2CWAA

Crystal structure of the single-stranded dna binding protein from thermus thermophilus hb8
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
226
structure length
206
Chain Sequence
RGLNRVFLIGALATRPDMRYTPAGLAILDLTLAGQDLLREVSWYHRVRLLGRQAEMWGDLLDQGQLVFVEGRLEYRQSELQIRADFLDPLDDRGKERAEDSRGQPRLRAALNQVFLMGNLTRDPELRYTPQGTAVARLGLAVNERERTHFVEVQAWRDLAEWAAELRKGDGLFVIGRLVNDSWTSSSGERRFQTRVEALRLERPTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-strand binding protein
publication title Crystal Structure Of The Single-stranded DNA Binding Protein From Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Dna binding protein
total genus 42
structure length 206
sequence length 226
ec nomenclature
pdb deposition date 2005-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2cwaA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2cwaA02
3CF5A 3HOVG 3RLNA 2WP8J 2N3SA 3L0OA 3GTJH 5JEAG 5FJ8G 5FJ8H 5IYCH 4OX9L 1QUQB 1E1TA 1E1OA 3G4SA 1WJJA 4R4CA 1PH4A 1K73C 4IO9A 4LUVA 2UXDL 2JA9A 2N8NA 2WAQE 2VW9A 4X6AH 4OO1I 1EWIA 1WYDA 2JA7G 2IHFA 3K7UC 2DUDA 5GAEC 1HR0W 3UDIA 1YJNA 4OX9Q 4DUZQ 1VQLA 1Q1BA 2R7ZH 1N34Q 1XMQQ 5GAHC 1YJ9A 4A3JH 1XTDA 2CWAA 2EIFA 1IBKQ 3H3VI 5C0XG 4KI0A 2FXQA 4A76A 4ALPA 1JE5A 3HFZB 2R7FA 4C3HH 4DR1Q 4C2MH 2I0QA 2UUCQ 1SLJA 1RL2A 3TEHB 2NVXH 1Y1WG 4PZ6A 3CMEA 1KHIA 2K75A 4B3SL 3ICEA 4IFDG 4DUYL 1NJIC 3MEFA 3M3YH 2XGTA 4X65Q 3RZDH 3E9IA 2E5LQ 4DV6Q 3ZJYC 1FJGL 1VQHA 1D7QA 2JJQA 1I5FA 4L5TA 4P74A 4A3BG 5M3FG 1KXLA 2WB1E 3BJUA 3CP0A 4DAYB 3PO2G 3PO2H 4DR4Q 2NN6G 4OWXB 4Y52H 2ZTCA 2N78A 5IWAL 1D8LA 2JA6H 2UXBL 1A63A 4RMFA 2HIXA 4BBRG 4YWMA 4BBRH 3OTOQ 1MJEA 4JI8L 2UU9Q 4B3SQ 4DV0Q 1VQCA 1JJCB 3T1YL 3CCQA 2UUAQ 3STBC 3W1BA 1QVGA 1PH8A 1Q1EA 4A3KH 4JI4Q 4HJ9A 5C3EG 1YEZA 3U4ZA 1X9NA 4YWKA 3PF4A 2ALYB 5LMNW 4LF8Q 4A93G 1U0LA 3H0GG 4JG2A 4C3IH 3S1RH 1PH7A 1V1QA 2ZTDA 3K81C 5IP9G 3T1HL 4MNOA 3CMAA 2ES2A 4LW1A 1KRTA 4DPGA 1OTCA 4DR3Q 3G6EA 1YIJA 3KFUA 1Q46A 1YZ6A 2V1CC 3D31A 4YWLA 4HJ8A 2KCTA 3M4PA 2ZM6Q 2K5HA 3ULPA 4X66L 4UY8C 4WJ3M 1X55A 1PH2A 3F2CA 4RG1A 3CPWA 2OTLA 1VQEA 2JA6G 2EXDA 3A5ZB 3KF8B 2JE6I 3J80c 2YYZA 4JBKA 1TWGH 1VQOA 1HR0L 1BKBA 1X6OA 4DK3C 4NPSA 4A3EG 3CCEA 1S72A 1SR3A 4JI2L 3RZOH 4DR5L 4LFBL 1PH9A 1CKNB 1IYJB 4JI3L 4BBSH 4R4QA 3U4VA 2YTVA 1N36L 2R93H 2A19A 3U50C 4C3JH 4UP8A 2CQOA 2K5VA 3H15A 2JQOA 4JI5L 4GLXA 1PYBA 3AYHB 1HNXL 3HOWG 3TS2A 2YV5A 1E24A 1UWVA 2HQLA 4JI1Q 1BBWA 1EQRA 4L5QA 3PF5A 1TWCH 1VQ4A 3UDGA 4XTCS 4GNXB 1A0IA 4JI2Q 4NXML 4A3IG 2PI2E 4DR5Q 3CCSA 2QEXA 2VUMG 4H02A 3OYYA 1XNRL 4JI5Q 3L7ZC 4GKJL 2AWNA 1WFQA 2YTXA 1UE5A 2EQSA 5AJ3L 4R4TA 3I4NH 4DV4L 4B3ML 2MO0A 3UE1A 4X62Q 2VQFQ 1K8AC 5JJIA 2WAQG 5LMNL 1ASYA 5C0XI 1ASZA 5EAYA 2ATWA 4GKKQ 1EUJA 1HNWL 2D0PA 2AHOB 3K8AA 5K36G 1EQQA 2Y0SE 1YNXA 3GTOH 4IFDI 2VY3A 5JEAJ 2LXKA 2JK8A 1X56A 1Y1VH 5IY0A 4DV7L 1N33Q 3DM3A 3HOUG 3HOUH 4NXNL 5LMNQ 3I4MG 2NN6I 1P8LA 3B6YA 1VQIA 4LUOA 1J5EL 1IBLQ 2E8GA 2AWOA 2I5HA 1XPRA 4NB3A 4YHHQ 4JBWA 2MNAA 4A3DG 2PMZE 3F2DA 2NVTH 3A0JA 4LF9Q 4BY7G 1WOCA 3PUVA 4IOCA 1HNWQ 1NTGA 2Q2IA 2WB1G 1VQBA 4GN5A 5IYDG 3EN2A 4JBMA 4R4OA 2ZTEA 3TRZA 1AE3A 5C0XJ 3J81c 5C4JH 1NY4A 1VQ9A 4JV5L 2R7DA 5IYBG 4B3TQ 3HOVH 1L1OC 1TWAH 1VCIA 2GN5A 2MQHA 2WFWA 4P75A 5E7NA 3J80i 1JJ2A 4IFDJ 4DR6L 4DR2Q 1QZHA 2Q2UA 2MFIA 1KL9A 1LUZA 2Q2HA 3PUZA 2B29A 4IPHA 4OONA 4YY3Q 4JC0A 4PZ7A 4LF5Q 1HZ9A 1PH6A 4IJLA 3J7A5 1W2BA 1PVOA 1I50H 2H5XA 3E9HA 4TVAB 4DV2L 1HZBA 3AFPA 2OWOA 2HHHL 2D62A 4GNXC 2JA7H 2F52A 4J15A 3S15H 1TXYA 1A8VA 4GN4B 3HOXG 4A3FG 3STBD 4L5RC 3PUWA 2I5MX 3GTKH 1JB7A 1RIPA 3I55A 1EOVA 1HZAA 1T9HA 2UXDQ 1GO3E 1PV4A 2KHJA 2K52A 3RR5A 3GO5A 3S16H 2KHIA 4HIDA 3S2DH 1Y1WH 3LGJA 1L1OA 2XTIA 4JI7L 1C9OA 2ASBA 2OCEA 1AE2A 1CKNA 5GROA 1TWFH 4DV5L 2F4VL 4P73A 1CSPA 1XMOL 4LFAL 3PSIA 4A3BH 5M3FH 4DV1L 3A5UA 4WJ4A 2AMCB 1EIYB 2RHQB 4Y7NH 3S1NH 4KLKA 1VQFA 4QIWE 2NVQH 4GNXA 1VQNA 1EIFA 4DUYQ 1SE8A 4DV5Q 2Q2TA 3UDXA 1FJGQ 1VQDA 2CFMA 1E22A 4LFAQ 2RF4A 1K3RA 4UPAA 2PQAB 5C3EH 1YI2A 1MKHA 2ZJQA 3FP9A 4QY7A 4GOPB 1TWHH 5IWAQ 3H0GH 2UUBL 4A93H 4LF7L 1IL2A 4LF4L 2UXBQ 1N32L 5IP9H 1I3QH 4JI8Q 4OWWB 4JI0L 3IRBA 2KENA 3DLLA 1Q8KA 3T1YQ 2IY5B 1M90C 2PNHA 3GD7A 2VNUD 1JJGA 4TQUS 1I94L 1PFSA 1PYSB 4JOIC 4PMWA 5M3MG 1B70B 4A3GG 1NMGA 5HY6A 1YBYA 1K9MC 3J81j 3UDFA 3J81i 2Y0SG 4LF7Q 1PH1A 1U5KA 3CCLA 4K0KL 3T1HQ 4DV3L 3CC2A 3S2HH 1W3SA 4OWTB 3UE0A 4A3EH 3M7NA 2CWPA 2Z6KC 3FKIG 4X66Q 4HJAA 3SGIA 4KHPL 2HT1A 3MXNB 3CCVA 4GLVB 4MZ9A 3M4OH 2CKZB 4QL5A 3RNUA 4A3DH 3HOWH 4BXXG 5C44G 4LUZA 4IOAA 1CKOA 5GQOA 4AQYL 1HR0Q 5BR8L 1O7IA 3S24A 4JOIA 5J3BA 4LFCL 1L0WA 4A3IH 2VL6A 2GVBA 1MIUA 2K50A 5M5YH 4LFBQ 4JI3Q 1N36Q 2B63G 1QUQA 1WCMG 1WCMH 4YCVA 3KJOA 1LYLA 1YITA 1GD7A 3Q8DA 2VUMH 1XPOA 2BA1A 4X64L 1HNXQ 3PO3G 3PUYA 2JA5G 1GVPA 1WI5A 2MO1A 4LF6L 4YCWA 4NXMQ 2Z6KA 1SRUA 4R1JA 1KD1C 1X65A 3U58A 5GADC 1XNQL 1QZGA 3FHWA 1XNRQ 4UP9A 2NZOA 4DK6C 1JT8A 2CCZA 1PH3A 4GKJQ 3I4OA 4GOPC 1AH9A 4DKAC 2RCNA 2ZJPA 4A75A 3GTMH 3WWVA 4JBJA 3ULLA 5AJ3Q 4DV4Q 4B3MQ 5IP7G 5IP7H 1OXTA 1HZCA 1FGUA 3BZCA 3BU2A 5IT9c 3BZKA 5LMUL 1SFOH 3I4MH 4QQBX 1G6PA 3PUXA 1VQ8A 4QJFA 4AH6A 4P72A 4JI6L 3CW2C 1VQ6A 1OXSC 1LTLA 3JC66 2DGYA 4BY7H 1MJCA 2C35B 1E3PA 3G71A 4DV7Q 1K0RA 3KDFB 5IYDH 3JAMi 4NXNQ 1UE7A 4B3RL 1J5EQ 4IPDA 3F1ZA 1GKHA 1OXXK 5IYBH 3HOZG 2VS1A 1K83H 1CKMA 4GOPA 3NEMA 1CUKA 1Z9FA 1VQKA 2E2HH 1IBML 3K7AH 4HJ5A 2RHSB 5JJLA 3I7FA 2E2IH 3S17H 4JV5Q 3TREA 1B7YB 3CD6A 4A3CG 3RLOA 3CCMA 4PZ8A 1KC8C 4DR6Q 3OW2A 3HOXH 3F2BA 1I6HH 3TS0A 4A3FH 3HOYG 3A74A 1EFWA 4IJHA 1IBMQ 1Q7YC 3CQZH 5FLXc 2QA4A 4DV2Q 1Q82C 5IYCG 3S1MH 2HHHQ 1BVSA 4XIGS 3CXCA 1X3FA 4DUZL 2JA8G 2JA8H 2VZAA 4BA2I 3M9BA 1PA6A 1XMQL 1N34L 4R4IA 1VQMA 3CCUA 2HIVA 3NBHB 1IBKL 1VQGA 2PI2A 3W5OA 4LWCA 2K5NA 4DR1L 2IX0A 3K0XA 1V43A 2UUCL 4O0AA 1CSQA 2R92G 2R92H 2AKWB 1BBUA 3CC4A 1NBWA 3KF6B 4X65L 3S1QH 1P16A 3HKZE 4DV6L 1UE6A 4ME3A 1XPUA 4JI7Q 3M85A 2R7ZG 1YHAA 3M4QA 4A3JG 3PIOA 2OQKA 2F4VQ 3J7ZC 3PV0A 4DR4L 1XMOQ 4FDBA 1IXRA 1L2FA 1FL0A 1X3EA 2R6GA 2UU9L 5FLMG 5FLMH 3OTOL 4DV1Q 3GTPH 3GTQH 4GN3B 4JYAQ 4DV0L 2GVAA 2UUAL 4GLAC 2IHEA 1IZ6A 5HGQA 2KBNA 4JI4L 2F3IA 4HIMA 2BH2A 2A8VA 4EQ5A 1S3OA 4LF8L 2YTYA 1OXVA 5M3MH 3JAMc 3L2PA 1K8GA 4A3GH 5M5XH 1X3GA 1OXUA 3AQQA 5IE8A 1M1KC 5M5WH 2JEAI 1N8RC 2B3GA 4DR3L 2UUBQ 4LF4Q 4UP7A 1N32Q 2ZM6L 2A1AA 1YVCA 1Q12A 1EYGA 1SN8A 2N49A 2QGQA 3KYHC 4A3KG 4AYBG 2LSSA 4JI0Q 3PGZA 3CCJA 2UXCL 1Z47A 2YU9H 1R9TH 1I94Q 2ZJRA 3HKSA 2K14A 3FKIH 4PG3A 1PH5A 4HIOA 3NELA 1C7YA 1JMCA 1HNZL 1NE3A 1VQAA 2D0OA 3I56A 4BXXH 3KDFA 5C44H 4K0KQ 5JJKA 4DV3Q 5GAGC 4DNIA 2UXCQ 1KRSA 4MTNA 3TQYA 1YHQA 3EBEA 4JYAL 4OO1G 3CAMA 4KHPQ 1YHBA 4APVA 2NVYH 2B63H 1HNZQ 4A3CH 1C0AA 4EX5A 4A3LG 4A3LH 4JI1L 3PO3H 1SROA 1E7ZA 2E2JH 2JA5H 1YJWA 4AQYQ 1L1OB 4POFA 5DLQE 3H3VH 3F8TA 5BR8Q 4BBSG 4JCVE 5C4XH 2R93G 5C4XG 1N9WA 1X54A 4OXPA 4LFCQ 4AIMA 3GTGH 3GTLH 1HJPA 1G291 1LM0A 1A62A 3KJPA 1VQ5A 3G48A 1VQPA 2I5LX 5H1SE 1PHJA 2Z0SA 4X64Q 1XJVA 1VS0A 2VQFL 4X62L 2OTJA 4IPGA 3NENA 2IT1A 4AYBE 1KAWA 2BH8A 4LF6Q 4LNQA 3S14H 4GKKL 1J6QA 4DAMA 3GDEA 4QGUA 1UE1A 3VDYA 4L5SA 3ERSX 4GS3A 1XNQQ 2L15A 4O2DA 3PCOB 2IX1A 1GM5A 2KCMA 3K80C 1H95A 5ELOA 3I4NG 1N33L 2VQEL 1FVIA 4IPCA 3CPFA 3E0EA 3EIVA 2OQ0A 3CCRA 1NMFA 3KF6A 3ULJA 2NZHA 1IBLL 4HJ7A 1V9PA 3RN2A 4YHHL 5LMUQ 3RN5A 4A3MG 4A3MH 3HKZG 3KLWA 4LF9L 1QVFA 3W1GA 3HOZH 2LXJA 2PQAA 1Y1VG 2K4KA 1G51A 3KOJA 4P71A 4HIKA 1S40A 2VQEQ 1VQ7A 4JI6Q 4DR7L 4YCUA 1UEBA 3PIPA 1SMXA 3I2ZA 2ID0A 3AEVA 1QVCA 1KIXA 2BA0A 3AFQA 1Q81C 4B3TL 4B3RQ 2E5LL 3ER0A 1Y14B 3RLFA 1DGSA 1VQJA 1B8AA 4BA1I 4KHZA 4DR2L 4YY3L 3D0FA 1HH2P 5ELNA 4LF5L 4DR7Q 3CC7A 1Q86C 4BY1G 4BY1H 4POGA 3HOYH 2JEBI 4A4IA 1KQSA
chains in the Genus database with same CATH superfamily
3HEJA 3CF5A 3A8KE 3RLNA 2WAQB 3A54A 3GTJH 5JEAG 5FJ8G 5IYCH 1E1OA 1PH4A 2JN4A 4KY7A 3WOFA 2WAQE 5CMDA 3TP5A 3NP8A 4OO1I 3E6ZX 1M4VA 1AEXA 3NSWA 2DUDA 3I4MB 2KA7A 3UDIA 2HQEA 3CRLC 3SHLA 3DEOA 4OX9Q 1PTOH 1XMQQ 5JVH3 2CWAA 1GUGA 4ALPA 3IKJA 4C3HH 4DR1Q 2WV6D 3TEHB 1MI2A 4PZ6A 1J9OA 1X3QA 3ICEA 1NJIC 3E9IA 1BOSA 3ZJYC 1VQHA 3HOVB 1ENFA 2TMPA 4Y52H 2NN6G 4OWXB 1TT2A 1D8LA 1A63A 4BBRG 2UU9Q 3OTOQ 1TS3A 4B3SQ 1JJCB 2EYOA 3T1YL 3HG9A 3S17B 4WORA 1A3UA 4KMUC 1QVGA 1Q1EA 1CI3M 2JA7B 3U4ZA 5BN3A 4YWKA 2MGSA 1EZ8A 1F2MA 1FR3A 4CGYB 4LK1C 4C3IH 1Q3LA 4NP5A 3SK6A 5IP9G 1CZWA 1PH7A 4MNOA 1KRTA 1OTCA 2K6AA 1YIJA 4IUPA 2KCTA 3M4PA 2ZM6Q 2K5HA 3S1MB 2K04A 3ULPA 4WJ3M 4IURA 4RG1A 5FLXE 2OTLA 4KJNA 3VYRA 2SEBD 2JE6I 3BVZA 1UEAB 2L5TA 1S72A 4JI3L 4IUUA 2YTVA 2R93H 2A19A 4CJ0B 3U50C 1LTGD 3QR8A 4GLXA 2JQOA 1PYBA 3MTSA 2EOTA 1UWVA 2HQLA 4JI1Q 1KDAA 4WRDA 1BBWA 5TSSA 2EY1A 1JR0D 2JA6G 4JI2Q 1BCPC 2L12A 4DR5Q 1A15A 4HCSA 1TIID 2KEEA 4JVZA 3ERQA 4I7ZC 4K8JA 1JOOA 3R3OA 2AWNA 5M5XB 2YTXA 4B08A 5I6YA 2Y0SB 2DNEA 3I4NH 1WVLA 2MO0A 3NXWA 3UE1A 4X62Q 1AZPA 3JAME 3P20A 5D65A 1R9TB 2AHOB 3K8AA 1GXDC 1EWHA 1U4MA 2Y0SE 5J1ZA 3GTOH 5T1IA 5JEAJ 1JCKB 4XQNA 1LTBD 3HOUG 5E4XA 3E3XA 1RODA 4YHHQ 1Y8OB 3F2DA 1JC7A 4V190 3A0JA 4BY7G 4RA8A 2Q2IA 5IYDG 4GN5A 1AE3A 1ZXTA 2DJGC 1VQ9A 3TBIB 2R7DA 3HZXA 4P2CB 2EY2A 3HOVH 4P75A 1LTAD 5FO8B 1JOKA 1PFNA 2Q2HA 1LUZA 3PUZA 1MGSA 1T5XD 4JC0A 3J7A5 1PVOA 4CJ2C 2NB0A 3E9HA 3TZDA 5C4HA 2OWOA 2PQEA 4GNXC 2JA7H 2PZTA 4KK7A 2I5MX 1RIPA 1HZAA 1T9HA 2BE5D 2UXDQ 1GO3E 3Q6SA 3RR5A 1CZGA 3LGJA 