2CWDA

Crystal structure of tt1001 protein from thermus thermophilus hb8
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
150
structure length
150
Chain Sequence
DRPVRVLFVCLGNICRSPMAEGIFRKLLKERGLEDRFEVDSAGTGAWHVGEPMDPRARRVLEEEGAYFPHVARRLTREDVLAYDHILVMDRENLEEVLRRFPEARGKVRLVLEELGGGEVQDPYYGDLEDFREVYWTLEAALQAFLDRHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of TT1001 protein from Thermus thermophilus HB8
rcsb
molecule keywords low molecular weight phosphotyrosine protein phosphatase
molecule tags Hydrolase
source organism Thermus thermophilus
total genus 61
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2cwdA00
4Y9TA 2MSKA 3BRQA 1ZHHA 5TQJA 5JNSA 1LJUA 4S04A 2FQWA 1SXGA 4L85A 2HJ9A 5TQ0B 4MPTA 3MF4A 4MR9B 2FQYA 3MQ4A 4RU1A 5D2CA 4G97A 3HDVA 4GPAA 5BQ3A 2NZUG 1BDJA 4O1HA 2PUBA 2HSGA 3Q15C 1NXVA 1SRRA 2GBPA 1YS7A 4FE7A 1GCAA 2P9HA 4ETNA 3M9XA 3HUUA 5JNWA 3QX9A 1UDRA 4MLCA 4G86A 1E2BA 3I5AA 1IIBA 4IMJB 3BRSA 3CNBA 3W9SA 2A9RA 1Y1LA 3I45A 2LP4Y 2E4YA 1ZAYA 2FVYA 3H5WA 4Z9BA 3B2NA 5B3JA 1PEAA 3CLKA 4JAVC 4CBVA 3BBLA 4F11A 3OLVA 4WXMA 1DC7A 3T8YA 3MIZA 5ABPA 1U0SY 2GKGA 3H75A 5CNMA 4RSMA 2XDYA 3KKEA 1DCKA 5C5CA 3IPCA 4TMYA 1YK1A 2CD7A 3A10A 1ZN2A 3LUGA 3A0RB 3QEMB 3LUJA 3CG4A 3JVIA 4WUTA 5C5EA 1BDIA 1USGA 3OLXA 1OXKB 1EAYA 5GOTA 3QLVA 2FSPA 1JYEA 3LUHA 4KV7A 2A9QA 1CEYA 1SXHA 3A0UA 3H5IA 4RKRA 1FSPA 4KREA 4RY8A 4XXHA 3JPYA 4LE0A 1VPWA 1XWWA 5JNTA 4N03A 1PNRA 3GL9A 1MB0A 4Q6BA 1JL3A 4IRXA 2OENG 1P6UA 1YS6A 3TX6A 3NNSA 4KK3A 4D6YA 1JFVA 1YVUA 5DTEA 1DG9A 4JOQA 4MS1A 4NQRA 1CHNA 3OMXA 3MMNA 3SG0A 2F8SA 3GYBA 1F4VA 1TVMA 3G85A 2L18A 4YP9A 1WETA 1FFGA 2MYUA 2PUDA 3Q7RA 3H5OA 1EWVA 3T6KA 3QELB 1Z2DA 1JDNA 2LPMA 4EYQA 5FWYB 2NT3A 3C3MA 4W5RA 2MSWA 4RXMA 5IEJA 2VUIB 2PL9A 2N9UA 3SM9A 1DBQA 2NUBA 2PKXA 5KQMA 2OQRA 3N8IA 1QP4A 1CYEA 4MLDA 4YWHA 2YHBA 4P98A 1VLZA 4S05A 2KYRA 2NZVG 3C6QA 3O21A 2FN9A 1DZ3A 4LE1A 3FFWA 1OXBB 4G0MA 4O1IA 3KYJB 3JVDA 2H0AA 2JVKA 1AB5A 5BRAA 2IPLA 2PJUA 1W9HA 4WXEA 4YRZA 3KYIB 3K9CA 4RKQA 5TE9A 1E6MA 1DP4A 4TLMB 3LFTA 3CZ5A 2CHEA 3O1HB 4MR7B 4N47A 4DN6A 1DBPA 4MR9A 6CHYA 3EDCA 2O20A 2CWDA 1M5UA 3KLOA 3O1JC 1Z18A 3N75A 2JVIA 4E7OA 2MYPA 4MQEA 1Z2EA 2HQRA 3LKBA 2E4VA 1M5TA 2IPNA 1M2FA 3GRCA 1ABEA 2LUOA 3TMYA 3TB6A 2CHFA 2FTKE 5JS2A 3SQNA 4G0PA 2ID7A 4PYRA 4PZ0A 3A3KA 2GX6A 4LZLA 1J56A 4MQFB 5E3JA 5HSGA 1FFWA 1ZGZA 4MGEA 1I3CA 3CFYA 4RDCA 2QSJA 1Z25A 2FEPA 4MR8A 4YCSA 2JK1A 3E61A 3HCWA 1NXWA 3Q41A 4HNQA 2QV0A 3P9YA 3JPWA 2VUHB 4LE2A 3QEMA 1GUDA 1R8JA 3IP5A 5DLEA 3ROTA 4OLBA 3RVOA 2JRLA 3OLZA 3F73A 3RVSA 5TQ2B 4F06A 3VNAA 2MYTA 4XFKA 5GQSA 2RJOA 3LUDA 3Q7TA 2DRIA 3H6GA 4LRQA 4KRFA 3EODA 1GLGA 1MVOA 2FEKA 4D74A 1QQAA 2ID9A 3IP6A 4KVFA 5DGCA 4KNYA 2WJAA 1B00A 3Q9SA 2FN8A 2JBAB 3O2JA 3R0JA 5IULC 1MAVA 1E6KA 3EAFA 4G0QA 4QYWA 1BAPA 1DRJA 3GT7A 3H1EA 4RS3A 1AB6A 4F3TA 4B09A 1JDPA 2M1ZA 4YS6A 2QU7A 5FWXB 1M2EA 5KQGA 1KGSA 3D02A 5EWMB 3SAJA 2L17A 3KCNA 4PICA 4KFCA 2R25B 1ZVVA 3RVNA 3DLHA 3EJWA 4M88A 5KC9A 2ZWMA 3O2SB 4MS3B 1P2FA 2QVCA 5CNJA 5EWJA 4RK7A 2IOYA 4W5NA 3O2QB 1D2AA 5HKOA 4OG2A 4XAQA 2FXIA 3UUGA 2AYZA 1RXIA 3KLNA 4XLTA 1YIOA 4G0ZA 3LMKA 3O75A 1MB3A 3FGZA 3MYYA 4PE5B 4IMIB 3EQ2A 1JYFA 3ROFA 4EYOA 2F8TA 1NY5A 5TPWB 2B1JA 4DQDA 4H3HB 4IGAA 2FMFA 1JX6A 1QKKA 1U2QA 1PEYA 3IPAA 1MIHA 3C97A 1U8TA 4RY9A 5IUNC 1QQBA 1ISSA 5BR1A 1U04A 5F64A 4RY0A 2QXYA 4NV3A 3KHTA 4RK4A 3FDFA 3CTPA 3OM0A 5ED4A 5IUJC 2QR3A 2IDMA 2PUAA 2RDMA 1C0EA 2TMYA 5IBQA 2WB4A 4FB4A 3OLWA 3N0WA 2PUEA 3O1IC 4Z0NA 2E4UA 4MS4B 3LUCA 2WWVD 2PUGA 3RVLA 3FFTA 3H6HA 1ZY2A 1NXSA 4MRMA 3T95A 1A2OA 4QICA 2L19A 4JASB 4MAAA 1FFSA 3HJFA 4Q7EA 4L4UA 2QW1A 3HUTA 3OQOA 2WRZA 3N0RA 2M98A 2HPHA 3DGFC 3N53A 3HVRA 1URPA 4H60A 3KG2A 1QO0A 9ABPA 4G0OA 2PE5A 1YTUA 4N0PA 3N0XA 2QZJA 4YR7A 3SY8A 2NT4A 4ZPJA 5HQJA 3RVJA 4TLLB 4RK0A 5CNKA 5TQ2A 3RVRA 1S8NA 4OTZA 5TQ0A 4EUKA 1ABFA 2P4UA 1K66A 4WWHA 4RK6A 5JNVA 2PUFA 3OO1A 4FE4A 1QP7A 4Z4CA 3CU5A 4N0QA 2R48A 3OM1A 5IUKC 2X7XA 5PNTA 1RPJA 1A04A 4EVQA 1LJLA 4QYMA 4KQCA 1USKA 4WZZA 4ZYLA 5EWLB 1Z26A 2MYNA 2VYCA 4IILA 3HK2A 5FWXA 3RQIA 4YO7A 4XARA 3H5LA 2RJNA 4RXTA 4UHKA 5T3YA 2R47A 1P8AA 4N41A 1DCMA 1SXIA 4HNSA 4ZMSA 2PL1A 2WMYA 3RVQA 3C3WA 3S99A 2PUCA 4NCBA 1ZH2A 4JB2A 4ETIA 3QEKA 3QK7A 4YGXB 3DLBA 3GBVA 4G0YA 3BREA 4W5QA 3HXMA 2IPAB 3GV0A 1XHFA 4F12A 4KPYA 3IDOA 4JA2A 1SD5A 5FBHA 2GWRA 4MS1B 3SNKA 3CG0A 3QX8A 1FQWA 5HM6A 5TPZD 4ML3A 7ABPA 2GI4A 1ZGGA 3OMWA 3OQNA 2R4QA 5KI6A 1DBWA 3KTOA 4YV7A 4YLEA 3O74A 3HS3A 2FMHA 4H3KB 3EQZA 3UK0A 5IC5A 4OBBA 1JHZA 1D1QA 3H5VA 4EVSA 1YMVA 1USIA 4KMRA 1Z16A 4RK1A 3CZCA 3DGEC 1D5WA 3JTEA 2FLKA 4NICA 3TO5A 5T7BA 3E3MA 1KRWA 1TLFA 3BILA 4JP1A 5DCLA 5IEBA 4N76A 1NXPA 4IF4A 1YMUA 2FKAA 1XHEA 4KK4A 4RZSA 4W5OA 1NATA 2IYNA 3DBIA 3KS9A 4MS4A 4JB0A 5KQLA 1Z13A 3QLUA 3RH0A 4KZKA 4ZMRA 1C4WA 4NCAA 3M6MD 3QELA 4RWEA 1KMIY 3H5TA 1HEYA 2J48A 3D8UA 5I4CA 3HEBA 2E4ZA 5FWYA 3HV2A 3LTEA 1ZDMA 3MM4A 1Z17A 4MQEB 3NHZA 1RZRD 1QO0D 4EY3A 1BA2A 1RXEA 1GCGA 2JCGA 1JF8A 1L5YA 4HYEA 3VNBA 4ZJPA 2L2QA 4MYRA 2A9OA 1EHCA 5KQPA 5TPZA 