2CWDA

Crystal structure of tt1001 protein from thermus thermophilus hb8
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
150
structure length
150
Chain Sequence
DRPVRVLFVCLGNICRSPMAEGIFRKLLKERGLEDRFEVDSAGTGAWHVGEPMDPRARRVLEEEGAYFPHVARRLTREDVLAYDHILVMDRENLEEVLRRFPEARGKVRLVLEELGGGEVQDPYYGDLEDFREVYWTLEAALQAFLDRHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords low molecular weight phosphotyrosine protein phosphatase
publication title Crystal Structure of TT1001 protein from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 61
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2cwdA00
5C5CA 3GT7A 4UHJA 3O74A 3O75A 3BRSA 3RH0A 2PUAA 4NQRA 2M98A 2V0NA 3H5TA 5I4CA 3JTEA 2FW0A 1YK1A 2RGYA 4MRMB 3KLNA 4PZ0A 4ETIA 3I5AA 3HEBA 3FFXA 1Z16A 4GPAA 3A0RB 3GRCA 3HSYA 3UKJA 2E4WA 1FFSA 3EODA 1BDIA 3H1FA 1D5WA 2E4XA 1M2FA 4WZZA 4ETNA 3HDGA 5CNKA 4KZKA 3OLXA 1JDPA 4RS3A 1P8AA 2F8TA 4KPYA 4WT7A 2MYNA 4W5QA 3T8YA 1KRWA 1W25A 2JBAA 3TB6A 1DCFA 3EULA 3O2QB 1J56A 4HYEA 3GBVA 2FN8A 2LPMA 1YVUA 4NCBA 2IKSA 4E7OA 2WMYA 3Q15C 4O1IA 4H3HB 1ZGZA 2HJ9A 4G0MA 4D74A 1KMIY 4FB4A 1Z25A 4ETMA 1TJYA 4N76A 5EWJA 1WETA 2Q5CA 3UUGA 3OQOA 2ID9A 1ZAYA 2PJUA 1OXBB 5CHYA 4G0ZA 4S04A 2FQXA 5IULC 1GUDA 4WUTA 1Z15A 3IP6A 2L18A 1NXTA 3K9CA 1C4WA 4WWHA 3QLUC 1JH9A 1VPWA 4H60A 3D02A 4EYQA 1EFAA 3QX9A 1YMVA 4HNSA 4NCAA 5B3JC 3IPAA 2WY2D 1QPZA 4LE2A 2GI4A 3JY6A 4MGEA 5KQGA 4MLDA 1ZHHA 4Z4GA 3HXMA 2A9PA 3M9WA 1LK0A 3RVLA 3LUFA 1OXKB 1U0SY 3KHTA 1XWWA 1QQBA 4N41A 1JYFA 1PEAA 3CTPA 2O20A 4F8JA 4PYRA 3MA0A 3SAJA 3IPCA 4NV3A 5IC5A 4RXTA 3HM9A 1A2OA 3NBMA 5KWSA 2OENG 3SNKA 1U2QA 3SM9A 3F6CA 3JS5A 1MB3A 3EAFA 1BA2A 5F64A 1VKRA 3GV0A 4OBBA 2AYZA 4KQ9A 4Q6WA 5FWXB 1NXWA 4ZYLA 3B2NA 1F4VA 4Z4CA 2HSGA 4G86A 4JB0A 3TO5A 1USGA 2VUIB 3DGFC 2PKXA 4JB2A 5ED4A 3I45A 2VUHB 2MSKA 4MS4B 3QLUA 5TPZD 3FFWA 2A9QA 3EDCA 2PUBA 4MQEA 2IPNA 1YS6A 4MLCA 1NXSA 4ZPJA 5B3JA 2TMYA 4LE0A 4RXMA 4PE5B 2CWDA 1MVOA 8ABPA 4MR7A 1CEYA 2JVJA 1PNRA 1L5ZA 1T34A 2H3HA 3CRNA 4RDCA 3H5WA 4MR8A 1U2PA 2QU7A 1CHNA 2LIVA 2OQRA 4RK6A 1PHRA 3MF4A 1M5UA 2DRIA 1E6MA 3TMYA 5CNJA 4EVRA 4YV7A 1K66A 1NY5A 3CLKA 2PL9A 3H5LA 3KKEA 1P2FA 3IDOA 4MYRA 5KC9A 2BGGA 1QP0A 4Z4EA 2YHAA 4MS3A 1DRJA 3KTOA 1EAYA 2HPHA 1EWVA 1LBIA 2FEWB 2IDMA 2ZAYA 3GBPA 4G0QA 4P98A 4Z4FA 5TQJA 3ROFA 3VNBA 5EWJB 3URMA 4F11A 3RVQA 1AB6A 1RXEA 2J48A 3D8UA 4IRXA 3H5VA 4XLTA 2A9RA 4GNRA 4XASA 2PL1A 5EWLA 1E6LA 1PNTA 4P1ZA 3KCNA 4OG2A 3CZCA 4YO7A 4F06A 1H9CA 4LDZA 1ZESA 3CHYA 3QEMB 2VYCA 4FE7A 3LFTA 3EJWA 1KRXA 3T6KA 5ABPA 1Z17A 3I09A 4Q6BA 4F3TA 3CZ5A 1HEYA 4G0XA 3RVKA 3LMKA 1BDHA 1DJMA 1TLFA 3FGZA 4RZSA 5IBQA 2HQOA 5TPWB 3H1GA 5TQ0B 5IX8A 3FFTA 5GOTA 2NT4A 5PNTA 4KREA 4EYOA 2FTKE 2JCGA 1TMYA 5FBHA 1E6KA 3DLBA 3JPWA 4RV5A 1P6UA 3NNSA 4KQCA 1SXGA 2NZVG 3HK2A 3H75A 1ZH4A 4D6XA 1JBEA 1NXVA 1ZN2A 3HV2A 4Z99A 5HSGA 4TN5A 1LJLA 2HQBA 3E3MA 1LJUA 2L19A 3LUCA 4W5NA 2RJOA 1DG9A 3CKMA 2PE5A 1YIOA 3G85A 2FEKA 1D1PA 3A10A 1JWLA 3F7NA 5BRAA 3HUUA 4KVFA 1DCKA 3KJXA 4MR9A 1JLKA 1ZH2A 4RU1A 2IPAB 5EWMA 3I42A 3L49A 3BBLA 3OLWA 3VNAA 1FFGA 1DRKA 4QYMA 4PICA 2WWVD 3C97A 3M6MD 3Q9SA 2QW1A 1ABEA 4QYWA 3NNDA 1FQWA 1F51E 3O2SB 4MQEB 3S99A 3Q7RA 4W5OA 3ROTA 2MYTA 5BRJA 2FSPA 3QLVC 3N0RA 1Z2DA 3NHZA 3SQNA 4RKQA 1YS7A 4LDAA 3ILHA 1M2EA 4MQFA 2JB9A 3FMVA 2M1ZA 2GKGA 4TLMB 2KYRA 3DZDA 3RQIA 3HS3A 4ML3A 1R8JA 5CNIA 3KYIB 4JOQA 4EGSA 4XXHA 5FWYA 3N6VA 4FE4A 4Q7EA 2QXYA 3N0XA 2PLNA 4MS1A 3SY8A 4OATA 1EHCA 5TQ2B 4XARA 3OLVA 1FFWA 5BQ3A 1C0EA 1RNLA 3SG0A 4EVSA 5KQPA 4MRMA 3ILYA 1JL3A 1E2BA 2PUCA 3HZHA 4TLLB 4G97A 3FDFA 2LP4Y 2WJWA 1Z26A 3OMWA 1SRRA 3QX8A 4UHKA 4ZMSA 2FKAA 3LUJA 5DLEA 3OQMA 1DBQA 3KS9A 4KMRA 4QPJC 3LTEA 1TVMA 2FVYA 3DBIA 2PUFA 4RY8A 2CHFA 2ZWMA 3QLVA 5IUKC 2JVKA 4IMIB 3RVSA 4HNQA 2FXIA 2MSLA 2R25B 1URPA 3CG0A 4ZMRA 3OQNA 3CS3A 4LE1A 4KNYA 4Z9BA 5T3YA 3IP7A 3O1IC 4RWEA 5T7BA 4W5RA 3EQZA 1AB5A 2PUEA 3KLOA 1FSPA 4JA2A 2QR3A 2QVCA 2JBAB 5D2CA 1ABFA 2P9HA 1I3CA 2RJNA 1U04A 3H5OA 1ZDMA 5GQSA 4TMYA 2WJAA 2HQRA 1D4ZA 2X7XA 1CYEA 1QMPA 1DZ3A 3JVIA 3C3KA 4OLAA 5EWMB 1JFTA 3OM0A 4DADA 4IGAA 1RPJA 2B1JA 3IP5A 4RSMA 4N03A 2FEPA 5HQJA 3BRQA 4Z4HA 3HJFA 2FQYA 3KSMA 3O1JC 1RXIA 2LBPA 3MYYA 3TD9A 1QP7A 1A04A 3HCWA 1YMUA 2E4ZA 1QO0D 1YTUA 4EVQA 4Z4IA 2I6FA 1Z18A 1JFVA 3LUGA 4L4UA 3H5IA 5JS2A 2NT3A 4W5TA 3C3WA 1APBA 3F6PA 4S05A 2FMIA 2PUDA 3W9SA 1ISRA 2QSJA 2IYNA 1NXXA 5DKFA 3N0WA 3JPYA 2A9OA 4LRQA 5TE9A 4KRFA 1BAPA 3EGCA 5HM6A 2E4UA 5KC8A 3GWGA 2WRZA 3O1HB 4XFKA 5FWYB 1DP4A 1QNLA 2PAFA 2GX6A 1L5YA 4G0YA 4MS1B 1B00A 1NTRA 2FMKA 1UDRA 3KG2A 3KYJB 1MB0A 1QO0A 1DC8A 2LUOA 1Z13A 1RZRD 4YCSA 1GLGA 4KK4A 4NICA 2R4QA 5FWXA 1IIBA 4WXEA 1EWTA 1ZY2A 3QELA 2FLWA 4QICA 4O1HA 5JNVA 2JK1A 3NNNA 3NHMA 5JNSA 1P6QA 3K4HA 4MS4A 3O21A 3HDVA 2L17A 3Q7TA 5DGCA 2FN9A 1EWKA 3JVDA 3GYBA 1USKA 3LUAA 3OO1A 3P9YA 4RY0A 3RVJA 1VRVA 2IOYA 3GL9A 3T38A 1XHFA 4RK7A 1Z2EA 2MYUA 2L2QA 4LZLA 4EYGA 2MYPA 1TM2A 3N53A 4DQDA 5FBKA 4YLEA 3N8IA 3OM1A 1LBHA 6ABPA 3T95A 4MPTA 2WB4A 1USIA 2NUBA 1RZRA 1M5TA 3R0JA 1VLZA 4JP1A 3OMXA 4RK5A 