1L1OA 2HCIA 1KAAA 5E1FA 4DV5L 2F4VL 2KUMA 1NUCA 4HMJA 3A5UA 2RHQB 2JSOA 2WINB 5JVG3 1HTPA 1EIFA 3KLSA 1B53A 5DEHA 3UDXA 1LLRD 3VR5A 4FNFA 3EVQA 4LFAQ 4ABNA 1YI2A 4UPAA 4EQOA 4X3UA 1LO5D 1I6HB 2UXBQ 1IL2A 1RD9D 3ONAB 4UAIA 2JYOA 2B2VC 1I3QH 4JI8Q 3BYTB 4OWWB 3IRBA 5HURA 1M90C 1L0XB 4DF7A 3DMUA 4TQUS 4JOIC 2F0PA 1I4XA 2PO4A 5DM63 1YBYA 3UDFA 4LF7Q 3J7AV 1U5KA 5KRUA 4N9PA 5K5PA 4K5WA 5ISRA 2CWPA 4UDUC 5CBEE 2Z6KC 3FKIG 2R7ZB 5ELDA 3MXNB 3CCVA 1PZKD 4GLVB 1GOZA 1TKWB 1SYDA 5C44G 2VXWA 1PXUA 1RF2D 1WTHA 3AMUA 5J3BA 2XRQD 1EY7A 1L0WA 2VL6A 4FXDA 1MIUA 3URYA 4A3CG 2VUMH 3Q8DA 5ELCA 1H9JA 1BR9A 5KNCA 2F3VA 4LF6L 4YCWA 1PRTD 5GADC 1XNQL 1JE4A 1C48A 3I8ZA 4UP9A 1PH3A 1AH9A 4MHEA 3GTMH 3WWVA 1ESFA 5IP7G 1HZCA 1V1PB 5LMUL 3BZKA 2KVMA 3QOLA 3PUXA 1EWCA 5CV9A 4AH6A 1VQ6A 4PNYA 1LTLA 2EPBA 1F2YA 3PO3B 2F4IA 1E3PA 1ICWA 3QIAA 1K0RA 3KDFB 5KEEA 4DV7Q 4NXNQ 5C6AA 4LAAA 4LMQD 3BDOA 5C4XB 4JPBW 3HOZG 2VS1A 4IN3A 3GTLB 1SXTA 1Q90A 4N9TA 4GOPA 1Z9FA 5EPKA 5FO7B 4HJ5A 4RGNA 5BN4A 3A7AB 1B7YB 3TDQA 4EGVA 3NTKA 1MBYA 1KC8C 3CCMA 4EQNA 4DR6Q 1STNA 3HOXH 3F2BA 1I6HH 5CV5A 4A3FH 3A74A 1ML0D 1QILA 1Q7YC 2B2TA 1H9MA 5FLXc 2QA4A 3H6MA 5IYCG 2HHHQ 1X3FA 1VDZA 2VZAA 3M9BA 1STYA 1XMQL 4R4IA 4IQZA 1VQGA 2B2WA 4DR1L 1SE2A 1F9QA 2K1BA 1EY4A 2MUYA 2KCNA 2OQKA 2K03A 4X3TA 4C3HG 2UU9L 3OTOL 5CC4A 5IGFA 3OPOA 2QDBA 1IZ6A 2KBNA 1F2ZA 4PMCA 2RSNA 3H3VC 2K32A 1U9RA 2YTYA 1K8GA 2PZWA 4IUTA 3JAMc 1OXUA 1CQVA 3AQQA 1M1KC 2E76C 2KHSA 2UUBQ 2F0UA 4CDCC 2ZM6L 2A1AA 1SN8A 2QGQA 4XYQA 4N8FA 3HKSA 2K14A 2RDHA 3KUPA 3NELA 4J8QA 1NE3A 1VQAA 5JPNC 4BXXH 5FLXL 4DV3Q 3S2DB 1Y1WB 2F0VA 2F0MA 4DNIA 2EYPA 1KRSA 3TQYA 3EBEA 3CAMA 5M3FB 4APVA 2B63H 1C0AA 5CV4A 4EX5A 4Y7NB 4A3LG 5C5LA 4JI1L 3PO3H 1E7ZA 4PMBA 1YJWA 4AQYQ 1STAA 1L1OB 4POFA 2LMCB 2R93G 5C4XH 2NYZD 3VR2A 3SK5A 1STHA 3GTGH 3GV3A 2F0SA 3GTLH 1A62A 4NMZA 2I5LX 5H1SE 4A93B 1DXMA 4X64Q 1CA6A 3S1RB 1VS0A 4X62L 3V96A 4UHVA 1KAWA 2BH8A 3K5LA 3TN2A 3S14H 3M7GA 3EFXD 1A6XA 4QGUA 1B9NA 3NBHA 3ERSX 2BDOA 3JAML 3K80C 1UNSA 2SNMA 5G3LD 3I4NG 3J7AF 3CPFA 2N88A 1DCZA 3EIVA 3A56A 3E0EA 3CCRA 1NMFA 3KF6A 4I65A 2NZHA 1CA5A 1V9PA 4YHHL 3RN5A 2D2CC 2OT2A 4CKBA 4A3MG 3KLWA 1EY8A 1D1IA 3W1GA 2PQAA 2K4KA 1S40A 4JI6Q 3KOJA 3S9WA 1SMXA 4PQXA 4DXFA 3F2UA 1HTLD 4B3RQ 2RSOA 1DGSA 2VB2X 4KHZA 1F9RA 2WACA 3CKIB 3K59A 1F2LA 4NKLA 4RFBA 4BY1G 3HOYH 1D5XC 3HOVG 2B2UA 2WP8J 3L0OA 1EEID 3FVQA 4NW2A 2RDGA 1E1TA 3DWPA 3G4SA 1HPCA 4R4CA 1K73C 4S3SA 4IO9A 4LUVA 2UXDL 2JA9A 2EZVA 1QCBD 2B2YA 3HP3A 2JA7G 2IHFA 2VB3X 3OSOA 1YJ9A 1F9PA 1LV9A 1EEFD 4WJWA 1XTDA 2EIFA 5IT9E 1IBKQ 4KI0A 2FXQA 4A76A 1WTPA 5DAUA 3X3NA 1RL2A 1KHIA 3P7JA 3NWSA 4DV6Q 3SK8A 1TWAB 1A3TA 2I07B 3VYUA 3Q24A 3PO2G 3HGBA 4CDDC 4DR4Q 2N78A 2UXBL 2E2HB 4YWMA 1O78A 4JI8L 3NQIA 4HAEA 4O42A 4DV0Q 3STBC 1YEZA 2ALYB 4ZRZA 3OMCA 3TZUA 1LT6D 4JG2A 3S1RH 4FP5D 1V1QA 2ZTDA 2ES2A 4DPGA 3G6EA 3BG3A 1YZ6A 4YWLA 4ZK9B 5EJWA 1R4PB 1VMCA 4UY8C 1X55A 1JB3A 4F7XA 3F2CA 1F77A 3CPWA 2DNCA 3D4DA 4OO1H 3IAYA 3R2TA 3X3MA 3A5ZB 3KF8B 4JBKA 1PRTB 1AW7A 4NPSA 1SR3A 2RKSA 4FF3A 5C3WA 3RZOH 1CKNB 1IYJB 1HCZA 4R4QA 5D3DA 4C3JG 4UP8A 4JI5L 2K28A 5C3EB 2YV5A 1E24A 2MJ8A 3H0GB 1EQRA 4L5QA 3UDGA 4XTCS 4GNXB 2F03A 3OIPA 3CCSA 2VUMG 3OYYA 3L7ZC 4A3GB 2FMMA 1ESRA 4ZCKA 5LMNL 1K3BC 5C0XI 4XT1B 5EGTA 5EAYA 1ASZA 4GKKQ 2D0PA 1PRTF 4K5XA 1YNXA 4IFDI 4KJOA 4QF4A 3HOWB 4DV7L 2N55A 1Z7TA 1STGA 4NXNL 3T51B 1VF5C 3B6YA 4NB3A 1GJXA 2M2LA 3TP7A 5IODA 1WOCA 4B9WA 2WB1G 2DY7A 4JBMA 1XWEA 1TS4A 1NCVA 3K5MA 4G4KA 1EU3A 1L1OC 1TWAH 1JJ2A 3J80i 1B9MA 4DR6L 4DA2A 4DR2Q 4YY3Q 4IPHA 4DGZA 4PZ7A 4LF5Q 1PH6A 1W2BA 4RCNA 2H5XA 4TVAB 1LT5D 3W2DA 1HZBA 2HHHL 2D62A 2EE1A 3A7LA 2NTTA 4J15A 3DWQA 1SFOB 1S5BD 4ZAIA 1I4PA 1O7LA 3HOXG 3EJIA 4A3FG 5A2QE 3STBD 3SXHA 1XTCD 4H13C 1JB7A 1QE6A 3IFTA 4K6LA 3PIO3 2X6LA 3GO5A 3GP7A 3V2TA 3E0JA 2IJ0A 2ASBA 1AE2A 3SVMA 1MD2D 2E75C 4QIWB 4ULLA 5KNBA 1NR2A 3Q0AA 1G6ZA 2LY7A 1D5ZC 3PSIA 3DXJC 4A3BH 2AMCB 1VQFA 4FO2A 4QIWE 1VQNA 4DK0A 2A6EC 4TSSA 1V8QA 4H0LC 1IKMA 1FJGQ 1VQDA 1E22A 1K3RA 2PQAB 5C3EH 5ELEA 2BE5C 3FP9A 4QY7A 4HCEA 4N8X1 2UUBL 5IWAQ 3H0GH 1JWMD 4XYOA 3BVGA 4GZYC 3CQZB 2A68D 4TKOB 4KN4C 3GD7A 1PYSB 2XWJB 4PMWA 2JA8B 1B70B 4KV6A 4RH6A 2QF7A 5HY6A 5EKIA 1ZEQX 3J81j 1K9MC 3J81i 2F0LA 2HDLA 2XWBB 2A6HD 2EYHA 1M8AA 4DV3L 3T1HQ 2KOLA 2R92B 4RGTA 1W3SA 4A3EH 1G2SA 1KNEA 4U673 2PCFB 4X66Q 3SGIA 2HT1A 4A3JB 2CKZB 3E5SA 4QL5A 3RNUA 3HOWH 4BXXG 3FMCA 4LUZA 1EY5A 4IOAA 5GQOA 2L9HA 3T4AC 4AQYL 1HR0Q 3GTQB 3KBGA 2CW0C 3M3YB 4A3IH 1PMRA 2GVBA 1H9RA 4K2KA 1A2UA 2B63G 1QUQA 1WCMG 3KJOA 1LYLA 1YITA 3PO3G 1XPOA 2BA1A 4X64L 1GVPA 1K8MA 2LKVA 1LTRD 2RVLA 4FXKC 4NXMQ 1SRUA 3V05A 2ENBA 1KD1C 4XQJA 3MEHA 5EBCA 1XNRQ 1EOTA 2RCFA 5K36H 4DK6C 4IALA 4GKJQ 2O5IC 4GOPC 1SYEA 4A75A 4JBJA 3ULLA 5AJ3Q 3VA5A 2SOBA 1LTSD 4DV4Q 1JWUD 1FGUA 3BZCA 1H9KA 1NAPA 3BU2A 5IT9c 1SFOH 3I4MH 1G6PA 1QG7A 1VQ8A 3QWNA 2JP1A 4P72A 4JI6L 3CW2C 1OXSC 1KLUD 2DGYA 1MJCA 1SNMA 3I73A 1PRTC 3VR3A 2B2TC 4B3RL 3J80E 3PMFA 4BBSB 3F1ZA 1MHWC 4CKEA 1OXXK 3A55A 5IYBH 3DM1A 2CHBD 5LL6X 1SJHD 1TQOA 2F1MA 2KQ3A 2B2WC 5CYUA 4CHTB 5KYIA 1GUOA 1NR4A 1L0YB 4ZUJA 5HGTA 3S17H 4JV5Q 2C9OA 4RAUC 2A6ED 5DM73 3MA2B 3HOYG 3QO2A 1IBMQ 3CQZH 2F0EA 4XT3B 5EBDA 5ELBA 1E2VA 4IUVA 4U68A 1UAPA 1KNAA 3S1MH 3CXCA 2JA8H 1OO9B 1VQMA 1IBKL 2PI2A 2A73B 5I2XA 2IX0A 3K0XA 1V43A 1ONLA 1CSQA 2R92H 2AKWB 3UI2A 3T56B 1P16A 3HKZE 5IT9L 2J7ZA 3NK9A 4DV6L 1XPUA 4BWGB 3PIOA 3PV0A 4DR4L 2WKDA 1XMOQ 1LABA 1FL0A 1X3EA 5I4DA 5FLMG 4DV1Q 4KD3A 1TS5A 3GTQH 5EQ0A 4DV0L 3C2PA 1EY0A 4RHRA 5C4JB 1HHVA 4QUFA 2EJGC 2IX3A 1HQRD 2F3IA 4KTAA 3TMEA 2HD3A 2BH2A 1DYQA 3TP6A 4LJZC 1S3OA 3J81E 5KGUA 2CW0D 3L2PA 5M5XH 5IE8A 2B3GA 2PW7A 4UP7A 4C1NK 1EYGA 1YVCA 1N32Q 3KYHC 2B8GA 2UXCL 1ILPA 4TRDA 1R9TH 2ZJRA 2NZ1D 1I94Q 1FNUA 2J0TD 3I3CA 3GTKB 1G2TA 4K0KQ 4C1NI 2Q8RE 1YNJC 5AFWA 1YHQA 4OO1G 1XX8A 4KHPQ 1HNZQ 1T5EA 3NWTA 1SYBA 1CQFA 1SROA 3KLSX 2NVQB 4BBRB 3ND8A 2R3ZA 5CV6A 2RA4A 3H3VH 5BR8Q 2OXPA 1RJTA 2FJ2A 4A3KB 3VR6A 1GUWA 3OMGA 1G291 5E3FA 1HA5A 4KKUA 4HSVA 1PHJA 1TWHB 1SYCA 5FKAC 2MHVA 3VA7A 2OTJA 1BDOA 1NSNS 1HFNA 4R8IA 1O80A 3NE5B 5IGCA 4GKKL 5ELFA 4L5SA 4G57A 1I4GA 1D6EC 2IX1A 1GM5A 4CBVA 3A8IE 3FEWX 4IPCA 2EJFC 4J1MA 2MP1A 3S2HB 4K2LA 1WTOA 3R93A 4HJ7A 4DU9A 4OIKA 4HSPA 4PV1C 2B2UC 3U9OA 3DEPA 2LXJA 1VQ7A 2IWHA 4R8NA 2VQEQ 4DR7L 1UEBA 1IYUA 3PIPA 3Q22A 2CVRA 5IOCA 3AEVA 1QVCA 1RHPA 2B2YC 2JA6B 2XRSD 3AFQA 4KKTA 3RMHA 1SSOA 2Z4IA 3RLFA 5M5YB 4BA1I 1RTOA 4DR2L 2AUKA 4YY3L 3D0FA 2AQ2B 1EQTA 4J6HA 4LF5L 1AP0A 2FINB 1Y8NB 5LHY1 1Q12A 4A4IA 1QWYA 2DN8A 4ODGA 2N3SA 1BNZA 4DNTB 5FJ8H 4OX9L 1QUQB 1WJJA 4C56C 3GQBA 1STEA 2VW9A 2N8NA 4X6AH 4QB4A 1HRJA 1EWIA 1WYDA 3K7UC 5A2QL 3HOUB 1SYGA 1YJNA 1EY6A 2R7ZH 1HUMA 4ME5A 1N34Q 3MFYA 1E2WA 3H3VI 1LTTD 4BY7B 2R7FA 2QCPX 2I0QA 4HEDA 1SLJA 1IKLA 1CHQD 3MFGA 4L6TB 3CMEA 2K75A 4B3SL 5E4WC 3MEFA 2XGTA 1FJGL 5IGGA 2EYLA 1I5FA 4P74A 4A3BG 1TU2B 3BJUA 1KXLA 1YNJD 2ZTCA 5IWAL 1S5CD 4OIJA 4BBRH 4FF4A 1MSGA 1LT4D 1H9SA 1I50B 2E2IB 3CCQA 3I72A 4RKBA 1PH8A 3SEBA 4A3KH 4JI4Q 1ZYRC 2A5HA 5C3EG 1FNWA 3PF4A 5LMNW 4LF8Q 3H0GG 4C3IG 3BS1A 3T1HL 3M7NA 3KFUA 3EA6A 3QOJA 3D31A 3A8JE 1DM0B 1XXGA 3S16B 2P5ZX 4X66L 4Z9CB 1PH2A 1TWFB 3W3AA 3J80c 2YYZA 1VQOA 1HR0L 3S1NB 3J7YW 5KIXA 4A3EG 2F0HA 4JI2L 4DR5L 1PH9A 1EY9A 1B50A 3U4VA 3NHHA 1U4PA 4JYAQ 2K5VA 3HOWG 3AYHB 4CDEC 3TS2A 1HFGA 2NBFA 3Q23A 1I4RA 2VNUD 3H94A 3PF5A 1VQ4A 4NXML 2JA6H 1A0IA 4A3IG 2PI2E 5JOBA 1GUTA 2QEXA 1XNRL 1PLFA 4GKJL 2EQSA 2NUCA 5AJ3L 4IUQA 4DV4L 3FRPB 1K8AC 4DNRB 2WAQG 2O5JC 1EZ6A 1ILQA 3FKIB 5K36G 3NPPA 3M4OB 1SBBB 2LXKA 1X56A 4A3DB 1TR5A 1N33Q 2Z4HA 3DM3A 3HOUH 1S4ZA 5NUCA 1SDFA 5A35A 3I4MG 2NN6I 1IHZA 1P8LA 4LUOA 5C3XA 2LS01 2E8GA 2I5HA 2K01A 1XPRA 2MNAA 1DOMA 2XVSA 2QW7A 2NVYB 3CU7A 4M1UB 4LF9Q 3D8GA 4IOCA 5L37A 1NTGA 5C4ZA 3EN2A 2E2JB 1UUPA 3EROA 3J81c 4JV5L 4B9XA 5IYBG 4B3TQ 2L4NA 2GN5A 4HTHA 2RQXA 2MFIA 1KL9A 2B29A 1LACA 1EYDA 1HZ9A 4IJLA 1I50H 2ICIA 1TXYA 1A8VA 2BDNA 4GN4B 4ZKBB 4L5RC 1AN8A 2XSCA 3I90A 1ZYRD 1EOVA 5C0XH 4R9WA 3SK4A 1V1OA 3S16H 2KHIA 1B4OA 1Y1WH 3S2DH 2XTIA 2OCEA 2L11A 4IFDH 1TWFH 5CORA 2WKCA 2KCCA 1XMOL 4LFAL 3HOZB 1K83B 5M3FH 4DV1L 5IGEA 1EIYB 4Y7NH 3S1NH 4KLKA 3K7AB 4DUYQ 2CH4W 2D9UA 3LX0A 4DV5Q 2CFMA 2F0NA 1MKHA 4GOPB 4F88A 1J8IA 3NTIA 5J22A 4A93H 4LF7L 1N32L 1W6KA 4I7AA 3D6CA 2KENA 1C8CA 1Q8KA 2PNHA 1I94L 2V4DA 4H44C 2G9HD 1MSHA 2Y0SG 2H1EA 1PH1A 3CCLA 4K0KL 1PZJD 1TY0A 2PYKA 4OWTB 3UE0A 1GUSA 5FK9C 4KHPL 2ZXPA 1WTQA 4MZ9A 2EYFA 3M4OH 2L55A 5IIFA 4A3DH 2K7VA 3T13A 4C3HB 2A68C 3GTPB 1CKOA 3BYYB 1DZ1A 1Y69U 5BR8L 4L63B 1O7IA 3S24A 4LFBQ 3N52A 1EU4A 1N36Q 3C3LA 4YCVA 2A6HC 1K8OA 1GD7A 2E2DC 3MHBA 1HNXQ 5M3MB 2MO1A 2EY5A 1SNQA 4R1JA 1X65A 3U58A 2J4XA 1G91A 2YU9B 1TY2A 3FHWA 2F3WA 2O4XA 4G7ZC 2NZOA 4FYDA 3RUZA 2CCZA 3ZYYX 4DKAC 2A69D 2RCNA 2ZJPA 4WFN3 4QMGA 4B3MQ 3NTHA 1OXTA 5IP7H 2BOSA 2G9DA 4QJFA 4F8MA 1LTID 4DAYA 3OHXC 3JC66 5BN5A 5CGKA 3BDLA 1NNXA 1U4RA 2JA5B 3JAMi 1SNDA 1J5EQ 4IPDA 3N6RA 5EPJA 1GKHA 3FPUB 1K83H 1X3PA 5D14A 5EKLA 1CUKA 3QG1A 2E2HH 2A74C 3K7AH 5COYA 5JJLA 3I7FA 4F87A 1FD7D 4PZ8A 3OW2A 2F0FA 3TS0A 5JPMC 1CT1D 2F0OA 2QDLA 1SEBD 4DV2Q 4MN3A 3TSSA 1GHKA 1I4QA 1BVSA 4BA2I 1N34L 1PA6A 3MXNA 3CCUA 3MVVA 3NBHB 4A3MB 3GTOB 1SJED 4LWCA 3I70A 4RGOS 4O0AA 2O2LD 3CC4A 1KLGD 3I91A 3KF6B 2R7ZG 1UE6A 4ME3A 4JI7Q 