2CWDA

Crystal structure of tt1001 protein from thermus thermophilus hb8
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
150
structure length
150
Chain Sequence
DRPVRVLFVCLGNICRSPMAEGIFRKLLKERGLEDRFEVDSAGTGAWHVGEPMDPRARRVLEEEGAYFPHVARRLTREDVLAYDHILVMDRENLEEVLRRFPEARGKVRLVLEELGGGEVQDPYYGDLEDFREVYWTLEAALQAFLDRHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of TT1001 protein from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords low molecular weight phosphotyrosine protein phosphatase
total genus 61
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2cwdA00
3BBLA 3N6VA 4KRFA 3KSMA 2JB9A 3K4HA 2ZWMA 1Z16A 4PEVA 2X7XA 3MMNA 1RNLA 3Q41A 2PMCA 3FFTA 1SRRA 1JDPA 4O1IA 1JFSA 1SXHA 3CFYA 2MYPA 1U8TA 1LBIA 2L17A 4HNRA 1ZY2A 2WJWA 1E6KA 1B00A 2H3HA 3OLYA 3RVKA 3SM9A 2PUCA 2PUAA 3RH0A 4CBVA 3KYIB 1Z25A 5JNUA 2R48A 3QELB 3RVSA 3GL9A 1YK0A 1YTUA 1YS7A 4QPJC 4RKRA 4PE5B 3H5VA 3SY8A 4MLDA 5KQGA 1AB5A 4P1ZA 1K68A 5JNVA 1KRXA 4PZ0A 2V0NA 3H1FA 4ZPJA 1ZDMA 2WMYA 2M98A 3HUTA 3HVRA 1NXPA 4IMJB 2LIVA 3RVRA 4OLBA 4RDCA 5DKFA 4FE7A 4Z4FA 2B4AA 3FGZA 5FBHA 2LP4Y 3LKVA 3JVIA 3UUGA 3SNKA 1QQBA 1RPJA 4JA2A 5IUJC 4RXMA 2O20A 5B3JA 4KNYA 3DZDA 3H1GA 1VKRA 3QEMB 3OM1A 1QP0A 4OBBA 4ETIA 4YCSA 5DTEA 3RVMA 2FEWB 1LBHA 3EDCA 4H60A 1PNTA 3HEBA 1USGA 3F7NA 4XARA 2PE5A 2WWVD 1PUXA 3OQMA 2FEPA 2HPHA 5IEBA 2L2QA 3H5TA 2E4WA 2GKGA 2N9UA 3C3WA 2P4UA 1ABFA 3S99A 4LZLA 3T95A 5TE9A 1BA2A 4RU1A 1SXGA 3BILA 2R47A 2PUGA 3KLOA 1KMIY 3HSYA 4XXHA 3EAFA 3CG0A 5IEJA 2F8SA 1YMUA 1S8NA 3OLWA 4WZZA 5FWYB 3A0UA 5GQSA 3CRNA 4WUTA 3L49A 2XDYA 1QQAA 2ID7A 3IP9A 1JWLA 4E7PA 3IP7A 4WWHA 1CHNA 3CNBA 4RSMA 4RY8A 4ZMRA 4RWEA 3Q9SA 1TM2A 3F6PA 4D74A 3CG4A 1RZRD 1APBA 3MQ4A 1I3CA 3W9SA 4G0OA 1XHFA 4TMYA 1P8AA 3DGFC 2PUDA 3LUHA 5T3YA 2YHBA 3ROTA 3C3KA 4W5TA 3HJFA 2FQWA 3C97A 3CU5A 1ZN2A 3O2QB 1ZAYA 4DQDA 2A9QA 4QICA 2QSJA 3GRCA 5CHYA 2NT4A 1XHEA 5TPZA 1Z2DA 3TMYA 3HM9A 4TN5A 1L5ZA 2JVIA 4FE4A 5ED4A 2L18A 1QO0A 2FLKA 4QYWA 1DP4A 1Z26A 3HV2A 3NHZA 4DADA 4KREA 3EJWA 4MS4A 4N47A 2FQYA 1DBPA 3N53A 4EYQA 1YVUA 1VPWA 5C5CA 3OLVA 3EGCA 3Q15C 1Z15A 4RK5A 3OQOA 3CZCA 1OXBB 3LUDA 4KQ9A 4RK4A 3QLTA 2NZUG 4KMRA 2HQOA 3Q7SA 1JX6A 3KG2A 4MQFA 3UK0A 4N41A 3IDOA 1NTRA 1FFSA 3EULA 4Z4GA 3OMXA 3CHYA 3H5IA 4DN6A 2GBPA 1MB3A 2FMFA 2JRLA 2MYTA 2CHEA 4KQCA 4OG2A 1NXTA 2QW1A 1VLZA 3R0JA 4F8JA 1DC8A 5IULC 3QELA 1DCMA 5EWJA 5EWJB 5TPWA 4MAAA 3P9YA 3LKBA 2GX6A 3MA0A 2LPMA 3GT7A 5GOTA 4EYGA 1EWKA 3T8YA 1EWVA 1MVOA 5IBQA 3OM0A 3I45A 2VYCA 4E7OA 3T6KA 2AYXA 2M1ZA 3FFXA 1EFAA 4YRZA 3E61A 4MQFB 4OATA 1YK1A 1FSPA 1ZGZA 4YV7A 5JNSA 3A0RB 4LRQA 2E4YA 2MSLA 4NICA 2HSGA 3OMWA 4OLAA 4EVRA 5KQPA 1C0EA 3O2SB 3TO5A 2QU7A 4RV5A 2FMKA 1TVMA 3RVPA 1D5WA 2FLWA 4Z4IA 4FB4A 1GCAA 3SG0A 1JLKA 3KLNA 1M5TA 4MS1B 4F11A 4YP9A 5KWSA 2JBAB 2P9HA 4RY9A 1HEYA 4JOQA 1BAPA 3N0XA 3RVQA 1W9HA 4P98A 4F12A 1ZH4A 1DCFA 2ZAYA 2FTKE 4MPTA 1RXIA 2NUBA 3NHMA 4MR9A 1TLFA 3D8UA 3KS9A 2OQRA 1CYEA 4N76A 2MYUA 4MR7A 2PUFA 1PHRA 3N0WA 4MS4B 2Q5CA 5BR1A 3GYBA 4RY0A 1GCGA 4L4UA 3Q7RA 3DLHA 4Q6WA 3RVNA 1D4ZA 5KI6A 3HCWA 3F6CA 3G85A 3SAJA 5KC8A 2FQXA 4IGAA 1Z13A 4RS3A 4M88A 2YHAA 4D6XA 2R4QA 6ABPA 3A10A 3IP6A 1MB0A 2E4ZA 4G0QA 2AYZA 1PEYA 4ETNA 5B3JC 3A3KA 4HNQA 4MR9B 5CNJA 4B09A 3Q7TA 4G0ZA 2E4UA 2LBPA 2QXYA 2TMYA 1F51E 4XAQA 5FWYA 3TB6A 5IUNC 3B2NA 1Z18A 2F8TA 3N75A 3BRQA 3LFTA 3M9WA 9ABPA 1USKA 3NBMA 5T7BA 1Z17A 4Z4EA 5TPWB 4EYKA 2FKAA 4MS3A 4NCBA 4UHKA 3H1EA 3FMVA 1DCKA 1Y1LA 3CLKA 4L85A 2A9PA 4Z9AA 5D2CA 4JAVC 4YS6A 1ISRA 3H6GA 1PEAA 1JDNA 1T34A 2NT3A 5KQLA 1ABEA 4IILA 1A2OA 3GBVA 1JHZA 3SQNA 4Q6BA 4ETMA 2IPAB 2PL9A 3LUCA 1H9CA 4NV3A 1VRVA 1A04A 1E2BA 3DBIA 1FQWA 1XWWA 3H5WA 4W5OA 2L19A 2IDMA 3QLUC 5EWLA 3OQNA 1AB6A 4MS1A 2WB4A 3JY6A 4ZYLA 3QLVA 3OLZA 3F73A 4RK6A 1SD5A 2JK1A 2FSPA 3NNDA 3CZ5A 2IKSA 3G1WA 1U04A 4LE1A 1C4WA 5PNTA 4MQEA 2WY2D 3NNSA 3UKJA 5BRJA 1W25A 2CWDA 2FMIA 3LUFA 2JCGA 2E4XA 3D02A 3QEMA 4MR8B 2KYRA 4RXTA 4XLTA 1JYFA 1LJUA 1YIOA 3EQ2A 1PNRA 2GWRA 3M9XA 4GPAA 3VNBA 4HNSA 3LUAA 1YMVA 3TD9A 3RVLA 1EHCA 4H3HB 4IMIB 3RVOA 1MAVA 2IPMA 3CKMA 2CD7A 4W5NA 4N0PA 3N0RA 1ZGGA 3O1JC 1LK0A 2RJOA 3O74A 3RVJA 4Z4HA 4LE2A 4TLLB 5F64A 4PICA 5JNRA 1E6LA 1JFTA 2RJNA 1MIHA 5E3JA 2FMHA 4N0QA 2RGYA 3E3MA 5IX8A 4TLMB 4Z0NA 1NXSA 5EWMA 2LUOA 3MF4A 2BGGA 1UDRA 1QMPA 2MSKA 3HS3A 4MS3B 4G97A 3LOPA 4RXUA 2PKXA 4F06A 5TPZD 4YR7A 3JTEA 4UHJA 1QP7A 1QO0D 3JPWA 5C5EA 7ABPA 4S05A 4G86A 5JNWA 1RXEA 1GLGA 1URPA 3M6MD 3O1HB 4KK3A 4EY3A 1DJMA 3HDVA 4EYOA 2QV0A 3HDGA 3O2JA 1D1PA 2I6FA 2HQBA 1D2AA 3FDFA 3CS3A 5TQ0A 1U0SY 2HJ9A 1Z12A 4QYMA 3GV0A 3LUKA 2FN9A 3ROFA 2WJAA 4H3KB 1BDJA 3OO1A 1BDHA 1DRKA 1E6MA 5CNIA 3H6HA 4MR7B 4Y9TA 3VNAA 1QP4A 1QNLA 1NATA 4ZJPA 4YGXB 1QPZA 3KCNA 4XFKA 1A0OA 3URMA 6CHYA 4KZKA 4F3TA 1FFWA 1FFGA 3MYYA 4N03A 4JB2A 4WT7A 5ABPA 1USIA 1Z2EA 4EGSA 1GUBA 3KTOA 3QK7A 4MRMA 1JFVA 1KGSA 3GA5A 3H75A 4KPYA 2FXIA 5I4CA 2JBAA 3HZHA 1QKKA 2RDMA 3H5LA 3QLVC 5IC5A 4ZMSA 4W5QA 4NQRA 4PYRA 1RZRA 1DRJA 3O21A 1U2QA 4KVFA 2B1JA 3HO1A 5FBKA 1LJLA 2VK2A 3O1IC 4JASB 3ILYA 