5HA 3GTPH 1Y1VB 2XWBB 4IFDH 2NVTB 4A93H 1EWCA 3S1QB 1CKNB 1FR3A 2R6GA 2FFKB 4QJFA 4O0AA 2CWPA 1WVLA 3NWSA 4NPSA 1PYWD 2I46A 4ZLTF 4LUVA 1X56A 2QEJC 2VUMH 1LUZA 4DV7L 1RD9D 2XN9C 1QE6A 4DV1Q 4L5QA 4I7AA 4P72A 1SEBD 2A6EC 2JQOA 1Y1WB 1Q86C 3M4PA 1TWCB 1SNQA 1L0YB 2D0PA 5I9PA 3M3YB 2AWOA 2WAQB 1JJCB 1K83B 2OEOA 2AKWB 1C48A 1C8CA 3TP5A 5KEEA 3HFZB 4A3FB 1BVSA 2M2LA 1PDQA 2LFNA 3I4MG 5BR8Q 1Q8KA 2K6AA 5HURA 1PH8A 1Z7TA 4A3IB 4KD4A 3UE0A 1BOSA 2BE5D 1F9RA 3FP9A 1J5EQ 2UXDL 2XRSD 3S14B 1D8LA 3GTKH 4LK1C 4BS9A 1EU4A 2BCOA 3K5OA 1X6OA 1Y8PB 4FYDA 1QVCA 2A68C 4PG3A 4OIJA 3PIOA 3J81c 3NTIA 3HOXG 1FNVA 1GHKA 5IT9c 3SXHA 1DM0B 1X3FA 4X65L 4A3MB 5HGTA 2QDBA 1BDOA 4H44C 1TY2A 4I65A 4DR3L 2A6HD 3PMFA 5C4HA 4JYAQ 1KL9A 1K8GA 1I4HA 1O7YA 5LMNL 1EYDA 4C2MH 1WOCA 2A69C 5GADC 4GLVB 1PFMA 1XMQL 2TSSA 3T56B 4TQUS 3QWNA 1HR0W 1HCZA 2B63B 4LFBL 1ESRA 4V0BA 3CD6A 1XXGA 3PO2B 3TREA 2C35B 2EYJA 2PZUA 2RKSA 4DUZL 2MO1A 3A8JE 5M3MG 1LACA 2BDNA 3JAML
chains in the Genus database with same CATH topology
1HZ9A 2CWAA 4KI0A 1U0LA 2WAQE 1W3SA 1NY4A 5GAGC 4Y7NH 4A76A 1M90C 4JG2A 4L5TA 3CC2A 2DUDA 3CQZH 4JBMA 2OQKA 4QL5A 5J3BA 4X62Q 2Y0SG 4DV4Q 4HIOA 1XPUA 1YI2A 4NXML 2MQHA 2UXCL 2L15A 3B6YA 2EIFA 2OCEA 3PO2G 1XPOA 1WI5A 3J7ZC 2R7ZG 5JJKA 3S1QH 4JI1Q 1KD1C 4A3KH 4YY3L 4B3SQ 3J80c 4JI6L 2UUCQ 1YJWA 2JJQA 1HH2P 3CCSA 3T1HQ 2RHQB 1SMXA 1I5FA 4DV6L 1GD7A 1YEZA 2NVQH 4IJLA 3PF4A 4GS3A 1CUKA 2IX0A 1CKMA 4JBJA 1HNXL 4DR7L 4LW1A 5C3EG 4DV7Q 1L1OC 3A5UA 4A3LH 4YCVA 4DAYB 1YVCA 2EXDA 2D62A 1KRTA 1SROA 1UWVA 4A4IA 3L0OA 3PCOB 4OWTB 1VQLA 3U50C 1PVOA 4DPGA 3L7ZC 4GKJQ 2ATWA 3KF6A 5JEAJ 4BA1I 4DV3Q 4FDBA 3KYHC 3M7NA 4GKKQ 1E1TA 2JA7H 3GTOH 1HR0L 3PV0A 5IYDH 5FLMG 5C0XG 2I5MX 4JI4L 4HJAA 4A93G 4UP8A 1XNRQ 1KXLA 4MNOA 5C4JH 3CCQA 2UU9L 1IXRA 3A0JA 4KHPQ 3UDIA 4KHZA 1Q12A 1UE6A 4GN5A 2FXQA 4UP9A 1N34L 1L1OB 4WJ4A 4HIMA 2MO0A 4A3DG 2MFIA 2LXJA 3H0GG 1IBLL 1EQRA 2R7DA 4B3ML 1C9OA 4POGA 4MZ9A 4PZ6A 2E8GA 4DAMA 1ASZA 4DV0L 1EOVA 3I7FA 4R1JA 4JCVE 5EAYA 1N33Q 3K0XA 2ZTCA 2ZTEA 3E9IA 3RZDH 1QZHA 2UXDQ 5FJ8H 2JEBI 4GOPA 2BH2A 4X64Q 3PF5A 3W5OA 2NVTH 3AYHB 1NMGA 1X55A 1SE8A 2CKZB 1V43A 2Y0SE 4OXPA 5GROA 4DNIA 5IYBH 2YV5A 4LF9L 4JBWA 2QA4A 1CKOA 1VQNA 1BBWA 2JE6I 5H1SE 5C44H 3GTLH 1XTDA 2QEXA 1PYSB 2I5HA 1JE5A 3CXCA 3S1MH 2VQEL 4X65Q 1WCMG 1N36L 5M3FH 1LM0A 1HNZQ 3K8AA 2UUAQ 4HIDA 1MJCA 4LF8Q 2ID0A 1GM5A 3I2ZA 4UPAA 3GTQH 4BA2I 3I4NG 3KF6B 3NENA 4JI8L 4DR3Q 1Q46A 4A3GG 4JI2L 4B3RQ 1Y1WH 3HKSA 3TS0A 2K4KA 1TWCH 1Q1BA 1IZ6A 3U4VA 3GD7A 2UXBQ 4YHHQ 4LF6Q 3M3YH 5IY0A 2KENA 1PHJA 4LF4L 1K83H 1VQOA 5JEAG 4BXXG 2KCTA 3RLFA 1R9TH 5AJ3L 4XIGS 5LMNQ 1FVIA 3ER0A 1XMOQ 1GKHA 4A3FH 1I94Q 1XMQQ 1A0IA 2A1AA 5LMUQ 1E22A 1X9NA 2Q2UA 2IT1A 1QUQB 3EIVA 4OX9L 1AE3A 3PUWA 4LFBQ 4A3IH 1CSQA 1WFQA 1N32L 1IL2A 5M5XH 1FGUA 2AMCB 2R92G 5GQOA 1J5EL 4DUZQ 3HOUH 3S14H 4IOAA 1Q82C 3J81i 1IBKQ 3NEMA 4IFDJ 3CCLA 5GAHC 1NTGA 3GTMH 5DLQE 4DR2Q 3RR5A 4IJHA 3E0EA 3RLNA 3D31A 3OTOL 4OONA 1OXVA 4R4TA 1PH4A 4AH6A 5IP9H 4IO9A 2HT1A 4A3EH 4BY1G 3K7AH 3AFQA 4A3MH 4MTNA 1TWGH 2A19A 4LF5L 1VQ8A 1WJJA 1YHBA 3PGZA 3CMEA 4JI0Q 3I4OA 3KFUA 2OTLA 1ASYA 1HNWL 3NBHB 3AFPA 5FLXc 1K0RA 2UXCQ 3HKZG 4DR4Q 4IPCA 1VQEA 2WP8J 1V1QA 4B3TL 2OTJA 4DK3C 4YY3Q 1QVGA 3F8TA 4HJ8A 2YU9H 1CKNA 3KJPA 1XJVA 1TWHH 4OWXB 2H5XA 3UDXA 1VQ5A 1E1OA 2LXKA 4A3CH 3HOZG 3W1GA 4UP7A 3RN5A 1YITA 1YJ9A 4DR7Q 2F3IA 3L2PA 2E5LL 4LFAL 4GN4B 2CQOA 1VQKA 4BBSH 3KLWA 3FKIG 4OWWB 4GN3B 2MNAA 5IWAL 4A3JG 1A63A 3S24A 4A3BH 4JOIA 3ULPA 1I3QH 4K0KQ 3BZCA 4UY8C 4DR6L 1E24A 4DUYL 2B63H 2OWOA 4NB3A 1YHQA 1EFWA 1HR0Q 3KOJA 4JI4Q 3PO2H 3BJUA 3OW2A 4A3KG 2UU9Q 1VQDA 2PNHA 4APVA 3CF5A 5K36G 4LF7L 1HZCA 3J81j 1OXXK 4JI5L 1TWFH 1MKHA 1RIPA 4EX5A 3M85A 3S1NH 2GVBA 1KHIA 1VQ9A 1S3OA 3H3VH 2CFMA 3PO3H 1IBLQ 1PYBA 4B3MQ 4R4OA 5C3EH 4IFDG 1Z9FA 4JBKA 4LNQA 4AIMA 4QIWE 2IY5B 1PFSA 3K81C 4YWLA 2HQLA 3TS2A 5JJLA 3CMAA 4AQYQ 4JOIC 3J80i 1HZBA 3HOYG 2JA7G 1C0AA 4DUYQ 2NN6G 1SR3A 3NELA 4R4CA 5FLMH 4GLAC 3T1YL 4LF9Q 2VUMG 3F2DA 2RCNA 3H3VI 2JA5G 3CAMA 3U4ZA 2ZJRA 1WYDA 4YCUA 3HKZE 1VQ6A 2ES2A 1EYGA 1Q81C 2JA6G 5C4XG 1SRUA 1S72A 2VQEQ 2B3GA 1HZAA 1N36Q 4A3DH 4PZ7A 3UE1A 2BA0A 1LTLA 3H0GH 2GVAA 5C0XI 3CCMA 3CC7A 2R93H 3CPFA 3JC66 4JI8Q 4C3JH 4P71A 2Q2IA 3LGJA 4JI2Q 2PQAA 1X54A 5IE8A 3HOVH 4GKJL 2VNUD 1UE1A 2K14A 4GKKL 1VCIA 1Y1VG 2KBNA 1QVFA 1YZ6A 5M5WH 1A8VA 3PIPA 2R7ZH 5JJIA 1UE7A 2XGTA 4LF4Q 2OQ0A 1X65A 3KJOA 3SGIA 3DM3A 3K7UC 5AJ3Q 3I4MH 3TRZA 4DV1L 3FHWA 1G6PA 3WWVA 4KHPL 4P74A 1AE2A 1VQHA 2F52A 4X66L 4JI3L 1X3EA 3GTGH 3ULJA 1WCMH 5ELNA 4IPGA 4GOPC 1KQSA 1N9WA 2NZHA 1VQ7A 1PH1A 4OX9Q 4DR5Q 1PH7A 4OO1I 4DV2L 1PH2A 3CCUA 1IBML 2K5NA 3F2BA 4R4QA 1N33L 4BBRG 2Z0SA 1CSPA 3HOXH 3S2DH 2IX1A 1EIFA 3KDFA 1KRSA 2VS1A 2E2JH 4NXNL 4DR1L 5IYCG 3G6EA 1VQMA 3U58A 4BXXH 4P75A 1OXTA 1UEBA 5BR8L 3JAMc 1VQBA 4XTCS 3RN2A 3STBD 2JEAI 2VQFQ 2HIVA 1YHAA 3ZJYC 1OTCA 1VQFA 1Y14B 4GOPB 2WB1G 1JJGA 4LF5Q 3CC4A 2GN5A 2ZM6Q 4DV5L 2CCZA 2YYZA 3CCJA 1HNZL 4AYBG 1H95A 4RG1A 1U5KA 4HJ9A 2JA8H 4LF8L 2NZOA 1HNWQ 2PMZE 4IOCA 3PUVA 3TQYA 2KHJA 4DK6C 3M4QA 5M5YH 2A8VA 4H02A 4HJ5A 4BY7H 1IYJB 2Z6KA 4B3TQ 4B3RL 3H15A 1KIXA 3HOUG 3RZOH 1B8AA 4HJ7A 3F1ZA 3S16H 5ELOA 3PUXA 5IP7H 4JI7L 3BU2A 2JA9A 1G51A 1YJNA 2HHHL 2UUBL 3M9BA 4NXMQ 1XMOL 4LFAQ 2E5LQ 3GDEA 4JC0A 3EN2A 1XNQL 4WJ3M 3JAMi 1N8RC 3MXNB 2VY3A 1I94L 2N78A 4KLKA 4A3EG 4BY1H 5IWAQ 4HIKA 3TEHB 1EIYB 3HOWH 4JYAL 4JI6Q 3CPWA 2YTXA 4DR6Q 5M3MH 4LFCL 4DV6Q 1MIUA 1S40A 4R4IA 4LUZA 4EQ5A 1HNXQ 1W2BA 1M1KC 3G4SA 2I5LX 2Z6KC 4J15A 1XPRA 2NVXH 3I55A 1FL0A 2YTYA 2VL6A 1SFOH 1IBKL 4LF7Q 2XTIA 2R7FA 2BH8A 3STBC 4A75A 2F4VL 4JI5Q 3HOZH 1Z47A 3PSIA 4LUOA 2EQSA 3CW2C 4GNXA 2K75A 2DGYA 1L1OA 4ME3A 2Q2HA 1EUJA 4TVAB 4YCWA 3CCEA 2PI2A 4JV5L 1B70B 3UDGA 1YIJA 4BBSG 3FKIH 1E3PA 4A3JH 3G48A 3I56A 1KAWA 2ALYB 3K80C 2WB1E 4JI0L 2ZJPA 4A3BG 1K8AC 2VZAA 3ULLA 2E2HH 1FJGL 2B63G 2D0OA 2LSSA 4AYBE 1N34Q 2K5VA 1VQCA 3T1YQ 1I50H 3ERSX 4DR4L 2NVYH 3DLLA 4YWKA 4POFA 4A3LG 3J7A5 5HGQA 2QGQA 3MEFA 3GO5A 4DV0Q 3S1RH 3UDFA 2ZJQA 4GLXA 1J6QA 1K3RA 3CCRA 4X62L 1YBYA 4DV4L 1RL2A 1K73C 1PH3A 2K5HA 2B29A 1PH9A 4YWMA 4GNXC 3GTPH 3PO3G 5IYDG 3GTJH 4A93H 1VQAA 1CKNB 3RLOA 2R6GA 4JI1L 4QJFA 1JT8A 4O0AA 4B3SL 2CWPA 2UUCL 2K50A 2N3SA 3T1HL 4K0KL 4NPSA 1PH6A 2RHSB 1BBUA 4L5RC 4LUVA 3HOYH 1X56A 2WFWA 4L5SA 2IHFA 4PMWA 2VUMH 1LUZA 1VQGA 3CCVA 2JA5H 1VQPA 2ASBA 4DV7L 1MJEA 4IFDI 4QGUA 4P73A 4DV1Q 4L5QA 4P72A 4X66Q 4GNXB 4JI3Q 2JA6H 5C4XH 4IPDA 2JQOA 1PV4A 1OXUA 1T9HA 5FJ8G 4DV3L 2N8NA 