3M85A 4M8AA 1U4LA 3M4QA 4O1NA 3J7ZC 4FDBA 3OWFA 1Y8PB 3GTPH 4GN3B 2NTSA 3KLRA 4RWSC 4BY1B 1S5ED 2IPKD 1AFPA 3ITPA 4JI4L 4MTKA 1R4QB 3HRZC 2RBMA 2A8VA 4ZUIA 4LF8L 3C1EA 5M3MH 5LL6S 4A3GH 1DD2A 3BVMA 4BS9A 2JEAI 1N8RC 4K8IA 4LF4Q 1V1PA 1B3AA 2N49A 4HR7B 4A3KG 4JI0Q 3ND9A 2YU9H 4PG3A 4E6IA 4DFAA 3P1HA 1ENCA 5CV8A 2D0OA 4ID6A 3I56A 4C2MB 1RCVD 3KDFA 2F0TA 2NVXB 1BO0A 1YNND 1O7YA 1VF7A 2Z9HA 4MTNA 4X3KA 2AQ3B 3VYSA 4JK1C 3RZDB 2M9VA 3OIQA 4JYAL 1JQYD 1SNPA 1XYIA 3PO2B 1RDPD 4A3LH 1W6JA 2OEOA 5IGDA 2JA5H 2B8FA 2F0DA 4G7HC 1TS2A 1HQMC 5C4XG 1N9WA 4QUCA 4XDXA 4LFCQ 4AIMA 1HJPA 4AYBB 4KHVA 3KJPA 1BBXC 2L1BA 5EKKA 1I3QB 2IT1A 2Z6BA 1BQQT 4AYBE 4LNQA 4NDXA 1QNUA 2SDFA 4RKLA 4DAMA 3VDYA 2L15A 3O13A 4O2DA 3PIP3 4XXEA 5ELOA 4RGMA 1N33L 1TWGB 4OEMB 5G3LF 1JORA 1GHJA 2OQ0A 1WTRA 4H7BA 2MPMA 2EXZA 3RN2A 2KEDA 4FXGC 2QKIC 4A3MH 2K33A 4LF9L 1CHPD 1A2TA 4C3JB 1PTOC 4P71A 1RTNA 4EQPA 4HIKA 4YCUA 5F2DA 2EYMA 1KIXA 1TWCB 1X32A 2BA0A 4FF1A 4B3TL 2IW3A 1Y14B 1VQJA 3BZDB 1QB5D 2CQAA 2I46A 3FDTA 2VUMB 2Q8TA 1HH2P 2WIIB 5ELNA 4DN4M 3H91A 1Q86C 4BY1H 2JEBI 1PFMA 1Q8IA 3SDZA 1KQSA 2B39A 4OELB 1ICFB 2X69A 2HDMA 5JAVA 4HN7A 3HKZB 4HMIA 3GTMB 3T16A 1HXYD 1Y1VB 4X3SA 1B2TA 5GAEC 1HR0W 3MAQA 4DUZQ 1VQLA 1Q1BA 3D4RA 5GAHC 4A3JH 2NWGA 2CH4A 1II3A 3VR4A 5C0XG 3K57A 2NVTB 1JE5A 3HFZB 4C2MH 2UUCQ 2WB1B 2NVXH 1A3VA 1Y1WG 1QJOA 4IFDG 4RCOA 4DUYL 2C5CA 3K6OA 3M3YH 4X65Q 3RZDH 1D7QA 2JJQA 4L5TA 5M3FG 2WB1E 3CP0A 4DAYB 3PO2H 2K05A 2GA4B 1SE3A 2LFNA 1QNKA 4K5VA 4RMFA 2HIXA 2HCCA 1MJEA 1DONA 2XIWA 1VQCA 4ILWA 4ZYSA 2SNSA 3L3OC 2UUAQ 3W1BA 4DK1A 4HJ9A 1KABA 3S15B 2EYJA 3G7LA 1X9NA 2PNRC 4ZLTF 3HOXB 4A93G 1U0LA 4A3FB 5CV7A 3K81C 3K5OA 3CMAA 4LW1A 4DR3Q 1O7ZA 1EL0A 1Q46A 2V1CC 4HJ8A 1E0BA 1STBA 1EFID 1I6VC 1ET9A 3KK7A 1BCPD 1VQEA 3LWUA 5I9OA 3MWYW 2EXDA 4KY5A 1TWGH 1K28A 5C5MA 1BKBA 1PDQA 1X6OA 4DK3C 2AUJD 3CCEA 1S5FD 2L0CA 4LFBL 3G6JB 3OW7A 4BBSH 1N36L 4C3JH 3H15A 4K14A 2CQOA 1AZQA 4A3DG 1HNXL 1DOLA 2F0JA 3DHQA 3FPPA 1TWCH 1PTOD 3D4WA 2XN9C 4H02A 4JI5Q 4ZQ3A 1WFQA 1UE5A 4KKSA 5KYLA 1SE4A 4R4TA 4B3ML 3LWEA 3MXPA 2VQFQ 5JJIA 3KBXA 1ASYA 3K0YA 2ATWA 1EUJA 1BXTA 1Z6HA 1EQQA 1JOQA 2VY3A 2JK8A 1Y1VH 1KDBA 2PMZB 5IY0A 3PQIA 2EVBA 3CRKC 5LMNQ 3EQLC 2AQ1B 1PYWD 3P75A 1VQIA 1J5EL 1IBLQ 5FOBB 5I9PA 2AWOA 4JBWA 2PMZE 5IGBA 2NVTH 2B63B 1WCMB 1FGBD 3PUVA 1HNWQ 1TVXA 4CDFC 3TRZA 1VQBA 4R4OA 2ZTEA 5C0XJ 5C4JH 1NY4A 1QOHA 2E5LQ 3GTGB 1VCIA 2TSSA 2MQHA 2WFWA 5E7NA 3VYTA 4IFDJ 5JEAH 1QZHA 2Q2UA 4OONA 3OOCA 3IL8A 2K5DA 3GV6A 5JJZA 1EIGA 1S5DD 3MZ5A 4DV2L 3S14B 3AFPA 4G7OC 2F52A 3S15H 2FHTA 2ICEC 2H4OA 2EJMA 3M4YA 3PUWA 3KF8A 3GTKH 3I55A 1B44D 1PV4A 2KHJA 2K52A 4HIDA 4JI7L 1C9OA 1CKNA 5GROA 1FNVA 5KNDA 4P73A 1CSPA 3NQTA 2EY6A 2Z8LA 3SE0A 4WJ4A 4JW0A 2Z1CA 2NN6H 3DWAA 2NVQH 4GNXA 2K5QA 1SE8A 2Q2TA 5M9OA 1SNCA 2PW5A 2ZJQA 1SYFA 2RF4A 2PZUA 1TWHH 3HOYB 1KDCA 4LF4L 5IP9H 1SNOA 4JI0L 3DLLA 2OF1A 3T1YQ 2IY5B 1JJGA 1ENAA 1PFSA 1D2BA 5M3MG 4A3GG 1NMGA 5FO9B 4L8JA 1ET6A 1HUNA 4KD4A 5CBAE 4XQQA 3CC2A 3S2HH 3S1QB 4HJAA 4KY6A 2QILA 2FFKB 2B2VA 2BCOA 1PZID 1EYCA 4JOIA 4LFCL 1SAPA 2K50A 2G5DA 3MXUA 5M5YH 4JI3Q 1WCMH 2F0WA 2IL8A 3PUYA 2JA5G 1WI5A 1WTWA 5M5WB 2F0GA 2Z6KA 1SMYC 3NBIA 1CK1A 1QZGA 3CHBD 4RHSA 1JT8A 1CM9A 3I4OA 3WDNA 3R2IA 1WTVA 5C44B 5I6WA 1E2ZA 4QQBX 1EIHA 2E74C 1D5MC 4BY7H 2ZT9C 3J80L 2C35B 3G71A 5IYDH 3RZOB 1UE7A 2ZXOA 5J39A 3K58A 1CKMA 2A69C 3MC0B 3NEMA 3OWEB 3LNNA 4QCLA 1VQKA 2DJFC 1CFMA 1IBML 1I4HA 2RHSB 5D3IB 3U9SA 1C4QA 2E2IH 3TREA 3CD6A 3RLOA 1EFWA 4IJHA 3QB3A 2D5DA 3RD4A 2PPBC 2DY8A 1Q82C 1CTMA 2M00A 4XIGS 4DUZL 2JA8G 1JWSD 2K5WA 2X6GA 2HIVA 1JICA 3W5OA 1IYVA 1FYCA 2K5NA 1IW7C 2UUCL 5EPLA 4V0BA 2R92G 5CR3A 1BBUA 1B1ZA 1NBWA 2HUGA 4X65L 3S1QH 1DOKA 1YHAA 3QJYA 4A3JG 2F4VQ 3L9AX 4Q0FA 4OGQC 1IXRA 1L2FA 4OHJA 2R6GA 3SR1A 5FLMH 1BCPB 2GVAA 4CKCA 2XNAC 3WOEA 1KTKA 2UUAL 4GLAC 1ZKOA 2IHEA 1VMPA 5HGQA 5T1GA 3J81L 4CJ1B 4HIMA 3GTJB 4EQ5A 5I2YA 1OXVA 1IL8A 1X3GA 2R61A 2Q8IB 3IFDA 5M5WH 4DR3L 4Q5VA 2KJXA 4KN7C 1RKNA 4AYBG 2LSSA 3PGZA 3CCJA 1EYAA 1Z47A 1PFBA 3FKIH 1PH5A 1PTOB 4HIOA 1C7YA 1JMCA 1SMYD 2F0KA 1HNZL 1LT3D 2QEJC 4K6DA 5JJKA 5C44H 3TP8A 5GAGC 2UXCQ 1BCPF 4EVOA 4A3BB 1YHBA 2NVYH 4A3CH 3BDCA 4MIUA 1GUNA 2E2JH 1D1KA 2EDGA 2KECA 2F0QA 5DNFA 3D3RA 1BF4A 5DLQE 4BBSG 3F8TA 4JCVE 4OXPA 1X54A 3I4LA 1LM0A 3D6WA 1VQ5A 2F0IA 3G48A 4ZKCB 1VQPA 1EQVA 2Z0SA 1XJVA 4C3IB 2VQFL 4IPGA 3NENA 1HA6A 3C46A 1YNNC 1B3QA 4DAPA 4LF6Q 1H9SB 1PTOF 1DJRD 2ZXRA 3T53B 1J6QA 3GDEA 1UE1A 1WTXA 3MXGA 4IUNA 1F9SA 4GS3A 1XNQQ 3PCOB 4DXGA 4FF2A 2KCMA 1H95A 2VQEL 1FVIA 3K5NA 4YIJA 3AU7A 3ULJA 4A3EB 1IBLL 4FVMA 3H09A 2FMCA 5LMUQ 3HKZG 4IZ8A 1QVFA 2R93B 4DAVA 3HOZH 1HNWL 1Y1VG 1G51A 1WD1A 1BUVT 3I2ZA 2RDFA 2ID0A 3NUCA 1WD0A 4OL7A 1K0SA 1IW7D 1Q81C 2JXMB 3DUZA 4A3IB 2E5LL 3ER0A 1B8AA 3R8BA 3AB9A 4DR7Q 1G8ZD 3CC7A 3C1FA 4POGA 3HS0C 3I4NB
chains in the Genus database with same CATH topology
3CF5A 3HOVG 3RLNA 2WP8J 2N3SA 3L0OA 3GTJH 5JEAG 5FJ8G 5FJ8H 5IYCH 4OX9L 1QUQB 1E1TA 1E1OA 3G4SA 1WJJA 4R4CA 1PH4A 1K73C 4IO9A 4LUVA 2UXDL 2JA9A 2N8NA 2WAQE 2VW9A 4X6AH 4OO1I 1EWIA 1WYDA 2JA7G 2IHFA 3K7UC 2DUDA 5GAEC 1HR0W 3UDIA 1YJNA 4OX9Q 4DUZQ 1VQLA 1Q1BA 2R7ZH 1N34Q 1XMQQ 5GAHC 1YJ9A 4A3JH 1XTDA 2CWAA 2EIFA 1IBKQ 3H3VI 5C0XG 4KI0A 2FXQA 4A76A 4ALPA 1JE5A 3HFZB 2R7FA 4C3HH 4DR1Q 4C2MH 2I0QA 2UUCQ 1SLJA 1RL2A 3TEHB 2NVXH 1Y1WG 4PZ6A 3CMEA 1KHIA 2K75A 4B3SL 3ICEA 4IFDG 4DUYL 1NJIC 3MEFA 3M3YH 2XGTA 4X65Q 3RZDH 3E9IA 2E5LQ 4DV6Q 3ZJYC 1FJGL 1VQHA 1D7QA 2JJQA 1I5FA 4L5TA 4P74A 4A3BG 5M3FG 1KXLA 2WB1E 3BJUA 3CP0A 4DAYB 3PO2G 3PO2H 4DR4Q 2NN6G 4OWXB 4Y52H 2ZTCA 2N78A 5IWAL 1D8LA 2JA6H 2UXBL 1A63A 4RMFA 2HIXA 4BBRG 4YWMA 4BBRH 3OTOQ 1MJEA 4JI8L 2UU9Q 4B3SQ 4DV0Q 1VQCA 1JJCB 3T1YL 3CCQA 2UUAQ 3STBC 3W1BA 1QVGA 1PH8A 1Q1EA 4A3KH 4JI4Q 4HJ9A 5C3EG 1YEZA 3U4ZA 1X9NA 4YWKA 3PF4A 2ALYB 5LMNW 4LF8Q 4A93G 1U0LA 3H0GG 4JG2A 4C3IH 3S1RH 1PH7A 1V1QA 2ZTDA 3K81C 5IP9G 3T1HL 4MNOA 3CMAA 2ES2A 4LW1A 1KRTA 4DPGA 1OTCA 4DR3Q 3G6EA 1YIJA 3KFUA 1Q46A 1YZ6A 2V1CC 3D31A 4YWLA 4HJ8A 2KCTA 3M4PA 2ZM6Q 2K5HA 3ULPA 4X66L 4UY8C 4WJ3M 1X55A 1PH2A 3F2CA 4RG1A 3CPWA 2OTLA 1VQEA 2JA6G 2EXDA 3A5ZB 3KF8B 2JE6I 3J80c 2YYZA 4JBKA 1TWGH 1VQOA 1HR0L 1BKBA 1X6OA 4DK3C 4NPSA 4A3EG 3CCEA 1S72A 1SR3A 4JI2L 3RZOH 4DR5L 4LFBL 1PH9A 1CKNB 1IYJB 4JI3L 4BBSH 4R4QA 3U4VA 2YTVA 1N36L 2R93H 2A19A 3U50C 4C3JH 4UP8A 2CQOA 2K5VA 3H15A 2JQOA 4JI5L 4GLXA 1PYBA 3AYHB 1HNXL 3HOWG 3TS2A 2YV5A 1E24A 1UWVA 2HQLA 4JI1Q 1BBWA 1EQRA 4L5QA 3PF5A 1TWCH 1VQ4A 3UDGA 4XTCS 4GNXB 1A0IA 4JI2Q 4NXML 4A3IG 2PI2E 4DR5Q 3CCSA 2QEXA 2VUMG 4H02A 3OYYA 1XNRL 4JI5Q 3L7ZC 4GKJL 2AWNA 1WFQA 2YTXA 1UE5A 2EQSA 5AJ3L 4R4TA 3I4NH 4DV4L 4B3ML 2MO0A 3UE1A 4X62Q 2VQFQ 1K8AC 5JJIA 2WAQG 5LMNL 1ASYA 5C0XI 1ASZA 5EAYA 2ATWA 4GKKQ 1EUJA 1HNWL 2D0PA 2AHOB 3K8AA 5K36G 1EQQA 2Y0SE 1YNXA 3GTOH 4IFDI 2VY3A 5JEAJ 2LXKA 2JK8A 1X56A 1Y1VH 5IY0A 4DV7L 1N33Q 3DM3A 3HOUG 3HOUH 4NXNL 5LMNQ 3I4MG 2NN6I 1P8LA 3B6YA 1VQIA 4LUOA 1J5EL 1IBLQ 2E8GA 2AWOA 2I5HA 1XPRA 4NB3A 4YHHQ 4JBWA 2MNAA 4A3DG 2PMZE 3F2DA 2NVTH 3A0JA 4LF9Q 4BY7G 1WOCA 3PUVA 4IOCA 1HNWQ 1NTGA 2Q2IA 2WB1G 1VQBA 4GN5A 5IYDG 3EN2A 4JBMA 4R4OA 2ZTEA 3TRZA 1AE3A 5C0XJ 3J81c 5C4JH 1NY4A 1VQ9A 4JV5L 2R7DA 5IYBG 4B3TQ 3HOVH 1L1OC 1TWAH 1VCIA 2GN5A 2MQHA 2WFWA 4P75A 5E7NA 3J80i 1JJ2A 4IFDJ 4DR6L 4DR2Q 1QZHA 2Q2UA 2MFIA 1KL9A 1LUZA 2Q2HA 3PUZA 2B29A 4IPHA 4OONA 4YY3Q 4JC0A 4PZ7A 4LF5Q 1HZ9A 1PH6A 4IJLA 3J7A5 1W2BA 1PVOA 1I50H 2H5XA 3E9HA 4TVAB 4DV2L 1HZBA 3AFPA 2OWOA 2HHHL 2D62A 4GNXC 2JA7H 2F52A 4J15A 3S15H 1TXYA 1A8VA 4GN4B 3HOXG 4A3FG 3STBD 4L5RC 3PUWA 2I5MX 3GTKH 1JB7A 1RIPA 3I55A 1EOVA 1HZAA 1T9HA 2UXDQ 1GO3E 1PV4A 2KHJA 2K52A 3RR5A 3GO5A 3S16H 2KHIA 4HIDA 3S2DH 1Y1WH 3LGJA 1L1OA 2XTIA 4JI7L 1C9OA 2ASBA 2OCEA 1AE2A 1CKNA 5GROA 1TWFH 4DV5L 2F4VL 4P73A 1CSPA 1XMOL 4LFAL 3PSIA 4A3BH 5M3FH 4DV1L 3A5UA 4WJ4A 2AMCB 1EIYB 2RHQB 4Y7NH 3S1NH 4KLKA 1VQFA 4QIWE 2NVQH 4GNXA 1VQNA 1EIFA 4DUYQ 1SE8A 4DV5Q 2Q2TA 3UDXA 1FJGQ 1VQDA 2CFMA 1E22A 4LFAQ 2RF4A 1K3RA 4UPAA 2PQAB 5C3EH 1YI2A 1MKHA 2ZJQA 3FP9A 4QY7A 4GOPB 1TWHH 5IWAQ 3H0GH 2UUBL 4A93H 4LF7L 1IL2A 4LF4L 2UXBQ 1N32L 5IP9H 1I3QH 4JI8Q 4OWWB 4JI0L 3IRBA 2KENA 3DLLA 1Q8KA 3T1YQ 2IY5B 1M90C 2PNHA 3GD7A 2VNUD 1JJGA 4TQUS 1I94L 1PFSA 1PYSB 4JOIC 4PMWA 5M3MG 1B70B 4A3GG 1NMGA 5HY6A 1YBYA 1K9MC 3J81j 3UDFA 3J81i 2Y0SG 4LF7Q 1PH1A 1U5KA 3CCLA 4K0KL 3T1HQ 4DV3L 3CC2A 3S2HH 1W3SA 4OWTB 3UE0A 4A3EH 3M7NA 2CWPA 2Z6KC 3FKIG 4X66Q 4HJAA 3SGIA 4KHPL 2HT1A 3MXNB 3CCVA 4GLVB 4MZ9A 3M4OH 2CKZB 4QL5A 3RNUA 4A3DH 3HOWH 4BXXG 5C44G 4LUZA 4IOAA 1CKOA 5GQOA 4AQYL 1HR0Q 5BR8L 1O7IA 3S24A 4JOIA 5J3BA 4LFCL 1L0WA 4A3IH 2VL6A 2GVBA 1MIUA 2K50A 5M5YH 4LFBQ 4JI3Q 1N36Q 2B63G 1QUQA 1WCMG 1WCMH 4YCVA 3KJOA 1LYLA 1YITA 1GD7A 3Q8DA 2VUMH 1XPOA 2BA1A 4X64L 1HNXQ 3PO3G 3PUYA 2JA5G 1GVPA 1WI5A 2MO1A 4LF6L 4YCWA 4NXMQ 2Z6KA 1SRUA 4R1JA 1KD1C 1X65A 3U58A 5GADC 1XNQL 1QZGA 3FHWA 1XNRQ 4UP9A 2NZOA 4DK6C 1JT8A 2CCZA 1PH3A 4GKJQ 3I4OA 4GOPC 1AH9A 4DKAC 2RCNA 2ZJPA 4A75A 3GTMH 3WWVA 4JBJA 3ULLA 5AJ3Q 4DV4Q 4B3MQ 5IP7G 5IP7H 1OXTA 1HZCA 1FGUA 3BZCA 3BU2A 5IT9c 3BZKA 5LMUL 1SFOH 3I4MH 4QQBX 1G6PA 3PUXA 1VQ8A 4QJFA 4AH6A 4P72A 4JI6L 3CW2C 1VQ6A 1OXSC 1LTLA 3JC66 2DGYA 4BY7H 1MJCA 2C35B 1E3PA 3G71A 4DV7Q 1K0RA 3KDFB 5IYDH 3JAMi 4NXNQ 1UE7A 4B3RL 1J5EQ 4IPDA 3F1ZA 1GKHA 1OXXK 5IYBH 