4G0MA 1NXOA 2WRZA 3JPYA 2H0AA 5JNTA 5FWXB 2PUEA 5TQJA 1P6UA 2VUIB 4GNRA 4MQEB 1NXVA 4RK7A 3CTPA 4G0PA 1KRWA 4WXMA 3BRSA 2FEKA 2NZVG 4LE0A 2PLNA 4WXEA 4IF4A 3FFWA 1NXXA 3QX8A 1NXWA 4LX8A 2IPNA 2MSWA 2W42A 3KKEA 3DGEC 2IYNA 3GBPA 5CNMA 5TQ2B 4EVSA 5TQ2A 5KQMA 5EWLB 1JH9A 4LDAA 2J48A 5TQ0B 5FWXA 3RQIA 5KC9A 2PUBA 4MLCA 4ML3A 1K66A 2A9RA 3I5AA 4EVQA 2PAFA 1M5UA 1ZHHA 1DG9A 1WETA 2VUHB 4KV7A 3LUGA 4D6YA 4KK4A 2JVJA 4OTZA 3EQZA 3LMKA 5DGCA 1BDIA 1P2FA 5JS1A 5EWMB 2DRIA 4YLEA 4NCAA 2MYNA 1F4VA 1JYEA 3C6QA 4JB0A 4JP1A 4RKQA 1IIBA 1GUDA 3ILHA 4MR8A 3MIZA 5HQJA 3LTEA 1EAYA 3H5OA 4MRMB 3L6UA 1YS6A 3QEKA 3QLUA 1ZVVA 1JL3A 3C3MA 1D1QA 1SXIA 4Z4CA 1JF8A 1R8JA 1M2FA 3IP5A 1TJYA 5CNKA 5DCLA 3MM4A 5HSGA 1M2EA 2ID9A 3IPCA 3HUUA 1DZ3A 3JVDA 1OXKB 1TMYA 4RZSA 4EUKA 4KFCA 2QVCA 3I42A 2JVKA 3DLBA 5DLEA 3KYJB 4RK1A 2FW0A 3T38A 5BRAA 2IOYA 1DBWA 5JS2A 1J56A 2R25B 2QZJA 3KJXA 1DBQA 2OENG 4IRXA 1BVHA 1DC7A 8ABPA 2IPLA 2PL1A 1JBEA 3I09A 4O1HA 3TX6A 2GI4A 3HK2A 4RK0A 1U2PA 4G0YA 3K9CA 1ZH2A 1ISSA 3JS5A 4O5AA 4Q7EA 4XASA 4Z9BA 2E4VA 3LUJA 4YWHA 3OLXA 3KHTA 1ZITA 4MYRA 4LDZA 1P6QA 4HYEA 3BREA 4MGEA 5BQ3A 2QR3A 1ZESA 2FVYA 3NNNA 2FN8A 2A9OA 2HQRA 1L5YA 2PJUA 3IPAA 3OO0A 2CHFA 3QX9A 3N8IA 4S04A 1EWTA 4Z99A 3HXMA 4W5RA 1CEYA 5HM6A 4YO7A 4G0XA 2QVGA 3O75A 3GWGA 1NY5A 5IUKC 3EODA 5HKOA
chains in the Genus database with same CATH superfamily
4D8VA 2RHLA 3K4HA 1GTVA 2BBSA 3P5SA 2BMFA 3ZU3A 3B12A 3KQMA 4BVBA 4QUKA 4AJJA 2D5AA 2OO3A 4PX5A 2Y8EA 2OQVA 4XJTA 1I32A 1GDDA 4ARAA 1NVTA 4XDYA 4D3FA 5IVDA 1DC4A 4PYQA 4QZVA 2PBRA 2I8LA 5HP4A 4PVDA 1E0JA 3KQSA 2C5GA 1YVDA 1ZW6A 4N4AA 1ZNQO 2WJYA 3NTOA 2OBLA 3ONEA 3ZZ1A 3LQRA 1X92A 1YK0A 3EB9A 3TQFA 1QQ6A 1K88A 1Z75A 3AF3A 4M99A 5L45A 2QTTA 3ACCA 1AB5A 4L5AA 1CZKA 2PSFA 2IBTA 1ZQ9A 2J3IA 4DJJA 1SHUX 1U8ZA 2Z83A 2UVQA 2X2FA 1PR1A 3DP7A 3G2OA 3H7AA 3JQBA 4JELA 4P08A 4PIMA 2FF7A 3HYCA 4D0LB 3HI4A 3QU4A 3FM9A 5JO0A 4BMPB 4DHEA 2H1FA 2YW9A 2VUUA 4FE7A 4MCAA 3TFQA 1B0ZA 1WQ3A 2E49A 2P6MA 5AJZA 3Q8KA 1VJ1A 4O2BA 1XPUA 1NMEA 4F1JA 1KQFA 2AN4A 1N6OA 4RMJA 5B3JA 1T0HB 5DW0A 4TN1A 1XRLA 4AJ4A 2RH4A 3WHIA 3MOSA 3E8SA 1YACA 3JYNA 3SHQA 1UP4A 2K7FA 1CZNA 3HEBA 4XARA 2B6NA 1QH9A 4BE7B 1JEYA 2NXCA 4XTCS 4Q4CA 2O0MA 4FIDA 4P84A 3ZDRA 1FJ2A 4URVR 5I7WA 2AHRA 3CF0A 4M53A 4UMEA 5G3YA 3C3WA 3L8DA 3H3XA 4JNCA 4P53A 4CQJA 1LF5A 4IDOA 4K9NA 4PPGA 2EGGA 4IOKA 3O92A 1LUAA 5GMOA 2PR7A 5IABA 5TXGA 2VYND 2YINC 3KLOA 1XOIA 4M9CA 4PYMA 3INGA 1MOQA 3SEQA 3A25A 4J2HA 3W8RA 2ZUCA 3NHYA 3D6FA 2OV6A 3EAFA 4P4TA 5IN5A 3L84A 5DE3A 5K6TA 5FWYB 3W6ZA 1IAQA 4GR9A 2VH5R 1G63A 2C5AA 4LDQA 1PR0A 3LLCA 1NW6A 2GF2A 4A82A 3CNBA 1OFIA 3CXUA 1RHRA 2YWCA 2BFDB 1DUSA 2JD1A 4DDHA 1RZRD 3UH0A 2P3OA 3PDIB 1WDWB 4M38A 3N7AA 4MUYA 3EGIA 4J0FA 1WSDA 1HORA 5I7RA 2I2CA 3L1HA 2WJGA 2DC1A 4PYIA 3V8BA 4JLPA 3WLNA 3FWPA 1K0UA 3FZNA 2F4NA 4UE6A 3KL4A 4XUDA 1ZJZA 1PR6A 3RS5A 4BX0A 4BVJA 3ZDXB 3X2SA 4RELA 3D4PA 2PLRA 2R96A 2QTFA 3PIRA 2V7QD 1XRJA 3BKWA 1L8OA 3HCCA 1NJFA 1SKBA 2V59A 3P45A 3UJNA 3HKEB 3ZX4A 1MC5A 4GVLA 2DUUA 2Q2QA 2C7BA 3QVMA 2J07A 4U9HS 5FPSA 1EA7A 4EL0A 3DOFA 2WSYB 1FDSA 3PR1A 5C52B 2O2XA 3BDIA 5CCDA 4F8EA 1Z2PX 1DEAA 2I6GA 4KREA 1RM0A 5J4VA 4EA8A 2H1CA 2Q41A 5A3QA 3HUFA 1TCAA 3ZLJA 3OTWA 4D9MA 1G1AA 2ISCA 3L5OA 4CT5A 5KVQA 1JTEA 2PQ0A 4ITRC 2KW5A 1U1GA 2AFIE 2ZYUX 4WCVA 3U1VA 1XF9A 1IZZA 2ZWIA 1ZHOA 3OUUA 2ORYA 4I4LA 4U0JA 3ZD9A 2ZZMA 4FFNA 1JDZA 1UQRA 4RKFA 1R5OA 4J7CA 3M6IA 1TB4A 3IBFA 4QXMA 1YGPA 2QE7D 2O5VA 1LI7A 1Z0DA 5JVDF 5F3WB 3TNYA 1KMHB 5EZ6B 5GVSA 1NXTA 3H9JA 4TXHA 4OUKX 1KJIA 2XMRA 1CR2A 4E22A 3K53A 3SSMA 3HWSA 3VFDA 4I1OA 1Y4UA 3KSUA 3FD8A 5HWSA 5GVRA 3HB0A 2AEFA 3BIJA 3GT7A 1E32A 2YBDA 1EWVA 2CDNA 4CPDA 1YZQA 1X1RA 1R16A 3EVZA 2F3RA 5DHPA 1QZZA 1TZCA 1OU4A 5DYNA 4PPFA 2ES4A 2WWRA 4KLNA 5CTJA 1Z4QA 2DLCX 2AR9A 2NPIA 4DDWA 3IBYA 3QU5A 4KXXA 1GYQA 5LZ4A 1RHKA 2A0WA 4TLCA 1SHJA 3E1GA 1L4UA 4II7A 3UPTA 4K03A 1BJTA 5A4KA 1L5VA 1NMSA 1NW3A 4NICA 4NDNE 1ODJA 1Q3KA 3VI3B 1U80A 1V39A 1XA4A 2H4FA 2QU7A 5TARA 1P2SA 1WU8A 1HTBA 2ZB7A 2FLWA 5I7FA 3FDZB 5FNVA 4Z4IA 3PGLA 4HQLA 1YU6A 3UBMA 3RSCA 5KWSA 4YP9A 4UNSA 3V80A 1KI4A 3HA2A 2VRBA 3VZSA 4CNQA 1AKQA 5KINB 4Q9KA 4HN4B 4TLAA 3D4BA 4LBZA 4QA9A 4TV8F 1WSWA 1FE8A 3BWYA 1HOXA 1MPXA 3TQRA 1XYGA 4ZIRA 1LBQA 3OLQA 2O6HA 4FS3A 1REQB 4WJLA 4YH1A 2HFJA 5JMOA 3PE6A 3WHLA 2FY8A 5CLHA 4HX9A 3LK7A 2A78A 3C1TA 4JJ7A 4F92B 2M32A 3C1AA 4EKDA 1AXGA 3TW6A 1I4DD 1G2OA 4M1QA 5BNTA 5KYNA 1AQYA 3LNCA 3PXDA 1T43A 2EZ9A 2Q5CA 4YBZA 5CFQA 2WTAA 2QDXA 3ASVA 4H1VA 2AK3A 1O95A 2QWXA 3WY9A 3MGBA 4NS4A 4OI0A 1VPTA 4Y0NA 5K0GA 1FSGA 3C41J 3GQVA 3NHBA 4EB6B 4CQMD 5M3BA 2V7TA 1I1QB 2Q6VA 3OCVA 1CPYA 1L3IA 1O97C 1UAGA 2RGNC 1H5QA 3DBLA 1SR8A 4IGAA 1K5HA 2R4QA 4I8IA 4AF7A 1NNUA 2CDRA 4FMDF 4HFRA 1N1MA 1IN8A 2N1MA 3ESXA 4JT2A 3ORQA 3S8EA 4V03A 3WJ1A 2O1XA 2H4XA 4BNKA 2PMFA 3EW7A 3H5AA 3V9AA 4XAQA 2V6FA 1DO0A 1GPNA 4LV5B 1IVYA 5KSYA 5MFZA 3N75A 4HUJA 4WOPA 4Y1RA 2FQQA 2PIAA 4M6WA 4BVKA 4P4SB 4E70A 2XYGA 4AN0A 3QQPA 4RF2A 1SQSA 3TLGA 5FTJA 1G21E 2FX2A 4UVGA 4YROA 4ND1A 