2PUGA 4MR7B 4IMJB 2FMHA 3QK7A 3HUTA 4L85A 4CBVA 3F73A 1MAVA 4MR8B 2FLKA 3DGEC 4Z9AA 3MMNA 3RVOA 1PUXA 2QVGA 4N47A 3N75A 4YRZA 2N9UA 1DBWA 1GCGA 1MIHA 4O5AA 4YR7A 3Q41A 2FMFA 1QQAA 2CHEA 1BVHA 2VK2A 2QV0A 1ISSA 2W42A 4JAVC 4MS3B 3RVMA 1Y1LA 3LUHA 1JDNA 5BR1A 1D2AA 1XHEA 4KFCA 1A0OA 3C3MA 1JHZA 1YK0A 3IP9A 3O2JA 3LOPA 3QEMA 4M88A 1KGSA 3QEKA 4RKRA 3OLZA 4EY3A 3HO1A 1NXOA 4MAAA 3CNBA 1DBPA 4RXUA 3BREA 5EWLB 5JS1A 4HNRA 5TPWA 2E4VA 2ID7A 4G0OA 5TQ0A 2MSWA 2IPLA 3EQ2A 3MQ4A 4JASB 4WXMA 5IEBA 4EYKA 2GBPA 4H3KB 3M9XA 4LX8A 6CHYA 3DLHA 4YP9A 1SXHA 4IILA 5KQMA 9ABPA 4DN6A 2R48A 1D1QA 3H6HA 5JNWA 1JFSA 3E61A 3OO0A 3A3KA 2JRLA 2JVIA 5E3JA 2R47A 4RK4A 1SXIA 3MM4A 3G1WA 2P4UA 3H6GA 5IUNC 3OLYA 5IEJA 4G0PA 3LKVA 1NXPA 5HKOA 5JNTA 4ZJPA 1QKKA 1ZVVA 3RVRA 5KQLA 2IPMA 2RDMA 1DC7A 3C6QA 3LUDA 3QELB 4YWHA 4Z0NA 5DCLA 4PEVA 2B4AA 3TX6A 4F12A 3QLTA 3HVRA 1JYEA 4N0QA 3RVNA 1Z12A 2QZJA 1K68A 2F8SA 5DTEA 2YHBA 4MR9B 4RY9A 4RK0A 2CD7A 1U8TA 3LUKA 4E7PA 5JNRA 3CG4A 4RK1A 1JX6A 4YGXB 4EUKA 4XAQA 1GUBA 3CU5A 5KI6A 5JNUA 4B09A 3L6UA 1GCAA 1S8NA 1BDJA 4OTZA 1W9HA 3H1EA 4YS6A 2GWRA 4OLBA 2AYXA 1NATA 3CFYA 3RVPA 2NZUG 2H0AA 3GA5A 1SD5A 4KV7A 5CNMA 3MIZA 2E4YA 5IUJC 4MQFB 2PMCA 5C5EA 5TPZA 4KK3A 3UK0A 1JF8A 5TQ2A 2FQWA 4IF4A 4N0PA 1ZITA 1DCMA 3BILA 3LKBA 3Q7SA 1PEYA 3A0UA 4D6YA 4Y9TA 7ABPA 1ZGGA 1QP4A 2XDYA
chains in the Genus database with same CATH superfamily
1IY0A 1LS1A 1SN7A 1MQSA 5KVCA 4KBYA 4YRAA 1ODLA 3QEJA 1MAHA 1GU7A 3OX4A 3SBOA 4JL5A 4E88A 2W98A 5B55A 2C00A 2OOSA 3REQA 1FX0A 1YK1A 3F8TA 1A9TA 4MRMB 3IQHX 3QBDA 1I2AA 2YWHA 4I6JA 4OAQA 1YZKA 4UZEA 4EY5A 2PLWA 5DHSA 4DLTA 3O8DA 4L9RA 4TX1A 2P5YA 2DMRA 2R8ZA 4A92A 1RLTA 1EUCB 1TCAA 3K2EA 3TN7A 3H1FA 4CLXA 1UBJS 3BULA 4TYWA 1M2FA 4IQ8A 2WHPB 1X1SA 2VYND 4WBXC 5HE9A 4K6OA 1MP0A 4ZGBA 4FW9A 1K92A 2IEDA 2H7XA 2JJ2D 1PS9A 3O82A 2I8LA 4OXIA 3NHLA 4RS3A 5A9RA 3FLMA 4HX9A 4EI7A 2QJRA 1CY8A 1NPYA 1SHZA 3F4LA 4YMHA 2WUWE 3HEMA 4GEGA 3KYBA 5DM4A 3VOTA 1KGDA 4FFNA 3ZW7A 4AF7A 5JT1A 1T8SA 3HNRA 3JQ8A 3OQIB 2HIMA 3O9ZA 2QTHA 3S1AA 4A2PA 4BLTA 4L5IA 1UOEA 3GA7A 3F96A 4RDIA 4R69A 2IXTA 4TYMA 2HJ9A 3T9BA 2PH5A 4DUGD 3CPEA 3K20A 3CZ9A 3JVUA 3N86A 2I2CA 2IUUA 4GKAA 1EBBA 4ETMA 1F8XA 1NFFA 4PGFA 3GFVA 4U2BA 5A6SB 4Z1MA 3GFRA 4S04A 1EUQA 2OE2A 1SCUA 1U8FO 4X20A 1ZSNA 3K1ZA 5ALKA 4LMAA 1X87A 3OTHA 2L18A 2D59A 1UDWA 2VDLB 4KPUB 5NULA 3I9NA 5IC4A 2BGIA 2XDQB 1LA2A 1VPWA 3F1LA 4WFQA 4B76A 1S0UA 4K9DA 2UAGA 5BMVB 2C8LA 1K97A 1QFXA 2PUTA 4QU9A 3TEJA 4AROA 4CKEB 4RVCA 1NFQA 5FI5A 4L72A 3MGKA 4IJUA 5CD9A 3U19A 3B2EA 1CVIA 2Z4RA 1UF9A 2O8EB 3CUKA 4UOQA 1WPGA 1U8AA 1XKQA 3MGGA 4QDUA 4WZBE 2IELA 1EP9A 1YR7A 1QGZA 4FOOA 5JJLA 5EKUA 4CETA 3RCBA 4QUKA 4G8JA 3L7MA 2H85A 4OP2A 4YMUA 1CTQA 4HATA 2YJTD 2DCUA 1A2OA 2C5GA 3CRMA 3T0IA 1RI4A 1K2VN 2XKBA 4K81B 4X66B 1FX1A 1IQRA 1BQ4A 3MWGA 4J7XA 4JLWA 5JMPA 3ZDZB 3P5BA 4ZYUA 1JQLB 3BFVA 2FG5A 4IIGA 2CUNA 3RKSA 1MHPA 1CWUA 4CL2A 1NXWA 2CF5A 3BH7A 1IUOA 1YS1X 1AG9A 1VG1A 3VGJA 4UXJA 4HXFB 4U7GA 4A10A 5DX1A 3OY2A 5FL7A 3QKRA 3UJNA 2C2OA 1SVUA 2WUFA 5JCOA 4C3ZA 3ONDA 3QLUA 2R8PA 4F93B 3OOHA 3D5QA 3JZFA 1A8HA 5B3JA 4XM0A 3L93A 4KX5A 1T5OA 4GS5A 3M6WA 5E7QA 8ABPA 3TUZC 3GFFA 3Q5DA 5ESXA 1BD3A 4JI3B 1TUBA 2W2MA 4HAZA 4RDCA 3FWHA 1FYWA 4LHXA 1UQTA 5JOQA 2P65A 1DZIA 1GL7A 2H9IA 3BGOS 2QTWB 3LO8A 4N5LA 4DMUB 3CF0A 5IM4A 1ZUWA 5A4MS 1YHZA 1E1MA 1PNOA 1JXOA 2IRWA 4EHLA 3KQKA 3CLKA 2PL9A 4UAJA 3STUA 1GZ6A 1P2FA 1WVMA 3KZCA 5I9MA 5TGTA 5AKZA 5KC9A 3JASA 4MS3A 2NAFA 1JEDA 2HPHA 2ZYGA 1EWVA 1L7VC 1L5QA 1VJRA 1JT9A 4JCOA 2GYYA 3RKUA 3I53A 3RTDA 1PK7A 4TUYF 1JI0A 1OWPA 3R3VA 2B1QA 1MV8A 4Q7QA 1DG1G 2J87A 3RVQA 3EEIA 4IV8A 3P0EA 3S1SA 1D8AA 1ONOA 1WU8A 3FVQA 4QTZA 4BO2A 4D3DA 3G8YA 4BO7A 2JNWA 2WG1A 1H9CA 1R9MA 1Z63A 2AQHA 4C03A 1WQ1R 3JX9A 1CUUA 3DTVA 1QR6A 2Z6UA 1C1YA 1YR9A 1NVFA 1VLHA 3E0XA 3CZ5A 1KZ6A 1QGOA 1X92A 3AKCA 1HE3A 2EZTA 4PO8A 3IVGA 2ZSIA 4UE2A 4BNWA 2OY0A 2QLMA 5ALXA 2WM9B 2Q5EA 3BE4A 3FFTA 3QJ5A 1T5BA 5PNTA 2RHJA 4P86A 2OYSA 5C7OO 4NENB 1PLKA 4WL0A 1E6KA 2OFWA 3JQGB 4BNLA 1NMEA 1KJ9A 3KYDB 1Z88A 2NXCA 4LXIA 4KXVA 2VJMA 4ZVNA 4ZOQI 1XLUA 2ZS9A 3I01A 4MV7A 5AKGA 4F91B 2YJ4A 1SA0A 2Q6IA 4RACA 4A5OA 4HUJA 5J5CA 1IDN1 1GR1A 1IQ0A 2W22A 2COKA 3OC6A 5CBKA 2ODBA 3KL2A 4YWJA 4UPDA 2XKKA 2FSFA 2QM0A 2CE2X 4KVFA 5TT0A 3ER8A 4I3HA 4Q19A 1E2PA 1H23A 3LBIA 2OGZA 4IDEA 1CR1A 1T8TA 4II7A 2WFZA 1HY3A 1NI4B 1IG3A 4MR9A 4TT3A 2YIDA 3W7BA 4BWFB 3MJTA 1L1FA 4RABA 1WTCA 2YC4C 2IHVA 1W44A 5L51A 4P4SA 1QG2A 4AO8A 1I01A 1ABEA 1NYQA 4PQRA 1Y9EA 1WUYA 3TNYA 2ZXFA 5AXBA 2GN0A 3QVGB 3ZG6A 1ZM2A 4L95C 1KQPA 2HYDA 3QEBZ 1GG5A 2KPOA 1Z0ZA 3OU7A 4K9PA 2HJRA 3CLUD 2VF2A 4PHGA 5IVIA 3C8ZA 3RSOA 4TL9A 3NU1A 4E5VA 1WRBA 5JFTA 2QYSA 1G21B 2HB6A 2HM7A 3GQBB 1MGPA 3OQPA 2JZOA 3EA0A 2G5PA 1WKCA 3I2YX 3HS3A 4HEJA 1NR7A 4L5YA 3IUQA 1VI2A 1CUSA 4RD3A 3I6YA 1WMBA 3UCXA 2QQ5A 5HX7A 1WTAA 3HVJA 1G3RA 3TTYA 1XC7A 3FJOA 3JR3A 2EATA 3SY8A 4AZ3A 1FW6A 1TLLA 4C4XA 2VYQA 3G8BA 3HNPA 4OI4A 3OLVA 3WA7A 4FGLA 4QUBA 4OHYA 2FZEA 4HUTA 4Z1OA 4HDOB 1ISJA 5ETJA 3N5CA 1YDWA 