2LBPA 4TN5A 1APBA 1NXXA 1JH9A 1EFAA 2PMCA 1GUBA 4Z4FA 3GWGA 2V0NA 1ZESA 2W42A 4MR7A 4LDAA 4LDZA 4MR8B 1DCFA 2FLWA 2FW0A 3URMA 3JY6A 8ABPA 2Q5CA 3G1WA 1F51E 5BRJA 1DC8A 3T38A 1VRVA 5KWSA 3HDGA 5EWLA 1ISRA 3HO1A 5CNIA 3KJXA 1L5ZA 1W25A 3LUFA 4Z4GA 1NXTA 3JS5A 4Z4HA 4W5TA 1QPZA 3LOPA 3RVMA 3IP9A 3NBMA 1LBHA 1K68A 4G0XA 2YHAA 3N6VA 4WT7A 2MSLA 1EWKA 1P6QA 3F7NA 4Z99A 3CKMA 2E4XA 1D4ZA 4MQFA 3C3KA 1JFSA 2FMKA 2JVJA 1U2PA 4RXUA 1T34A 1QMPA 1A0OA 2FQXA 5JNUA 4ETMA 3K4HA 1RNLA 3Q7SA 1QP0A 1Z15A 1BVHA 4O5AA 1D1PA 1RZRA 3KSMA 3LUAA 3NNDA 4F8JA 5CHYA 1YK0A 3QLUC 3FMVA 3MA0A 1PNTA 3IP7A 1JWLA 4PEVA 3LUKA 2H3HA 1KRXA 2I6FA 3CRNA 3DZDA 5EWJB 3NNNA 1PHRA 1TJYA 4E7PA 4P1ZA 2IPMA 4UHJA 4EYGA 4EGSA 2JBAA 3OQMA 3LKVA 3CS3A 4QPJC 1DRKA 1LK0A 1NXOA 2RGYA 4OLAA 3F6PA 3I09A 4DADA 3HM9A 2PAFA 1VKRA 1LBIA 2FMIA 4Q6WA 5EWMA 2WY2D 2FEWB 1E6LA 2WJWA 3QLTA 5JS1A 5JNRA 4Z9AA 2QVGA 1QNLA 4KQ9A 4MS3A 1JLKA 3OLYA 3OO0A 3GBPA 1TM2A 3RVKA 3TD9A 5B3JC 6ABPA 3RVPA 2PLNA 3M9WA 4EYKA 3UKJA 3L6UA 3H1GA 1TMYA 3ILYA 1PUXA 2VK2A 4Z4IA 1ZITA 2HQOA 2HQBA 1Z12A 5KC8A 3H1FA 3FFXA 1NTRA 3F6CA 1JFTA 3CHYA 4EVRA 2AYXA 3QLVC 4RV5A 3HSYA 5TPWA 4MRMB 5FBKA 3L49A 1H9CA 4LX8A 3ILHA 3NHMA 1EWTA 2B4AA 4OATA 1BDHA 2IKSA 1JBEA 4GNRA 1DJMA 2BGGA 3HZHA 4HNRA 2A9PA 2E4WA 2ZAYA 3I42A 4RK5A 5DKFA 3EULA 4Z4EA 4D6XA 3EGCA 5IX8A 2LIVA 1ZH4A 2JB9A 3GA5A 4XASA
chains in the Genus database with same CATH superfamily
1N2IA 2CK3D 2XYQA 3CZRA 1Y8ZA 4A82A 1V11B 3UEOA 3O7MA 1O9GA 3ZH9B 5CHEA 1FLAA 2O5RA 1OFUA 4J7CA 2P41A 3VZDA 5KMGA 2IYAA 2N1MA 2GZ1A 1SXGA 5E4FA 3BSYA 4MVJG 3VH2A 2PGXA 1U2DA 1Y1TA 1P4HA 2ENUA 3AR9A 3ZR4B 2JGJA 2XRYA 3CC8A 3I53A 4FW9A 3JWIA 3QXJA 3V9PA 2JC3A 2DR0A 4J0IA 5A5GA 3BIXA 2Q07A 1EXWA 1U0LA 2C2BA 3R3WA 3ZLTA 3Q15C 2H85A 4HFMA 4KWTA 1DDGA 3A6LA 4PX5A 4LY3A 4AY6A 1AK1A 2QRVA 4I19A 4Q16A 2FPIA 3ML1A 1R4AA 3HUUA 4Q7JB 4P0QB 2ZBVA 4MLCA 5TX7A 5A7FA 2WP0A 4E2XA 2C29D 5EMJA 4DIEA 2IT1A 4P5EA 3ZLBA 4C4SA 4R83A 1NW3A 2VDKB 1NMSA 4OAOA 5B64A 1J2UA 3LBIA 2O59A 3Q2OA 4ARIA 3T3GA 1L4HA 3ZDFA 2GZHA 3Q0TA 1OFUX 2NOAA 4MYTA 2VDRB 2DGDA 5GGXA 2QVLA 3CLKA 3PF9A 2EKLA 1K5GA 1QHHB 1H94A 5D3QA 4ZVVA 4JV5B 1QVVA 4RKFA 2QGZA 3H0EA 4MVJF 2AMJA 2GN2A 2HF8A 4QPCA 1NMZA 2QN3A 1Y5NA 4HDQB 4F8YA 2FWPA 4KE6A 2QL9A 3WJ1A 3PGLA 2HMVA 4RGYA 5DWDA 4DBLC 1US8A 4KFUA 5C3UA 5TR9A 4N3GA 1T0JB 3CRVA 4WLFA 2WWYA 1EIWA 1O7JA 2H1CA 5B1IA 5BRNA 5A71A 1KE1A 3IHLA 3WQSB 1EP1B 3HZZA 3MCAA 5HF8A 3OZRA 2PCJA 1DAOA 3DBRA 3Q11A 5K4AA 3CLRC 4KIWA 1BMDA 1VE3A 3PVCA 1H3FA 2BE9A 4UVEA 1VPWA 1QS0A 3QW4B 3BRWD 1QRUA 5ITZB 5D8DA 1HDEA 3FI9A 3ON5A 4L95C 2B94A 4EECA 4EY4A 1C4XA 4JSRA 2OENG 3QXSA 4HNAB 4INZA 4X91A 5DTEA 1N0HA 4NS4A 1TIPA 2B4RO 3ETCA 4LYYA 4ZYVA 1JXMA 2QJRA 1T6YA 3OMXA 2WSIA 3GYBA 2TECE 1GKIA 1Z4NA 3GEPA 4YRDA 3DAFA 4YJGA 4P4LA 3D6JA 4F38A 3DWGA 2XDQB 2XWJI 1RYNA 4IM7A 2PUDA 4IG9A 4AS1A 1HQDA 3HR7A 1A97A 4HDKA 4NH4A 2ATIA 3W2IA 4LJ5A 4EFNA 1OXTA 2AEEA 1R0KA 2BKXA 4RCVA 1IULA 3BD6A 3CMMA 3WNBA 1IONA 2NUBA 1B6SA 2XZDA 3TB4A 4YRGA 5ETJA 2F9MA 1YS9A 2JFQA 1ZO8A 2K5UA 3UB3A 4B4VA 1VLZA 4KVAA 4DZTA 3PYLA 3JWJA 1H05A 3TLCA 5F78A 4EJ6A 2ZSHA 1CIVA 2PT6A 3THWA 4Z51A 4CLDA 3W2FA 1KJWA 5J58A 3HP1A 4YJHB 3GRPA 2KHZA 4N1AA 1E99A 2H9YA 2XCLA 2VSFA 4MKXA 4I3HA 3ADDA 1IB0A 2JBWA 2DUWA 2PKQP 3FPEA 5C1IA 4EJ0A 2HA5A 3G6WA 4QBTA 4Z9YA 5JRZA 1JQKA 3CZ5A 5JZOA 5P21A 2FSIA 4LXUA 3VPSA 1JVSA 5D85A 1I6LA 1NSTA 1WZUA 1P81A 1YSCA 1V8BA 2NV0A 2NU7B 5D5QA 2Y8EA 4MW5A 1U0BB 2NZ8A 1IHDA 2ETVA 4PO1A 3AM4A 1IK6A 3KQVA 3BF8A 4W5HA 1M2FA 1B93A 5JI3E 2Z6VA 5JEDA 3F7TA 1U0JA 1JEOA 2WZDA 4DMCA 1VM6A 2FTKE 2YYZA 3C1AA 1D2RA 3FUWA 4WVFA 1H2AS 3ZY3A 5BUSA 2W2LD 1QHFA 4PYRA 3MFYA 4IH9A 2DLNA 1BC5A 1L4EA 3WWOA 5IG2A 2CF6A 3ZK9A 1S8AA 3F98A 2X3YA 4PAQA 4AJ9A 2IEZA 5HKBA 3VZPA 1PFUA 4I5IA 4LJ6A 4M36A 4ZJUA 3DW3X 5B7NA 2XAAA 4YCSA 1A9PA 1UJMA 4ZVOA 4EIWA 1F6BA 2QYSA 1GTRA 3CLSD 3LXMA 2Z6UA 3ETGA 5F5LA 3TEFA 3FNFA 3SFZA 3SIWA 3TPCA 2BR5A 1GU0A 1NKTA 4WZBA 2WJ4A 4ZVSA 4A0FA 3DDWA 3QU9A 3ESCA 2R6AA 2RHTA 4QOFA 4OREX 5B12A 1O3YA 1SOUA 3LBNA 1VL5A 2X8WA 1N1DA 1GLGA 3WFIA 4BXOA 4J7AA 1CEEA 2GPYA 4HWOA 3SHOA 4LGMA 1LLFA 3ZE0B 4EEXA 1CU1A 4PSUA 5EMHA 4EOGA 1MAVA 5GIOE 4N3NA 5B4TA 2AYYA 3BQNB 2AN1A 3OJEA 3OZTA 1SA0B 4IDHA 5E4JA 4NXMB 1HT0A 3EIQA 3HBNA 1TX4B 2YVAA 4MP3A 3RYCA 1GQRA 3FIUA 1J21A 3M9LA 4EKYA 1NF3A 3C5EA 4B6SA 1H4VB 3BKWA 3HBLA 4HYTA 4ZN6A 3SX0A 1V1JA 2VTDA 4PINA 5CA1B 3ESRA 4Q39A 3CIFA 1NI3A 4CEHA 5JTUA 5L7WA 4CEJB 1Z73A 4I36A 1SCNE 1P2FA 3NIBA 1P5FA 1SXJC 4MZDA 5AJZA 4Y9SA 4CMJA 1X77A 1DG3A 4BO5A 1DARA 4O8CA 1LK7A 4MW2A 2ZLBA 4QBFA 2W2TA 4YCDA 4W5NA 2DERA 3GD5A 3QZUA 4ZHQF 1E3TA 5KU7A 2UYQA 4WOJA 4K9LA 1FU7A 2AX4A 2P2YA 2W83A 3P27A 1NZDA 2F1IA 1DKUA 1YIOA 3GAMA 3KR1A 2ZRFA 2B4KA 3IQFA 1L5MA 2J85A 3W05A 3U9LA 1GYRA 4OXRA 4X3CA 3BAFA 1IXYA 4KQXA 3GLFA 3B8EA 1QOQB 3DR3A 1U0TA 5ILOA 1CF2O 2OOSA 2Q6VA 3AHEA 4YRCA 3O4GA 1L7BA 3UPDA 4REOA 2GN1A 3I1IA 1WW3A 3SJ7A 4XQ0A 2HJRA 4U2DA 2AF4C 3JYHA 5HPYB 1RVV1 1OB2A 1IPHA 3F67A 3R8CA 3EAQA 3SR4A 4WFJA 5HIJA 3EBLA 4D8TA 4UAGA 3U7HB 