4UHKA 4Q03A 3DKPA 3VTAA 3RAJA 4B71A 2WUVA 3PEYA 3QKWA 3LCJA 2EFDB 3RUIA 2NO4A 3QG5A 2JGFA 5LP6A 3IC5A 4TS4A 2WLSA 4IJQA 4KUEA 1Q19A 4CN8A 2X14A 4R1MA 1JDNA 1ML3A 1C3XA 3ELWA 3AV0B 3G0OA 1V25A 4OLFA 3KXPA 1SGWA 2GEJA 3QVLA 2Y1XA 3OT5A 4IIDA 1MTOA 4OJTA 1R6BX 3AILA 3QH4A 1R0WA 4H1UA 5ALKA 4A5SA 1TKRA 4F56A 1ZXBA 3ETGA 4HTAA 1FMTA 1KR2A 4D3SA 1VRVA 5CB8A 3VU9B 5E1DA 3C7KA 1P7WA 4JBNA 5TDHA 3O3MB 4PRKA 1TMGE 2Q5OA 1WXHA 3IUEA 4BE4A 5FR2A 3MJVA 1WCYA 5HF6A 3WLEA 4BFSA 1GPWB 4CI0B 1OFGA 3FI0A 3LFUA 4TT3D 1BVYF 1A9OA 3NFRA 3K8QA 3LNTA 4V0SA 3EA5A 3HBLA 4B33A 3U3KA 1VGVA 3K1ZA 3OEED 3H8WA 1VBMA 3BMCB 4HNAA 1C8VB 5DYGA 4B7UA 4X6XA 1C7IA 4I2VA 4XB2A 3E2PA 1V2HE 2X1HA 3TFOA 2X8JB 1CUCA 2IW1A 3F6BX 2VDKB 3FUVA 4EGFA 2DWPA 4ZAZA 5L40A 5CVVA 3OC0A 4MQEA 3SFVA 2GPJA 2QUBA 3DMTA 3ZD7A 2ZSAA 1BEEA 4H7DA 2FMIA 3AUKA 1K08A 1XRNA 2FW8A 3I28A 3QEMA 3SDZA 4X41A 2I4NA 3JAMA 4ZHSA 4NHEA 5KNDA 3WMEA 2V0CA 4JBGA 2EEPA 2QD3A 3ML1A 1B1CA 4C43A 1YRBA 5L7WA 2HJGA 3LC7O 3DCYA 5HX7A 4P32A 2RIRA 4FNOA 4YP0A 4CLDA 4WK2B 2IS2A 1UFOA 2OD7A 2QNIA 3DFUA 4ZO6A 5J5AA 1RCUA 2XD4A 3IEXA 4HDSB 4MDYA 1S4MA 2A0YA 1E2QA 2HJHA 1D1TA 1JQBA 4BMCA 4MROA 4OB6A 4UE2A 3HGTA 3NHJA 5K8LA 5FUYA 1E63A 3WIBA 2HRCA 1V16A 2RI1A 4XYEA 1ZJJA 2QRZA 3PDCA 2C54A 2WINI 2OZLB 3O31A 4ALIA 3MOIA 4U00A 4QYIA 1YJ8A 2C9CA 1I9GA 4BE9A 3BRWA 3EPRA 4Q4AA 3RUAA 3PTLA 1B6TA 5AW9A 2PH5A 3OUTA 3UK7A 1NZJA 3GEBA 4H6WA 5JTTA 1QP7A 4PHHA 3EZYA 1R7RA 1T3TA 5IKOA 1GV1A 4NJMA 2QVXX 2RGRA 1W4AA 1KMHA 1QAMA 3F5QA 2I34A 3NPMA 3OP4A 3RSGA 1GN9A 2G76A 2IGTA 2HSDA 3AI3A 2HNKA 4K6CA 4WY5A 4Y6RA 4EKIA 4EY3A 1Y8QA 3MCVA 4F8YA 1FEZA 1PFKA 3B1ZA 1RRCA 2CXOA 1RJ9A 1CUFA 3PXCX 1CS0B 3FDFA 1RW4A 1GL7A 4DAEA 5JCOA 3KLPX 5CDFA 1BMQA 2KJQA 2W00A 1VCOA 3DF7A 2VPWA 1HT0A 1RI5A 3ZWXA 1NMXA 4DKJA 3W9BA 5IFLA 3KUDA 1DRKA 2EP5A 3L0IB 5IK2A 4NCBA 4Y9TA 3GRZA 4XGQA 2JLAA 1GYPA 3USCS 1XALA 3ZTTA 3H84A 1A0OA 2CUKA 2QN1A 2ZSKA 4KQGA 2ZDGA 4N03A 4DMMA 4LXGA 3AW9A 4LEIA 1SVNA 3AY6A 4MEAA 1Y1SA 5IH3A 5IAKA 1Q7RA 2PNFA 3GC6A 3BFKA 3TIFA 3RFVA 1RYNA 2YBEA 4DJEC 3STHA 1Z6QA 2QXUA 3OSZA 1UWKA 3BMNB 2VBGA 2AMJA 3JYQA 4HPJB 3TZBA 3LHFA 3WGLA 5I4CA 4HDNB 3NTRA 2FG7C 4NQRA 3PF8A 4PYRA 3IUPA 3B5EA 4TZTA 1PD1A 1JQJC 1Q77A 4C21A 1N32B 3I2YX 3SHFA 5B1EA 1AGNA 2B1GA 2W70A 2EYQA 4BJ5A 3CX8A 1DXOA 1P2VA 4B3IA 3JPYA 1LLFA 3OZDA 4G85A 1DAKA 1Z3CA 5E8JA 5E4JA 1O77A 1P33A 2VAMA 4C4YA 3ICWA 4LQ4A 1SOUA 4AZVA 3DTYA 2OCXA 221PA 1S3IA 2NZ8A 5K3DA 2CXNA 3D54D 4RK7A 4TKVB 3L7KA 2RHHA 3PQ8A 3K92A 2NZVG 1L5RA 2ZFUA 1I4LD 3HQ4O 4LE0A 5JEDA 3D6VA 3I9V6 3ZIAD 1PZEA 1BS2A 3BJRA 2ORVA 3FUWA 3A9RA 3MCAA 1JR3A 4Q15A 4UM9D 1LBSA 2DUMA 5KAPA 1VE5A 3AKZA 1CDZA 1QIFA 1Z07A 2BY4A 1PZGA 1V1RA 4QPPA 1ODIA 4WKNA 3P9XA 3DT8A 3I6YA 2DWQA 2WUDA 5E1BA 4FMCF 2HKIA 2UUBB 4PSVA 1Y98A 2EEZA 3GUYA 4PWYA 1QTIA 2QB5A 2V7WA 4NFLA 1M5UA 1THTA 4RV9A 4D92A 1NVKA 2I65A 4P7KA 3KLMX 4PXYA 3T9EA 3VDMA 4PG5A 3X1DA 3U1BA 2I1LA 5FPPA 1LBTA 4U6SA 1E1RD 3ASYA 1I33A 3LMKA 2CEKA 3DVAB 4GOJA 5DGCA 1F7UA 5JS1A 3TTWA 4BX3A 4BZWA 5DN6D 4IZOA 4R9VA 3EUEA 1B73A 3L07A 1U81A 2XKBA 1H2XA 2IEDA 4Q9JA 1SU8A 1JTFA 4KWIA 5GJWC 4OMCA 1NNEA 2JLBA 4B43A 1EVJA 3CEAA 1AGPA 2WUEA 5CA1A 3D7RA 4MVJM 3IILA 2VJPA 1EMDA 1IQ0A 1R4MB 4CM3A 5DTRA 1PKEA 1L7MA 3QMVA 4U63A 3SWWA 3CH6A 2ID9A 5EJ2A 1I5RA 4ZZ2A 2PS1A 5LMCA 4ZD6A 1XP5A 4DUPA 1IB0A 1FDVA 2XWQA 2Y1EA 3HZRA 1Y3HA 4UCXA 5LC1A 4OREX 4N18A 3DONA 3ZUPA 3P27A 3EXEA 4IJUA 2Y67A 4OKIA 5K0EA 1T0UA 3WWYA 4ACAA 2EW2A 5ALFA 5CA0F 2PJDA 3LXXA 3T7TA 3U49A 3UV7A 1AH2A 3MJEA 1EM6A 3C4JA 5J40A 2OG2A 5DNYB 1E7MA 4BNZA 8ABPA 2X9VA 1YBFA 1PL8A 2Q1SA 3EGVA 2E48A 4RK0A 3PHIA 4G0YA 4JDPA 5CH8A 1T0PA 2BUAA 4UUAA 5HVNA 3TTTA 3TIXB 2J3DA 2ZB4A 3K20A 4LPSA 4YWHA 2C7OA 1CETA 1TQHA 2E37A 1X7YA 3LVRE 4XSGA 3QITA 3EFOB 1CWUA 1KIFA 1AUVA 1K4MA 2A9OA 3AIKA 3AVQA 5C5IA 1GKYA 2CT8A 3F3KA 3CCCA 1R10A 1SCAA 3OY2A 3H8JA 2GLTA 4TYMA 3TW8B 4BKUA 1U9IA 3KJQA 3KWMA 1BYUA 2ZS7A 4PLHA 4N54A 4CG3A 3GYGA 5KNDD 3TPZA 3THRA 3DE0X 1P31A 5DBEX 2QJWA 4M46A 3ZK7A 3ZVLA 5H8WA 2HQ1A 3Q41A 2ZPAA 3F4KA 1J24A 4CFYA 1ORVA 1NSYA 3THYA 2AW5A 1EUCB 2BR5A 3RTAA 3Q5EA 1T9KA 4A8PA 4AJIA 1DB3A 2R751 2MSDB 4PHGA 3BSFA 4R69A 3E35A 5K2OA 5A03A 5CGQB 4QUHA 1RVV1 3N8HA 1I7NA 3KDSE 4MQ6A 4P4UA 2O8CB 3EXG2 2FE1A 1Z25A 3HDJA 4MCJA 4B3BA 3TDMA 3G0GA 4B8ZA 3QWBA 3BHMA 4JK3A 4JQSA 4UNQA 2RG1A 1KDVA 1TUIA 4C9BA 2A8YA 3SY8A 4KTTE 1NRXA 1XTJA 5TGDA 4O4JA 3A27A 3A3PA 3V1KA 1LB1B 3ANYB 1YOBA 5DGDA 1Z38A 1O4VA 4H7PA 4A2PA 4UASA 1NFFA 4AO8A 2QVZX 2YVQA 3U80A 4MMXB 4QM6A 5C1OA 3B9PA 3MMXA 1JIIA 4FI3C 4FZRA 4RORA 2MU1A 4ZU3A 3FCEA 1WUKS 2OGTA 1W5EA 2R97A 3BF7A 4GAEA 4OHWA 1JLLB 3R9IA 4HAYA 5IUJC 4ROTA 3H1GA 1FY2A 1NX6A 1Q0TA 4Q12A 1PZXA 3BQ9A 1KTIA 1GDHA 2GTHA 3I83A 1NYRA 3T52A 2COKA 1DV1A 2COUA 3TEFA 5D01A 4OP1A 1DC6A 3B3QA 4IFBA 2C8VA 3P96A 3WKAA 4YUYA 3LBIA 2B2NA 4G81A 1U98A 2O9JA 1PS0A 1Q0PA 2EHJA 2L2QA 2QS9A 2A3NA 3SXUB 2N9UA 2GKGA 3WB9A 5CFPA 1S3SA 3FWZA 4CZ2A 1OW3B 2J67A 3K9NA 4IVNA 4YDSA 3UIEA 1PGNA 4L7QA 4N7MA 2NYUA 1TVKB 2CMDA 5DBOA 2GXQA 5J2TF 3E5RA 1TKBA 