2CWDA

Crystal structure of tt1001 protein from thermus thermophilus hb8
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
150
structure length
150
Chain Sequence
b'DRPVRVLFVCLGNICRSPMAEGIFRKLLKERGLEDRFEVDSAGTGAWHVGEPMDPRARRVLEEEGAYFPHVARRLTREDVLAYDHILVMDRENLEEVLRRFPEARGKVRLVLEELGGGEVQDPYYGDLEDFREVYWTLEAALQAFLDRHG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords low molecular weight phosphotyrosine protein phosphatase
publication title Crystal Structure of TT1001 protein from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 61
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2cwdA00
1VLZA 3H1EA 5JNWA 2GX6A 4D6YA 3QLUA 3QK7A 1BVHA 1EWTA 1QP4A 4L4UA 3FDFA 3RVNA 4RZSA 5JNRA 3B2NA 5KQMA 2FQXA 2J48A 4MGEA 4EGSA 1USGA 2QZJA 3LTEA 2QU7A 4H3KB 3N8IA 4G0YA 4KZKA 2PUGA 1JH9A 2FQWA 5FBKA 5GQSA 3H75A 1ZHHA 2MYPA 2LUOA 4TMYA 3SY8A 1M2FA 3FFXA 1JX6A 3O1JC 4WXMA 3EDCA 1CHNA 1PEAA 1URPA 2NT4A 3LOPA 4RSMA 2WB4A 2IOYA 1QP0A 4Z4FA 1DG9A 1K66A 2E4UA 2QXYA 2R48A 2JBAB 4HYEA 3LMKA 5TPZD 3RH0A 3F6CA 3O1HB 3DLHA 3CG4A 1DRKA 1FQWA 3O2QB 3HCWA 2DRIA 5EWJB 3TB6A 3GRCA 4G0ZA 4FB4A 2ZAYA 4O5AA 4G97A 3O75A 1RPJA 2M98A 3LUJA 4IF4A 3GV0A 2QW1A 2HQBA 4Z4EA 4KPYA 5FWYB 3LUDA 3F73A 5BRAA 2QSJA 4MR9A 3MM4A 4N0PA 3RVPA 3IP5A 3FFTA 2VUIB 3H6HA 4G0MA 4IILA 3JTEA 5TPWB 2MYUA 1SXGA 4FE4A 2FXIA 4IMJB 3ILYA 5IUKC 4D6XA 1FFWA 1GUBA 5F64A 1BDIA 4G0OA 3H1FA 4UHKA 3H5LA 5I4CA 5KQLA 1GLGA 3IP6A 1EHCA 3EAFA 4TN5A 3SG0A 4NCAA 4Z9AA 2IDMA 2HSGA 2PKXA 4MPTA 4ETIA 3LUFA 4LRQA 2L2QA 3CZ5A 3Q7SA 5B3JC 3TMYA 4B09A 5IX8A 5JNUA 3DGFC 1WETA 2NZUG 3MMNA 3HUUA 1FSPA 4IGAA 3F7NA 4MAAA 2Q5CA 2O20A 2E4YA 3QLVC 1W25A 4IMIB 5IULC 4EYGA 1Z25A 4JASB 4MLCA 1D5WA 1H9CA 4WT7A 1HEYA 2RJNA 2TMYA 4ETNA 3H5IA 4QYWA 3K4HA 3EULA 3O21A 2QR3A 1P6QA 4WXEA 5ED4A 2NT3A 3BRQA 1QO0A 5HSGA 4W5TA 1QPZA 4UHJA 4ML3A 2PE5A 1BA2A 1NXVA 4MR7A 3OQOA 1NXOA 1U8TA 2IPNA 5DKFA 1C0EA 1VPWA 2P9HA 1FFGA 1ZESA 1ZY2A 3FFWA 3L49A 4O1HA 4RY0A 5EWLB 3T8YA 1APBA 1QMPA 1NY5A 3QEMB 3TD9A 4OTZA 2HQOA 3N6VA 2ID9A 2B4AA 4W5RA 1JBEA 3CS3A 1U0SY 1JLKA 3LUGA 1JF8A 1NXWA 2GWRA 2XDYA 4MQEB 1A2OA 4RK6A 3KHTA 1SXIA 3MIZA 4RS3A 2VK2A 2LBPA 3RVOA 4Z4IA 5T3YA 3EQZA 1DCKA 2IPAB 3UK0A 2JVKA 4TLMB 1LJLA 2CWDA 2JBAA 5KWSA 2LP4Y 4MQFB 3HV2A 3TX6A 1JWLA 1Z2EA 3C3MA 3C3WA 5EWJA 1MB0A 3LKVA 2PUDA 2P4UA 5JNSA 1E6LA 4O1IA 1ISRA 5TQ0B 2MYNA 2L17A 2CD7A 2N9UA 4Z4GA 3A0RB 3OLVA 2PLNA 1L5YA 1TJYA 5FWXA 5KQGA 4NV3A 3QLUC 2FEKA 2FW0A 4QICA 4OATA 4WWHA 4HNRA 2FMKA 1DCFA 3K9CA 4XLTA 1ISSA 3I09A 2FMFA 4YWHA 4YCSA 4OLBA 5TPWA 1A04A 5KC9A 1Y1LA 3T6KA 1B00A 3CLKA 1AB5A 3IDOA 3L6UA 3OMXA 4RK7A 3D8UA 4RK0A 2JVIA 2PJUA 4S04A 1JFSA 4HNQA 5IUNC 1F4VA 3E3MA 2WJAA 3CHYA 5DLEA 3VNAA 4F8JA 4QYMA 3BREA 2I6FA 2PL9A 4P1ZA 4EVSA 2GBPA 5JNVA 3OQMA 5EWMB 2E4ZA 4GPAA 5JS2A 3IP7A 4LE1A 4JA2A 1KRWA 2H0AA 4YP9A 5TQ2B 1DBQA 5TQJA 2R47A 2JB9A 4MS1B 1TLFA 4PE5B 4Z4HA 4NICA 4EY3A 1E6KA 3HDGA 3OO0A 3Q7RA 4YV7A 3GBVA 1NXTA 2HJ9A 3N53A 3OMWA 1CEYA 1LJUA 3LUAA 2M1ZA 2ID7A 1DBPA 2HQRA 3JPYA 3CTPA 4E7PA 3DBIA 1DC7A 1KRXA 5C5CA 3H5WA 2PL1A 3TO5A 1OXBB 2E4VA 2BGGA 2FMHA 2QVGA 5ABPA 2IPLA 3QEMA 1PNRA 4N47A 4G0XA 3HS3A 1USIA 2AYZA 2WJWA 5IBQA 2IKSA 1GUDA 4XARA 2JCGA 5IC5A 1Z15A 4RK4A 4XAQA 4LDZA 4E7OA 3LUHA 4KREA 1JYFA 1SD5A 4YLEA 1ZVVA 3F6PA 4W5OA 1ZAYA 4MQFA 2PUBA 4F11A 8ABPA 4ETMA 9ABPA 7ABPA 3D02A 3OM0A 4IRXA 4Q7EA 1PNTA 1XHFA 2FKAA 2HPHA 2OQRA 3JPWA 3LKBA 1EWVA 4F06A 2FN8A 1P8AA 4RWEA 3O1IC 2VYCA 2L19A 5FBHA 3HSYA 3JY6A 3NNNA 1D1QA 4RKRA 1QP7A 3CKMA 5CNIA 1ZDMA 1QO0D 4EVQA 3DGEC 4LX8A 5CHYA 1JFVA 1J56A 1E6MA 3KCNA 3GL9A 2IPMA 3BRSA 3QX8A 1M5UA 1JL3A 3BILA 1MVOA 2PUFA 2JVJA 4HNSA 4XXHA 4YRZA 4Z9BA 1RZRA 2B1JA 1ABFA 2FEPA 2PMCA 1DBWA 4KK4A 1GCGA 1YIOA 4F12A 1QNLA 1LK0A 5HM6A 4RDCA 2X7XA 1QQAA 3KTOA 5TQ2A 2LIVA 3I5AA 4MS3B 3W9SA 2FN9A 1JFTA 4KQCA 3RQIA 3GT7A 3JVIA 2PUEA 4G0QA 3P9YA 4MRMB 3Q9SA 2E4WA 4KRFA 5KI6A 4H3HB 4MYRA 5HKOA 3CZCA 1Z13A 3M6MD 4YO7A 3N0RA 4D74A 3OLYA 4KVFA 3SQNA 4ZMSA 4G86A 6ABPA 3CU5A 3OLZA 5CNJA 1UDRA 4MR8B 1C4WA 2L18A 4MR9B 3OLWA 1YMVA 3KLOA 4RKQA 1MAVA 3M9WA 4KFCA 5FWYA 1CYEA 4Z0NA 2FEWB 4EYOA 1D4ZA 2LPMA 5KQPA 1M2EA 1NXXA 4JB0A 1JYEA 3EODA 3NNDA 4PICA 1Z12A 4S05A 3RVLA 2A9RA 3A3KA 1M5TA 4RU1A 3O2SB 4DQDA 4Z4CA 1F51E 4LE2A 1U04A 2VUHB 3OM1A 5BQ3A 3HEBA 2PUAA 4KNYA 3NNSA 1DCMA 3I42A 3EQ2A 3KLNA 4MLDA 5E3JA 1SXHA 4Q6WA 3QELB 1MIHA 1Z18A 3R0JA 3ROFA 5TE9A 1NXSA 1KMIY 3KSMA 1LBHA 3MA0A 1P2FA 1YTUA 4WUTA 3IP9A 5JS1A 1DP4A 1JDPA 3H5OA 3H5VA 4EVRA 4RK5A 4ZYLA 2MSKA 5IEJA 1YS6A 2GI4A 2WMYA 3OO1A 4N0QA 3A0UA 1T34A 3SAJA 2FLKA 1PUXA 3FMVA 1MB3A 4NQRA 2OENG 4P98A 3HUTA 3OLXA 4LE0A 1RNLA 3CG0A 5CNKA 3LUCA 4N41A 3Q7TA 3MYYA 4MR7B 1RXEA 2RGYA 3JVDA 1RXIA 1U2PA 1ZN2A 3H5TA 3NHMA 4M88A 3SNKA 2W42A 5DGCA 3GA5A 3M9XA 3RVRA 4FE7A 3KYJB 2PUCA 1ZH4A 2F8SA 5EWLA 1DC8A 1VRVA 1ZH2A 3Q41A 5D2CA 3O2JA 3EGCA 1GCAA 2JK1A 1EFAA 1FFSA 1A0OA 1USKA 4MS3A 3RVJA 4GNRA 3HK2A 4ZMRA 1L5ZA 2IYNA 4MQEA 4Y9TA 3T95A 3URMA 4ZPJA 4OG2A 4EUKA 3QEKA 1SRRA 4QPJC 4H60A 3IPAA 3KYIB 4MRMA 1EWKA 3C3KA 2FMIA 4Q6BA 