3HOZG 2VS1A 1K83H 1CKMA 4GOPA 3NEMA 1CUKA 1Z9FA 1VQKA 2E2HH 1IBML 3K7AH 4HJ5A 2RHSB 5JJLA 3I7FA 2E2IH 3S17H 4JV5Q 3TREA 1B7YB 3CD6A 4A3CG 3RLOA 3CCMA 4PZ8A 1KC8C 4DR6Q 3OW2A 3HOXH 3F2BA 1I6HH 3TS0A 4A3FH 3HOYG 3A74A 1EFWA 4IJHA 1IBMQ 1Q7YC 3CQZH 5FLXc 2QA4A 4DV2Q 1Q82C 5IYCG 3S1MH 2HHHQ 1BVSA 4XIGS 3CXCA 1X3FA 4DUZL 2JA8G 2JA8H 2VZAA 4BA2I 3M9BA 1PA6A 1XMQL 1N34L 4R4IA 1VQMA 3CCUA 2HIVA 3NBHB 1IBKL 1VQGA 2PI2A 3W5OA 4LWCA 2K5NA 4DR1L 2IX0A 3K0XA 1V43A 2UUCL 4O0AA 1CSQA 2R92G 2R92H 2AKWB 1BBUA 3CC4A 1NBWA 3KF6B 4X65L 3S1QH 1P16A 3HKZE 4DV6L 1UE6A 4ME3A 1XPUA 4JI7Q 3M85A 2R7ZG 1YHAA 3M4QA 4A3JG 3PIOA 2OQKA 2F4VQ 3J7ZC 3PV0A 4DR4L 1XMOQ 4FDBA 1IXRA 1L2FA 1FL0A 1X3EA 2R6GA 2UU9L 5FLMG 5FLMH 3OTOL 4DV1Q 3GTPH 3GTQH 4GN3B 4JYAQ 4DV0L 2GVAA 2UUAL 4GLAC 2IHEA 1IZ6A 5HGQA 2KBNA 4JI4L 2F3IA 4HIMA 2BH2A 2A8VA 4EQ5A 1S3OA 4LF8L 2YTYA 1OXVA 5M3MH 3JAMc 3L2PA 1K8GA 4A3GH 5M5XH 1X3GA 1OXUA 3AQQA 5IE8A 1M1KC 5M5WH 2JEAI 1N8RC 2B3GA 4DR3L 2UUBQ 4LF4Q 4UP7A 1N32Q 2ZM6L 2A1AA 1YVCA 1Q12A 1EYGA 1SN8A 2N49A 2QGQA 3KYHC 4A3KG 4AYBG 2LSSA 4JI0Q 3PGZA 3CCJA 2UXCL 1Z47A 2YU9H 1R9TH 1I94Q 2ZJRA 3HKSA 2K14A 3FKIH 4PG3A 1PH5A 4HIOA 3NELA 1C7YA 1JMCA 1HNZL 1NE3A 1VQAA 2D0OA 3I56A 4BXXH 3KDFA 5C44H 4K0KQ 5JJKA 4DV3Q 5GAGC 4DNIA 2UXCQ 1KRSA 4MTNA 3TQYA 1YHQA 3EBEA 4JYAL 4OO1G 3CAMA 4KHPQ 1YHBA 4APVA 2NVYH 2B63H 1HNZQ 4A3CH 1C0AA 4EX5A 4A3LG 4A3LH 4JI1L 3PO3H 1SROA 1E7ZA 2E2JH 2JA5H 1YJWA 4AQYQ 1L1OB 4POFA 5DLQE 3H3VH 3F8TA 5BR8Q 4BBSG 4JCVE 5C4XH 2R93G 5C4XG 1N9WA 1X54A 4OXPA 4LFCQ 4AIMA 3GTGH 3GTLH 1HJPA 1G291 1LM0A 1A62A 3KJPA 1VQ5A 3G48A 1VQPA 2I5LX 5H1SE 1PHJA 2Z0SA 4X64Q 1XJVA 1VS0A 2VQFL 4X62L 2OTJA 4IPGA 3NENA 2IT1A 4AYBE 1KAWA 2BH8A 4LF6Q 4LNQA 3S14H 4GKKL 1J6QA 4DAMA 3GDEA 4QGUA 1UE1A 3VDYA 4L5SA 3ERSX 4GS3A 1XNQQ 2L15A 4O2DA 3PCOB 2IX1A 1GM5A 2KCMA 3K80C 1H95A 5ELOA 3I4NG 1N33L 2VQEL 1FVIA 4IPCA 3CPFA 3E0EA 3EIVA 2OQ0A 3CCRA 1NMFA 3KF6A 3ULJA 2NZHA 1IBLL 4HJ7A 1V9PA 3RN2A 4YHHL 5LMUQ 3RN5A 4A3MG 4A3MH 3HKZG 3KLWA 4LF9L 1QVFA 3W1GA 3HOZH 2LXJA 2PQAA 1Y1VG 2K4KA 1G51A 3KOJA 4P71A 4HIKA 1S40A 2VQEQ 1VQ7A 4JI6Q 4DR7L 4YCUA 1UEBA 3PIPA 1SMXA 3I2ZA 2ID0A 3AEVA 1QVCA 1KIXA 2BA0A 3AFQA 1Q81C 4B3TL 4B3RQ 2E5LL 3ER0A 1Y14B 3RLFA 1DGSA 1VQJA 1B8AA 4BA1I 4KHZA 4DR2L 4YY3L 3D0FA 1HH2P 5ELNA 4LF5L 4DR7Q 3CC7A 1Q86C 4BY1G 4BY1H 4POGA 3HOYH 2JEBI 4A4IA 1KQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CF5 A;  3HOV G;  3RLN A;  2WP8 J;  2N3S A;  3L0O A;  3GTJ H;  5JEA G;  5FJ8 G;  5FJ8 H;  5IYC H;  4OX9 L;  1QUQ B;  1E1T A;  1E1O A;  3G4S A;  1WJJ A;  4R4C A;  1PH4 A;  1K73 C;  4IO9 A;  4LUV A;  2UXD L;  2JA9 A;  2N8N A;  2WAQ E;  2VW9 A;  4X6A H;  4OO1 I;  1EWI A;  1WYD A;  2JA7 G;  2IHF A;  3K7U C;  2DUD A;  5GAE C;  1HR0 W;  3UDI A;  1YJN A;  4OX9 Q;  4DUZ Q;  1VQL A;  1Q1B A;  2R7Z H;  1N34 Q;  1XMQ Q;  5GAH C;  1YJ9 A;  4A3J H;  1XTD A;  2CWA A;  2EIF A;  1IBK Q;  3H3V I;  5C0X G;  4KI0 A;  2FXQ A;  4A76 A;  4ALP A;  1JE5 A;  3HFZ B;  2R7F A;  4C3H H;  4DR1 Q;  4C2M H;  2I0Q A;  2UUC Q;  1SLJ A;  1RL2 A;  3TEH B;  2NVX H;  1Y1W G;  4PZ6 A;  3CME A;  1KHI A;  2K75 A;  4B3S L;  3ICE A;  4IFD G;  4DUY L;  1NJI C;  3MEF A;  3M3Y H;  2XGT A;  4X65 Q;  3RZD H;  3E9I A;  2E5L Q;  4DV6 Q;  3ZJY C;  1FJG L;  1VQH A;  1D7Q A;  2JJQ A;  1I5F A;  4L5T A;  4P74 A;  4A3B G;  5M3F G;  1KXL A;  2WB1 E;  3BJU A;  3CP0 A;  4DAY B;  3PO2 G;  3PO2 H;  4DR4 Q;  2NN6 G;  4OWX B;  4Y52 H;  2ZTC A;  2N78 A;  5IWA L;  1D8L A;  2JA6 H;  2UXB L;  1A63 A;  4RMF A;  2HIX A;  4BBR G;  4YWM A;  4BBR H;  3OTO Q;  1MJE A;  4JI8 L;  2UU9 Q;  4B3S Q;  4DV0 Q;  1VQC A;  1JJC B;  3T1Y L;  3CCQ A;  2UUA Q;  3STB C;  3W1B A;  1QVG A;  1PH8 A;  1Q1E A;  4A3K H;  4JI4 Q;  4HJ9 A;  5C3E G;  1YEZ A;  3U4Z A;  1X9N A;  4YWK A;  3PF4 A;  2ALY B;  5LMN W;  4LF8 Q;  4A93 G;  1U0L A;  3H0G G;  4JG2 A;  4C3I H;  3S1R H;  1PH7 A;  1V1Q A;  2ZTD A;  3K81 C;  5IP9 G;  3T1H L;  4MNO A;  3CMA A;  2ES2 A;  4LW1 A;  1KRT A;  4DPG A;  1OTC A;  4DR3 Q;  3G6E A;  1YIJ A;  3KFU A;  1Q46 A;  1YZ6 A;  2V1C C;  3D31 A;  4YWL A;  4HJ8 A;  2KCT A;  3M4P A;  2ZM6 Q;  2K5H A;  3ULP A;  4X66 L;  4UY8 C;  4WJ3 M;  1X55 A;  1PH2 A;  3F2C A;  4RG1 A;  3CPW A;  2OTL A;  1VQE A;  2JA6 G;  2EXD A;  3A5Z B;  3KF8 B;  2JE6 I;  3J80 c;  2YYZ A;  4JBK A;  1TWG H;  1VQO A;  1HR0 L;  1BKB A;  1X6O A;  4DK3 C;  4NPS A;  4A3E G;  3CCE A;  1S72 A;  1SR3 A;  4JI2 L;  3RZO H;  4DR5 L;  4LFB L;  1PH9 A;  1CKN B;  1IYJ B;  4JI3 L;  4BBS H;  4R4Q A;  3U4V A;  2YTV A;  1N36 L;  2R93 H;  2A19 A;  3U50 C;  4C3J H;  4UP8 A;  2CQO A;  2K5V A;  3H15 A;  2JQO A;  4JI5 L;  4GLX A;  1PYB A;  3AYH B;  1HNX L;  3HOW G;  3TS2 A;  2YV5 A;  1E24 A;  1UWV A;  2HQL A;  4JI1 Q;  1BBW A;  1EQR A;  4L5Q A;  3PF5 A;  1TWC H;  1VQ4 A;  3UDG A;  4XTC S;  4GNX B;  1A0I A;  4JI2 Q;  4NXM L;  4A3I G;  2PI2 E;  4DR5 Q;  3CCS A;  2QEX A;  2VUM G;  4H02 A;  3OYY A;  1XNR L;  4JI5 Q;  3L7Z C;  4GKJ L;  2AWN A;  1WFQ A;  2YTX A;  1UE5 A;  2EQS A;  5AJ3 L;  4R4T A;  3I4N H;  4DV4 L;  4B3M L;  2MO0 A;  3UE1 A;  4X62 Q;  2VQF Q;  1K8A C;  5JJI A;  2WAQ G;  5LMN L;  1ASY A;  5C0X I;  1ASZ A;  5EAY A;  2ATW A;  4GKK Q;  1EUJ A;  1HNW L;  2D0P A;  2AHO B;  3K8A A;  5K36 G;  1EQQ A;  2Y0S E;  1YNX A;  3GTO H;  4IFD I;  2VY3 A;  5JEA J;  2LXK A;  2JK8 A;  1X56 A;  1Y1V H;  5IY0 A;  4DV7 L;  1N33 Q;  3DM3 A;  3HOU G;  3HOU H;  4NXN L;  5LMN Q;  3I4M G;  2NN6 I;  1P8L A;  3B6Y A;  1VQI A;  4LUO A;  1J5E L;  1IBL Q;  2E8G A;  2AWO A;  2I5H A;  1XPR A;  4NB3 A;  4YHH Q;  4JBW A;  2MNA A;  4A3D G;  2PMZ E;  3F2D A;  2NVT H;  3A0J A;  4LF9 Q;  4BY7 G;  1WOC A;  3PUV A;  4IOC A;  1HNW Q;  1NTG A;  2Q2I A;  2WB1 G;  1VQB A;  4GN5 A;  5IYD G;  3EN2 A;  4JBM A;  4R4O A;  2ZTE A;  3TRZ A;  1AE3 A;  5C0X J;  3J81 c;  5C4J H;  1NY4 A;  1VQ9 A;  4JV5 L;  2R7D A;  5IYB G;  4B3T Q;  3HOV H;  1L1O C;  1TWA H;  1VCI A;  2GN5 A;  2MQH A;  2WFW A;  4P75 A;  5E7N A;  3J80 i;  1JJ2 A;  4IFD J;  4DR6 L;  4DR2 Q;  1QZH A;  2Q2U A;  2MFI A;  1KL9 A;  1LUZ A;  2Q2H A;  3PUZ A;  2B29 A;  4IPH A;  4OON A;  4YY3 Q;  4JC0 A;  4PZ7 A;  4LF5 Q;  1HZ9 A;  1PH6 A;  4IJL A;  3J7A 5;  1W2B A;  1PVO A;  1I50 H;  2H5X A;  3E9H A;  4TVA B;  4DV2 L;  1HZB A;  3AFP A;  2OWO A;  2HHH L;  2D62 A;  4GNX C;  2JA7 H;  2F52 A;  4J15 A;  3S15 H;  1TXY A;  1A8V A;  4GN4 B;  3HOX G;  4A3F G;  3STB D;  4L5R C;  3PUW A;  2I5M X;  3GTK H;  1JB7 A;  1RIP A;  3I55 A;  1EOV A;  1HZA A;  1T9H A;  2UXD Q;  1GO3 E;  1PV4 A;  2KHJ A;  2K52 A;  3RR5 A;  3GO5 A;  3S16 H;  2KHI A;  4HID A;  3S2D H;  1Y1W H;  3LGJ A;  1L1O A;  2XTI A;  4JI7 L;  1C9O A;  2ASB A;  2OCE A;  1AE2 A;  1CKN A;  5GRO A;  1TWF H;  4DV5 L;  2F4V L;  4P73 A;  1CSP A;  1XMO L;  4LFA L;  3PSI A;  4A3B H;  5M3F H;  4DV1 L;  3A5U A;  4WJ4 A;  2AMC B;  1EIY B;  2RHQ B;  4Y7N H;  3S1N H;  4KLK A;  1VQF A;  4QIW E;  2NVQ H;  4GNX A;  1VQN A;  1EIF A;  4DUY Q;  1SE8 A;  4DV5 Q;  2Q2T A;  3UDX A;  1FJG Q;  1VQD A;  2CFM A;  1E22 A;  4LFA Q;  2RF4 A;  1K3R A;  4UPA A;  2PQA B;  5C3E H;  1YI2 A;  1MKH A;  2ZJQ A;  3FP9 A;  4QY7 A;  4GOP B;  1TWH H;  5IWA Q;  3H0G H;  2UUB L;  4A93 H;  4LF7 L;  1IL2 A;  4LF4 L;  2UXB Q;  1N32 L;  5IP9 H;  1I3Q H;  4JI8 Q;  4OWW B;  4JI0 L;  3IRB A;  2KEN A;  3DLL A;  1Q8K A;  3T1Y Q;  2IY5 B;  1M90 C;  2PNH A;  3GD7 A;  2VNU D;  1JJG A;  4TQU S;  1I94 L;  1PFS A;  1PYS B;  4JOI C;  4PMW A;  5M3M G;  1B70 B;  4A3G G;  1NMG A;  5HY6 A;  1YBY A;  1K9M C;  3J81 j;  3UDF A;  3J81 i;  2Y0S G;  4LF7 Q;  1PH1 A;  1U5K A;  3CCL A;  4K0K L;  3T1H Q;  4DV3 L;  3CC2 A;  3S2H H;  1W3S A;  4OWT B;  3UE0 A;  4A3E H;  3M7N A;  2CWP A;  2Z6K C;  3FKI G;  4X66 Q;  4HJA A;  3SGI A;  4KHP L;  2HT1 A;  3MXN B;  3CCV A;  4GLV B;  4MZ9 A;  3M4O H;  2CKZ B;  4QL5 A;  3RNU A;  4A3D H;  3HOW H;  4BXX G;  5C44 G;  4LUZ A;  4IOA A;  1CKO A;  5GQO A;  4AQY L;  1HR0 Q;  5BR8 L;  1O7I A;  3S24 A;  4JOI A;  5J3B A;  4LFC L;  1L0W A;  4A3I H;  2VL6 A;  2GVB A;  1MIU A;  2K50 A;  5M5Y H;  4LFB Q;  4JI3 Q;  1N36 Q;  2B63 G;  1QUQ A;  1WCM G;  1WCM H;  4YCV A;  3KJO A;  1LYL A;  1YIT A;  1GD7 A;  3Q8D A;  2VUM H;  1XPO A;  2BA1 A;  4X64 L;  1HNX Q;  3PO3 G;  3PUY A;  2JA5 G;  1GVP A;  1WI5 A;  2MO1 A;  4LF6 L;  4YCW A;  4NXM Q;  2Z6K A;  1SRU A;  4R1J A;  1KD1 C;  1X65 A;  3U58 A;  5GAD C;  1XNQ L;  1QZG A;  3FHW A;  1XNR Q;  4UP9 A;  2NZO A;  4DK6 C;  1JT8 A;  2CCZ A;  1PH3 A;  4GKJ Q;  3I4O A;  4GOP C;  1AH9 A;  4DKA C;  2RCN A;  2ZJP A;  4A75 A;  3GTM H;  3WWV A;  4JBJ A;  3ULL A;  5AJ3 Q;  4DV4 Q;  4B3M Q;  5IP7 G;  5IP7 H;  1OXT A;  1HZC A;  1FGU A;  3BZC A;  3BU2 A;  5IT9 c;  3BZK A;  5LMU L;  1SFO H;  3I4M H;  4QQB X;  1G6P A;  3PUX A;  1VQ8 A;  4QJF A;  4AH6 A;  4P72 A;  4JI6 L;  3CW2 C;  1VQ6 A;  1OXS C;  1LTL A;  3JC6 6;  2DGY A;  4BY7 H;  1MJC A;  2C35 B;  1E3P A;  3G71 A;  4DV7 Q;  1K0R A;  3KDF B;  5IYD H;  3JAM i;  4NXN Q;  1UE7 A;  4B3R L;  1J5E Q;  4IPD A;  3F1Z A;  1GKH A;  1OXX K;  5IYB H;  3HOZ G;  2VS1 A;  1K83 H;  1CKM A;  4GOP A;  3NEM A;  1CUK A;  1Z9F A;  1VQK A;  2E2H H;  1IBM L;  3K7A H;  4HJ5 A;  2RHS B;  5JJL A;  3I7F A;  2E2I H;  3S17 H;  4JV5 Q;  3TRE A;  1B7Y B;  3CD6 A;  4A3C G;  3RLO A;  3CCM A;  4PZ8 A;  1KC8 C;  4DR6 Q;  