3UC9A 1LY1A 1MQSA 1U65A 3L8ZA 4CKXA 1GGJA 3PLNA 2QG4A 3L8FA 4WFIA 4F4HA 1L1EA 2PX0A 3CG0A 2HYDA 2ZIXB 3NI2A 4P7GA 2I8AA 4NEHB 1WIWA 2IHVA 3FSGA 1E6WA 4FT2A 3C87A 2CCJA 4OA5A 4TRNA 4CM4B 5DJ5A 3SC2B 1NUQA 1QFSA 2D5LA 2COEA 2E4AA 4MLZA 4QPZA 2FPLA 3FPEA 4DA4A 3U9SA 2PCLA 3HKDA 1E7YA 1AZWA 1RM3A 2V54A 1TM2A 2CNWD 2I9PA 3FPGA 2GN0A 1GGFA 3MQ4A 4FD3A 1I3CA 1Z29A 2INGX 3Q72A 1XMXA 5CFZA 2H4JA 2WWWA 5EPUA 5LL6P 1IRIA 1F7VA 1Z5UA 3GZJA 3MJHA 4UD6A 1KI3A 4EGCB 4DSTA 2XWJI 3MUFA 3HCFA 4OM8A 3CU5A 5DT2A 4UTOA 1XU9A 4E08A 1UPTA 1W94A 2AN9A 4DVJA 2WIDA 4OGFA 1HDYA 4NYMR 4O0LA 3SQMA 5JZBA 1CY1A 1S0UA 1NU8A 2NUPA 3OFNA 2BMVA 4MXDA 1XDWA 1KWKA 4MRRA 2HLPA 2WB2A 3S27A 2VPXA 1V5GA 5CHYA 1QX3A 1M6NA 1ZUHA 5FH9A 3PZRA 5CITA 3JR7A 3D5QA 5IBRA 1CB7A 3JALA 4I9UA 3CKYA 1H8ED 3MRVA 1P7PA 2V5UA 4GUAA 4IQ0A 4QYWA 1RXVA 1DC3A 4C04A 4KPGA 1ORDA 2NPFA 1DBPA 2ZJ8A 4NOLA 4KQFA 2AJBA 4MV3A 3F7MA 2F2TA 2VSOA 2QD2A 1NM5A 1XZNA 1DIAA 4ZI7A 2GYYA 4TVKA 1BGWA 5F9HA 2I80A 4NXMB 3PPXA 1W96A 4U7WA 2HMTA 3QLTA 4TOIA 1WCIB 2XE8A 1JX6A 2JIZD 4DPKA 4LF7B 1GSHA 5DXAA 1AOXA 4N5HX 1L4HA 4YP5A 4PC2A 1ODLA 3PVSA 3FHTA 4NMLA 2GBPA 1EVIA 3PTZA 4CLEA 4A8HA 2JRLA 1X74A 2BGLA 2GN2A 3BGWA 2OCKA 4RQTA 1UMKA 2P7IA 4Y7DA 5CX1A 4PQRA 5JJLA 1W73A 4FK8A 2F1IA 4AMUA 2O5RA 2BELA 2G1AA 2GX6A 1T26A 2PGIA 4ZYVA 4X1KA 4D9NA 1V7PC 3BIWA 4ND8B 1YFKA 4CIAA 1EWKA 4RTSA 1V0JA 4OHFA 2DTEA 1Z7GA 2BDUA 1NASA 2HDWA 1TKAA 2PZMA 2VXBA 3NVDA 1EFAA 5DOVA 4ZJYA 1V8PA 4AYXA 1BFUA 1JQDA 4NJEB 4BS9A 2VDRB 5J47A 3TYXA 4FGUA 1FW6A 4Y1FA 1UDXA 5JFTA 1YJ5A 1O96B 5KYUB 3ZZTA 3C6MA 7AT1A 5HKBA 3CV3A 2C9YA 3I12A 2MSLA 2QZPA 3OMWA 5AKEA 4B84A 4AY6A 4PGHA 1C0EA 2YRFA 2XUPA 3O2SB 4OQQA 5LDGA 4B9AA 3N6RA 4EI7A 4O4LF 1XAGA 1NRIA 5DGIA 4D98A 1FFAA 1GUZA 5T3UA 4BEWA 5LN1A 3KPVA 3OECA 1CE8B 4F11A 1KC1A 3FFBA 2G63A 2ZJ0A 2VUSA 4O1MA 5BWCA 1GCOA 3ETJA 3FCUB 4GPTA 4IHAA 3HSSA 1IQPA 3TCNA 4COOA 1DCFA 1UFQA 3K6SB 4C4PA 4BLRA 4WLNA 4EI2A 4LWZA 3ZJ5A 4GLLA 1K98A 2CLLB 3O8OB 3NU1A 5HE9A 4EVIA 5BN5B 1BS9A 3NHPA 1A2KC 1YKGA 3D8UA 3DCIA 3GRFA 1CZLA 4V0LA 5B55A 1U8FO 3GLIE 1WM1A 1X70A 2SICE 1E20A 2HWXA 1CUBA 3I0MA 4XWGA 2ZR8A 2WHEA 3NX4A 4GFDA 4MS4B 4MP3A 1S7CA 2X19A 4A73A 1XR3A 1F14A 2O2IA 4JZYA 3UJ8A 1BMTA 1D4ZA 2GJSA 2ZIGA 5KI6A 4F93B 2X40A 2DPYA 2FHSA 3BIFA 3OU7A 5KC8A 4ATNA 1RTTA 1SKAA 4QO7A 4OYLA 1RSZA 4M88A 5A0TA 1IXZA 2EATA 3E5NA 4GWGA 4HTFA 4JFAA 4CUJA 1PEYA 3LCCA 4CJXA 1O1YA 1WZIA 1DHTA 5CPFA 4BECA 2GN1A 5LJLA 2XYQA 4EGQA 5JH7B 3WJ7A 3UAOA 2X2PA 2F8TA 1N6IA 1BTOA 3WGIA 2QA5A 1EYZA 4J1QA 4OSEA 3E81A 4PAQA 5J63A 1JT9A 4JOSA 4TXLA 2B21A 3JRXA 3WOVA 4BB6A 5L3SB 2CF6A 2EJWA 5T7BA 1NN1A 2FKAA 1TLTA 4RGQA 2ACKA 4OYHA 4DDTA 1E92A 1Z5OA 3OOSA 2ZSUA 4NECA 3DXYA 1IOZA 2RHWA 3VAZA 1DNPA 4MGKR 3ZHCA 3W7VA 1KEKA 5HW0A 3VYWA 4A26A 3O26A 4LMAA 3NYQA 3GK3A 2G80A 1GNRA 2N0SA 5K2MA 2XT9A 2PVPA 3RRFA 4BLTA 4D9KA 3DEFA 3PLRA 4NE9A 5MN4A 3EVGA 2R62A 1ONNA 1EE1A 1QS0A 3MBKA 4ZARA 1O03A 1ISPA 1KARA 1U6KA 3EJ6A 2JJ2A 1Z0ZA 3IJEB 3LUCA 1UXHA 3LZCA 1AQLA 4G1UC 4YY3B 1ISHA 4LRXA 4LFBB 1EWRA 2BF4A 2DUJA 1TD9A 1XMVA 3DSRA 2LR0A 3F49S 3H5WA 4I36A 4ITUA 3VYTB 4NWIA 4CCSA 1VPDA 2ATXA 2FG5A 4AZSA 2D1FA 4XUGB 1YS9A 3TH5A 2I4RA 2XYVA 3HCAA 2DVMA 2J33A 3TZQA 4P58A 2HW8A 4ER6A 3HYRA 3DW1X 3N59A 1WW2A 1A8QA 4H59A 1LH0A 1TT5A 2AUNA 2YWGA 1HA3A 2VBFA 1KY3A 3AR5A 4LCJA 1HG0A 3AONB 1U04A 3NS7A 4J0JA 3HJCA 5PNTA 4DXHA 2ZCUA 4KR9A 1OB5A 1PLJA 3IEIA 3TQOA 3QHAA 2C4HA 3E15A 2QAGA 4Q4HA 5FADA 2Q7DA 3SP1A 4RULA 2O8NA 1H1DA 3ES9A 5BSEA 1TAQA 1V9LA 2Z4SA 1I6WA 3AGQA 3KAJA 3PQEA 3DFZA 4UPDA 4G67A 4D97A 3UMBA 4YRKA 5IJ9A 5KKAA 3R6GA 1JIUA 3CW8X 5IDXA 3K9HA 1C30A 2PKWA 4P33A 3GJTA 2XIJA 4WBXC 4ARZA 3RVOA 4IMIB 2GD2A 5FPHA 4LECA 4HDKA 2PGAA 1NF2A 1ULZA 2YXEA 2P8SA 2HU2A 2QLLA 2PKRA 3CSSA 4QJ4A 4OB8A 2HA7A 2X8JA 5FO1A 3ITDA 3RD5A 2O0JA 3UW3A 5LMZA 3BWBA 5U4XA 3RG2A 1NBMD 2IYOA 3TSZA 1MFPA 4N0QA 3E3MA 5EMHA 4E0BA 3GUHA 2QTBA 2AOWA 4J7UA 4GMXA 3I2GA 3GZNB 4GRAA 4YUVA 1NXSA 1ZMXA 3QOXA 3VH2A 3B6KA 3C3YA 3I8XA 4WBNB 4NFYA 4ENRA 5I9MA 1UDRA 1MO5A 5J5VA 4DLNA 2CLIB 2FJPA 5LXTB 1WDLA 2F43B 4MYSA 3IX7A 3ORYA 1HY3A 1Z5WA 5HFJA 3FVQA 4LV8B 3MD9A 3PI6A 4NZ9A 5AJHA 3PFBA 1H8EA 2APJA 4EFNA 3AHDA 2XWBF 2GPWA 4DR5B 4BFVA 1RXEA 4Y6GB 1IHOA 3EH2A 3VDNB 2YOHA 4KK3A 4LDJA 2J4DA 2VP4A 1WUTA 5IJAA 1M5RA 2QAGC 2F9MA 1JDTA 1CUZA 4G26A 4D3ZA 4CV1A 3EWSA 4NR0A 4B75A 3N86A 2SKCA 5IT4A 3ZDYB 3EPLA 3INRA 4HQKA 4AY4A 1ZGAA 4QYMA 2PXXA 4NENB 3IEMA 1XRSB 3RSLA 3RVBA 4D99A 2GN6A 2H65A 1KDOA 3WGNA 3ZJVA 3VNAA 3H6HA 3HMKA 1GR1A 2HJSA 4M1SA 2A9KA 1G1MA 1NATA 1KK0A 3L8YA 1OJLA 2HLDA 3M8KA 3KCNA 4L6IA 1UXIA 3BD9A 4IQ4A 4FSHA 4BGVA 1FFGA 1IQRA 1XQVA 1ZM9A 3KAKA 4HDMB 5EHXA 1YRLA 2MR6A 2ZRFA 4F6CA 5ALYA 3SHOA 1TLLA 4KQ6A 2OCDA 3LGAA 4M54A 3C1UA 3SKYA 4RTKA 4OOEA 3QU9A 4QBIA 1TL7C 3ZCSA 5CLFA 1RP7A 1YVRA 4HWTA 2ZJ3A 1G5PA 2P8JA 3QLVC 1DAFA 2Q4RA 4K87A 4PF1A 4RTMA 2F4VB 1Q3HA 1Z56C 1DCTA 4DUGA 1TU0A 1KU6A 4ZU6X 4D44A 4YRIA 2Z2ZA 3X0DA 4W9RA 2NVWA 1N6KA 1KI1A 3LPLA 1U3WA 1H66A 1DKLA 3PVCA 3QGMA 4Y0AA 5JPIA 4MUJA 2IHTA 4WACA 1QKJA 