1Q86C 3EBEA 3M4PA 4PZ8A 3A5ZB 1YNXA 2NN6I 3OYYA 1E7ZA 1JJ2A 2D0PA 5IYBG 5LMNW 2IHEA 2AWOA 4DV2Q 1JJCB 1XNRL 2V1CC 5C44G 3AEVA 2AKWB 1C7YA 1K9MC 1QUQA 1NMFA 1IBMQ 1SLJA 3CP0A 3HOVG 2AHOB 2RF4A 3D0FA 4AQYL 1Y1VH 3HFZB 1BVSA 3KF8B 4NXNQ 5M3FG 4DR1Q 3AQQA 1QZGA 4OO1G 1Q7YC 3F2CA 5GAEC 3IRBA 3I4MG 5BR8Q 1D7QA 1Q8KA 3PUZA 3I4NH 1PH8A 1N32Q 3UE0A 2YTVA 1O7IA 3FP9A 4RMFA 1Y1WG 1J5EQ 2UXDL 4DV5Q 1NE3A 1NBWA 1D8LA 1EWIA 3A74A 4X64L 3GTKH 2WAQG 1VQIA 1P8LA 3S15H 3G71A 3S17H 1Q1EA 1X3GA 1X6OA 1JMCA 1QVCA 2KCMA 1VQJA 4PG3A 3OTOQ 3PIOA 3J81c 3HOXG 4BBRH 3PUYA 1GVPA 5IT9c 4ALPA 2N49A 1P16A 4A3FG 2JK8A 1X3FA 4X65L 5HY6A 4JI7Q 2UUAL 5IYCH 1TXYA 2HHHQ 1SN8A 2UUBQ 1GO3E 2PQAB 4A3IG 1XNQQ 2HIXA 3W1BA 4DR3L 3M4OH 2R92H 1HJPA 3VDYA 4QQBX 4JYAQ 3E9HA 2KHIA 1KL9A 4QY7A 1LYLA 1K8GA 1DGSA 1JB7A 1OXSC 2AWNA 2JA8G 3ICEA 2UXBL 1V9PA 4LWCA 4YHHL 4LF6L 4LFCQ 1AH9A 1L2FA 4DR5L 1VQ4A 3RNUA 2R93G 5LMNL 4BY7G 4IPHA 1PH5A 4C2MH 1WOCA 5GADC 5IP9G 4GLVB 4Y52H 3S2HH 1XMQL 4X6AH 1B7YB 1I6HH 4A3MG 1BKBA 4C3IH 2E2IH 1G291 2Q2TA 4A3GH 2F4VQ 5IP7G 5C0XJ 3Q8DA 1A62A 5LMUL 1PA6A 1L0WA 4TQUS 1EQQA 1KC8C 2I0QA 1HR0W 1NJIC 4LFBL 2VQFL 4JV5Q 3CD6A 3KDFB 1TWAH 2VW9A 4DKAC 3TREA 2C35B 4DUZL 2ZM6L 3HOWG 2MO1A 5E7NA 2K52A 1VS0A 2BA1A 2PI2E 3BZKA 5M3MG 1FJGQ 4A3CG 2ZTDA 4C3HH 1UE5A 4O2DA 4DR2L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZ9 A;  2CWA A;  4KI0 A;  1U0L A;  2WAQ E;  1W3S A;  1NY4 A;  5GAG C;  4Y7N H;  4A76 A;  1M90 C;  4JG2 A;  4L5T A;  3CC2 A;  2DUD A;  3CQZ H;  4JBM A;  2OQK A;  4QL5 A;  5J3B A;  4X62 Q;  2Y0S G;  4DV4 Q;  4HIO A;  1XPU A;  1YI2 A;  4NXM L;  2MQH A;  2UXC L;  2L15 A;  3B6Y A;  2EIF A;  2OCE A;  3PO2 G;  1XPO A;  1WI5 A;  3J7Z C;  2R7Z G;  5JJK A;  3S1Q H;  4JI1 Q;  1KD1 C;  4A3K H;  4YY3 L;  4B3S Q;  3J80 c;  4JI6 L;  2UUC Q;  1YJW A;  2JJQ A;  1HH2 P;  3CCS A;  3T1H Q;  2RHQ B;  1SMX A;  1I5F A;  4DV6 L;  1GD7 A;  1YEZ A;  2NVQ H;  4IJL A;  3PF4 A;  4GS3 A;  1CUK A;  2IX0 A;  1CKM A;  4JBJ A;  1HNX L;  4DR7 L;  4LW1 A;  5C3E G;  4DV7 Q;  1L1O C;  3A5U A;  4A3L H;  4YCV A;  4DAY B;  1YVC A;  2EXD A;  2D62 A;  1KRT A;  1SRO A;  1UWV A;  4A4I A;  3L0O A;  3PCO B;  4OWT B;  1VQL A;  3U50 C;  1PVO A;  4DPG A;  3L7Z C;  4GKJ Q;  2ATW A;  3KF6 A;  5JEA J;  4BA1 I;  4DV3 Q;  4FDB A;  3KYH C;  3M7N A;  4GKK Q;  1E1T A;  2JA7 H;  3GTO H;  1HR0 L;  3PV0 A;  5IYD H;  5FLM G;  5C0X G;  2I5M X;  4JI4 L;  4HJA A;  4A93 G;  4UP8 A;  1XNR Q;  1KXL A;  4MNO A;  5C4J H;  3CCQ A;  2UU9 L;  1IXR A;  3A0J A;  4KHP Q;  3UDI A;  4KHZ A;  1Q12 A;  1UE6 A;  4GN5 A;  2FXQ A;  4UP9 A;  1N34 L;  1L1O B;  4WJ4 A;  4HIM A;  2MO0 A;  4A3D G;  2MFI A;  2LXJ A;  3H0G G;  1IBL L;  1EQR A;  2R7D A;  4B3M L;  1C9O A;  4POG A;  4MZ9 A;  4PZ6 A;  2E8G A;  4DAM A;  1ASZ A;  4DV0 L;  1EOV A;  3I7F A;  4R1J A;  4JCV E;  5EAY A;  1N33 Q;  3K0X A;  2ZTC A;  2ZTE A;  3E9I A;  3RZD H;  1QZH A;  2UXD Q;  5FJ8 H;  2JEB I;  4GOP A;  2BH2 A;  4X64 Q;  3PF5 A;  3W5O A;  2NVT H;  3AYH B;  1NMG A;  1X55 A;  1SE8 A;  2CKZ B;  1V43 A;  2Y0S E;  4OXP A;  5GRO A;  4DNI A;  5IYB H;  2YV5 A;  4LF9 L;  4JBW A;  2QA4 A;  1CKO A;  1VQN A;  1BBW A;  2JE6 I;  5H1S E;  5C44 H;  3GTL H;  1XTD A;  2QEX A;  1PYS B;  2I5H A;  1JE5 A;  3CXC A;  3S1M H;  2VQE L;  4X65 Q;  1WCM G;  1N36 L;  5M3F H;  1LM0 A;  1HNZ Q;  3K8A A;  2UUA Q;  4HID A;  1MJC A;  4LF8 Q;  2ID0 A;  1GM5 A;  3I2Z A;  4UPA A;  3GTQ H;  4BA2 I;  3I4N G;  3KF6 B;  3NEN A;  4JI8 L;  4DR3 Q;  1Q46 A;  4A3G G;  4JI2 L;  4B3R Q;  1Y1W H;  3HKS A;  3TS0 A;  2K4K A;  1TWC H;  1Q1B A;  1IZ6 A;  3U4V A;  3GD7 A;  2UXB Q;  4YHH Q;  4LF6 Q;  3M3Y H;  5IY0 A;  2KEN A;  1PHJ A;  4LF4 L;  1K83 H;  1VQO A;  5JEA G;  4BXX G;  2KCT A;  3RLF A;  1R9T H;  5AJ3 L;  4XIG S;  5LMN Q;  1FVI A;  3ER0 A;  1XMO Q;  1GKH A;  4A3F H;  1I94 Q;  1XMQ Q;  1A0I A;  2A1A A;  5LMU Q;  1E22 A;  1X9N A;  2Q2U A;  2IT1 A;  1QUQ B;  3EIV A;  4OX9 L;  1AE3 A;  3PUW A;  4LFB Q;  4A3I H;  1CSQ A;  1WFQ A;  1N32 L;  1IL2 A;  5M5X H;  1FGU A;  2AMC B;  2R92 G;  5GQO A;  1J5E L;  4DUZ Q;  3HOU H;  3S14 H;  4IOA A;  1Q82 C;  3J81 i;  1IBK Q;  3NEM A;  4IFD J;  3CCL A;  5GAH C;  1NTG A;  3GTM H;  5DLQ E;  4DR2 Q;  3RR5 A;  4IJH A;  3E0E A;  3RLN A;  3D31 A;  3OTO L;  4OON A;  1OXV A;  4R4T A;  1PH4 A;  4AH6 A;  5IP9 H;  4IO9 A;  2HT1 A;  4A3E H;  4BY1 G;  3K7A H;  3AFQ A;  4A3M H;  4MTN A;  1TWG H;  2A19 A;  4LF5 L;  1VQ8 A;  1WJJ A;  1YHB A;  3PGZ A;  3CME A;  4JI0 Q;  3I4O A;  3KFU A;  2OTL A;  1ASY A;  1HNW L;  3NBH B;  3AFP A;  5FLX c;  1K0R A;  2UXC Q;  3HKZ G;  4DR4 Q;  4IPC A;  1VQE A;  2WP8 J;  1V1Q A;  4B3T L;  2OTJ A;  4DK3 C;  4YY3 Q;  1QVG A;  3F8T A;  4HJ8 A;  2YU9 H;  1CKN A;  3KJP A;  1XJV A;  1TWH H;  4OWX B;  2H5X A;  3UDX A;  1VQ5 A;  1E1O A;  2LXK A;  4A3C H;  3HOZ G;  3W1G A;  4UP7 A;  3RN5 A;  1YIT A;  1YJ9 A;  4DR7 Q;  2F3I A;  3L2P A;  2E5L L;  4LFA L;  4GN4 B;  2CQO A;  1VQK A;  4BBS H;  3KLW A;  3FKI G;  4OWW B;  4GN3 B;  2MNA A;  5IWA L;  4A3J G;  1A63 A;  3S24 A;  4A3B H;  4JOI A;  3ULP A;  1I3Q H;  4K0K Q;  3BZC A;  4UY8 C;  4DR6 L;  1E24 A;  4DUY L;  2B63 H;  2OWO A;  4NB3 A;  1YHQ A;  1EFW A;  1HR0 Q;  3KOJ A;  4JI4 Q;  3PO2 H;  3BJU A;  3OW2 A;  4A3K G;  2UU9 Q;  1VQD A;  2PNH A;  4APV A;  3CF5 A;  5K36 G;  4LF7 L;  1HZC A;  3J81 j;  1OXX K;  4JI5 L;  1TWF H;  1MKH A;  1RIP A;  4EX5 A;  3M85 A;  3S1N H;  2GVB A;  1KHI A;  1VQ9 A;  1S3O A;  3H3V H;  2CFM A;  3PO3 H;  1IBL Q;  1PYB A;  4B3M Q;  4R4O A;  5C3E H;  4IFD G;  1Z9F A;  4JBK A;  4LNQ A;  4AIM A;  4QIW E;  2IY5 B;  1PFS A;  3K81 C;  4YWL A;  2HQL A;  3TS2 A;  5JJL A;  3CMA A;  4AQY Q;  4JOI C;  3J80 i;  1HZB A;  3HOY G;  2JA7 G;  1C0A A;  4DUY Q;  2NN6 G;  1SR3 A;  3NEL A;  4R4C A;  5FLM H;  4GLA C;  3T1Y L;  4LF9 Q;  2VUM G;  3F2D A;  2RCN A;  3H3V I;  2JA5 G;  3CAM A;  3U4Z A;  2ZJR A;  1WYD A;  4YCU A;  3HKZ E;  1VQ6 A;  2ES2 A;  1EYG A;  1Q81 C;  2JA6 G;  5C4X G;  1SRU A;  1S72 A;  2VQE Q;  2B3G A;  1HZA A;  1N36 Q;  4A3D H;  4PZ7 A;  3UE1 A;  2BA0 A;  1LTL A;  3H0G H;  2GVA A;  5C0X I;  3CCM A;  3CC7 A;  2R93 H;  3CPF A;  3JC6 6;  4JI8 Q;  4C3J H;  4P71 A;  2Q2I A;  3LGJ A;  4JI2 Q;  2PQA A;  1X54 A;  5IE8 A;  3HOV H;  4GKJ L;  2VNU D;  1UE1 A;  2K14 A;  4GKK L;  1VCI A;  1Y1V G;  2KBN A;  1QVF A;  1YZ6 A;  5M5W H;  1A8V A;  3PIP A;  2R7Z H;  5JJI A;  1UE7 A;  2XGT A;  4LF4 Q;  2OQ0 A;  1X65 A;  3KJO A;  3SGI A;  3DM3 A;  3K7U C;  5AJ3 Q;  3I4M H;  3TRZ A;  4DV1 L;  3FHW A;  1G6P A;  3WWV A;  4KHP L;  4P74 A;  1AE2 A;  1VQH A;  2F52 A;  4X66 L;  4JI3 L;  1X3E A;  3GTG H;  3ULJ A;  1WCM H;  5ELN A;  4IPG A;  4GOP C;  1KQS A;  1N9W A;  2NZH A;  1VQ7 A;  1PH1 A;  4OX9 Q;  4DR5 Q;  1PH7 A;  4OO1 I;  4DV2 L;  1PH2 A;  3CCU A;  1IBM L;  2K5N A;  3F2B A;  4R4Q A;  1N33 L;  4BBR G;  2Z0S A;  1CSP A;  3HOX H;  3S2D H;  2IX1 A;  1EIF A;  3KDF A;  1KRS A;  2VS1 A;  2E2J H;  4NXN L;  4DR1 L;  5IYC G;  3G6E A;  1VQM A;  3U58 A;  4BXX H;  4P75 A;  1OXT A;  1UEB A;  5BR8 L;  3JAM c;  1VQB A;  4XTC S;  3RN2 A;  3STB D;  2JEA I;  2VQF Q;  2HIV A;  1YHA A;  3ZJY C;  1OTC A;  1VQF A;  1Y14 B;  4GOP B;  2WB1 G;  1JJG A;  4LF5 Q;  3CC4 A;  2GN5 A;  2ZM6 Q;  4DV5 L;  2CCZ A;  2YYZ A;  3CCJ A;  1HNZ L;  4AYB G;  1H95 A;  4RG1 A;  1U5K A;  4HJ9 A;  2JA8 H;  4LF8 L;  2NZO A;  1HNW Q;  2PMZ E;  4IOC A;  3PUV A;  3TQY A;  2KHJ A;  4DK6 C;  3M4Q A;  5M5Y H;  2A8V A;  4H02 A;  4HJ5 A;  4BY7 H;  1IYJ B;  2Z6K A;  4B3T Q;  4B3R L;  3H15 A;  1KIX A;  3HOU G;  3RZO H;  1B8A A;  4HJ7 A;  3F1Z A;  3S16 H;  5ELO A;  3PUX A;  5IP7 H;  4JI7 L;  3BU2 A;  2JA9 A;  1G51 A;  1YJN A;  2HHH L;  2UUB L;  3M9B A;  4NXM Q;  1XMO L;  4LFA Q;  2E5L Q;  3GDE A;  4JC0 A;  3EN2 A;  1XNQ L;  4WJ3 M;  3JAM i;  1N8R C;  3MXN B;  2VY3 A;  1I94 L;  2N78 A;  4KLK A;  4A3E G;  4BY1 H;  5IWA Q;  4HIK A;  3TEH B;  1EIY B;  3HOW H;  4JYA L;  4JI6 Q;  3CPW A;  2YTX A;  4DR6 Q;  5M3M H;  4LFC L;  4DV6 Q;  1MIU A;  1S40 A;  4R4I A;  4LUZ A;  4EQ5 A;  1HNX Q;  1W2B A;  1M1K C;  3G4S A;  2I5L X;  2Z6K C;  4J15 A;  1XPR A;  2NVX H;  3I55 A;  1FL0 A;  2YTY A;  2VL6 A;  1SFO H;  1IBK L;  4LF7 Q;  2XTI A;  2R7F A;  2BH8 A;  3STB C;  4A75 A;  2F4V L;  4JI5 Q;  3HOZ H;  1Z47 A;  3PSI A;  4LUO A;  2EQS A;  3CW2 C;  4GNX A;  2K75 A;  2DGY A;  1L1O A;  4ME3 A;  2Q2H A;  1EUJ A;  4TVA B;  4YCW A;  3CCE A;  2PI2 A;  4JV5 L;  1B70 B;  3UDG A;  1YIJ A;  4BBS G;  3FKI H;  1E3P A;  4A3J H;  3G48 A;  3I56 A;  1KAW A;  2ALY B;  3K80 C;  2WB1 E;  4JI0 L;  2ZJP A;  4A3B G;  1K8A C;  2VZA A;  3ULL A;  2E2H H;  1FJG L;  2B63 G;  2D0O A;  2LSS A;  4AYB E;  1N34 Q;  2K5V A;  1VQC A;  3T1Y Q;  1I50 H;  3ERS X;  4DR4 L;  2NVY H;  3DLL A;  4YWK A;  4POF A;  4A3L G;  3J7A 5;  5HGQ A;  2QGQ A;  3MEF A;  3GO5 A;  4DV0 Q;  3S1R H;  3UDF A;  2ZJQ A;  4GLX A;  1J6Q A;  1K3R A;  3CCR A;  4X62 L;  1YBY A;  4DV4 L;  1RL2 A;  1K73 C;  1PH3 A;  2K5H A;  2B29 A;  1PH9 A;  4YWM A;  4GNX C;  3GTP H;  3PO3 G;  5IYD G;  3GTJ H;  4A93 H;  1VQA A;  1CKN B;  3RLO A;  2R6G A;  4JI1 L;  4QJF A;  1JT8 A;  4O0A A;  4B3S L;  2CWP A;  2UUC L;  2K50 A;  2N3S A;  3T1H L;  4K0K L;  4NPS A;  1PH6 A;  2RHS B;  1BBU A;  4L5R C;  4LUV A;  3HOY H;  1X56 A;  2WFW A;  4L5S A;  2IHF A;  4PMW A;  2VUM H;  1LUZ A;  1VQG A;  3CCV A;  2JA5 H;  1VQP A;  2ASB A;  4DV7 L;  1MJE A;  4IFD I;  4QGU A;  4P73 A;  4DV1 Q;  4L5Q A;  4P72 A;  4X66 Q;  4GNX B;  4JI3 Q;  2JA6 H;  5C4X H;  4IPD A;  2JQO A;  1PV4 A;  1OXU A;  1T9H A;  5FJ8 G;  4DV3 L;  2N8N A;  1Q86 C;  3EBE A;  3M4P A;  4PZ8 A;  3A5Z B;  1YNX A;  2NN6 I;  3OYY A;  1E7Z A;  1JJ2 A;  2D0P A;  5IYB G;  5LMN W;  2IHE A;  2AWO A;  4DV2 Q;  1JJC B;  1XNR L;  2V1C C;  5C44 G;  3AEV A;  2AKW B;  1C7Y A;  1K9M C;  1QUQ A;  1NMF A;  1IBM Q;  1SLJ A;  3CP0 A;  3HOV G;  2AHO B;  2RF4 A;  3D0F A;  4AQY L;  1Y1V H;  3HFZ B;  1BVS A;  3KF8 B;  4NXN Q;  5M3F G;  4DR1 Q;  3AQQ A;  1QZG A;  4OO1 G;  1Q7Y C;  3F2C A;  5GAE C;  3IRB A;  3I4M G;  5BR8 Q;  1D7Q A;  1Q8K A;  3PUZ A;  3I4N H;  1PH8 A;  1N32 Q;  3UE0 A;  2YTV A;  1O7I A;  3FP9 A;  4RMF A;  1Y1W G;  1J5E Q;  2UXD L;  4DV5 Q;  1NE3 A;  1NBW A;  1D8L A;  1EWI A;  3A74 A;  4X64 L;  3GTK H;  2WAQ G;  1VQI A;  1P8L A;  3S15 H;  3G71 A;  3S17 H;  1Q1E A;  1X3G A;  1X6O A;  1JMC A;  1QVC A;  2KCM A;  1VQJ A;  4PG3 A;  3OTO Q;  3PIO A;  3J81 c;  3HOX G;  4BBR H;  3PUY A;  1GVP A;  5IT9 c;  4ALP A;  2N49 A;  1P16 A;  4A3F G;  2JK8 A;  1X3F A;  4X65 L;  5HY6 A;  4JI7 Q;  2UUA L;  5IYC H;  1TXY A;  2HHH Q;  1SN8 A;  2UUB Q;  1GO3 E;  2PQA B;  4A3I G;  1XNQ Q;  2HIX A;  3W1B A;  4DR3 L;  3M4O H;  2R92 H;  1HJP A;  3VDY A;  4QQB X;  4JYA Q;  3E9H A;  2KHI A;  1KL9 A;  4QY7 A;  1LYL A;  1K8G A;  1DGS A;  1JB7 A;  1OXS C;  2AWN A;  2JA8 G;  3ICE A;  2UXB L;  1V9P A;  4LWC A;  4YHH L;  4LF6 L;  4LFC Q;  1AH9 A;  1L2F A;  4DR5 L;  1VQ4 A;  3RNU A;  2R93 G;  5LMN L;  4BY7 G;  4IPH A;  1PH5 A;  4C2M H;  1WOC A;  5GAD C;  5IP9 G;  4GLV B;  4Y52 H;  3S2H H;  1XMQ L;  4X6A H;  1B7Y B;  1I6H H;  4A3M G;  1BKB A;  4C3I H;  2E2I H;  1G29 1;  2Q2T A;  4A3G H;  2F4V Q;  5IP7 G;  5C0X J;  3Q8D A;  1A62 A;  5LMU L;  1PA6 A;  1L0W A;  4TQU S;  1EQQ A;  1KC8 C;  2I0Q A;  1HR0 W;  1NJI C;  4LFB L;  2VQF L;  4JV5 Q;  3CD6 A;  3KDF B;  1TWA H;  2VW9 A;  4DKA C;  3TRE A;  2C35 B;  4DUZ L;  2ZM6 L;  3HOW G;  2MO1 A;  5E7N A;  2K52 A;  1VS0 A;  2BA1 A;  2PI2 E;  3BZK A;  5M3M G;  1FJG Q;  4A3C G;  2ZTD A;  4C3H H;  1UE5 A;  4O2D A;  4DR2 L; 
#chains in the Genus database with same CATH topology
 1HZ9 A;  1U0L A;  2WAQ E;  1W3S A;  1F9Q A;  1YNN C;  4A76 A;  1EY4 A;  5FOB B;  3WDN A;  1SMY C;  1AFP A;  2HUG A;  1F2Z A;  2OQK A;  4ME5 A;  5J3B A;  1XPU A;  2MQH A;  4KY6 A;  3CRL C;  5BN3 A;  3BDL A;  1PFN A;  4YY3 L;  3J80 c;  5D3D A;  3CCS A;  1HH2 P;  1SYD A;  1AEX A;  2PW5 A;  3D6W A;  2HCI A;  5FLX L;  4DV6 L;  2NVQ H;  3H6M A;  2F0F A;  1HNX L;  1FNW A;  4LW1 A;  4DV7 Q;  1QB5 D;  3H0G B;  2EXD A;  2F4I A;  2D62 A;  1X32 A;  1CHP D;  4ZKC B;  4EQN A;  3U9S A;  1KNE A;  5A35 A;  4GKJ Q;  1TQO A;  2SDF A;  4FDB A;  3KYH C;  2JXM B;  5CC4 A;  1E1T A;  2L11 A;  1GJX A;  5IYD H;  5C0X G;  2I5M X;  2IJ0 A;  4UP8 A;  2UU9 L;  3A0J A;  3KUP A;  1Q12 A;  1R4P B;  2FXQ A;  1CZG A;  3DMU A;  1N34 L;  2DY7 A;  4A3D G;  5KND A;  2MFI A;  3GTG B;  1WCM B;  1PTO C;  2RDF A;  1QNK A;  5EKI A;  2E8G A;  1ZYR C;  3T16 A;  2ZXP A;  2L5T A;  4JCV E;  2B2T A;  2UXD Q;  4HR7 B;  1QZH A;  1JOQ A;  3S2D B;  2BH2 A;  2EDG A;  5JAV A;  3PF5 A;  3W5O A;  2NVT H;  3AYH B;  2SEB D;  1V43 A;  5IYB H;  2R7Z G;  1XWE A;  4HN7 A;  4LF9 L;  3S1Q H;  2E2J B;  1VQN A;  2LY7 A;  1CFM A;  1XTD A;  4NDX A;  1DYQ A;  4IUU A;  5IOC A;  1PTO B;  2OT2 A;  3U9O A;  1D5X C;  4X65 Q;  1N36 L;  4V19 0;  4OO1 H;  2ID0 A;  2JA8 B;  4UDU C;  4UPA A;  5M5Y B;  3NEN A;  4DR3 Q;  4BY7 B;  4E6I A;  1A3V A;  4JI2 L;  2IX3 A;  2B2T C;  1Y1W H;  4F88 A;  