3A1WA 3N05A 3T15A 3G5TA 4MKFA 4PQFA 3CVUA 4TLLB 3EQ9A 3ZKAA 1B6GA 4HD8A 4Q03A 5AI9A 5ADVA 5F7ZA 5IDVA 4F5YA 4I1VA 3BJIC 3IO3A 5SZJA 5DPMA 4ZMSA 3RNLA 1U65A 1DBQA 3DFMA 3F6BX 1GGVA 4ZIRB 1TVMA 2BEKA 4C7JA 4FYYA 1RR6A 2VP3A 3L8GA 4RY8A 5LP6F 4MB2A 2C5BA 4BO8A 2HK9A 4NOJA 1JHPA 4UOEA 3UMCA 1T9ZA 2REBA 1FDIA 3IS3A 1TZCA 3A14A 1HZJA 1KEEB 5IYZB 1Q1NA 3QPUA 4R1TA 4DDTA 3MPOA 4MAFA 3D7SA 2RARA 3QLEA 2YOFA 1VIDA 5THQA 3WGNA 2XOKA 3QVVA 5DE3A 2CF6A 4L73A 5JIBA 1FSPA 3AB7A 3DEAA 4KYVA 2HQ1A 5ARDA 3U3XA 3GFOA 3PE6A 3QPAA 4WECA 3GDFA 1ZD8A 2FSIA 2XCOA 4J1TA 2I4TA 2VYVA 1F9EA 1JJVA 4XYMA 4EKEA 3H5AA 3AGPA 2HA0A 2WJAA 2P69A 1KYQA 1RQ2A 2FDRA 3DBHA 2IU6A 4KQKA 2HHLA 3LP8A 4Y2JA 5BW6B 4C4ZA 3M6UA 2YVAA 4F3NA 3T5BA 1YU6A 1HURA 2EBFX 4JJ4A 4HCJA 2G7MC 5FR2A 1PQ4A 2DPHA 2ZIWB 3SYLA 3D81A 1T15A 1XZKA 2E89A 2D1QA 2G06A 4M76B 1D2RA 3QUTA 4ZICA 5CA0B 4DNXA 3FFAA 1RPJA 4FOPA 2O2GA 1N0HA 5BY2A 3IB3A 4E1BA 1P2TA 4WCVA 4BN5A 3VTFA 3BRQA 3D5TA 2BOVA 3ECCA 5SYMA 4M1WA 3MQFA 2PS3A 1ZI8A 4I9HA 1TJ4A 2YVKA 3EXEB 4M36A 3T54A 1QZZA 4Y18A 5NLLA 1L7OA 2HMUA 4YQZA 2PZBA 3CZMA 4LZPA 1P0IA 1BVRA 1D2NA 1Z39A 4FT2A 4RFSB 4EW6A 3BKXA 4BQSA 1VFNA 5I45A 4DCSA 4KWIA 4QQKA 1T6ZA 3HGQA 4IVQA 3FZGA 1OW3B 1BW9B 5CIWA 2CL0X 1V96A 2C42A 3PEUA 1H2YA 4Q1FA 3U3KA 3T5AA 1ZD3A 3QE9Y 1P3Y1 3DVAA 2ADOA 1U2DA 5I9LA 3O1HB 2DU8A 1CRQA 1FPQA 1N9GA 3KU1A 3X2EA 2GX6A 3CVXA 1HQKA 2AL7A 1T43A 1T25A 3C3XA 3UOWA 1GN9A 4JLDA 4LNAA 4BNKA 4M1QA 4RS4A 5C7LO 4UBNA 1U2ZA 1ST3A 2QNRA 4QULA 3SKYA 3WBFA 3VKHA 5BRNA 3V7UA 4MVJH 4RENA 3IUPA 3ZZNA 4YN3A 2SKCA 2C9MA 1IIBA 2GEJA 2J6CA 5I4IA 4GF5A 3TG8A 4PM4A 3THWA 1R4AA 1JMKC 1AXGA 3WKAA 1XDDA 2V5VA 1KNXA 3IBYA 4KL8S 2VT7A 4MS4A 4IMRA 4P81A 4UTNA 4Q3DA 1VL5A 1WUJS 4YASA 3U7JA 2Z83A 4PR3A 1USKA 1SD1A 3P9YA 4KO4S 4LRTB 4IIEA 3I76A 1OH7A 1Y7PA 3O4GA 1RAIA 2CXRA 2HPAA 1K6EA 1RE1A 2A5FA 2XT6A 1TK9A 3BSFA 1ZJ4A 2JJYA 3T4PA 1KO5A 2OGUA 4OP1A 1XU4A 4ZO6A 5FQOA 3V2UA 1VCHA 4RF2A 1JZSA 5LZ4A 1S3IA 2GAAA 4L5JA 3JD1A 2ZSDA 2GBLC 4LI3X 1T6BY 1UBHS 2WB4A 3ZYCA 3W6OA 3ERCA 3UH1A 1D6SA 1Y1TA 4RV9A 3E9EA 5BR4A 4YJ3F 2AZXA 1GR0A 3VC7A 4L8LA 4WOJA 3PI6A 2BW0A 2FPIB 2ZPUA 3HYNA 4B47A 4DTIA 2CDCA 1SMKA 1FE8A 3QK7A 3IOBA 5BSKA 5HJEA 2HNKA 2WYHA 3VR0A 4Z9AA 2AHOA 4GX1A 3I61A 2YOGA 2OKGA 3K0EA 4AMGA 1GQFA 2PDAA 1OLUB 1D2MA 2HPZA 3LP6A 5BN5B 5KX5B 1O96A 4AJOA 5BWBA 4O33A 3IPRA 1E3DA 1XLVA 4IUDS 4CJXA 3DEIA 2CV2A 4X41A 3KDAA 2GBFA 4QFBA 1JB1A 3RVMA 3RS7A 4EECA 1H0RA 4ER0A 4OOEA 3H4MA 2MDTA 3ZBPA 4IYRA 2FMTA 4ZVSA 4ZD6A 4YJ2A 3U61B 5CYGA 3QEMA 2FPRA 3LWDA 4EI9A 3BC1A 4P0PB 2HFJA 3BH6A 1AUOA 3IOYA 5HW0A 4PCVA 3WB9A 1G0OA 3U2QA 3AUJB 3BD6A 4C0LA 4HLCA 1T1SA 4ADSG 2BM8A 1KHTA 1ZMXA 2OLEA 3FA2A 1SUEA 1Z83A 4Q1EA 3JD0A 1TA9A 4BFTA 2PRKA 1IHPA 1IOVA 1U3CA 2VF5X 3GFBA 3MTIA 5CVEA 4QL3A 1BE8A 3E61A 4HDSA 1W88B 3QOWA 3PR1A 2JVIA 1GTZA 2ZJBA 2VKQA 3ID6C 4RSRA 1LI7A 1NW9B 1Z0KA 2XIQA 4GL4A 1IN7A 4GM1A 3U1VA 1XMVA 4L4ZA 5HIIA 4EVIA 5IKEA 2H16A 3TTTA 1X3SA 1BWRA 3DOJA 1RM5A 2J3IA 3GR6A 3LKVA 2ISQA 4YPVA 2FUEA 1RKQA 4GBJA 1C8VB 2PUVA 4W1QA 2RDMA 4D3YA 3RYFA 5DGIA 1T4BA 4B3JA 4NPHA 3MZ0A 2GLXA 2FRDC 2J0UB 1SUDA 2V9ZA 3ZJ5A 4WKNA 4FCWA 1Z12A 2DUMA 2VQEB 2V98A 1S5PA 2IS1A 3TJRA 1XX6A 2H59A 4V39A 4RZQA 1KEWA 3KB6A 3KRTA 3QWBA 3RRMA 1IPEA 1H05A 1L4MA 3OWHA 2H1OA 3BBPA 2JJ8A 1LC3A 2CB0A 3LQKA 3CZ4A 5DH9A 3GRKA 4MUKA 3PPYA 3CLSC 4MB0A 1Z73A 3L6UA 3BMOA 2K2QB 1GRNA 2IV7A 1Z0JA 5REQA 1W9HA 4ON9A 4D46A 5D51S 2A5YB 2VL7A 4IL5A 5B6IA 1Z7EA 5HCIA 2IIPA 4KQHA 1D6JA 2D00A 4KV7A 2P9ZA 1L5GB 1DKRA 3B3QA 3MIZA 1PL0A 3N70A 3C5HA 4EB6B 2QN8A 1O9HA 2QR2A 3RS5A 2B2CA 2AD1A 4LQCA 4DYVA 1GTG1 1PEYA 1TO6A 2Y1GA 3C48A 4L27A 4NY1A 1AO3A 1Q6ZA 3BWDD 2HD4A 4BPBA 3GVXA 1ODSA 2AMLA 3M4NA 5C5CA 2QEQA 4MIKA 2A5GA 2FRVA 1KEPA 3DG9A 3C8DA 3SPXA 2OEPA 5DBEX 4AYXA 4HLUA 2GYWA 1IBSA 2V0NA 3OU2A 1EVQA 5ILQA 4RHUA 3KLNA 4AICA 4BQNA 2J0SA 1Z16A 4KC0A 3EEFA 3MTEA 16PKA 2DHEA 2X58A 5K0TA 2PJRA 2X5KO 1R4MA 4JQZA 1QTNA 3DE4X 3HB5X 4U0KA 5AJUA 1A9PA 1E2GA 4Y6QA 5ALPA 2HK6A 3HCCA 3KQTA 4Q47A 1CY6A 4J0KA 1RQLA 1KFEB 1WVIA 2CHVA 3U39A 5CNKA 4R84A 2PT9A 2YY7A 2NO7A 3VSAA 4AXBA 2Z6QA 5LDHA 1DBRA 4D97A 2FWBA 3DZHA 3V33A 4CFSA 3T8YA 3PHJA 3TB6A 1NP6A 1J09A 4S24A 1AY0A 2TYSB 2X15A 1YR1A 3PICA 4IOJA 1JFLA 2FN8A 1LPMA 5ES4B 2GHTA 4RHYA 3PXAA 3T3PB 4D81A 4F1KA 2V7EA 1W30A 2O7QA 3J81k 4E7OA 2WMYA 2G8NA 2FP4B 4L3WA 4LGCA 1RZVA 3MS7A 4ZZ0A 3C3PA 3RARA 2RCYA 2OV6A 4WKPA 2P0EA 1Q15A 3ELBA 5BSRA 2VHYA 2C3UA 3DE3X 4CDRA 1GNSA 3S7TA 3GU3A 1M6HA 3H5NA 3G5UA 4AO6A 1G9SA 2Q5CA 1W76A 1RKBA 3RS8A 4AJLA 3D6AA 4CT4B 3AF5A 4EG1A 2FQXA 4L28A 4NYIR 3P9IA 2NPIA 4ER3A 1AUVA 2IYRA 3E84A 1U6JA 1XPRA 3NZEA 4QOFA 2UYYA 1LSUA 4OBWA 3I62A 3FUWA 2QRPA 2LR0A 2WF9A 5L4NA 2NV2B 3EGDB 2GGSA 4TS1A 2QB5A 4H60A 4WK6A 2Q62A 3TE7A 2PWAA 2AG0A 2RGUA 4P58A 4U2CA 1J2RA 2FSVC 2YINC 3WZMA 4FMCF 4MLZA 4E30A 2CXUA 2B5OA 3UV7A 4DMKA 3B6JA 1C1DB 1CQIA 3RTAA 1WCWA 1EK0A 3PUIA 1R74A 1YXMA 1Z37A 4Q3LA 3F3MA 3SICE 1WEKA 3GB9A 1QTQA 2DPLA 1ZL0A 1N2OA 2I2DA 3LYLA 3TRFA 1YQGA 4UMVA 5FL3A 4BRSA 4N41A 3NP9A 1O0SA 