2CWEA

Crystal structure of hypothetical transcriptional regulator protein, ph1932 from pyrococcus horikoshii ot3
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
191
structure length
191
Chain Sequence
AKKVKVITDPEVIKVMLEDTRRKILKLLRNKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTEMKGNLVEKYYGRTADVFYINLYLGDEELRYIARSRLKTKIDIFKRLGYQFEENELLNIMDRMSQKEFDATVRISKYIEEKEDALKDFSNEDIIHAIEWLSTAELARDEEYLELLKRLGSILKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical transcription regulator protein, PH1932
publication title Crystal structure of hypothetical transcriptional regulator protein, PH1932 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Gene regulation
total genus 74
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2005-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2cweA01
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2cweA02
5F1RA 3B0DB 2QENA 4LD9A 1KX5B 1WRJA 4EGZA 3AYWC 5B1MD 4ESJA 1XSXA 3R0AA 2O8XA 4ENKA 2P6SA 4N0BA 3HTUA 2V9VA 1P3FD 1ZGAA 5C3IB 3I59A 1Z6TA 4AIJA 2K7LA 1ZRFA 2Q2EA 3F8NA 3F23A 2PYOC 3K2ZA 4KGCA 4H9QB 1KU5A 1S8NA 4KUDB 1P4WA 2EV6A 3C1CC 5BNXA 3C3WA 3ISPA 4Z2MH 5E17F 4WU9D 3MGPC 3TU4D 2IVMA 1KX4C 1IRGA 4LLGF 3JAMK 4MQVA 5DNMC 5CPIA 5GSUA 1TAFA 3B6GC 4YS3B 1W5SA 2FRHA 4Q5SF 3VH5A 4CSRA 5AV6D 3WA9A 2Y75A 3GEZA 1XB4A 2YU3A 2RVQD 4MGRA 3VH6T 2VBXA 4G92B 2DK5A 3B0DC 4ZZDA 2RC4A 1KX5C 3LZ1A 3UTAB 1RUOA 3NQJA 4ZZLA 2OAZA 4F7ZA 4I0BA 3EYYA 3O62B 4CXFA 4S05A 1JXSA 3HHHA 1BFMA 5B24A 4WU8A 4U0VA 5BO0A 4A6DA 2K4BA 3RELB 1B67A 3SQNA 3F3XA 5GSUD 4Z2MG 3AV1B 1WWIA 4H9SA 5LGTA 2L02A 3WA9D 2JPBA 4U7BA 1O7LA 3FHZA 4UVAA 5BMZA 1SD5A 3FMRA 5FO5A 2IA0A 5LBQA 1E17A 4EGYA 2NQBD 3F8FA 4YS3C 1P3GA 4Z5TD 1P6RA 3C1BB 4IRHA 5E1XA 3PQKA 4H9PB 4G92C 5B24D 1OMIA 3TGNA 4WU8D 4JK1X 5AY8C 3LWFA 4H9OB 2YFWA 3WKJB 5B2ID 2PI0A 1F66B 3I71A 1RNLA 2O0YA 3W96B 1SMYF 2MD5A 3HOTA 1KU7A 1SAXA 3MNNA 3RELC 1B9NA 1GXQA 1P4AA 5D5WB 1M18A 2R7DA 1P3PB 2C6YA 2STTA 2QLZA 5BS7A 3I0TA 3AV1C 5DV5A 1P3GD 3FXUA 3GO5A 1SFEA 1YW9A 3VODA 5DCMA 2E1CA 2CV5B 1GVJA 1SD6A 3GF2A 5CVUA 1AWCA 3MGQB 3AZNB 1Y0UA 3W97D 5CJ9A 3ZPLA 4ZUXC 2X0LA 4J8WD 3K1NA 4YFNF 1KU2A 4HV5A 5IT9Z 2FBKA 3DEUA 3IC7A 5B32B 3QRFF 5E18F 1P3AB 5GT3B 1P3LD 5CP6B 3MNND 1S6LA 4WX9A 4EM2A 1N1JB 1M18D 1F66C 2O3FA 1ON1A 3CUQC 3SXYA 1UCRA 3GX4X 4EM1A 2F8NA 3X1UD 5BOXA 4YG2F 3W99B 3ZN1A 2A6HF 3BJOA 1RUNA 3KEOA 1A7WA 1LJ9A 4UUZA 1KQ9A 3I4PA 2VODA 4Z66C 1R36A 3B6FA 3T8RA 1J7KA 3AZKD 4LLNA 2E1NA 1FYKA 1QO0D 2QM3A 3LAPA 1QGPA 3UT9A 4HAMA 3QP5A 2LDUA 3REIA 4M6YA 3MGRC 3BPXA 2CV5C 1ON2A 4A0XA 3MGQC 3AZNC 1YQAA 3J81Z 3MGPD 4QLCC 2HIOA 3J7AO 1U5TB 2F8ND 1W7PA 2R3SA 1U35B 5DNMD 4MEYF 4Y13A 5B32C 2YSRA 1J2XA 5DEQA 3AAFA 1P3AC 3LSTA 5FFZA 5BT1C 5JHUA 1HW5A 3E6MA 4M6XA 5AV9A 1ONVA 2VT2A 4L9JA 1IXCA 5B33D 1HQ3B 5H20A 1FX7A 2F5FA 5L3FA 3B6FD 2P8TA 2K02A 5GT0C 3AZEA 5ERIA 3C7JA 3DP7A 3QU3A 2JZYA 2LY8A 4KDPA 4X23B 2ISZA 3LJAB 2M8EA 4HBLA 5GXQA 1AOYA 2FQ3A 2QVOA 2XHKA 2DFIA 4YM6D 3WU1B 3TOAA 2EA4A 2VC0A 3K0LA 2HIOD 2P5LC 1W7PD 3ZN0A 1FSHA 3LELB 1WKMA 2XAHA 1B1BA 3A6NA 3AZIB 3MEXA 2L54A 2NZDA 2ZXJA 1S32C 2HUEB 3GFMA 3RJPA 5AV9D 1BOAA 3ELKA 3AFAB 1H3OA 5DUIA 3NQUA 1QNTA 4XLNF 1U35C 2QBYA 5LEKA 4GGGA 4KT5C 3REHC 3M8FA 5FB2A 1XDSA 4GXOA 3IWZA 3ZP5A 2EV0A 2EJRA 5GXQD 4N9IA 5LLQA 1HQ3C 1SFXA 4NHJA 1BH8A 4J8VB 4EJVA 1P3FB 5AY8D 3V7CA 5HDKA 1B9MA 2O6GE 3EYIA 1FOKA 2CYYA 3A6ND 4WNNA 3LJAC 4MQ9F 1FP2A 2NZDD 2GXBA 5JRGB 4ESFA 5BQTA 3UTBA 4G7HF 2FU4A 3TU4B 4HOBA 3BWGA 3DPTA 3W6KB 3LELC 5JI6A 3JSOA 2KJBA 2IW5A 2ISYA 1TQMA 3AFAC 3GW2A 3KP6A 5AV5A 5AV6B 4CICA 1R4VA 4Z2YA 1ID3A 2CGPA 3GZ5A 4BH9A 1K6OA 5B2JB 4ZUXD 2CO5A 4EQQA 5B1MC 3HOSA 3M7GA 4L9TA 4H9RB 3RIRA 2BEOA 1FPQA 3REJA 3UTBD 1P3FC 3GFJA 2P5VA 3O2PE 3TO7A 3L2CA 2R7FA 3KETA 2ZO4A 1F1ZA 3G73A 3Q5FA 2EFNA 3ZMZA 3AZHB 5D8KB 2FJ7B 5G49B 5IT3A 1IXRC 5F64A 5ICCA 5AV5D 3ZMDA 4WU9C 3TU4C 2QQAA 1ID3D 2G7HA 2PEXA 1G3TA 3WE3A 3KLNA 1U78A 2NQBB 4IRGA 4Z5TB 3AZLA 3MGRD 1XCVA 3K1PA 4Q48A 1R1UA 3REJD 3SFZA 2RVQC 1T98A 4EJWA 5B24B 1D3YA 4J8UB 1KU9A 2PN6A 1P3ID 4FX0A 5B2IB 4MTDA 4KN7X 3W6JB 1P3OA 5EEHA 2L01A 5LHHA 3WGIA 3RKYA 2QUFA 1IRFA 3S2WA 2CFXA 3P9CA 2F8NK 2OD5A 3WTTC 5GT0D 4KFCA 4P5OA 2W24A 3IWFA 5GSUC 1FLIA 3MGSA 1P3GB 4OIQF 3AZLD 1YYVA 2WWYA 3TKYA 5D5UB 2HDCA 3WA9C 3AZFB 5DNNA 3HSRA 4U88A 5D5XB 5J8CA 3KWQB 3C1DA 1Z6RA 3W97B 2KIFA 3B0CW 4WXCA 4J8WB 1P3OD 1YW7A 1OPCA 4P9UA 4R8PA 3KZZA 1WI9A 4H9NA 2ESHA 1S32D 5B24C 1P92A 1I5ZA 4WU8C 1QZYA 2CWEA 3BPVA 1S7OA 1P3LB 1R1TA 4I02A 3ZMUA 1XSDA 3X1TD 3MNNB 3EUHA 5B0YA 1P34B 3I58A 5JA4B 2NS0A 1O57A 2V1DA 3U9GA 3X1UB 2VT3A 4H9SC 2M87A 2QQBA 3AN2A 4MNUA 3ROUA 2ZJ2A 5DNND 1M19A 5DCMB 4R79A 3KCCA 4J8XD 5FUGA 5B31A 5B0ZA 1PUEE 5AVCA 1G6NA 3R45A 3LZ0A 5DD8A 3AZKB 1WSUA 1P3GC 2PYOB 4LFUA 2EFPA 4UVBA 4HF0A 2PMUA 3BJ6A 4RGSA 4AWXB 5E5AA 3F8MA 3V7RA 1FT9A 3MGPB 1ZG3A 1MDMA 3GUDA 1WWSA 1EQZA 1MD0A 3AN2D 1K78B 5DNMB 1JFIA 1XGMA 3AZJD 1USSA 4OMYA 2FXAA 1P3LC 3MNNC 3WG9A 2XAFA 4KA4A 5AVCD 1M18C 5B33B 1HQCA 4BHCA 3HYIA 5BS7C 1LDJA 3GXOA 3X1UC 4EVIA 3SZTA 2XVCA 3F22A 2M1BA 4LGWA 4KN4X 4YFXF 3VH6W 5E5AD 4GYGA 2HYFA 4MTEA 2HZTA 5F99A 2IA1A 3J80Z 1XGSA 4KICA 4YM6B 2DPUA 3AZKC 3HUGA 4YIFA 3PFIA 4DQ2A 2HIOB 5K5OA 1W7PB 2XAGA 5E1ZB 4N9HA 4PGHA 2FBIA 2Z5UA 2G7UA 2HWVA 2EWNA 2P7VB 1UFMA 2J5PA 2Z33A 4FX4A 4HQMA 2F5EA 4EJTA 2F8NH 4LD9D 4AVPA 2JPCA 2HR3A 4M9ZA 3B02A 5BS6A 1LVAA 5IT9K 3HHGA 5JFRA 3CUOA 4M72A 4HF2A 5GXQB 1KX3A 3RDIA 1I1SA 5B33C 3REKA 2HTJA 3B6FC 2HOEA 2QZ8A 3E5QA 4YFKF 1TZYA 1YIOA 2OQRA 5AY8B 1D8KA 1XMKA 2CW0F 2JTVA 4G91C 4KGCD 1QQIA 2STWA 4G6QA 4HQEA 5FLXZ 4RB3C 1FBSA 3LQQA 3FXRA 4L9VA 5LGUA 2NZDB 5D8LB 4YM6C 2H27A 1TQPA 5J6XA 3NQUB 2HIOC 4RB0A 4XSZF 5CPID 3KUYA 1P3BA 1DP7P 2PJPA 4IVNA 1R58A 1KX3D 5AV9C 3WTUC 3RYRA 4H0EA 4WZSB 4ASNA 2EV5A 2K27A 5AIQA 4JJNA 3AV2A 2F8NG 4U0YA 3LZ1D 3FMSA 1ZRDA 3AZMA 1P3KA 2LNBA 4XSXF 5CVIA 4ZUXB 1Q9CA 4RGXA 3AZGA 4B8XA 5JVTA 2XASA 4LK0F 5GXQC 3U2RA 2NAZA 3E97A 1TTYA 4WCGA 5KDMB 3FZVA 1P4XA 2FA5A 1KGSA 4L5IA 1MJAA 2VN2A 3W98A 1LDKB 3RPQA 3ABUA 1O3SA 3CUQB 2L5AA 4KYWA 3A6NC 3KUYD 1IXSB 1HBXG 3KSYA 1IF1A 2NZDC 5DYMA 4IXAA 5CPKA 3M9AA 2L3DA 3P7NA 4RS8A 4LB5A 1AOIA 2UZKA 5CVVA 3EETA 3AV2D 3ZQ7A 4JJND 1ID3B 2QQ9A 4Z66B 4I98B 3AZMD 1REPC 2FMLA 1P3KD 2AS5F 1KQ0A 5D6EA 2HEOA 4P55A 3KXBA 3L00A 4EJOA 2XROA 3P9IA 1T39A 3MGRB 5CPJA 5AVBA 1HXDA 3TOBA 4OIRF 5DD4A 1HKSA 5K1YA 3W98D 3KFWX 2E7WA 3HSEA 4GYIA 2IO5C 3MFKA 4QLCB 1P3IB 5ILUA 4CAYB 2FSWA 3ULQB 2COMA 3UTBC 1AOID 3V4GA 3WTZA 2DPDA 1BI3A 4RB1A 4DRAA 5GT0B 1LEAA 3VFZA 1UHWA 2E7XA 4ESBA 1XDUA 2KKOA 2WTEA 4TV7A 2XV4S 3HSFA 5CPJD 3WE2A 5AVBD 5AV5C 3R0JA 4P9FA 3SZPA 2HYGD 4MEXF 3K1MA 3P9KA 1ID3C 2ZMEB 4XZQA 2ZFWA 2VONA 4Q4ZF 1V3FA 1O7FA 3V9RB 2AROA 1KX4A 2NYXA 3F8CA 3SHFA 2ZBKA 3REJC 3DXJF 3HRMA 1S32B 3OV8A 3RKWA 1ZREA 1FSEA 1PP7U 3X1SA 3KP3A 5K5QA 3X1TB 2EB7A 1P3IC 1ZLAA 2YPRA 4UV8A 5ICFA 3FMQA 1HSJA 1KX5A 4CGZA 2ZKZA 1O3TA 3REHB 5ILVA 4A12A 4R1HA 3WU0A 1GHCA 4JBAA 4J8XB 4XZQD 4NFTA 3I64A 2OBPA 1STZA 2Q0OA 3GLXA 2AROD 3BY6A 4HYEA 4CYDA 4H9QA 3UT9D 1YW8A 4KHAB 4KUDA 3AZLC 3REID 5A2QZ 1I6XA 3Q9VA 1GXPA 2MA3A 5E8IA 3D5LA 3QU6A 1FC3A 3FXQA 2XAJA 3E6DA 5BNVB 3LA2A 3TO9A 5DDGA 3IRQA 3D0SA 4U7DA 4UXNA 3WODF 1P3OC 1QZZA 4E70A 4YS3A 1YFHA 3ZMTA 3AN2B 4QWQA 3AZJB 4CHUA 3QAHA 1B6AA 1W5TA 2D2WA 3X1TC 1TBXA 4NB5A 3KEQA 3F8BA 3AZED 3R45B 2EK5A 2RDPA 3NQOA 2YFVB 3UTAA 2BYMB 4XBFA 1ZARA 4WV4B 1IN7A 1KA8A 5B1MB 4HA8A 3O62A 5DNNC 2O61A 5KK1A 1BH9B 4J8XC 3X1VA 4A5MA 1KU3A 3CDHA 4M71A 1BIBA 3VH6A 3CJNA 3L09A 5B1LA 3RELA 4CZZA 4MHGA 2G9WA 3E6CC 4G9YA 4UVCA 3TDUC 1G3SA 3V8KA 4R8PC 4GO1A 1SFUA 1Z1DA 1V4RA 3V7SA 3WAAA 2DO7A 2HTSA 4WU9B 5B0YC 3ZMSA 3TO6A 2ESNA 2VBWA 1IW7F 2TDXA 3EQLF 1FP1D 4LD9B 1UB9A 2RV8A 3AN2C 2OU2A 1R5GA 3C1BA 1IZ1A 3AZJC 2JSCA 1Z05A 4ENNA 3N4MA 2BYVE 4H9PA 4OIOF 1MJBA 3X1VD 3KP2A 5AVCC 4ETSA 2DI3A 3E5XA 5B1LD 4O5VA 4H9OA 3I59B 1OYIA 3WKJA 1F66A 2EFWA 2PFBA 4A0ZA 4KGCB 3T0YA 6PAXA 3W96A 4Q47A 5BNXB 3R60A 3VH5T 5E5AC 3WAAD 4AWLC 3WTPA 5K5RA 1H9GA 2ADUA 3WTWC 3ZMVA 5AIPA 1P3PA 3T1BA 3LQRA 4BAYA 2W57A 3C1BD 5CPIB 5GSUB 2Q8KA 1TAFB 4KMFA 4HDUA 4CSRB 1ZG5A 3WA9B 4L9NA 3MGQA 4G94A 3AZNA 4DRBA 4LD9C 2YX7A 2CG4A 1DUXC 3LZ1B 4HZFA 2FOKA 3NQJB 2DU9A 2RN7A 3COAC 5B31G 2Y48A 3IL2A 5B32A 1YTYA 2EA2A 5FD5A 1K7AA 5AONA 1P3AA 3BOQA 3V8LA 2D45A 5GT3A 5CP6A 4A6EA 3WTPD 5HVQC 4WU8B 1N1JA 5BO0B 5HLIA 2HQNA 4LG0A 4E44A 2LF7A 2M5WA 4KGCC 3W99A 1FY7A 3C18A 3R4KA 3J80K 3JTHA 1KYZA 3AV2B 4JJNB 3MZYA 2GIVA 1T0FA 5CPIC 1G3YA 4EMSA 5AV8A 5BPDA 5HDNA 3GFLA 2W85A 1LEBA 1KX3C 2CSOA 5GT3D 2L4MA 5CP6D 2Y0MA 2V1XA 4HGAC 3RKXA 1HSTA 1YG2A 1X3UA 3LZ1C 2YFWB 3L9FA 5LGNA 4ZYGA 1U5TA 3WTXC 3RYPA 4XUJA 5HDGA 1U35A 3JTGA 1Z7UA 1BC8C 