1MGS A;  2K4K A;  1TWC H;  3S16 B;  3M3Y H;  2QDL A;  5IY0 A;  1K83 H;  5LMN Q;  3RUZ A;  2FMC A;  4K5V A;  1GKH A;  5CR3 A;  4A3F H;  1I94 Q;  1XMQ Q;  5IGB A;  2Q2U A;  4LFB Q;  4A3I H;  1N32 L;  3BS1 A;  5AFW A;  2R92 G;  1CK1 A;  2CW0 D;  4DUZ Q;  3S14 H;  1TVX A;  3ERQ A;  4QUF A;  1I4X A;  1U4R A;  5DLQ E;  4IJH A;  5FO7 B;  5KGU A;  2MJ8 A;  4RKL A;  5COR A;  5C4Z A;  2HT1 A;  3EJI A;  1PZJ D;  4ZK9 B;  4BY1 G;  4LF5 L;  4A3M H;  3PGZ A;  3KFU A;  3CME A;  3DEO A;  1BCP D;  2E2H B;  5C6A A;  1VMC A;  2K01 A;  3ITP A;  5IT9 L;  1VQE A;  2NVY B;  4YY3 Q;  3IKJ A;  4TRD A;  5EBC A;  2H5X A;  2H1E A;  1VQ5 A;  1E1O A;  4X3U A;  2K1B A;  1YIT A;  1YJ9 A;  1KLU D;  4OEL B;  3L2P A;  3DHQ A;  1PZI D;  3FKI G;  3P20 A;  4OWW B;  1A63 A;  4A3J G;  4G7O C;  4JOI A;  3BYT B;  4K8I A;  4UY8 C;  4DR6 L;  4Q0F A;  1E24 A;  2B63 H;  1I6V C;  3PO2 H;  3BJU A;  2EY2 A;  1ROD A;  3VR4 A;  2UU9 Q;  1HA5 A;  1TS3 A;  4G7H C;  1F2M A;  1Q3L A;  1SNM A;  1RIP A;  5C4X B;  1Y8N B;  1KHI A;  3MC0 B;  3D4R A;  3DWA A;  1PYB A;  1MHW C;  1Z9F A;  2MHV A;  4AIM A;  3FPU B;  5COY A;  1QCB D;  2JN4 A;  2HQL A;  3CMA A;  4JOI C;  3ND9 A;  2RQX A;  2NTS A;  3T1Y L;  1SR3 A;  5FLM H;  1GUS A;  4LF9 Q;  4XT3 B;  3F2D A;  3CAM A;  2ZJR A;  1QG7 A;  1A15 A;  3NWT A;  1Q81 C;  2KEC A;  3NK9 A;  2B3G A;  1N36 Q;  5CV9 A;  1E2W A;  2BA0 A;  3H0G H;  2K32 A;  1SJE D;  3M4Y A;  3I8Z A;  3CCM A;  3CC7 A;  1A3T A;  1GXD C;  3CPF A;  4K14 A;  5KIX A;  4RKB A;  4JI2 Q;  4HMJ A;  1UE1 A;  4GKK L;  1VCI A;  1B44 D;  2L12 A;  4L63 B;  5JJI A;  1DJR D;  4JVZ A;  2OQ0 A;  3FHW A;  4KHP L;  4P74 A;  1AE2 A;  4X66 L;  4OHJ A;  1ICW A;  4L6T B;  3GTG H;  5C5M A;  1WCM H;  5ELN A;  4GOP C;  4AYB B;  3CCU A;  1H9J A;  2F1M A;  4HTH A;  3MZ5 A;  3GP7 A;  3S2D H;  3BVZ A;  3S2H B;  2VS1 A;  2E2J H;  4A3G B;  5IYC G;  1JE4 A;  4BXX H;  1J8I A;  1UEB A;  2AQ2 B;  1PTO H;  3ZJY C;  4GOP B;  1Y14 B;  4LF5 Q;  3FDT A;  3IFD A;  2ZM6 Q;  1HNZ L;  1TR5 A;  2IWH A;  5JVH 3;  4HJ9 A;  2JA8 H;  4LF8 L;  1F9S A;  1EEI D;  5M5Y H;  2PYK A;  2HDM A;  4BY7 H;  1YNJ D;  5I4D A;  1NR4 A;  3H15 A;  2C9O A;  3J81 E;  5J22 A;  1B8A A;  4HJ7 A;  5DM6 3;  4MIU A;  5T1I A;  3S16 H;  5ELO A;  3PUX A;  2F0U A;  4JI7 L;  3BU2 A;  1XTC D;  4KK7 A;  3TZD A;  4PNY A;  1ENF A;  4NXM Q;  3EFX D;  4QB4 A;  3NXW A;  1K8O A;  4A3E G;  1SJH D;  5KNB A;  1RF2 D;  4A3K B;  3T4A C;  4JI6 Q;  1EEF D;  2YTX A;  3OWE B;  1LT5 D;  4DR6 Q;  4C3H G;  4R4I A;  4LUZ A;  2Q8T A;  4EQ5 A;  4DNR B;  1T5E A;  1LTG D;  4DF7 A;  2VL6 A;  1EYA A;  2DN8 A;  4J8Q A;  3STB C;  5EKK A;  3IAY A;  1DOM A;  3I3C A;  2F4V L;  1Z47 A;  2EQS A;  1PXU A;  2K75 A;  2DGY A;  4ME3 A;  2Q2H A;  2JA7 B;  4F7X A;  4YCW A;  4JV5 L;  4U68 A;  2CH4 A;  2VUM B;  1RJT A;  4BBS G;  1EY9 A;  1E3P A;  3I56 A;  4JI0 L;  3AU7 A;  2F0K A;  3ULL A;  4F87 A;  2E2H H;  1E0B A;  4AYB E;  2K5V A;  1WTV A;  3T1Y Q;  4GZY C;  5LL6 S;  2NVY H;  4POF A;  3J7A 5;  5HGQ A;  2QGQ A;  4RA8 A;  1ESF A;  3NBI A;  4GLX A;  1LTB D;  3RZD B;  1YBY A;  1PH3 A;  4WJW A;  2AUK A;  1FYC A;  4JI1 L;  2QIL A;  3KLR A;  4B3S L;  3J80 E;  1EY6 A;  1PH6 A;  1STG A;  5I9O A;  4H7B A;  3HOY H;  3H94 A;  2EYL A;  2F0S A;  2IHF A;  3RD4 A;  1WTP A;  2K5D A;  3DUZ A;  1I4G A;  1EZ8 A;  1SBB B;  1CA5 A;  4X66 Q;  5C4X H;  4O1N A;  4IPD A;  3TP8 A;  4X3T A;  2N8N A;  3A5Z B;  1YNX A;  2NN6 I;  3DXJ C;  1JQY D;  1IYU A;  3HZX A;  1SYC A;  2NZ1 D;  1XNR L;  5C44 G;  1QUQ A;  3CP0 A;  4AQY L;  3R93 A;  3J7A V;  1RHP A;  4CJ2 C;  3KF8 B;  1IKL A;  3FEW X;  5M3F G;  4RGO S;  1QZG A;  5E4X A;  2A69 D;  3F2C A;  1D7Q A;  1SE3 A;  3V96 A;  5M5X B;  5ELB A;  2YTV A;  1O7I A;  1NBW A;  1SYB A;  1PZK D;  5EPJ A;  3SVM A;  3NBH A;  3OTO Q;  1B9N A;  3LWE A;  3PUY A;  4ALP A;  1P16 A;  1V8Q A;  3K7A B;  2E2D C;  1ZKO A;  4JI7 Q;  1SYF A;  1YNN D;  2CHB D;  2P5Z X;  5EQ0 A;  3NSW A;  1QIL A;  1AZP A;  1GO3 E;  2PQA B;  3W1B A;  3EVQ A;  2KHI A;  1D6E C;  1JWU D;  1LYL A;  2UXB L;  3ICE A;  1RKN A;  1V9P A;  1WTR A;  1L2F A;  4QCL A;  3N52 A;  2J0T D;  1PRT F;  2WKD A;  3PIO 3;  3S2H H;  2Q2T A;  3H3V C;  4A3G H;  2F4V Q;  5IP7 G;  5LMU L;  1G2S A;  1HFG A;  1L0W A;  4A3B B;  1EQQ A;  1I3Q B;  2I0Q A;  5I2X A;  4TKO B;  4JV5 Q;  3KLS A;  1T5X D;  1I4R A;  3HOW G;  2K52 A;  5ELF A;  3R8B A;  3Q22 A;  2MPM A;  2BA1 A;  1MSG A;  5CYU A;  3IFT A;  4A3C G;  4FNF A;  2TMP A;  1TWF B;  4O2D A;  1XX8 A;  4KN4 C;  5KYL A;  3S1N B;  1NY4 A;  5GAG C;  1G8Z D;  3NTH A;  3PO3 B;  2RA4 A;  4JG2 A;  1WTQ A;  4RWS C;  3NTK A;  1PTO D;  1Z6H A;  1YI2 A;  2UXC L;  2L15 A;  1S5F D;  4IN3 A;  2IPK D;  5JJK A;  4JI1 Q;  4A3K H;  4B3S Q;  3KBG A;  4HSV A;  5D14 A;  5EBD A;  1SMX A;  2O4X A;  1BF4 A;  2B2U A;  1GD7 A;  1YEZ A;  5F2D A;  1F77 A;  2X69 A;  4X3S A;  3R2T A;  2IX0 A;  4GS3 A;  3PF4 A;  4A3D B;  3P75 A;  2KOL A;  4DAY B;  2NBF A;  1KRT A;  2MP1 A;  4A4I A;  2R93 B;  4DPG A;  4C3J B;  1S5C D;  3HOV B;  5JEA J;  4HCS A;  2JA7 H;  4H13 C;  1B1Z A;  3PV0 A;  4S3S A;  1HR0 L;  1BUV T;  4A93 G;  1JIC A;  4G57 A;  2R7Z B;  1XNR Q;  4MNO A;  1PMR A;  4KD3 A;  1IXR A;  2ZXR A;  3VYR A;  4KHZ A;  1UE6 A;  1ZXT A;  3HRZ C;  2B2U C;  3I70 A;  1NSN S;  4HIM A;  1KAA A;  1BXT A;  4B3M L;  1EQR A;  2R7D A;  5CBA E;  1C9O A;  3SK6 A;  3OWF A;  4DAM A;  4IUR A;  1HHV A;  3RZD H;  2ZTE A;  3NP8 A;  1IKM A;  2AQ1 B;  1S5D D;  2CKZ B;  1D1K A;  1S5B D;  1CKO A;  5H1S E;  2EYP A;  2G9D A;  1IHZ A;  2EJG C;  1CQF A;  4DU9 A;  1V1P A;  1LM0 A;  4ODG A;  3K8A A;  5E4W C;  1W6J A;  3SDZ A;  3H09 A;  2IL8 A;  1K28 A;  4X3K A;  1Y69 U;  3OSO A;  2NYZ D;  3M7G A;  4MHE A;  2UXB Q;  4KN7 C;  4RCN A;  2AUJ D;  5DEH A;  3VR6 A;  5E1F A;  4LF4 L;  3D4W A;  1VQO A;  2D2C C;  5A2Q E;  5AJ3 L;  4XIG S;  1KLG D;  1FVI A;  4CKB A;  5CBE E;  1CQV A;  4BY1 B;  4XQN A;  5LMU Q;  3PIP 3;  2IT1 A;  1I4P A;  3PUW A;  3QOL A;  1HQR D;  1IL2 A;  5M5X H;  2AMC B;  1LT6 D;  3N6R A;  5GQO A;  1ILP A;  2RBM A;  2NVX B;  1STA A;  2L4N A;  3J81 i;  2RDH A;  3LX0 A;  2EOT A;  1SFO B;  4IFD J;  5GAH C;  1NTG A;  1JB3 A;  2RDG A;  4K2K A;  1LTA D;  1OXV A;  4R4T A;  1PH4 A;  4K2L A;  4AH6 A;  4IO9 A;  2ICI A;  3L3O C;  3K7A H;  3AFQ A;  3FKI B;  4MTN A;  4A3J B;  1VQ8 A;  4ZQ3 A;  3J7Y W;  1NCV A;  1HNW L;  4ZAI A;  2XRQ D;  3A8I E;  4ZYS A;  5C5L A;  2UXC Q;  3MXG A;  1I50 B;  4IPC A;  4CJ1 B;  4DK3 C;  2LKV A;  1QVG