3OW2 A;  3HOX H;  3F2B A;  1I6H H;  3TS0 A;  4A3F H;  3HOY G;  3A74 A;  1EFW A;  4IJH A;  1IBM Q;  1Q7Y C;  3CQZ H;  5FLX c;  2QA4 A;  4DV2 Q;  1Q82 C;  5IYC G;  3S1M H;  2HHH Q;  1BVS A;  4XIG S;  3CXC A;  1X3F A;  4DUZ L;  2JA8 G;  2JA8 H;  2VZA A;  4BA2 I;  3M9B A;  1PA6 A;  1XMQ L;  1N34 L;  4R4I A;  1VQM A;  3CCU A;  2HIV A;  3NBH B;  1IBK L;  1VQG A;  2PI2 A;  3W5O A;  4LWC A;  2K5N A;  4DR1 L;  2IX0 A;  3K0X A;  1V43 A;  2UUC L;  4O0A A;  1CSQ A;  2R92 G;  2R92 H;  2AKW B;  1BBU A;  3CC4 A;  1NBW A;  3KF6 B;  4X65 L;  3S1Q H;  1P16 A;  3HKZ E;  4DV6 L;  1UE6 A;  4ME3 A;  1XPU A;  4JI7 Q;  3M85 A;  2R7Z G;  1YHA A;  3M4Q A;  4A3J G;  3PIO A;  2OQK A;  2F4V Q;  3J7Z C;  3PV0 A;  4DR4 L;  1XMO Q;  4FDB A;  1IXR A;  1L2F A;  1FL0 A;  1X3E A;  2R6G A;  2UU9 L;  5FLM G;  5FLM H;  3OTO L;  4DV1 Q;  3GTP H;  3GTQ H;  4GN3 B;  4JYA Q;  4DV0 L;  2GVA A;  2UUA L;  4GLA C;  2IHE A;  1IZ6 A;  5HGQ A;  2KBN A;  4JI4 L;  2F3I A;  4HIM A;  2BH2 A;  2A8V A;  4EQ5 A;  1S3O A;  4LF8 L;  2YTY A;  1OXV A;  5M3M H;  3JAM c;  3L2P A;  1K8G A;  4A3G H;  5M5X H;  1X3G A;  1OXU A;  3AQQ A;  5IE8 A;  1M1K C;  5M5W H;  2JEA I;  1N8R C;  2B3G A;  4DR3 L;  2UUB Q;  4LF4 Q;  4UP7 A;  1N32 Q;  2ZM6 L;  2A1A A;  1YVC A;  1Q12 A;  1EYG A;  1SN8 A;  2N49 A;  2QGQ A;  3KYH C;  4A3K G;  4AYB G;  2LSS A;  4JI0 Q;  3PGZ A;  3CCJ A;  2UXC L;  1Z47 A;  2YU9 H;  1R9T H;  1I94 Q;  2ZJR A;  3HKS A;  2K14 A;  3FKI H;  4PG3 A;  1PH5 A;  4HIO A;  3NEL A;  1C7Y A;  1JMC A;  1HNZ L;  1NE3 A;  1VQA A;  2D0O A;  3I56 A;  4BXX H;  3KDF A;  5C44 H;  4K0K Q;  5JJK A;  4DV3 Q;  5GAG C;  4DNI A;  2UXC Q;  1KRS A;  4MTN A;  3TQY A;  1YHQ A;  3EBE A;  4JYA L;  4OO1 G;  3CAM A;  4KHP Q;  1YHB A;  4APV A;  2NVY H;  2B63 H;  1HNZ Q;  4A3C H;  1C0A A;  4EX5 A;  4A3L G;  4A3L H;  4JI1 L;  3PO3 H;  1SRO A;  1E7Z A;  2E2J H;  2JA5 H;  1YJW A;  4AQY Q;  1L1O B;  4POF A;  5DLQ E;  3H3V H;  3F8T A;  5BR8 Q;  4BBS G;  4JCV E;  5C4X H;  2R93 G;  5C4X G;  1N9W A;  1X54 A;  4OXP A;  4LFC Q;  4AIM A;  3GTG H;  3GTL H;  1HJP A;  1G29 1;  1LM0 A;  1A62 A;  3KJP A;  1VQ5 A;  3G48 A;  1VQP A;  2I5L X;  5H1S E;  1PHJ A;  2Z0S A;  4X64 Q;  1XJV A;  1VS0 A;  2VQF L;  4X62 L;  2OTJ A;  4IPG A;  3NEN A;  2IT1 A;  4AYB E;  1KAW A;  2BH8 A;  4LF6 Q;  4LNQ A;  3S14 H;  4GKK L;  1J6Q A;  4DAM A;  3GDE A;  4QGU A;  1UE1 A;  3VDY A;  4L5S A;  3ERS X;  4GS3 A;  1XNQ Q;  2L15 A;  4O2D A;  3PCO B;  2IX1 A;  1GM5 A;  2KCM A;  3K80 C;  1H95 A;  5ELO A;  3I4N G;  1N33 L;  2VQE L;  1FVI A;  4IPC A;  3CPF A;  3E0E A;  3EIV A;  2OQ0 A;  3CCR A;  1NMF A;  3KF6 A;  3ULJ A;  2NZH A;  1IBL L;  4HJ7 A;  1V9P A;  3RN2 A;  4YHH L;  5LMU Q;  3RN5 A;  4A3M G;  4A3M H;  3HKZ G;  3KLW A;  4LF9 L;  1QVF A;  3W1G A;  3HOZ H;  2LXJ A;  2PQA A;  1Y1V G;  2K4K A;  1G51 A;  3KOJ A;  4P71 A;  4HIK A;  1S40 A;  2VQE Q;  1VQ7 A;  4JI6 Q;  4DR7 L;  4YCU A;  1UEB A;  3PIP A;  1SMX A;  3I2Z A;  2ID0 A;  3AEV A;  1QVC A;  1KIX A;  2BA0 A;  3AFQ A;  1Q81 C;  4B3T L;  4B3R Q;  2E5L L;  3ER0 A;  1Y14 B;  3RLF A;  1DGS A;  1VQJ A;  1B8A A;  4BA1 I;  4KHZ A;  4DR2 L;  4YY3 L;  3D0F A;  1HH2 P;  5ELN A;  4LF5 L;  4DR7 Q;  3CC7 A;  1Q86 C;  4BY1 G;  4BY1 H;  4POG A;  3HOY H;  2JEB I;  4A4I A;  1KQS A; 
#chains in the Genus database with same CATH topology
 3HEJ A;  3CF5 A;  3A8K E;  3RLN A;  2WAQ B;  3A54 A;  3GTJ H;  5JEA G;  5FJ8 G;  5IYC H;  1E1O A;  1PH4 A;  2JN4 A;  4KY7 A;  3WOF A;  2WAQ E;  5CMD A;  3TP5 A;  3NP8 A;  4OO1 I;  3E6Z X;  1M4V A;  1AEX A;  3NSW A;  2DUD A;  3I4M B;  2KA7 A;  3UDI A;  2HQE A;  3CRL C;  3SHL A;  3DEO A;  4OX9 Q;  1PTO H;  1XMQ Q;  5JVH 3;  2CWA A;  1GUG A;  4ALP A;  3IKJ A;  4C3H H;  4DR1 Q;  2WV6 D;  3TEH B;  1MI2 A;  4PZ6 A;  1J9O A;  1X3Q A;  3ICE A;  1NJI C;  3E9I A;  1BOS A;  3ZJY C;  1VQH A;  3HOV B;  1ENF A;  2TMP A;  4Y52 H;  2NN6 G;  4OWX B;  1TT2 A;  1D8L A;  1A63 A;  4BBR G;  2UU9 Q;  3OTO Q;  1TS3 A;  4B3S Q;  1JJC B;  2EYO A;  3T1Y L;  3HG9 A;  3S17 B;  4WOR A;  1A3U A;  4KMU C;  1QVG A;  1Q1E A;  1CI3 M;  2JA7 B;  3U4Z A;  5BN3 A;  4YWK A;  2MGS A;  1EZ8 A;  1F2M A;  1FR3 A;  4CGY B;  4LK1 C;  4C3I H;  1Q3L A;  4NP5 A;  3SK6 A;  5IP9 G;  1CZW A;  1PH7 A;  4MNO A;  1KRT A;  1OTC A;  2K6A A;  1YIJ A;  4IUP A;  2KCT A;  3M4P A;  2ZM6 Q;  2K5H A;  3S1M B;  2K04 A;  3ULP A;  4WJ3 M;  4IUR A;  4RG1 A;  5FLX E;  2OTL A;  4KJN A;  3VYR A;  2SEB D;  2JE6 I;  3BVZ A;  1UEA B;  2L5T A;  1S72 A;  4JI3 L;  4IUU A;  2YTV A;  2R93 H;  2A19 A;  4CJ0 B;  3U50 C;  1LTG D;  3QR8 A;  4GLX A;  2JQO A;  1PYB A;  3MTS A;  2EOT A;  1UWV A;  2HQL A;  4JI1 Q;  1KDA A;  4WRD A;  1BBW A;  5TSS A;  2EY1 A;  1JR0 D;  2JA6 G;  4JI2 Q;  1BCP C;  2L12 A;  4DR5 Q;  1A15 A;  4HCS A;  1TII D;  2KEE A;  4JVZ A;  3ERQ A;  4I7Z C;  4K8J A;  1JOO A;  3R3O A;  2AWN A;  5M5X B;  2YTX A;  4B08 A;  5I6Y A;  2Y0S B;  2DNE A;  3I4N H;  1WVL A;  2MO0 A;  3NXW A;  3UE1 A;  4X62 Q;  1AZP A;  3JAM E;  3P20 A;  5D65 A;  1R9T B;  2AHO B;  3K8A A;  1GXD C;  1EWH A;  1U4M A;  2Y0S E;  5J1Z A;  3GTO H;  5T1I A;  5JEA J;  1JCK B;  4XQN A;  1LTB D;  3HOU G;  5E4X A;  3E3X A;  1ROD A;  4YHH Q;  1Y8O B;  3F2D A;  1JC7 A;  4V19 0;  3A0J A;  4BY7 G;  4RA8 A;  2Q2I A;  5IYD G;  4GN5 A;  1AE3 A;  1ZXT A;  2DJG C;  1VQ9 A;  3TBI B;  2R7D A;  3HZX A;  4P2C B;  2EY2 A;  3HOV H;  4P75 A;  1LTA D;  5FO8 B;  1JOK A;  1PFN A;  2Q2H A;  1LUZ A;  3PUZ A;  1MGS A;  1T5X D;  4JC0 A;  3J7A 5;  1PVO A;  4CJ2 C;  2NB0 A;  3E9H A;  3TZD A;  5C4H A;  2OWO A;  2PQE A;  4GNX C;  2JA7 H;  2PZT A;  4KK7 A;  2I5M X;  1RIP A;  1HZA A;  1T9H A;  2BE5 D;  2UXD Q;  1GO3 E;  3Q6S A;  3RR5 A;  1CZG A;  3LGJ A;  1L1O A;  2HCI A;  1KAA A;  5E1F A;  4DV5 L;  2F4V L;  2KUM A;  1NUC A;  4HMJ A;  3A5U A;  2RHQ B;  2JSO A;  2WIN B;  5JVG 3;  1HTP A;  1EIF A;  3KLS A;  1B53 A;  5DEH A;  3UDX A;  1LLR D;  3VR5 A;  4FNF A;  3EVQ A;  4LFA Q;  4ABN A;  1YI2 A;  4UPA A;  4EQO A;  4X3U A;  1LO5 D;  1I6H B;  2UXB Q;  1IL2 A;  1RD9 D;  3ONA B;  4UAI A;  2JYO A;  2B2V C;  1I3Q H;  4JI8 Q;  3BYT B;  4OWW B;  3IRB A;  5HUR A;  1M90 C;  1L0X B;  4DF7 A;  3DMU A;  4TQU S;  4JOI C;  2F0P A;  1I4X A;  2PO4 A;  5DM6 3;  1YBY A;  3UDF A;  4LF7 Q;  3J7A V;  1U5K A;  5KRU A;  4N9P A;  5K5P A;  4K5W A;  5ISR A;  2CWP A;  4UDU C;  5CBE E;  2Z6K C;  3FKI G;  2R7Z B;  5ELD A;  3MXN B;  3CCV A;  1PZK D;  4GLV B;  1GOZ A;  1TKW B;  1SYD A;  5C44 G;  2VXW A;  1PXU A;  1RF2 D;  1WTH A;  3AMU A;  5J3B A;  2XRQ D;  1EY7 A;  1L0W A;  2VL6 A;  4FXD A;  1MIU A;  3URY A;  4A3C G;  2VUM H;  3Q8D A;  5ELC A;  1H9J A;  1BR9 A;  5KNC A;  2F3V A;  4LF6 L;  4YCW A;  1PRT D;  5GAD C;  1XNQ L;  1JE4 A;  1C48 A;  3I8Z A;  4UP9 A;  1PH3 A;  1AH9 A;  4MHE A;  3GTM H;  3WWV A;  1ESF A;  5IP7 G;  1HZC A;  1V1P B;  5LMU L;  3BZK A;  2KVM A;  3QOL A;  3PUX A;  1EWC A;  5CV9 A;  4AH6 A;  1VQ6 A;  4PNY A;  1LTL A;  2EPB A;  1F2Y A;  3PO3 B;  2F4I A;  1E3P A;  1ICW A;  3QIA A;  1K0R A;  3KDF B;  5KEE A;  4DV7 Q;  4NXN Q;  5C6A A;  4LAA A;  4LMQ D;  3BDO A;  5C4X B;  4JPB W;  3HOZ G;  2VS1 A;  4IN3 A;  3GTL B;  1SXT A;  1Q90 A;  4N9T A;  4GOP A;  1Z9F A;  5EPK A;  5FO7 B;  4HJ5 A;  4RGN A;  5BN4 A;  3A7A B;  1B7Y B;  3TDQ A;  4EGV A;  3NTK A;  1MBY A;  1KC8 C;  3CCM A;  4EQN A;  4DR6 Q;  1STN A;  3HOX H;  3F2B A;  1I6H H;  5CV5 A;  4A3F H;  3A74 A;  1ML0 D;  1QIL A;  1Q7Y C;  2B2T A;  1H9M A;  5FLX c;  2QA4 A;  3H6M A;  5IYC G;  2HHH Q;  1X3F A;  1VDZ A;  2VZA A;  3M9B A;  1STY A;  1XMQ L;  4R4I A;  4IQZ A;  1VQG A;  2B2W A;  4DR1 L;  1SE2 A;  1F9Q A;  2K1B A;  1EY4 A;  2MUY A;  2KCN A;  2OQK A;  2K03 A;  4X3T A;  4C3H G;  2UU9 L;  3OTO L;  5CC4 A;  5IGF A;  3OPO A;  2QDB A;  1IZ6 A;  2KBN A;  1F2Z A;  4PMC A;  2RSN A;  3H3V C;  2K32 A;  1U9R A;  2YTY A;  1K8G A;  2PZW A;  4IUT A;  3JAM c;  1OXU A;  1CQV A;  3AQQ A;  1M1K C;  2E76 C;  2KHS A;  2UUB Q;  2F0U A;  4CDC C;  2ZM6 L;  2A1A A;  1SN8 A;  2QGQ A;  4XYQ A;  4N8F A;  3HKS A;  2K14 A;  2RDH A;  3KUP A;  3NEL A;  4J8Q A;  1NE3 A;  1VQA A;  5JPN C;  4BXX H;  5FLX L;  4DV3 Q;  3S2D B;  1Y1W B;  2F0V A;  2F0M A;  4DNI A;  2EYP A;  1KRS A;  3TQY A;  3EBE A;  3CAM A;  5M3F B;  4APV A;  2B63 H;  1C0A A;  5CV4 A;  4EX5 A;  4Y7N B;  4A3L G;  5C5L A;  4JI1 L;  3PO3 H;  1E7Z A;  4PMB A;  1YJW A;  4AQY Q;  1STA A;  1L1O B;  4POF A;  2LMC B;  2R93 G;  5C4X H;  2NYZ D;  3VR2 A;  3SK5 A;  1STH A;  3GTG H;  3GV3 A;  2F0S A;  3GTL H;  1A62 A;  4NMZ A;  2I5L X;  5H1S E;  4A93 B;  1DXM A;  4X64 Q;  1CA6 A;  3S1R B;  1VS0 A;  4X62 L;  3V96 A;  4UHV A;  1KAW A;  2BH8 A;  3K5L A;  3TN2 A;  3S14 H;  3M7G A;  3EFX D;  1A6X A;  4QGU A;  1B9N A;  3NBH A;  3ERS X;  2BDO A;  3JAM L;  3K80 C;  1UNS A;  2SNM A;  5G3L D;  3I4N G;  3J7A F;  3CPF A;  2N88 A;  1DCZ A;  3EIV A;  3A56 A;  3E0E A;  3CCR A;  1NMF A;  3KF6 A;  4I65 A;  2NZH A;  1CA5 A;  1V9P A;  4YHH L;  3RN5 A;  2D2C C;  2OT2 A;  4CKB A;  4A3M G;  3KLW A;  1EY8 A;  1D1I A;  3W1G A;  2PQA A;  2K4K A;  1S40 A;  4JI6 Q;  3KOJ A;  3S9W A;  1SMX A;  4PQX A;  4DXF A;  3F2U A;  1HTL D;  4B3R Q;  2RSO A;  1DGS A;  2VB2 X;  4KHZ A;  1F9R A;  2WAC A;  3CKI B;  3K59 A;  1F2L A;  4NKL A;  4RFB A;  4BY1 G;  3HOY H;  1D5X C;  3HOV G;  2B2U A;  2WP8 J;  3L0O