4HLXA 2RKHA 3KE2A 2QYOA 2XAQA 1RI7A 3REOA 4QLCU 1M18B 2V79A 3KUYC 3MGSD 4I0AA 4RAYA 5AV8D 4X23A 3HRSA 5FLXK 2HGCA 4JQFA 1ODDA 5L3BA 1R23A 1ZYRF 2F2EA 2HQRA 3F6OA 3AV2C 4JJNC 3MVDA 4NE6A 5KVRA 3O3KA 2BGCA 1ZG1A 3MAJA 1DPUA 3AZMC 1XGOA 1P3KC 2A61A 3FX3A 1SD4A 4XUJD 2V1UA 4CDGA 3LELA 2IT0A 2BBYA 3WGHA 3AZIA 4M73A 4R8PD 2MBFA 2WC2A 1OYWA 1IN6A 3KP4A 1FWZA 1HW1A 3AFAA 3LA3A 2QWWA 3W98C 2D1HA 2V6CA 5B0YD 3BJAA 5BPIA 1PP8F 1J0RA 4BHPA 4X23D 2F8NB 3VOEA 1BI0A 5CPKC 4L0ZB 3B0CT 1BM9A 1M19D 4UUZB 1AOIC 1QPMA 2A6EF 4WXHA 5B31D 3MVDD 5B0ZD 1T6SA 4J8VA 4ZYHA 1P3FA 3LZ0D 4A2UA 4I09A 5E20A 3B6FB 2A69F 3JW4A 3KXBC 4G91B 4Y17A 1YS6A 3RTRA 3UT9B 3REIB 5E1WA 1B4AA 5CPJC 5AVBC 5JRGA 4OMZA 3IRRA 4B09A 3DKWA 2LF8A 2PMHA 5ILSA 5CYVA 1P3MA 3TQNA 1R5HA 1EQZD 1LDDA 4BQAA 1ZAOA 1EH8A 5D4SA 2F5DA 1HW2A 1BI2A 5HLHA 4L18B 5AV6A 2FF4A 4OIPF 3ERED 2A68F 5AV9B 4J8VD 1T2KA 4A5NA 4IHTA 3AZEB 4M74A 3NRVA 2VE9A 5B2JA 1YLFA 3ECOA 4LK1F 3QP6A 5HS8A 1EH6A 1ZGJA 4H9RA 2HKXA 5JRGD 1BC7C 1TW3A 3FF5A 5F99D 1LB2A 4K2EA 1Z91A 2UXXA 1P3MD 4XZQC 1IN8A 1BIAA 1FYLA 1XMAA 4UHTA 4LJZF 2AROC 3H3UA 1IUYA 3WTVC 1T38A 2ETHA 5CHLB 5JR3A 3UT9C 1JHHA 3NEUA 3MZHA 5D5VB 1G4DA 3AZHA 3REIC 2FJ7A 5G49A 3A6NB 3BROA 1M1AA 2F5CA 4WF2A 2GZWA 3X1SC 4PGGA 3KP7A 1H3OB 1YS7A 1FZPB 1ZLAC 4PDKA 5ICEA 1F1EA 4E45A 2D1VA 1E2XA 1ZLJA 3DV8A 2DW4A 5B2JD 2QBYB 2NQBA 4M9XA 4HW0A 4BXUA 2PG4A 1EH7A 2GA2A 2A3SA 4Z5TA 2ZCWA 3EDPA 4HX8A 3I54A 3F21A 2M30A 3REKD 5C3IC 3JSPA 2IP2A 3X1VB 2EFQA 3J81K 2VE8A 1BH8B 1TZYD 3AZEC 4J8UA 1ZH5A 4AD9A 5D4RA 1Z9CA 2J5OA 2YX4A 5B1LB 5B40A 3E6BA 4OOIA 2IO5B 5B2IA 4KUDC 3AZHD 2P5KA 1R22A 2FJ7D 4WNNB 1M1AD 3WTYC 1F9NA 2XGXA 4KUMA 2FMYA 2MLKA 4D0PA 3GYHX 2K4JA 3WAAB 3UTBB 3Q9SA 4BHBA 4FT8A 3TDZC 4KMUX 4BYYA 2A07F 1P3BD 1MKMA 1CGPA 1P2FA 5A2QK 3CTAA 3AZFA 2DBBA 3IHUA 3MWMA 2OQGA 5HS7A 5AV5B 2ELHA 4M6BA 1FBQA 3WTPE 4J8UD 4HLYA 2RQPA 5H6RA 5B40D 3FWEA 3KWQA 3MQ0A 3UTAC 1OKRA 5L3DA 4IPAA 5DUKA 3W97A 5TJJA 3R6SA 4J8WA 2H6CA 3AZGD 3O62C 4R8HA 4EO5B 3RI4A 3K9TA 3X1VC 3REJB 1P3LA 3WTPB 4Y15A 5B1LC 2PBIA 1S3JA 1P34A 3T8TA 3T5XA 5JA4A 4L5JA 1CF7A 5L3CA 3WTSC 3FM5A 3X1UA 3AYWA 5CPKD 1HTAA 1S29A 3AZFD 4I01A 4HF1A 3WAAC 2P4WA 3LAJA 2MH2A 4LLLA 2Z9OA 2ZNZA 3KWQD 1OYYA 3JAMZ 2Z3YA 3AZKA 2ZNYA 3C1BC 3KXBD 2PYOA 4DNCA 4NQWA 3AZLB 1L3LA 3C1CA 1U3EM 4EJUA 1JHFA 2KRFA 1J9IA 3KP5A 3U1DA 1J75A 3GWZA 5L3EA 3WKJC 4UV9A 3MGPA 1P34D 4LG0B 2IJLA 3I5UA 4UNOA 3W96C 1DPRA 4EO5C 4UUVA 3AYWD 1XCBA 2NNNA 1K78A 5DNMA 2RGVA 2VBYA 1B6WA 1P3OB 5LRSA 1FBUA 3B6GA 3WTPC 3HRTA 3DF8A 1K79A 5E8GA 2BYKA 5B33A 1P3PC 2FNAA 1RIOH 4G7OF 2PYOD 3MGSB 2O03A 2OA4A 4G8XA 5AV8B 3C1CD 2WV0A 2DQRA 2X4HA 5ICGA 5DNNB 2KIMA 2DTRA 4WK8F 4YM6A 4EV0A 4ENMA 1H9TA 1KX4D 1B59A 2Z99A 4PZJA 2DK8A 2ACJA 5D6FA 4YIIA 1TQIA 2B0LA 4ZH4F 2FBHA 4XUJB 1VTNC 4AIKA 5EEGA 3B6GD 1JGSA 5GT3C 2PQ8A 5CP6C 2KJCA 4R8PB 4H9NB 2FNPA 3X1SD 2NRAC 1ZLAD 1ULYA 2XRNA 2LKPA 5B0YB 1KX5D 4RGUA 4HX7A 4I2OA 3LFKA 3W99C 1J59A 5ED4A 1MZBA 3QOPA 3ECHA 1NHAA 1M19B 5CVJA 3K69A 5FUGB 5B31B 3MVDB 5B0ZB 3CO7C 4KNYA 2YR2A 5AVCB 5CLSA 5AY8A 3LZ0B 1BBYA 1C0WA 3MGSC 2BE5F 2P7CB 2OZUA 4KUDD 5AV8C 2EFOA 2K86A 2NNYA 4G6DA 3DPLC 1BJAA 2GWRA 3GFIA 5E5AB 1W4MA 4KIBA 4AWLB 2MC3A 4ZYEA 2OZ6A 1U5TC 2JSSA 1MDMB 4XUJC 1A04A 1QBJA 2FE3A 1EQZB 5B32G 3VH5W 2MLGA 4YS3D 3AV1A 4M9SA 2GXGA 1JFIB 1UHMA 4KIFA 5L3GA 1S7AA 3MCZA 1HKQA 1R00A 5HOOA 4GCVA 1TNTA 4I7HA 5FFXA 3GVAA 4KIGA 3UTAD 4AIHA 3BDDA 4X23C 3BP8A 4FHTA 4ZUXA 3VEPA 3E5UA 4RB2C 4S04A 5LHGA 1H0MA 3O62D 5FD6A 1M19C 1O3RA 4ON0A 2UWMA 4HX4A 1TNSA 1YO5C 2XKOA 4XLPF 5B31C 3MVDC 5B0ZC 3HIFA 2DLLA 2H6BA 5KDMA 5F99B 3LZ0C 5LRRA 1ZLAB 1PDNC 1P3MB 2P6TA 3RELD 1F4KA 1OR7A 2KIUA 5FGMA 3CUQA 3ML6A 3AZIC 3R61A 3AV1D 2CQKA 2HUEC 4IRIA 1FYMA 1ZHFA 3IKVA 2HS5A 4LD5A 4HDVA 2H09A 1L0OC 3HTSB 1SMTA 4Z66A 1EQZC 3LA7A 2RVCA 3M8EA 1WWXA 4NE3A 1F5TA 2VC1A 3GZ6A 4CO8A 2VOOA 5HLGA 3MGRA 1KX3B 3ABTA 4J8VC 2CV5A 2W25A 3REKB 1SD7A 3E3VA 3G3ZA 2JRTA 3WKJD 1XSVA 1TZYB 4HGAB 1F66D 4QLCA 3DFGA 2A5YB 1P3IA 4CAYA 3W96D 3I53A 2HKOA 4OU0A 2H94A 1XN7A 5JRGC 1KQ8A 2VBZA 1ZRCA 1M1AB 5F99C 3H3ZA 1P3MC 1Q1HA 1HKTA 4Z66D 1P3PD 3N97A 3IKTA 4OINF 5GT0A 1XD7A 3FM3A 1TLHB 3KUYB 4A0YA 1P3BB 1LQ1A 4HV6A 2XIGA 5AV6C 1I27A 2IRFG 2CV5D 2ZMEA 3MGQD 3AZND 4P96A 4QLCD 5B2JC 2UXNA 5B40B 3V9RA 4IF4A 4ZBJB 4EM0B 3AZMB 1P3KB 5LHIA 5TRDA 2M45A 1O3QA 1TW2A 3AZGB 