4DADA 4RK1A 1YMUA 4MS4B 1DRJA 4RY8A 3CRNA 1ZGZA 1W9HA 2RJOA 5GOTA 4NCBA 4JAVC 5TPZA 3CNBA 2WWVD 1Z16A 3HDVA 4MR8A 5FWXB 1VKRA 3G85A 3OQNA 5DTEA 5T7BA 3RVMA 5TQ0A 3QX9A 3N0XA 3BBLA 4YS6A 5C5EA 2WRZA 1KGSA 5IUJC 1DJMA 3IPCA 4PZ0A 3UUGA 2QV0A 4F3TA 4YGXB 4G0PA 2V0NA 2A9PA 5JNTA 1PHRA 4KQ9A 2WY2D 3I45A 4YR7A 1EAYA 1YK1A 1Z2DA 2R25B 2H3HA 4CBVA 2R4QA 1RZRD 3C6QA 3G1WA 4W5QA 2YHAA 2A9QA 2JRLA 3ILHA 3SM9A 4XFKA 4KV7A 1TMYA 2YHBA 3QELA 3S99A 4ZJPA 1JHZA 3C97A 3KKEA 3MQ4A 3KJXA 2PAFA 1IIBA 3HJFA 5PNTA 1ABEA 3JS5A 3E61A 3FGZA 5EWMA 1E2BA 4W5NA 1BAPA 1YK0A 5BR1A 2AYXA 5KC8A 1PEYA 2FVYA 4PEVA 5BRJA 2NUBA 2CHFA 3RVSA 1K68A 2F8TA 4MS1A 1DZ3A 1I3CA 1YVUA 2FSPA 3GWGA 4LDAA 5B3JA 4JP1A 6CHYA 4Z99A 1D1PA 2FLWA 4OBBA 2A9OA 3CFYA 3QLVA 4JOQA 4TLLB 3LFTA 2E4XA 3DZDA 1QQBA 3KG2A 2KYRA 1LBIA 3UKJA 1QKKA 3O74A 3HXMA 4JB2A 3HM9A 3LUKA 5DCLA 3DLBA 1JDNA 3A10A 3N0WA 5HQJA 3HO1A 3GBPA 1TM2A 5IEBA 3ROTA 1NXPA 4PYRA 4RV5A 2FTKE 1Z17A 4EYKA 3KS9A 2RDMA 2MSLA 3MF4A 4RY9A 1Z26A 1BDHA 1ZGGA 3VNBA 1S8NA 3H1GA 1D2AA 1NTRA 1OXKB 2GKGA 1AB6A 5CNMA 3GYBA 3Q15C 2FQYA 4DN6A 4EYQA 2ZWMA 4RXTA 3QLTA 4OLAA 1U2QA 1XWWA 3T38A 3N75A 4KK3A 4MS4A 3HVRA 4WZZA 3RVQA 1XHEA 1TVMA 2CHEA 2NZVG 1BDJA 4LZLA 1R8JA 2QVCA 1P6UA 4KMRA 4N03A 4N76A 3RVKA 1ZITA 4RXUA 2MYTA 4RXMA 4XASA 1NATA 3EJWA 3H6GA 3HZHA 4L85A 1YS7A 3NBMA 3NHZA 2MSWA
chains in the Genus database with same CATH superfamily
2IHJA 3OHSX 5JNWA 3SS8A 1JKXA 2WKQA 3QLUA 4X63A 2H07A 2YC2C 4W1SA 4CKZA 1QP4A 3JZIA 4RZSA 1ZQ1A 4W9NC 1UXOA 5JO9A 1N1MA 2J8ZA 2QGFA 4RGYA 2HZ7A 4EGSA 2DERA 1WBDA 1W46A 3A4LA 3EWNA 4MHTA 4KQGA 1FDVA 2HN9A 4UFPA 4YJ2A 2FZGA 5FPTA 4AJPA 5F4ZA 1R9NA 1TM4E 1WP4A 1S5PA 2Q8NA 4EB0A 1GGMA 3B1FA 3ETCA 2F3SA 2I78A 3QU5A 3RS9A 2C7QA 3GX1A 1HQYE 4M9XA 4PTLA 3CPHA 1PQPA 2HF7A 4Y1RA 1DFIA 1J8DA 1JX6A 2FFBA 3T7DA 1IEXA 4OXYA 2ACWA 1LFAA 4LF8B 3ADKA 2V7WA 3L7LA 1K66A 4W6ZA 3F1KA 4Q1VA 2ADFA 2JBAB 3PHGA 3EGIA 2WQ7A 2V0GA 5HBGA 2GH1A 4X7PA 4IDHA 3CG4A 3RG8A 4A1OA 1V16B 1YDMA 3ABRB 3TBHA 2IYQA 1KZGB 4EHFA 3N5CA 2PGIA 1DAHA 2O4UX 1C9DB 4O5AA 4DNPA 2PA3A 4FZ5A 3N9IA 4HMQA 5EE0A 2AJDA 5CBKA 3IQZA 5J4KA 5JEDA 3G1UA 3KHUA 2B6NA 1SNYA 1Y80A 4ZO7A 2V8BA 1IM8A 4KCGA 4RFSB 2R9VA 3PU6A 1ADFA 2VHWA 5E2IA 5IN5A 4O63O 4BO9A 1U1GA 5MFPA 4NESA 4X24A 5DV9A 1OBOA 5F5NA 1RADA 3T3DA 3UB3A 2FETA 4DLTA 1UQRA 3GAZA 4EY7A 1AN9A 5K0TA 1BEEA 3TLKA 3RTEA 1VYHA 3KV1A 4U9HS 3CX7A 1IWOA 4I5DA 2CK3A 3L93A 4JVSB 1ZX1A 2HU5A 4RCZA 3UWMA 1RXUA 4V0RA 2FJPA 1L5LA 4E03A 1KE2A 1H1LB 2XNJA 1XWFA 3L7JA 5EIOA 4KN5A 2UYGA 3IUPA 1LTKA 1GYPA 4LRUA 1LDEA 4UEJA 4CQMB 4ETIA 1ODKA 1MHPA 1E9CA 2GPNA 1GKUB 3MB8A 3OZIA 2L2QA 1EP2B 3CGGA 4B09A 3HO6A 2DEUA 3Q9LA 4GYYA 4L6CA 2V7UA 1SQGA 3CWZA 1A7JA 2CBZA 2W58A 4IGAA 1MOPA 4Y0AA 4KHPB 1QYRA 4MJLA 3EEFA 4BLQA 3ZWPA 4M22A 2HTEA 3PS9A 4MKFA 2JCSA 2QLMA 3E1KA 4U00A 1MNAA 1NW8A 3GJQA 3WLAA 2TMYA 3QU9A 1QDLB 3NDJA 1AUXA 2ICAA 5FX2A 3RU3A 4D43A 4AMYA 1ZK3A 3MBKA 4H7DA 1T36B 2O8EA 5C1PA 2RI0A 4J0EA 1K7FB 4ML3A 4MV8A 1MO5A 3O94A 1VL8A 3IP3A 4PSKA 5FF9A 5CDYA 2JJ1D 2P62A 3KAPA 3U0VA 1APBA 4IINA 3OY7A 2Y1LA 4INOA 5LZ7A 3L0PA 3VOBA 4IXWA 3MXOA 1DB3A 1TKCA 1XZAA 2WG1A 3N6VA 5DB4A 1GGHA 3DQQA 1JLKA 2OORA 3I64A 4W1PA 4E3WA 4KPEC 4AJ4A 2YQ4A 3G2PA 2H5LA 4FEGA 3KOOA 4DF3A 2G8NA 4DLAA 3RS2A 1JFFB 4OQDA 3FTCA 5DBEX 1CB7A 1KIFA 4PO1A 2OCPA 3EXIA 4WDQA 1ZOIA 3EMVA 4N4AA 3UK0A 3VDNB 5HOEA 3HL4A 2BELA 1ZVKA 5AK6A 1WUJS 3FCSB 2OWDA 3LW7A 2V98A 4GE0A 1R8YA 2FG7C 3KYDA 4M1YA 3V33A 4KYIB 2IYPA 2RBKA 2RE8A 4GWLA 1ESEA 1MB0A 3KR9A 2JI4A 2GRUA 3MELA 5LUBA 4UVDA 3RYHB 4AS2A 5HPYB 5JZMA 3I61A 1C0IA 4JI5B 2OHVA 5TQ0B 1OU0A 1PFWA 4Z4GA 4IAOA 1VJRA 2N3ZA 2CZGA 4Y2PA 3PICA 4QICA 1KP9A 2CSUA 3GW8A 3OU2A 4KO4S 4LHYA 2SHKA 1GAEO 5JMPA 4D4GA 2XV1A 2P4EA 3PTZA 4C2UA 4F3KA 1SJ9A 2IUTA 4OLBA 1KHTA 4NIMA 3QNWA 1CHDA 3WMWA 4BMZA 2ZYDA 3ABZA 4G5FA 5KC9A 3T6KA 4MQ4A 5ILQA 5EJ6A 2M9MA 1KEZA 3UH0A 1QIMA 3HI6A 3MWFA 4BJ1A 4ON9A 4YCDA 2RI1A 3FHCB 5CLJA 1WKCA 1V8DA 3VXKA 1TU0A 2EP8A 2VJOA 2JI8A 1W87A 2CJYA 1N2BA 2PL9A 5J1TB 3THRA 1ZD1A 3RE1A 4GGPA 4TTPA 5HZHA 3GN1A 3NKVA 1XVAA 4KJXA 4ZICA 3A2MA 1W94A 3DV0B 5IASA 2V59A 1C9EA 1T13A 2QQGA 2WWFA 4Y6SA 3I1FA 1JKJA 3AKYA 3OZCA 1MC4A 1RAAA 3SZUA 3UY4A 1A5AB 3F6YA 3Q7RA 1ECLA 1TZJA 2RFLA 4FPXA 3HB5X 1OGYA 2KSQA 3GJ6A 1X7GA 2OWEA 3QXHA 3VUFA 3KJIA 2WUEA 1SBYA 1KDZA 1IHXA 3R3WA 5IZCA 5KYGA 4OKNA 4ZKEA 1XAIA 1RXCA 3IR7A 2DFTA 3M5WA 1NBIA 1Z5VA 5BSTA 4A16A 2Q3CA 1Z28A 2O0MA 2YRFA 1VHTA 3LP5A 1I36A 1BC5A 1IRIA 1VPVA 2X0KA 1X7DA 4DC1A 4G89A 4AZSA 2CEAA 2CNWA 1PNRA 2O3JA 3JQBA 3T9EA 4HX2A 4G0XA 4EW1A 2EBWA 3RYFB 4B8ZA 5CDTA 3C1AA 1RABA 4AZTA 1SY7A 1U90A 3CX4A 4MIOA 1JJVA 3DTVB 4LGVA 2BE9A 5A5VA 4EIWA 1A8IA 3ZD7A 1Z0SA 5ESWA 1KR2A 1G6Q1 4V24A 1JYFA 4F04A 4S1OA 2PUBA 2Z6AA 2I4NA 5DHPA 2FSUA 3TQSA 2ZJOA 3CEHA 4RX1A 3GLVA 1Y8ZA 4GRDA 2TRSB 4XB2A 3L3BA 3FYSA 4ER7A 2H0RA 1H6BA 2C78A 2HLDD 3A37A 3FYCA 3QMPA 1JG1A 2HXGA 4RWEA 3VDXA 2PKQO 4L8YA 5HHTA 1V26A 3GG2A 3JY6A 2Z0MA 5AKEA 4BVFA 3NOXA 1G55A 1K2WA 4ZRDA 1DKUA 3KKQA 3QWBA 3GYGA 4PNZA 1DKOA 4BXOA 3ZE1B 