1NQUA 2ASVA 3HYNA 3VOSA 3OZIA 2EFGA 1Y3CE 4YCLA 2BMDA 5FNVF 3G0DA 3LWBA 3OKPA 3RBVA 1PR9A 3FDJA 1C0EA 1CUHA 1GN9A 2DKOA 2FK8A 5CDFA 3N2YA 5F33A 2OPHA 1EM8A 1VGVA 3CPSA 4DQXA 3MCZA 2CDBA 4C0WA 4KMOA 2EKPA 5FOSA 5K8CA 3CVUA 3DYVA 1LNZA 3CNQS 3CLUC 2AVDA 3JQ9C 2LNDA 1EP9A 2P9YA 3LHKA 4RD3A 5T64A 1AKYA 4FONA 4JI3B 1Y9DA 4YRMA 4MCJA 4YC7A 1CJBA 3RKUA 3RS8A 4BUZA 2I33A 2HR1A 1G6HA 5K8UA 1PS0A 4B6EA 2CE2X 2I6GA 3P2YA 3TTUA 1F5SA 1W0KA 1GD1O 2PE5A 1FYDA 1Z8NA 2QZJA 5I9MA 5CH3A 4IEEA 3FZEA 1C9JA 1E4EB 1Q0PA 2BV3A 3QOFA 4KBYA 4P93A 4KITB 4RTKA 2VHTA 1XQYA 3HKBA 3PTZA 4MKHA 4JWKA 4K3VA 4OTZA 4QPDA 1VBMA 4XIJA 2V7BA 4EKNB 3UPTA 4PXYA 3BIFA 4F4DA 2AEFA 1M1XB 3NHSA 3OO1A 4KOEC 1G63A 4LXXA 4M8LA 1UXKA 4RH1A 1SCQA 1TI7A 3WI7A 1BE1A 1MJHA 2INGX 2YJZA 4MAFA 1ZGBA 2V7EA 4IDAA 5D3MA 5KYUA 4BLRA 2EERA 1W1UA 3JWPA 3FMFA 2EOAA 1U7HA 4WA7A 2JI9A 4E6EA 2HSZA 1Q77A 4QDZA 1XVTA 3GT3A 4QG3A 1HETA 3K9FC 4R40A 3PXXA 4K2AA 2YWCA 4C21A 1JV2B 1Y5LA 2O9JA 2QI9F 2HZBA 4IIHA 3R7WA 4NL4H 5B36A 4TTPA 4K9KA 5IBRA 5ALNA 4DR2B 2OILA 4BVHA 2W6ID 4AZWA 3DFUA 3I6BA 1ZICA 4KRXA 3PC4A 2FXVA 3B85A 1WMSA 3BZWA 4GSKA 1VP3A 4ETIA 4JK3A 3CKYA 4HI0E 4CG0A 1I9CA 5JFGA 4F12A 2H29A 5CUQA 3IDZA 2BRUC 4OQLA 2JJ2A 3KRTA 4C2BA 1U1IA 3CG0A 3LUPA 4QU9A 5FUXA 2NZWA 4B79A 2ZSAA 4NARA 2B78A 1SVKA 5T8KA 4HYQA 1EA7A 3GBSA 4K6HA 1U0HC 4O0LA 4PZPA 5DM1A 1I4WA 1ZGGA 1MT0A 4FYVA 1TEVA 4PFJA 1V3TA 1I1OA 4C7VA 1Y7LA 4P7KA 3U4DA 3HS3A 1VPDA 1J9EA 3THYA 1JKIA 1X8JA 1E3MA 3NETA 2I34A 2Z83A 1XQ1A 2HO5A 3PA6A 2OVFA 4WXYB 3SVTA 1QVRA 3GMIA 1TJ3A 1YBMA 4K87A 4NICA 4I8DA 4Z0TA 4IH4A 3VR2A 4MRVA 3V2HA 1MF7A 1ZC3A 1KZHA 2R8EA 3B5EA 1GDHA 2NZ2A 2PSJA 1J2RA 5JI2E 4JODA 3NTXA 2P3QA 3QHAA 1RKXA 2P1RA 4BAUA 5CCBA 5ICSA 1C4WA 2O8EB 1LV8A 1KQGA 3ZJ4A 3GJQA 2IY7A 3D8SA 4HAUA 2GNAA 1UDAA 1EE1A 2X2OA 4PNHA 1RRFA 3WLOA 1HX7A 2FDXA 2Q45A 3A37A 2WM8A 1SBHA 2VP3A 3MAGA 3LTEA 2BKLA 5I9NA 3MM4A 2IC5A 1BA2A 1W4BA 3N8NA 4FGUA 2YY6A 4HP8A 1ZIOA 2GXUA 4J76A 1E20A 3ROXA 1YJ5A 1SHKA 3REGA 3AQ4A 1Q20A 4UU0A 1DG1G 2PRZA 2I4NA 2QW0X 1BFUA 1IDN1 1UFOA 1WU7A 4PZZA 5IVIA 1YR7A 3A4MA 3DVAA 5ALMA 4B3DA 2JEOA 8ATCA 3Q88A 5DCUA 1HY3A 2Q2QA 3C6ZA 3DMHA 4K5QA 2FZWA 3UCEA 1C81A 2BZ0A 3HACA 3OIYA 3NH9A 5LA6F 3ZW8A 1FK8A 3NJ8A 4LDAA 4L7QA 4BBJA 4M2LA 4CKXA 2IS2A 2ONCA 4OMCA 5AVSA 2O14A 2OGUA 3ZN2A 1YR6A 3B6IA 1T6ZA 1XAJA 3W5VA 2WYWA 1Z9BA 3B9PA 3RD5A 3BYZA 3R7FA 1JEJA 2OQ2A 1ONBA 4WADA 3UFBA 1C14A 4TL7A 4H08A 1TIBA 1XU7A 4BNGA 5AW2A 1KVQA 1EUCB 1QPZA 1HC7A 1X1EA 4ENSA 3OOWA 2N47A 2YBEA 1LRJA 3MJRA 5D84A 3M6UA 5GMOA 2YX1A 2W2NA 4Z99A 5IM4F 1ARZA 3DEJA 5H81A 1UK8A 2YV4A 5EE1A 4X71A 3FOZA 3B12A 3LP8A 5D7BA 4B2YA 1CZHA 2R62A 2NPFA 2JJ2D 5AOBA 2J9FB 4NYJQ 1L2TA 1I0LA 3J7AC 2CL6X 3GXOA 1NSYA 2PWYA 3SDZA 3HXQA 2C8KA 2WWFA 2GBLC 3LY7A 5TGDA 3OQHA 5AXBA 3SXUB 2H1HA 3NNDA 4EUHA 2X0KA 4NMWA 4F8JA 1M54A 1UDBA 5J1SB 3P94A 5B2FA 1EUDB 1X6VA 3ESQA 3I6IA 1HA3A 1X42A 1PNTA 1NI5A 3FMGA 3JQFA 3BS4A 3MA0A 4MV1A 4XGRA 3RUHA 3S4YA 4EHBA 5FUMA 5JEEA 3D6HA 1MJFA 3QYJA 2X0NA 3ZJVA 3IMEA 4HRXA 3THRA 3U4GA 1ND5A 4V0QA 4UDNA 5CJ2A 1NU6A 1I01A 4BASA 4DSUA 2XQIA 5G53C 2XVYA 4RORA 3EUFA 4Z8YA 2GK6A 4EYGA 1QFMA 1N9KA 1I2ZA 2YOGA 3A9UA 3NTRA 3CUWA 3VR2D 3K9BA 1SVWA 3OQ6A 1MVLA 1IM2A 4XCXA 5I6DA 2HSWA 2P2LA 1E0KA 3E1GA 2BBOA 3AWIA 1E1CA 2FZKA 3IOMA 1T1SA 4J7XA 4WLOA 3T3NA 4BTLA 3RJZA 3BICA 1CQJA 3U3DA 3AY0A 5FF9A 4U6NA 2F1JA 3QHPA 1GNVA 2J1LA 1PBTA 4MHSA 5IT5A 1Y1RA 3JVVA 1GR0A 5HNKA 3OO0A 2C2YA 1UP7A 2PX5A 1G6OA 2C5AA 2F43A 2PLNA 1BCRB 4L3OA 3IERA 4Q7LA 3TLGA 3GUHA 2YKGA 1E5TA 2YC2C 2DAPA 4CU5A 4YMLA 2UZ4A 1T1RA 4HX5A 2OWEA 3ZGLA 2VTBB 2YXLA 1FVHA 2ZSUA 2PKEA 2G04A 5ALYA 4UTXA 4JBHA 8OHMA 1OIVA 1GZHB 1KJYA 2DQZA 2ZB4A 4PHTA 3RREA 4EWLA 2AI1A 1ND6A 2EVWX 3U7FB 2IOFA 1Z6YA 4NV1A 1VECA 3JQDA 4YH1A 2IBSA 2PKQO 2QTCA 1Z8DA 1X74A 1IEQA 1ZRHA 2Y2UA 3CURA 4LX8A 1EWTA 2A7XA 5DHPA 1U8AA 3ESZA 3REFA 2F55A 2Q29A 2R44A 1KZ1A 2RH5A 2B20A 3HZHA 4JQYA 4E31A 2ZZNA 1EJBA 4NJEA 2FN7A 4HQ0A 1V4VA 4JT4A 5A4MS 1CFJA 3LZCA 3D6FA 3H9UA 2XD4A 3OLQA 4K6GA 5GONF 5IMBA 3CONA 2VDWA 1I8TA 2GT1A 2VQ6A 3Q5GA 4OXXA 5E1OA 4RPKA 3ZLVA 5JZ9A 1IU9A 2JD0A 2Y1FA 3FYCA 3ILXA 3T3HA 1V37A 2ABWA 4TTIA 2RONA 4PYKA 5EJFA 3A4VA 3M4JA 5DTQA 2QZZA 2JCVA 4BMPB 1MP0A 2HJ9A 2JFNA 1S1CA 2VCEA 4L3VA 2WMOB 3K0FA 2OHFA 5ICEA 3BHMA 2QVYX 4LJSA 3S6JA 1DEKA 5IAOA 1DTWA 1ZSVA 4BE4A 3AGQA 1CR6A 1TCVA 3L0BA 1QHSA 4MK4A 4V3CA 3UWMA 5JSFA 5K3EA 3HTXA 3F8WA 3K3PA 2PD3A 2NZUG 2VBCA 4PWZA 4YT5A 3W5SA 4U7TB 4A73A 2H2GA 3F3KA 3OF3A 4XGNA 5E95A 3DMRA 4BLWA 1YR8A 4ANFA 3ZY2A 1A69A 4DR6B 3AKEA 5CYFA 5DTJA 2IEYA 3PP8A 3K92A 3SYRA 4BO9A 1Z7GA 3LYAA 4ZOAA 5B57C 1TK2A 1JFFB 2X23A 1XRJA 1PYGA 2RI1A 3RRFA 1VE5A 1NX9A 2I8CA 2C03A 2JFFA 4S1VA 4HX2A 3F0TA 3IHWA 1VFNA 4XFDA 3OP1A 4B5LA 3I12A 5AK4A 4Z9BA 5A6SA 2W2QA 2PJZA 1E8NA 4UHFA 1UOEA 2HTEA 4ZTZB 3MNFA 3BBLA 2HC9A 3OZSA 5HIMA 1L4YA 1Z56C 1PZXA 2H3EA 3RYIB 3U1VA 4AF8A 1UPBA 1MOPA 5AI8A 5ABPA 5TXGA 4TMYA 3G0GA 4XTCS 3V46A 2WTAA 3ZQUA 4M7PA 3BE6A 2QROA 1G8PA 3FUVA 3ZUGA 5C5EA 2YNMA 1YRWA 1FMCA 1OXKB 3Q5DA 3DKKA 2JJ8A 2G9RA 