2JT1A 5B32D 3B73A 1KYWA 1P3AD 3REKC 1S32A 5BT1D 3L7WA 1TZYC 2GQQA 3HRUA 3X1TA 4G7ZF 1XGNA 4WXDA 3W98B 3AZHC 4RAZA 1D8JA 2FJ7C 3F6VA 3W99D 1RZ4A 3REHA 1M1AC 1U8RA 5CPKB 3BZ6A 1MGTA 3CLOA 4RGRA 2DQLA 1MJ9A 5DCFA 1LNWA 2L4AA 1AOIB 1ZLKA 1HQ3A 4J8XA 3PQJA 2BV6A 2IPQX 4ZYDA 3V8JA 1WQ2A 1D5VA 2NQBC 2W84A 1P3BC 4L0YB 4ENJA 4KHAA 4Z5TC 3B0BA 3KXBB 2HFHA 2RNJA 3LJAA 3QPHA 1DDNA 1G3WA 4XRFA 1R7JA 4LB6B 5AVBB 5CPJB 1USTA 4J8UC 4NE5A 2MH9A 5B40C 3KZYA 5LEJA 5BNVA 3F72A 3WGGA 4ZBJC 3DQVC 1R1VA 1BN5A 5B2IC 4U0WA 1U35D 3QPTA 1CF7B 3AZGC 4LMYA 4BNCA 2IA2A 2AXLA 3REHD 5H6QA 1I1GA 2DT5A 1JE8A 2GAUA 3AYWB 3RPUA 2XKPA 4O6JA 3AZJA 3O6BB 3VB2A 2DAOA 4IHSA 1IN5A 2PLYA 1HQ3D 3CO6C 1IAWA 4PCQA 3M1EA 2FEZA 2YFVA 2BYMA 1FNNA 1EV7A 3LJAD 5B1MA 3AZFC 3C1CB 1BH9A 3H92A 5J8FA 3KWQC 2VOPA 1BI1A 4O3MA 3KLOA 1J5YA 1IN4A 2LSOA 2VXZA 4XZQB 3W97C 4WWCA 2AROB 5HS9A 3LELD 4J8WC 1KX4B 3AZID 1U6GA 2GA1A 3OOPA 5CVRA 3B6GB 2XUBA 3AFAD 4WU9A 3X1SB 1P34C 2BYKB 3TU4A 1ZN2A 5F6FA 4IJAA 1U2WA
chains in the Genus database with same CATH superfamily
5F1RA 2ZXIA 4X6AJ 2QENA 3B0DB 2MFZA 4LD9A 2L9RA 1KX5B 1WRJA 2ECBA 3BR1A 3MZ8A 3DBRB 4PJLA 4EGZA 3AYWC 5B1MD 4ESJA 1XSXA 4DQYB 3H36A 3R0AA 4QPOA 2OTJI 2O8XA 4ENKA 2P6SA 4N0BA 4A3GJ 2A05A 2V6EA 3HTUA 2B63J 2V9VA 5IOYA 2DYRH 1P3FD 2W4SA 1ZGAA 3BT9A 5C3IB 3DU5A 3HOZJ 3I59A 1Z6TA 4AIJA 2K7LA 1ZRFA 2Q2EA 2CQQA 3F8NA 3F23A 3K2ZA 2PYOC 1U0JA 5F0CA 1KU5A 4H9QB 4KGCA 1S8NA 3PUBA 1SFOJ 4KUDB 4M3DA 1TL8A 1P4WA 2EV6A 3C1CC 5BNXA 3C3WA 3ISPA 4Z2MH 2LFBA 2LREA 1JKOC 5E17F 3HOVJ 4WU9D 2DMQA 4XL9A 3K4KA 3MGPC 2BW3A 3TU4D 3OYCA 2IVMA 2X1EA 3GTLJ 1MNEA 1RKTA 4MO7A 1KX4C 1IRGA 4LLGF 3JAMK 4DYRA 2FJ1A 1GV5A 1B72B 4MQVA 4V2GA 4E7IA 5DNMC 5CPIA 5GSUA 3H9QA 1TAFA 3B6GC 4YS3B 4D7MA 1W5SA 1WFXA 2FRHA 4Q5SF 3VH5A 4CSRA 5AV6D 1QHHD 2I8DA 2Y75A 3GEZA 4NBQA 5FKOA 1XB4A 2YU3A 3I9V2 3CD6I 2RVQD 4MGRA 3VH6T 3G1OA 2VBXA 4G92B 2DK5A 3B0DC 3GTQJ 4ZZDA 1Z77A 2RC4A 1KX5C 3A2KA 3BTIA 3LZ1A 3UTAB 1RUOA 3EPJA 2VQCA 5BNGA 3NQJA 4ZZLA 4FQGA 2OAZA 2VIXA 3FXLA 4F7ZA 1ZGWA 3RZDJ 4I0BA 3EYYA 2NVYJ 1H8AC 3O62B 1VQ4I 4CXFA 1TWAJ 4S05A 1JXSA 3KYDB 5DM7F 3QYBA 3HHHA 3QQAA 1A35A 1BFMA 3GTGJ 5B24A 4WU8A 4U0VA 3BG9A 5BO0A 2EIMH 3M4OJ 5F04A 4A6DA 2K4BA 1FOXA 2HDWA 3RELB 1WJDA 1B67A 2HOAA 3SQNA 2XC7A 2XPWA 3F3XA 5GSUD 4Z2MG 3AV1B 1WWIA 1EKEA 3HGYA 3EPZA 4H9SA 5LGTA 2L02A 4DOZA 3WA9D 2JPBA 4U7BA 3DTEA 1O7LA 3ZQCA 1MH4A 3FHZA 4UVAA 5BMZA 3HKZA 4BDZA 1SD5A 3FMRA 5FO5A 2IA0A 3TL4X 2V1NA 5LBQA 1E17A 4EGYA 2D5VA 2NQBD 3HOYJ 1VQNI 5EGOA 3F8FA 4YS3C 2P81A 1P3GA 4Z5TD 1P6RA 3C1BB 4IRHA 5E1XA 2YU9J 3PQKA 3N05A 3QODA 5E3NA 2RREA 4H9PB 4G92C 5B24D 1OMIA 3TGNA 4WU8D 4KISA 1X3ZB 4JK1X 3IH4A 5AY8C 3LWFA 4H9OB 2LMDA 1S72I 2WBMA 2YFWA 5E79C 3WKJB 2PJRA 2PI0A 5B2ID 1F66B 3TBIA 1OCCH 1YJNI 2MD0A 1MW7A 3I71A 3GTPJ 1B8IA 1RNLA 2O0YA 4AUXA 3OYDA 3W96B 3TMOA 2QKLB 1SMYF 2VQLA 3PSFA 4Y4RA 1UAAA 2MD5A 3BG3A 3HOTA 3CMEI 1KU7A 3ZCOA 4E6KG 5GPCA 1SAXA 3MNNA 3RELC 1B9NA 3OMYA 1GXQA 5GTIC 1P4AA 5D5WB 1M18A 5EG0B 2R7DA 1P3PB 1IRXA 4IHXA 2C6YA 2STTA 3IH2A 2VQRA 3H0LC 2QLZA 5BS7A 3I0TA 4XIDA 3AV1C 5DV5A 3W2AA 1P3GD 4HPQA 3AL0C 3FXUA 3GO5A 1SFEA 2OV7A 1YW9A 3VODA 5B1BH 3BLYA 1OCZH 5DCMA 5F08A 5E3MA 4XN0A 3FBNB 2M0CA 2E1CA 5GAGJ 1DGWY 2M0MA 1GVJA 1BW6A 1SD6A 2CV5B 3GF2A 1OJLA 1ORKA 5CVUA 1AWCA 3MGQB 3AZNB 1Y0UA 4ZTFA 4BDYA 3PO2J 2E2JJ 1G59A 3W97D 1BA5A 5CJ9A 3ZPLA 4ZUXC 1ZTRA 2X0LA 4J8WD 1JT6A 3K1NA 2O9LA 2EZHA 2KRHA 1KU2A 1Y6IA 4QIWN 4YFNF 2W7NA 3A0BC 1QVTA 4HV5A 2R7VA 2FBKA 3LNQA 5IT9Z 1PVEA 3K4NA 3DEUA 3IC7A 2HVRA 5B32B 3QRFF 5E18F 1P3AB 2NOJB 5GT3B 5CP6B 1PUFA 1P3LD 3MNND 4W1UA 1S6LA 4WX9A 4A69C 1OR7C 4EM2A 1N1JB 1M18D 3VWBA 1F66C 2O3FA 1ON1A 3CUQC 1WJCA 3O8HA 4LIVA 1UCRA 3SXYA 3GX4X 4EM1A 2E1OA 2F8NA 2R0QC 3X1UD 5BOXA 2G5HC 4YG2F 4C2TA 2DOEA 3ZN1A 3W99B 2A6HF 1Z3XA 3BJOA 4A3JJ 1RUNA 3KEOA 3DKYA 4CYCB 1A7WA 1LJ9A 1EA3A 4UUZA 2R7WA 4DGWB 1KQ9A 2RIQA 4PFPA 2ID6A 3I4PA 2VODA 3QWLA 4RBOA 4Z66C 1G8XA 1R36A 3B6FA 1X58A 5KAFC 3T8RA 3IV5A 1J7KA 2H8RA 4LLNA 1S9HA 2E1NA 3AZKD 1FYKA 2F4MB 1QO0D 1BW5A 1SVOA 1MBJA 2Y2OA 2QM3A 3LAPA 1QGPA 3UT9A 4HAMA 3QP5A 2MABA 2LDUA 1VFCA 3CQZJ 3REIA 4M6YA 3MGRC 2X48A 3BPXA 2R5YB 2CV5C 1ON2A 2ZXWH 4A0XA 3ZQQA 3MGQC 4A3EJ 3AZNC 1YQAA 3J81Z 3MGPD 2ELKA 2LYCA 1EF4A 4QLCC 1ACIA 4YELA 4F3QA 2HIOA 3J7AO 4GDFA 1LE8A 3CCEI 2DA2A 1U5TB 2F8ND 1W7PA 2R3SA 