3ZDCA 4TV8A 1R3UA 4PPFA 2FEXA 1CUWA 4M7OA 4K9MA 4XGQA 1LQTA 2HADA 3KCNA 2VTDA 4I9UA 3K9QO 1FFXB 1GPWB 3L1HA 2XODA 1UXKA 3K5WA 1TK9A 3QJYA 5AOBA 3WB1A 3QVGA 3L41A 4HNSA 3W0LB 2IEGA 4WOCA 2Q9CA 3AEUB 2B1JA 3ZCQA 1FTSA 1HA3A 1PDVA 2PMCA 2WHQA 2XQJA 3H05A 4ODIA 3HKBB 1JG2A 2ONKA 2WF8A 4JN6B 3GLSA 3OJFA 2PU7A 3ZZTA 2D06A 5LIPA 2IUEA 2WWXA 3NMUF 1QQAA 1U7PA 3L79A 1DT3A 1T4MA 3SJBA 1LLQA 2AOVA 3H9JA 1UBEA 3K73O 2O2SA 2VPTA 2JFGA 2AQIA 2GNOA 2WUVA 3BMXA 1VIMA 3LSYA 2EKBA 4JL5A 3GRAA 3LLSA 3D4IA 3O93A 5CH3A 5EQTA 2PKYX 3C16C 3P9YA 2AJ8A 4FGLA 1UFKA 2UZAA 4QATA 1CQXA 2CKMA 4BBZA 4BMOB 4BNWA 5JH7A 1Y4UA 3N8GA 4JV5B 1I2AA 1WUKS 2FE1A 3N59A 4MYRA 3WIEA 5GONA 2B8EA 3ZY6A 1P7VA 4YO7A 2J3JA 4H7JA 1J8VA 2EWVA 3DLIA 4KQKA 3GGGA 3PC2A 4NENB 1GN9A 1QFXA 3E7FA 3H5NA 4MR8B 3VA7A 2Y67A 4MR9B 4MKHA 4QU9A 5KOHA 3L1JA 1UJ2A 2H4YA 3LXRA 4YV0A 6ADHA 3I9NA 2BGRA 2CFCA 2GYVA 3IHTA 3MAGA 4RPHA 4M6WB 5HE8A 5AM0A 2JC3A 4ZHQB 3CVVA 3ZV4A 5F7OA 4LCBA 1J0CA 1NX9A 3EFOA 1U0NA 5ALWA 5DYNA 2ENWA 2QRQA 5KYUB 4OK6A 4W6QA 2GVDC 2GGSA 5CM9C 1ANKA 4B2YA 1CR1A 4BVBA 4DQDA 4JMLA 3B3AA 4N6GA 1WWKA 4LE2A 1UANA 2YFKA 4I5EA 5AJXA 3ZWBA 1IM2A 2FEMA 4JBLA 4A6EA 4UM9B 4F96A 1Z6YA 4QU8A 5CFNA 1EE1A 2OCIA 4Q9LA 4Y6GB 4HVLA 4UAJA 3BICA 1DO8A 1NZDA 4FQ7A 1JIUA 4DRXA 3MT8A 4ERXA 2HPAA 5KDOA 2O8CA 1THTA 2W6IA 3I2GA 3GLFB 1D2RA 2QTAA 2VLIA 3C3XA 1LDMA 4YFYA 3QPAA 4Z3KA 1N5JA 3MD9A 3PUXA 5DVZA 3RCBA 4DA8A 1FFAA 3DEIA 2X3YA 1UCFA 1RKXA 1ZJYA 4X97A 3DV2A 1H1DA 1GIAA 3V8EA 2NG1A 3PKJA 3ZH9B 5KVAA 2Z8XA 3EDQA 4LXIA 2YZKA 4KSCA 4D9HA 5IT0A 3MFQA 2QT0A 1QQ5A 1OWOA 3JYHA 3HFGA 4O2AF 5ICFA 4DN6A 3BIOA 4KQJA 1SOAA 4LE0A 2J5QA 1E66A 1XRJA 1EQ2A 1JLRA 3CCFA 1NJ8A 2QMHA 1Q7TA 4DB4A 3NBKA 1Z6PA 3GZNA 3Q6MA 4JQOA 3OBBA 4MR7B 4DANA 3PWTA 1XCJA 4O2AB 4ZZ3A 1PBTA 4PZYA 2VS1A 1HRKA 2RCYA 2NXNA 2W42A 5IRCD 2BEUB 1YJ5A 2ZEJA 3DHEA 2HZBA 4XSVA 3VNQA 5CB4B 2WU8A 3L04A 2F4VB 1VRVA 1ZK1A 4B32A 3H9CA 3GOHA 2ZPAA 5SY4A 4B3DA 1XDDA 4D4JA 4JKYA 1VSUA 2PT7A 5FXMA 1RLOA 2ACEA 4PSAA 2Z43A 3GCXA 3WIUA 1UJCA 3NV9A 3HZOA 5CFQA 1GZHB 1Z2NX 1EDDA 2EG5A 4EG7A 1BW9A 4FMDF 3QW4B 4IRUB 1UXIA 1VPDA 4R71A 2ET6A 4P54A 3UUEA 1MO3A 1RHKA 2Q46A 2W2MA 3FTQA 5BSMA 1RCFA 1P2UA 4RORA 3UT5B 5ALQA 3MJVA 5KUTA 1RXVA 3PT9A 2YINC 3C8HA 2PGOA 3DNPA 2DOKA 1F48A 2JGRA 2R85A 3C74A 3L6BA 2UVPB 2HI0A 4L5CA 5LA6A 2JH9A 2Q45A 3D4NA 4YS6A 4IIVA 3H42B 1GUYA 1T4GA 1CB0A 1KAGA 1X7XB 1Y4AE 2QU8A 4LIPD 1KMHA 5G1OA 5JNTA 2F1RA 1KZ7B 3BH0A 3MOGA 3RRJA 3SDSA 1RWNA 1ACMA 1Z2DA 2R25B 5K3DA 3TZHA 1VA5A 1JP7A 4E5DA 3Q1LA 5DE3A 3IAS1 3IPRA 3P19A 3IEIA 4US0R 3TQIA 4BBPA 4MVJI 4C20A 4F7DA 4S1VA 3VR1A 2KM1A 3SWWA 1IEWA 3G59A 4U0JA 2J85A 1FNMA 1O03A 2C0CA 4J1TC 5C7YA 1L7VC 2CT8A 2OLEA 4ZJPA 4QWMA 4JI0B 3QVVA 2X5JO 4LWOA 3HBMA 3L0ZA 5FOWA 3RS4A 3FZEA 2XCTB 3EEQA 1TTTA 5EWMA 1ECGA 1ESZA 2ODEA 2RKOA 4FQ5A 2FP3A 3D5QA 4Y1RB 3WHPA 1SVIA 2E49A 5AW4A 1C7RA 3IQXA 1JWAB 2H5IA 1T4DA 5ITZA 4LDAA 2CD9A 3EWAA 1UJ5A 1PTKA 2D0IA 4LX0A 3VO8A 1P7YA 1NPTO 2WF6A 4ZI7F 3TW4A 1LPOA 2JIDA 3N58A 4E0BA 2CSXA 3NTVA 3BJEA 5E6UA 2WIGA 4CLXA 2WW8A 2Z08A 4JOQA 4JR0A 2P41A 4TLLB 4TT3D 2QMUA 2V1XA 3IEMA 4H6VA 1D2EA 1ULAA 1M7BA 1ZMBA 1PNOA 1NI5A 2Y0BA 2WKPA 3M49A 3O74A 4P9NA 4WOPA 5DP2A 4ZI7B 1BVUA 3QHQA 121PA 1EP1B 2EJTA 3PQ4A 1GFIA 3UW1A 2CHUA 1I94B 5J5VA 5EHXA 1YA6A 3HJHA 3N0TA 1KDTA 5TRTA 2JBHA 4L95C 4ZODA 1WB9A 1BFDA 2PT5A 4CTNA 1JYSA 3NEAA 1J0AA 1JDVA 3BYZA 4FNOA 2G25A 1SU4A 3LH5A 3DHYA 4W63A 1ES9A 2R62A 3M6UA 3ETDA 3L1KA 1AQYA 1MW9X 2CVOA 4J4TA 4I4NA 2RK3A 3KT3A 5H4HA 4EYQA 4D82A 2C61A 1VE7A 4XKJA 3X43A 2VA8A 1ZM2A 2ODNA 1RJDA 4GP9A 4LFAB 3PXDA 1UWVA 3SSAA 4TZ0A 2GNAA 4JI1B 4BNFA 5JYDA 1N36B 4N76A 3M82A 4V02A 4PQEA 3H11B 4HUJA 1C7QA 2CHGA 4BU0A 3H9GA 5DTQA 2RHJA 1RMYA 3GP5A 3EVBA 1DQPA 2QW8A 1CTQA 4M0FA 1B0ZA 2PLAA 2AFVA 1KZYC 3DE0X 2XAUA 3HZHA 1V1RA 3I5MA 3EFBA 2H1WA 2QL9A 3NBMA 1NYRA 4H9GA 1EESA 4XIFA 2GX6A 1NWHA 1UP6A 1Z37A 2GUGA 2OBLA 2UYOA 3AU8A 4P38A 2YMQA 3GLHB 3DZFA 4M1SA 5K7SA 2O8EB 4L4UA 4ACAA 4EA6A 4C6TA 1R6XA 3K35A 4MGHA 1Y0BA 5KQMA 1WNTA 1CF9A 1U0TA 4KSYA 3WJ7A 1USGA 2GZRA 2H11A 1TM1E 5G02A 2D1RA 1HURA 1HM5A 2IEAA 2QZJA 2YDYA 1JNYA 1EIZA 1ND6A 2XOEA 3COYA 3N8IA 3PL1A 4H3KB 4HDQB 5DMXA 4B2IA 1XA4A 4MVWA 1ICIA 1ZGAA 3M34A 4XIYA 5DCWA 4CL2A 1CE8B 1X6VA 1Y5LA 4BS9A 2VDNB 2FDRA 1NBWB 4HZGA 2CJWA 1QHNA 4XTCS 5DWQA 4XRRA 1I3KA 4A0HA 1RXWA 4PPGA 2J3LA 2WQ6A 3U9LA 1HNWB 3B6KA 1V5WA 4PC2A 1XP8A 3QF4A 4DY4A 3EXIB 3L4JA 1Q1NA 1QP0A 1CRQA 1UBHS 3DAPA 2P9TA 3K0EA 1B23P 3KYDB 4PLGA 1KJYA 4DREA 3BMQA 1TIKA 2ODTX 1P2BA 3GRCA 4BLPA 2G63A 4RDIA 1Q0PA 4NRDA 1IN5A 1T1IA 5TVGA 1I2BA 3I2KA 4PRZA 3GFRA 4RM2A 1ATZA 3PCRB 5DMHA 4EVIA 2VA9A 2HQBA 2GPTA 1JEQB 3GVXA 3P5SA 1LK7A 2PRSA 2EZTA 3QA3E 3REQA 2R87A 2C8LA 3H6HA 3ZY2A 2DWCA 2ZR9A 2GO1A 4HKTA 2ZUWA 1E2KA 2OZKA 1P4HA 3JTEA 1YBFA 2OGUA 4TSFA 1OHHA 3HVKA 3EC1A 3GD5A 4LQDA 1FUKA 1GUBA 1P45A 2JAHA 5IUKC 1E1RD 5L3ZA 3BT7A 4D8TA 2ADOA 2X0FA 5KQLA 2BEKA 3LAWA 5E9AA 3AJ9A 2X1LA 3B7GA 3SICE 2RAFA 1EHCA 2X4LA 3SG0A 1W2HA 3S2YA 4NCAA 1NXQA 1Z38A 2WUFA 1N2GA 4QOIA 5L6LB 2C2OA 