A;  1EEI D;  3FVQ A;  4NW2 A;  2RDG A;  1E1T A;  3DWP A;  3G4S A;  1HPC A;  4R4C A;  1K73 C;  4S3S A;  4IO9 A;  4LUV A;  2UXD L;  2JA9 A;  2EZV A;  1QCB D;  2B2Y A;  3HP3 A;  2JA7 G;  2IHF A;  2VB3 X;  3OSO A;  1YJ9 A;  1F9P A;  1LV9 A;  1EEF D;  4WJW A;  1XTD A;  2EIF A;  5IT9 E;  1IBK Q;  4KI0 A;  2FXQ A;  4A76 A;  1WTP A;  5DAU A;  3X3N A;  1RL2 A;  1KHI A;  3P7J A;  3NWS A;  4DV6 Q;  3SK8 A;  1TWA B;  1A3T A;  2I07 B;  3VYU A;  3Q24 A;  3PO2 G;  3HGB A;  4CDD C;  4DR4 Q;  2N78 A;  2UXB L;  2E2H B;  4YWM A;  1O78 A;  4JI8 L;  3NQI A;  4HAE A;  4O42 A;  4DV0 Q;  3STB C;  1YEZ A;  2ALY B;  4ZRZ A;  3OMC A;  3TZU A;  1LT6 D;  4JG2 A;  3S1R H;  4FP5 D;  1V1Q A;  2ZTD A;  2ES2 A;  4DPG A;  3G6E A;  3BG3 A;  1YZ6 A;  4YWL A;  4ZK9 B;  5EJW A;  1R4P B;  1VMC A;  4UY8 C;  1X55 A;  1JB3 A;  4F7X A;  3F2C A;  1F77 A;  3CPW A;  2DNC A;  3D4D A;  4OO1 H;  3IAY A;  3R2T A;  3X3M A;  3A5Z B;  3KF8 B;  4JBK A;  1PRT B;  1AW7 A;  4NPS A;  1SR3 A;  2RKS A;  4FF3 A;  5C3W A;  3RZO H;  1CKN B;  1IYJ B;  1HCZ A;  4R4Q A;  5D3D A;  4C3J G;  4UP8 A;  4JI5 L;  2K28 A;  5C3E B;  2YV5 A;  1E24 A;  2MJ8 A;  3H0G B;  1EQR A;  4L5Q A;  3UDG A;  4XTC S;  4GNX B;  2F03 A;  3OIP A;  3CCS A;  2VUM G;  3OYY A;  3L7Z C;  4A3G B;  2FMM A;  1ESR A;  4ZCK A;  5LMN L;  1K3B C;  5C0X I;  4XT1 B;  5EGT A;  5EAY A;  1ASZ A;  4GKK Q;  2D0P A;  1PRT F;  4K5X A;  1YNX A;  4IFD I;  4KJO A;  4QF4 A;  3HOW B;  4DV7 L;  2N55 A;  1Z7T A;  1STG A;  4NXN L;  3T51 B;  1VF5 C;  3B6Y A;  4NB3 A;  1GJX A;  2M2L A;  3TP7 A;  5IOD A;  1WOC A;  4B9W A;  2WB1 G;  2DY7 A;  4JBM A;  1XWE A;  1TS4 A;  1NCV A;  3K5M A;  4G4K A;  1EU3 A;  1L1O C;  1TWA H;  1JJ2 A;  3J80 i;  1B9M A;  4DR6 L;  4DA2 A;  4DR2 Q;  4YY3 Q;  4IPH A;  4DGZ A;  4PZ7 A;  4LF5 Q;  1PH6 A;  1W2B A;  4RCN A;  2H5X A;  4TVA B;  1LT5 D;  3W2D A;  1HZB A;  2HHH L;  2D62 A;  2EE1 A;  3A7L A;  2NTT A;  4J15 A;  3DWQ A;  1SFO B;  1S5B D;  4ZAI A;  1I4P A;  1O7L A;  3HOX G;  3EJI A;  4A3F G;  5A2Q E;  3STB D;  3SXH A;  1XTC D;  4H13 C;  1JB7 A;  1QE6 A;  3IFT A;  4K6L A;  3PIO 3;  2X6L A;  3GO5 A;  3GP7 A;  3V2T A;  3E0J A;  2IJ0 A;  2ASB A;  1AE2 A;  3SVM A;  1MD2 D;  2E75 C;  4QIW B;  4ULL A;  5KNB A;  1NR2 A;  3Q0A A;  1G6Z A;  2LY7 A;  1D5Z C;  3PSI A;  3DXJ C;  4A3B H;  2AMC B;  1VQF A;  4FO2 A;  4QIW E;  1VQN A;  4DK0 A;  2A6E C;  4TSS A;  1V8Q A;  4H0L C;  1IKM A;  1FJG Q;  1VQD A;  1E22 A;  1K3R A;  2PQA B;  5C3E H;  5ELE A;  2BE5 C;  3FP9 A;  4QY7 A;  4HCE A;  4N8X 1;  2UUB L;  5IWA Q;  3H0G H;  1JWM D;  4XYO A;  3BVG A;  4GZY C;  3CQZ B;  2A68 D;  4TKO B;  4KN4 C;  3GD7 A;  1PYS B;  2XWJ B;  4PMW A;  2JA8 B;  1B70 B;  4KV6 A;  4RH6 A;  2QF7 A;  5HY6 A;  5EKI A;  1ZEQ X;  3J81 j;  1K9M C;  3J81 i;  2F0L A;  2HDL A;  2XWB B;  2A6H D;  2EYH A;  1M8A A;  4DV3 L;  3T1H Q;  2KOL A;  2R92 B;  4RGT A;  1W3S A;  4A3E H;  1G2S A;  1KNE A;  4U67 3;  2PCF B;  4X66 Q;  3SGI A;  2HT1 A;  4A3J B;  2CKZ B;  3E5S A;  4QL5 A;  3RNU A;  3HOW H;  4BXX G;  3FMC A;  4LUZ A;  1EY5 A;  4IOA A;  5GQO A;  2L9H A;  3T4A C;  4AQY L;  1HR0 Q;  3GTQ B;  3KBG A;  2CW0 C;  3M3Y B;  4A3I H;  1PMR A;  2GVB A;  1H9R A;  4K2K A;  1A2U A;  2B63 G;  1QUQ A;  1WCM G;  3KJO A;  1LYL A;  1YIT A;  3PO3 G;  1XPO A;  2BA1 A;  4X64 L;  1GVP A;  1K8M A;  2LKV A;  1LTR D;  2RVL A;  4FXK C;  4NXM Q;  1SRU A;  3V05 A;  2ENB A;  1KD1 C;  4XQJ A;  3MEH A;  5EBC A;  1XNR Q;  1EOT A;  2RCF A;  5K36 H;  4DK6 C;  4IAL A;  4GKJ Q;  2O5I C;  4GOP C;  1SYE A;  4A75 A;  4JBJ A;  3ULL A;  5AJ3 Q;  3VA5 A;  2SOB A;  1LTS D;  4DV4 Q;  1JWU D;  1FGU A;  3BZC A;  1H9K A;  1NAP A;  3BU2 A;  5IT9 c;  1SFO H;  3I4M H;  1G6P A;  1QG7 A;  1VQ8 A;  3QWN A;  2JP1 A;  4P72 A;  4JI6 L;  3CW2 C;  1OXS C;  1KLU D;  2DGY A;  1MJC A;  1SNM A;  3I73 A;  1PRT C;  3VR3 A;  2B2T C;  4B3R L;  3J80 E;  3PMF A;  4BBS B;  3F1Z A;  1MHW C;  4CKE A;  1OXX K;  3A55 A;  5IYB H;  3DM1 A;  2CHB D;  5LL6 X;  1SJH D;  1TQO A;  2F1M A;  2KQ3 A;  2B2W C;  5CYU A;  4CHT B;  5KYI A;  1GUO A;  1NR4 A;  1L0Y B;  4ZUJ A;  5HGT A;  3S17 H;  4JV5 Q;  2C9O A;  4RAU C;  2A6E D;  5DM7 3;  3MA2 B;  3HOY G;  3QO2 A;  1IBM Q;  3CQZ H;  2F0E A;  4XT3 B;  5EBD A;  5ELB A;  1E2V A;  4IUV A;  4U68 A;  1UAP A;  1KNA A;  3S1M H;  3CXC A;  2JA8 H;  1OO9 B;  1VQM A;  1IBK L;  2PI2 A;  2A73 B;  5I2X A;  2IX0 A;  3K0X A;  1V43 A;  1ONL A;  1CSQ A;  2R92 H;  2AKW B;  3UI2 A;  3T56 B;  1P16 A;  3HKZ E;  5IT9 L;  2J7Z A;  3NK9 A;  4DV6 L;  1XPU A;  4BWG B;  3PIO A;  3PV0 A;  4DR4 L;  2WKD A;  1XMO Q;  1LAB A;  1FL0 A;  1X3E A;  5I4D A;  5FLM G;  4DV1 Q;  4KD3 A;  1TS5 A;  3GTQ H;  5EQ0 A;  4DV0 L;  3C2P A;  1EY0 A;  4RHR A;  5C4J B;  1HHV A;  4QUF A;  2EJG C;  2IX3 A;  1HQR D;  2F3I A;  4KTA A;  3TME A;  2HD3 A;  2BH2 A;  1DYQ A;  3TP6 A;  4LJZ C;  1S3O A;  3J81 E;  5KGU A;  2CW0 D;  3L2P A;  5M5X H;  5IE8 A;  2B3G A;  2PW7 A;  4UP7 A;  4C1N K;  1EYG A;  1YVC A;  1N32 Q;  3KYH C;  2B8G A;  2UXC L;  1ILP A;  4TRD A;  1R9T H;  2ZJR A;  2NZ1 D;  1I94 Q;  1FNU A;  2J0T D;  3I3C A;  3GTK B;  1G2T A;  4K0K Q;  4C1N I;  2Q8R E;  1YNJ C;  5AFW A;  1YHQ A;  4OO1 G;  1XX8 A;  4KHP Q;  1HNZ Q;  1T5E A;  3NWT A;  1SYB A;  1CQF A;  1SRO A;  3KLS X;  2NVQ B;  4BBR B;  3ND8 A;  2R3Z A;  5CV6 A;  2RA4 A;  3H3V H;  5BR8 Q;  2OXP A;  1RJT A;  2FJ2 A;  4A3K B;  3VR6 A;  1GUW A;  3OMG A;  1G29 1;  5E3F A;  1HA5 A;  4KKU A;  4HSV A;  1PHJ A;  1TWH B;  1SYC A;  5FKA C;  2MHV A;  3VA7 A;  2OTJ A;  1BDO A;  1NSN S;  1HFN A;  4R8I A;  1O80 A;  3NE5 B;  5IGC A;  4GKK L;  5ELF A;  4L5S A;  4G57 A;  1I4G A;  1D6E C;  2IX1 A;  1GM5 A;  4CBV A;  3A8I E;  3FEW X;  4IPC A;  2EJF C;  4J1M A;  2MP1 A;  3S2H B;  4K2L A;  1WTO A;  3R93 A;  4HJ7 A;  4DU9 A;  4OIK A;  4HSP A;  4PV1 C;  2B2U C;  3U9O A;  3DEP A;  2LXJ A;  1VQ7 A;  2IWH A;  4R8N A;  2VQE Q;  4DR7 L;  1UEB A;  1IYU A;  3PIP A;  3Q22 A;  2CVR A;  5IOC A;  3AEV A;  1QVC A;  1RHP A;  2B2Y C;  2JA6 B;  2XRS D;  3AFQ A;  4KKT A;  3RMH A;  1SSO A;  2Z4I A;  3RLF A;  5M5Y B;  4BA1 I;  1RTO A;  4DR2 L;  2AUK A;  4YY3 L;  3D0F A;  2AQ2 B;  1EQT A;  4J6H A;  4LF5 L;  1AP0 A;  2FIN B;  1Y8N B;  5LHY 1;  1Q12 A;  4A4I A;  1QWY A;  2DN8 A;  4ODG A;  2N3S A;  1BNZ A;  4DNT B;  5FJ8 H;  4OX9 L;  1QUQ B;  1WJJ A;  4C56 C;  3GQB A;  1STE A;  2VW9 A;  2N8N A;  4X6A H;  4QB4 A;  1HRJ A;  1EWI A;  1WYD A;  3K7U C;  5A2Q L;  3HOU B;  1SYG A;  1YJN A;  1EY6 A;  2R7Z H;  1HUM A;  4ME5 A;  1N34 Q;  3MFY A;  1E2W A;  3H3V I;  1LTT D;  4BY7 B;  2R7F A;  2QCP X;  2I0Q A;  4HED A;  1SLJ A;  1IKL A;  1CHQ D;  3MFG A;  4L6T B;  3CME A;  2K75 A;  4B3S L;  5E4W C;  3MEF A;  2XGT A;  1FJG L;  5IGG A;  2EYL A;  1I5F A;  4P74 A;  4A3B G;  1TU2 B;  3BJU A;  1KXL A;  1YNJ D;  2ZTC A;  5IWA L;  1S5C D;  4OIJ A;  4BBR H;  4FF4 A;  1MSG A;  1LT4 D;  1H9S A;  1I50 B;  2E2I B;  3CCQ A;  3I72 A;  4RKB A;  1PH8 A;  3SEB A;  4A3K H;  4JI4 Q;  1ZYR C;  2A5H A;  5C3E G;  1FNW A;  3PF4 A;  5LMN W;  4LF8 Q;  3H0G G;  4C3I G;  3BS1 A;  3T1H L;  3M7N A;  3KFU A;  3EA6 A;  3QOJ A;  3D31 A;  3A8J E;  1DM0 B;  1XXG A;  3S16 B;  2P5Z X;  4X66 L;  4Z9C B;  1PH2 A;  1TWF B;  3W3A A;  3J80 c;  2YYZ A;  1VQO A;  1HR0 L;  3S1N B;  3J7Y W;  5KIX A;  4A3E G;  2F0H A;  4JI2 L;  4DR5 L;  1PH9 A;  1EY9 A;  1B50 A;  3U4V A;  3NHH A;  1U4P A;  4JYA Q;  2K5V A;  3HOW G;  3AYH B;  4CDE C;  3TS2 A;  1HFG A;  2NBF A;  3Q23 A;  1I4R A;  2VNU D;  3H94 A;  3PF5 A;  1VQ4 A;  4NXM L;  2JA6 H;  1A0I A;  4A3I G;  2PI2 E;  5JOB A;  1GUT A;  2QEX A;  1XNR L;  1PLF A;  4GKJ L;  2EQS A;  2NUC A;  5AJ3 L;  4IUQ A;  4DV4 L;  3FRP B;  1K8A C;  4DNR B;  2WAQ G;  2O5J C;  1EZ6 A;  1ILQ A;  3FKI B;  5K36 G;  3NPP A;  3M4O B;  1SBB B;  2LXK A;  1X56 A;  4A3D B;  1TR5 A;  1N33 Q;  2Z4H A;  3DM3 A;  3HOU H;  1S4Z A;  5NUC A;  1SDF A;  5A35 A;  3I4M G;  2NN6 I;  1IHZ A;  1P8L A;  4LUO A;  5C3X A;  2LS0 1;  2E8G A;  2I5H A;  2K01 A;  1XPR A;  2MNA A;  1DOM A;  2XVS A;  2QW7 A;  2NVY B;  3CU7 A;  4M1U B;  4LF9 Q;  3D8G A;  4IOC A;  5L37 A;  1NTG A;  5C4Z A;  3EN2 A;  2E2J B;  1UUP A;  3ERO A;  3J81 c;  4JV5 L;  4B9X A;  5IYB G;  4B3T Q;  2L4N A;  2GN5 A;  4HTH A;  2RQX A;  2MFI A;  1KL9 A;  2B29 A;  1LAC A;  1EYD A;  1HZ9 A;  4IJL A;  1I50 H;  2ICI A;  1TXY A;  1A8V A;  2BDN A;  4GN4 B;  4ZKB B;  4L5R C;  1AN8 A;  2XSC A;  3I90 A;  1ZYR D;  1EOV A;  5C0X H;  4R9W A;  3SK4 A;  1V1O A;  3S16 H;  2KHI A;  1B4O A;  1Y1W H;  3S2D H;  2XTI A;  2OCE A;  2L11 A;  4IFD H;  1TWF H;  5COR A;  2WKC A;  2KCC A;  1XMO L;  4LFA L;  3HOZ B;  1K83 B;  5M3F H;  4DV1 L;  5IGE A;  1EIY B;  4Y7N H;  3S1N H;  4KLK A;  3K7A B;  4DUY Q;  2CH4 W;  2D9U A;  3LX0 A;  4DV5 Q;  2CFM A;  2F0N A;  1MKH A;  4GOP B;  4F88 A;  1J8I A;  3NTI A;  5J22 A;  4A93 H;  4LF7 L;  1N32 L;  1W6K A;  4I7A A;  3D6C A;  2KEN A;  1C8C A;  1Q8K A;  2PNH A;  1I94 L;  2V4D A;  4H44 C;  2G9H D;  1MSH A;  2Y0S G;  2H1E A;  1PH1 A;  3CCL A;  4K0K L;  1PZJ D;  1TY0 A;  2PYK A;  4OWT B;  3UE0 A;  1GUS A;  5FK9 C;  4KHP L;  2ZXP A;  1WTQ A;  4MZ9 A;  2EYF A;  3M4O H;  2L55 A;  5IIF A;  4A3D H;  2K7V A;  3T13 A;  4C3H B;  2A68 C;  3GTP B;  1CKO A;  3BYY B;  1DZ1 A;  1Y69 U;  5BR8 L;  4L63 B;  1O7I A;  3S24 A;  4LFB Q;  3N52 A;  1EU4 A;  