5TGTA 5EF6A 4OAYA 1U35B 1W2EA 5DNMD 4MEYF 3CJTB 2IGOA 4Y13A 3H1CA 5B32C 2YSRA 1J2XA 5DEQA 3AAFA 1P3AC 3LSTA 5FFZA 5BT1C 4A3BJ 5JHUA 1HW5A 4EEFG 3E6MA 4M6XA 5AV9A 1ONVA 2VT2A 4L9JA 1IXCA 2CUFA 5B33D 3OS1A 1HQ3B 5H20A 1FX7A 2F5FA 5L3FA 3B6FD 3JRDA 2P8TA 2K02A 5GT0C 3AZEA 3C7JA 5ERIA 2JVHA 2IEKA 3DP7A 3QU3A 1N75A 2JZYA 5EJCA 5GP9A 5B5EC 1IC8A 2LY8A 2DFEA 3HEFA 1WCMJ 4KDPA 4X23B 2ISZA 3LJAB 4J19A 2M8EA 4HBLA 5GXQA 1AOYA 1SVLA 2FQ3A 2ZMEC 2QVOA 2XHKA 2VKHA 2DFIA 3AG4H 4XK4A 5FLMJ 3WU1B 4YM6D 3TOAA 3H5NA 2EA4A 1YI2I 3DTKA 1R6RA 3ZQFA 2VC0A 3K0LA 3OYJA 4J01A 5LD2C 2HIOD 2P5LC 2ZY2A 4B4CA 3BR3A 3JRBA 1W7PD 3ZN0A 1FSHA 1K83J 3LELB 1WKMA 2XAHA 1B1BA 3NWSA 5CQGA 5K7ZA 3FK7A 3A6NA 3AZIB 3MEXA 2L54A 4HRIA 1A6QA 2ZXJA 1S32C 2NZDA 2HUEB 3GFMA 5TISC 3RJPA 5AV9D 1UZCA 1BOAA 4XKVA 2VKEA 3ELKA 3AFAB 1H3OA 5DUIA 3NQUA 1CQTA 3I4NJ 1QNTA 4AVZA 4XLNF 3OYMA 2F2AC 3BTLA 1U35C 2QBYA 5LEKA 4GGGA 4KT5C 4GRIA 3REHC 1X3WB 3ZOBA 3M8FA 2K9MA 5FB2A 3RKQA 1XDSA 4D9JA 4GXOA 3DEWA 3IWZA 3ZP5A 2EV0A 2EJRA 1YOVB 5GXQD 4N9IA 4FE7A 5LLQA 1HQ3C 3PO3J 3LL7A 2VKDA 1SFXA 2QF7A 4NHJA 1BH8A 1T8IA 1Y56A 4J8VB 4EJVA 1P3FB 1JT0A 5AY8D 1R9TJ 3V7CA 3FHNA 2R7OA 3UNGC 5HDKA 1QA6A 1B9MA 4M6VA 5K7FA 2O6GE 3K2AA 2LY1A 3EUKL 3EYIA 1FOKA 2CYYA 2O8KA 2BXYA 1XPXA 4WNNA 3A6ND 3LJAC 3H35A 4ABZA 1R49A 2HQ5A 1FP2A 3CCYA 4MQ9F 1GDTA 2GXBA 2NZDD 5JRGB 4LG3A 4ESFA 5BQTA 4CUGA 3K7AJ 3OR1C 1MSEC 2K40A 4XKWA 3UTBA 2HPIA 2HVSA 4G7HF 3ZRGA 2TRTA 2FU4A 3TU4B 2JUCA 4BGDA 4NDLA 4HOBA 3BWGA 3DPTA 2COBA 3W6KB 3LELC 5JI6A 3HOWJ 2F5VA 3H0RC 3JSOA 3ESWB 4XOPA 3TP0A 2KJBA 3PFYA 2IW5A 2ME6A 5H2FC 2ISYA 2Y0SN 1TQMA 3AFAC 2IS4A 3GW2A 3KP6A 3ZQIA 5AV5A 5AV6B 3ZQHA 1LFUP 4CICA 1R4VA 4Z2YA 3Q0VA 2W1OA 1ID3A 3RZOJ 2CGPA 3GZ5A 4BH9A 1IRZA 1K6OA 3G2BA 4Y3OA 5B2JB 2KZVA 3MKLA 4ZUXD 2CO5A 4EQQA 5B1MC 3TW7A 3HOSA 1R4NB 3M7GA 4L9TA 3K10A 4H9RB 5CQEA 5LFAA 3RIRA 2BEOA 3PNTA 1FPQA 2HI3A 2NVQJ 3REJA 3UTBD 1P3FC 3GFJA 2P5VA 3O2PE 1VQMI 3TO7A 3L2CA 2BW3B 2R7FA 3KETA 2ZO4A 3QPSA 2Y2NA 1F1ZA 3G73A 3Q5FA 2EFNA 4XORA 3ZMZA 2DA5A 3TEDA 3CLQA 3AZHB 2BY1A 5D8KB 2FJ7B 4B47A 5G49B 3FDYA 5IT3A 1TZLA 3C2BA 2F4OB 4FETA 2ZY5A 1IXRC 5F64A 2OCCH 2DDAA 5F27A 5ICCA 5AV5D 3ZMDA 4F91B 3K4MA 4WU9C 5J1YA 3TU4C 2BY2A 2CS3A 2QQAA 1ID3D 1ETVA 1H88C 2G7HA 2PEXA 1G3TA 3S1RJ 2I5UA 1V5FA 3DKXA 1MMNA 3KLNA 3WE3A 2L7MP 4BQOA 1DQUA 1U78A 1MNMC 5DS9A 1X19A 1PYVA 2NQBB 2R7TA 4IRGA 4QTRA 2E2HJ 5J47A 2IAIA 4Z5TB 3AZLA 3MGRD 4DYQA 5DM6F 1XCVA 5GPAA 3K1PA 3S2HJ 4Q48A 5GADJ 1R1UA 2DMPA 2XAUA 2JA8J 3REJD 3SFZA 2RVQC 5KNLA 1T98A 1UG0A 4EJWA 1FTTA 5B24B 2LOOA 1D3YA 3LSRA 4J8UB 1KU9A 2PN6A 2KLOA 2WA0A 1P3ID 4E7SA 3OL3A 4FX0A 2AHQA 3F6TA 5B2IB 4MTDA 4KN7X 3W6JB 1P3OA 3SYTA 5EEHA 1FOYA 2L01A 5LHHA 3WGIA 3RKYA 2IXSA 2QUFA 1IRFA 1XG1A 2E19A 3S2WA 2CFXA 3DPUA 3P9CA 2F8NK 9ANTA 3KIOA 2V26A 2MC4A 2OD5A 2WY8Q 3WTTC 4DBRA 4PJNA 5DTDA 5GT0D 4KFCA 4P5OA 2W24A 1MMSA 2NS8A 3IWFA 4BXXJ 5GSUC 1FLIA 3MGSA 3HZJA 2EH3A 1P3GB 4JX5A 4OIQF 3AZLD 3OS0A 1YYVA 2WWYA 3TKYA 3OYAA 5D5UB 2HDCA 3WA9C 3AZFB 5DNNA 2R7SA 4Y52J 3HSRA 2MW8A 2JA6J 3W2VA 4U88A 1WVRA 5D5XB 5J8CA 4FCYA 1RRJA 2VQHA 3KWQB 3C1DA 4BE1A 5J1UA 1Z6RA 2PJRB 3SEZA 1S7EA 3W97B 2KIFA 3B0CW 1I50J 4WXCA 4J8WB 1N77A 1P3OD 1YW7A 1OPCA 4P9UA 2DODA 3I55I 2L7FP 3CJRB 4R8PA 3KZZA 1WI9A 2MSYA 3QPLA 2ESHA 4H9NA 1S32D 3LSIA 5B24C 1P92A 1I5ZA 4WU8C 1QZYA 2CWEA 3BPVA 1S7OA 1P3LB 1R1TA 4I02A 2H1LA 3ZMUA 1X4PA 1XSDA 3X1TD 3MNNB 3EUHA 3OYLA 1JKRC 1RR8C 5B0YA 2DMTA 1P34B 2A5WA 2Y0SA 3I58A 3CDLA 2UWXA 2XF7A 5JA4B 2NS0A 1O57A 2V1DA 3M07A 3U9GA 3X1UB 4RAFA 2VT3A 4F92B 4H9SC 2M87A 2QQBA 3AN2A 1I39A 3J7ZI 4MNUA 3ROUA 2ZJ2A 3M8JA 5DNND 1M19A 5DCMB 2BOLA 4R79A 3KCCA 4J8XD 5FUGA 3A01A 4ZYAA 4IOCF 5B31A 5B0ZA 1PUEE 5AVCA 1G6NA 4BL0B 3R45A 1T95A 2IGMA 3LZ0A 3HOXJ 3FKIJ 4CCLA 5DD8A 1O4XA 3AZKB 1WSUA 1P3GC 5K7HA 1POGA 3PUFA 2PYOB 3FXOA 4LFUA 1AHDP 2EFPA 2G0EA 4HF0A 2PMUA 4UVBA 1HC8A 4NQWB 4IHWA 5J1RA 3BJ6A 2VB6A 4RGSA 2Y2LA 1FMVA 2G5IC 2CH0A 2RQQA 4AWXB 2X6XA 4B43A 3CP8A 2VUMJ 1I6HJ 5E5AA 1ETXA 2HXOA 5F0FA 3F8MA 5IP9J 3V7RA 3AKZA 1FT9A 2R5ZB 1ZG3A 3MGPB 1MDMA 3GUDA 1WWSA 1EQZA 3GCMA 4HNVA 4PJ0C 3OYGA 1E3HA 1MD0A 3AN2D 1K78B 5DNMB 1JFIA 1XGMA 2DA7A 3AZJD 2LR8A 5E3LA 1USSA 4CCMA 4OMYA 2FXAA 3H9GA 2R7ZJ 1P3LC 3MNNC 1IO2A 3WG9A 2XAFA 4KA4A 5AVCD 2Z1DA 1M18C 4UY8I 1Y8QB 2IS6A 5B33B 1HQCA 4BHCA 3RQIA 2KMUA 3HYIA 