2G6BA 4FHFA 4TKUB 4N5DA 1WW8A 1SZDA 3SF0A 4CM5A 2V7UA 3QBVA 4GBMA 3M3PA 1T4DA 1DFIA 2NNLD 3BK7A 4J9UE 3A05A 1EJBA 2B25A 3T5PA 2XYHA 3QY9A 5GIOE 3HM9A 5DSTA 2RH4A 3EFEA 4UCQA 1ZOSA 3ESZA 3ZZUA 4MQLA 4AYWA 3SLKA 5EXDA 4MWDA 4ARZB 2FPSA 5FWXB 3GDHA 3VSDA 1JZTA 5CU7A 3EPKA 3H2ZA 3H4VA 4B3IA 2HSGA 4ZCSA 5K4HA 1ZK2A 1DOHA 4JB2A 2BP7A 4TTSA 4U8GA 2G80A 3D3EA 4JELA 4HWGA 5EMNA 2IWRA 3WJ2A 4F3CA 1Z2PX 5KVSA 2XF2A 4NBKA 1G4AE 1NLFA 1KJWA 2X6QA 2Y8EA 1E96A 1EM8A 3PFFA 2HUNA 4LE0A 4AMBA 1B16A 4LVCA 3E05A 5HMLA 3CRNA 3V8EA 4CT0A 3TM5A 1UK9A 2J7KA 2TMGA 2CVZA 3PC2A 2LIVA 3QW2A 5JSZA 2F3UA 3PGXA 2C4VA 5FJIA 5KKNB 3UG7A 3PSHA 4Y1RA 3EXHB 4E3ZA 3KM0A 4KE6A 9MHTA 2IHNA 2PXHA 2DPGA 1LPPA 4XLLA 3B38A 4YCAA 1LVUA 3KTOA 3C85A 4F2DA 5EP3A 4FFVA 1K98A 2H4HA 1TIPA 4QGFA 4HH4A 1YBHA 3HEAA 4BZXA 4PC7A 4HL6A 4KX3A 2VPTA 2BFPA 2BFEA 1HNWB 1V7QA 4F11A 4K0RA 5KYYA 3C24A 1DX9A 1K5GA 2GN4A 4QDKA 4RYLA 1MDFA 5G0TA 3ZWAA 2ZYTX 4FBLA 5AJWA 2OV2A 1VPTA 3W9YA 1E6LA 3Q9NA 1IYZA 1NNUA 4O25A 2MCFA 4BBJA 2W2QA 4EB0A 5JMOA 2Y0PA 1ZESA 3E35A 1JJBA 5ED0A 3AXSA 2I3AA 4J94A 3BEDA 5AW3A 1M34B 3RREA 3WRXA 4DIEA 5K05A 1U0RA 5K8JB 5ABPA 1D09A 1CXZA 4G37A 2BFDB 3DULA 3EOAI 4XOUA 4F6RB 5IDWA 3U80A 4YRTA 1XDBA 3WP1B 2P9CA 3IHLA 2V6FA 2XWQA 3FGZA 2W2TA 4O4LA 1XTJA 3AONB 5TPWB 1NVEA 3A6EA 4QUEA 3QIVA 1S2GA 3E2PA 2ES4A 5DTIA 5LOVB 1A8SA 1U1CA 3B6MA 4YLGA 2XMBA 4DB2A 1O08A 1OWMA 2BDEA 4ZQIA 2W8BA 2YRWA 3TAUA 3P2YA 3W7AA 3PVCA 3W8EA 1FUEA 2WYIA 3E18A 4NEQA 1N1EA 2P1RA 2RJOA 3N74A 4BNMA 5H8WA 2LRHA 3OZFA 4DHEA 1VGRA 3U09A 3DDUA 3SJAA 4DQUA 2X8BA 3DDNA 4MA0A 4DOMA 2GXSA 1CY1A 4IEEA 4QXPA 3ZWWA 1DCKA 1WU7A 3JQAD 3KQWA 5K1ZA 1N92A 2GPWA 4OQDA 4COKA 4RU1A 4XWKA 3LA6A 3CLUC 4JY7A 4FFRA 1KY5A 1N5RA 1TA4A 1FU4A 4CEHB 1UPBA 5EJ5A 4P53A 3C98A 3LXXA 4WN9B 3M6MD 1MX3A 3PE3A 4GYJA 4OF4A 4XRRA 1C7QA 4YRPA 4BNJA 5B6PA 3MHPA 1XEFA 5G4KB 1X9IA 4M83A 5K0LA 1AZWA 3ESYA 3QVOA 3H84A 2W58A 3UNXA 2FG7C 1Z2DA 2WG2A 4U39A 3V5NA 1MO6A 1QHHB 5AJYA 1HE8B 3DF9A 4K3UA 4PZLA 1KEZA 2X3YA 4MO9A 3PA6A 2P90A 3PWZA 3Q98A 1Z08A 3IOCA 3K6KA 5AUPB 5JRDS 2KYRA 3OG9A 5BV0A 1J70A 2OOKA 5CX4A 2OZLA 2YWXA 2ZT8A 3TVDA 4I19A 4FYPA 4HAWA 1MXFA 2TSYB 1D2HA 3AP3A 1PJRA 2WIAA 2PLNA 5CB4B 3K32A 3KTFA 4H3VA 1KAQA 4AN0A 5BVHB 2DQ4A 1XCJA 5B7QA 1PLLA 4B81A 3SG0A 5GINE 4JNCA 2IL1A 3AUXA 1FZQA 1XP5A 2J5QA 4G81A 2ZUCA 3IH5A 1YQTA 4JROA 4U7PB 3RR2A 3W6ZA 2IY8A 1Q95A 3FDIA 3PQCA 1SRRA 4NXNB 2QROA 1OPXA 1XVUA 2PZAA 3A6DA 1MOPA 2QW8A 2VDJA 3TKAA 3O7WA 4K6MA 3U4CA 2CHFA 3MB8A 1AGPA 3SNHA 4NP6A 3B78A 3VUEA 4D8UA 1QB8A 1XD8A 1NVXQ 5HZMA 2LTAA 2P35A 3E1SA 4PWYA 2UYOA 1UPAA 4PSCA 5E3IA 3CS3A 3ELYA 3DZFA 3SQMA 4WUVA 2HCJB 2R00C 3O9MA 3JYHA 1HNNA 2QTNA 1OMOA 1RI5A 2PUEA 5KJ6A 1NMQA 2Y9PB 1OB2A 3NBFA 2XTNA 1ORIA 3B1KA 3B3AA 1P5ZB 4AO7A 1NF2A 3LPDA 4OQLA 3VR4H 2Q5FA 3P0JA 1AXEA 3ESCA 5CEEA 1C50A 4DTCA 1M6WA 5KJ1A 2WVAA 1CYEA 4OHCA 3U7EB 1PR3A 5JROA 3D7RA 4MA4A 4UTXA 4PLVA 3ZK9A 4B6EA 4RTJA 3TZHA 1MNQA 4OQMA 4HT3B 2PR7A 1P61B 5CM9C 3LVFO 1C4XA 4RIIA 5FA6A 2IYSA 1Y1QA 3IP5A 5EXPA 4BX0A 4HVAA 3VUFA 2R6DA 3KTDA 2NU6B 5IAJA 2IZ6A 2FEPA 3ZCRA 1M1NA 3PR3A 3K31A 3TXXA 4D9CA 4Z4HA 2GCOB 2NTJA 4OH1A 1SVLA 4GLFA 2XE7A 2B61A 2ZWVA 3K0CA 4U2EA 5LL6P 3KDPA 1YMUA 4W9NC 5DK6A 4OHFA 2ZDGA 4RKYA 1N5IA 2VO1A 1V9SA 4AIIA 2OBMA 3MT8A 2Z3ZA 1YKFA 4NBVA 4UREA 5AJHA 4DL9A 1APBA 3ABSB 3U4DA 5JJCA 4MP8A 5FBLB 2R6JA 3DWEX 2QTVB 2YMPA 3ZXSA 2D0IA 2I5PO 4K2HA 3N0WA 2HI0A 3OTQA 3L84A 4IXWA 1BAPA 1KVQA 4B80A 3SYNA 1PR4A 1DRUA 5EJ4A 2VJNA 2BIFA 3DMTC 3V4PB 5AW7A 1UMCB 2J33A 1W0CA 3OF3A 4HFNA 4UDXX 5T41A 2YFQA 2H18A 2PLFA 4RGBA 3KJQA 4Y6PA 3OFSA 1VE7A 4IHJA 1LS6A 1PUJA 4CLDA 3MIIA 4JQYA 4WX2B 3CCFA 3P2MA 3CEAA 5IHXA 3P9QA 2FLWA 4CTMA 1U0BB 3HKDB 4HRVA 5CX1B 4POOA 4Q15A 3K4HA 3O21A 1SG0A 1TJNA 3CYFA 1SIBE 2A3NA 3DCJA 3TLGA 3BQMB 4IDQA 2GASA 4ECAA 1ZK1A 4MULA 5H4GA 3U7FB 2ZSKA 3DA8A 1BYUA 3SBDA 4KAXA 1BGWA 2ISCA 4BUJA 1BOOA 3MWFA 4R9VA 1TECE 4HRXA 3RD5A 3WNQA 5TV2A 1VMKA 1LBHA 2DJ5A 3FMFA 1V41E 2CNOA 4G2NA 4EUFA 3PEYA 1B0UA 4RZ2A 3U17A 1N2CB 3FPLA 4CDMA 5LBUA 1YRQA 3ZE1B 1C29B 2WUEA 1RFLA 1CHDA 2C3MA 5AI4A 3ZVLA 2BFCB 3QTLA 3HPRA 4U7WA 2CNWA 1TOAA 2FLKA 3ZV6A 1N6RA 3EQ6A 5G41A 4F7WA 3RVOA 2ZGVA 3ZR4B 3U5TA 2WKQA 1GCGA 4I4IA 2B7LA 3GA0A 4GYWA 2XUDA 3AKZA 4RSGA 4N18A 2VWQA 4P6VF 5G0VA 5AW1A 2YNMD 2VXOA 1SU7A 3LAWA 2GZ3A 1YA6A 2OHVA 4OB6A 5K0GA 3HO6A 4BKOA 2GBIA 3L9WA 2AE2A 3LX5A 1T1RA 1T9CA 4ND8A 5AUQA 1T2EA 1Y8QB 2HSDA 1OI7A 1TGYA 3FOBA 4J91A 3WLHA 3LPCA 1JMYA 3S1LA 4KQ2A 2B9EA 4FMDF 5JCOC 3IUSA 3NJ8A 1TC1A 3EZGA 1R0BA 4M8SA 1Q2XA 4ND1A 4HNGA 4LYAA 1WVGA 4W9RA 5A0FA 1XZMA 3GJYA 2BFOA 13PKA 3JZIA 1NXOA 3ICOA 1RCTE 1SQGA 5JDIC 4WJKB 1I0LA 1XZPA 5GWXA 3UBMA 3BT7A 4RIEA 3TLYA 3EXAA 4Q7MB 3EQ2A 2IPLA 3X43A 1IZYA 2IYEA 1E20A 2XX3A 1OKKD 2HXGA 6CHYA 2EX4A 3A1TA 1Z0AA 2O3RA 3GFTA 4Z0TA 1ZMRA 1R5BA 1U0HC 5I9IA 4YUWA 1C0LA 4FWIB 4BMCA 2VDWB 1BEEA 2XVYA 1Z5UA 3QU5A 4PWZA 4FB4A 5KNDD 3A06A 4ZAVA 2GAIA 5JXHA 2R47A 1SCNE 4HDCA 4Z2YA 4TS4A 2DFPA 4P4UA 3JYQA 1BS2A 2WQ7A 3PCTA 1T5IA 3ND8A 1CR0A 2G88A 3OT5A 4YROA 5AD1A 