A;  3KJP A;  1ICF B;  4OWX B;  1HUN A;  2LXK A;  3HOZ G;  4FXG C;  4UP7 A;  2F3I A;  4O42 A;  3GTJ B;  3EQL C;  1VQK A;  3KLW A;  3D3R A;  1EL0 A;  4A3B H;  1I3Q H;  3KK7 A;  1HR0 Q;  1QNU A;  1VF7 A;  4DFA A;  1SSO A;  2B2V A;  3CF5 A;  2PNH A;  5K36 G;  1HZC A;  1KDB A;  1OXX K;  4C1N K;  4I7Z C;  1TWF H;  2N55 A;  3S1N H;  2GVB A;  3H3V H;  1ZEQ X;  3PO3 H;  4B3M Q;  5ELD A;  2IY5 B;  2M9V A;  1SDF A;  3J80 i;  1GUO A;  5IIF A;  2ZT9 C;  1HZB A;  2OXP A;  2NN6 G;  5C0X H;  2RCN A;  2JA5 G;  3U4Z A;  1WYD A;  4IUV A;  2B2V C;  1EYG A;  4L8J A;  2PPB C;  3I4N B;  2F03 A;  3L9A X;  3W3A A;  2JA6 G;  1SRU A;  1S72 A;  5KNC A;  4A3D H;  1FGB D;  2EYO A;  1A3U A;  2R93 H;  4C3J H;  1EFI D;  1SYG A;  3HOV H;  1X54 A;  2K14 A;  3BYY B;  3SHL A;  1Y1V G;  3PIP A;  2R7Z H;  1UE7 A;  1CZW A;  4LF4 Q;  1X65 A;  5AJ3 Q;  1ML0 D;  1G6P A;  3I4L A;  2F52 A;  3CRK C;  1ONL A;  1GUG A;  4FF1 A;  1H9M A;  4IPG A;  1KQS A;  1HA6 A;  2EY5 A;  1PH1 A;  4R8N A;  2F0L A;  1HFN A;  4DV2 L;  3G7L A;  2MUY A;  1Q8I A;  1N33 L;  4BBR G;  3SE0 A;  2IX1 A;  3KDF A;  5DM7 3;  2V4D A;  3AB9 A;  1I6H B;  1O7Z A;  4NXN L;  3G6E A;  1VQM A;  2B8F A;  3U58 A;  4XTC S;  1R4Q B;  3E6Z X;  2O2L D;  2R3Z A;  3STB D;  3TN2 A;  3BG3 A;  1YHA A;  3W2D A;  1OTC A;  1VQF A;  2WB1 G;  3K59 A;  1TWA B;  3CC4 A;  2GN5 A;  2YYZ A;  4RGM A;  4B9W A;  1HNW Q;  3PUV A;  3M4Q A;  4C3H B;  4RAU C;  4H0L C;  5EJW A;  2WIN B;  1EY7 A;  4B3R L;  4JW0 A;  2VB3 X;  4CKE A;  4C3I G;  3NHH A;  2JA9 A;  2HHH L;  1M4V A;  2UUB L;  2Z8L A;  5IGE A;  1XMO L;  3J81 L;  3GDE A;  2M00 A;  4JC0 A;  4Q5V A;  1XNQ L;  4WJ3 M;  2VY3 A;  4BY1 H;  4HIK A;  1EIY B;  3TEH B;  1EYC A;  2BE5 C;  5JPN C;  3A7A B;  4DV6 Q;  2OF1 A;  2GA4 B;  2B2Y A;  1HNX Q;  1M1K C;  2I5L X;  2NVX H;  2YTY A;  1SFO H;  1IBK L;  4R8I A;  2XTI A;  2R7F A;  2FHT A;  1CM9 A;  2I07 B;  2LS0 1;  4GNX A;  3CW2 C;  3O13 A;  1L1O A;  3HOY B;  3GTO B;  3CCE A;  2XIW A;  1B70 B;  3FKI H;  4A3J H;  3G48 A;  4UHV A;  3K5N A;  5C4J B;  4IUQ A;  3ND8 A;  3MFY A;  1FJG L;  2B63 G;  1N34 Q;  5FLX E;  1I50 H;  4DR4 L;  2EYF A;  4A3L G;  1STN A;  3A55 A;  2ZJQ A;  5TSS A;  2F0V A;  1K73 C;  1RL2 A;  1B50 A;  3OHX C;  4YWM A;  4GNX C;  3I72 A;  3GTJ H;  4TSS A;  1XYI A;  1VQA A;  1CT1 D;  1LV9 A;  1JT8 A;  5C44 B;  3GTL B;  2UUC L;  2N3S A;  3QB3 A;  4K0K L;  2RHS B;  1BBU A;  4L5R C;  2Q8R E;  1JR0 D;  4FVM A;  2RSN A;  3OMG A;  3S1M B;  3OPO A;  3KBX A;  3A56 A;  4PMW A;  2Q8I B;  4KTA A;  5IGD A;  4CDD C;  4KKU A;  5M3F B;  1VQP A;  4IFD I;  1MJE A;  4DGZ A;  3J80 L;  1O7L A;  4P73 A;  5G3L F;  4R9W A;  4FF3 A;  3GTQ B;  4GNX B;  1BCP F;  1WTW A;  1PV4 A;  1CA6 A;  3F2U A;  4DV3 L;  1LT3 D;  5FJ8 G;  3EBE A;  4PZ8 A;  2WII B;  1E7Z A;  4DV2 Q;  3NQT A;  2V1C C;  5ELE A;  1BO0 A;  1NMF A;  1R9T B;  1K9M C;  1H9R A;  2AHO B;  2RF4 A;  1O80 A;  5M9O A;  2A73 B;  5JOB A;  4NXN Q;  4OEM B;  3AQQ A;  1GOZ A;  1Q7Y C;  3D4D A;  1ENA A;  3IRB A;  3BZD B;  3PUZ A;  1MBY A;  3I4N H;  3VYU A;  1N32 Q;  2VB2 X;  1L0X B;  2EYM A;  5FO8 B;  4KJN A;  5I6Y A;  2K28 A;  3HOU B;  1NE3 A;  2F0T A;  3A74 A;  2B2W A;  3DM1 A;  2FJ2 A;  3G71 A;  3GTM B;  1JMC A;  2KCM A;  4HAE A;  2D9U A;  1STY A;  2NUC A;  2PCF B;  2FIN B;  2UUA L;  5IYC H;  1TXY A;  2HHH Q;  1WTO A;  2UUB Q;  1DD2 A;  1VDZ A;  2O5I C;  1XNQ Q;  2HIX A;  2BOS A;  1NNX A;  3VDY A;  4XYQ A;  4HSP A;  4QY7 A;  2YU9 B;  1JB7 A;  4ZCK A;  2AWN A;  2AQ3 B;  2JA8 G;  4YHH L;  4LF6 L;  5KRU A;  1VQ4 A;  4DR5 L;  3RNU A;  4BY7 G;  1PH5 A;  3MA2 B;  5IP9 G;  2QKI C;  1B7Y B;  1I6H H;  1BKB A;  4FXD A;  1EOT A;  1HPC A;  3Q8D A;  1A62 A;  1PA6 A;  1F2Y A;  1A6X A;  1NJI C;  2VQF L;  3VR3 A;  4G7Z C;  1TWA H;  2VW9 A;  5E7N A;  1VS0 A;  1HTP A;  3T53 B;  3K5M A;  1FJG Q;  4C3H H;  4KHV A;  4KI0 A;  1M90 C;  2A6E D;  2DUD A;  3K58 A;  4DAV A;  5CV8 A;  4QL5 A;  2Y0S G;  3A7L A;  4RCO A;  3B6Y A;  2EIF A;  2OCE A;  2KED A;  1XPO A;  1WI5 A;  1RCV D;  1KD1 C;  2UUC Q;  1YJW A;  2JJQ A;  2JP1 A;  1I5F A;  3Q24 A;  1OO9 B;  2XVS A;  4IJL A;  4NMZ A;  4XYO A;  5C3E G;  1JOK A;  3A5U A;  1SRO A;  1UWV A;  3L0O A;  4OWT B;  3D8G A;  1VQL A;  3U50 C;  4PQX A;  3L7Z C;  1AP0 A;  1KAB A;  3KF6 A;  4BA1 I;  4DV3 Q;  3M7N A;  4GKK Q;  3GTO H;  5J1Z A;  3VA5 A;  1LTT D;  1BCP C;  4KKT A;  2A68 D;  5M5W B;  4JI4 L;  2K04 A;  3WOE A;  3QJY A;  5ELC A;  3CCQ A;  5C4J H;  3I4M B;  4KHP Q;  3UDI A;  5KYI A;  4WJ4 A;  2MO0 A;  4B08 A;  4MZ9 A;  1G2T A;  4PZ6 A;  1ASZ A;  4OGQ C;  4DV0 L;  3FRP B;  1EOV A;  3E5S A;  3I7F A;  1CTM A;  3K0X A;  2ZTC A;  3CU7 A;  3HOX B;  2JEB I;  4N8F A;  1NMG A;  1X55 A;  1SE8 A;  3TSS A;  4OXP A;  5GRO A;  2L1B A;  1BQQ T;  2QA4 A;  2IW3 A;  1BBW A;  2JYO A;  3HG9 A;  5C44 H;  3GTL H;  2SNM A;  4C56 C;  2QEX A;  3KLS X;  4J1M A;  1JE5 A;  3CXC A;  3NUC A;  3S1M H;  4PV1 C;  4M8A A;  5M3F H;  1E2Z A;  3FMC A;  1HNZ Q;  2UUA Q;  4HID A;  4LF8 Q;  3QR8 A;  2Z6B A;  3GTQ H;  4BA2 I;  3KF6 B;  1Q46 A;  2DJG C;  2EVB A;  3MWY W;  3X3M A;  3FVQ A;  3LWU A;  2CH4 W;  3HKS A;  3MXN A;  4KV6 A;  3U4V A;  3GD7 A;  4YHH Q;  4LF6 Q;  2KEN A;  1PHJ A;  2KVM A;  5JEA G;  2KCT A;  1R9T H;  2L0C A;  1SMY D;  4QIW B;  2E74 C;  3PQI A;  1A2T A;  1A0I A;  1JOO A;  3MXP A;  1DZ1 A;  1E22 A;  1QUQ B;  5M3M B;  4OX9 L;  1AE3 A;  4DA2 A;  1WFQ A;  1FGU A;  2DNC A;  2EJM A;  5I6W A;  1J5E L;  2Z1C A;  3SEB A;  3HOU H;  4FXK C;  2ICE C;  3DWP A;  1SXT A;  3GTM H;  3HOZ B;  3RMH A;  3RR5 A;  1U4L A;  3E0E A;  3I91 A;  1C4Q A;  4OON A;  1STB A;  2A19 A;  4A3G G;  1WJJ A;  1YHB A;  4JI0 Q;  2HCC A;  4OIK A;  2WAC A;  4HED A;  2OTL A;  1ASY A;  5C3X A;  1LTS D;  2EYH A;  3NBH B;  5FLX c;  2HDL A;  1BR9 A;  1K0R A;  1SNP A;  1JWM D;  3HKZ G;  5CV5 A;  4U67 3;  1X3P A;  1Y8O B;  1AW7 A;  1V1Q A;  4YIJ A;  2F0P A;  4UAI A;  3F8T A;  4HJ8 A;  2YU9 H;  1CKN A;  1XJV A;  3UDX A;  4A3C H;  1Q90 A;  1LTI D;  3RN5 A;  2PO4 A;  1LT4 D;  1ZYR D;  1FNU A;  2E5L L;  4LFA L;  2QW7 A;  2MNA A;  3CHB D;  3WOF A;  3ULP A;  3GV3 A;  3BZC A;  1B3Q A;  2OWO A;  4NB3 A;  1YHQ A;  1EFW A;  4JI4 Q;  1LTR D;  5T1G A;  2JA5 B;  1WTH A;  5C3W A;  2E75 C;  4A3K G;  4APV A;  3SR1 A;  3J81 j;  2N88 A;  3I90 A;  2F3W A;  1B2T A;  1WTX A;  2JA6 B;  2F0E A;  1S3O A;  2K05 A;  2PMZ B;  4IFD G;  1UNS A;  2KCC A;  3EA6 A;  3QOJ A;  4JBK A;  4QIW E;  3MVV A;  2QF7 A;  4YWL A;  3TS2 A;  3MXU A;  4CDF C;  