1V54H 1ZK8A 5BS7C 3U1KA 1LDJA 3GXOA 2OUMA 4XONA 3X1UC 1NG7A 4EVIA 3SZTA 2XVCA 3F22A 2B7EA 2M1BA 4LGWA 2EBIA 2E5NA 4KN4X 4YFXF 1YJWI 1FJLA 4F93B 3NWTA 2R7UA 1W0TA 1ITYA 3VH6W 5FROA 5E5AD 4GYGA 2HYFA 2PX9A 4MTEA 3K70D 2HZTA 3EG5B 5F99A 2IA1A 3J80Z 2DOFA 1XGSA 4KICA 4CZCA 4YM6B 4Y7NJ 2W82A 1HCRA 2DPUA 3AZKC 3HUGA 4YIFA 3PFIA 3ABMH 3AG3H 4DQ2A 2HIOB 1T3UA 2ECCA 5K5OA 2HDDA 3Q0UA 1W7PB 2L0KA 2ZY4A 2XAGA 5E1ZB 1JTXA 2DFFA 4N9HA 1ETYA 4PGHA 2FBIA 1MMGA 2Z5UA 2G7UA 4PJJA 2HWVA 2J8PA 2EWNA 2H8WA 2P7VB 4WJ3C 2XGEA 1AKHB 3CCQI 1UFMA 2J5PA 2VJ4A 2Z33A 4FX4A 4HQMA 2F5EA 4NC7A 4EJTA 2BHYA 2E1MB 3B6CA 4CCJA 5KHDA 2F8NH 4LD9D 4AVPA 2JPCA 1DU6A 1HDDC 1VQLI 1WHUA 2HR3A 3L2VA 4M9ZA 3B02A 4M3EA 5BS6A 1LVAA 5IT9K 2EQRA 3HHGA 3K4CA 5JFRA 3CUOA 4M72A 4HF2A 3OYKA 5GXQB 1KX3A 3RDIA 4BQQA 1I1SA 5B33C 3S1MJ 1SEUA 3REKA 2ZSHB 2HTJA 3B6FC 2HOEA 5HNHA 2JUGA 3HOUJ 2QZ8A 3E5QA 1TWHJ 4YFKF 2CV1A 1TZYA 1YIOA 2OQRA 3H5RA 4FTHA 5AY8B 2JTVA 1D8KA 1XMKA 2CW0F 4G91C 2UV1A 1DU0A 2E2IJ 4KGCD 2FX0A 4FE4A 1QQIA 2STWA 1S5LC 4G6QA 4HQEA 3OS2A 5FLXZ 4RB3C 1FBSA 2ZJPF 3LQQA 3FXRA 1VQOI 2GIZA 4L9VA 4HEA2 5LGUA 4A3LJ 3I4MJ 2NZDB 3MN2A 5FRNA 4HNUA 5D8LB 4YM6C 4A3KJ 2H27A 3HGGA 1TQPA 2KDOA 5J6XA 3NQUB 1LPQA 1Z2CB 2HIOC 1I3AA 4RB0A 4A3DJ 4XSZF 1Y39A 5CPID 5J4YA 3KUYA 1P3BA 1DP7P 2PJPA 3ZXSA 2JJ7A 1OCPA 3AL0B 1WJAA 1SVMA 2DA4A 4IVNA 1WI3A 1D1CA 4ANJA 3ABLH 1R58A 1KX3D 5AV9C 3WTUC 3RYRA 2X85A 4H0EA 2GBYA 4PFOA 2M4GA 2K9SA 4WZSB 4ASNA 2EV5A 2K27A 5AIQA 4JJNA 3AV2A 2F8NG 2E1MC 4U0YA 3LZ1D 1X1BA 3FMSA 4S0HB 1ZRDA 3AZMA 2L9VA 1P3KA 2LNBA 4XSXF 5CVIA 4ZUXB 1Q9CA 4RGXA 3AZGA 4B8XA 5JVTA 2XASA 4LK0F 1YRNA 1GUUA 5GXQC 3U2RA 2NAZA 4CSWA 1IUFA 3PSIA 3E97A 2LKXA 3JCUC 1TTYA 4WCGA 3BQZA 3OYIA 5KDMB 3FZVA 1P4XA 2FA5A 1KGSA 3PIPF 1TC3C 1HOMA 4L5IA 1MJAA 1UELB 2VN2A 3W98A 3MVPA 1LDKB 3GMEA 3RPQA 3S3OA 2Y9YA 4C2MJ 3ABUA 1O3SA 2X6OA 2XDVA 2VASA 3CUQB 4KYWA 2L5AA 3A6NC 1IXSB 2WV1A 3KUYD 1HBXG 3KSYA 5EEAA 1IF1A 2NZDC 5DYMA 2VI6A 4IXAA 4B3AA 5CPKA 1P9QC 2X51A 3M9AA 2LY9A 4AYBN 2L3DA 3P7NA 4RS8A 4LB5A 2KHMA 3WHCA 2UZKA 1AOIA 5CVVA 1FOWA 3EETA 3ZQ7A 5C3EJ 4JJND 3AV2D 2CMPA 1ID3B 2QQ9A 4Z66B 4I98B 2ELJA 2M4KA 3AZMD 1REPC 2FMLA 4DW6A 1P3KD 2XF5A 2AS5F 1KQ0A 1RKWA 5D6EA 4P55A 2HEOA 2QSHX 4BXFA 3KXBA 2XPUA 1V55H 3L00A 4EJOA 2XROA 3MD2A 3P9IA 3A1YA 4UUSA 3DU6A 3L2QA 1T39A 4GFBA 3H3VK 3MGRB 2JA7J 5CPJA 5AVBA 1K61A 1HXDA 4BJ6C 3CCVI 3TOBA 1VF9A 3K6GA 3W3CA 3OSGA 4OIRF 5DD4A 1HKSA 5K1YA 3W98D 2VPRA 2BHZA 2E7WA 3HSEA 3KFWX 3NAUA 4GYIA 2IO5C 2LH9A 3MFKA 5IYBJ 4QLCB 1P3IB 2UUZA 5ILUA 3BCAA 2Z16A 3Q3SA 4CAYB 2FSWA 3D5SC 3S32A 4YRVA 5IOZA 3ULQB 2COMA 3UTBC 1AOID 3BG6A 3V4GA 3WTZA 5JVGF 2DPDA 1BI3A 4RB1A 2QEXI 2ZJQF 1K4SA 4DRAA 5GT0B 4BJ5C 1LEAA 2NXNB 1HDPA 3VFZA 1VZ0A 4IQ4A 1UHWA 2E7XA 4ESBA 1XDUA 2KKOA 2WTEA 4TV7A 2XV4S 3J7YJ 5HNFA 4IHYA 1UHSA 3H5AA 2KISA 3HSFA 5CPJD 3WE2A 5AVBD 5AV5C 2QKMB 3R0JA 3P5JA 3LMMA 2QSFX 4P9FA 3SZPA 2HYGD 4MEXF 1UG2A 3K1MA 3P9KA 2R4GA 4M3BA 1ID3C 2ZMEB 4XZQA 2ZFWA 2VONA 4Q4ZF 1V3FA 1HLVA 1JKPC 1O7FA 3V9RB 2AROA 4V2FA 3JR9A 2EZKA 3X2QH 1KX4A 2NYXA 3F8CA 3D5RC 2X1DA 4C3JJ 2Q1ZB 3SHFA 2ZBKA 1A31A 2HOTA 3REJC 3DXJF 3HRMA 1S32B 3OV8A 3RKWA 1NK2P 2QA4I 1ZREA 1FSEA 3A4CA 1PP7U 3X1SA 1XMXA 4PSWA 3KP3A 5K5QA 3X1TB 2EB7A 1JI8A 1P3IC 1ZLAA 2YPRA 4UV8A 5ICFA 3FMQA 3OIQA 4ITVA 2L7KA 1HSJA 5EDNA 3SJMA 1KX5A 4Y33A 3L2UA 3GLLA 2ZC2A 3WHBA 3SZGA 1D5YA 4CGZA 2ZKZA 2BZTA 1YIJI 2AQEA 1O3TA 3REHB 5ILVA 4A12A 2BY0A 3I56I 4A93J 4R1HA 5FLVA 1OLTA 2JK3A 2F48A 2X9DA 1LVKA 3WU0A 3BR5A 2CW7A 5IPAA 2VPLA 1GHCA 4JBAA 4J8XB 4RM2A 4XZQD 3FXKA 4NFTA 3CF5F 3I64A 2OBPA 4CCNA 1STZA 2Q0OA 3GLXA 2AROD 3BY6A 1ZR4A 2NVTJ 4HYEA 4CYDA 4H9QA 3UT9D 5M3FJ 3BTJA 1N25A 1YW8A 2HU9A 1OQYA 4XRMA 4KHAB 3REID 3AZLC 4KUDA 5A2QZ 1I6XA 3Q9VA 5GAHJ 1GT0C 1GXPA 2KQRA 4BQNA 4YEJA 3A03A 1IV6A 2MA3A 5E8IA 5IP6A 1WJEA 1FEXA 2KRCA 3S8PA 3D5LA 3QU6A 1FC3A 3FXQA 2XAJA 1T33A 3E6DA 2WADA 3ASNH 2DXIA 1Z21A 1PZRA 3A1IA 2K9NA 2JA2A 5BNVB 2JA5J 3LA2A 4MFEA 3TO9A 4AYBA 2O7OA 5DDGA 1X4OA 3IRQA 1B72A 3D0SA 3VYTB 1R4MB 4U7DA 4NC8A 4UXNA 3WODF 1P3OC 1QZZA 2QGUA 2DN0A 4FASD 4E70A 4YS3A 1YFHA 3ZMTA 3AN2B 4E7HA 5IY5H 4QWQA 3OYNA 3AZJB 2DFHA 3CESA 4AC0A 3CMAI 4CHUA 3QAHA 1B6AA 4ZDOA 1W5TA 2D2WA 3X1TC 1TBXA 1GLNA 4NB5A 4UUTA 3KEQA 5M5YJ 3F8BA 3FIWA 3MKZA 1JJ8C 2EK5A 2RDPA 4E4HA 3R45B 3NQOA 3AZED 2KL4A 1VQKI 2YFVB 3UTAA 