2H0AA 2FRVA 3L7LA 1OY1A 2AJLI 2DFKB 4C0JA 5C7OO 3B1FA 5ER9A 4MULA 3T15A 3RUCA 3I5XA 1OFHA 2J7PA 3GPCA 1F9AA 3FB4A 3PEVA 4LS3A 1DDOA 2IC5A 4FLMA 1T5BA 1PYOA 3M34A 5AW6A 1S4QA 3DYBA 2FEKA 2FZGA 4FGKA 4QXAA 5CB4B 4CKZA 2WWGA 3S28A 4A8TA 3W0LB 3HFJA 4Y2PA 1TCUA 4ISCA 2WU0A 5EQTA 1DUIA 3FVWA 4OQFA 3KKEA 3GDWA 2IYNA 1M34B 5DGTA 4CG0A 3G5UA 3HDTA 4XPIB 3FPHA 3F9CA 2FK8A 2ZTMA 3UAGA 4GNKA 4BO0A 1YFLA 5KOHA 3NHRA 4MLCA 3SLRA 2BZ0A 1BH6A 2FX3A 1YOVB 2PAFA 3AFMA 4OHRA 4TV9F 2AI2A 5CX4A 1XNRB 4IGIA 2WYVA 1M33A 1C4OA 1X1TA 1VCIA 3GJ7A 1KJJA 1N0IA 4PZZA 2GD0A 2W7TA 1TD1A 3FOWA 4EMSA 2XECA 1W19A 4YMLA 5I45A 5DTQA 2M9MA 3DAPA 2IXDA 3BMOB 1XF1A 4CYMA 3MJRA 1SC3A 1E2DA 4NMHA 2R8RA 3ILHA 1L1RA 3K1AA 4D96A 4QKQA 4P36A 1GOTA 2QAGB 2C2XA 4A1FA 2OP1A 4EFDA 3DE3X 4UBLA 1G7RA 1HDOA 1SXIA 1PSWA 3EVEA 4QHSA 5E7QA 4OJQA 3AUFA 1U94A 1LV8A 4DC9A 1UKAA 3OP1A 3WA6A 4JBLA 4L0DA 3WKEA 4HYYA 4XUCA 4QDOA 2RFLA 4OQMA 3HUUA 1HQCA 4ARZB 1OXKB 3UHJA 5MHTA 3AZOA 1Y3BE 2YJ6A 1NLFA 1EGAA 3PUKA 4MQ4A 2NU8A 4DQUA 2FSSA 3ENWA 3IXQA 4RAOA 4ZVKA 4QL3A 4QTTB 2H5IA 1C9MA 3IQHX 4KN8A 3PHJA 2YYYA 4M89A 1IK4A 4CKWA 1OX6A 1RWWA 1P3Y1 1U5BA 2YV5A 2OGWA 4HXFB 3KJXA 5I9TA 3AQIA 3EOZA 2R0QC 2OGSA 4GM1A 3JSAA 1ULUA 3A3OA 4Q4AB 5JQGF 1YC2A 3HK2A 1G42A 4DBLE 3L5KA 4QARA 3GEHA 1LEHA 2O7QA 1MIOA 1TA4A 3C85A 1U4NA 3ODPA 3OEHD 4GOKA 4K9SA 3OM8A 4BLOA 3B1WA 1WOYA 4LDZA 5C2JB 1CUUA 1TUEA 3UM9A 4PBTA 4CCYA 4BNIA 2WMDA 1U9CA 4I1UA 5EKDA 5LZ9A 2XXBA 3TW4A 3DC7A 1J5EB 2VUTA 1UXJA 2VJQA 4ILKA 4BN4A 1ZVQA 4CTMA 5FTWA 4E2FA 2GCNA 4UAUA 1H5UA 2VWQA 5JXWA 3LQ1A 5K4GA 3FH0A 3UJAA 2VNKA 2D54A 2FGKA 2UU9B 1SCNE 1N2XA 3KSMA 2PY6A 2JCSA 1M1ZA 1N5OX 3DHNA 3EXIA 2HH9A 1RNLA 4J8PA 1OIXA 1SXPA 5CHEA 3M1LA 4KAAA 4X6YA 2A1UA 3ZQ4A 1JEOA 4B3JA 1ZRMA 4MWZA 3PBKA 4WUVA 4DY6A 4QUIA 2UZ1B 5FKJA 1ZY2A 4OUDA 2Z8ZA 1VG0B 4H15A 1XQYA 1YL5A 3AKDA 4L72A 5LZ7A 3OFJA 2DQZA 3KZCA 1N2SA 2CMFA 2G3YA 1WPXA 1B0PA 3QELB 1M2WA 4G5QA 4QNRA 3QXXA 2VDNB 1YTUA 1EGVB 1Y5RA 4MAMA 5C80A 5KQGA 1QRDA 3I9JA 4D1YA 2BJWA 4BRZA 2FGJA 4DA6A 3CURA 1MCZA 1FUEA 3FKSA 1BN6A 4IVQA 3TRHA 5LP6F 4NYJQ 1UKZA 4EJMA 1BMFA 4KQKA 1N5KA 4A5OA 3H13A 1NXPA 3BDVA 1U0TA 3VA7A 4Z9YA 5SYMA 2C4MA 3QEBZ 1Z7WA 1KDTA 1I51A 1AGYA 3HEAA 4AIRA 4DARA 6LDHA 2DFPA 2ECOA 3RSSA 5FWNA 5BO5A 3NHUA 2X0EA 3NGXA 4GMKA 1RPAA 2PRSA 1GD1O 2G5GX 3OQVA 4X71A 3PE4A 3H1PA 5JYDA 1P72A 2I3AA 4JH0A 2YFHA 5BYAA 4FCWA 1C7JA 1IBCA 1RD4A 2BCEA 3EDCA 1PT9A 2FZVA 2VYFA 4RWZA 1RQLA 2XUIA 1DJLA 1V6AA 1V7QA 3K6KA 4AS1A 4F21A 1UXGA 2B78A 1H4TA 3PQCA 1YS4A 5K3EA 3TBKA 1TTHA 2FF5A 3TIGA 2C7RA 1A76A 1IN6A 4Q7MB 1BYIA 1Q6ZA 1YASA 3H5NA 3QVSA 5E7MA 1R9GA 1Z73A 2E2WA 2GWHA 2J0EA 3PIDA 4HAXA 1W8DA 2IPOA 4ZIRB 1GTMA 1QHIA 4Q3DA 1OBCA 3V4SA 3VPFA 2Y2UA 1T1IA 4WQMA 2XMZA 4XI9A 5DULA 4MRAA 2J0VA 3HFGA 3UJ9A 5BN1A 1MH1A 2I4LA 4EK9A 4R98A 1BXZA 4JIMA 3QG1A 5IEJA 4B6PA 5DGXA 3T9BA 2B36A 3RV3A 2ZRLA 4CKWB 5A0VA 1SO8A 4C2UA 3ITKA 2HSJA 4RBNA 5KYUA 4L22A 3A3NA 1OFVA 4L1KA 3IP7A 3JZFA 1CHNA 2VSXA 3OA2A 4WASA 3VPCA 2IL1A 3GRYA 4PNPA 1L2TA 3A1WA 4NG4A 1ES9A 3RIHA 3QE4A 3E0XA 4BBPA 2JLRA 1T8WA 3OVMA 4I4CA 3KJZA 4TMYA 2EKLA 2CUZA 3MINB 3ORFA 1NBHA 2QG9A 2XRYA 4DV6B 1GRCA 1J1IA 1KJWA 4XYMA 3H4MA 5I48A 3TZCA 3QPAA 2JD2A 3VHLB 2O2YA 3PHHA 3O2QB 2QZSA 2FMXA 1BFKA 5C34B 3JCZA 1AKTA 2G7MC 2Q9CA 1KYTA 4TMXA 3IPXA 4DANA 4MGIR 4C0KA 4EA9A 4LF5B 3TMYA 1KBOA 2VHJA 4FE4A 4RZQA 3I6BA 1AUOA 3GIWA 4BRWA 3B6IA 4OVKA 4AWXA 5G0SA 3FHCB 2CFIA 3NDIA 5FA6A 1UJ5A 1VJGA 4BN0A 1P9WA 3UMMA 3I92A 3PFKA 4OXYA 3BX1A 4L8GA 4DLWA 3NRBA 3DDNA 3EGCA 3Q15C 1GTRA 2HX1A 2GOYA 2IYVA 5JBQA 1DFHA 5HM8A 3FE2A 3D3JA 4KQ9A 3TFWA 2AE1A 2YCBA 4A6EA 1S1MA 3RUDA 1OCEA 2N46A 1TC2A 4HDRA 4ID9A 1POWA 1C7QA 3IOMA 3OFSA 1B15A 2IITA 3GELA 2AJ8A 3P9SA 3OMXA 1E4OA 4GW3A 3U9LA 1IY9A 1CVRA 1NW5A 4D8YA 4AY3A 3O6VA 2IDZA 3G02A 2BBTA 3HXQA 4CIXA 3IV6A 4KLZA 3DPIA 2AQIA 2XGSA 3BD6A 3U39A 3T7IA 1STOA 4OMUA 2QQFA 5HS6A 2WR8A 3QU7A 5EXEA 3TM5A 3HN7A 3AIIA 4FW8A 5GOTA 2BZ1A 1KAOA 3FMOB 4ZCRA 1KYVA 1KE2A 1LPBB 4HRYA 3L0OA 5HJ2A 3GGDA 3CNHA 3NCTA 3LBFA 4P4LA 2YOGA 4UUPA 1E6CA 4NXNB 3Q7PA 4KAFA 2ACEA 4BVLA 4GMGA 3NOVA 2UZ1A 3M6LA 2CW5A 2P67A 2BD0A 3UK1A 3D8BA 5F76A 2VT7A 4P2GA 5GTDA 4LRQA 4Y98A 4UNRA 5K4AA 1JQ3A 1D7OA 1WQ4A 3KVOA 3L41A 3KKMA 3AK4A 1G8FA 3B7GA 5LZ2A 2C92A 3RVPA 1A69A 1JSZA 5B1SA 2OC4A 2V7XA 1ZOSA 3S1AB 1MP0A 3DZJA 3UCXA 5A62A 2YHUA 2JBAB 2BJHA 1HEYA 4AYWA 5HKLA 2FWIA 3SXUA 1PT7A 2GXSA 2PUWA 2VNHA 4WCFB 1SG6A 2B20A 3NG1A 3VVMA 4FZ5A 3IAS6 3RGWS 3T7DA 4MMZB 1OF1A 4UKDA 4UAJA 1AKVA 1K92A 3HNPA 1CY7A 3L1UA 3CEPB 4KXMA 2IZ7A 2GCGA 1ZJWA 1OXUA 2QRJA 3LBHA 2ZR0A 4NENA 4R5MA 4DBZA 3KS9A 3WB1A 2KMLA 2ZBPA 3EMKA 1PJ4A 2L0XA 3FTFA 3ZWMA 1Q3TA 3D6TB 4FTWA 4TRMA 2GF0A 4M37A 1YVPA 1CRWG 2M1XA 1GA4A 2NGRA 3ESAA 5EJ5A 3NMUF 2IZZA 1TRHA 2OG1A 3QWFA 2I6TA 1MO3A 3BGVA 1NT2A 3N2GA 2BTEA 4RD1A 2G06A 1HT2E 2WFLA 1CKEA 3W2TA 3P4XA 1W4BA 2ZSHA 5F52A 1GGVA 2FWNA 5B3JC 2JGEA 1HT3A 2FETA 2IXAA 1GQRA 2XMGA 1J2YA 4JXXA 3VZRA 1Z45A 4RHTA 4LQDA 3ZV7A 4NBVA 1ECFA 3BRQA 2AC7A 1QH1B 4BWGA 2HN9A 1Z4MA 3S0JA 1HRKA 