4JPB W;  4AQY Q;  2EJF C;  1JWS D;  2JA7 G;  3X3N A;  4R4C A;  2VUM G;  4YCU A;  1CHQ D;  3OIP A;  1H9S A;  2ES2 A;  1STE A;  1EY5 A;  3BDO A;  5BN5 A;  2Z9H A;  5E3F A;  5DNF A;  2GVA A;  4RFB A;  3OW7 A;  3S15 B;  3D6C A;  3JC6 6;  3S17 B;  3G6J B;  4P71 A;  1TS5 A;  3LGJ A;  3K5L A;  4GKJ L;  5IGG A;  1J9O A;  1A2U A;  4BBR B;  5DAU A;  3C46 A;  1QVF A;  4JK1 C;  5M5W H;  1A8V A;  1B9M A;  2XGT A;  1GUT A;  2R61 A;  3OMC A;  3Q0A A;  1ILQ A;  3DM3 A;  3I4M H;  1AZQ A;  3WWV A;  4IUP A;  2F0G A;  1IW7 C;  1PTO F;  1VQH A;  4JI3 L;  3M4O B;  2R92 B;  1X3E A;  3UI2 A;  2WB1 B;  3ULJ A;  1E2V A;  1UAP A;  2NZH A;  4OX9 Q;  1PH2 A;  3HS0 C;  1IBM L;  2L9H A;  2K5N A;  3F2B A;  3BVM A;  4R4Q A;  4J6H A;  3HOX H;  2Z0S A;  1EIF A;  1KRS A;  4ZKB B;  2E2I B;  4C3I B;  4DR1 L;  1PRT C;  1WD0 A;  2J4X A;  1H9S B;  1RTN A;  1OXT A;  3SK5 A;  3RN2 A;  1VQB A;  3V2T A;  2JEA I;  3VA7 A;  2HIV A;  1IL8 A;  3HP3 A;  3NQI A;  5LHY 1;  4CJ0 B;  4DV5 L;  2CCZ A;  3CCJ A;  1H95 A;  2A5H A;  2K5W A;  5IGF A;  3DEP A;  1PLF A;  2PMZ E;  3TQY A;  4FF2 A;  2KHJ A;  3HGB A;  2DNE A;  4DK6 C;  2G5D A;  4NP5 A;  5EKL A;  3T51 B;  1STH A;  4H02 A;  4K6L A;  2RSO A;  2KEE A;  4Y7N B;  1PRT B;  1V1P B;  3F1Z A;  4DXF A;  3CQZ B;  2RVL A;  4QMG A;  1G51 A;  3LNN A;  1HUM A;  1TY0 A;  4LFA Q;  2E5L Q;  4EQP A;  4MN3 A;  1N8R C;  1I94 L;  2N78 A;  4KLK A;  1LO5 D;  4HCE A;  3A54 A;  3H91 A;  5M3M H;  3BVG A;  4LFC L;  1MIU A;  1S40 A;  3SK8 A;  1KTK A;  3GQB A;  2DJF C;  3MEH A;  1PFB A;  1XPR A;  3I55 A;  4OL7 A;  1FL0 A;  2L55 A;  2BH8 A;  5EGT A;  3VYT A;  1D1I A;  1FD7 D;  1QOH A;  3HOZ H;  2F0O A;  1DON A;  1EUJ A;  1V1O A;  2PI2 A;  1YIJ A;  5IGC A;  1KAW A;  3K80 C;  2WB1 E;  4A3B G;  1ET9 A;  1K8A C;  2VZA A;  3K0Y A;  1BBX C;  1ENC A;  1AN8 A;  2ZXO A;  4LAA A;  3DLL A;  1KNA A;  1SYE A;  2K33 A;  4YWK A;  5K36 H;  3GO5 A;  5EPK A;  1J6Q A;  1K3R A;  4X62 L;  4DV4 L;  1K8M A;  2B29 A;  3PO3 G;  2NWG A;  4IUT A;  5IYD G;  2EZV A;  3TZU A;  2J7Z A;  3RLO A;  1U4P A;  2HD3 A;  1NUC A;  4K5W A;  3GV6 A;  1ET6 A;  2K50 A;  3T1H L;  3ERO A;  2WFW A;  4L5S A;  4EVO A;  4IAL A;  2NN6 H;  3A8K E;  3AMU A;  1VQG A;  3CCV A;  2JA5 H;  2ASB A;  4QGU A;  4XT1 B;  3TP7 A;  1EIH A;  3TME A;  3DWQ A;  4NKL A;  2F0J A;  1NAP A;  1DOL A;  3QG1 A;  4JI3 Q;  2JA6 H;  3OIQ A;  1OXU A;  1T9H A;  3OYY A;  1JJ2 A;  5IYB G;  3IL8 A;  5LMN W;  2IHE A;  1RDP D;  2R93 G;  2O5J C;  1TU2 B;  2ENB A;  3AEV A;  1IBM Q;  1C7Y A;  1KDC A;  4C3J G;  1SLJ A;  2EY6 A;  3HOV G;  1VF5 C;  3D0F A;  4ULL A;  1Y1V H;  1F2L A;  2C5C A;  3E0J A;  3URY A;  4DR1 Q;  4OO1 G;  5GAE C;  1D5Z C;  4N9P A;  1Y1W G;  4EQO A;  4RMF A;  1HQM C;  2SOB A;  4XXE A;  4DV5 Q;  4X64 L;  1EWI A;  3MAQ A;  2F3V A;  2WAQ G;  1VQI A;  1P8L A;  1D5M C;  1F9P A;  3S15 H;  3S17 H;  3P7J A;  1Q1E A;  1X3G A;  1VQJ A;  4BBR H;  1JC7 A;  1GVP A;  4FP5 D;  4A3F G;  2N49 A;  2JK8 A;  4A3E B;  4P2C B;  3C2P A;  5HY6 A;  1TWG B;  2SNS A;  4DAP A;  1SN8 A;  4A3I G;  3M4O H;  2R92 H;  1HJP A;  4N8X 1;  4QQB X;  1EY0 A;  3E9H A;  1DGS A;  2KJX A;  1OXS C;  1TWH B;  4ID6 A;  4LWC A;  1AH9 A;  4LFC Q;  1LAB A;  2KA7 A;  4IPH A;  5J39 A;  2K5Q A;  4CKC A;  5K5P A;  4Y52 H;  3S9W A;  4X6A H;  4A3M G;  4G4K A;  4C3I H;  2E2I H;  1G29 1;  4BBS B;  1O78 A;  5C0X J;  2H4O A;  1KC8 C;  2Y0S B;  3JAM E;  1W6K A;  1SE4 A;  3QO2 A;  3KDF B;  4DKA C;  4KY7 A;  2ZM6 L;  5G3L D;  3BZK A;  2PI2 E;  1SNO A;  2ZTD A;  4RGT A;  1UE5 A;  4DR2 L;  2CWA A;  2LMC B;  4Y7N H;  5C3E B;  4KJO A;  4L5T A;  3CC2 A;  2F0I A;  3CQZ H;  2F0D A;  1B4O A;  2A6H C;  2KHS A;  4JBM A;  2K03 A;  4X62 Q;  4DV4 Q;  4HIO A;  4NXM L;  5ISR A;  1HTL D;  1EY8 A;  1TT2 A;  3PO2 G;  3J7Z C;  5LL6 X;  2B2Y C;  2PW7 A;  2A74 C;  4JI6 L;  3T1H Q;  2RHQ B;  4PMB A;  3Q23 A;  5JJZ A;  3VR2 A;  2PZT A;  4JBJ A;  1CUK A;  2DY8 A;  1CKM A;  3K6O A;  2PNR C;  4DR7 L;  4A3L H;  1L1O C;  4WOR A;  4YCV A;  1YVC A;  2FMM A;  3I73 A;  2KCN A;  4IUN A;  3PCO B;  3R2I A;  1PVO A;  2XWJ B;  3P1H A;  2ATW A;  2K7V A;  2WKC A;  3Q6S A;  5FLM G;  4HJA A;  4DK1 A;  2E76 C;  1KXL A;  4KMU C;  1TS2 A;  4RHR A;  2F0N A;  4GN5 A;  5CV6 A;  4KY5 A;  1EU3 A;  4K6D A;  4UP9 A;  5NUC A;  4BWG B;  1L1O B;  1GUN A;  1TKW B;  2LXJ A;  5CV4 A;  4WFN 3;  3H0G G;  1IBL L;  2Z4I A;  4POG A;  1JOR A;  2F0H A;  4R1J A;  5EAY A;  4LJZ C;  4CGY B;  4MTK A;  1N33 Q;  3E9I A;  5FJ8 H;  4GOP A;  4X64 Q;  4DUY L;  4KKS A;  2Y0S E;  4QUC A;  4B9X A;  4DNI A;  2YV5 A;  4JBW A;  2JE6 I;  3TDQ A;  1GUW A;  3MTS A;  1TS4 A;  3C3L A;  1PYS B;  2I5H A;  3HEJ A;  5D3I B;  2VQE L;  2B39 A;  1WCM G;  2F0W A;  1MJC A;  3J7A F;  1GM5 A;  3I2Z A;  3I4N G;  4JI8 L;  4B3R Q;  3V05 A;  3TS0 A;  3RZO B;  4CBV A;  1Q1B A;  1IZ6 A;  2QCP X;  4DXG A;  4BXX G;  3RLF A;  2HQE A;  2WV6 D;  4HMI A;  1II3 A;  3ER0 A;  5BN4 A;  1XMO Q;  2VXW A;  4ABN A;  4ZUJ A;  2B8G A;  2A1A A;  3HOW B;  1HRJ A;  5CMD A;  1X9N A;  1IYV A;  2B2W C;  1EQV A;  3EIV A;  1MI2 A;  4EGV A;  4FO2 A;  1U4M A;  1CSQ A;  3TBI B;  4FF4 A;  3HKZ B;  4IOA A;  5CGK A;  2EXZ A;  1Q82 C;  1IBK Q;  3NEM A;  5L37 A;  3CCL A;  4Z9C B;  4DR2 Q;  3RLN A;  3D31 A;  3OTO L;  5IP9 H;  3BDC A;  4NW2 A;  3MHB A;  5IT9 E;  4A3E H;  1B3A A;  1TWG H;  2BDO A;  2VNU D;  3I4O A;  3TP6 A;  1MSH A;  1I4Q A;  3AFP A;  2RCF A;  4DR4 Q;  2WP8 J;  4B3T L;  2OTJ A;  1S5E D;  1G91 A;  1TWH H;  2XSC A;  3S1R B;  2KUM A;  3W1G A;  4QF4 A;  4DR7 Q;  4XDX A;  3GTP B;  4GN4 B;  5JVG 3;  4IQZ A;  2CQO A;  4LMQ D;  4A93 B;  4BBS H;  4ILW A;  4GN3 B;  5IWA L;  3S24 A;  2EPB A;  4C1N I;  2CW0 C;  1MD2 D;  4K0K Q;  1NR2 A;  1G6Z A;  1UEA B;  2CVR A;  1DCZ A;  3KOJ A;  3OW2 A;  2F0Q A;  5D65 A;  1VQD A;  1X3Q A;  4LF7 L;  4JI5 L;  1MKH A;  3K57 A;  4EX5 A;  3M85 A;  3NPP A;  2X6G A;  1VQ9 A;  2CFM A;  1IBL Q;  3KF8 A;  4R4O A;  5C3E H;  1IW7 D;  4LNQ A;  1DOK A;  1PFS A;  3FPP A;  1HXY D;  3K81 C;  1WD1 A;  5JJL A;  5FO9 B;  2D5D A;  1DXM A;  3HOY G;  5I2Y A;  4WRD A;  1C0A A;  4IZ8 A;  4DUY Q;  3NEL A;  4GLA C;  3H3V I;  1U9R A;  2G9H D;  2NTT A;  3HKZ E;  1VQ6 A;  4RHS A;  5IOD A;  1PRT D;  5C4X G;  1BCP B;  4DK0 A;  2VQE Q;  1HZA A;  4PZ7 A;  3UE1 A;  4DNT B;  1LTL A;  3GTK B;  5C0X I;  1S4Z A;  4XQJ A;  4K5X A;  4JI8 Q;  2X6L A;  3NE5 B;  2Q2I A;  2PQA A;  5IE8 A;  1UUP A;  2KBN A;  1EIG A;  2PQE A;  1YZ6 A;  3E3X A;  4DN4 M;  4N9T A;  3VR5 A;  3KJO