2BYMB 2R92J 1VI0A 1J09A 1NTCA 2OF7A 4XBFA 4XQFA 1ZARA 4WV4B 1IN7A 1KA8A 3ERMA 2DYSH 5B1MB 4HA8A 2HPMA 2X6YA 3O62A 5DNNC 2O61A 5KK1A 4C2UA 1BH9B 4J8XC 4F52A 4BU2A 4IQJA 3X1VA 4A5MA 1KU3A 3CDHA 4XICA 4M71A 1BIBA 1XS9A 3VH6A 3CJNA 3L09A 3J7AY 5B1LA 3JRHA 3RELA 4CZZA 4W97A 2XSJC 4MHGA 2LBFB 1ETQA 2G9WA 3E6CC 4G9YA 4UVCA 3UR3C 3TDUC 4D5FA 1G3SA 2X6WA 3V8KA 4R8PC 1TT0A 2BVMA 4GO1A 1SFUA 2DJIA 3IH3A 2JQ7A 1Z1DA 1LFBA 1V4RA 3V7SA 3WAAA 1V5EA 2DO7A 2LTPA 4H4KC 3EUHC 2LC2A 2HTSA 4WU9B 5B0YC 3ZMSA 3FXJA 3TO6A 2ESNA 2VBWA 1IW7F 2TDXA 3HPGA 2I10A 3EQLF 3VSLA 1FP1D 1IG7A 2FUG2 4LD9B 1UB9A 2RV8A 3AN2C 2OU2A 1R5GA 3C1BA 1IZ1A 3AZJC 4BY1J 2OJED 2JSCA 1Z05A 4PSXA 2VXDA 4ZDPA 4ENNA 3N4MA 2BYVE 4H9PA 4OIOF 1MJBA 3X1VD 2GXAA 3KP2A 5AVCC 4ETSA 2DDBA 2DI3A 3E5XA 5B1LD 4O5VA 4H9OA 3I59B 1OYIA 1SFKA 3WKJA 3HUGB 5JLXA 1F66A 2Q2EB 3PNVA 5J3LA 3L2RA 2RAEA 2EFWA 1WJ5A 2PFBA 4A0ZA 4KGCB 2HYJA 2MYSA 3T0YA 6PAXA 3W96A 4Q47A 2B9SA 4CCKA 1MH3A 5BNXB 2GLOA 3R60A 1ENHA 3CF2A 3VH5T 5E5AC 3WAAD 4LD9C 3JREA 3K70C 4AWLC 2XF6A 1U9NA 2CRGA 3WTPA 5K5RA 1H9GA 2ADUA 3WTWC 3ZMVA 5AIPA 1RR7A 1P3PA 2E36A 3T1BA 1D1AA 1VQPI 3LQRA 4BAYA 2W57A 3C1BD 5CPIB 2X1CA 5GSUB 2Q8KA 2EIJH 4KMFA 1TAFB 2Y2MA 3BQYA 1VQ5I 4HDUA 2KIQA 4CSRB 4JP0A 1ZG5A 2EIKH 1VQ8I 3WA9B 3U21A 4L9NA 3MGQA 4G94A 3AZNA 2Y2PA 4DRBA 3LSMA 1T08B 1AU7A 4C30A 2E71A 3K4JA 2YX7A 2CG4A 1DUXC 3LZ1B 2IGKA 4HZFA 4XLCA 3G4SI 2FOKA 3NQJB 1YE9A 2DU9A 3WA9A 2RN7A 4JYKA 3COAC 5B31G 2XGDA 2Y48A 3IL2A 5B32A 1YTYA 2EA2A 5FD5A 4ZJZA 4BKXA 1K7AA 5AONA 1P3AA 3BOQA 3V8LA 4B1RA 2D45A 5GT3A 4A6EA 5CP6A 1HF0A 3WTPD 4XOTA 1JGGA 3A0HC 5HVQC 4WU8B 1N1JA 5BO0B 5HLIA 2HQNA 1NK3P 4LG0A 4E44A 2LF7A 2M5WA 4KGCC 1MSFC 3S15J 1W0UA 2WAEA 2KZGA 1FY7A 3W99A 3QOEA 4XRSA 4LOCA 2Y2KA 4PUSA 4CYCA 5M3MJ 3C18A 3R4KA 2DQNC 2CV0A 1E3PA 2L9NA 3J80K 2ZM5A 3JTHA 1KYZA 3AV2B 4JJNB 3MZYA 2GIVA 1T0FA 5CPIC 3A02A 1G3YA 5EGOB 4M3FA 3HG9A 4EMSA 5C44J 5AV8A 1D0XA 3MKWB 5BPDA 5HDNA 3GFLA 1VNDA 3HB9A 2W85A 1YRNB 3KYCB 3AG1H 1F36A 1OCOH 1LEBA 1KX3C 2R5YA 2CSOA 5GT3D 2L4MA 3GBGA 1D0YA 2XRLA 5CP6D 1MBHA 2Y0MA 3PL8A 2V1XA 4HGAC 3RKXA 4P1WA 2V7FA 4XR6A 1HSTA 1YG2A 1X3UA 2Y9ZA 3LZ1C 3OIOA 2YFWB 3L9FA 5LGNA 4ZYGA 1U5TA 2VL8A 3WTXC 3RYPA 1NH3A 1VQ7I 4XUJA 3VDXA 5HDGA 1U35A 4E7LA 1B8IB 3JTGA 1Z7UA 1BC8C 4BBSJ 3EPLA 4HLXA 1SC7A 2RKHA 3KE2A 2QYOA 4AM3A 3JRFA 1ZELA 2HXIA 2XAQA 5JHFA 1RI7A 3REOA 1GVDA 4QLCU 1A5JA 3PNYA 1M18B 1BR4A 1D0ZA 3TP3A 2V79A 3KUYC 4ZC3A 3MGSD 2YUSA 4I0AA 4RAYA 4IO9F 3K4LA 3SFIA 1BL0A 2CV2A 5AV8D 4X23A 1TWFJ 2DTZA 3HRSA 3S14J 5FLXK 1W5CC 2HGCA 2ZXHA 4JQFA 1ODDA 1OCRH 5L3BA 1R23A 1ZYRF 2F2EA 4BEHA 2HQRA 3O8GA 3ZQGA 3F6OA 3AV2C 1N78A 4JJNC 3MVDA 4NE6A 5KVRA 3O3KA 2BGCA 4UB6C 1OCTC 1ZG1A 3MAJA 1E3OC 1DPUA 4MFDA 3IP4B 1XGOA 3AZMC 2LRDA 1P3KC 2A61A 3FX3A 4M3GA 1SD4A 4F55A 4XUJD 2V1UA 4CDGA 3LELA 2IT0A 2BBYA 3WGHA 4XLEA 3AZIA 3PJRA 1BR2A 3KPHA 4M73A 4R8PD 2MBFA 2MGQA 2WC2A 1OYWA 4QSHA 2GM4A 1IN6A 3KP4A 1FWZA 2Y31A 1HW1A 3AFAA 2YS9A 2IGNA 1PUFB 2K9LA 3LA3A 5FKNA 2QWWA 3W98C 4HG2A 2D1HA 2V6CA 5B0YD 3BJAA 2V4JC 1Y1VJ 3CCRI 5BPIA 1PP8F 3EPKA 1J0RA 3EPHA 4AIDA 1YHQI 4BHPA 4X23D 2F8NB 3VOEA 1BI0A 4E7JA 5CPKC 4L0ZB 2LY2A 3OR2C 3B0CT 1ETWA 1BM9A 2EILH 1M19D 2HNHA 1TP4A 2QQ8A 1QPMA 2A6EF 4WXHA 3S2DJ 4UUZB 1P7IA 1AOIC 5B31D 1JUPA 3MVDD 2E60A 5B0ZD 3F0CA 1T6SA 3G6EI 4J8VA 4ZYHA 1P3FA 3QYEA 4A2UA 3LZ0D 4I09A 3SDBA 5E20A 3B6FB 1X1DA 2A69F 2CQXA 3JW4A 3C2HA 3CJQB 3KXBC 4DIQA 4G91B 4Y17A 1YS6A 3RTRA 3UT9B 3B6AA 3REIB 5E1WA 1B4AA 4IOAF 1JKQC 5AVBC 1TWGJ 5CPJC 5JRGA 4OMZA 3KZIC 3IRRA 4B09A 2VJJA 1RPWA 1ETOA 3DKWA 3C2GA 2LF8A 2PMHA 4MLOA 5ILSA 2IS1A 2KDZA 3IP4C 5CYVA 1P3MA 2JWTA 3TQNA 4ZDLA 1TT5B 1R5HA 1EQZD 5CPRB 1LDDA 1LE8B 4BQAA 3RCOA 1ZAOA 1A6IA 1EH8A 3A1KA 3ZQLA 2L7ZA 5D4SA 2XB5A 1WH5A 4RM3A 2F5DA 2JMWA 3CCJI 1HW2A 1BI2A 2DMNA 5HLHA 4L18B 5AV6A 2FF4A 3LFUA 4OIPF 1SANA 3ERED 5HLTA 2A68F 5AV9B 4J8VD 2Y2IA 4BS9A 3BG7A 4OAZA 1Y1WJ 4LITA 2WAQN 2E35A 4C3HJ 1T2KA 4A5NA 4L5EA 4IHTA 3AZEB 4M74A 4DJAA 3NRVA 1QHGA 2VE9A 5B2JA 1YLFA 3ECOA 4LK1F 1MMAA 2LG4A 3QP6A 5HS8A 1EH6A 1ZGJA 4H9RA 2HKXA 5JRGD 4DZPA 4RAGA 1BC7C 1TW3A 3FF5A 5F99D 1JTYA 1LB2A 4K2EA 1WJFA 1IDYA 3CCUI 1Z91A 2UXXA 1QU3A 4XZQC 1IN8A 4BE2A 1P3MD 1BIAA 1FYLA 5GAEJ 1XMAA 3S3MA 4UHTA 1IV8A 4LJZF 3H3UA 2AROC 3OYEA 3DWLE 3PIOF 3WTVC 3OSFA 1UJ8A 2ETHA 3QYFA 5JR3A 1T38A 1IUYA 5CHLB 