3GRFA 1M34B 4MQUA 4HUJA 1CEYA 2IQIA 1PWEA 3DV0B 2LXNA 4PC7A 2ZPTX 1YH3A 1ZH8A 5G3YA 2Q2OA 4AJNA 5HGJA 2CUKA 1M2HA 1SUBA 1U9IC 1RPZA 1RQGA 3F2VA 1D04A 2A35A 3CGGA 4TL6A 3TSYA 2J3EA 4LJ4A 2D0PB 2D8AA 2FUEA 3ND8A 4IJWA 4TXLA 3TECE 2WDPA 3AERA 3ZDEA 9LDTA 3DDSA 4EW1A 4XGQA 3T3EA 5KX5F 1MC4A 2CVZA 5JCJD 1T0BA 1JDVA 2GYWA 3VR6A 2A30A 1MIOA 3V7NA 1X80A 2MYUA 3F9IA 4O4IA 4Q9NA 4JLKA 5KYYA 4M7RA 3HMQA 3GUZA 1QFZA 2C97A 1SIWA 3U7QB 1AQ6A 4GX1A 2CHUA 5FWYB 3L8YA 4RD2A 2A1TR 4C20A 4DJ5X 3UJAA 1U2GA 1ETUA 1UPUA 3LYLA 3WGOA 1Z2NX 3ONNA 1XJ5A 2BTQA 1L8LA 1NASA 3IUPA 2KSQA 3C6QA 3UMCA 1KAHA 2M6LA 2EL7A 1QTIA 1TUEA 3VR4H 4DV5B 2LWIA 1XXHE 1YRHA 3KEQA 3RKSA 3LCJA 4ZI7A 1Q0LA 4Z1MA 2EDCA 4DG8A 3ONFA 3GRZA 4PBSA 1AB5A 4QWMA 1C1XB 1XKQA 5DI3A 1GZDA 3WV5A 4C1BA 1JZTA 1GL7A 2LCFA 2ZJ7A 5K2MA 1HLDA 5DP2A 4LCBA 5FL3A 1XDSA 1OYVA 1X1BA 3AU8A 4DWOA 1G9TA 5KNCH 1YDHA 4CTMA 1J8QA 2ZM5A 4HBZA 4DVJA 5KOHA 1Z18A 1U80A 1F4PA 2JVIA 3FVQA 5ARDA 4MLZA 1C3XA 2E4VA 3PWSA 1YE3A 4A8JB 4CMBA 4PZUA 2ZIVB 3ZEIA 3GJSA 4D2IA 4BUJA 2BKUA 2C84A 4TV8F 3ZV7A 4DZRA 1DXQA 1QHNA 2CXNA 4OHWA 1X8LA 1YR9A 3PQ6A 4PZ0A 4B40A 4Q34A 4EB6A 3FPFA 3H42B 3K0KA 4MQFB 3TDMA 1J0EA 1QLHA 1O4WA 3ESAA 4NECA 1GITA 5FAXA 4HWGA 4UBIA 4ZI2A 4G85A 3PK0A 2O7QA 2DYKA 4F9EA 4YDRA 1J09A 1V71A 1BHQ1 1XTQA 1GY8A 3HY4A 2GJ8A 5C51B 2A0KA 2CHQA 3HA3A 4ZDKA 5HK9A 3UAOA 1YHZA 2NSDA 1LQUA 2QV0A 2YNMD 3GLHB 3BSSA 3DMPA 2WAAA 1ESDA 3HB0A 2P75A 1H2XA 2QRKA 1IG0A 4FR0A 4P36A 5C8VA 1R0ZA 3GGPA 3LGXA 4F06A 3B48A 3RFXA 3VNAA 4ZAYA 4Q4JA 1U8FO 2JRCA 1AGXA 3DPUA 3KC2A 4TTVA 2HWUA 5F12A 5BSRA 4YWJA 5HBGA 3FNHA 5DHRA 4F2HA 4C6TB 4KVFA 4MI3A 1I24A 4BMOB 2JCBA 2NPOA 3KJEA 5AJXA 4P80A 5FBWB 5C2JB 5EJ4A 1QZ3A 3SIRA 5L3QB 3E27A 1JMKC 1CQIA 3CJRA 3MJ4A 3E0XA 1P7VA 2PYZA 3LKZA 2O3QA 3W79A 1RHKA 4ARZA 4BLSA 3JU3A 1R9MA 4FFNA 3VR6D 2DBQA 1CIPA 4O3FA 4DYDA 1VMKA 1KBQA 2EIHA 4YMUA 4YCMA 1N36B 2PVSA 5J63A 1MJGM 4FMBB 1U02A 3D4BA 2X6QA 3E7WA 5DXFA 2CNKA 1UZUA 5CLGA 5E6RB 5FJJA 3DSRA 1GZ6A 4E51A 3DDCA 4JLSA 4WACA 3T7SA 1COWA 3R23A 1NQXA 3KJGA 3DBLA 3ONWA 4PCVA 2ODBA 5EIWA 4CT5A 3PVZA 1W5EA 3VISA 4D8VA 3ZNOA 3LBFA 4KE7A 3CZPA 3DO5A 1C9NA 4EYEA 1DWUA 3VYSB 4XLTA 1K6IA 1ZKDA 3ZWVA 1J00A 1E2UA 1Z08A 3MGCA 5GV7A 1MB3A 1PBNA 5CVEA 2DVMA 3RWMB 4PE5B 1W88B 1BU5A 2I71A 2ZVJA 3M5DA 4IMIB 4W4TA 3V48A 1DQSA 2TSYB 3GDHA 5LN1A 1NY5A 1NULA 3L7JA 3M0EA 1UBGA 1XKXA 2OE2A 4ZDIA 1PZEA 3EGWA 3AFOA 1X94A 2Q3FA 1BNCA 3P9RA 3L1KA 4URHA 1R8XA 3LCRA 4HH3C 3ZHYA 1JDSA 2XUGA 1KF0A 4AI6A 1D2MA 2OFXA 3D3KA 1M8FA 3FTFA 1JHXA 3ZV5A 1K98A 4W1SA 3ID6C 1TQDA 4DV1B 1C9DB 2AUTA 3GT4A 3HC7A 3MCUA 1X1CA 1SZCA 2RGUA 5SYMA 3NCTA 5KMGB 3DMYA 4PLTA 5IC6A 2OV6A 1KDRA 3S2SA 4CUZA 4U7WA 1NN3A 2UUAB 4C89A 3NHYA 1Q15A 4TLDA 4AZ0A 5HF9A 4S0XA 2WYIA 3RVLA 1DV2A 4OU5A 3S2FA 2G7MC 3G6KA 4Q82A 2P7HA 4DQUA 3K0AA 1KKUA 1CUJA 1GPKA 1INLA 1VI6A 3L1VA 1P8JA 3CRW1 3EXAA 4QICA 4NHOA 4C7BA 4QHYA 2ADMA 4TQ9A 3UHPA 3KKQA 3OZGA 4Q7EA 3CPJB 4Y6SA 5LNK6 1A2KC 1R10A 2Q4BA 4ENRA 2ZXUA 2CXOA 3AESB 1U7OA 2DX7A 2QRVB 1YWGO 2FPIB 3DLIA 4EGAA 5JXIA 5LXTA 1PJSA 1KJIA 5M3BA 3PUHA 4PLCA 2WLTA 3ONDA 4AX8A 5BWNA 1YQWA 2FPRA 5IM5A 5HOQA 3LC1O 4CF3A 3QU2A 3FSGD 1O87A 2EEZA 3ICVA 1VA4A 3N7AA 2HA7A 4GIBA 4CV3A 3BK2A 2BISA 4W8HA 3GRKA 5CNKA 2PT9A 4S0ZA 3NT5A 5AKXA 3O5AA 4WEQA 2WIDA 4OHBA 1AKRA 4FU0A 4Q93A 3W9UA 1O57A 3TWOA 3DE2X 1M3SA 1L4GA 4EZBA 2YMPA 4MW0A 3ABSB 2RHMA 1DADA 5PNTA 1LNSA 4RF4A 1O6GA 2GERA 4YASA 4ZT7A 1VIAA 4KQCA 5K6AA 2O23A 5EWLB 1XCJA 2ZROA 1YJCA 1US8B 3RQIA 2YYSA 4R1LA 3OCCA 3H5LA 4TYMA 3Q1KA 1COWD 3QWFA 2CLHB 2VP0A 3GJ6A 5CURA 1O08A 3DBRB 1OFTA 2IUEA 1ZH2A 2PH1A 4OP1A 1JYSA 1QS0B 1SIBE 4QBKA 2HM7A 2VZ8A 3R1IA 3GBVA 1AZLA 3I34X 3NKVA 4HDOB 1ZC4A 4OXIA 3WK9A 5JZMA 1SULA 4FS3A 3C0KA 5EL0A 1ELOA 1S96A 1UBHS 3PTLA 4OQQA 4LJRA 1O77A 1IOLA 4DJEC 2O2IA 1N5OX 3EA4A 1E3LA 4OIFA 3U48A 4D8UA 4LJYA 4WXPA 2V7XA 5FAKA 3TXAA 4YJGB 5A03A 4L8VA 3A1VA 3AVVA 3GHYA 2E9SA 2CNNA 1PU2A 4QQKA 4BO2A 1K7SN 1YO6A 4ZALA 4HDKB 5C1PA 3VSCA 3WYDA 4YLEA 3D0QA 3IEXA 4H3KB 4J0JA 4QDXA 3UK0A 4W99A 5IC5A 3AVXA 1UJ5A 2PS3A 3TIFA 1Y3HA 3IT1A 2XOEA 3V4ZA 4PZDA 2HUPA 4MNTA 1OBOA 3ZS9A 3A4TA 3KVYA 4J8PA 2CW5A 1UFKA 1EHYA 4IV0A 4U0JA 4B75A 4EHHA 1L1QA 1YTLA 4WKGA 4Z53A 1G3QA 1N5KA 1A4RA 4B3IA 1GTVA 3DYIA 1THTA 3VHQA 3FUTA 5B6PA 1P2TA 1OUMA 4QATA 3V5NA 2SICE 1QFXA 3VO2A 4EW2A 4J0CA 2Q1SA 1EQ2A 3DEKA 2D54A 2C2ZA 1JLRA 3JZMA 4B8YA 2RGDA 5ER9A 1VE7A 1GGVA 1R66A 2JNWA 3IE2A 3N05A 1BJKA 4MUKA 1U3GA 5L51A 3EZXA 3LDAA 3ED1A 2PGDA 2ZBFA 3KZOA 2PGAA 4EY3A 1U31A 4K6OA 1AGYA 1XROA 1IAQA 1IY1A 2NSLA 3N2IA 4PLHA 1T8RA 4XQEA 4DIKA 1HTTA 3CUYA 3G9ZA 3VNBA 5IJ0A 3NWBA 4DLYA 2WFAA 5L3VA 1QYIA 5KKAA 4TN5A 3U5ZB 1NXXA 4P5PA 3AXSA 2ZU6A 3I6ZA 4ODIA 4LTMA 3I61A 3ZKWA 3GGGA 5F21A 4B33A 2PS0A 5KOJA 4MWCA 4JXKA 4AO7A 1KSHA 3KQPA 3VAZA 4B3GA 2XUQA 5AI9A 4MR7A 3Q0IA 3SKYA 4LI0A 3V2UA 2Y1WA 4HOYA 4PRZA 4LFBB 2OK7A 4PO8A 1AURA 4Z6KA 1ECBA 4IFEA 1F20A 4B8WA 2XNDD 3FFBA 4KP7A 4X84A 5G0VA 3UC9A 4C4YA 4YT2A 2GCNA 1UOPA 2OCIA 4KO4S 4WZBB 3OQIA 4KPGA 3T61A 4Q18A 2HBYA 3I28A 3A7EA 4G5HA 