1N36 Q;  3C3L A;  4YCV A;  2A6H C;  1K8O A;  1GD7 A;  2E2D C;  3MHB A;  1HNX Q;  5M3M B;  2MO1 A;  2EY5 A;  1SNQ A;  4R1J A;  1X65 A;  3U58 A;  2J4X A;  1G91 A;  2YU9 B;  1TY2 A;  3FHW A;  2F3W A;  2O4X A;  4G7Z C;  2NZO A;  4FYD A;  3RUZ A;  2CCZ A;  3ZYY X;  4DKA C;  2A69 D;  2RCN A;  2ZJP A;  4WFN 3;  4QMG A;  4B3M Q;  3NTH A;  1OXT A;  5IP7 H;  2BOS A;  2G9D A;  4QJF A;  4F8M A;  1LTI D;  4DAY A;  3OHX C;  3JC6 6;  5BN5 A;  5CGK A;  3BDL A;  1NNX A;  1U4R A;  2JA5 B;  3JAM i;  1SND A;  1J5E Q;  4IPD A;  3N6R A;  5EPJ A;  1GKH A;  3FPU B;  1K83 H;  1X3P A;  5D14 A;  5EKL A;  1CUK A;  3QG1 A;  2E2H H;  2A74 C;  3K7A H;  5COY A;  5JJL A;  3I7F A;  4F87 A;  1FD7 D;  4PZ8 A;  3OW2 A;  2F0F A;  3TS0 A;  5JPM C;  1CT1 D;  2F0O A;  2QDL A;  1SEB D;  4DV2 Q;  4MN3 A;  3TSS A;  1GHK A;  1I4Q A;  1BVS A;  4BA2 I;  1N34 L;  1PA6 A;  3MXN A;  3CCU A;  3MVV A;  3NBH B;  4A3M B;  3GTO B;  1SJE D;  4LWC A;  3I70 A;  4RGO S;  4O0A A;  2O2L D;  3CC4 A;  1KLG D;  3I91 A;  3KF6 B;  2R7Z G;  1UE6 A;  4ME3 A;  4JI7 Q;  3M85 A;  4M8A A;  1U4L A;  3M4Q A;  4O1N A;  3J7Z C;  4FDB A;  3OWF A;  1Y8P B;  3GTP H;  4GN3 B;  2NTS A;  3KLR A;  4RWS C;  4BY1 B;  1S5E D;  2IPK D;  1AFP A;  3ITP A;  4JI4 L;  4MTK A;  1R4Q B;  3HRZ C;  2RBM A;  2A8V A;  4ZUI A;  4LF8 L;  3C1E A;  5M3M H;  5LL6 S;  4A3G H;  1DD2 A;  3BVM A;  4BS9 A;  2JEA I;  1N8R C;  4K8I A;  4LF4 Q;  1V1P A;  1B3A A;  2N49 A;  4HR7 B;  4A3K G;  4JI0 Q;  3ND9 A;  2YU9 H;  4PG3 A;  4E6I A;  4DFA A;  3P1H A;  1ENC A;  5CV8 A;  2D0O A;  4ID6 A;  3I56 A;  4C2M B;  1RCV D;  3KDF A;  2F0T A;  2NVX B;  1BO0 A;  1YNN D;  1O7Y A;  1VF7 A;  2Z9H A;  4MTN A;  4X3K A;  2AQ3 B;  3VYS A;  4JK1 C;  3RZD B;  2M9V A;  3OIQ A;  4JYA L;  1JQY D;  1SNP A;  1XYI A;  3PO2 B;  1RDP D;  4A3L H;  1W6J A;  2OEO A;  5IGD A;  2JA5 H;  2B8F A;  2F0D A;  4G7H C;  1TS2 A;  1HQM C;  5C4X G;  1N9W A;  4QUC A;  4XDX A;  4LFC Q;  4AIM A;  1HJP A;  4AYB B;  4KHV A;  3KJP A;  1BBX C;  2L1B A;  5EKK A;  1I3Q B;  2IT1 A;  2Z6B A;  1BQQ T;  4AYB E;  4LNQ A;  4NDX A;  1QNU A;  2SDF A;  4RKL A;  4DAM A;  3VDY A;  2L15 A;  3O13 A;  4O2D A;  3PIP 3;  4XXE A;  5ELO A;  4RGM A;  1N33 L;  1TWG B;  4OEM B;  5G3L F;  1JOR A;  1GHJ A;  2OQ0 A;  1WTR A;  4H7B A;  2MPM A;  2EXZ A;  3RN2 A;  2KED A;  4FXG C;  2QKI C;  4A3M H;  2K33 A;  4LF9 L;  1CHP D;  1A2T A;  4C3J B;  1PTO C;  4P71 A;  1RTN A;  4EQP A;  4HIK A;  4YCU A;  5F2D A;  2EYM A;  1KIX A;  1TWC B;  1X32 A;  2BA0 A;  4FF1 A;  4B3T L;  2IW3 A;  1Y14 B;  1VQJ A;  3BZD B;  1QB5 D;  2CQA A;  2I46 A;  3FDT A;  2VUM B;  2Q8T A;  1HH2 P;  2WII B;  5ELN A;  4DN4 M;  3H91 A;  1Q86 C;  4BY1 H;  2JEB I;  1PFM A;  1Q8I A;  3SDZ A;  1KQS A;  2B39 A;  4OEL B;  1ICF B;  2X69 A;  2HDM A;  5JAV A;  4HN7 A;  3HKZ B;  4HMI A;  3GTM B;  3T16 A;  1HXY D;  1Y1V B;  4X3S A;  1B2T A;  5GAE C;  1HR0 W;  3MAQ A;  4DUZ Q;  1VQL A;  1Q1B A;  3D4R A;  5GAH C;  4A3J H;  2NWG A;  2CH4 A;  1II3 A;  3VR4 A;  5C0X G;  3K57 A;  2NVT B;  1JE5 A;  3HFZ B;  4C2M H;  2UUC Q;  2WB1 B;  2NVX H;  1A3V A;  1Y1W G;  1QJO A;  4IFD G;  4RCO A;  4DUY L;  2C5C A;  3K6O A;  3M3Y H;  4X65 Q;  3RZD H;  1D7Q A;  2JJQ A;  4L5T A;  5M3F G;  2WB1 E;  3CP0 A;  4DAY B;  3PO2 H;  2K05 A;  2GA4 B;  1SE3 A;  2LFN A;  1QNK A;  4K5V A;  4RMF A;  2HIX A;  2HCC A;  1MJE A;  1DON A;  2XIW A;  1VQC A;  4ILW A;  4ZYS A;  2SNS A;  3L3O C;  2UUA Q;  3W1B A;  4DK1 A;  4HJ9 A;  1KAB A;  3S15 B;  2EYJ A;  3G7L A;  1X9N A;  2PNR C;  4ZLT F;  3HOX B;  4A93 G;  1U0L A;  4A3F B;  5CV7 A;  3K81 C;  3K5O A;  3CMA A;  4LW1 A;  4DR3 Q;  1O7Z A;  1EL0 A;  1Q46 A;  2V1C C;  4HJ8 A;  1E0B A;  1STB A;  1EFI D;  1I6V C;  1ET9 A;  3KK7 A;  1BCP D;  1VQE A;  3LWU A;  5I9O A;  3MWY W;  2EXD A;  4KY5 A;  1TWG H;  1K28 A;  5C5M A;  1BKB A;  1PDQ A;  1X6O A;  4DK3 C;  2AUJ D;  3CCE A;  1S5F D;  2L0C A;  4LFB L;  3G6J B;  3OW7 A;  4BBS H;  1N36 L;  4C3J H;  3H15 A;  4K14 A;  2CQO A;  1AZQ A;  4A3D G;  1HNX L;  1DOL A;  2F0J A;  3DHQ A;  3FPP A;  1TWC H;  1PTO D;  3D4W A;  2XN9 C;  4H02 A;  4JI5 Q;  4ZQ3 A;  1WFQ A;  1UE5 A;  4KKS A;  5KYL A;  1SE4 A;  4R4T A;  4B3M L;  3LWE A;  3MXP A;  2VQF Q;  5JJI A;  3KBX A;  1ASY A;  3K0Y A;  2ATW A;  1EUJ A;  1BXT A;  1Z6H A;  1EQQ A;  1JOQ A;  2VY3 A;  2JK8 A;  1Y1V H;  1KDB A;  2PMZ B;  5IY0 A;  3PQI A;  2EVB A;  3CRK C;  5LMN Q;  3EQL C;  2AQ1 B;  1PYW D;  3P75 A;  1VQI A;  1J5E L;  1IBL Q;  5FOB B;  5I9P A;  2AWO A;  4JBW A;  2PMZ E;  5IGB A;  2NVT H;  2B63 B;  1WCM B;  1FGB D;  3PUV A;  1HNW Q;  1TVX A;  4CDF C;  3TRZ A;  1VQB A;  4R4O A;  2ZTE A;  5C0X J;  5C4J H;  1NY4 A;  1QOH A;  2E5L Q;  3GTG B;  1VCI A;  2TSS A;  2MQH A;  2WFW A;  5E7N A;  3VYT A;  4IFD J;  5JEA H;  1QZH A;  2Q2U A;  4OON A;  3OOC A;  3IL8 A;  2K5D A;  3GV6 A;  5JJZ A;  1EIG A;  1S5D D;  3MZ5 A;  4DV2 L;  3S14 B;  3AFP A;  4G7O C;  2F52 A;  3S15 H;  2FHT A;  2ICE C;  2H4O A;  2EJM A;  3M4Y A;  3PUW A;  3KF8 A;  3GTK H;  3I55 A;  1B44 D;  1PV4 A;  2KHJ A;  2K52 A;  4HID A;  4JI7 L;  1C9O A;  1CKN A;  5GRO A;  1FNV A;  5KND A;  4P73 A;  1CSP A;  3NQT A;  2EY6 A;  2Z8L A;  3SE0 A;  4WJ4 A;  4JW0 A;  2Z1C A;  2NN6 H;  3DWA A;  2NVQ H;  4GNX A;  2K5Q A;  1SE8 A;  2Q2T A;  5M9O A;  1SNC A;  2PW5 A;  2ZJQ A;  1SYF A;  2RF4 A;  2PZU A;  1TWH H;  3HOY B;  1KDC A;  4LF4 L;  5IP9 H;  1SNO A;  4JI0 L;  3DLL A;  2OF1 A;  3T1Y Q;  2IY5 B;  1JJG A;  1ENA A;  1PFS A;  1D2B A;  5M3M G;  4A3G G;  1NMG A;  5FO9 B;  4L8J A;  1ET6 A;  1HUN A;  4KD4 A;  5CBA E;  4XQQ A;  3CC2 A;  3S2H H;  3S1Q B;  4HJA A;  4KY6 A;  2QIL A;  2FFK B;  2B2V A;  2BCO A;  1PZI D;  1EYC A;  4JOI A;  4LFC L;  1SAP A;  2K50 A;  2G5D A;  3MXU A;  5M5Y H;  4JI3 Q;  1WCM H;  2F0W A;  2IL8 A;  3PUY A;  2JA5 G;  1WI5 A;  1WTW A;  5M5W B;  2F0G A;  2Z6K A;  1SMY C;  3NBI A;  1CK1 A;  1QZG A;  3CHB D;  4RHS A;  1JT8 A;  1CM9 A;  3I4O A;  3WDN A;  3R2I A;  1WTV A;  5C44 B;  5I6W A;  1E2Z A;  4QQB X;  1EIH A;  2E74 C;  1D5M C;  4BY7 H;  2ZT9 C;  3J80 L;  2C35 B;  3G71 A;  5IYD H;  3RZO B;  1UE7 A;  2ZXO A;  5J39 A;  3K58 A;  1CKM A;  2A69 C;  3MC0 B;  3NEM A;  3OWE B;  3LNN A;  4QCL A;  1VQK A;  2DJF C;  1CFM A;  1IBM L;  1I4H A;  2RHS B;  5D3I B;  3U9S A;  1C4Q A;  2E2I H;  3TRE A;  3CD6 A;  3RLO A;  1EFW A;  4IJH A;  3QB3 A;  2D5D A;  3RD4 A;  2PPB C;  2DY8 A;  1Q82 C;  1CTM A;  2M00 A;  4XIG S;  4DUZ L;  2JA8 G;  1JWS D;  2K5W A;  2X6G A;  2HIV A;  1JIC A;  3W5O A;  1IYV A;  1FYC A;  2K5N A;  1IW7 C;  2UUC L;  5EPL A;  4V0B A;  2R92 G;  5CR3 A;  1BBU A;  1B1Z A;  1NBW A;  2HUG A;  4X65 L;  3S1Q H;  1DOK A;  1YHA A;  3QJY A;  4A3J G;  2F4V Q;  3L9A X;  4Q0F A;  4OGQ C;  1IXR A;  1L2F A;  4OHJ A;  2R6G A;  3SR1 A;  5FLM H;  1BCP B;  2GVA A;  4CKC A;  2XNA C;  3WOE A;  1KTK A;  2UUA L;  4GLA C;  1ZKO A;  2IHE A;  1VMP A;  5HGQ A;  5T1G A;  3J81 L;  4CJ1 B;  4HIM A;  3GTJ B;  4EQ5 A;  5I2Y A;  1OXV A;  1IL8 A;  1X3G A;  2R61 A;  2Q8I B;  3IFD A;  5M5W H;  4DR3 L;  4Q5V A;  2KJX A;  4KN7 C;  1RKN A;  4AYB G;  2LSS A;  3PGZ A;  3CCJ A;  1EYA A;  1Z47 A;  1PFB A;  3FKI H;  1PH5 A;  1PTO B;  4HIO A;  1C7Y A;  1JMC A;  1SMY D;  2F0K A;  1HNZ L;  1LT3 D;  2QEJ C;  4K6D A;  5JJK A;  5C44 H;  3TP8 A;  5GAG C;  2UXC Q;  1BCP F;  4EVO A;  4A3B B;  1YHB A;  2NVY H;  4A3C H;  3BDC A;  4MIU A;  1GUN A;  2E2J H;  1D1K A;  2EDG A;  2KEC A;  2F0Q A;  5DNF A;  3D3R A;  1BF4 A;  5DLQ E;  4BBS G;  3F8T A;  4JCV E;  4OXP A;  1X54 A;  3I4L A;  1LM0 A;  3D6W A;  1VQ5 A;  2F0I A;  3G48 A;  4ZKC B;  1VQP A;  1EQV A;  2Z0S A;  1XJV A;  4C3I B;  2VQF L;  4IPG A;  3NEN A;  1HA6 A;  3C46 A;  1YNN C;  1B3Q A;  4DAP A;  4LF6 Q;  1H9S B;  1PTO F;  1DJR D;  2ZXR A;  3T53 B;  1J6Q A;  3GDE A;  1UE1 A;  1WTX A;  3MXG A;  4IUN A;  1F9S A;  4GS3 A;  1XNQ Q;  3PCO B;  4DXG A;  4FF2 A;  2KCM A;  1H95 A;  2VQE L;  1FVI A;  3K5N A;  4YIJ A;  3AU7 A;  3ULJ A;  4A3E B;  1IBL L;  4FVM A;  3H09 A;  2FMC A;  5LMU Q;  3HKZ G;  4IZ8 A;  1QVF A;  2R93 B;  4DAV A;  3HOZ H;  1HNW L;  1Y1V G;  1G51 A;  1WD1 A;  1BUV T;  3I2Z A;  2RDF A;  2ID0 A;  3NUC A;  1WD0 A;  4OL7 A;  1K0S A;  1IW7 D;  1Q81 C;  2JXM B;  3DUZ A;  4A3I B;  2E5L L;  3ER0 A;  1B8A A;  3R8B A;  3AB9 A;  4DR7 Q;  1G8Z D;  3CC7 A;  3C1F A;  4POG A;  3HS0 C;  3I4N B; 
#chains in the Genus database with same CATH homology