1SHTX 2V6JA 5ECYA 3P9QA 4MV9A 1C3OA 3HB1A 3EUWA 3V5NA 1I4LD 1E2IA 3U4QA 2J9ZB 2XKJE 1RBYA 1NV8A 3KWLA 5HFNA 4MXDA 2R68A 1E5DA 1JTEA 3TLJA 2A6PA 4WECA 1MO6A 2IY7A 3CNEA 2HSZA 4PLHA 5C8XA 3W4KA 2O6HA 3FWPA 4Y2QA 4IIUA 2VSNA 3BKXA 1Y3BE 1NPDA 1H42A 2IOFA 2PSDA 2PZ8A 3CW8X 4G9GA 3UWOA 4H31A 4DMMA 5KPDA 3M33A 4FYPA 5AW9A 2A86A 5DM0A 3T1QA 5LKRA 4J90A 3ZGYA 1WKVA 4BFXA 2AHRA 1NJ5A 4OP2A 4RKEA 1M10A 2VH1A 2WJYA 1JILA 1T0HB 5CK4A 3FFWA 3IVRA 1QMPA 1JHAA 2H8GA 3HN6A 4UMVA 2ONZA 1JFLA 2WWTA 3N70A 3ONFA 1IOVA 4BTVA 4X1YA 5CX1A 3LUGA 4AX4A 4YCLA 1NXWA 4MQEB 3RT1A 3C41J 4RAOA 4ISCA 4YHHB 1TYEB 4QUHA 3QPVA 3DFMA 4FHEA 4CQLA 1RM3A 2GBCA 3RVOA 3UATA 5B12A 1R0BA 3D6HA 4P53A 3IQFA 4QSMA 4UEOA 1YUMA 5KINB 4IH4A 3WS7A 5F2OA 2PQ2A 4OFXA 3KB1A 1QDUA 1MV8A 2LP4Y 1Z73A 4EZBA 3C3WA 1ZGBA 4EF6A 3A4MA 5KVCA 4KACA 4WACA 2EFDB 2J3EA 3IAXA 1P1KA 4AUKA 2R6AA 1QRTA 1RZVA 1I4OA 1E6LA 1XCPA 2WG0A 3EBLA 1JQLB 3WVNA 1DRWA 3HP4A 3LDFA 1JQBA 2HRDA 5ULLA 3ZZ1A 2O3QA 2VJQA 2F43A 3GDGA 2GPAA 3JQDA 3QLUC 1K5HA 1QCDA 3K0SA 1U2GA 5TDHA 3RKSA 4DLRA 1QVVA 5GV8A 2RGWA 4BXOB 3QNMA 1K3UB 3K9CA 4XLTA 2QPTA 2Z9BA 4HLNA 2PX8A 4IVQA 5IP5A 1CT9A 2GK4A 3A1EA 5IANA 4C7OA 3UZUA 2HMYB 3PFFA 4TXNA 3HKDA 2Z5FA 3FKQA 1Q7RA 3N2KB 3Q87B 3KKKA 2Z9DA 2OLKA 4CM8A 2WAMA 4N1AA 4C3ZA 3ILVA 5IMBA 4IIHA 3ZD9A 5A02A 3H87A 3QVGB 1IBLB 2J5RA 3UKDA 2HSWA 2NNWB 1HR0B 1EUYA 5DLEA 1CJKC 4HAOA 2O4CA 4IXMA 4WZAE 4FEEA 3PUWA 2IS2A 2ID4A 1RYYA 2VAPA 4GEKA 5BVHB 4U7DA 1W73A 1TYBE 3DOEA 1Y5MA 2C88A 2EWMA 1L7RA 3FOCA 5JNVA 1OPRA 4GOLD 5JE8A 4HRAA 4WK0B 3W9YA 5J3JA 1QQTA 1TJNA 1QUEA 2Y99A 2H4HA 2YWBA 1RYBA 3DZIA 1WULS 3N39C 4MI6A 3I9FA 3TPZA 4ECEA 4Z4HA 5JVDA 3KT6A 3GI1A 3ABSB 4YP5A 4B7CA 1BSVA 1CY8A 3U4IA 2ODPA 2XJ9A 3HJGA 4KPGA 4E2XA 4BC0A 1N78A 2JLCA 3F6SA 4A73A 3CW2A 2BJHA 1KI6A 2WMOB 1RT9A 4M83A 5K0EA 1HOXA 3PC3A 3OTOB 2J67A 1X15A 1L4HA 1EFCA 1OY1A 4IFBA 5GONB 5DYGA 1NKVA 1R9GA 4WK6A 3LQ1A 1U3UA 4DIDA 3IDQA 1R0SA 5DLDA 3M5DA 2CNNA 1OXBB 2P2DA 2AG1A 1QV9A 1KFEB 1PYGA 2QJFA 2QMOA 3NWPA 2FMHA 1QGYA 5DN9A 2W2KA 4IIDA 3OQ1A 1M34B 1CUIA 3QVTA 2YV2A 1K8XB 3OLCX 1YONA 1TUBA 4LYDA 4M46A 3KEMA 5KX5A 3QHAA 1EGQA 4DG9A 3ZGVA 1E64A 2MR5A 2C9MA 1JEOA 2X5XA 3K8QA 4HCJA 3U7IA 3SOZA 2QTCA 4YDRA 2H7XA 1PL8A 1WV1A 1F8GA 3C1OA 4R2IA 4KREA 3IVCA 2DFVA 4U2FA 3ROQA 4Z5XA 4QWWA 5AP9A 3GJ4A 3GQBB 1YTLA 1LBTA 1VHWA 1W93A 1HY3A 2ZVQX 4NX2A 1Y3CE 4Q1BA 5LC1A 3UK2A 3ZWVA 2EYQA 2FKAA 3IE0A 3G9XA 3WFJA 5JZSA 4B3SB 5JS6A 3UEOA 5ES4B 4HEHA 3WIBA 3PRYA 2NXEA 5JD5A 2PWBA 2FRVA 1OI3A 3DEHA 4YMGA 4RZXA 2HSJA 2JEZA 2RGGA 1TRHA 4R8VA 1D1QA 1X2EA 4TLEA 3SPXA 3AUSA 4PN7A 1VGQA 3GNQA 1QHYA 1IJBA 3FVRA 4CKYA 1ZDMA 1RAEA 1BIFA 3HA2A 4MCAA 4L8FA 4LX8A 4Y7CA 1S2NA 2Y2VA 1VKNA 4FDLA 5BSGA 5KKCA 1EVKA 3IHWA 1C3XA 1UOOA 2OUIA 5HF8A 2FUG1 3AUKA 3V4PB 3W5AA 2V65A 2GT1A 3GMIA 2OORC 3ZZ0A 4HDNA 1GLNA 3ZV6A 4EA7A 2L82A 3K1TA 4G1MB 2MCFA 2AVDA 1GQFA 4H59A 4WFJA 4J76A 4E5YA 2HFJA 2MSEB 4S1NA 1DOAA 1IBRA 2RIRA 4UTPA 1VJ0A 1CRWG 2C00A 2P69A 2BSXA 4QKQA 5C52B 3M83A 4JLSA 4E08A 4PIPA 1WSBA 3II6X 1S3IA 2FWPA 3VPCA 3PA8A 3DT6A 3MLBA 1ZXXA 2HK9A 1L1RA 1U8XX 5LLTA 4Z0TA 2CLEB 5DM60 4F2PA 3BMCA 3SZ3A 1D2NA 2ZXUA 4Y2JA 1KIAA 1I7LA 2VR1A 4CG1A 1BW9B 2GPBA 3DCIA 3RSQA 3BSWA 4EA9A 5BORA 2B1QA 3UOWA 1P0QA 3F74A 4UE3S 4AZ3A 1XRMA 2J30A 2LCFA 4G2NA 3MLEA 1YIDA 5H7XA 3TLGA 4GKKB 3WDSA 1U3VA 4U8GA 3Q8LA 3CU5A 5DO9A 4BNGA 1C4WA 1F0KA 2L18A 5LA6B 3SS9X 4OHCA 3QYPA 1VJCA 2B2NA 1SWWA 3DZ8A 5DHSA 3QMMA 4L9AA 3GEHA 1L5OA 1I01A 2VKTA 4U7WA 2A92A 3TLMA 5KQPA 1SC6A 1U8YA 3ERCA 1EKXA 4MUKA 4XYEA 3U1TA 3TIIA 2UKDA 4YASA 3OU6A 3PJRA 2A9RA 1CC1S 2GKOA 1RI5A 2DY1A 1F51E 3P27A 1YE8A 1GV0A 1EA7A 4BNDB 2Z83A 3F9IA 3SN6A 5K0CA 4W9MC 4E5KA 3JRWA 2E87A 3I42A 3MK31 1ZRNA 5ILGA 4WLFA 4EY4A 2OBFA 2AFHE 4HNUA 2F9FA 4PR0A 3ROFA 1A5TA 3L1IA 1KMIY 2P9QA 3MA0A 2DGDA 3AKEA 2X7JA 4IFTA 3WBKA 3FB4A 1G8HA 2P11A 4R4JA 4JC0A 1L7XA 3NW9A 4GHWA 5PGMA 2W22A 2CKDA 4J6FA 2EQBA 1XMJA 1L7NA 1Z0UA 3DO8A 4LVCA 5THKA 3U3JA 3OFVA 1QANA 1QXSA 4KUHA 2QUKA 4P7BA 4RK5A 1T2CA 4ZQFA 5IZCC 1ONBA 4B6EA 1BJTA 3DEJA 4TTAA 4L74A 1Z6QA 1SXJE 3OOEA 2CXNA 2WP8J 4A0GA 5ITZB 3MGGA 3SAJA 1PUXA 4UCWA 4PYJA 4GL2A 4LY6A 2AI1A 1YB7A 3HUTA 1CS0B 4H27A 3PFIA 3WWEA 1RNLA 2VZ8A 2OD9A 1PYDA 1KAHA 4CU2A 2C4HA 4ZZ0A 2G7MC 5E6UB 2G1AA 1KP3A 4HJRA 2IY8A 3JQBC 3L9XA 3RUHA 4DIBA 1RXEA 1W4AA 2OCYC 2OHIA 5C7LO 1AUQA 4J75A 3WC4A 5LYJF 2QVZX 1F12A 1P7ZA 3K8YA 2C3UA 3L18A 2C5GA 5ALIA 5JWOA 1KO4A 2OOKA 3SJZA 5DGCA 3WQHA 1YRLA 4D9MA 5BSHA 1HDXA 4U1RA 2JRCA 2O1SA 3BBPA 4E12A 5LVAA 2PRZA 1N9ZA 4UHCA 3T54A 4BFCA 1R4AA 3T7KA 2IXDA 4P32A 3PZBA 4IV5A 4MKZA 3X44A 5EIEA 3ZI4A 5LYJB 3C4JA 2LXNA 3Q4GA 4FS8A 5DCUA 5K0NA 3HJTA 1YZYA 3PCXA 4B31A 2P1ZA 4R9NA 3T1YB 4RV4A 4Y9TA 2Q3EA 3QPCA 1XDUA 5DYYA 1KQOA 2VQ6A 1V5FA 2AKAB 4P5PA 3KYIB 4MUIA 2Y0DA 3SR0A 3U62A 4HN4B 1IEVA 4DADA 5AVZA 1P5JA 4RK1A 4WEOA 5KAMA 1U0FA 2V45A 1CLUA 3BIWA 4RA9A 4C0JA 4FEYA 3NOQA 3DE3X 3VR4H 5FADA 1CKEA 5FQNA 5TPZA 5H3CA 4G8CA 2YASA 2DHCA 4Z9XA 2QQ0A 3F71A 3Q6IA 2VZLA 1GDTA 4JDUA 4U7HA 4ZYYA 2VJPA 2WRZA 3QKUA 3M4XA 