4B1FA 5J47A 5G4LA 1ESCA 3HU3A 1RAHA 1NRIA 3TLEA 1ODKA 4FWBA 4E1AA 4MRPA 4BX8A 1DTEA 3IP9A 2JIMA 2WG2A 1KQNA 4F6RA 2UVDA 3LG2A 4TWAA 4BXOB 3G82C 3STUA 1P4SA 1SOMA 2HUNA 2NTJA 3ZGVA 1RI4A 2WVAA 1JHVA 4CDRA 4I1RA 2I4OA 4CEIA 1MEEA 3IJEB 4O4JF 2ZYGA 1MR3F 4YN3A 3PHLA 2ON6A 2VEOA 4B3TB 1NW6A 3VV3A 3S8EA 3UMVA 4IHKA 2WIKA 1QP0A 5LQKA 4O5AA 3RYCB 3BTSA 3BQMB 1TL7C 1HUQA 2OGZA 2QTBA 1W0JA 2HL6A 1NJ6A 2JATA 5FBLB 3QF7A 3PU6A 3GFTA 4KU4A 1NLYA 4FJ0A 3ICWA 4ITRC 3JR3A 1ULAA 4DC1A 4EKIA 1DCTA 3OSUA 3K0EA 1Z8FA 5CIWA 1DRWA 5IYZF 2X3UA 1EDOA 3CH4B 3PHCA 3VTAA 4QFBA 3AVOA 3DE0X 2H4FA 4M83A 1RIFA 3CF6R 2CNBA 4R0MA 1ONOA 2B82A 2A0WA 4CIAA 1TJYA 3NRBA 4A2CA 1KU0A 4E7PA 1GUFA 5HOEA 4AP6A 5LC1A 4QTZA 3F49S 3GD7A 1WD5A 4CIDA 4ESEA 5DASA 2OCPA 4LVOA 4CI9A 1KJJA 2WTXA 3GLFB 2XNHA 1EVEA 3TRDA 3OKAA 3G8YA 4KGXA 1YJAA 4OSOA 4N8EA 3BA1A 3KX2A 3BAZA 1GRCA 5LOVF 2H1WA 3A1CA 1OROA 1BRTA 3ZD7A 5KYWB 4ND3A 3T5TA 4C7OA 4HX9A 2VJQA 1JEQA 5H9WA 4HQFA 4XUGB 5GJBA 3E5HA 2MCFA 3QPAA 1YB6A 2TRSB 4DR1B 2P8JA 1MB9A 1PJAA 3GEDA 3I2GA 4IX1A 2H1RA 3M9WA 3ABOB 3L8MA 4Y3UA 2C9DA 3H1GA 2OV2A 2BM8A 3QVJA 3KUUA 1P2SA 2C4VA 1KOGA 4FFOA 4ER0A 2OEPA 1FNDA 1PKXA 2XVAA 3TBFA 1Z12A 5JVDF 1PEKE 1NTRA 1P2VA 1YDEA 1JHYA 1J7KA 2R6GA 4RESA 3W2HA 1EM8B 3ZGXA 8MHTA 4R8MA 4TTRA 3O3CA 1F2VA 3QLVC 2PZ8A 4JVLA 2QHXA 4WN9A 4C7KA 1DX9A 1FB5A 4IDPA 5FBVB 3J81A 1FMFA 2Y6VA 2C3UA 2WWWA 3MQFA 1ZS9A 4ZYUA 1KS9A 3QPVA 2PSFA 1IY2A 2RG1A 3K72B 3T06B 4R8LA 2VKQA 3AF2A 3RAJA 3RAFC 2IZ7A 3UJ9A 1ECCA 3KT3A 1HF3A 3DE5X 4QAJA 3EZLA 3EGCA 4L28A 2LIVA 3F4LA 5B3AA 2Z56A 3VO9A 5TJHA 1K6EA 2Y1EA 3TQSA 3R9XA 2DFNA 2WF7A 4E46A 5HS6A 1TTQB 2OBNA 2I91A 1T5OA 1ZHHA 1L8AA 1R15A 5F2KA 4IMPA 3HKBB 4Q47A 2ZR7A 4CNQA 1ZMOA 3NZEA 5K1ZA 4TSFA 3QPUA 3G8CA 1F0KA 3ITNA 1PG5A 4MPTA 3BBPA 2ZR0A 4LYJA 5A0FA 3SQOA 4E2FA 2MINA 3MF4A 2ECOA 3AUSA 4FC6A 3S55A 1EBFA 1N2CE 1QTRA 1UPAA 4JCOA 5D3MB 5IKOA 1UEXC 1OGIA 1O96A 2IP2A 3K2QA 5KYUB 1KEKA 1JKMA 3UB2A 1KMHA 3IT0A 4JOBA 1IQPA 1E2EA 4V0RA 1W0JD 5EIOA 2RGRA 5ALDA 3W4JA 3WMFA 1OTYA 2VPPA 3I5AA 2QUHA 4MUAA 1CX9B 4R98A 4UVIA 2XTZA 1N6LA 4HAOA 3R7WB 2DUUA 2HNAA 4GKBA 1E79D 2F62A 1GTZA 3LRPA 1O89A 1TJ4A 3C8DA 3QVKA 4RMGA 3WNQA 2L0XA 3H5WA 4JYAB 4RKYA 2OFWA 1T2UA 2BF4A 4FD3A 1IEWA 3K0CC 4WOPA 4Z86A 3WGGA 4BX9A 4E4RA 1D8TA 3AX6A 3NBKA 1QF6A 2AK3A 3OT5A 2QLJA 4LBZA 2CCGA 4V0MA 4XJSA 3VZCA 2PH7A 3CRZA 3FCAA 3RAGA 1UP6A 1LRLA 2QBYA 4Q3CA 4IOLA 2V0CA 5BV7A 2XKAA 3L4SO 5F4BA 1Z0IA 3QLVA 1YBFA 5HRUA 4TZTA 1QU3A 3QPCA 4Y6OA 3P0IA 2ZJ5A 4L6IA 1VE6A 2ZJYA 3PXAA 4AJHA 4PR0A 2Q4TA 2VQSA 4PONA 1JJ7A 3A1SA 2ACEA 3TW8A 3D1LA 4KREA 1VDZA 2ZUCA 1EGHA 3JPYA 2XE6A 1ZNYA 1PJLA 2XT6A 4GYYA 3U6KA 5DYGA 1JL3A 4R7TA 2FYTA 3IAM6 1JRLA 1JSCA 3C3JA 1ISFA 1UXGA 1YDGA 2QX6A 4HMQA 4JOQA 2FJUA 1CHNA 1IHUA 3HY6A 4O2BA 3WHPA 2D4HA 4LYHA 1ML3A 3G85A 4ZO9A 4J6EA 2DHRA 3CMCO 3K8YA 3KUXA 3LM8A 3RS2A 4FMPA 4OHZA 5JRDS 1GNSA 3CKKA 2H8KA 3EIUA 3L6DA 5LNK1 1KVTA 1EWVA 3GC6A 1H5NA 3LY8A 4XUDA 3FCOA 1U98A 2PUJA 4NYIQ 4XW2A 4KQIA 4IDCA 4D0GA 1SNYA 1X92A 2IYTA 4Y18A 2MSWA 4XSHA 5IAAA 2XBLA 1PR3A 2PLWA 4YJFA 3SM9A 3FCUB 2D5CA 5KQMA 4PLFA 4YROA 3TR5A 1YVPA 4MLDA 4QSMA 2J0UA 4FHDA 3D2LA 4B3HA 1AHPA 3V4LA 2KYRA 4KO3S 3S81A 3O21A 4DHWA 3MJHA 1OFHA 5EXXA 1CVIA 2QGNA 2YRFA 3EOZA 1VHWA 5C4MA 1XK7A 4M55A 4O1IA 3UMJA 1RCTE 4JJ7A 3EASA 1EX9A 1QQ5A 3CGWA 1L5RA 3DVAB 4G0VA 4H6XA 2CGEA 2Q8PA 1S2MA 3BSWA 3A9CA 2FA9A 1K1EA 3P2OA 1J1IA 2O3SA 2EWWA 4QEZA 4N47A 1CY1A 2XUKA 1N34B 3K0CA 2PFGA 1QF9A 4Q1BA 3DC7A 5AVKA 4P92A 1RXUA 3MBKA 2P67A 3FHCB 1D4FA 3K9LA 4UE2A 3X2FA 1DIHA 4QGGA 1OZFA 2VT7A 3PG5A 4TYQA 5AUQA 3O3NB 3M6XA 4C0BA 2CHFA 2XITA 1LD3A 2ZE5A 3UAWA 2QD1A 1VJ1A 5DGIA 3QPDA 2CCJA 3D7NA 2DKFA 2GX6A 1IMJA 3FH0A 1FFAA 1TQ4A 3HP4A 4GW3A 3SSOA 1IB6A 5I7VA 2ZTVA 3G02A 4HO1X 4M6WA 5ADHA 3K0SA 1YZYA 1C7RA 1Q0RA 1Z47A 4WZAE 5JFOA 3N2EA 1FZTA 3KR9A 2GJSA 3INNA 4JLDA 3QMMA 2P7IA 1UXJA 2WUFA 1MA0A 3ZE9A 3CA8A 3BB3A 5JSYA 4M54A 1M1NB 5WRFA 4OLBA 4H16A 2C77A 3N07A 3VYRB 3WKDA 4GOMD 4HS9A 3F73A 1VKOA 2F3RA 3SIXA 5AQ1A 5B4UA 2VATA 4Q1CA 4I4TF 3IEIA 4D99A 2DM6A 4D5EA 2OCLA 4X95A 2G17A 4DIDA 1ZSNA 2Z5VA 3QTTA 2ZWOA 2HXSA 3IP6A 3W8RA 5DGXA 4C0SA 2ZOSA 2Q6LA 3N58A 1V3UA 3I6QA 2Z4SA 5BV0A 2O2DA 3U3RA 1C9EA 2EBFX 3I2JA 2UXCB 3IVRA 1G64A 1L5QA 3K6KA 1WCWA 3GGCA 3H9CA 4LPSA 5FDFA 4RS3A 4K9PA 4F4CA 4YQZA 3KKPA 3R7BA 3KLPX 2X1MA 2OGSA 1QVWA 1E1CB 3TPFA 3VHLB 4I5DA 3KSBC 4DHEA 2DQ4A 2PKWA 1CQJB 2R6R1 2AD5A 1NF2A 5DWVA 3SX2A 4V1CA 1EVIA 2B4TO 2C83A 2F17A 1FFYA 3WYNA 3QQ5A 3CUEF 1G291 1ENPA 2R7LA 3FJ1A 1RS0A 3ICQB 1ZOSA 1CULC 4DLAA 2F43B 5AUNB 1Q1GA 1DXOA 3QKIA 2OCAA 3Q3EA 4W5WA 1KO1A 2Q5JA 1D8AA 2FFBA 2ZBPA 3RFTA 3TLGB 4UFPA 5A9TA 4Y9UA 2E89A 5FTMA 1SXPA 4I3GA 4DE5A 2I4IA 1XKLA 2Y1XA 1AQLA 4NBKA 1GLVA 5BUZA 2QMZA 4UAVA 5I8ZA 2PLAA 3DP7A 1GXSA 5KJEA 3NXKA 1U0OC 4GD3Q 3GGSA 4C0JA 4HD8A 1AU9A 1FPQA 4UVDA 3NOXA 3PGMA 3MD9A 1RI1A 1O95A 3M70A 4WLUA 4RENA 5DHFA 5TMDA 4PVDA 1PR1A 1RLUA 4BQIA 3NMUF 1Y42X 2H4XA 4NJEB 2AFRA 4GF5A 3NGXA 1EFVB 4P54A 1X15A 3CXRA 3KLMX 2X5XA 2B8TA 1S7GA 1XLTA 4HGOA 1DB3A 