1N8TA 4ATNA 2GWHA 4LGMA 3WDLA 4B84A 2P2SA 5G3YA 1WL8A 4OBEA 3RJ9A 1UJMA 5JLAA 1RJ9B 3OCYA 1DC7A 2ST1A 2OL4A 4RY2A 1U1IA 2P62A 4IHKA 1O2DA 3OKFA 4WLVA 2X8WA 2J41A 4FX5A 4PEVA 3DLCA 3AU9A 3U3JA 4D56A 4D9NA 1JP7A 4P2BA 4TT8A 4B3FX 5IARA 4C88A 3GZ4A 3DQPA 2X0NA 1GSHA 5E6UA 4NAUA 3H97A 4C6HA 3STHA 4DCVA 3OBIA 2XUOA 4OGLA 1I1OA 3HMKA 4K6HA 2KHZA 2ADMA 3I12A 4D0GA 1VIAA 3L7LA 1R0CA 4AXXA 2TMKA 3NEPX 1NJFA 4XUGB 1NOKA 5HDBB 1OZHA 4JUCA 2HWWA 4DRXA 1PR5A 1GCAA 2XSZA 3A6ZA 2ZB7A 4K03A 2VT2A 2GN6A 3D3NA 3G88A 4H6XA 1GG2A 3PQFA 1REQB 2BHNA 1P0FA 1SD5A 2ZRCA 5LBIA 3VR5D 2A94A 2X4GA 3OAAA 2PMCA 4IIDA 1YR6A 4Q1CA 4R0NA 4QUAA 5EMHA 5CDTA 1QLHA 4FGJA 2RGNC 1SD2A 1Q3KA 4LYYA 4GSYA 3Q7SA 5SYNA 2BRUA 3V7NA 3DBRA 2Q1UA 1HDCA 8LDHA 2EHDA 1PFGA 5F2NA 4C2TA 1NF3A 3I8SA 4DBZA 4UHHA 4J9VA 2W6QA 1I32A 4BJ6A 2W2KB 2O7RA 4WNCA 3TPZA 2HA7A 5D1NA 3IE1A 4TXHA 1DS6A 3BSYA 1CUAA 1WWKA 3ANXA 2RHTA 4EPYA 4C7OB 2AB0A 1D07A 3BIFA 5G1OA 5TMBA 2I71A 2R7KA 3D59A 3MINB 3MJEA 1RD4A 1XQ9A 1DIGA 4I50B 4WOPA 4D9JA 1EJ6A 4YAIA 1FDRA 3CF6R 1ZLYA 4N12A 5LFAA 4Y9UA 1PFKA 1FFSA 1YL6A 3OOJA 5AHKA 1ZS9A 1BDIA 2YZKA 3MAAC 2W6MA 5KWIA 3GRYA 2JLCA 4PLPA 3BGSA 1KZYC 1Q0UA 4RLFA 4U5QA 2EIXA 2Q4DA 5EXSA 2VC2B 5ARCA 4YCLA 1E2QA 2B5WA 1JXMA 3UUWA 5JQWA 4UCWA 2I7DA 1JDPA 3NTRA 4BAUA 3EXFB 1G6OA 1M2OB 5GIPE 3QJGA 2ZDQA 3MOSA 3EULA 4OD0A 1OBFO 4I1RA 4DGSA 5DHAA 1RMTA 4QT4A 3ON5A 4YCBA 5D85A 2BMEA 4HLNA 1O6CA 2WTNA 2VTKA 1LUAA 4O1IA 4DZTA 3E9ZA 3FF4A 1M8GA 2A9VA 1M6VA 1NJGA 2NO4A 3CW2A 3OICA 4UDNA 4L4RA 3OIDA 5EHQA 1K7FB 4BO9A 5C8YB 3USCS 3PD1A 3UM9A 2ZTLA 3HJNA 3PGMA 4NJOA 4W8GA 5ILOA 2FUCA 3W6PA 2YVQA 4PNEA 3MFQA 1SQ5A 3KQPA 4KQWA 5C18A 4MX8A 3O8QA 3OIYA 3H9BA 4YHBA 1JS1X 2C20A 2I4RA 2XY4A 3E5RA 4WUTA 3DV2A 1KIMA 3SEAA 2DGDA 1UPXA 1OA1A 2Q7XA 3PTAA 3EN0A 2D5LA 2YICA 4HG2A 2WLTA 4BRUA 3TDKA 4HGYA 2DH5A 3EZ7A 3EPLA 3B3JA 4MUXA 1C9YA 1YZ3A 3ISTA 4YIKA 3WGQA 2O5EA 4QVKA 4AK9A 1MEOA 2F3TA 1H6DA 3ECSA 3HWWA 4H35A 5DN9A 4CM4A 3CIOA 1M7HA 4JH0A 3PWSA 4G5FA 1U0SY 4UEWA 5FFNA 2VK1A 1VQ1A 1ETUA 1RWPA 2HN9A 5FLEX 4ARAA 1XHLA 4MQ6A 2K6GA 2PYIA 5CG1A 1ISGA 4RHCA 4RF5A 4CE6A 3SC2B 2Y68A 4FNGA 5AJXA 4ZQGA 2DOKA 1B3RA 3L6BA 2FW1A 3FIJA 3JQ6A 2QS9A 1E3SA 4KR3A 4EPWA 1ENOA 1V48A 3NYWA 3AEQA 2JCYA 4OOFA 3NH6A 4N0MA 4R1OA 1PWZA 4V0RA 1I4LD 3UJ7A 3JYNA 4AG5A 1R0XA 2QJOA 2IITA 3KUKA 1NL3A 4QEZA 4O2BB 4OJKA 3SHWA 3AR8A 4C0AC 1J22A 2OGWA 3NV7A 4KIUA 2JA1A 4GI7A 1MH9A 2I4NA 1RPAA 2IODA 2QRKA 1UM8A 2ZB8A 5DGDA 3VZCA 5ED4A 4ZHQF 4MUJA 3R8XA 3LQRA 3TUIC 3JD2A 1XG5A 2RFLA 4LZJA 2JFOA 3WWDA 4KIWA 1DOZA 3H2IA 2V6BA 3LZ6A 1DX4A 1L3IA 1NNSA 5U4XA 4PE5B 1P3JA 1H2EA 1MVOA 2IHZA 4OIMA 4UZFA 3R2JA 2KE5A 4N3AA 4TWIA 4EY8A 3F9IA 1MW9X 1E9BA 5F21A 1GUZA 5H59A 1JG2A 5CJJA 3PJGA 4X84A 3THSA 4CL0A 1FJXA 3GGJA 2PJDA 5I9TA 4GLLA 4DPLA 3ZLJA 3WB0A 1JN0A 3SR4A 1AKQA 1KH1A 2GJ4A 2WPDD 1I5EA 1XJ0A 2V7QA 3P0FA 1WF3A 4BHTA 3TMYA 5C8ZA 5AESA 2VHVA 2O6HA 1VE5A 1WUKS 4ARSA 2P4HX 2GCNA 1UODA 4RE6A 3V8NA 3W3AD 4DJTA 5IT5A 1D1TA 5BPFA 4CG1A 4G0QA 1I6WA 3W8FA 3AR5A 5L3QB 3OIWA 3OZRA 3ADBA 4F0JA 3VPCA 4Q9DA 5FH9A 3TK1A 2WWHA 1UXJA 3ABQB 4JNKA 5J2TF 4IRXA 1H93A 3PJEA 4UUPA 4WD3A 1VJ1A 1Q0LA 2A0UA 2P8JA 3PUWA 4GNRA 3D3WA 1Z2CA 4W1PA 5LZ8A 4GPTA 3CZCA 2V5AA 3EIQA 1Z36A 3ZIUA 4XDGA 1KOFA 2NTYC 2AD5A 3H65A 4JI2B 3RBVA 2HIAA 1CJMA 4WLNA 1LFDB 1Q21A 4LDNA 3T3HA 1C3OA 4WCFB 5ANRB 1DG3A 2J5XA 3BN3A 4JBXA 1BDHA 1P0QA 4CQJA 3LYHA 1LZKA 1XKLA 3BDVA 3CRQA 1SC4A 5TQ0B 1V16B 2DCMA 1GVHA 4KDRA 4CODB 5KPJA 2JLRA 1DO0A 3I9V1 4ZXFA 2FZKA 4UBOA 1FDSA 1PF7E 1OC4A 2JAXA 2WWXA 4NYMR 3VO1A 3VV2A 3FPFA 5DNDA 3TQOA 3RHFA 1CERA 3VU9A 1N2IA 1YSCA 1TM1E 1V6SA 2AEMA 2RHOA 2O5RA 4NESA 4E94A 2INGX 4G41A 5BW8A 2RGGA 3FJYA 1ZWLA 2UYQA 2OQIA 2PO5A 4JX8A 1M2GA 4O6VA 3G85A 3L8YA 3VOSA 2SECE 3TIFA 3WAKA 4DS3A 5HUQA 5ICEA 4A2WA 3H4TA 3KSRA 3LY7A 2APJA 4P3OA 4CTKA 3ZVKA 5ER9A 3DV0B 3KJXA 5A05A 3ZDQA 5I7HA 2BGRA 4MHOA 4QTTB 4Y8VA 1J1IA 1A3CA 2FA9A 3KQSA 1QGDA 3CB2A 3D6MA 3T34A 4OM8A 3QUQA 1NJ5A 1TQ6A 1UWKA 5L7YA 1E58A 2H1HA 3SJZA 1LLDA 2QX9A 3C97A 1IIRA 5FDFA 1F51E 1GGHA 1COZA 1IB6A 3F3YA 1B8PA 3ROTA 3H86A 1BE0A 3LXUX 3B1VA 2KBEA 1XMPA 1VYTA 2DUJA 1YC2A 4X6LA 2D13A 4FC6A 4L0MA 5HQ3A 1W75A 1T1EA 4LN1A 4XR9A 1YJXA 3AIOA 1P39A 3W8DA 5EQDA 5B1EA 2JB9A 1VZ2A 3TL2A 3DS8A 4RLQA 4BO6A 5ILGA 1BRMA 4OREX 5AW6A 3PJRA 3U7HB 5LZ9A 2NPFA 2GEFA 3TR5A 1AUQA 4QODA 1Z34A 2IH5A 1X19A 4NFLA 2H07A 1W1IA 3G49A 4GI3A 1RJDA 2JFHA 2E87A 3BXZA 3H3FA 5HFNA 4GM4A 4HDRB 5K5EA 4IFEA 1JILA 2PZLA 3DO8A 2RHLA 4FEYA 4Q4JB 3O8BA 1XJQA 4HX2A 4J0JA 4U6QA 4IZHA 3KB8A 1I94B 3AETA 4XJTA 1VPLA 2UVPA 3DNMA 3TAHA 1OIXA 2GJ8A 1QV7A 3IAHA 2FEOA 3MWEA 1T0JB 3E1GA 3R76A 3EQ8A 5J63A 1LQ2A 1RC0A 1Y4AE 3RS4A 3LKZA 1IJKA 1U0FA 3DE2X 4IFBA 1WXFA 2Z57A 3MTDA 4LJLA 4L1KA 4US1R 4AWBA 4B82A 2IXFA 4OHZA 4D9IA 4HXEB 2XIJA 1P7ZA 3REQB 1HDYA 1V45E 2ZTSA 1FX0B 4IYJA 5MN5A 5A02A 3DBIA 3UJ8A 3UJBA 1MG0A 3LX8A 2P6PA 2XLCA 1G18A 4RBNA 3SBXA 4NK4A 3GN2A 4BVBA 5IXSA 5CH5A 4HAUA 2VUSA 3RSHA 4UQLA 5KUTA 1TVKA 3A6JA 4PN7A 2GSWA 4DSAA 1G59A 1ODCA 3I83A 1KK3A 3FN4A 1SQFA 