A;  3SGI A;  3TRZ A;  3K7U C;  4DV1 L;  4CHT B;  1EQT A;  1EWH A;  4ZUI A;  1N9W A;  1VQ7 A;  4DR5 Q;  1PH7 A;  4OO1 I;  1SND A;  2Z4H A;  1QWY A;  3OOC A;  1LLR D;  1SNC A;  1CSP A;  4C2M B;  1K0S A;  3QIA A;  5FK9 C;  3VYS A;  4RH6 A;  5A2Q L;  3R3O A;  5JEA H;  4P75 A;  4CDC C;  4K8J A;  4RGN A;  3JAM c;  5BR8 L;  1GHJ A;  2VQF Q;  3C1F A;  2JSO A;  1KDA A;  1JJG A;  4F8M A;  2EE1 A;  3ZYY X;  3C1E A;  4AYB G;  4RG1 A;  1U5K A;  2EY1 A;  2NZO A;  4IOC A;  2A8V A;  4HJ5 A;  1IYJ B;  1RTO A;  2NB0 A;  2Z6K A;  4B3T Q;  1KIX A;  3HOU G;  3RZO H;  5IP7 H;  1TII D;  1EZ6 A;  1YJN A;  4PMC A;  3M9B A;  1D2B A;  5FKA C;  3EN2 A;  3SK4 A;  3JAM i;  3MXN B;  2MGS A;  5IWA Q;  3HOW H;  4JYA L;  4DAY A;  2KQ3 A;  3CPW A;  4M1U B;  2CQA A;  3MFG A;  3T13 A;  2NVQ B;  1H9K A;  1W2B A;  4XQQ A;  3G4S A;  2Z6K C;  4J15 A;  1BNZ A;  1VMP A;  4LF7 Q;  4A75 A;  4JI5 Q;  5JPM C;  3PSI A;  2F0M A;  4LUO A;  5EPL A;  4TVA B;  4ZRZ A;  3UDG A;  1M8A A;  1YNJ C;  2ALY B;  1SAP A;  2ZJP A;  2PZW A;  5CV7 A;  2D0O A;  2LSS A;  1K3B C;  1VQC A;  3ERS X;  4CDE C;  3CKI B;  3MEF A;  4DV0 Q;  3S1R H;  1CI3 M;  3UDF A;  1QJO A;  1B53 A;  2XNA C;  1SE2 A;  3CCR A;  3ONA B;  1JCK B;  1PH9 A;  2K5H A;  3GTP H;  1Y1V B;  2XWB B;  4IFD H;  2NVT B;  4A93 H;  1EWC A;  3S1Q B;  1CKN B;  1FR3 A;  2R6G A;  2FFK B;  4QJF A;  4O0A A;  2CWP A;  1WVL A;  3NWS A;  4NPS A;  1PYW D;  2I46 A;  4ZLT F;  4LUV A;  1X56 A;  2QEJ C;  2VUM H;  1LUZ A;  4DV7 L;  1RD9 D;  2XN9 C;  1QE6 A;  4DV1 Q;  4L5Q A;  4I7A A;  4P72 A;  1SEB D;  2A6E C;  2JQO A;  1Y1W B;  1Q86 C;  3M4P A;  1TWC B;  1SNQ A;  1L0Y B;  2D0P A;  5I9P A;  3M3Y B;  2AWO A;  2WAQ B;  1JJC B;  1K83 B;  2OEO A;  2AKW B;  1C48 A;  1C8C A;  3TP5 A;  5KEE A;  3HFZ B;  4A3F B;  1BVS A;  2M2L A;  1PDQ A;  2LFN A;  3I4M G;  5BR8 Q;  1Q8K A;  2K6A A;  5HUR A;  1PH8 A;  1Z7T A;  4A3I B;  4KD4 A;  3UE0 A;  1BOS A;  2BE5 D;  1F9R A;  3FP9 A;  1J5E Q;  2UXD L;  2XRS D;  3S14 B;  1D8L A;  3GTK H;  4LK1 C;  4BS9 A;  1EU4 A;  2BCO A;  3K5O A;  1X6O A;  1Y8P B;  4FYD A;  1QVC A;  2A68 C;  4PG3 A;  4OIJ A;  3PIO A;  3J81 c;  3NTI A;  3HOX G;  1FNV A;  1GHK A;  5IT9 c;  3SXH A;  1DM0 B;  1X3F A;  4X65 L;  4A3M B;  5HGT A;  2QDB A;  1BDO A;  4H44 C;  1TY2 A;  4I65 A;  4DR3 L;  2A6H D;  3PMF A;  5C4H A;  4JYA Q;  1KL9 A;  1K8G A;  1I4H A;  1O7Y A;  5LMN L;  1EYD A;  4C2M H;  1WOC A;  2A69 C;  5GAD C;  4GLV B;  1PFM A;  1XMQ L;  2TSS A;  3T56 B;  4TQU S;  3QWN A;  1HR0 W;  1HCZ A;  2B63 B;  4LFB L;  1ESR A;  4V0B A;  3CD6 A;  1XXG A;  3PO2 B;  3TRE A;  2C35 B;  2EYJ A;  2PZU A;  2RKS A;  4DUZ L;  2MO1 A;  3A8J E;  5M3M G;  1LAC A;  2BDN A;  3JAM L; 
#chains in the Genus database with same CATH homology
 1HZ9 A;  2CWA A;  4KI0 A;  1U0L A;  2WAQ E;  1W3S A;  1NY4 A;  5GAG C;  4Y7N H;  4A76 A;  1M90 C;  4JG2 A;  4L5T A;  3CC2 A;  2DUD A;  3CQZ H;  4JBM A;  2OQK A;  4QL5 A;  5J3B A;  4X62 Q;  2Y0S G;  4DV4 Q;  4HIO A;  1XPU A;  1YI2 A;  4NXM L;  2MQH A;  2UXC L;  2L15 A;  3B6Y A;  2EIF A;  2OCE A;  3PO2 G;  1XPO A;  1WI5 A;  3J7Z C;  2R7Z G;  5JJK A;  3S1Q H;  4JI1 Q;  1KD1 C;  4A3K H;  4YY3 L;  4B3S Q;  3J80 c;  4JI6 L;  2UUC Q;  1YJW A;  2JJQ A;  1HH2 P;  3CCS A;  3T1H Q;  2RHQ B;  1SMX A;  1I5F A;  4DV6 L;  1GD7 A;  1YEZ A;  2NVQ H;  4IJL A;  3PF4 A;  4GS3 A;  1CUK A;  2IX0 A;  1CKM A;  4JBJ A;  1HNX L;  4DR7 L;  4LW1 A;  5C3E G;  4DV7 Q;  1L1O C;  3A5U A;  4A3L H;  4YCV A;  4DAY B;  1YVC A;  2EXD A;  2D62 A;  1KRT A;  1SRO A;  1UWV A;  4A4I A;  3L0O A;  3PCO B;  4OWT B;  1VQL A;  3U50 C;  1PVO A;  4DPG A;  3L7Z C;  4GKJ Q;  2ATW A;  3KF6 A;  5JEA J;  4BA1 I;  4DV3 Q;  4FDB A;  3KYH C;  3M7N A;  4GKK Q;  1E1T A;  2JA7 H;  3GTO H;  1HR0 L;  3PV0 A;  5IYD H;  5FLM G;  5C0X G;  2I5M X;  4JI4 L;  4HJA A;  4A93 G;  4UP8 A;  1XNR Q;  1KXL A;  4MNO A;  5C4J H;  3CCQ A;  2UU9 L;  1IXR A;  3A0J A;  4KHP Q;  3UDI A;  4KHZ A;  1Q12 A;  1UE6 A;  4GN5 A;  2FXQ A;  4UP9 A;  1N34 L;  1L1O B;  4WJ4 A;  4HIM A;  2MO0 A;  4A3D G;  2MFI A;  2LXJ A;  3H0G G;  1IBL L;  1EQR A;  2R7D A;  4B3M L;  1C9O A;  4POG A;  4MZ9 A;  4PZ6 A;  2E8G A;  4DAM A;  1ASZ A;  4DV0 L;  1EOV A;  3I7F A;  4R1J A;  4JCV E;  5EAY A;  1N33 Q;  3K0X A;  2ZTC A;  2ZTE A;  3E9I A;  3RZD H;  1QZH A;  2UXD Q;  5FJ8 H;  2JEB I;  4GOP A;  2BH2 A;  4X64 Q;  3PF5 A;  3W5O A;  2NVT H;  3AYH B;  1NMG A;  1X55 A;  1SE8 A;  2CKZ B;  1V43 A;  2Y0S E;  4OXP A;  5GRO A;  4DNI A;  5IYB H;  2YV5 A;  4LF9 L;  4JBW A;  2QA4 A;  1CKO A;  1VQN A;  1BBW A;  2JE6 I;  5H1S E;  5C44 H;  3GTL H;  1XTD A;  2QEX A;  1PYS B;  2I5H A;  1JE5 A;  3CXC A;  3S1M H;  2VQE L;  4X65 Q;  1WCM G;  1N36 L;  5M3F H;  1LM0 A;  1HNZ Q;  3K8A A;  2UUA Q;  4HID A;  1MJC A;  4LF8 Q;  2ID0 A;  1GM5 A;  3I2Z A;  4UPA A;  3GTQ H;  4BA2 I;  3I4N G;  3KF6 B;  3NEN A;  4JI8 L;  4DR3 Q;  1Q46 A;  4A3G G;  4JI2 L;  4B3R Q;  1Y1W H;  3HKS A;  3TS0 A;  2K4K A;  1TWC H;  1Q1B A;  1IZ6 A;  3U4V A;  3GD7 A;  2UXB Q;  4YHH Q;  4LF6 Q;  3M3Y H;  5IY0 A;  2KEN A;  1PHJ A;  4LF4 L;  1K83 H;  1VQO A;  5JEA G;  4BXX G;  2KCT A;  3RLF A;  1R9T H;  5AJ3 L;  4XIG S;  5LMN Q;  1FVI A;  3ER0 A;  1XMO Q;  1GKH A;  4A3F H;  1I94 Q;  1XMQ Q;  1A0I A;  2A1A A;  5LMU Q;  1E22 A;  1X9N A;  2Q2U A;  2IT1 A;  1QUQ B;  3EIV A;  4OX9 L;  1AE3 A;  3PUW A;  4LFB Q;  4A3I H;  1CSQ A;  1WFQ A;  1N32 L;  1IL2 A;  5M5X H;  1FGU A;  2AMC B;  2R92 G;  5GQO A;  1J5E L;  4DUZ Q;  3HOU H;  3S14 H;  4IOA A;  1Q82 C;  3J81 i;  1IBK Q;  3NEM A;  4IFD J;  3CCL A;  5GAH C;  1NTG A;  3GTM H;  5DLQ E;  4DR2 Q;  3RR5 A;  4IJH A;  3E0E A;  3RLN A;  3D31 A;  3OTO L;  4OON A;  1OXV A;  4R4T A;  1PH4 A;  4AH6 A;  5IP9 H;  4IO9 A;  2HT1 A;  4A3E H;  4BY1 G;  3K7A H;  3AFQ A;  4A3M H;  4MTN A;  1TWG H;  2A19 A;  4LF5 L;  1VQ8 A;  1WJJ A;  1YHB A;  3PGZ A;  3CME A;  4JI0 Q;  3I4O A;  3KFU A;  2OTL A;  1ASY A;  1HNW L;  3NBH B;  3AFP A;  5FLX c;  1K0R A;  2UXC Q;  3HKZ G;  4DR4 Q;  4IPC A;  1VQE A;  2WP8 J;  1V1Q A;  4B3T L;  2OTJ A;  4DK3 C;  4YY3 Q;  1QVG A;  3F8T A;  4HJ8 A;  2YU9 H;  1CKN A;  3KJP A;  1XJV A;  1TWH H;  4OWX B;  2H5X A;  3UDX A;  1VQ5 A;  1E1O A;  2LXK A;  4A3C H;  3HOZ G;  3W1G A;  4UP7 A;  3RN5 A;  1YIT A;  1YJ9 A;  4DR7 Q;  2F3I A;  3L2P A;  2E5L L;  4LFA L;  4GN4 B;  2CQO A;  1VQK A;  4BBS H;  3KLW A;  3FKI G;  4OWW B;  4GN3 B;  2MNA A;  5IWA L;  4A3J G;  1A63 A;  3S24 A;  4A3B H;  4JOI A;  3ULP A;  1I3Q H;  4K0K Q;  