4N6OA 4PV7A 2R8YA 4AIIA 4U7DA 2Z5GA 4BNLA 3SX4A 5K0CA 5IUJC 5ED4A 4D3XA 3OTHA 5JQGF 1M33A 1PX2A 4Y1GA 4AJEA 2FG5A 1II0A 3H9BA 5IBQA 2QRGA 1KPIA 5AW9A 2Z98A 1FXUA 1T10A 1JG4A 3PE4A 4IFIA 5HVNA 2VAXA 1D2NA 2QTZA 3LH5A 3EGEA 3FFTA 1V5FA 2R4TA 2WLSA 1YS4A 3RFFA 3W0LB 3T52A 4DA9A 4RKEA 2PJRA 5BUCA 2CL5A 5SZJA 4BBPA 2IUTA 4DCCA 1BW9A 1E4YA 3F90A 4PU0A 1PWZA 2HMSA 3U3JA 1Z5ZA 2WZCA 3IVXA 4GPD1 1G98A 2FQQA 1OW3B 1V0JA 2NO6A 2ZFUA 4V2UA 3LPMA 5COBA 1L8XA 3UH1A 4DSZA 1UAYA 2HIHA 1DKPA 4EA8A 1ZK1A 3SOZA 3ZBTA 4DCVA 1E9BA 1LWOA 3CJQA 3FZQA 3HGTA 1GL9B 1UZMA 2BR3A 3I52A 2P9FA 5A6SB 1I4TD 4NHEA 4FOTA 3TQTA 3GXBA 2OLJA 4NDZA 4ERNA 1XVIA 4AD8A 4F5WA 4EFKA 4M0FA 4FE4A 3ZDCA 4PZAA 4M7WA 2DY0A 4ZANA 3AW8A 3S27A 2W58A 1HR0B 3AM1A 4EY6A 2WUVA 2ZPAA 3OE1A 3ENZA 1W49A 4RJLA 1WB4A 3WK7A 3U44A 1LJLA 3HPQA 1HSZA 3TSCA 3WE7A 1D6JA 3H2HA 5LQNA 2X9QA 1WY7A 4EX6A 5CLFA 4U2GA 2RJNA 2CDAA 5T3YA 4JITA 4DXAA 2Z2XA 1UM9A 1PUIA 2NVWA 2VNHA 4GWGA 4LNHA 4MV5A 2CMGA 4KBFA 2OXRA 3F5QA 4ZQHA 3SEFA 3ETEA 2YRWA 5J23A 4X1IA 1THGA 4ZJZA 1JW9B 4DDUA 3LDFA 4BJ3A 3CT6A 2PBZA 3P7MA 3NYIA 4OXYA 3WB1A 2H4HA 4J3FA 3DT8A 2QUBA 1E2NA 3AERB 2C31A 3PJFA 2GH1A 1KZ4A 4NY1A 5FPYA 4EHAA 3EQ8A 3COZA 4X65B 1FL9A 1FW8A 1M0EA 3PEFA 2PMFA 1TZJA 2AKEA 4YRTA 3FHTA 4MRSA 1O95D 4C14A 1MIOB 3NC0C 4Z7JA 3CNHA 3KALA 3ZQ6A 4O4IB 2J7KA 4K3UA 1W30A 2HBRA 5A3VA 3ZZ1A 4BOYA 4X90A 4ZOLF 4HH0A 2RHBA 1COZA 2C2KA 2PWBA 3OSZA 4FFMA 1UZNA 4YDHB 4UM9D 5IKEA 3O74A 3OM9A 2FMHA 4YNBA 5SZHB 4C3OB 2V6JA 3LPDA 2ZSJA 5AJHA 3UOAB 1VYUA 3QLEA 3A6DA 1O6CA 2QR2A 5SV2A 4RFLA 1E1RD 1V35A 3VSDA 1G5HA 4OHMA 1Y4SA 2C54A 2JCSA 4B73A 5E7MA 4UCXA 5IT4A 3K5HA 3ZE6A 3NJRA 1MH1A 1YAHA 4RZSA 2UYCA 3BB4A 4ZOEA 4ZI7B 4RABA 4DMMA 5CFLA 3L8CA 2PR2A 3O4FA 4UKDA 4TZKA 1KYQA 3BIOA 1OXVA 2PYIA 3G17A 4GOXA 1SBCA 4XE5A 4LJ7A 1Z13A 5DI3B 1VLHA 5LBTA 1BMFA 3K9HA 3PXGA 4BVBA 3GOQA 5AVQA 2FP3A 1G0OA 1QZXA 1WF6A 1M1UA 4HBGA 4ZI5A 5C7LO 3EVCA 4QG7A 2YWHA 2IXEA 3AYZB 2W48A 4EELA 4EUNA 3TRJA 4TWJA 4ZT3A 5KOHB 4XEUA 4QXRA 4J07A 1FFHA 3D1JA 3UK6A 3VNSA 3FD8A 4H7HA 1DJLA 1UWVA 5AKGA 5CG2A 1SCUA 5TY0A 3VPCA 1UAGA 5KPJA 1T8SA 3HCCA 2D7DA 2EFEB 3E2IA 3L4EA 1XZBA 2EFHB 1V1MA 4JVSB 4Z0PA 2PZKA 2QGFA 2W2VA 3TQRA 2A3RA 3II6X 3OHPA 1NUHA 4X94A 3DHVA 4BFVA 1J5PA 1UK7A 1XEWY 1XC7A 4EB6B 1LA2A 4JLUA 4ARUA 1YDWA 1A8PA 4FYJA 3GJXC 2QT0A 4EBFA 2AC7A 3DNMA 1B7GO 3L18A 3ANYB 1K7YA 3AFIA 3D81A 5E4TA 3WBKA 3LBAA 1R9JA 1MC5A 1XGKA 2AFIB 1Y82A 2WVJA 3B1JA 1XMSA 2B2CA 3DNFA 4G8CA 4MCIA 4PPYA 4V24A 2I7VA 2UVPA 4A10A 5K8VA 2ZI9A 3GJ5A 3E7XA 1X14A 3M1YA 4K1XA 3UANA 3KTAB 3LBHA 3OZWA 2W8ZA 5HQ3A 3T3IA 1KVUA 1VPTA 1WD7A 3STTA 3GVPA 3NRCA 3MD0A 5CIYA 5DNYB 5GADl 3ELBA 2YJGA 5DBGA 2V7PA 1Q12A 5CEJA 5HJEA 1SPBS 1I4EB 3HE3A 3LOPA 4Q4JB 3R74A 4PG6A 3VO8A 1JQEA 2WVGA 1NY6A 4LI3X 2C2MA 1RMQA 4QUAA 1JPUA 2ZRNA 3EW9A 3IAM1 1FU4A 1TAQA 1CQIB 2OYSA 3S1AA 3D31A 1TT5A 2ZYDA 3K4HA 4ARZB 5MGNA 3HO6A 2QLBA 1KDTA 2RGAA 2VJLA 4QJIA 3ZDAA 3H1BA 3I5YA 1VPVA 2HIAA 2GF9A 3NAQA 4IHJF 3DTVA 2V03A 3I5UA 4TVKA 2J6IA 5G1OA 3OFNA 5HFNA 1FJHA 3PQEA 4EG0A 1EK5A 4OHYA 3F71A 4WA8A 2WYHA 4X45A 1C3JA 2GF2A 4UQPA 1KU6A 3ISVA 4PEVA 5CXXA 1E5LA 1QPGA 4H27A 1P0IA 3CV3A 4OL9A 4A03A 4B6PA 1ZR4A 1S4QA 4IZ6A 5EHNA 2ILVA 2A4MA 4HXYA 2P79A 1K27A 3ANXA 3E2PA 4GVPA 4AC9A 2IE0A 4CV1A 1L8QA 4EAAA 1RP7A 4O8ZA 5JBIA 2A2ZA 2UUOA 2YJ3A 5CXUA 5KDDA 2V45A 2GPAA 1R74A 2P1DA 3H17A 4K2HA 4JSTA 1DBSA 3GEHA 4PZ9A 1NMQA 3QJGA 1UC4B 3G7UA 2E5FA 5HG0A 4E09A 1ENOA 4GXTA 1WSBA 2BGTA 4LIPD 5JDIC 3U7IA 3LC0A 3BE4A 5DTIA 2FFQA 4N49A 5T6BA 3IDFA 3LRXA 3L82B 3VH4A 4E88A 1J49A 2D1TA 4N7JA 1D4OA 4DLTA 2FF7A 1Q1BA 3WQHA 4L72A 3SEZA 4JL5A 1DX6A 1U1CA 4RVOA 4O0MA 1UJ4A 4CL3A 4POOA 4JKOA 4RVSA 1TD1A 3B89A 3GUYA 4LWOA 5EQDA 5DPMA 1GNRA 1GG9A 5LFAA 4CRWB 1ZD8A 4H6WA 3RW9A 1D03A 1SXQA 5BPHA 2JI6A 3KPVA 1WXHA 5FTJA 1OFGA 3K0AB 1ATZA 2H65A 2H5EA 2O0KA 3JRXA 1UADA 3IKLA 3JWHA 3UJ3X 2F6RA 4Q3NA 1C9KA 1JBEA 3L6BA 1F7VA 3D4OA 1LU9A 1M0SA 4WLNA 1M0TA 1QXSA 1WWKA 4XD7D 2POCA 2ZAYA 3I42A 2F3QA 5ED0A 5LXTB 3RLIA 2JFWA 2X40A 3CEJA 4FEYA 4ITVA 4MV9A 3F5FA 1AN0A 1YQ9A 2HAEA 2OV4A 4NMMA 3VBEA 1R2QA 3WP0A 4BNHA 5BW8A 4FCCA 4XYEA 2KX7A 4I50A 1KKLA 1JP7A 4F91B 1BRMA 2ZWVA 3MRTA 3KXPA 1QCDA 2HU2A 5TQJA 4EVIA 3TIVA 1NURA 2G0NA 4GM4A 4P82A 1XNGA 3EQ7A 1L5NA 2ODPA 4RJTA 4L3WA 1DJQA 2QAJA 2RC5A 2GPTA 1WP4A 2WM2A 2WZQA 4WNAA 4EP1A 1X86B 5DMXA 2Y9PB 5TF0A 2XMSA 4OBXA 2FQYA 4B17A 2CV0A 1JVNA 1Z4LA 3HDVA 1U8ZA 1FRNA 6YASA 1CNEA 2HQSA 2GBPA 2YW9A 3D6MA 4MV0A 4MI9A 3WMWA 3OAAA 1NR5A 4NMLA 1KR2A 1XU9A 3DTVD 5INTA 3OFND 4MI6A 4GVXA 1IBSA 4Q66C 1MKYA 1IIBA 2KI5A 3W5UA 3R5TA 4C1NA 5AJUA 3AVUA 2B83A 2QTWB 1C7ZA 5LWHA 1ZEJA 1GA4A 3E9EA 5JDIA 4DZZA 1VL0A 4URVR 1ZAYA 1HI9A 4Q9LA 3ZDDA 3T34A 1LBQA 5KNLA 3I9JA 1Z88A 4LXQA 3PC8C 5T4HA 1E1QA 1TEHA 1U1GA 1UBJS 1Z62A 3IR7A 4JGIA 4KGVA 1Z2AA 4DCSA 3PX7A 4J9UE 3RU2A 3HP7A 4RACA 3C7AA 4NBVA 4GLLA 1B14A 3EFBA 5LMCA 3TRHA 2MHCA 5F5XA 3WZLA 3PQ4A 4DV4B 3K05A 5BR4A 2QJTA 2WHYA 3CG4A 1ILWA 1F38A 1LTHR 3GX1A 1TAHA 3HR4A 4JB8A 2YH2A 1QV6A 4PZCA 4BZZA 4K7JA 5K3BA 5ALHA 