3QE3A 4EL5A 4KNYA 3ZC3A 2E18A 4NZNA 1RRMA 3UUEA 2QYTA 1R8SA 4CTNA 3M70A 2ZJ4A 4JVMA 4CUKA 4DLNA 1J2JA 2V96A 4PTYA 4EHJA 1VC2A 2HRBA 3HBJA 4KQJA 4HKTA 3HY6A 1H2RS 3G2OA 4ZODA 4RJJA 3AW9A 3DMFA 4H18A 2PS0A 4MGHA 4ECEA 3D6FA 4CIAA 2X3FA 3JQ8B 5BORA 5AXCA 3E22A 3D2BA 5CCBA 1FYEA 1YNSA 4HFMA 3S1AB 5AW0A 2H63A 2HQRA 3GLUA 1J0DA 1BA3A 3JARA 3V7FA 1QKJA 1R6XA 1M75A 1U02A 4P0TA 4DR2B 1IEXA 4D5GA 2XTZA 1Z62A 1GVNB 3EDRA 1HOTA 3K35A 4G5YA 2JHAA 3DMDA 3DT8A 4V0OA 3ZHXA 3BD7A 3T3OA 5L3ZA 1BU5A 2AJTA 3FPSA 1C0PA 1WEHA 2A5LA 3D4NA 4CM8A 3ZE9A 2RH9B 4F4FA 4YMGA 1SCUB 1ZO8A 2ECQA 4ND5A 4X20B 2PUJA 2NXEA 1LDGA 3ANLA 3KPUA 4RKEA 5CT4A 1ULUA 4UHFA 4PRZA 5F2KA 4BWVA 4UM8B 2HBYA 1RWOA 1IY8A 3TPFA 3WRYA 4QARA 4W5TA 3V4RA 1XQ6A 2VXYA 3UWMA 3VDRA 1J97A 1SBHA 2JI7A 2YV3A 1PAUA 3BDIA 3BGWA 3GDOA 1GHTA 1U3TA 2YN0A 4JLMA 4IKOA 3KE8A 4HB2A 2PLAA 1LGYA 1VLMA 2A9OA 2QN9A 1FXUA 1KDOA 1RYNA 1WMDA 3QVUA 5TE9A 1A7UA 4B85A 1AQUA 1NJ2A 4X64B 2P6OA 5GGYA 2Y1LA 2HDNB 5ULLA 4FONA 1KO4A 3WL5A 3ASYA 1XIVA 5EC8A 4A7PA 2WAXA 3TH5A 3GOHA 3Q3EA 1KMCA 1A4RA 1MB0A 4LOHA 4N9WA 3ZHCA 4BAGA 4C2AA 1JVSA 1DHRA 4HDKA 3RUAA 1OTHA 1Z6GA 3AZQA 3O4RA 3OZEA 4QAJA 1S7GA 2OD2A 3JZMA 1L3CA 2OV4A 4NWIA 2RBEA 1QCZA 2V55B 2I4IA 1GZ4A 4RD4A 1U3VA 4HH1A 4AJ2A 1W59A 1ZM4A 1ESEA 2KQUA 3V8VA 2WAOA 4RK7A 1LKZA 3LU1A 4MPJA 4KSCA 4MJ7A 4EYGA 2C82A 4Q5IA 3HY3A 3R6LA 2FW8A 2P68A 3QKRB 4D9MA 4ETWA 1BU8A 4ZFNA 1AGXA 3AUUA 1ICEA 3DHEA 3LOQA 1AGYA 2WJIA 5JBQA 1VBMA 2VAPA 5BYBA 1PSDA 2IUFA 2W0MA 2CUZA 2IOFK 1NOIA 2FPGA 3ZWOA 3LH5A 2CVOA 3D0OA 3D6UA 1AT1A 4X45A 2J3QA 1PT9A 4HDMA 2PKWA 2VDRB 2ZZMA 3DCYA 4EQ6A 3GXOA 3QHQA 1I4OA 4FI3C 1CDZA 1TUBB 4GU5A 4TS9A 1PS8A 1IQPA 3EAGA 4KWTA 4OMUA 2G4VA 4TMZA 2P6RA 2ACWA 1ZPDA 2ZPTX 1DBWA 3DKKA 3I1JA 1E62A 2VAVA 1W96A 4PY2A 4WOKA 5FBZA 4PLYA 3W6UA 3I2IA 3I9V6 4CEJB 4MUEA 4GGMX 5KSPA 1OU0A 3OCZA 2JGAA 5A1JA 3JASB 2NZXA 3HKBA 4JAVC 2ZR7A 4MS3B 4U63A 1TK3A 3GPLA 4P38A 3GH1A 2YS7A 1NVTA 2G67A 3SIPA 1N8KA 1VSTA 2GFHA 2VF8A 2B4TO 4XA8A 3ZK8A 3CNHA 3M6LA 4ASUA 5LXTA 4IWYA 4TTAA 5KOJA 1R0SA 2JGDA 1KTVA 2EU8A 2Q5JA 3H18A 3OI7A 4OBXA 1CF4A 4A91A 1SBNE 4IH4A 1A8UA 4YRRA 4D4HA 1IXYA 3LC7O 3N2GA 3JZDA 3BHMA 3D4BA 1FVXA 4L7QA 2CYAA 2BELA 3D3JA 4HQRA 2I1QA 4LJYA 3TD2A 2RGBA 2FGKA 1T5SA 3DTVB 3N8HA 5DXJA 4YP9A 4A8HA 4KO1S 4BIIA 4EHKA 1P18A 4XH9B 4XB2A 1U9IC 1L5SA 2IZ1A 3EPRA 4QXRA 1JFSA 2NV6A 2FI1A 4X71A 3SZMA 3UV6A 1AQIA 1VL2A 1XBTA 3IIMA 1GGMA 2Q3BA 1OBCA 1NURA 4YV2A 4PGGA 3FOZA 1DXYA 3ZQUA 5HIKA 4ZQCB 3TRJA 1NXPA 5HKOA 1QKKA 2OZVA 2VJMB 5CA1A 3TI9A 4KQGA 4Q48A 3WP0A 2HGSA 1SA0B 3K15A 3KXIA 4MGIR 4CVNA 4FIZA 4GMXA 5TSDA 4ARIA 4MDHA 2H54A 1AH2A 1E3LA 1IB0A 4GOOD 4N0QA 5EJ6A 4M9QA 2FOXA 4QQRA 1CS0A 2G0AA 4ALKA 3CLVA 3QKSA 2OV8A 1MVLA 1Y9ZA 5D3MA 4MR9B 2B34A 5IJAA 4P9NA 2BFFA 1BN7A 1YFKA 3K8ZA 4UD2A 2ZJ3A 2PIDA 2Y1XA 2C96A 1CUEA 2A58A 5AW9A 4J1NA 2X1LA 3C3CA 4P4SB 4FGZA 5AK0A 3P9CA 2EFCB 4XAQA 2R66A 4LJ4A 5IDQA 1JQKA 3BSWA 1X0XA 3V80A 4URHA 3ZHOA 4PLGA 3Q8KA 2FWAA 2O3QA 5FXMA 3LBHA 3AU8A 2B8WA 1U0EA 3F97A 2IWHA 3A7EA 1ZNWA 3OU6A 3DOEA 2AYXA 3KIPA 3C1TA 1VG8A 1WPQA 1GKLA 3C39A 1FS5A 1GQ2A 2QLBA 2YW9A 4B3BA 2GESA 2PUWA 4BMZA 2IZ0A 1ACJA 4BUZA 5K0EA 3WNDA 3KVNA 1MR3F 3B82A 3GLKA 2DTXA 4FTWA 4HQKA 4KAAA 4W5HA 3PQ5A 1QFZA 1WE2A 2GHIA 1W4LA 1ZFNA 4DMHA 1NDUA 1UFVA 1IHXA 4D9GA 2WKSA 9LDTA 4NFHA 2XDYA 4J2OA 3SSOA 2AWOA 4AZ3B 3CLTD 4GDFA 4UU7A 5BSUA 1H4QA 4E09A 3Q6NA 2CL5A 2M98A 4WRRA 5CTJA 2QZPA 2B94A 2RG1A 2RH8A 3BXGA 3FPBA 4K2AA 1GAWA 5LYJA 5L7TA 3EGIA 2IUSA 1KDZA 2PGXA 4RKFA 1KFJB 5K99A 2FX3A 3DR5A 2AA3A 1YKGA 4B48A 5SY4A 2JAHA 2F00A 1SKUA 1OLXA 4IDFA 4LYFA 5DV9A 5F5NA 2WSSA 3EQ7A 4QA9A 1G20A 3RAFC 1XT6A 3AI2A 1GLNA 1RRKA 3GGOA 1F8UA 4RAQA 2EFGA 4OI1A 4BASA 1AQYA 1KSJA 4UULA 1Q0HA 4QHYA 4BMPB 5HTOA 4B75A 4TMTA 1N7JA 1FXWF 1YJ5A 3TRHA 3UYLA 4CQMD 5JSKA 3O2QB 1ND5A 4QT0A 1P2DA 4Y2TA 1N2XA 1N4AA 2YJ5A 3FLBA 2WIDA 2FZLA 5WRFA 4YMIA 2WP0A 2VRWA 1TU4A 2PX8A 4ITVA 5JANA 1L2TA 4PYQA 5E6SA 3Q15C 2JDIA 2OV3A 1GPUA 2CNLA 1FOEB 3V1LA 1CY2A 2XOEA 2H57A 3HABA 1ZGJA 1UJCA 3NDPA 1WBDA 1XZAA 1B1CA 2VP9A 1TC2A 3P9KA 2VNAA 3UGTA 2Z9BA 1CYDA 3BL6A 1RCFA 3NETA 5C34B 2V6MA 3DBHB 3G2QA 3WDMA 4CV3A 3E9NA 1I8TA 1KH2A 1Y3AA 3NG1A 4RNCA 1ZAYA 4DR6B 1UEXC 1BGVA 3IMKA 1YRWA 4F60A 4KXXA 3C5WP 4IOKA 5I9NA 3DFZA 3CZAA 3OIFA 5C52B 4WFJA 3ROEA 3KKZA 3W5CA 4DIDA 2NVUA 1P1CA 5I7VA 3QXSA 1PEKE 4D8YA 4JJEA 3EW9A 3L43A 3RFVA 3W77A 4BNUA 1CUVA 2AG6A 2RGDA 1DEXA 3CE6A 4EJSC 2VPPA 6NULA 4ZTUB 1ECLA 1XCOA 2GZSA 5TMPA 3BWBA 1DJOA 2Q4EA 4KOAA 2HY7A 1U4NA 4L2IA 4AG3A 4QBIA 4AIRA 4GKVA 3ZD8A 5LZ7A 3PPIA 3DVAB 4US0R 1D4FA 1E9CA 1FK8A 1KFKB 1KO7A 2BCEA 2QUAA 2LIPA 2VBGA 3MA0A 1N9GB 3GX1A 1WD7A 5I9BA 1HO3A 1UXOA 3LL7A 1FDOA 4Z7JA 1VG9B 2G83A 2QMOA 3IE0A 4YRNA 4ZCQA 1Y3HA 3SNKA 3ESQA 1A8IA 2Q5LA 3QWFA 1BA2A 1NVUQ 5KQSA 3OPNA 1FLAA 1SFRA 3HJBA 4OBBA 3RYIB 2Z58A 5KTMA 1T9GR 5E1OA 5CM2Z 3DPSA 3K0CC 3S8EA 1FRZA 4BLWA 2AR7A 5L4LA 4NI5A 4U2FA 4MS4B 2ODQA 5AOCA 3EVFA 2Q8PA 3FB4A 4GWKA 2V97A 3H2KA 4C87A 3K70B 2O05A 3I05A 4FSDA 4R98A 4Y2HA 4K28A 4MQEA 2IPNA 