5I47A 4I5FA 1DJMA 2QX7A 4PZ0A 4YONB 4A0QA 1YACA 4GRAA 3K30A 1V1RB 4G0PA 4M9UA 4RIEA 3EXG1 3F97A 1EVZA 2WY2D 3A6ZA 4Q7LA 4P3NA 2JFQA 3RTDA 3TTWA 3W7AA 4E94A 4DV6B 1HL3A 4J1NA 4GR5A 1BXKA 4F46A 4C6TB 4TMVA 2A9QA 2JIZA 1U8CB 3B5EA 4O4IA 2HNKA 1J42A 1P3JA 2WKRA 4Q66C 4DRXB 4E21A 1O7JA 1U8AA 3HR7A 3L8ZA 3D7MA 3PNOA 4TSRA 3VDRA 3NAGA 1OA0A 4GC9A 1E18A 2AI2A 5EZYF 1QIKA 2V55B 2OXRA 4D0NA 5A4AA 4IOMA 1MPXA 2ATXA 4JGIA 1W36C 4Z3DA 3EK2A 3GXOA 2CJWB 4FOSA 4H4DA 4PVDA 4EPVA 4EY6A 1UBCA 2ZATA 1STOA 5H3LA 3QF4B 4GYKA 3HN2A 4FYHA 4OHFA 1AGPA 1L7PA 1V7ZA 2ZWAA 3G79A 4I1SA 4Y6OA 1XNRB 2QSYA 2L42A 2ECOA 2DZDA 2FLWA 2O0LA 3EC2A 4O4LF 4PAMA 4EWLA 1VMAA 4JHLA 4ALMA 1CQWA 5C46F 2BLNA 1KQGA 4IIJA 3BMQB 1COWD 1MC8A 3Q3JB 3DD5A 1NW4A 1XPUA 4IYJA 5A4MS 3ANSA 1P29A 3I23A 4DDWA 2CNOA 2Z57A 2WSBA 2FPOA 4DR1B 4IO0A 4QDKA 5SZJA 3REQB 2QE7D 4JJ8A 3TEMA 3S5JA 2GWHA 3OEHA 4J3FA 5HGJA 4XGRA 3C15C 3WWYA 3THWA 5B6JA 2GEJA 3QUCA 1LS1A 2G0TA 4JQCA 1BKDR 2EDAA 3BHJA 2WU4A 3GH1A 3TRIA 1K8ZB 1JDBB 2A4KA 1VL0A 3SGLA 1C5KA 1UQUA 2UYYA 3GYBA 4OLAA 2B94A 2ZWMA 4DEXA 2QNRA 3A1WA 1MJGA 1XWWA 2CCKA 3B52X 3B6JA 4URXR 3H97A 3LPNA 3PQDA 1C3OB 2AFIE 3ZPXA 3U4QB 1QIDA 3NI2A 1BDJA 4JI6B 2GN2A 1R8JA 3NUGA 1DJOA 4O2RA 4ILEA 2FCRA 3AERA 3HJNA 2IZZA 4RTPA 2BTEA 2BGLA 3S2GA 3KSAC 4DTIA 1V8FA 1DBRA 1KXJA 1UK9A 3A6LA 4QAQA 4JUAA 4B3GA 3IKMB 3JQAB 2BJVA 4YCNA 1G21B 1VRWA 2G0NA 2GXUA 1BN6A 1MJ5A 3NDRA 2XTMA 3RIXA 4D8WA 4DMLA 2BOVA 5LM3A 2DQKA 2VNIA 3GEBA 2AFHA 4GEGA 4M21A 3LRXA 5FPPA 4CFYA 1M67A 3L0SA 5A2QA 2IEBA 1FX1A 2FQXA 3FW1A 4M49A 3NR2A 5F52A 3E05A 3WGOA 1P1RA 3DQZA 2NZ2A 2GK3A 4UXHA 5HFJA 3Q8MA 2CMKA 2OGZA 4K1XA 2UVQA 5IHPA 4XUCA 1RFGE 3OESA 4EABA 2NN3C 3GFTA 1KBZA 1T6YA 3IR5A 1H93A 4NFHA 4U63A 2I6SA 4MA5A 3WGZA 1ZFNA 1ZHHA 5CX1B 4DDMA 1SXJA 2MYPA 1OTXA 4EHJA 1HMPA 4N18A 1SHUX 3LI2A 2H7VA 4MTLA 5B5SA 1OAKA 4KXNA 4WAUA 1NOJA 5KJ6A 4G37A 1GDDA 2XEXA 4HH0A 4IR7A 3O7WA 1WVMA 2R97A 2NT4A 2PLWA 3F0TA 3K16A 2C83A 4MA4A 2P6OA 1VMKA 2O2HA 1KOLA 3DDOA 3TE7A 1VDMA 4B4DA 2GPSA 2C5EA 1W0JD 1CJCA 2JFZA 2H18A 3AL3A 4ZT5A 3ZU2A 2J4DA 2DLDA 5HIJA 4EUSA 2H31A 3C6YA 3LO5A 1VCOA 4IUYA 4YK7A 3O75A 1C2TA 2M98A 1A9XB 1BD4A 1FMJA 4A6PA 3COZA 2AN4A 3UNXA 5LQNA 2P4SA 4Z4EA 1VXOA 2F43B 3PI6A 4F84A 3FGOA 2G9VA 4IW3B 4PNHA 4AJ1A 1SURA 4HWTA 2A0XA 4RTRA 4I1YA 1OV6A 4KMOA 3ZDRA 4MWCA 1PE0A 4W8OA 2IYUA 3HPQA 3BFJA 3S8MA 2O52A 1KAEA 1YSCA 4C7OB 1GT91 3L8MA 3SYRA 1IZ7A 3HKDB 3FPEA 4K88A 2AUNA 3ZCVA 4CT0A 2HDOA 3FCYA 1GG5A 3VPDA 2IUYA 2QUBA 4OQNA 2X8BA 3QVJA 3PHHA 3N28A 4ZDJA 3B9RA 2VPXA 3CLVA 3FHJA 1Y1PA 3E5HA 3FSJX 3NUZA 4Z9AA 5IJZA 2PKXA 2HA7A 3IPLA 4JQYA 3SEFA 4EMUA 4BUJA 3NRCA 4NXMB 4YPFA 1LRKA 5IAKA 1YD7A 1FOEB 4CGYA 2ZJ7A 3WSTA 4PQYA 5CFMA 1UDWA 3FCEA 4RVFA 2QIPA 3HUUA 4F1WA 2I9KA 1C29B 2JPDA 9MHTA 4EY8A 3BMNA 2XYGA 2OQ2A 1U1CA 3A9TA 5JVDB 1LDGA 3B6ZA 2IBTA 2P6PA 4N54A 1PKXA 2WWGA 3KU4A 4MLCA 4O6VA 5FKJA 3V4VB 2WNHA 3RIYA 4CG0A 4Z1MD 3VKHA 3ZHSA 1KI6B 2HT1A 3FVTA 4A9AA 3TQRA 4ZO4A 3QVUA 1POXA 1NLFA 1FJXA 5KTSA 2QS9A 4ZCSA 1X39A 2JAUA 4LAFA 5EZQA 2Q5IA 4BKOA 1TKRA 2QR5A 2P91A 5DKFA 3PUHA 5SY6A 1UIMA 4B34A 4AF6A 5B58C 5EEGA 2XGMA 2W2KB 4X9XA 1CUAA 4YXWA 1WXGA 3TD9A 2ZETA 1TQ2A 3EXFA 1U80A 4K6OA 3E35A 4F21A 2P7HA 1TUBB 4KFUA 1KSGA 1I4DD 5K8IA 4O4JF 1KU6A 5KX5B 3U7GA 3RO7A 3EGVA 3TLZA 1QR2A 1YKSA 4RK6A 3WMFA 5D5HA 5KWJA 2FSGA 1LLCA 4Z4IA 1CYDA 1ZH0A 1WD5A 1HKUA 1OSNA 4HYQA 1X9HA 5JALA 1XZ8A 3PUKA 1LF5A 4R54A 2AV6A 1DLIA 1G2IA 1J7JA 1F8UA 1EX1A 4HXFB 1RRMA 4N9QA 3HV2A 3HU5A 4GOOD 4O4JB 4WLVA 1DBIA 5I5GA 4XWKA 3CLSD 3HEMA 4UHFA 4A10A 1QORA 2XCSB 2EARA 4HQKA 5B4VA 2WF5A 2CD7A 1EFUA 4TZTA 3UFXB 3HGQA 2PUTA 2V7GA 3CN7A 4MJ3A 4PBTA 3GAAA 1GQQA 5T57A 1BE6A 1CUXA 1L5MA 1ZZGA 2D3TA 3ZNQA 2G40A 3GHHA 3BSYA 4EKEA 3G7NA 3EUFA 4BLRA 1TUEA 2ZRHA 1DWUA 2UUBB 2BGJA 3CF2A 4Z1OA 1J07A 4GL4A 5FPSA 5TPWA 4D42A 4KXLA 3HZZA 5K8UA 1WLSA 3ITDA 5K2MA 1ZOSA 4GI3A 5A2GA 4WNAB 3IOCA 2QWXA 4IHAA 4ND8B 5D7NA 3IA2A 4HDNB 2AFIA 1L6IA 2JA2A 4JYCA 1AGYA 3QEBZ 4JI3B 1RKUA 3QKWA 2FX2A 4G1EB 4LGMA 4CG2A 1MZPA 3S55A 5JRJA 1TVCA 5CPFA 5HA5A 1XTSA 2V9PA 1D07A 2E4ZA 3WWDA 2HHJA 5JS2A 3JASA 4MWTA 2HUPA 4Y18A 2EWWA 3R40A 4HGQA 5D3MA 2OVBA 4R1QA 1IFXA 1WEHA 1SMKA 1KSJA 1P4GA 1OV4A 1QUFA 3HPRA 5E1BA 4PFQA 2AMJA 1NRIA 3BMCB 2BHRA 1GFSA 1JQAA 1E3IA 2ODWA 5D84A 3TKLA 3ACCA 1E96A 2BCEA 2B61A 4A27A 2B78A 4B5LA 2O2XA 3TLGB 3IAM6 3Q3IA 3G9ZA 1JHYA 3PHJA 1E0SA 1Y1RA 2NQTA 2NVWA 4RC9A 1NPYA 2A78A 2R00A 1M9NA 4IJVA 1QQ7A 1SUIA 4WXYB 2GZAA 4WZ6A 5C7IO 3M0EA 1KYQA 3KZKA 2IOHA 1TNDA 2JFWA 1JDBC 3MQFA 5KJ1A 3HS3A 5ALVA 1A69A 1PK7A 2JGIA 1GZDA 1PJ8A 1P1CA 3B89A 5HJ7A 3DCJA 3OQVA 3CRZA 4RK4A 1FYFA 1L9XA 3O3MB 4OXIA 2Q4OA 4YP0A 3TTSA 5C35A 3RJTA 1SCNE 1O97C 4HLQB 4NS1A 2X5KO 2AMVA 3LDUA 5KHOC 3QV2A 4YGYA 3SBDA 4W5OA 3HTXA 2NV2B 4OGKA 4WLUA 7ABPA 4AJ2A 4IZOA 4MRNA 4BMCA 4YO8A 3PTLA 4O0LA 1XHFA 1T15A 3BH6A 1JEDA 1F17A 4AG6A 5K8TA 1LPAB 2W8ZA 4B6OA 1B6RA 3JZAA 3O1IC 4UEKA 1PLLA 4ZZ2A 3CUYA 3PGJA 2DWPA 1FU8A 1OT3A 3OOHA 2RG7A 4AF7A 3S5UA 3R6WA 1J33A 1K7XB 1UQTA 2HJVA 1J5PA 5AR1A 1RHMA 5EN4A 