1CS4C 1KC1A 4Y6PA 4MQ4A 2L42A 3G49A 3O2NA 4ZT5A 3ROMA 4CLRA 5AUOB 3BQ9A 4YRSA 1HDIA 2FWIA 4RKRA 5DN9A 1XAIA 4R2MA 1KFKB 1QQTA 4ZHSA 1FSPA 5CEEA 1B6TA 2HLDD 3KFVA 1AHNA 2BZ1A 2ZI3A 3WK5A 1Y6FA 1DAEA 2NYUA 4D4HA 1RWVA 1J99A 1TM1E 3TEJA 2YINC 3ZHQA 1VYHA 2VL7A 2RHOA 4O33A 1P0FA 3K71B 1OZGA 3X1XA 4DSOA 3PL1A 1XVUA 1TVMA 3EXEA 3LW7A 4Z3DA 2ZUFA 3HFRA 4A7PA 2CXTA 3ZIAA 2EV9A 3H5OA 1WULS 2GVDC 3ZHXA 3PNPA 4BWGA 2C3PA 2ZUTA 2BLLA 3BMOA 2PSEA 3P2JA 3CR7A 5DFAA 3TQFA 3A3NA 4FZJA 2VLBA 5EQJB 3FE2A 4HWRA 3QE0A 2QUKA 3HJNA 1RRGA 2E5LB 4ZJYA 1XTPA 5EA2A 5C8YF 3L2OB 3N2KA 4AY5A 1CUIA 2FN9A 4EZEA 1O2DA 3VJMA 1YI1A 5IJ0B 3FNIA 4Q9DA 2ZB2A 3OQBA 4MVJA 3TOZA 3GPLA 2HQ1A 1OBCA 5EMMA 1E96A 3O0TA 4UHBA 5KOJB 1N3LA 3MHTA 1UH5A 4RKQA 1Y6RA 3RYHA 4AP9A 1BFKA 1T25A 2Q0HA 1IZ0A 4BMXA 5BSKA 2IOQA 4MR7B 4BN5A 4BV8A 3WS7A 2YRXA 1IZ9A 2WHXA 3MT8A 4AJ2A 4AQ7A 3WTBA 3OAAD 2ZR9A 3NTOA 4NMHA 5DBHX 1H8HA 2XTNA 4FN4A 1P3JA 1FDIA 1B1CA 1H3NA 1RYZA 4Z49A 1X2BA 3HJAA 3LVFO 3OQIB 3SPXA 4YHHB 1V1RB 3I4FA 1SC6A 1CE8A 1WEHA 3GW8A 4HZGA 4GT1A 5JISA 1IVNA 4EYSA 3BK7A 3PC2A 4F6RB 1WDTA 4ZCTA 5BW5A 4BWVA 5AT1A 2JZOA 1IHPA 3NTVA 3PNKA 4WK6A 1C29B 4EITA 3A3KA 2R8RA 3H4IA 3P32A 1J56A 1LVGA 2I22A 2PS1A 4NZOA 4WY2A 5E3JA 4CEIB 1E1QD 3SZOA 3VR5A 5HSGA 3R0QA 3DD1A 2CB9A 2MTBA 1XD2A 2ZB7A 2JLBA 5EIBC 1IDOA 3MLEA 1N6OA 4IDNA 3KQTA 1DBRA 1N0UA 3NTUA 1L5LA 4B5KA 1NM5C 4ACAA 1JAHA 1W6RA 1XNQB 1DE0A 4GUDA 3KU1A 3HA7A 5CMLA 3GJTA 4ZO8A 3USES 4ALLA 2NO5A 3RS7A 3DZFA 3PD0A 4QTYA 2VUHB 4JVMA 5I7FA 4WOBA 4B9AA 1KZ9A 2Q41A 5DIZA 2JLAA 3MJSA 4YP6A 1PR6A 3AB7A 1O97D 1CRLA 4ZVMA 2I3GA 1BH6A 4LSMA 5DK4A 1PDOA 4D9CA 2JEZA 2FUCA 2ZYTX 1H66A 2GXSA 2WSSA 3C7CB 2XYVA 2VZ9A 5GV8A 1LPSA 2GB4A 4G0QA 3IHTA 1K86A 4QTTB 1LF5A 3CPEA 4LVNA 5D3KA 3KR2A 5AKZA 5A4FS 2ZK7A 1MA3A 4U1RA 4KPFC 3T1OA 4QODA 3R24A 5HUQA 4I9GA 1KQFA 3NC1C 3EUWA 4BRSA 4IRMA 4M1WA 1XFAA 2WD7A 5DBEX 4KTVE 1NVUQ 3WXMA 1U9CA 1XZFA 5HX7A 3L1JA 5I7HA 2OFPA 4M9SA 3DKVA 3EHEA 1L4BA 1YBAA 3FCSB 4IAOA 5HJ7A 4C7OB 1AKUA 4KHZA 2KJQA 3IVGA 5JD6A 1ZM9A 1GG5A 3P9CA 2GEBA 2Q5LA 3DF7A 4Q21A 5CNJA 4DUPA 1IEXA 3HXOA 2V1UA 4RK7A 3FUXA 4P22A 2QE7A 5H80A 3TTTA 1E0AA 3SBDA 4ZCLA 1OE0A 2P4HX 2QQ5A 2ZT8A 3RSFA 1I6MA 1XK6A 1EPUA 4KQMA 1NZFA 3E3NA 4W6QA 3O03A 1GARA 4L5AA 2PX8A 2NACA 1FFCA 5EXSA 2P2SA 3RRZA 2GN8A 1PLKA 1JYFA 2R2AA 3IUNA 3ROFA 3H2KA 3U17A 3PCTA 3AJRA 3O8QA 4WN9B 4LCEA 3SR0A 3OEEA 3DZHA 3S68A 1RM4A 3I23A 2ZTSA 4QPPA 4NZ9A 1DEAA 3MS7A 4YR9A 2MMCA 3L5KA 3B9QA 3I9MA 2WHRA 4J2OA 3RIGA 5KINB 3GY0A 4UPDA 1W4RA 1L5GB 4CKCA 4D9IA 1FOEB 2NZYA 5JWRA 2Q2WA 1HFKA 2XGMA 1NJ8A 3P2EA 5FWAA 3PRYA 3R9XB 2G5CA 2G6TA 2OXIA 2RDMA 3E82A 1EB9A 1P1FA 1N7HA 2E4UA 4QPZA 4Y1FA 2BZGA 2J4DA 1ULTA 3R3XA 3WGJA 1FS4A 4G9GA 1AX9A 4QM7A 1SKYB 2PWZA 3OI7A 5AXAA 4YUWA 2YZMA 3MG9A 2MINB 2FPSA 2VS1A 2X0JA 2WV9A 3HRKA 4DA0A 3QPWA 5KYVA 2HCTA 5BSTA 5LPNA 3VH1A 1ECLA 1O96B 3R0VA 1ZK0A 1JJAA 2IEDA 3P4UA 4JXXA 4PN7A 2XUPA 2YWBA 3W5BA 2E18A 3T94A 3RUDA 4EVSA 4OLJA 3HVRA 3GFVA 1EESA 1Z75A 4ZHQA 4G0OA 3LT0A 3PHGA 5DW0A 1TD9A 5TVKA 4KR2A 3EVZA 2CFTA 3PYXA 2ANBA 1IQ0A 4JEHA 5G4KA 2DT8A 1EE2A 1G4UR 3RHSA 1QH1A 4PANA 3I2HA 2X86A 5BWCA 1SCAA 3AHIA 3M3PA 1NC3A 2QI9C 1H4SA 1ZSYA 5CDTA 2WQZA 1P1HA 3OM1A 2F1RA 4KUEA 1YU6A 3D6VA 4FOPA 4E3WA 5IDXA 1Z35A 1D6SA 2O2GA 3T9AA 4HXFB 2O2EA 4FWTA 4BVGA 1WCV1 3UKOA 2QBYB 2C9ZA 2H1VA 1VP9A 4JC8A 5FYQA 1Z8HA 2ONYA 3SKVA 3TW0A 3JARA 1K97A 1RAFA 3AM3A 3QVUA 4IUYA 4R01A 4FBGA 2NQ2C 5KNBD 2QF7A 3VR3A 1U8EA 2WKWA 1MOZA 1RVDA 4WIAA 2B69A 2QMOA 1TZCA 3U7RA 3QVGA 2X0DA 4PBRA 4A27A 4G0YA 2A0FA 4PC6A 1POWA 1W94A 3GV0A 4IZHA 1GWNA 1WCXA 3HLKA 5TV2A 1KEEA 1UKCA 2ZYSA 3FA2A 1ECGA 1TEZA 2ZDHA 4LWPA 1JKJA 3NONA 2ORIA 4O2BB 4R2KA 4EPXA 4OI2A 4UEJA 5FUQA 1NA5A 1M6NA 5G40A 2ZSEA 1XE3A 3OEED 4L22A 5J4LA 2WTMA 2QR5A 2Q5HA 1DELA 1TCBA 2GSDA 4BNUA 1DAPA 2Y0DA 3OQNA 1DT5A 3AVYA 3AVWA 2NXWA 1T0PA 3HRHA 1BWRA 3MJVA 4GMHA 1FLVA 2E3JA 5EKDA 1VJCA 4BRZA 3VC3A 5I4IA 2JGLA 4Y2VA 3TAXA 1P1KA 4MGYR 1PVVA 2FPXA 1ZJ5A 2ZRGA 4LF5B 3QE2A 4MUBA 4PHHA 1AUQA 4FJ2A 1N2CA 2J0UB 4WXRA 1T1EA 3F1KA 4LJLA 3KHUA 5AXDA 2FN4A 2FLKA 3NT4A 3PNQA 4ZEOA 1IE3A 4D56A 9GPBA 4NE2A 1VI2A 2ZUBA 1GHTA 2FFHA 4KK4A 2VKTA 1NATA 5BN3A 3KHSA 5IXSA 3K0HA 2A94A 3VU0A 2HGZA 2GM5A 4G8DA 4KJZA 3NWOA 3WICA 1LJ8A 3U0BA 3UCXA 2QM0A 3QLUA 4KO2S 4KXQA 4QUIA 2R6HA 3DAHA 4WTOA 5CYOA 2PAAA 2AOXA 4RGBA 4BMYA 2CDNA 4FZ3A 3L6CA 3VJLA 3TMKA 5K0EA 3FOFC 1C5KA 3AEYA 4C03A 5BR8B 1V9SA 1GTMA 1RJDA 5H5JA 2AW3A 3GFOA 1E6EA 2P3SA 2M6RA 3ADPA 2AXEA 2HN9A 3H8WA 1HE3A 3L04A 3NHRA 4OJQA 2RHDA 4WUVA 1BG6A 1KY3A 1Z17A 2CFCA 3UMFA 3B5IA 4B48A 3L4KA 1ZU4A 1OWNA 3KQKA 1WUYA 2GLXA 1T9GR 1TFUA 2LD4A 3K20A 5EERA 4BO1A 1W44A 2OAEA 3ESDA 2DFVA 3GPDG 1QHXA 2XCQA 3EZ9A 5GM1A 421PA 4DIMA 2P9EA 1EHCA 4BDSA 4Q4DA 1EFAA 5TGTA 1GPDG 1X7ZB 4AXXA 4MXDA 4FOLA 5I7UA 3B8HA 3KQHA 4M6WB 3GCXA 5H70A 5JV5A 3TLKA 1RM0A 3O73A 2AIRA 3PQ2A 2QUZA 1DDIA 2VNSA 4LTDA 4R4JA 3W4IA 3MUNA 4YJKA 3ZVMA 3HDGA 4WCFA 4UFNA 5FBQB 3VR3D 4IDQA 4O3MA 1JHPA 3TLXA 3EY9A 1QG4A 4Z54A 3K2EA 2XWPA 3EIHA 3P97A 2UVQA 3BIJA 3K5WA 