 3CF5 A;  3HOV G;  3RLN A;  2WP8 J;  2N3S A;  3L0O A;  3GTJ H;  5JEA G;  5FJ8 G;  5FJ8 H;  5IYC H;  4OX9 L;  1QUQ B;  1E1T A;  1E1O A;  3G4S A;  1WJJ A;  4R4C A;  1PH4 A;  1K73 C;  4IO9 A;  4LUV A;  2UXD L;  2JA9 A;  2N8N A;  2WAQ E;  2VW9 A;  4X6A H;  4OO1 I;  1EWI A;  1WYD A;  2JA7 G;  2IHF A;  3K7U C;  2DUD A;  5GAE C;  1HR0 W;  3UDI A;  1YJN A;  4OX9 Q;  4DUZ Q;  1VQL A;  1Q1B A;  2R7Z H;  1N34 Q;  1XMQ Q;  5GAH C;  1YJ9 A;  4A3J H;  1XTD A;  2CWA A;  2EIF A;  1IBK Q;  3H3V I;  5C0X G;  4KI0 A;  2FXQ A;  4A76 A;  4ALP A;  1JE5 A;  3HFZ B;  2R7F A;  4C3H H;  4DR1 Q;  4C2M H;  2I0Q A;  2UUC Q;  1SLJ A;  1RL2 A;  3TEH B;  2NVX H;  1Y1W G;  4PZ6 A;  3CME A;  1KHI A;  2K75 A;  4B3S L;  3ICE A;  4IFD G;  4DUY L;  1NJI C;  3MEF A;  3M3Y H;  2XGT A;  4X65 Q;  3RZD H;  3E9I A;  2E5L Q;  4DV6 Q;  3ZJY C;  1FJG L;  1VQH A;  1D7Q A;  2JJQ A;  1I5F A;  4L5T A;  4P74 A;  4A3B G;  5M3F G;  1KXL A;  2WB1 E;  3BJU A;  3CP0 A;  4DAY B;  3PO2 G;  3PO2 H;  4DR4 Q;  2NN6 G;  4OWX B;  4Y52 H;  2ZTC A;  2N78 A;  5IWA L;  1D8L A;  2JA6 H;  2UXB L;  1A63 A;  4RMF A;  2HIX A;  4BBR G;  4YWM A;  4BBR H;  3OTO Q;  1MJE A;  4JI8 L;  2UU9 Q;  4B3S Q;  4DV0 Q;  1VQC A;  1JJC B;  3T1Y L;  3CCQ A;  2UUA Q;  3STB C;  3W1B A;  1QVG A;  1PH8 A;  1Q1E A;  4A3K H;  4JI4 Q;  4HJ9 A;  5C3E G;  1YEZ A;  3U4Z A;  1X9N A;  4YWK A;  3PF4 A;  2ALY B;  5LMN W;  4LF8 Q;  4A93 G;  1U0L A;  3H0G G;  4JG2 A;  4C3I H;  3S1R H;  1PH7 A;  1V1Q A;  2ZTD A;  3K81 C;  5IP9 G;  3T1H L;  4MNO A;  3CMA A;  2ES2 A;  4LW1 A;  1KRT A;  4DPG A;  1OTC A;  4DR3 Q;  3G6E A;  1YIJ A;  3KFU A;  1Q46 A;  1YZ6 A;  2V1C C;  3D31 A;  4YWL A;  4HJ8 A;  2KCT A;  3M4P A;  2ZM6 Q;  2K5H A;  3ULP A;  4X66 L;  4UY8 C;  4WJ3 M;  1X55 A;  1PH2 A;  3F2C A;  4RG1 A;  3CPW A;  2OTL A;  1VQE A;  2JA6 G;  2EXD A;  3A5Z B;  3KF8 B;  2JE6 I;  3J80 c;  2YYZ A;  4JBK A;  1TWG H;  1VQO A;  1HR0 L;  1BKB A;  1X6O A;  4DK3 C;  4NPS A;  4A3E G;  3CCE A;  1S72 A;  1SR3 A;  4JI2 L;  3RZO H;  4DR5 L;  4LFB L;  1PH9 A;  1CKN B;  1IYJ B;  4JI3 L;  4BBS H;  4R4Q A;  3U4V A;  2YTV A;  1N36 L;  2R93 H;  2A19 A;  3U50 C;  4C3J H;  4UP8 A;  2CQO A;  2K5V A;  3H15 A;  2JQO A;  4JI5 L;  4GLX A;  1PYB A;  3AYH B;  1HNX L;  3HOW G;  3TS2 A;  2YV5 A;  1E24 A;  1UWV A;  2HQL A;  4JI1 Q;  1BBW A;  1EQR A;  4L5Q A;  3PF5 A;  1TWC H;  1VQ4 A;  3UDG A;  4XTC S;  4GNX B;  1A0I A;  4JI2 Q;  4NXM L;  4A3I G;  2PI2 E;  4DR5 Q;  3CCS A;  2QEX A;  2VUM G;  4H02 A;  3OYY A;  1XNR L;  4JI5 Q;  3L7Z C;  4GKJ L;  2AWN A;  1WFQ A;  2YTX A;  1UE5 A;  2EQS A;  5AJ3 L;  4R4T A;  3I4N H;  4DV4 L;  4B3M L;  2MO0 A;  3UE1 A;  4X62 Q;  2VQF Q;  1K8A C;  5JJI A;  2WAQ G;  5LMN L;  1ASY A;  5C0X I;  1ASZ A;  5EAY A;  2ATW A;  4GKK Q;  1EUJ A;  1HNW L;  2D0P A;  2AHO B;  3K8A A;  5K36 G;  1EQQ A;  2Y0S E;  1YNX A;  3GTO H;  4IFD I;  2VY3 A;  5JEA J;  2LXK A;  2JK8 A;  1X56 A;  1Y1V H;  5IY0 A;  4DV7 L;  1N33 Q;  3DM3 A;  3HOU G;  3HOU H;  4NXN L;  5LMN Q;  3I4M G;  2NN6 I;  1P8L A;  3B6Y A;  1VQI A;  4LUO A;  1J5E L;  1IBL Q;  2E8G A;  2AWO A;  2I5H A;  1XPR A;  4NB3 A;  4YHH Q;  4JBW A;  2MNA A;  4A3D G;  2PMZ E;  3F2D A;  2NVT H;  3A0J A;  4LF9 Q;  4BY7 G;  1WOC A;  3PUV A;  4IOC A;  1HNW Q;  1NTG A;  2Q2I A;  2WB1 G;  1VQB A;  4GN5 A;  5IYD G;  3EN2 A;  4JBM A;  4R4O A;  2ZTE A;  3TRZ A;  1AE3 A;  5C0X J;  3J81 c;  5C4J H;  1NY4 A;  1VQ9 A;  4JV5 L;  2R7D A;  5IYB G;  4B3T Q;  3HOV H;  1L1O C;  1TWA H;  1VCI A;  2GN5 A;  2MQH A;  2WFW A;  4P75 A;  5E7N A;  3J80 i;  1JJ2 A;  4IFD J;  4DR6 L;  4DR2 Q;  1QZH A;  2Q2U A;  2MFI A;  1KL9 A;  1LUZ A;  2Q2H A;  3PUZ A;  2B29 A;  4IPH A;  4OON A;  4YY3 Q;  4JC0 A;  4PZ7 A;  4LF5 Q;  1HZ9 A;  1PH6 A;  4IJL A;  3J7A 5;  1W2B A;  1PVO A;  1I50 H;  2H5X A;  3E9H A;  4TVA B;  4DV2 L;  1HZB A;  3AFP A;  2OWO A;  2HHH L;  2D62 A;  4GNX C;  2JA7 H;  2F52 A;  4J15 A;  3S15 H;  1TXY A;  1A8V A;  4GN4 B;  3HOX G;  4A3F G;  3STB D;  4L5R C;  3PUW A;  2I5M X;  3GTK H;  1JB7 A;  1RIP A;  3I55 A;  1EOV A;  1HZA A;  1T9H A;  2UXD Q;  1GO3 E;  1PV4 A;  2KHJ A;  2K52 A;  3RR5 A;  3GO5 A;  3S16 H;  2KHI A;  4HID A;  3S2D H;  1Y1W H;  3LGJ A;  1L1O A;  2XTI A;  4JI7 L;  1C9O A;  2ASB A;  2OCE A;  1AE2 A;  1CKN A;  5GRO A;  1TWF H;  4DV5 L;  2F4V L;  4P73 A;  1CSP A;  1XMO L;  4LFA L;  3PSI A;  4A3B H;  5M3F H;  4DV1 L;  3A5U A;  4WJ4 A;  2AMC B;  1EIY B;  2RHQ B;  4Y7N H;  3S1N H;  4KLK A;  1VQF A;  4QIW E;  2NVQ H;  4GNX A;  1VQN A;  1EIF A;  4DUY Q;  1SE8 A;  4DV5 Q;  2Q2T A;  3UDX A;  1FJG Q;  1VQD A;  2CFM A;  1E22 A;  4LFA Q;  2RF4 A;  1K3R A;  4UPA A;  2PQA B;  5C3E H;  1YI2 A;  1MKH A;  2ZJQ A;  3FP9 A;  4QY7 A;  4GOP B;  1TWH H;  5IWA Q;  3H0G H;  2UUB L;  4A93 H;  4LF7 L;  1IL2 A;  4LF4 L;  2UXB Q;  1N32 L;  5IP9 H;  1I3Q H;  4JI8 Q;  4OWW B;  4JI0 L;  3IRB A;  2KEN A;  3DLL A;  1Q8K A;  3T1Y Q;  2IY5 B;  1M90 C;  2PNH A;  3GD7 A;  2VNU D;  1JJG A;  4TQU S;  1I94 L;  1PFS A;  1PYS B;  4JOI C;  4PMW A;  5M3M G;  1B70 B;  4A3G G;  1NMG A;  5HY6 A;  1YBY A;  1K9M C;  3J81 j;  3UDF A;  3J81 i;  2Y0S G;  4LF7 Q;  1PH1 A;  1U5K A;  3CCL A;  4K0K L;  3T1H Q;  4DV3 L;  3CC2 A;  3S2H H;  1W3S A;  4OWT B;  3UE0 A;  4A3E H;  3M7N A;  2CWP A;  2Z6K C;  3FKI G;  4X66 Q;  4HJA A;  3SGI A;  4KHP L;  2HT1 A;  3MXN B;  3CCV A;  4GLV B;  4MZ9 A;  3M4O H;  2CKZ B;  4QL5 A;  3RNU A;  4A3D H;  3HOW H;  4BXX G;  5C44 G;  4LUZ A;  4IOA A;  1CKO A;  5GQO A;  4AQY L;  1HR0 Q;  5BR8 L;  1O7I A;  3S24 A;  4JOI A;  5J3B A;  4LFC L;  1L0W A;  4A3I H;  2VL6 A;  2GVB A;  1MIU A;  2K50 A;  5M5Y H;  4LFB Q;  4JI3 Q;  1N36 Q;  2B63 G;  1QUQ A;  1WCM G;  1WCM H;  4YCV A;  3KJO A;  1LYL A;  1YIT A;  1GD7 A;  3Q8D A;  2VUM H;  1XPO A;  2BA1 A;  4X64 L;  1HNX Q;  3PO3 G;  3PUY A;  2JA5 G;  1GVP A;  1WI5 A;  2MO1 A;  4LF6 L;  4YCW A;  4NXM Q;  2Z6K A;  1SRU A;  4R1J A;  1KD1 C;  1X65 A;  3U58 A;  5GAD C;  1XNQ L;  1QZG A;  3FHW A;  1XNR Q;  4UP9 A;  2NZO A;  4DK6 C;  1JT8 A;  2CCZ A;  1PH3 A;  4GKJ Q;  3I4O A;  4GOP C;  1AH9 A;  4DKA C;  2RCN A;  2ZJP A;  4A75 A;  3GTM H;  3WWV A;  4JBJ A;  3ULL A;  5AJ3 Q;  4DV4 Q;  4B3M Q;  5IP7 G;  5IP7 H;  1OXT A;  1HZC A;  1FGU A;  3BZC A;  3BU2 A;  5IT9 c;  3BZK A;  5LMU L;  1SFO H;  3I4M H;  4QQB X;  1G6P A;  3PUX A;  1VQ8 A;  4QJF A;  4AH6 A;  4P72 A;  4JI6 L;  3CW2 C;  1VQ6 A;  1OXS C;  1LTL A;  3JC6 6;  2DGY A;  4BY7 H;  1MJC A;  2C35 B;  1E3P A;  3G71 A;  4DV7 Q;  1K0R A;  3KDF B;  5IYD H;  3JAM i;  4NXN Q;  1UE7 A;  4B3R L;  1J5E Q;  4IPD A;  3F1Z A;  1GKH A;  1OXX K;  5IYB H;  3HOZ G;  2VS1 A;  1K83 H;  1CKM A;  4GOP A;  3NEM A;  1CUK A;  1Z9F A;  1VQK A;  2E2H H;  1IBM L;  3K7A H;  4HJ5 A;  2RHS B;  5JJL A;  3I7F A;  2E2I H;  3S17 H;  4JV5 Q;  3TRE A;  1B7Y B;  3CD6 A;  4A3C G;  3RLO A;  3CCM A;  4PZ8 A;  1KC8 C;  4DR6 Q;  3OW2 A;  3HOX H;  3F2B A;  1I6H H;  3TS0 A;  4A3F H;  3HOY G;  3A74 A;  1EFW A;  4IJH A;  1IBM Q;  1Q7Y C;  3CQZ H;  5FLX c;  2QA4 A;  4DV2 Q;  1Q82 C;  5IYC G;  3S1M H;  2HHH Q;  1BVS A;  4XIG S;  3CXC A;  1X3F A;  4DUZ L;  2JA8 G;  2JA8 H;  2VZA A;  4BA2 I;  3M9B A;  1PA6 A;  1XMQ L;  1N34 L;  4R4I A;  1VQM A;  3CCU A;  2HIV A;  3NBH B;  1IBK L;  1VQG A;  2PI2 A;  3W5O A;  4LWC A;  2K5N A;  4DR1 L;  2IX0 A;  3K0X A;  1V43 A;  2UUC L;  4O0A A;  1CSQ A;  2R92 G;  2R92 H;  2AKW B;  1BBU A;  3CC4 A;  1NBW A;  3KF6 B;  4X65 L;  3S1Q H;  1P16 A;  3HKZ E;  4DV6 L;  1UE6 A;  4ME3 A;  1XPU A;  4JI7 Q;  3M85 A;  2R7Z G;  1YHA A;  3M4Q A;  4A3J G;  3PIO A;  2OQK A;  2F4V Q;  3J7Z C;  3PV0 A;  4DR4 L;  1XMO Q;  4FDB A;  1IXR A;  1L2F A;  1FL0 A;  1X3E A;  2R6G A;  2UU9 L;  5FLM G;  5FLM H;  3OTO L;  4DV1 Q;  3GTP H;  3GTQ H;  4GN3 B;  4JYA Q;  4DV0 L;  2GVA A;  2UUA L;  4GLA C;  2IHE A;  1IZ6 A;  5HGQ A;  2KBN A;  4JI4 L;  2F3I A;  4HIM A;  2BH2 A;  2A8V A;  4EQ5 A;  1S3O A;  4LF8 L;  2YTY A;  1OXV A;  5M3M H;  3JAM c;  3L2P A;  1K8G A;  4A3G H;  5M5X H;  1X3G A;  1OXU A;  3AQQ A;  5IE8 A;  1M1K C;  5M5W H;  2JEA I;  1N8R C;  2B3G A;  4DR3 L;  2UUB Q;  4LF4 Q;  4UP7 A;  1N32 Q;  2ZM6 L;  2A1A A;  1YVC A;  1Q12 A;  1EYG A;  1SN8 A;  2N49 A;  2QGQ A;  3KYH C;  4A3K G;  4AYB G;  2LSS A;  4JI0 Q;  3PGZ A;  3CCJ A;  2UXC L;  1Z47 A;  2YU9 H;  1R9T H;  1I94 Q;  2ZJR A;  3HKS A;  2K14 A;  3FKI H;  4PG3 A;  1PH5 A;  4HIO A;  3NEL A;  1C7Y A;  1JMC A;  1HNZ L;  1NE3 A;  1VQA A;  2D0O A;  3I56 A;  4BXX H;  3KDF A;  5C44 H;  4K0K Q;  5JJK A;  4DV3 Q;  5GAG C;  4DNI A;  2UXC Q;  1KRS A;  4MTN A;  3TQY A;  1YHQ A;  3EBE A;  4JYA L;  4OO1 G;  3CAM A;  4KHP Q;  1YHB A;  4APV A;  2NVY H;  2B63 H;  1HNZ Q;  4A3C H;  1C0A A;  4EX5 A;  4A3L G;  4A3L H;  4JI1 L;  3PO3 H;  1SRO A;  1E7Z A;  2E2J H;  2JA5 H;  1YJW A;  4AQY Q;  1L1O B;  4POF A;  5DLQ E;  3H3V H;  3F8T A;  5BR8 Q;  4BBS G;  4JCV E;  5C4X H;  2R93 G;  5C4X G;  1N9W A;  1X54 A;  4OXP A;  4LFC Q;  4AIM A;  3GTG H;  3GTL H;  1HJP A;  1G29 1;  1LM0 A;  1A62 A;  3KJP A;  1VQ5 A;  3G48 A;  1VQP A;  2I5L X;  5H1S E;  1PHJ A;  2Z0S A;  4X64 Q;  1XJV A;  1VS0 A;  2VQF L;  4X62 L;  2OTJ A;  4IPG A;  3NEN A;  2IT1 A;  4AYB E;  1KAW A;  2BH8 A;  4LF6 Q;  4LNQ A;  3S14 H;  4GKK L;  1J6Q A;  4DAM A;  3GDE A;  4QGU A;  1UE1 A;  3VDY A;  4L5S A;  3ERS X;  4GS3 A;  1XNQ Q;  2L15 A;  4O2D A;  3PCO B;  2IX1 A;  1GM5 A;  2KCM A;  3K80 C;  1H95 A;  5ELO A;  3I4N G;  1N33 L;  2VQE L;  1FVI A;  4IPC A;  3CPF A;  3E0E A;  3EIV A;  2OQ0 A;  3CCR A;  1NMF A;  3KF6 A;  3ULJ A;  2NZH A;  1IBL L;  4HJ7 A;  1V9P A;  3RN2 A;  4YHH L;  5LMU Q;  3RN5 A;  4A3M G;  4A3M H;  3HKZ G;  3KLW A;  4LF9 L;  1QVF A;  3W1G A;  3HOZ H;  2LXJ A;  2PQA A;  1Y1V G;  2K4K A;  1G51 A;  3KOJ A;  4P71 A;  4HIK A;  1S40 A;  2VQE Q;  1VQ7 A;  4JI6 Q;  4DR7 L;  4YCU A;  1UEB A;  3PIP A;  1SMX A;  3I2Z A;  2ID0 A;  3AEV A;  1QVC A;  1KIX A;  2BA0 A;  3AFQ A;  1Q81 C;  4B3T L;  4B3R Q;  2E5L L;  3ER0 A;  1Y14 B;  3RLF A;  1DGS A;  1VQJ A;  1B8A A;  4BA1 I;  4KHZ A;  4DR2 L;  4YY3 L;  3D0F A;  1HH2 P;  5ELN A;  4LF5 L;  4DR7 Q;  3CC7 A;  1Q86 C;  4BY1 G;  4BY1 H;  4POG A;  3HOY H;  2JEB I;  4A4I A;  1KQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...