1VMEA 1KJJA 3QXGA 2WJZB 3PGXA 5T6MA 1EEXB 1P7PA 2OBXA 4JZKA 4BVHA 1QO0D 2VBGA 3ZHCA 5IYZA 3E8XA 1B1AA 2EP7A 4TQUS 1EH5A 2JI7A 1J0BA 2J9FA 2P4HX 3LBIA 3CKKA 3QXCA 1NVMB 3BILA 1MVOA 4DQUA 3O0TA 5KYXB 2JVJA 1YS2X 4OJMX 1J2TA 2LCIA 1KJIA 4GFDA 5D01A 4ARSA 4AX8A 4DV7B 5EPUA 2Z4SA 4B0OA 4ENTA 3CEMA 1VHDA 2GD1O 5JAPA 4MRAA 3V97A 2E6KA 3H3JA 3I30X 2G1UA 3Q40A 1H4VB 4X54A 1IU9A 1UJNA 1LK0A 1RU3A 1PD0A 3EC7A 3P8ZA 3QM1A 1IXRC 2BSAA 3FPAA 2OYSA 5HS6A 5DU2A 3KSBC 4WKGA 2HK8A 4LNHA 3ZW8A 4BC1A 4DDVA 1JFTA 4BX8A 4IJKA 1I80A 5J2UF 4P0PB 3QVKA 1W36B 3E23A 5DIZA 3RHSA 3QFHA 4ZT2A 2C1ZA 3V7YA 4DNOA 3N6XA 1VSTA 1U3GA 3CUUA 5L4NA 2P8SA 1EI9A 1K3FA 4RA9B 1LZLA 8GPBA 1U2GC 1TO1E 5E4YA 4ZYVA 3N0RA 4UNIA 4I7EA 5AM1A 2R86A 2SECE 4LOJA 1O95D 1EVLA 3IE1A 4B8YA 5J2TA 2OGTA 1S1CA 2PS3A 5BYJA 1DKRA 3IE2A 2ZULA 4E5NA 3MIIA 2OG2A 3AKZA 2LPMA 4MQ6A 4DCJA 3ZWCA 3DULA 1Y82A 1QIHA 4QBGB 4OQZA 2R5WA 5B7NA 1XZPA 5SZKB 1U9IA 2Q6OA 2QZ4A 3D6TB 4O02B 2IEDA 1I4WA 4C2AA 1ORDA 2HWKA 3BQNB 3LW8A 4AYTA 2VDPB 1ULBA 1Z7GA 1GOTA 1JKMA 4BKQA 1DCMA 4O4IB 4ZYXA 2ZBUA 4MLDA 4AU1A 3F46A 4ND5A 4LZOA 1NE2A 3WGMA 2RAVA 3R0JA 3P2JA 5HQTA 3PR2B 3KL2A 4EHDA 1PFYA 1UK8A 3F47A 5DNEA 3RRMA 1E99A 2I7CA 3M3HA 5EGSA 3ZIAD 2C2BA 5TJ9A 1S89A 4WUTA 1HE4A 2XAAA 4N3GA 5DGHA 1ZK0A 4N5HX 3AFMA 1IAQA 4UTVA 1WXHA 3FMOB 2PMWB 5A05A 3I2FA 3S70A 4RTJA 2Z5VA 3MWGA 4G5GA 2FLKA 3P9IA 4H18A 4KVGA 4P98A 5EPOA 5K3EA 3NGXA 3TEJA 5KYNA 3ED1A 1JWBB 1LC0A 1RXYA 4DLWA 4PNEA 3S1SA 3HFSA 4IIJB 5AHWA 2UUPA 1W5EA 2IELA 3R6LA 3GFOA 4QA9A 1WDKA 5F9HA 4HD8A 4QPPA 3EZYA 1SR8A 4FS3A 1RMQA 5C4IA 1P7CA 2AE1A 5ALHA 3BA6A 2HJHA 1ZJJA 4DGSA 4JUBA 1I6MA 4IFEA 3DEKA 3OBIA 3N05A 1AHNA 2GN4A 3JWEA 4Q3DA 4H6XA 4JI4B 1GCAA 1WDTA 3O4HA 4KYTA 4R3NA 2ODAA 4ZOLF 4WESA 4J94A 3THWB 2RGBA 1QTNA 1NP6A 4G5SA 2RD2A 1F0PA 1X14A 1WSWA 1ZWKA 2JDIA 4JU9A 2QDKA 4OO3A 3QEKA 5EP2A 2J3HA 1M2VA 3QHPA 2BGMA 5AKYA 3U81A 9LDTA 3HWRA 4GZ6A 2W6JA 5JFTA 1R0CA 1PDOA 3AB8A 3OMLA 2PMKA 1D9XA 1Q74A 2XWJI 3SR4A 2AH5A 3FJ1A 5AOCA 4P31A 3WADA 1NUQA 4P8RA 5GGXA 3E48A 4GBMA 2WHYA 2Y0EA 2WWVD 4XPZA 3RUIA 3THXA 4TXLA 3TPFA 4XYGA 5KNDH 1MABA 4TUYA 2ZSAA 3DOOA 3KDSE 5ALDA 1VE3A 1MF7A 3IJPA 4JBHA 1VCNA 3HCBA 3T61A 4K6CA 2NAPA 4NFYA 4Q4DA 3P97A 1KKUA 3WTBA 2GBFA 4G8DA 2CVHA 2IV3A 4H0FA 1F6BA 3NOOA 1VG8A 4R68A 4FC6A 1IH8A 1FUUA 3IT3A 4L8GA 1YC5A 4L8VA 4EI2A 4OF4A 1QCYA 1SK9A 2Z2JA 3OQ6A 4JFAA 1KEEA 2YTZA 4DV3B 3W2HA 5ICMA 1JEAA 3OTHA 5EUBA 1KK1A 2C5HA 3KB2A 1S8AA 4FFOA 5JNLA 1I9GA 2XDAA 5KHAA 3LYHA 2BCGY 2AR7A 2DQSA 3WJ2A 4BVJA 1NFFA 5IBCA 3CNOA 3E61A 3LQQA 5HFAA 1EXVA 5T4BA 3F9CA 2AYXA 4TROA 1PEYA 1C0PA 4JLUA 4PLVA 2CLLB 3O1LA 4MS1A 2Q5HA 3IMFA 3H2ZA 1THMA 3I4FA 5TV2A 4YV1A 1Q0ZA 2NO6A 3VDMA 2YZGA 3EGXA 5FV4A 5L3QA 4MDFA 3L0IB 8LDHA 1W581 3B36A 2X9NA 4FFVA 3EIWA 4LBZA 2PO5A 3T1HB 4HFNA 1HL7A 1NQOA 5A1TA 2YJ4A 3EZXA 4R6WA 3VJKA 3WJ1A 1L7BA 4W82A 4QAJA 2BJWA 4GRIA 1FPMA 2NU8A 4MP8A 2V7QA 3TIGA 5DCLA 3F90A 3PD0A 5AQEA 3THYB 2O57A 4BASA 1N0IA 2E5LB 3O82A 4KPYA 4BNXA 1EYZA 1IWBB 1CIPA 1Q0LA 1JT2A 2A5GA 2Q49A 1IY0A 1J9GA 1KYWA 4G5RA 3OTWA 4A8PA 3C6KA 1GVNB 2VPIA 4M0EA 1B6GA 1KK2A 4GYWA 1KY2A 2VHXA 3E1SA 4QYSA 5KPJA 4AP9A 1T5HX 4HQ0A 1NLUA 1X1TA 5AMXA 5B3LA 5BURA 2OC4A 2XIQA 4QECA 2R8OA 4CQMD 4DUYB 5ALTA 2OCDA 5CTJA 3P96A 3OIWA 4OBWA 1J90A 4RHFA 2R8ZA 4F4CA 1GNQA 1TW3A 2G5TA 4NYIR 5BOVA 4UULA 5FHQA 1TVMA 4TTRA 3CVJA 4V0ME 1L4UA 2BIFA 5ENDA 4JVOA 1WVIA 1A3CA 1D2GA 2B3TA 3HB4X 1C9YA 2BW0A 1BWRA 1WDWB 1C41A 1NQVA 3BMNB 5HJEA 1FYWA 4LNAA 3KQUA 1QTQA 4DIMA 2ZR7A 1UZUA 2I6GA 1QMGA 4HO1X 4K5QA 3QBEA 3OZGA 1HWYA 2I99A 1XC7A 1ZM3A 1EJBA 4I50A 5H80A 4PFKA 4YX9A 4IIFA 3ZX5A 2PPVA 1ESCA 1UXGA 3W5JA 1I1HA 1JVNA 3QZUA 3JXEA 1YR8A 3U4CA 1BVHA 1EWTA 2HJGA 4RPKA 1ZU4A 4FWIB 4CIXA 3ELWA 1NUTA 3KELA 5B4UA 3OPQA 3D7NA 1SU8A 3P9KA 2EW8A 3U44B 1AKNA 1U31A 1SVWA 1DQRA 1YAJA 4JYZA 3MOIA 3D4BA 3DBRA 3EXFB 2Q7OE 1W8DA 1I32A 3K09A 3PG5A 4IX1A 4DC0A 3SIPA 2IYXA 1H1TA 3L77A 1XEFA 4OXXA 1Z6GA 3SOPA 4NMLA 4DUZB 1IK4A 4U2EA 2QQEA 2QN3A 3U7QB 1P0FA 1DRVA 1H0RA 4MYHA 4A6DA 4E15A 3PJEA 1KI1A 1L8AA 3ORQA 4Z4FA 1DWOA 1N2HA 1XXHE 2Y6UA 5AK4A 2RH9B 2XUDA 1M6YA 4INAA 4B4UA 3CPEA 1A4UA 3C98A 3PPWA 3SCZA 2DTXA 1NIJA 1FQWA 4HHEA 3FWHA 2XYPA 2XGSA 4G0ZA 2A3NA 3FYDA 2ZAYA 4WCVA 1OI4A 1ECPA 2CXTA 3LUJA 2AG0A 1UZAA 3G8AA 4ER6A 2X2FA 3JD4A 4N49A 2QW1A 4ZO8A 4DYVA 5C8VA 3HWWA 1PSDA 4PX2A 4DMCA 3H99A 2O50A 2ARKA 2QSJA 3MM4A 3NBYC 3PDJA 2VH2A 5JROA 5ARCA 1YB4A 1G9SA 3EXAA 4JBYA 3BWYA 4G0MA 1PDWA 4ZRMA 3SEQA 1FP6A 1K6EA 2QRJA 3ABIA 1O0CA 5TPWB 4UHBA 1Z8FA 2RHDA 4BLSA 2MSNA 4BE4A 5KSOA 2HT6A 1EE9A 1UODA 5JZ9A 3EG5A 3QE0A 4X1IA 2GMWA 2FCAA 4RIHA 4UHKA 1Q6YA 2EIHA 4XM0A 2O54A 4B8WA 2AFIB 1GPBA 4A15A 2ECPA 2WVGA 2I4RA 3MRTA 4FD3A 2XNDD 2BMWA 4AVYA 5JSUA 2JFNA 2ATVA 5AOAA 4AP5A 2I4MA 3D81A 4HNVA 3STYA 3DYIA 1OIXA 3JASB 4FX5A 3MMNA 4KH0A 1TA4A 2JI6A 4RM3A 4YJ3F 4BQSA 4HTFA 4QRHA 3NS7A 5A4KA 2FZCA 4R1LA 3SHVA 3V4LA 4L08A 5EE5B 1BGWA 3GEEA 3GUUA 3PR1A 3FUXA 5T8KA 3ROZA 3G7SA 1RYZA 4RBNA 3S68A 2WYWA 2X0JA 4LC0A 3PDUA 4FKMA 1C1HA 3EVEA 5SZHB 3WHLA 