4RELA 3TBHA 2TYSB 1SZPA 2JVJA 2PX4A 1R4ZA 4DMRA 1U1DA 4HH4A 2YIVX 2RBGA 4RD6A 3ZXUB 1AMOA 3SQXA 5JNUA 1CFZA 4P0TA 1I6WA 2VA8A 3M6VA 1NUPA 1Y34E 1VCMA 4RZUA 3LQKA 1R00A 5E2IA 1GOTA 3SXJA 1JR4A 3FFAA 1XZIA 4V1CB 2Q5FA 2ZIZA 4C2UA 1PV1A 3T1QA 4C6RA 1VDMA 4ME6A 3WLIA 1U9JA 5EN4A 2B25A 3S2GA 2QNBA 3JQAB 4I66A 4IFBA 4GR5A 3DZDA 5EUBA 4JQZA 2MR6A 4RNDB 1JG1A 3PICA 2P0EA 4LBYA 4P1ZA 1FDTA 2YWEA 3DTTA 2JGMA 2K4MA 3V2GA 1ZI6A 2QTFA 4NBLA 1H2HA 3FPJA 1DRKA 1HL3A 4X60A 3KJFA 1NXOA 1GXSB 4MX8A 4A8HA 4B76A 2VDNB 2WG1A 1E18A 1R0CA 4F21A 1BEZA 3AP3A 4TL9A 1G8YA 2P91A 3L0OA 4NBUA 3WL6A 1H2WA 1P0MA 2FEWB 3ZPXA 3SGLA 5EVJA 3TZHA 5IJZA 3NVKI 3G2HA 1T5BA 4EJSA 1PLJA 1TM2A 4HLQB 3RVKA 2FHPA 5A4IS 6NULA 1NFRA 2QX7A 4A92A 3DT9A 3SYNA 1WOYA 5JXHA 1Y4DE 3PUIA 4NZYA 4EATA 3TUIC 2V7TA 4YUVA 4RTMA 1ZITA 4F85A 3SI7A 1ISJA 1DL5A 1ZM3A 1M72A 4FN5A 5DVZA 3SYLA 3SZGA 2AUMA 4AWXA 1EDEA 2E55A 1BCSA 2FQ1A 2XYHA 2AVNA 3MINA 4OI0A 4EHKA 3ZE8A 4O4HA 1UEJA 4HRVA 3D54D 5LQJA 3ICPA 3KKMA 3DE4X 3MSCA 3PR3A 1DX4A 2AJLI 1QC5A 1BW9B 2C9MA 3Q8MA 2E4WA 3KKLA 2Z95A 2I4MA 4NIMA 2MSNA 1PNVA 2FCAA 2ODTX 3AF3A 3PD1A 4FS8A 2E0IA 3KR0A 1BVRA 1Z06A 1KZ7B 2CYBA 2MSKA 1SPXA 4IWYA 3V4SA 3LLUA 2F90A 1TMGE 2C2OA 4D8YA 2V7QA 2NU9A 3NHLA 3WGUA 1VE9A 1NYTA 2P5TB 1X9IA 3S70A 3JRWA 1VI5A 3KM0A 4KIFA 4IIVA 1Y1PA 3C6BA 2OB2A 3SZUA 4RU1A 3IO5A 5DM2A 2QVXX 5BQ3A 3C3XA 4IJMA 3U44B 1ZW6A 1GSIA 1MGOA 2B1QA 3AIIA 3B7PA 1FS6A 2FW8A 3GYGA 3ZYZA 3PT9A 4W1PA 5DHTA 5LLSA 3HA5A 1YRBA 3O4VA 2C9BA 2G8LA 2JCYA 1EDDA 1LXCA 2OSVA 1KEVA 2Z08A 3UICA 2BC9A 1UM9B 1QKJA 2CN1A 2BD0A 4ZIRA 2J5KA 2J6BA 4MGHA 1NAHA 2CMHA 4LTNA 5D6OA 3HB7A 2G76A 3D4NA 4ASUA 4DLWA 3B70A 3HVIA 1QTNA 1DIGA 4X44A 2OD7A 2WJGA 3AF4A 3FNEA 2NU8A 5D7NA 3W8NA 2JF0A 2GKGA 5C8ZA 1E7RA 4MV6A 5EJ8A 1WXEA 2QTVA 5AK5A 1LFAA 1VCIA 1FTQA 1B1AA 5ELMA 3QEMB 1N57A 2RJ3A 4LFAB 1BDIA 3KYCA 4HCJA 4C0AC 2H8GA 4EI8A 1XRMA 4G5FA 1JYEA 3KJHA 5DYTA 3X0DA 1L5HA 1MV5A 1W4ZA 4KLNA 5LJIA 3PNBA 2HHCA 4TS3A 3DF9A 4YCAA 2P2CA 4NPCA 2XKKA 1G7TA 4WK4B 1TUGA 4BMZA 1PW7A 2X2PA 1VRWA 2FZ5A 3NR2A 2FUG6 3UUEA 1TMOA 1ZGHA 3W77A 4BBAA 1GTL1 2BBTA 4MWZA 4POAA 3GCGA 4H0FA 2IV2X 2EWVA 1J25A 3NNSA 4K6FA 1WP9A 4LISA 1WBBA 1LY1A 4RZHA 2QZPA 3CWZA 5BV8A 2FW7A 3H18A 2CLFB 3QKWA 4HDMA 4GI1A 3U3ZA 1YCGA 4JLOA 2CSXA 4BLUA 2H31A 3BHIA 4YHBA 3MMZA 3JXEA 4H4CA 1QOPB 1SHZA 5FFFA 5G0UA 2DB3A 3F8SA 3TZ6A 3I1YA 2AKYA 2ZB3A 3AH8A 1L4UA 3AK4A 1Z2DA 3GJZA 1V2HE 2HA6A 5I51A 3PEWA 1E9SA 4OPMA 4QOSA 4ZVUA 2G09A 3ZCTA 2O2SA 3A6ZA 2DWUA 4DPKA 3ILSA 3QUTA 4V1CI 3RVMA 2PL9A 2IYOA 1L8OA 2JEYA 1P19A 3BZUA 3KUKA 2O1XA 5EJIA 3PE6A 5K3FA 5K0SA 1QP4A 5CT6A 4CEHB 3OX1A 3I9V1 2C9OA 1SCUB 3C4VA 3WHIA 3EF0A 1OWOA 1T6XA 3RGGA 1V1MB 2BTEA 4B83A 1GQ2A 2V7QD 1T13A 4ZTUB 2IHUA 2O8BA 4IBOA 2YYYA 2B6HA 1X0XA 1GRRA 2Q4OA 3DQZA 4EI7A 1VOTA 4XPZA 1T2CA 5BRAA 2NNLD 2ZS7A 3D0OA 3OJ0A 3OT4A 2JAOA 4O4LA 4Q48A 4EY5A 3DLBA 3FBGA 2BLNA 3T7CA 4BKMA 3E84A 4DMLA 1L4MA 3LZ6A 1NBOA 3U4CA 4YMGA 4DN6A 5DM70 1C8BA 4BZQA 3LVQE 3EDCA 5KZMB 1OAAA 2CWDA 2KW5A 2UVPB 3AB3A 1GVNB 4EUFA 1TYAE 5ICMA 4ZCRA 1J2EA 1RWNA 2VZEA 4YMSA 2FX3A 3GLIA 2QDKA 1KA9H 1Z2EA 2ISCA 2Q5QA 1WXIA 1SVOA 3LKBA 3PHJA 1LPOA 4HTFA 3SFVA 3CYFA 2EWMA 5F1OA 1UC5B 3ADBA 3QVVA 3M89A 3MTBA 2ZSKA 5JS2A 3FROA 4OB7A 4LW8A 4CI0B 1IYZA 1L7RA 2VDUE 5KX5A 5J2UA 4ASUD 5FKJA 4JJZA 4C5BA 1I7PA 1IJFA 4WBNA 3QIVA 2EFCB 3FW1A 4UDYX 4OMFG 1IM5A 1TLTA 3MZ0A 3PDUA 4RDCA 3NDIA 3S1AB 1TT5B 1A5TA 1T5LA 4P53A 4YIKA 1SKAA 1GYPA 4RVNA 2ZBEA 4K1LA 2X1HA 3F3MA 4ZQIA 3IR6A 4QD3A 1ZXLA 16PKA 2VR1A 4C78A 4IV8A 4CFYA 3DTVB 3P19A 4DG5A 1WX1A 1MJ5A 4I99A 3U3MA 5JJBA 3TUZC 2H7VA 3TAUA 4FXOA 4F4UA 2QG6A 4KC0A 3ZEAA 4GGMX 3FDXA 5THKA 4TKLA 3FUCA 4YAOA 3TGPA 4PHFA 1XL1A 2X4IA 3LUDA 2C58A 3S8MA 4EZIA 3VMMA 3H6GA 5CM9C 1RW4A 3WZ2A 2FEKA 2P9BA 1NJ5A 4JDUA 1WBJB 4IX9A 2REBA 2ZTLA 2FP4A 3HXTA 3AUYA 1QHIA 2YHSA 5IULC 1B41A 2UAGA 3AUXA 1E6KA 5J59A 1JJVA 5A04A 1D7AA 1TGYA 1AHIA 3EFHA 1M2VA 1E2FA 1QZTA 4H7EA 621PA 1IZZA 5A5VA 1R6DA 1NQ5A 3W8DA 2F3UA 3PC7A 3WX0A 1NNLA 2HJGA 2BHRA 4KFCA 1AXGA 3VKGA 3FOEC 1N2OA 4S12A 4UD2A 4JUCA 4U63A 1KI9A 5DCWA 5HGXA 2HF2A 2NZJA 3DLPX 4G9BA 2ARKA 2XMQA 3I3OA 4OHPA 4WFKA 3ZDQA 5CD1A 3VTZA 3MOGA 4Y2RA 5IN5A 2AR7A 3H8SA 3HEMA 2Z2JA 3HJTA 1D0IA 3H7AA 4W6ZA 4BFLA 2FV8A 1IOZA 4IIBA 1PO7A 1NMYA 2IOYA 4Q4HA 2MOKA 2ZS9A 1HZZA 5HK8A 4M0KA 1CZNA 1OMOA 1R0LA 4OLFA 3FOAA 3L9WA 1PCXA 4MEAA 4DLKA 4I1OA 3GJ8A 2KPOA 2VTKA 4FFVA 4IDDA 4LYDA 1B8VA 2BAGA 3NDPA 3V6LA 4Q01A 1M75A 5DB4A 2XDAA 2TS1A 5E3IA 4EYOA 3D3NA 1G5PA 1NPTO 1Y0BA 1JNYA 2VTEA 1DKOA 2WPNA 2ZSIA 2ZTUA 4GP6A 1RWWA 2QE6A 5FO1A 3IPRA 1V8FA 3JQPA 1JFRA 1U0FA 4KX3A 5L6MB 1JA0A 1N25A 1M83A 5DM4A 1A5AB 1MIHA 1MOQA 1U8TA 4IFTA 3S40A 4RVHA 5ENDA 4CQMD 2IK8A 4KUGA 5K2OA 5BR1A 1OIXA 5IP5A 4RY0A 3TCKA 3OCJA 4YMVA 2VVTA 3KHTA 1DAIA 5CA0F 4D4MA 4Q5IA 1TKCA 5ENVA 1GQFA 4M22A 5L4NA 4MW7A 3AEQA 3C41J 4I50B 1V5EA 3ZY4A 4AZ3A 2NADA 3ZWBA 1R4MA 2PUAA 4AROA 2OUKA 2XGGA 3VVMA 1SIOA 3LC7O 4RO0A 2FZVA 3DBHA 1VMDA 3WIEA 1XRPA 2XY4A 1GV0A 4N0DA 4HKTA 1N9ZA 3TL3A 3IQGX 4WNAB 3F7OA 3DS8A