1E1CA 5TPWB 4X95A 1W1IA 1N1EA 2GRJA 2J3KA 3UGJA 1EESA 4AZ3B 5GINE 1EZZA 1D2GA 1GZ5A 4KIGA 1KMMA 3QE2A 4I9HA 4PFSA 2VJMA 1GXSA 4PYKA 4JHLA 4DNFA 1ISRA 4ENWA 3KQOA 3R2JA 3A2LA 3OQJA 4W1QA 2BGJA 5JAOA 2D7CA 2WA2A 1YJCA 5F7XA 2I4TA 4S0XA 5SY6A 5SY9A 5KQLA 1ZR2A 4PAGA 2P9GA 3EDQA 3OJXA 3O4IA 2DAPA 4LKRA 4GGMX 2IPAB 4ETMA 2GPBA 2I7VA 2ZRDA 4JXKA 4KAJA 3DMYA 4M7WA 3QEJA 4P6VF 1J1ZA 1F48A 2Q5JA 3GP3A 5GONF 3WL7A 5B1IA 4YV1A 2G5CA 3DNMA 2WU3A 3OLCX 2A86A 4DNOA 4JCCA 3DBIA 1O87A 3INTA 1ZRNA 4JJZA 3WK6A 2FAXA 2PT9A 3HG7A 3P0IA 3U7FB 2FUCA 2LKCA 1P17A 3GAFA 4YP7A 2JZCA 1VIAA 4QQKA 5JZ9A 2XUZA 1UKYA 3FBGA 4OHYA 2DY0A 5B6PA 3F73A 4YJ2B 1NVBA 1LX7A 1SD5A 1IATA 2ZB2A 1AD2A 5ICMA 3CZ5A 4FCCA 1HYEA 1RDFA 2BZSA 2GBCA 1WD5A 1YGYA 2J45A 4FXOA 2YDXA 2F64A 4HQRA 2JFFA 3UKJA 4G63A 1T5LA 4J4HA 2F00A 3L6RA 1PGJA 2JCGA 4H9GA 1VBFA 4I66A 2P4SA 3LPCA 3P9NA 4RE6A 2VHXA 5JMWA 3A6HA 3II6X 2B92A 3EQ2A 3WQRA 2DLNA 1W2GA 2GM9A 2PH3A 1JAXA 4PO8A 4IKEA 4WK6A 4CL3A 5HYVA 3BH0A 3A4TA 4IDNA 3MT9A 1VJ5A 4ALJA 2X3YA 1RXCA 3R20A 4O2RA 1MOZA 5JZVA 2OZEA 5FP0A 2CD7A 1W5TA 2D8AA 2IXFA 3AB7A 1OLUB 3VYRB 4W5NA 1AC5A 2IY8A 3L05A 2OB1A 4FSXA 4Q7LA 5HG0A 5K45A 4QWWA 3LX8A 1FNMA 2FMHA 1GEEA 1Q5PA 5FTLA 1U7PA 3H16A 3VJKA 2W2PA 4BFXA 4NI5A 1F2VA 2JFYA 2I0FA 1OGJA 5CLQA 3TLMA 4XFJA 1R3DA 3W4JA 3ZDFA 4CMIB 1KVSA 3FDXA 1CIVA 1U8XX 1CY6A 3RF6A 2QI9C 1DTWB 3HJAA 2JGAA 4LQLA 3BXPA 4XYLA 3H2JA 4IIVA 1U1IA 2HPVA 2XQKA 3UANA 1XTKA 2VP6A 4ZCMA 4LVNA 4IS3A 4MITA 4EHLA 1BW9A 5A5FA 2XQVA 4AJNA 4COKA 3M6MD 4UCWA 1T24A 3D2CA 4D26A 5K8TA 1A7KA 4AW9A 1RAIA 4OV6B 1YRQA 3BWVA 3HM2A 1I9CA 2DKNA 3ROMA 3I6QA 3T54A 4BV9A 3BCSA 4JC8A 3LVFO 4E3ZA 1CUGA 1F8YA 2I2WA 3ZXSA 3LT5A 3ZWAA 1GG5A 2PQ2A 5ALSA 1GRRA 1P39A 2XF2A 4E6PA 2G04A 4B31A 3OO1A 1NRWA 3C8MA 3B9RA 3CXRA 3S2IA 4AM8A 2FV8A 1RS0A 1HLFA 1HQDA 3I6ZA 4ZJPA 4X45A 4F86A 3V4FA 3L40A 1EJBA 4KIFA 1VSQA 3N0TA 4KZKA 2NU7A 3N39C 3ANXA 4O8ZA 1CP2A 4RZXA 4TWRA 3W5CA 5ABPA 2FDRA 3N2YA 4PCUA 3K71B 2W6OA 1H2YA 2OFOA 3H19A 4MRMA 4OBWA 4RZHA 2JLSA 4GVXA 4RMGA 3QXHA 4DSNA 1K75A 2NAPA 3OPYA 3BFJA 4U2DA 1KZ4A 5IC5A 3RUPA 1EP9A 1KJZA 3HCDA 5EJMA 4EKNB 2XB6A 3ZJUA 2YYAA 3UMVA 1U3VA 1MXHA 1SQGA 5K6RA 3KHUA 3UA3A 2ICAA 2A2ZA 4L5YA 2QPTA 5KAMA 1NW7A 2DFLA 1KEUA 3HGMA 3Q7IA 2QN9A 1JG3A 4LYGA 5GONB 1O95C 1XCMA 2NO1A 3K05A 1ZL2A 1AJEA 3OC6A 3TS1A 1V8DA 2KQUA 3VMMA 2NIPA 4GDMA 5TQJA 3W6PA 1XFAA 1T2CA 2NO9A 2AOUB 1DMSA 4KHZA 3L02A 5EJ8A 2FPUA 1AN9A 1JALA 3CLRD 4UM9B 4X1IA 4ZYTA 3AJ9A 1DQSA 1SXJE 2XTZA 4GYYA 1P1KA 2PO5A 3VUFA 1KWGA 4EM6A 1UIMA 1K4KA 1M2OA 1XZLA 1PVVA 1C3VA 1OFUX 5CBPA 2X9NA 4NZMA 2ZUDA 4PO3X 3SNHA 4C0LA 4EUNA 5L51A 4ZQCB 2JLYA 4RCZA 2O8FB 4FFBB 3H17A 4CU5A 3WZMA 4PU0A 4IVPA 1BWRA 3WI7A 2B25A 3PUWA 4B2YA 3MAGA 4DE5A 1RT9A 2J9XB 3H2SA 5EWLB 1VE7A 3L6BA 2P30A 3ZIAA 3ICOA 2IOFK 3JV7A 3U3JA 3F1LA 4BV3A 3BE6A 2W6IA 4R16A 3CGGA 3WR5A 4EKGA 4OSOA 1NLYA 4M1TA 2CXSA 3NBQA 4H4CA 1R88A 1D2MA 2EJUA 4LNHA 1WETA 3PE3A 4AKEA 4KOAA 4KK4A 1VHLA 2IV3A 1BDIA 2O0LA 2VF5X 4QWMA 4JBYA 4L74A 3R5JA 1GSOA 4B45A 1JHUA 2BGMA 2BGUA 1SD1A 1QDEA 2FPSA 4MV6A 3ZJ4A 4BXOA 3MIZA 5EE1A 4S1VA 1YS6A 1FTWA 3QEKA 5IAJA 4JWKA 3S1AA 3UTCA 3TAUA 3UZUA 1QF9A 1ZH8A 1L7NA 1V1JA 4PYOA 4BLUA 3T1HB 1AE1A 1VE6A 1W87A 2XZPA 3KB1A 1TJYA 4YUAA 3E23A 1KAGA 2YRWA 3H6KA 4B80A 2PUHA 2CJYA 5H70A 7REQA 5HSGA 2ZSBA 4L73A 4X65B 1U1CA 2YWRA 1EK0A 1TMYA 3MT8A 1J22A 5KVAA 1QIEA 3IMFA 5CFNA 4FYVA 3ZHTA 3I42A 3CINA 4IIEA 3TLEA 1ZJ4A 2OV1A 5J1TB 3I39X 3LL4A 1R15A 4N3BA 1J8YF 4OH7A 3TLBA 2IOYA 5TF4A 5JWHA 1OKKD 1KZGB 3PWSA 6REQB 5C51B 1W88A 3BL6A 2BISA 5EZSA 3OIWA 5I6DA 2CLMB 1DAOA 5JISA 4B8YA 4B44A 2W6JD 4JEIA 3VR2A 1AO0A 5AM4A 4QT4A 4CCWA 3G9TA 1VHJA 3OKFA 1B42A 4GXRA 5KMGA 4TMTA 5M04A 3OF2A 1AGRA 4MYRA 2PZ8A 3NDBB 1ZRHA 3DKIA 5DRYA 1VJDA 4R0VA 3PJDA 1N4AA 3U0BA 4DCTA 2GRAA 1A97A 3IPAA 4RHEA 1D3AA 3DKKA 2OKGA 3WBFA 4CTKA 2R79A 5JXIA 1V48A 4B87A 2BI8A 3DCJA 1X7HA 1YBVA 2PS9A 2VJNA 1XK7A 2YN2A 3JARA 4YCCA 1EFPB 2CHUA 1WX1A 2VP3A 2L69A 1BEZA 3D7SA 1JU9A 1VOTA 2Q9UA 3VR5D 3CVOA 3OIDA 1IK6A 1ZISA 5CJJA 4YIKA 3ET4A 4JSYA 3IAM6 2X7XA 5KYGA 1WS6A 2FSGA 1U2GC 4L27A 1JS1X 3AEKA 1JDPA 4IO1A 5FLKA 4PR3A 2P9FA 1RC1A 3EZLA 4EHDA 1AHHA 4G8CA 1EE9A 6Q21A 3AEUB 3ENVA 3IHLA 4AS3A 4Z5XA 3EPKA 3IB3A 2CCGA 3NXKA 4C14A 2WJWA 3LLUA 3RVKA 3GN1A 3HHEA 4IEIA 1FIUA 4QQ8A 4ZXFA 2CLFB 4K9PA 5JCOC 5F12A 4A0HA 1LC0A 4PNHA 2H2GA 5FWDA 1UPBA 3TRIA 2SKDA 5L9AA 1JQEA 1SC9A 3R3VA 3FRIA 5JWRA 1JV2B 2Z56A 4MLDA 4MI6A 5FHRA 2EZUA 4FGSA 3RFUA 1U2DC 2ZZNA 1OFTA 3DBLB 4P0TA 4PZ0A 1KQNA 4EOGA 4ZQFA 1OIWA 5LKAA 2BFPA 3RE1A 3GEDA 3RVRA 3HH8A 2PGLA 3ICVA 4PZCA 2C3PA 2FWRA 2O3UA 5H68A 4JP3A 4RLSA 1TQ4A 5BQFA 1VC2A 2G1JA 1W0JD 3CJQA 1ZOPA 5HGJA 5DX0A 4WNAA 1QP0A 3N8KA 2P2YA 3FBWA 2Q62A 1PR3A 4YV2A 2EZTA 5DTEA 2RAPA 5K0SA 1XA0A 1G5FA 4MZXA 1P2GA 4QOHA 3RDPA 3RRMA 3T41A 4BQQA 2NV2B 1H4QA 2YMPA 3DD1A 1OH7A 3IO5A 1NKSA 1SKQA 3OPYB 1OLSA 4Q3EA 2Q8PA 3ZDZB 4JJ4A 1UMBA 4MUKA 3ABSB 3K1AB 3QF7A 4XX0B 3ZCVA 4G5YA 2X5OA 4FFWA 3V7NA 1SKYB 4JUIA 3B70A 4GX2A 4UPVA 4N5LA 1IM2A 3WWOA 4X91A 5KQRA 2QUAA 