1K92A 1U1IA 4FE3A 4GE3A 4WFKA 5BUCA 2B8JA 2MU1A 3BTOA 4Y98A 3V7NA 5L6MB 3QEAZ 1FBNA 1BDBA 1C8BA 2PV0A 2HDNB 4DSZA 3H8SA 3RAEC 1JW9B 1UJ6A 2AN1A 1OXTA 1J21A 2Q9BA 4FN5A 4BHTA 5K0LA 2CXSA 1JMYA 1Z36A 4UUNA 1TB4A 3O9ZA 4PXYA 1QQ6A 4MUBA 2PIAA 1TD9A 1MQAA 3L7AA 2GF9A 3SDZA 3TTXA 2B4AA 2F59A 2CV1A 4C0QC 3K0KA 4BUZA 4RTKA 3F78A 3DTVD 3A36A 2ZSKA 4RLFA 3ADOA 1JF8A 2XDYA 3BG5A 1JBKA 4JT2A 1YQGA 2OLJA 4DUGA 3MIZA 2AWOA 4YT4A 2PN1A 2QLNA 3E4CA 4KYUA 1X74A 1O94A 1UWCA 2Q2NA 3L6RA 4PNPA 3W6PA 1JXMA 1LJLA 2CWDA 4TVBA 1JWLA 2Q6IA 3OQHA 4US1R 2P6MA 5H5JA 2PPLA 3DZBA 4L5IA 3ZLUA 3VTAA 1LPBB 1ZYUA 1D8AA 1VE6A 2I71A 1J2JA 3LX4A 4IUCS 3ZOKA 1H4TA 3WGNA 2BM8A 1ZRSA 3I1YA 2ZI9A 1Y9ZA 3BF8A 3KQYA 1KF0A 4HQLA 4KHZA 5TARA 2XZLA 2PBZA 4NV3A 1T3HA 1V6CA 3EY4A 1JEEA 2C92A 3FR7A 1TPYA 2DETA 1U9YA 3CZQA 3GAFA 4F86A 2WTAA 4DMKA 3G0BA 2HMVA 3GJ3A 5B4TA 1AZSC 1KARA 1YXMA 1QFYA 2VSOA 1VFPA 4MYCA 1OF1A 4KB5A 4DCNA 5KTKA 1MA0A 2JEYA 2CHVA 1B00A 3KAJA 2BC9A 2NM0A 5AW1A 4BFLA 2J9FB 2D1QA 3L6UA 3E7XA 3OMXA 1MQ9A 3D0RA 4OKSA 3V46A 5JAHA 1UKEA 2RB4A 1Z68A 3JQ9A 4X93A 2RHMA 3DXZA 1HV8A 1BCSA 1SXJC 4INJA 1G8FA 5JAZA 4O3MA 2QN9A 4DARA 5AW2A 2W00A 2NNLD 4V0MA 3WLIA 4DV0B 5JUWA 2FOXA 3OUTA 4P0TA 4L9SA 3CR3C 1GRQA 1WUTA 2A1UA 2QY9A 2WVJA 5E3IA 2Q0XA 1C1YA 1YRHA 3M6FA 2I34A 3TNJA 2O3RA 1S3FA 3E0QA 3EGEA 5ARDA 3TLCA 3E9RA 4JOBA 4GX0A 1Q57A 3C1TA 4XD7D 4II7A 1OPXA 4IZIA 1DKQA 2F64A 3L7IA 3FRHA 4QOJA 1JPJA 1QIEA 1RS0A 1NXTA 1R0RE 4M8KA 5HCIA 3VR4A 3TJZA 3SXUA 4BP9A 1ODFA 1Z9BA 4RLQA 2ID7A 1DEAA 4C6SA 1YR7A 3UMYA 4QARA 5FL7A 4N3BA 1ZQ9A 3TFOA 2PDAA 1M8JA 2F00A 4E7PA 3LHKA 1DC7A 5FWNA 1OBVA 1HG1A 1V6AA 2DUUA 5HVNA 5J2TB 2IYEA 2BGGA 1NNLA 1M2GA 1TQ4A 3DNFA 4OI2A 1KOFA 5C80A 1JLSA 4CMAA 3T7RA 4YRTA 2TMGA 1CY7A 3TDKA 1T5BA 3OETA 3EVNA 2CDBA 1FP2A 1XXHA 4V0KA 5ADWA 1N6KA 2G07A 3FB1A 2MMCA 3NHFA 3S29A 5FPKA 5KTYA 3OIYA 4EGJA 5I9LA 2IX3A 4NV1A 5TXGA 2G3YA 5A3JA 3LXUX 4WUVA 5HW0A 3SSMA 5ICGA 1ZCFA 1U7ZA 2I76A 5CVDA 3B7PA 5JATA 2ZYWX 3JSXA 4R40A 4UHEA 5F2KA 2HIHA 5H68A 4CTOA 2EFEB 4Z54A 2YW9A 4ZREA 4KBGA 4A03A 4OJKA 2IHYA 5EQDA 1DEOA 3UN1A 4HPJB 4CUKA 4LI0A 1NP3A 5K03A 3EAQA 4R81A 2WILA 4FLFA 2QAJA 5A06A 4UZSA 1NHWA 3OJEA 2G09A 1KYXA 2EQAA 1UPBA 2CBGA 2AN5A 4MJ7A 1O58A 3JQGA 3RIGA 1W0CA 4KKXB 1OBCA 4RJKA 2DSTA 2BR3A 5LLDA 5A0VA 1YZTA 5B3AA 3MUNA 5KS2A 2M1XA 3DGEC 2AYYA 1LFDB 2E89A 1YJXA 3BXPA 3L43A 1UH5A 2Y1KA 1WY5A 2IVFA 2VDRB 3IDSA 3QPDA 3LLMA 4W7IA 4FFBA 2GB4A 4H16A 4PO3X 4QJIA 1TXGA 4D44A 2NMVA 2ZI3A 3GXBA 1KEPA 2FSFA 4UQPA 1C4XA 1E1CB 2IOQA 3MGCA 4CF5A 4C08A 4F5ZA 3LLCA 3IJRA 2NVBA 1MJHA 1X13A 1U7XA 1T8TA 1XZBA 3H9EO 4JC4A 3O5AA 2LIVA 4RVUA 4WESB 5FNVF 3BE5A 4IMPA 1RWVA 5K3SA 4HBGA 1KKLA 2FOLA 1TVKA 1ECCA 3HDTA 1GPH1 3H1PA 3D9QX 3MHPA 4PC7A 2J32A 3WMXA 1NUAA 1NR5A 3GVIA 2OSVA 2E4WA 2ENUA 2VP5A 3F67A 4NFSA 3RUCA 3S27A 1XNGA 3VM6A 5KVSA 2LCQA 5GIPE 3CZCA 5FORA 4LRYA 3WLEA 4JQZA 2YHIB 1IBCA 1N8KA 2DYKA 3THXB 2DQZA 3RABA 2VPQA 2XTNA 1Z6XA 2QZ9A 1MABB 1P61B 2PUVA 3E82A 4TUYB 4YUAA 3C3DA 4EJ2A 1UMKA 1MAVA 5FULA 1F3LA 1E8NA 5FWYA 3OEEA 1J8MF 1L7OA 2FEWB 2P9FA 3O4RA 1CDZA 4KQWA 2OZLA 4LK2A 1HRDA 2V03A 3BIFA 4O2BF 4DILA 2C2ZA 1E7WA 2GF2A 4LN1A 3WK6A 5BQFA 3BHIA 2RH8A 3KWJA 3WE7A 1GTSA 1T3SA 2FSVA 4OREX 4BX0A 4GAEA 3OJ0A 2DHDA 5H16A 2VF8A 5BWOA 5CT5A 5JC1A 1KEEB 3UMSA 1LS6A 3G0IA 3GLIA 2GK7A 2E7ZA 3GROA 3RNOA 4CEIB 1IPHA 4CUJA 1L4GA 2G88A 1ONSA 2Q5OA 3S81A 1WW2A 1Z8DA 3IIKA 4HGYA 3SFZA 1B0AA 3I6ZA 2WJIA 2HYIC 2DTEA 4G0NA 1IXSB 4ZGGA 5BY2A 4KQIA 2OV3A 2WIKA 2VYNA 1E6CA 1JDPA 4NYJR 1C0LA 3SK0A 5AESA 3A1CA 4DR2B 3PA6A 2ILTA 2H48A 1TI7A 2J46A 2XD9A 2C57A 4ZPXA 2C1EA 1M6VB 5HKBA 3D4OA 1T34A 3REOA 3PC4A 1MB3A 2PXAA 3EGXB 2I03A 4PQGA 1JTFA 3UXMA 3IELA 1JBQA 2R00C 4B2PA 1PFKA 1JAIA 4MUYA 1TJPB 3LBYA 3VZSA 4W1QA 3O9VA 4S35A 2DKFA 5AHXA 2NVOA 3TLBA 3LLVA 4OMDA 3AK4A 4UE6A 2YC4C 3TOCA 3I9OA 3Q0IA 1SQ6A 2Z1MA 4AMGA 4LHWA 3E9YA 4DAOA 2FMTA 1J8YF 4J0KA 2AZXA 3PJGA 4BKUA 1XMXA 4MUAA 3H6KA 2W6ZA 2FFHA 3GJRA 3TTYA 4DEVA 1EUCA 2GCGA 1AJEA 3VMFA 1LBEA 3CJQA 2X9QA 2F8SA 4HEJA 3LZDA 4URYR 1MJFA 1DC8A 1TK3A 1YI8A 2Z2XA 3F3MA 3UCEA 1L3CA 3O2JA 3SM3A 2V96A 1VPTA 3I37X 4RSHA 1EFHA 2B4KA 3DA8A 3D5EA 3OKCA 1T6XA 4HWPA 5H3HA 3RVJA 2XDQA 1C8KA 1W48A 2AMFA 4IJMA 5E6SA 3RM3A 1M8FA 4KQ6A 1ORRA 4OG2A 4E14A 1A5ZA 3KSRA 4HWRA 3RFUA 2ZI7A 1JN0A 1AA6A 3C3KA 1WX1A 4GOXA 3NDIA 3W5HA 2GAIA 4M9ZA 2QRNA 2ZBEA 3LFHA 4QPCA 1SVOA 1IQPA 3DLCA 4YWJA 3TSOA 1SG9A 4F5DA 5AW6A 3K9FC 2RJOA 3FMFA 1Z4MA 4TRNA 2F2TA 2PO7A 4L0MA 4EB8A 1KY5A 2AWNA 2ZJ0A 3T5BA 1HEIA 1DIRA 3HSSA 3I4CA 3IUYA 2ZUVA 4URFA 4PINA 3N0XA 5M2QA 4YH1A 4GPD1 2XGJA 4BVEA 1G20E 4IDFA 2PRJA 2CXXA 4I50B 4PLFA 2GXSA 3NBUA 1TJ3A 1VJDA 1YQDA 2JLXA 4WX2B 2ORVA 2R11A 4P81A 3B1KA 2BMJA 2YYYA 5F4BA 5FBRB 3F8SA 3VNVA 2R4QA 4ZVMA 5M7EA 3QI7A 2FFJA 3SFTA 4YR9A 2IYLD 2PWZA 4BWFB 2QVBA 2XRYA 3KLBA 1JQDA 5JIBA 3G0HA 4BNNA 3D1LA 2DM6A 5IVDA 2XADA 1LNQA 1R2QA 3FBWA 4I08A 1LC3A 4Q7JB 2HWYA 4OCZA 5BSKA 3U7HB 2IYOA 1E9SA 4EB6A 4XJVA 2C04A 4PHGA 4TKUA 4U5XA 1V8ZA 2WE8A 3C6XA 3D3JA 2NUTA 1UZNA 1BAPA 2B1GA 2JHAA 