3BZC A;  4UY8 C;  4DR6 L;  1E24 A;  4DUY L;  2B63 H;  2OWO A;  4NB3 A;  1YHQ A;  1EFW A;  1HR0 Q;  3KOJ A;  4JI4 Q;  3PO2 H;  3BJU A;  3OW2 A;  4A3K G;  2UU9 Q;  1VQD A;  2PNH A;  4APV A;  3CF5 A;  5K36 G;  4LF7 L;  1HZC A;  3J81 j;  1OXX K;  4JI5 L;  1TWF H;  1MKH A;  1RIP A;  4EX5 A;  3M85 A;  3S1N H;  2GVB A;  1KHI A;  1VQ9 A;  1S3O A;  3H3V H;  2CFM A;  3PO3 H;  1IBL Q;  1PYB A;  4B3M Q;  4R4O A;  5C3E H;  4IFD G;  1Z9F A;  4JBK A;  4LNQ A;  4AIM A;  4QIW E;  2IY5 B;  1PFS A;  3K81 C;  4YWL A;  2HQL A;  3TS2 A;  5JJL A;  3CMA A;  4AQY Q;  4JOI C;  3J80 i;  1HZB A;  3HOY G;  2JA7 G;  1C0A A;  4DUY Q;  2NN6 G;  1SR3 A;  3NEL A;  4R4C A;  5FLM H;  4GLA C;  3T1Y L;  4LF9 Q;  2VUM G;  3F2D A;  2RCN A;  3H3V I;  2JA5 G;  3CAM A;  3U4Z A;  2ZJR A;  1WYD A;  4YCU A;  3HKZ E;  1VQ6 A;  2ES2 A;  1EYG A;  1Q81 C;  2JA6 G;  5C4X G;  1SRU A;  1S72 A;  2VQE Q;  2B3G A;  1HZA A;  1N36 Q;  4A3D H;  4PZ7 A;  3UE1 A;  2BA0 A;  1LTL A;  3H0G H;  2GVA A;  5C0X I;  3CCM A;  3CC7 A;  2R93 H;  3CPF A;  3JC6 6;  4JI8 Q;  4C3J H;  4P71 A;  2Q2I A;  3LGJ A;  4JI2 Q;  2PQA A;  1X54 A;  5IE8 A;  3HOV H;  4GKJ L;  2VNU D;  1UE1 A;  2K14 A;  4GKK L;  1VCI A;  1Y1V G;  2KBN A;  1QVF A;  1YZ6 A;  5M5W H;  1A8V A;  3PIP A;  2R7Z H;  5JJI A;  1UE7 A;  2XGT A;  4LF4 Q;  2OQ0 A;  1X65 A;  3KJO A;  3SGI A;  3DM3 A;  3K7U C;  5AJ3 Q;  3I4M H;  3TRZ A;  4DV1 L;  3FHW A;  1G6P A;  3WWV A;  4KHP L;  4P74 A;  1AE2 A;  1VQH A;  2F52 A;  4X66 L;  4JI3 L;  1X3E A;  3GTG H;  3ULJ A;  1WCM H;  5ELN A;  4IPG A;  4GOP C;  1KQS A;  1N9W A;  2NZH A;  1VQ7 A;  1PH1 A;  4OX9 Q;  4DR5 Q;  1PH7 A;  4OO1 I;  4DV2 L;  1PH2 A;  3CCU A;  1IBM L;  2K5N A;  3F2B A;  4R4Q A;  1N33 L;  4BBR G;  2Z0S A;  1CSP A;  3HOX H;  3S2D H;  2IX1 A;  1EIF A;  3KDF A;  1KRS A;  2VS1 A;  2E2J H;  4NXN L;  4DR1 L;  5IYC G;  3G6E A;  1VQM A;  3U58 A;  4BXX H;  4P75 A;  1OXT A;  1UEB A;  5BR8 L;  3JAM c;  1VQB A;  4XTC S;  3RN2 A;  3STB D;  2JEA I;  2VQF Q;  2HIV A;  1YHA A;  3ZJY C;  1OTC A;  1VQF A;  1Y14 B;  4GOP B;  2WB1 G;  1JJG A;  4LF5 Q;  3CC4 A;  2GN5 A;  2ZM6 Q;  4DV5 L;  2CCZ A;  2YYZ A;  3CCJ A;  1HNZ L;  4AYB G;  1H95 A;  4RG1 A;  1U5K A;  4HJ9 A;  2JA8 H;  4LF8 L;  2NZO A;  1HNW Q;  2PMZ E;  4IOC A;  3PUV A;  3TQY A;  2KHJ A;  4DK6 C;  3M4Q A;  5M5Y H;  2A8V A;  4H02 A;  4HJ5 A;  4BY7 H;  1IYJ B;  2Z6K A;  4B3T Q;  4B3R L;  3H15 A;  1KIX A;  3HOU G;  3RZO H;  1B8A A;  4HJ7 A;  3F1Z A;  3S16 H;  5ELO A;  3PUX A;  5IP7 H;  4JI7 L;  3BU2 A;  2JA9 A;  1G51 A;  1YJN A;  2HHH L;  2UUB L;  3M9B A;  4NXM Q;  1XMO L;  4LFA Q;  2E5L Q;  3GDE A;  4JC0 A;  3EN2 A;  1XNQ L;  4WJ3 M;  3JAM i;  1N8R C;  3MXN B;  2VY3 A;  1I94 L;  2N78 A;  4KLK A;  4A3E G;  4BY1 H;  5IWA Q;  4HIK A;  3TEH B;  1EIY B;  3HOW H;  4JYA L;  4JI6 Q;  3CPW A;  2YTX A;  4DR6 Q;  5M3M H;  4LFC L;  4DV6 Q;  1MIU A;  1S40 A;  4R4I A;  4LUZ A;  4EQ5 A;  1HNX Q;  1W2B A;  1M1K C;  3G4S A;  2I5L X;  2Z6K C;  4J15 A;  1XPR A;  2NVX H;  3I55 A;  1FL0 A;  2YTY A;  2VL6 A;  1SFO H;  1IBK L;  4LF7 Q;  2XTI A;  2R7F A;  2BH8 A;  3STB C;  4A75 A;  2F4V L;  4JI5 Q;  3HOZ H;  1Z47 A;  3PSI A;  4LUO A;  2EQS A;  3CW2 C;  4GNX A;  2K75 A;  2DGY A;  1L1O A;  4ME3 A;  2Q2H A;  1EUJ A;  4TVA B;  4YCW A;  3CCE A;  2PI2 A;  4JV5 L;  1B70 B;  3UDG A;  1YIJ A;  4BBS G;  3FKI H;  1E3P A;  4A3J H;  3G48 A;  3I56 A;  1KAW A;  2ALY B;  3K80 C;  2WB1 E;  4JI0 L;  2ZJP A;  4A3B G;  1K8A C;  2VZA A;  3ULL A;  2E2H H;  1FJG L;  2B63 G;  2D0O A;  2LSS A;  4AYB E;  1N34 Q;  2K5V A;  1VQC A;  3T1Y Q;  1I50 H;  3ERS X;  4DR4 L;  2NVY H;  3DLL A;  4YWK A;  4POF A;  4A3L G;  3J7A 5;  5HGQ A;  2QGQ A;  3MEF A;  3GO5 A;  4DV0 Q;  3S1R H;  3UDF A;  2ZJQ A;  4GLX A;  1J6Q A;  1K3R A;  3CCR A;  4X62 L;  1YBY A;  4DV4 L;  1RL2 A;  1K73 C;  1PH3 A;  2K5H A;  2B29 A;  1PH9 A;  4YWM A;  4GNX C;  3GTP H;  3PO3 G;  5IYD G;  3GTJ H;  4A93 H;  1VQA A;  1CKN B;  3RLO A;  2R6G A;  4JI1 L;  4QJF A;  1JT8 A;  4O0A A;  4B3S L;  2CWP A;  2UUC L;  2K50 A;  2N3S A;  3T1H L;  4K0K L;  4NPS A;  1PH6 A;  2RHS B;  1BBU A;  4L5R C;  4LUV A;  3HOY H;  1X56 A;  2WFW A;  4L5S A;  2IHF A;  4PMW A;  2VUM H;  1LUZ A;  1VQG A;  3CCV A;  2JA5 H;  1VQP A;  2ASB A;  4DV7 L;  1MJE A;  4IFD I;  4QGU A;  4P73 A;  4DV1 Q;  4L5Q A;  4P72 A;  4X66 Q;  4GNX B;  4JI3 Q;  2JA6 H;  5C4X H;  4IPD A;  2JQO A;  1PV4 A;  1OXU A;  1T9H A;  5FJ8 G;  4DV3 L;  2N8N A;  1Q86 C;  3EBE A;  3M4P A;  4PZ8 A;  3A5Z B;  1YNX A;  2NN6 I;  3OYY A;  1E7Z A;  1JJ2 A;  2D0P A;  5IYB G;  5LMN W;  2IHE A;  2AWO A;  4DV2 Q;  1JJC B;  1XNR L;  2V1C C;  5C44 G;  3AEV A;  2AKW B;  1C7Y A;  1K9M C;  1QUQ A;  1NMF A;  1IBM Q;  1SLJ A;  3CP0 A;  3HOV G;  2AHO B;  2RF4 A;  3D0F A;  4AQY L;  1Y1V H;  3HFZ B;  1BVS A;  3KF8 B;  4NXN Q;  5M3F G;  4DR1 Q;  3AQQ A;  1QZG A;  4OO1 G;  1Q7Y C;  3F2C A;  5GAE C;  3IRB A;  3I4M G;  5BR8 Q;  1D7Q A;  1Q8K A;  3PUZ A;  3I4N H;  1PH8 A;  1N32 Q;  3UE0 A;  2YTV A;  1O7I A;  3FP9 A;  4RMF A;  1Y1W G;  1J5E Q;  2UXD L;  4DV5 Q;  1NE3 A;  1NBW A;  1D8L A;  1EWI A;  3A74 A;  4X64 L;  3GTK H;  2WAQ G;  1VQI A;  1P8L A;  3S15 H;  3G71 A;  3S17 H;  1Q1E A;  1X3G A;  1X6O A;  1JMC A;  1QVC A;  2KCM A;  1VQJ A;  4PG3 A;  3OTO Q;  3PIO A;  3J81 c;  3HOX G;  4BBR H;  3PUY A;  1GVP A;  5IT9 c;  4ALP A;  2N49 A;  1P16 A;  4A3F G;  2JK8 A;  1X3F A;  4X65 L;  5HY6 A;  4JI7 Q;  2UUA L;  5IYC H;  1TXY A;  2HHH Q;  1SN8 A;  2UUB Q;  1GO3 E;  2PQA B;  4A3I G;  1XNQ Q;  2HIX A;  3W1B A;  4DR3 L;  3M4O H;  2R92 H;  1HJP A;  3VDY A;  4QQB X;  4JYA Q;  3E9H A;  2KHI A;  1KL9 A;  4QY7 A;  1LYL A;  1K8G A;  1DGS A;  1JB7 A;  1OXS C;  2AWN A;  2JA8 G;  3ICE A;  2UXB L;  1V9P A;  4LWC A;  4YHH L;  4LF6 L;  4LFC Q;  1AH9 A;  1L2F A;  4DR5 L;  1VQ4 A;  3RNU A;  2R93 G;  5LMN L;  4BY7 G;  4IPH A;  1PH5 A;  4C2M H;  1WOC A;  5GAD C;  5IP9 G;  4GLV B;  4Y52 H;  3S2H H;  1XMQ L;  4X6A H;  1B7Y B;  1I6H H;  4A3M G;  1BKB A;  4C3I H;  2E2I H;  1G29 1;  2Q2T A;  4A3G H;  2F4V Q;  5IP7 G;  5C0X J;  3Q8D A;  1A62 A;  5LMU L;  1PA6 A;  1L0W A;  4TQU S;  1EQQ A;  1KC8 C;  2I0Q A;  1HR0 W;  1NJI C;  4LFB L;  2VQF L;  4JV5 Q;  3CD6 A;  3KDF B;  1TWA H;  2VW9 A;  4DKA C;  3TRE A;  2C35 B;  4DUZ L;  2ZM6 L;  3HOW G;  2MO1 A;  5E7N A;  2K52 A;  1VS0 A;  2BA1 A;  2PI2 E;  3BZK A;  5M3M G;  1FJG Q;  4A3C G;  2ZTD A;  4C3H H;  1UE5 A;  4O2D A;  4DR2 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...