2CLMB 2OBXA 3FNFA 4LMBA 3ZWKA 3E4CA 4AZVA 4D4GA 3W5UA 4JLPA 5AJTA 1VJTA 4AUNA 3IB6A 2HF7A 4TZ6A 4RULA 2HKIA 1CFZA 3OCCA 1PGJA 3VDXA 4YMVA 1I7NA 3GAAA 1ZZEA 1OROA 1U2PA 2G8LA 5CAEA 2NACA 4GIBA 4XIFA 5LQKA 4R6WA 2YOHA 4M9RA 3VJLA 1M5UA 4EMTA 2A30A 3OZDA 5IAGA 3EIFA 1MKYA 3N07A 5F5LA 3HCBA 1X8LA 4YDRA 5FULA 2OBNA 1O6FA 2J0QA 4XVUA 2BGGA 1Z5NA 2OCYC 5C8XA 1EK2A 2Z2KA 3JQQA 4BIMA 3AH8A 1E63A 4AJPA 4ACBA 2HSWA 3SDSA 4DQVA 4ENRA 3HN2A 1O96B 5ES3A 3HA7A 1ID1A 1U7DA 4K1XA 1G5RA 4LDRA 4W82A 1NR1A 3KKMA 1V1MB 2RCNA 1YRHA 3O5AA 4G5RA 4E13A 2QWXA 1F8YA 1NNI1 2ZJYA 4U02A 4ZEVA 3TDNA 3NJ4A 1II8A 1UXGA 4J07A 3ZE8A 2DFLA 2IYUA 3D6TB 3UK2A 3D4PA 4XASA 2PL1A 3QYAA 5EWLA 3ZTYA 3GVIA 4PQEA 4MRVA 1AKEA 1PNVA 3PT5A 4P08A 4YJ2B 4YAJA 3RUCA 2PR2A 3BZUA 1DKUA 1POXA 3B1ZA 3QEMB 2EZ4A 5ECDA 3TXYA 5JR3A 1HKUA 2ZOSA 5EZYB 5BXYA 4M0PA 1CZUA 1EAMA 1M1YE 1HEYA 4G0XA 4F2HA 3OPVA 1QE0A 4OMDA 3UJCA 3INTA 2YYAA 4KLCA 4XSGA 4EL0A 1QAMA 3PHGA 4RM3A 2HV8A 4YBRA 3DC7A 5GVRA 5IX8A 3ER9A 4KQ1A 4ZO7A 3CUUA 3OEHA 1S8OA 3K72B 1H0KA 3FWPA 3DWFA 4JSTA 4EYOA 1F2VA 2JGRA 2QHXA 1GFZA 1P6UA 1WW2A 3IR6A 3WYFA 4B7ZA 4ZOCA 4HDSB 4YHHB 1CUBA 1SY7A 4DCNA 5HUHA 2WWGA 1GQQA 4TN5A 4W5NA 3WQBA 1ODKA 1NVVQ 2Q07A 4RUKA 5JYDA 5JH7F 4NS4A 3G8DA 1TJ5A 1GXSA 2FSSA 3UXHA 1OBVA 3DTYA 1AMNA 4EEZA 5HDQA 2NUTA 1EGAA 4OJTA 1WY5A 3RYFB 2J3JA 4ZQFA 4D80A 2YDXA 1BO6A 3AHJA 3SEQA 2PIAA 3JQDA 3VNAA 2C7QA 4HH3C 3T7TA 5BN3A 2HK8A 5IJZA 2CHQA 3SZGA 2VHZA 3PIIA 1L9XA 1WKBA 1U4SA 4B8WA 4B3HA 2AZDA 4OIFA 3PDUA 3GLGA 3M83A 3O2SB 3WDKA 2HSJA 4CHTA 2F3RA 9LDBA 4W5OA 5KYVA 4TVBA 3LQ1A 1Z0DA 5AKHA 3EBOA 1H22A 1UKVY 3I6QA 4EX7A 4KMOA 2WA1A 2XADA 2FPWA 3IEIA 4ZOLF 4AX8A 4Y2YA 1B7GO 1BSVA 1M1YA 4LOKA 5CLHA 3Q85A 3BMOB 1NKTA 3GYGA 1EDEA 4AWXA 1XEXA 4BC1A 1DKLA 1T2CA 1PO7A 2GKGA 5REQB 3ROXA 2O8DA 3Q0EA 5D8DA 5ALTA 1B0PA 2Z2ZA 4RJIA 4U7HA 3V1TC 1PQYA 4IGIA 4Q3NA 3NCHA 2XZOA 4GQBA 4BFUA 5HGXA 1VA5A 1UZUA 1PV4A 3D2LA 4QPCA 2D1YA 4PO9A 1DWPA 4MS1A 2NPOA 1Z5VA 2H7YA 2ORED 2P8SA 3TSYA 3ZCTA 3TOSA 2AG5A 2BZ0A 1CUHA 1QRAA 3SLRA 5E2IA 4JJ7A 4EG5A 1LSJA 1CVRA 3HXOA 3ZOZA 4QYIA 4H7FA 1VLJA 3M1IA 4WV3A 5FAKA 2PRSA 2P2YA 5KCZA 3ZWPA 1Y9AA 5CG2A 2P30A 1Z26A 3L1JA 3TEFA 1GZDA 3DW3X 5B4TA 4BVGA 5IS2A 3Q2IA 3ENKA 4U6SA 5JC1A 2JFPA 4I5FA 2C29D 4RVUA 3HCOA 2Z5LA 3HY4A 5IUKC 1R4MB 2JAWA 3FM9A 1I7QB 2R25B 1GPLA 1G2PA 1WLYA 1Z4KA 1TEXA 1ZD5A 3K16A 4Y1EA 4ZMRA 2ZTHA 4YRQA 4LIPD 3SEFA 3W2GA 1L5MA 5LP6C 4OX9Y 1HT1E 4H7JA 2O1EA 3B53X 3KLOA 3E3LA 3ZDXB 2AC2A 4TLBA 2R8EA 3CH4B 4HS9A 5CK4A 2O8DB 3N2KA 1X7ZA 2BPOA 4WY8A 3DL2A 1EA5A 1BFUA 2O2SA 2YHUA 2ZT5A 4RF3A 2WV7A 4UDYX 3PTZA 4KQXA 1RFGE 4NZMA 4BB9A 4UPEA 4PBRA 2X23A 1XRNA 3GZNB 1Q7CA 5C1PA 2V3CC 2XUAA 2J9RA 1V37A 3ZCPA 1KI4A 1R6UA 3EXIA 4DLYA 3ACDA 5IHPA 2ZCVA 4FYKA 1OI3A 1U98A 1C4KA 1T4CA 1SG9A 5FV4A 1TD9A 5K3EA 4PZPA 4JGBA 3FPGA 1SVNA 1Z7YA 2AVDA 4UNSA 3VHXA 4BX2A 1UDAA 4MIOA 3HDTA 2PYZA 1I33A 2FZ5A 5E95A 1A50B 1L1RA 2W4QA 2XB9A 4Q4HA 1UMBA 1A04A 1ND6A 1JEEA 1G98A 1QO0D 4QRIA 1ZU5A 3VISA 3D0RA 1KMMA 1Z18A 1RAAA 3TJMA 4RGQA 4XD7A 5FPYA 2NSYA 3WO1A 4A6EA 2YL2A 1GADO 2I2AA 3NHAA 1OT5A 3NGLA 3BK2A 4JI0B 1Y1SA 1QE3A 3TX2A 5BQ5A 2B1RA 2BMAA 2EIHA 3DDSA 2Q8NA 2QSJA 1WOYA 2VPWA 3KX2A 4JA0A 1LC0A 2BSAA 4X1KA 3FYTA 3NI2A 4TT3D 3JPYA 4DRZA 1CQIB 4LRQA 3WB2A 3JD4A 1WJGA 1IJFA 1TUGA 4B4VA 4HRAA 4I5GA 1ILEA 1SIOA 3ZZ1A 5ALUA 4GKJB 1DWUA 1VCOA 1L9KA 3G1TA 5CT9A 4D0NA 2W93A 4YXFA 4O59O 3AWDA 3BZWA 1T9HA 3ZVNA 3B7PA 3JV7A 4JEUA 5DW3A 4O8CA 3ZHZA 3BRWD 4LXGA 4YT5A 3SSMA 3CISA 5LQDA 3S3TA 1JKMA 1Y5IA 2GK6A 2A59A 2DT8A 4ZTBA 1G3UA 1KETA 2FJPA 3AG6A 1ODIA 4H6VA 2IIBA 3FDXA 2HLDA 3KZXA 4XB1A 4XQ9A 1F48A 2VDNB 5L9AA 3UJ9A 1TKBA 1LDEA 1VMEA 2VR1A 4W5JA 1M2HA 2IOYA 3UT6A 2BJVA 2GCIA 3DAYA 4KOEC 3UVEA 1GG8A 1EDDA 4LK3A 4BN0A 2X0FA 1ZGCA 2EW8A 1ICIA 3AERA 4A82A 1JH8A 1V2HE 1E9DA 3CXRA 3RTBA 4BS9A 1TM2A 1AUPA 1RMYA 2BP7B 3OEWA 4ZVTA 4DA9A 3VU3A 1Z4NA 2EP5A 2QAGC 3DKPA 3JQCA 1R9NA 2FE4A 2VF4X 3JRWA 5EG5A 1EM8B 2FPKA 3C5EA 3FCEA 4AB1A 1MGOA 4FKZA 1DAKA 4IMJB 1KSHA 4B6RA 3UHOA 3HUTA 1QVAA 1XCBA 3H1BA 4IXTA 4XR4A 5LPNA 2J5BA 3IERA 1PUXA 3OX3A 1VP3A 5JSZB 3M2TA 3H99A 1IUPA 3MCWA 4TWZA 4Y1RB 1EK1A 5EUBA 3WJ7A 4A4DA 3O8OA 3PEWA 3P9SA 1O5OA 7REQA 2FMFA 3EVAA 3RUDA 4Q02A 3G2HA 4LTNA 1CUWA 1J5XA 1TX4B 3AUFA 1GAJA 3QF4A 2W42A 5IVKA 2I4LA 2R86A 3AHCA 4G5OA 4O0MA 4Q39A 4DBLC 2J5KA 1EYZA 1G7RA 1CDEA 1PJ3A 2FN3A 3BTOA 4GI1A 2CNNA 2V59A 2BFEB 3COWA 4JEIA 1U3DA 2VAMA 3KAKA 4M3NA 3T7CA 4CMHA 3A36A 1U90A 1LU9A 1YRBA 1HFEL 3A4VA 1ZAKA 1OFUX 2I2XB 3FNRA 4EY3A 3SS9X 1WQ3A 4HLQB 1J7JA 4KAJA 5JS1A 1NVAA 3FSGD 2XBMA 4WXMA 2QXTA 2CZCA 4MHTA 1P7YA 4F04A 4G1VA 2YRXA 4L9SA 1SXHA 3QMWA 4CIBA 2WJ4A 3RSZA 3JAMA 5A7HA 1RQGA 1MJHA 4KZPA 3WIVA 4MV1A 2BGTA 1SCDA 4EITA 1WY7A 4O4LB 1GTMA 2XA1A 1L0BA 3HXQA 1EFUA 3NHJA 1F12A 4OFWA 1YZUA 3UF0A 3G1WA 3MILA 3QVXA 5JMWA 1QIGA 4F8EA 4N3BA 1JR3D 3BHNA 1Z6QA 3DWIA 2ZRFA 4L6AA 2I4OA 4P2GA 3VYTB 1T0HB 4TZTA 3P9ZA 5ECYA 3C6QA 2CFTA 1RXVA 4Z6KA 4H16A 5SY6A 1E1DA 1Z56C 2ZBQA 4YWHA 4IW3B 7MDHA 2GPJA 2B4AA 2DFKB 2O06A 4ZYZA 5B2FA 2WWTA 