1EDZA 5K3FB 5EJ7A 3G7SA 1M66A 2R47A 1KPGA 1KQOA 2EBWA 4RD6A 1JXMA 2D4AA 3RBZA 3RKRA 3TZHA 3FOAA 1R64A 5L3ZA 3VU9A 1EFRA 2IOHA 1V5IA 4XWKA 1YJBA 2LVBA 4M36A 1CTQA 1WP9A 3B8EA 3PK0A 1WL8A 2W83A 3DLIA 3QE9Y 5AK4A 2C84A 3DYVA 1NQWA 2NVBA 3L49A 4OJMX 1Y4AE 2ID7A 4LTDA 4V0KA 4WDQA 2V6BA 3TLCA 3EQ6A 3H83A 4RS3A 4YFYA 5FCDA 1NVGA 4A9AA 1V9CA 4PYJA 3VKHA 1M2JA 1TGYA 2I3ZA 3K0CC 3IULA 1ECLA 4HAWA 1ZICA 4WSOA 4LXXA 3DZGA 4C5CA 1A72A 4ZVQA 5IW8A 1ZGHA 2H3EA 2OAGA 3IRUA 3QKIA 1AQNA 3HSKA 3C3KA 3EISA 4FFRA 4X54A 1WDTA 5H81A 1O6FA 4KQWA 2X2OA 4BNHA 2XUHA 3HL0A 4R3UC 2TMKA 4DQDA 3KPYA 2QF7A 3KUUA 5B4TA 3AL2A 1OGYA 3CZ4A 4HQFA 1Z33A 1KI6B 1YI1A 2OBNA 3IP8A 1TVKA 3W77A 4AZ0B 4QAJA 1ID8A 4Y2TA 1EFHA 3MCUA 3KDAA 1FLVA 5FV7A 4OYRA 5K3AA 3M3DA 3V3KA 5M5BA 2ZPUA 1C5KA 1RWKA 3FMGA 4BQRA 4HB0A 3DBRA 3SJUA 1YZLA 3CF2A 4C6SA 4KQXA 1D0SA 3CPJB 3N53A 1EQAA 4IV5A 4L9WA 4XEHA 5AKKA 2P40A 3PS9A 1R8SA 3OLVA 1G8YA 5KPJA 2I7TA 3KR0A 1EA5A 3AY3A 3AR9A 1UBHS 4KGZA 2BLNA 2VATA 4OI2A 2G9UA 2YJNA 1JAHA 5JVDA 2FG6C 1SCUB 4FFLA 2H4YA 1IRXA 3H86A 2QBYA 3MWEB 3OEWA 3T1VA 2JCYA 1LS6A 1V95A 4V0RA 3CZAA 1P1CA 3OU6A 4JVLA 3A6PC 3AVOA 2QPOA 3GUUA 2UAGA 4WOJA 5G1OA 3IT0A 1KYZA 2VDQB 3OZBA 3RODA 1FMFA 1JAYA 3KTFA 5AK3A 5IULC 3G3EA 2ETVA 3LHDA 1TTTA 2ECPA 4D5GA 3EEQA 1HDZA 3W5IA 5HJEA 2B37A 4U7PB 4KB5A 1WKVA 2WWYA 3ZHXA 1OBVA 2VA9A 2ZJFA 3DM9B 3G0CA 4FW9A 3D1VA 5A06A 5IH7A 4LOKA 1VHDA 5B1HA 2BHTA 1MEOA 1UJ4A 4C29A 4D4HA 3RYTC 4QGHA 2V7EA 3O9VA 3E61A 3LTNC 1RI1A 2HLHA 4JUFA 1E66A 4NBWA 5KCZA 5T41A 3ROQA 1E8NA 1EUCA 2DFVA 5ADUS 1IMOA 5JCXA 1GITA 4MYTA 1ZSNA 1GPUA 2EKQA 1GPBA 3GH3A 4AJ2A 4E21A 2I9KA 1YXMA 1J0DA 1NYTA 4RV5A 4RJIA 5EE5B 1TVMA 4JBIA 1XZIA 5AKYA 4QRHA 2OLEA 3W7BA 1X1AA 3QNWA 3R5HA 4U6QA 3A26A 3ZE2B 1ADYA 3QPCA 2MWMA 1OQAA 2Z95A 4NK4A 2BUBA 4QREA 5JZOA 4N6OA 2IYFA 4MV8A 5FXMA 4WCDA 3RR2A 5HOEA 4C07A 3NIBA 1FP2A 1KFJB 2XAAA 4PLPA 2VP9A 4O4HA 1UJBA 1GPJA 5TMDA 3ADCA 4EHNA 3RT7A 1WBDA 3V1NA 1GL6A 3BN3A 3P1JA 1EJ6A 5JSZB 2DP4E 1RXYA 4ND5A 1D6JA 1JAZA 4FDAA 3C5WP 4DT1A 3SSOA 5C31A 1M34A 3BE5A 3HCWA 3LSTA 4P0PB 3SAJA 5TT1A 4IIGA 1UBRS 3CLTC 1FYDA 2NZ2A 1WCIA 2YHAA 1Z0IA 2AR0A 1BCSB 3UATA 1V5FA 2BYTA 4I9NA 1BWPA 4I99A 1PSDA 2DT8A 5IUNC 1II9A 3GAAA 2AHOA 4OLJA 4CKCB 1IWBB 2J0QA 1KNXA 5L53A 5SICE 4C78A 5EOVA 1F6WA 3M3HA 3AR2A 3WGJA 3WZ2A 2ZKLA 4TVBA 3W6OA 2JH3A 2AV6A 2F3QA 3ED1A 3RS7A 2ZUVA 2H5LA 1DCKA 3HJHA 4HRVA 4OMFG 1GPDG 2XXAB 1EFLA 2PZEA 4EB0A 5HR5A 1YNOA 1J8QA 3MB8A 3TSOA 2AVNA 5LFAA 1M1YB 4KP7A 4HEQA 5MDHA 4IJ6A 1A2OA 3TM4A 3KEFA 2IH4A 3U13A 2GUWA 1XEWY 5LUAA 1GPH1 1IZ7A 1M7GA 5J2UF 1NBME 2PS3A 3T7RA 5K8UA 2B5WA 4IIUA 4PN3A 5A4JA 2YXPX 2GK7A 3DDWA 1GGHA 3I5UA 1QLJA 2O05A 3UB3A 1ZMRA 3VNVA 3DTTA 4M0MA 2GCOB 1KZ9A 1W75A 1QB8A 1U3FA 5ICFA 4F3NA 1H2HA 1RWMA 1U0NA 2WB4A 3K8YA 4MS1A 1GZ7A 4S3MA 5KTNA 3QKSA 3OE4A 3U09A 4MI9A 4PAMA 3K0KA 3U4GA 4OK6A 1MGPA 1THZA 1XQWA 2BUCA 4J7XA 1VZ3A 3AWIA 3KHSA 3KV3O 4MW6A 1Q14A 3T7SA 5AVVA 2BRUC 4PHFA 1IPEA 1QTNA 2IKSA 1A95A 4LE1A 4TZ0A 1N2CB 1XX6A 1Y8RA 2CJWA 2EX0A 3PXAA 3QOYA 3E82A 4FYKA 1XD9A 1R6AA 4OHKA 3QVJA 2YWJA 2G1UA 3PFWO 4DIOA 3FWYA 1ENYA 1YUMA 1Z39A 4WXPA 1POXA 4NYIR 5CPBA 1Q1BA 3DPUA 3BEDA 3WNVA 3QU2A 1GO2A 1V35A 2WT4A 5K0NA 3N7UA 2Y1LA 1MX5A 3O94A 5FLEX 2DQSA 2R5WA 5I9BA 3ZIUA 4Z1MD 1C9JA 1ZUIA 2QYOA 2G4CA 3GGGA 3L7JA 4OQ4A 1YT5A 5JD6A 5M7EA 5FL7D 4AB1A 1XROA 5IS2A 1Q91A 3O1JC 4OHBA 5CYPA 2QGNA 2YWDA 2ZBRA 1PJAA 5HRUA 4PICA 2D7DA 1E6LA 4EB3A 5AH0A 5KX5F 2AEJA 3CLRC 4REQA 3KOZA 2A9JA 4WXHA 1E6UA 1LLQA 5B7NA 5HJ7A 3KWFA 4F4CA 4M86A 3IQGX 2WKRA 2BGGA 4JQYA 3I37X 1OB2A 1N2CA 3OOEA 2YVUA 1QHGA 2H6EA 1Q0ZA 5IXSA 3VO8A 3WGVA 2ZM5A 3SQDA 3KU1A 1MMFB 1H6DA 4NARA 1EP3B 4QQRA 3WL6A 2IYRA 2IH5A 1QO0D 1KSJA 3FOZA 3QPBA 2P9ZA 3E0QA 4HWKA 3JXEA 5ECYA 3U4DA 2I7DA 5IJ9B 2VP2A 4DYDA 3RSFA 4OBEA 2CXXA 3QXCA 3VOSA 1G8KA 3CO0S 3EGWA 1QDLB 2IYEA 4H2DA 3QKRA 1JAIA 4WZBE 4G0VA 1X94A 2VH1A 1D1PA 2AZ4A 4WK4B 4GOND 4DMKA 3VDXA 3BB4A 4YPFA 4C0QC 2B2CA 5A71A 4ZWNA 1FNSA 1KZ7B 1VRCA 2Z3WA 5K3OA 5K8IA 4IGKA 4D45A 1YCDA 3ORRA 4PCVA 2PRZA 5DHRA 2C9BA 5KPDA 1ZL0A 3R9XA 2HLNA 2E21A 2RKBA 2X13A 1IJKA 4F2WA 3SS8A 4YTEA 1PLLA 1EXDA 1ENPA 1O8BA 3BXEA 3HO6A 3R5TA 2QIPA 1X7GA 4LYHA 5EEGA 5DI3B 3URMA 4ZDJA 5BMVA 3ZBQA 4NBSA 2Y93A 1P44A 3RSQA 1P4JA 1RHUA 4X3OA 5B53A 3ZV6A 5I8PA 1T1SA 2QUKA 3OHPA 1NZDA 2FCRA 4Q82A 1SC1A 3ZNOA 4XD2A 1IVNA 2HLDD 2O4UX 1C3EA 4BYMA 4MA5A 2AZTA 2H18A 3KPUA 3SEZA 4N01A 4ZMSA 5FPKA 3G5LA 5B6IA 1GGEA 3P2OA 4MUNA 4XX1A 2BFNA 1XXHB 4P3OA 2PUTA 3H42B 3HXTA 2ATIA 3B5IA 3ITEA 3ZWYA 2GEDA 1GTZA 1EB9A 1NGSA 3TTUA 2H4ZA 3AG6A 3TVDA 5KYTA 2VR1A 1L7OA 2BFWA 1OASA 2DCUA 1IFXA 2WHRA 4FEGA 8LDHA 1U2SA 2IGBA 4BC0A 5FWXB 3KQYA 3WB0A 1M0SA 2FPPA 2NSHA 1CR0A 2PRJA 3SC2A 1NW9B 2CVFA 3G2HA 3DLAA 4MQEB 1CRZA 1II8A 2E85A 3DE2X 3KAQA 4BFZA 3TOCA 2YICA 5I3CA 4EX6A 2FCAA 1KRWA 3BRSA 1Y5LA 3E1SA 3L93A 4LXYA 3WOHA 1GNSA 2ZYTX 3SHVA 1N6RA 1R4MA 3WYDA 5EP2A 1SQ0A 3T4XA 2G1KA 3L4SO 4OP2A 3UF0A 1MEJA 5FDFA 5NLLA 4EYEA 1MU0A 3AETA 3LT2A 3M83A 2XR1A 3N6XA 4GBJA 4Y2RA 3UT5B 3MEQA 4LDAA 