2WPNA 4HI0E 4BO7A 5CP8A 3RAFC 1JEYA 3DOCA 3NALA 1JHMA 2H29A 2QMYA 4BNVA 3PRJA 4QFCA 3BN3A 3TMAA 3BAZA 1I3CA 4CF7A 4BVLA 2IGBA 3HYNA 3L4EA 4JP1A 3C3JA 3CX3A 3SF8B 3T9CA 1D6MA 3TFWA 4Z99A 2WB2A 3HJRA 3WSWA 1AGXA 4TKLA 1HE1C 4BP3A 1YS1X 2OAEA 1GNLA 4MW7A 3VISA 3KIPA 3KG2A 1SIBE 2FN7A 1Z5WA 1XGKA 4RFLA 2VJBA 1V8BA 1B43A 1L8QA 2CYAA 3EVZA 3UV7A 1U9IC 3A10A 3D64A 4GNKA 3DVSX 4JEHA 5GZ1A 3R9XA 4WOBA 4CI0B 3UBMA 3GBPA 3NAMA 5FOXA 3UOAB 1HE5A 3QSGA 3S7TA 1YULA 1NXPA 5LDHA 4M36A 1Z17A 1F2TA 5E4JA 4EFKA 1HZJA 1I30A 1M3SA 1ZUIA 4FBMA 3A2LA 1I33A 2YWXA 3VKFA 4NZ9A 2OB2A 2HXSA 4X1IB 3VDQA 2GKGA 3WL3A 4F72A 5C8YF 2X77A 2JJ2D 1RPTA 1PS9A 5CNMA 4YRAA 4CQJA 4GMFA 4RF2A 3EF3A 4OMCA 3WAKA 3MWDA 1WM1A 1E2MA 4HY3A 3ZCTA 2G17A 4KODA 4NR0A 3G0GA 3H1BA 2IV7A 3TD2A 2WYHA 4V0SA 3WO1A 1Z5PA 4AUEA 5IF3A 1UR5A 4WY5A 1TA0A 2AUTA 3IODA 1FEZA 2C8VA 4LG1A 4C7VA 4ESHA 2LE0A 4HTFB 3ZK7A 1KTIA 2B9EA 3B9QA 4ANFA 5KJFA 3PXEA 4N3CA 1RTTA 3EMKA 1QKJA 3IJ5A 4L85A 1DHRA 1KR5A 4GKAA 4PHTA 2ZZNA 4OX9B 3KEFA 1WXQA 3H1EA 4BFUA 1KO1A 4ZAZA 1JJBA 1POWA 4M8SA 1E0KA 1GU1A 3GLUA 2I67A 4G56A 2EL7A 4LXTA 3RFCA 4FHZA 1Z7WA 4WD3A 5EY5B 1A72A 3OE1A 2HW8A 1SZCA 3NJ8A 1TC2A 2PNFA 5CB0A 4JXZA 2XMCA 1BQ4A 1Z5NA 1JKFA 2QTLA 3OJXA 4MP6A 3P4YA 4N0MA 3VJRA 3KKZA 1JH9A 3AW8A 4ACBA 5JJCA 4GO1A 4J2OA 1ILEA 2PR7A 2VP2A 5IS2A 4BNHA 4HS9A 2ORED 1TZCA 3AKDA 3FHOA 4GBJA 3DM5A 1KZ4A 3BOSA 4I6GA 2QM3A 3MOSA 2X13A 1K7YA 1A9RA 3KZXA 4UATA 3FUUA 1IZ8A 1DG9A 4AL4A 3ZHRA 2E4UA 3JWHA 1XRSB 4RF5A 4H6WA 4X6XA 2C3PA 4ZAVA 3RH0A 3C5HA 2E55A 3GVPA 1NNEA 3BERA 2Y1CA 3ZQ6A 3FSGD 4IGKA 1AZTA 4JBGA 4FB4A 1TM5E 4OGLA 4YRJA 4MITA 1Y63A 1CY1A 3TRFA 3FNQA 4UOQA 3GMTA 1W1UA 3LUDA 1UDXA 2Q5JA 2W6CX 3PLRA 3INGA 4LXXA 2PH1A 5DYTA 4TRMA 3RVPA 3FFTA 1FZTA 2WYVA 3ZWOA 3TSYA 1NBME 4ZFNA 3ZDZB 3BORA 3WB0A 4EG0A 3IQEA 1I0LA 4CJXA 3MZ0A 1N2CA 4K9KA 4XPIA 2MYUA 1ZA2A 2C77A 5FTNA 2EVWX 1DNPA 3I9JA 4J16A 4BB5A 4LF5B 4YI5A 2DU8A 3ADPA 1OR8A 4B3RB 1KMQA 4UTOA 5IWCA 1BCSB 2FR0A 5ALLA 4B73A 4B3MB 2OR3A 3EAFA 3PX3A 4H1UA 4QBIA 4CV0A 3SYNA 4R31A 4LMAA 1UOQA 3AR2A 4PV7A 4HB2A 2HX1A 3HFRA 3O38A 1W8IA 4LVOA 5T67A 4D02A 1BWSA 2DCMA 2DWOA 4XDHA 4YA6A 4XWYA 5D1NA 5JNUA 3TMYA 2VKQA 4ZZ1A 1G20A 2R6FA 3ZLJA 1D2HA 2HEIA 2D8AA 2H54A 4V3CA 2B7LA 4LRWA 1L5RA 4ZQBA 1ULZA 2BGIA 2E4YA 1XR3A 4D1YA 2VUTA 2NUPA 4TYMA 3ADCA 1N9GA 3LC1O 3NIFB 3M7IA 4EF4A 1U8EA 2FGKA 4TL7A 4MPPA 4LBYA 1CFJA 3SXUB 3H5IA 1KFKB 4TL8A 1NBEA 3WG9A 4MZDA 4JY7A 5GVSA 3WV5A 1SEPA 1GVHA 3I0NA 3D6FA 3C39A 4FDUA 4MVJF 4WXEA 5FRDA 3V1TC 1PLKA 2XOKA 3WYBA 1WL8A 2Y1FA 3UA3A 3HP1A 3T3IA 1U8TA 2BCJQ 3R8FA 1WDLA 5CVUA 2P9HA 2ERXA 4Y2YA 1ZOLA 3TW6A 3K6SA 2WINI 4PG5A 1X1DA 3TAHA 2E21A 2XMGA 2XMQA 3ANXA 2HCRA 2LDXA 3LOUA 2I1VB 4NBVA 2WYUA 3EGDA 5ER6A 2B7BA 2C9YA 1A2OA 2GEFA 4W5HA 4D80A 3DEYX 4JLJA 3R23A 4I66A 1A9SA 2BHTA 4H3SA 2J7PD 1AXGA 1SUFA 1BNCA 3V2IA 1NULA 5HZGA 3RWBA 2A5DA 3CEAA 3PJFA 3R7BA 1US8A 2WTNA 3H84A 4K7JA 1PHPA 4COKA 2P9JA 4M2LA 1FXUA 5HR5A 1Y3DE 4YALA 4WNCA 5BN1A 2C8KA 3FOWA 4BJ5A 2G06A 3G6KA 3HJAA 1BCRA 3QUQA 4HB3A 2CJFA 4PCUA 4LOHA 1QG2A 2NLOA 4LTNA 3EZ9A 5CM8B 4FOPA 4P86A 2EF0A 2FEKA 4TL6A 2EX4A 2WZQA 5EHQA 4D81A 1RZUA 2F7SA 3D4LA 5KTPA 4AS1A 4DS3A 1RHQA 1UZLA 4EEZA 3DV9A 5FPYA 4PFJA 5CIYA 2EKQA 2VN8A 3DWEX 3UGKA 3VR3D 5JY6A 3WL5A 4A6XA 2GJ4A 4QU5A 3CTMA 1O1YA 3W5UA 5BNTA 3B1WA 1NRWA 3GZJA 3K09C 3STUA 1MO2A 2Q2QA 2O07A 4HNQA 2CCJA 3IXQA 4OU4A 2VXOA 1S3SA 2CVPA 2R96A 3A6KA 2MSCB 1E2FA 3BWMA 3NGMA 1FB5A 4FLMA 3AOGA 3IAUA 5EFZA 3TIXB 4ARZA 4M98A 1P5ZB 4EVSA 1NSTA 1YCGA 3Q9NA 4UVGA 5FOUA 3PD7A 3FZQA 5AW5A 2XR1A 4Q4CA 1IN8A 4LE1A 3AYXB 1SB8A 1XEWY 2W11A 4IRMA 1U0JA 4TXJA 3ZTWA 2JLAA 2BISA 1LSOA 2FSHA 4H15A 4FJ1A 2DPMA 4WH0A 4ZEOA 1AURA 4PPYA 1K08A 1TVKB 5KQRA 2HDHA 4IEEA 1E6KA 4PN3A 4P58A 4RULA 4P4NA 4RENA 5DNUA 2NADA 3KJEA 2DY0A 4CM7A 3SHWA 4MB2A 4MRPA 1N2IA 3N8HA 1TU3A 3E9CA 5KNDA 1GAJA 1QAOA 4G23A 4AY3A 1NQAO 1BE8A 1KH1A 1N1DA 2NTVA 4HP8A 3IVMA 5AJVB 5KJEA 4EJSA 4W4TA 1WD7A 2XF8A 3BC1A 3GZTB 3ECCA 3GARA 2E4VA 3HXOA 4LWZA 2DAPA 4KPUA 1EM6A 5IVHA 1CRZA 2QAGA 4BO4A 4X44A 2QPOA 4REQA 3VH2A 4D8XA 1C7JA 1PJ3A 2FSIA 3QQPA 4P5EA 4UZFA 2JLZA 1P0PA 4QIHA 5B2EA 1NT2A 4FGWA 5E6RA 5IAAA 3TVYA 2VHCA 4KX5A 3UGQA 5I8ZA 2AEMA 4Z4QA 2DXIA 1KWGA 3S1LA 2F9LA 1P1BA 4MQLA 2QX9A 1NBAA 2COKA 4YLEA 1UPCA 1WPGA 3IQIX 3GLIB 1N2ZA 2RARA 4ETMA 5HOQA 1XJQA 3H0EA 1T6NA 3HR8A 1P1HA 1FDSA 4RACA 3KKNA 3F3SA 1GRVA 2J4FA 2J3DA 5T8KC 3BB1A 2GD0A 4P7FA 2L19A 3K1JA 1MU0A 3ESQA 5CHEA 3ZWWA 1NBMA 4OQLA 5FI0B 3PQ2A 3EIEA 4B83A 4G09A 5IT5A 2CLIB 2TSYB 4L5AA 4PYQA 1XQYA 2XUPA 3BXZA 1TQDA 4IEFB 3ZKWA 5BMOA 2ZB4A 4RH1A 4YT8A 3EPJA 4ISBA 1TT5B 3M4ZA 5E1DA 3KQKA 2O48X 4AZ0A 4KLAA 3BWEA 4QNMA 5T4FA 5HKAA 4B4VA 2P0AA 1E3TA 4F6LA 1S6YA 1EHIA 3T9FA 1J0EA 1U02A 3SJ7A 1V1MA 1Z3IX 5IDYA 3FZYA 1RPZA 5CVVA 1U6KA 1YR2A 4FINA 4EKYA 1RZRA 4H4CA 2X9VA 3LX5A 1ABFA 1EUCB 2FEPA 4HGPA 3RK0A 5ARBA 3L06A 1DBWA 1GZ4A 4ND3A 5SV2A 3TAXA 4AM8A 3C6BA 3G2OA 2AR0A 3BDIA 1R4NA 1YL6A 4WNIA 1I1NA 5A04A 1O94C 2C7RA 1GL9B 3CSSA 4OLHA 4OHZA 1T9AA 4DWVA 1LPNA 3I92A 4C6HA