4Y2PA 5KOYA 1M33A 1NKSA 4JJ6A 1AS2A 4YRBA 2Y1FA 1JHMA 5L3RA 1SUIA 5E4YA 1J8FA 1MEEA 1E0DA 4OHVA 4V0QA 5EP4A 2EVWX 3EYWA 3QBEA 2IGTA 2JLUA 2FFAA 1R6TA 3B3FA 1VE3A 4EUKA 5BUSA 4BNHA 1GL6A 2Y6VA 3NUGA 5C7YA 4EI2A 2IP2A 3RJ5A 2A67A 3A37A 5C9ZA 1NTOA 3ND5A 1A2KC 1WNTA 4YV0A 4RAOA 2ZBDA 4YS6A 3V9AA 1K88A 2VA9A 3UO8B 4C7KA 2ZT6A 2H4YA 4PAGA 4O4HA 3RVPA 3MCVA 4L50A 4F4CA 5M29A 4AJEA 3CLTC 5K0FA 3IQDB 4RFLA 4Y9DA 2JG3A 1VL8A 3K70D 3QX3A 3PYLA 2PMBA 4O2RA 1JLLA 5K0JA 5L95A 2HT6A 4IF4A 1E5VA 2OZLB 2ZRLA 5K45A 1ZEMA 4JLJA 1MC4A 1W6UA 3QNUA 4AKEA 1WETA 2W6IA 3P4XA 3A70A 2Y4NA 2ODWA 3HB9A 1DARA 3SC4A 5A04A 3GJTA 2WM3A 3A9WA 5B3LA 2JW5A 1IATA 2M9MA 2ZR8A 3IVAA 4OK5A 4M2LA 4B5KA 2P6UA 2ID8A 2RGYA 2WIBA 4PZ0A 5E8RA 4B4KA 1G8HA 4ZCPA 3HEBA 1HBJA 5HMMA 4Q3EA 4DLPA 1CR6A 1USUA 1X3LA 2HPVA 2PRZA 3A0RB 2VRNA 5DSXA 2E4WA 1EXVA 5T6MA 4Y0VA 5T4HA 2JLBA 1KXZA 3I2GA 2PPVA 2J4CA 2O3TA 1F0YA 3QITA 1E3EA 4KGXA 5K3FA 3TLXA 4BFWA 2ZM5A 1PFUA 1GTVA 1BDMA 2X0JA 4HWOA 1OFUA 4IIJF 3V7WA 4F97A 1P8AA 4IQ0A 2OCLA 2JEYA 2EF1A 1CUGA 3K4QA 1TDJA 3VZBA 4TQAA 1X7HA 3A3PA 1JHVA 1E2NA 4JLUA 2LPMA 2FMUA 2VDPB 3WO0A 2BLNA 4KR7A 1XEWY 3ROGA 4K6FA 1CY4A 2FY8A 1KH3A 2POCA 4HYYA 3ZZTA 4QRDA 2HSZA 4X1IA 3DZCA 2VA8A 4JI8B 4M87A 3WQSB 2V54A 1Q22A 1Q0TA 3M4XA 3UKOA 1CZNA 1R5OA 4XIYA 1A76A 4EUNA 5KNCD 3RWMB 5L4SA 4M98A 3AUYA 5B1YA 2Q0HA 2WTMA 4O3FA 4V03A 2R68A 3CCBA 5EQJB 5F98A 1NW4A 4HO1X 1GUDA 3A4TA 2XITA 3DB2A 3R5TA 3TBFA 5F9MA 3RJZA 1G8AA 2FP3A 3ZCSA 1KK2A 1VIYA 2PZJA 1RI1A 1ZKDA 2PXXA 3W5IA 2OGSA 1M67A 3VI4B 4ZAGA 2W2LD 4KFTA 3NYQA 4WJZA 1XNJA 2Y05A 5JWRA 2I9PA 4MQBA 4JYZA 1QYDA 2R85A 1K6IA 3DAPA 3OJLA 3WGOA 3PX3A 2JGJA 5HRCA 4ZKEA 4H1VA 4ZREA 4MVJI 1BMFA 4AKSA 4EZBA 3SVLA 4CF7A 4BJ5A 3DM5A 4MGEA 2NU9A 3DVLA 2AFHE 3LLCA 4UXHA 5KQGA 4A15A 2O0KA 2YBEA 3PC8A 4O02B 5ALEA 2Q27A 1V3UA 5HEKA 3I39X 2A9PA 4GI5A 2MSCB 3AV3A 2RHBA 4RV4A 1GYQA 4E2FA 4ED9A 1ZCJA 4P22A 1QJCA 2EV9A 1XWWA 2P2ZA 1JSRA 3C8UA 4J3JA 3WYDA 4LXUA 1WB9A 1UJNA 4G5SA 1ELOA 1YAHA 3CTPA 3H0KA 4HNTA 3CUWA 5JAZA 2IDZA 4IOLA 3KSAC 1MVNA 4OEHA 2ON6A 5KWSA 2W2NA 4DMCA 1SHJA 3NWJA 3L8EA 1CSEE 2NZ8A 1EINA 4IHJB 4LY3A 1D3AA 1FP6A 4MB6A 3DFUA 4RYDA 5CR9A 3GG2A 2GAFA 4DSTA 1UZMA 2E49A 1K6MA 3L7OA 4V3CA 4JB0A 3SHVA 4DRYA 1PGNA 2QM3A 1XR3A 2R9VA 4WNIA 3UAXA 3VSBA 4B17A 1W36C 2P1ZA 3IEVA 3ROMA 1OA0A 4BRWA 2Q4RA 2VNHA 2Q9CA 3TLGB 4DPKA 1NQVA 1W2WB 2AJBA 3PFNA 5I7OA 2CSXA 2G1AA 4A36A 3SBEA 2GOYA 5COQA 1FRVA 2BGMA 2PA0A 3QU2A 4MR7A 4B6SA 1H4SA 2Z98A 2I7VA 3RHSA 1C7EA 3FW1A 3V4LA 2YFHA 3L01A 3PGA1 5EUQB 3DFFA 2IYLD 3W5BA 1D5CA 2CGEA 5D7BA 4H7DA 4CTOA 2ATIA 3ZWQA 3AL0C 3U56A 8MHTA 1E7YA 3DDZX 4A26A 3PIRA 2PBFA 1SVIA 1ZI9A 3H5LA 2HU5A 1Z5PA 1ZUHA 2QA5A 5BURA 1P9NA 1KU6A 5JJKA 4BCBA 1QHYA 1CJUC 2EWMA 2A33A 1EAYA 1P2GA 4FWTA 3K1YA 3D1LA 4JB8A 5LA6F 1LF5A 1PEDA 4R68A 4XTCS 1KMQA 4JC4A 2C8JA 1UBRS 1QQ5A 1ZUD1 3U6BA 2PTHA 5EHXA 2LZ0A 2J48A 3GPDG 3HJGA 3JQ7A 4QX6A 1XPUA 2OP1A 2ID4A 2QNIA 4NV1A 3SN6A 1CVLA 4MVJE 2WM8A 2L69A 3GJXC 1XYVA 1K86A 4ENPA 1YOVA 1SBQA 5KU1A 1VYHA 3I09A 3ZGNA 4BMSA 1P31A 5CH3A 1EVZA 1C8BA 1FU8A 1XA4A 1KYYA 3MBOA 3FTNA 2NO6A 2OG1A 3K92A 3EHEA 3OBBA 3ZN2A 4LF9B 5IBQA 4P4LA 1N2JA 2I2WA 5FI3A 1RMQA 3QVSA 3F9CA 3ANYB 1XDUA 1J4AA 1IXZA 3NO4A 4HP8A 1M76A 4YQYA 4EG6A 4CLHA 3KFVA 2V7BA 1AKRA 4JEHA 4QVIA 4J2TA 4KQCA 3R5JA 1I24A 4R1UA 1W8IA 1QIEA 4LJ7A 2QX7A 1AK9A 3ABRB 4ZQHA 4C1BA 5CFRA 1KEVA 1J0AA 3CWCA 2ATEA 3E2MA 3G9UA 1QC5A 3A10A 4HZUA 1RWMA 1NP7A 1S2OA 5ENZA 4BVKA 1X1BA 5A03A 3DKRA 5BRAA 4AT1A 1DRVA 6GPBA 4GBED 4ZO9A 5BSVA 5D6NA 1E92A 2WINI 1JU3A 3DEHA 1T35A 3RYTC 1KP2A 4B45A 1JLKA 2BM9A 4XOIA 5DP2A 1KYVA 2Z2JA 2VBFA 1B2LA 5EWMA 3ZQ4A 3EVTA 1QGAA 3BBLA 2XXAA 3ORFA 4PYNA 1HV8A 2D1FA 3D3KA 4D9EA 3OFNA 1K3FA 4ALLA 1XZEA 4A5SA 1O3YA 1L8AA 2VDVE 4Q00A 3VJMA 5E6UB 3UMSA 3AJRA 4O4IF 4QYWA 5ICCA 5JI2E 4QXMA 4WOCA 3QHAA 4MVJA 1EJ0A 3QLVC 2AE1A 5FUQA 3THYA 3CF4G 4G1UC 1ZP6A 3QOFA 4AJNA 3WIEA 5DM2A 1V47A 4OXXA 2HX1A 2Y76A 4EW1A 1TA0A 4MJLA 2WMNB 3R3XA 4FMBB 4L3OA 3DO6A 5D84A 1YR3A 2F6RA 4TKZA 3U37A 4DRXB 4EHFA 4R2IA 2X14A 3Q10A 1U1DA 1M7GA 5IVHA 3UG6A 3IT2A 1UAAA 2IHKA 3SIRA 4AVYA 1N5JA 4J16A 4A6XA 2FNAA 2SCUB 2WU8A 1G8GA 3NOXA 5AK3A 4DIMA 5J2UF 5FTWA 3E7DA 1O97C 2QE7D 4URXR 5KKAA 1FQKA 2OYCA 2J8ZA 3BD9A 3N7UA 2FOIA 4PC2A 2YZMA 3EMDA 3T7SA 2W71A 4XARA 5IKPA 1FXWA 3KKNA 4DJ5X 4MTCA 4N0DA 2G5CA 1RZUA 3DBRB 3TAXA 4Z2AA 5M5BA 1OTXA 3PI7A 5AKEA 3KR2A 1HH4A 1RM4A 5KEIA 4CTJA 3TLCA 4X8OA 3UQZA 3LFUA 3X3HA 3EWSA 1TFRA 4TWJA 1QS0A 2J3DA 3IV7A 4BAZA 3NP7A 3CW9A 3QLJA 1MHTA 4F4IA 3NAQA 3ZLBA 2Q3LA 1AVTA 4MCJA 1VE9A 1C9KA 4EY6A 3NTXA 5DWVA 4PX3A 3OJXA 3NPAA 4MINA 3BXFA 1NUUA 3NWEA 4Q16A 1Q7GA 2Q3FA 2HMAA 4B3XA 3HC7A 4H6PA 4GD3Q 1ZNZA 4EMSA 1M2VA 4D9KA 4TKVB 1TO2E 5AHXA 1WB5A 1UBNA 4M1EA 3FYHA 1XMQB 1DO8A 2R4UA 3COPA 2JKZA 3JAKA 3U4QB 1DDGA 3GLQA 3DUWA 4BRZA 3V46A 4CMCA 2QR3A 3FPJA 5COBA 4KBGA 4URVR 4Z53A 2ZZKA 3MRTA 4GR5A 4D99A 4EMBA 3ETGA 4DMFA 5IASA 3ENVA 3NAGA 4E6PA 1TAGA 3ME5A 2ZK7A 3A6FA 3DZIA 3L3BA 4PHCA 3PDHA 5JQGA 5KJFA 2BVNA 5AR1A 3HCAA 1OX4A 1M6VB 5AM1A