3EF1A 2LTAA 4RJJA 3E5MA 1K6XA 4R7ZA 1OR8A 3ZZNA 4M9RA 4TVSA 4PXAA 1VG8A 421PA 4L8WB 1KYXA 2X8BA 3O4GA 4I5DA 1IUPA 3LG2A 5AYVA 5DSTA 1HNNA 4KBGA 1IM8A 3LRPA 3PWTA 1FXSA 4ZEWA 1Y9JA 2ZRCA 5FQNA 3WRYC 2PYDA 3USES 2ZBEA 2AK2A 2OXIA 1YQUA 4NU6A 1NQTA 1E9FA 2GUGA 1IIBA 4EG3A 3CGWA 1NAHA 3LTEA 5AKHA 1YZUA 1EAYA 1SVLA 2W8BB 4I1IA 4JOBA 5CIWA 1GILA 1T4DA 1UBSB 2H1WA 4JLSA 2GCIA 1IN7A 3OJFA 3R44A 2V6GA 3ZY5A 2BP7A 2WV7A 4NBKA 1DT5A 4R1NA 2GLXA 3MHTA 4GZLA 3JYPA 3R7WA 4ABTA 1QCYA 4N9QA 4I55A 3ABQB 3JVDA 4FT4A 1LFAA 3W79A 1G5TA 2A88A 2C2KA 3R24A 4ILEA 3EZ6A 4TQGA 1J0BA 1R4AA 3KR1A 2GPSA 5CCEA 3ORSA 3IB6A 5TF0A 3ILXA 5ARCA 4C1BA 1L1QA 1QNFA 4D46A 2DERA 1ZGCA 2FW0A 2Z1DA 3PNMA 1Z6AA 1JI3A 1RJWA 5EG5A 2OHIA 4L5BA 1RAHA 2C42A 1R0ZA 4ND8A 4AF8A 4EKEA 3JQDA 1E5QA 4MMYB 4RGYA 4M8SA 1CT9A 1CQZA 1JLRA 2CKMA 4M4SA 3RI3A 2CV0A 1MO2A 2HY7A 3WGQA 2P6UA 4DLUA 2HJWA 1I7PA 3EGEA 3ZZUA 1DMRA 1RBZA 2YZKA 3OZUA 1ISSA 4Q7EA 1M7HA 4ZT2A 1T0IA 1E1QD 4CTNA 5ISMA 1O5TA 1TF2A 1YJAA 2A1IA 2O3RA 2XUKA 3EXFB 2ZROA 4O2AA 4JI5B 3U61B 5DEOA 1YRAA 1NOKA 4MGEA 2AXPA 1N2IA 1KH1A 3NNNA 3OO0A 1MAUA 4MYCA 1EVKA 3FCYA 4QO8A 2Y4OA 4S04A 1KJ8A 4IIFA 2PX2A 5K0BA 4BMZA 1Z83A 1PQYA 2HU7A 1HE3A 4CQMA 1PDVA 1IPFA 4AKHA 3NT2A 1YFJA 4WBSA 1NFRA 4KRFA 1V71A 3IAFA 1DO2A 1OMOA 1RJFA 2VRNA 4TLDA 1BGVA 3MMNA 5LWQA 3IVXA 2QEQA 1AZSC 1ONPA 4INOA 1V16B 1DAIA 2EQ5A 2L17A 3GLGA 1U3TA 4LBWA 1Q92A 3NBZC 1CNEA 3SZMA 5UKDA 1GKKA 2HPZA 2BHNA 1TPYA 1G8HA 4JI2B 1E18A 1MH9A 2XCTB 1KS2A 1E3DA 4UBIA 2PANA 3UEOA 3SN6A 1DELA 1SZDA 2EX4A 5KVVA 2GZRA 3EN0A 1WB6A 3STYA 2X9GA 2EWMA 1KRXA 1ZRSA 2CB9A 1P1HA 1UMCB 2BMDA 3AR8A 2G8NA 3AW8A 2DFTA 5BPFA 2M98A 1XCLA 2AOVA 2IYTA 3HVRA 5HQ3B 1AX9A 2LIVA 3IKVA 3AF0A 5JJBA 1YF3A 3Q9LA 2OBFA 1P62B 1GZ6A 1A7JA 4JC4A 1K1EA 4AQ7A 1OH8A 3E9EA 2LP4Y 2IIBA 1QOPB 4JROA 3PU6A 2IBSA 4EDFA 3BE4A 3CUVA 2Q27A 4MHOA 4WLOA 5SY4A 4KN9S 4WVFA 5BVHA 3MWDA 2PT5A 1QF6A 3KUXA 3PGJA 2VDWA 2FEWB 3EIUA 5DZSA 1NYQA 1PNTA 5FYQA 1R1DA 2QTVA 1ZZGA 1CF4A 1M1NB 4FR2A 4Y2HA 4RC9A 1F8XA 3VR3D 2EIXA 1T5IA 3FYUC 4CHTA 3NEJA 3U31A 5G0TA 3BB1A 1A2QA 3OQPA 5TE9A 3S2FA 4C76A 5FORA 2OWEA 4YRRA 2Z5LA 1F2DA 4EPTA 1XPOA 1F2TA 4DCCA 2IIVA 4C0HA 3W8NA 1WG8A 4GE0A 3RWBA 4DJFC 4CLOA 4EA7A 3E9CA 2XSZD 2EL7A 2SHKA 3FA2A 3CRNA 3OPYI 3ZWBA 3OU2A 3V6LA 5FOXA 5JDCC 1NF9A 4WWHA 2IV7A 3AJDA 2XB8A 3PZBA 2QMHA 2BZGA 1KJQA 4J2TA 5DO9A 2HWUA 5AXAA 4DQKA 1NMYA 2KBFA 3LUHA 5I3ZA 3IMGA 1YKFA 2WKPA 2DHRA 2C61A 1KZHA 2IBMA 5AVRA 1Z22A 2IDJA 5HK8A 1T3LA 3EWAA 4GRDA 2GGSA 5H4GA 2FDXA 2HK8A 1ULHA 2UYOA 1U63A 1ARZA 3U26A 1W7AA 3QYPA 4MWEA 3VC7A 1XDDA 5CEJA 1B6SA 3OTOB 1K3TA 4ACBA 2JCBA 4Q16A 1JI0A 3TZEA 1YZVA 3GRCA 3F5FA 2NT4A 3NIFB 2WYIA 1I3MA 2BOVA 3TPFA 3NONA 2FUEA 3FCSB 4PLCA 5P8WA 4IVRA 4E5NA 1G21A 1NQXA 2AG0A 3OJCA 4RVHA 3NHZA 2KPOA 2WTNA 3AZPA 3EXHB 1YZNA 4GGPA 4HFMA 4ZYUA 2IVZA 3S44A 3A1NA 1EJ2A 2Z58A 3RIEA 4PQEA 2HU8A 3GEIA 2M6LA 4CV0A 2EERA 2ON6A 4LHEA 5A5GA 1U28A 3M4NA 2P6OA 4OFZA 4FYYA 2ZE6A 4AUEA 2F1KA 4DLSA 1TCCA 5DBGA 5CIYA 4MQFA 4BRSA 1BHO1 1R4ZA 3AVTA 1T9GS 4TS3A 4JL5A 4K40A 2D74A 2ODTX 3IO3A 4L8LA 2YVAA 2IX9A 4EB6A 2ZB3A 1Z08A 3G79A 2PN1A 1Y5NA 5KKCA 1ZNZA 1MB3A 4PZYA 5HMMA 1Z6TA 1M1NA 2DHCA 2WD7A 1GZDA 2AW3A 1CHDA 2R1ZA 3IDAA 4IXTA 1U7WA 2QPAA 3T34A 4R1SA 5A2GA 5KNDH 1UJMA 1YQ9A 3I1IA 4FFVA 1K5PA 3BXFA 3MJDA 4ALNA 2CV2A 2VN8A 4UREA 3OCXA 5E3HA 2AXNA 3OM0A 4E7OA 3UUFA 1PW5A 1GEGA 1IHDA 2Q4BA 2B98A 4F5EA 3J81A 4EHAA 2PTHA 4TSFA 1XQ1A 1RYZA 4NX2A 2RC6A 4KH1A 1TZBA 3QUSA 2VSYA 4G24A 1P9LA 1NN3A 2XUGA 2NZXA 4OLAA 1YE8A 1KERA 3H2KA 2NTJA 3KCQA 2VVTA 3S55A 4DEVA 4BQEA 3ISTA 3SEFA 3B1KA 4XB1A 4DLKA 1G5RA 3WWPA 3I62A 1R66A 1ZW1A 3ELUA 4HLNA 4ESOA 2C3OA 3SG0A 4X5OA 3CH7A 2YJTD 5CTAA 1ND6A 4IDBA 4PGAA 2V4MA 5ELXA 3VNQA 2BN4A 4IMRA 2FFBA 1W9HA 4F12A 4ZEMA 3EC7A 2E5WA 2WAYA 4ZI5A 2XGMA 3N76A 1T9AA 3DVAA 2XCUA 3B6JA 2WAAA 3BAZA 2QX6A 4G1BA 4I1YA 1PT8A 1NL3A 1Z2CA 4Q3BA 1G8GA 1FRQA 2Q45A 3FOBA 3HKBB 2X7JA 3VC3A 4I81A 1Q6YA 3SHWA 3R7FA 2UYYA 4WNAB 2ZXFA 2CFCA 5DASA 4HAIA 1ZAKA 3EXHA 3VHRA 3WWEA 4IWXA 1GCGA 3A4LA 3N5KA 5HJ5A 3KKOA 1KY4A 1Q44A 3RVNA 3OOWA 3I72A 4K0RA 4C7MA 5MN5A 4KO2S 2GAAA 2QMOA 3I6MA 1E5TA 3KVVA 3TCKA 5BNWA 3K0CA 1UKEA 3LP5A 4EJ6A 4CUZA 4O2LA 5G4KA 4FMCB 2UUPA 3EGXB 2AYZA 3WLQA 4ES6A 4E11A 3E9ZA 3JVEA 3N5CA 1XZHA 4G0ZA 4QBTA 5EYPA 1S8AA 2OPHA 1G6HA 3WGYA 4JLWA 3REQA 3D8HA 5U9CA 4B85A 2BFCB 3WSVA 1XHLA 4Z4EA 4JYAB 3TOZA 3O93A 2IZ6A 3PDIA 3C48A 5K0JA 2WC1A 3DEJA 1EX9A 1ZGBA 2WVGA 4KXQA 1L7DA 3AEZA 3IDQA 1JH8A 4HDQB 5H4HA 2HR1A 3OFVA 4MVYA 2O7SA 3H6GA 4RA6B 1QHHB 4DY4A 1I3LA 4CM7A 1T34A 4CGYA 3PQDA 3TLZA 3WXMA 4E12A 1CUXA 3DTVA 2C5SA 4QYXA 3EXHC 4IH4A 4E15A 1M2HA 1U6JA 2IKQA 4B6JA 4C05A 3L3BA 3DDHA 2J31A 3NV7A 4FHGA 1CUVA 2ZVPX 4DNQA 3ZYCA 1FQWA 2AOTA 4R40A 1J2JA 2VHVA 3QLUC 1PFVA 3CZQA 4P4SA 1E79D 2JLQA 1CZHA 4P3YA 5IYZB 1UT6A 5KNBA 3DOHA 4GYJA 4OHUA 5EIWA 1Y80A 4RKYA 4HUQB 2J87A 2WTMA 4HNUA 2RGAA 3A7DA 4YCMA 3TKLA 3K31A 4ZQGA 1B6GA 3NOXA 1BNCA 3AHIA 4QTZA 1X7XA 4D41A 1N36B 1NVAA 1I5OA 3ID6C 3HY3A 1AK1A 2VJKA 3QMPA 4L5CA 2JASA