1JHHA 3NEUA 3MZHA 5D5VB 1IJWC 1G4DA 3UT9C 3AZHA 3REIC 2GOXB 2FJ7A 4XM3A 5HODA 5G49A 3LSGA 3A6NB 3BROA 3LSKA 2K5CA 2ZFUA 1M1AA 2F5CA 1A36A 5M5WJ 4WF2A 3EUAA 2XGCA 2GZWA 1QZEA 3X1SC 1D1BA 2V9KA 4PGGA 3KP7A 1H3OB 1YS7A 5KCMA 1FZPB 1ZLAC 1NG6A 1Z3YA 4JX4A 4PDKA 5ICEA 2DA3A 2FQ4A 4RMNA 1F1EA 4IL6C 4E45A 2D1VA 1E2XA 1ZLJA 3DV8A 2DW4A 5B2JD 3MMYB 1RESA 2QBYB 2NQBA 4M9XA 2JSPA 4HW0A 2PG4A 1EH7A 2GA2A 2KPMA 2KT0A 4BXUA 4EATA 2A3SA 4Z5TA 2ZCWA 2IBDA 3EDPA 4HX8A 4B3XA 1FMWA 3GTKJ 3I54A 1LUJB 2BG1A 3F21A 2M30A 1MNDA 3REKD 5C3IC 3FDDA 2XD5A 3JSPA 2IP2A 3X1VB 1X1PA 2EFQA 3J81K 2VE8A 4A3MJ 1BH8B 1TZYD 4J8UA 3AZEC 1ZH5A 4AD9A 5D4RA 1Z9CA 2J5OA 2YX4A 3H0MC 5B1LB 5B40A 3E6BA 1LFPA 2V9PA 4OOIA 2XSDC 1R5ID 2IO5B 5B2IA 3AZHD 4KUDC 2P5KA 1R22A 2LD5A 2FJ7D 5J4VA 4HSTA 4WNNB 2M9HA 2VQGA 2QSGX 1M1AD 2ZSIB 3E0JB 1K4TA 2VLAA 3TW6A 1F9NA 3WTYC 1W36C 2XGXA 4KUMA 4C3IJ 2Y2JA 2FMYA 2MLKA 4D0PA 2ZY3A 3GYHX 2K4JA 3WAAB 3UTBB 3Q9SA 2HVQA 4BHBA 4FT8A 3TDZC 1MIJA 3FISA 3M1CA 1Z67A 3G71I 2CQNA 4KMUX 4BYYA 2A07F 1P3BD 1MKMA 3HC7A 1CGPA 2KP6A 1P2FA 5A2QK 2DF4C 3CTAA 3Q0WA 4X1EA 3AZFA 2DBBA 2K9QA 3IHUA 3MWMA 3ONQA 4II3A 3VSKA 2CUZA 2OQGA 5HS7A 5AV5B 2ELHA 4M6BA 1FBQA 2CW8A 4NNJA 3WTPE 4J8UD 4HLYA 2RQPA 5H6RA 2DMUA 5B40D 3FWEA 3KWQA 3MQ0A 1QPIA 1OKRA 2W48A 3UTAC 4G12A 5L3DA 4RDUA 4IPAA 5DUKA 3W97A 5TJJA 3R6SA 4J8WA 2H6CA 2M34A 1T56A 4AU7A 3AZGD 2KFDA 3HDDA 3O62C 4R8HA 1U8BA 4XLHA 4EO5B 2VJIA 3RI4A 4NC6A 3K9TA 2LLKA 3X1VC 3FBIB 3REJB 1P3LA 4B48A 3WTPB 4Y15A 1DP3A 5B1LC 2XD1A 2PBIA 1F43A 1S3JA 1P34A 3AFHA 3D1NI 5FKLA 2TCTA 3T8TA 2M7AA 3T5XA 5JA4A 4L5JA 1GV2A 1BOBA 1CF7A 5L3CA 3WTSC 1Z0XA 3FM5A 3X1UA 3HBLA 3AYWA 5CPKD 3WG7H 2WAQA 1Q1VA 1HTAA 1S29A 3UKGA 3AZFD 3OWTA 4I01A 4N4OB 2P4WA 4HF1A 3LAJA 3WAAC 2MH2A 4LLLA 2N8GA 2M8GX 2Z9OA 1YITI 2ZNZA 3KWQD 2JE5A 1OYYA 2JN6A 2Z3YA 3JAMZ 3AZKA 2AXTC 4BY7J 2ZNYA 3KX2A 3C1BC 3KXBD 2PYOA 2L9SA 4DNCA 3JRCA 4NQWA 3AZLB 1M1EB 4I76A 1L3LA 3C1CA 1U3EM 3LSHA 1WZ2A 3S1NJ 2CUJA 4U87A 4EJUA 1JHFA 2KRFA 1J9IA 3KP5A 3U1DA 1J75A 3GWZA 3CDIA 3S17J 2P0WA 5L3EA 3WKJC 2AQFA 4UV9A 2R5ZA 3MGPA 1P34D 2H1KA 1DGRM 4LG0B 4D7NA 4PK4A 2IJLA 4IHVA 3CCLI 3I5UA 4UNOA 3W96C 3H0DA 1DPRA 1FIPA 1JUSA 4UUVA 4EO5C 3HL2A 3AYWD 1XCBA 4G6TB 2NNNA 1R71A 1K78A 3GTOJ 5DNMA 2RGVA 2VBYA 2ICWG 1B6WA 1P3OB 2Y69H 1FBUA 4KT6A 5LRSA 4I6ZA 5FRMA 2CQ7A 3ASOH 3B6GA 4IEJA 2EPFA 2M7BA 3WTPC 3HRTA 1SAUA 3DF8A 1MMDA 5EYRA 2XB0X 1K79A 5E8GA 3VPRA 2BYKA 5B33A 1P3PC 2FNAA 3MKYB 4BACA 5M5XJ 4RA2A 1ETKA 1RIOH 3F9KA 2HQAA 4G7OF 2PYOD 1I3QJ 3OYBA 2E5ZA 3MGSB 2O03A 2OA4A 3ZR8X 4OWRB 4G8XA 3SDGA 2EINH 2WY7Q 5AV8B 3VYRB 3C1CD 2WV0A 2DQRA 3H0GJ 3PM1A 2XPVA 4XLAA 2X4HA 5ICGA 4DBQA 3CC7I 5DNNB 2KIMA 4RLQA 4YIRX 3BZCA 3L1PA 4MIMA 2DTRA 2M3AA 4WK8F 2LKSA 4YM6A 4II2A 4EV0A 5IYCJ 5E3OA 3DBLB 1X2MA 4ENMA 4J00A 1H9TA 1IGNA 3S16J 1BJZA 4Z6YA 1KX4D 1B59A 2Z99A 4PZJA 2DK8A 2ACJA 1ZQ3P 1ERDA 5D6FA 4YIIA 1TQIA 2B0LA 4ZH4F 2FBHA 4XUJB 1VTNC 2WAFA 3S1QJ 4AIKA 2HOSA 5EEGA 3H9JA 1X1CA 3B6GD 1JGSA 5GT3C 2PQ8A 5CP6C 1BR1A 1UMQA 2KJCA 4H9NB 1WJBA 2FNPA 4R8PB 3HM5A 3X1SD 4BBRJ 1XTAA 1AKHA 2NRAC 1ZLAD 1ULYA 2XRNA 3GTJJ 2ZJRF 2LKPA 5B0YB 3DTIA 3FXMA 1KX5D 2W00A 4RGUA 1RETA 2DOAA 3G1MA 3IUOA 3LFKA 4HX7A 3L2WA 4I2OA 3W99C 1J59A 4HNTA 5ED4A 2R93J 2EZIA 2R7QA 3DLAA 5FJ8J 2JCHA 1MZBA 2CUEA 3ABKH 3QOPA 4I99C 3OOUA 3ECHA 1NHAA 4FISA 2NVUB 1M19B 4BEHB 5CVJA 1VQ9I 3K69A 1P7JA 5FUGB 2FOWA 3A01B 5B31B 3MVDB 3CC4I 1XC5A 2K85A 3CO7C 1G2HA 4IX7A 2YR2A 4KNYA 5AVCB 5B0ZB 1T0FC 5CLSA 4BUPA 5AY8A 3LZ0B 2Y2QA 1BBYA 1C0WA 2OTLI 3MGSC 2BE5F 4DYCA 2P7CB 2W8SA 2OZUA 4A3FJ 4KUDD 5AV8C 1IDZA 2EFOA 4V19K 2CJJA 2QCOA 2K86A 2NNYA 4G6DA 3DPLC 1BJAA 1W36D 1RC9A 2GWRA 3RSNA 3GFIA 5FKMA 5E5AB 1W4MA 4KIBA 4AWLB 2MC3A 3BR6A 4ZYEA 2OZ6A 1OFCX 2O5RA 1U5TC 4PJMA 2JSSA 2F6CA 1MDMB 4XUJC 1A04A 2DA6A 1QBJA 2FE3A 1EQZB 2ID3A 5B32G 1MBEA 4A3IJ 3VH5W 2MLGA 3BR2A 4ZTJA 4YS3D 3AV1A 4M9SA 3BTCA 2GXGA 1JFIB 1Z7LA 1JJ6C 1UHMA 4KIFA 5L3GA 1S7AA 3MCZA 5CKTA 5C4XJ 1K6YA 1HKQA 1R00A 2WB1N 5HOOA 4GCVA 1TNTA 4I7HA 5FFXA 1WGXA 3GVAA 4KIGA 3UTAD 4XRSG 1VQ6I 4AIHA 3BDDA 4X23C 1QRYA 3BP8A 4FHTA 4ZUXA 3VEPA 4XLFA 3E5UA 3W2WA 4RB2C 4S04A 5LHGA 3CCMI 2LP0A 1H0MA 5FD6A 3O62D 1TWCJ 2NS7A 4ON0A 4HX4A 5B66C 1O3RA 2UWMA 1M19C 1TNSA 3FKJA 3CCSI 1YO5C 2XKOA 4XLPF 1X1AA 5B31C 3MVDC 1AA7A 5B0ZC 3HIFA 3LOCA 2DLLA 2H6BA 5KDMA 5F99B 3LZ0C 5LRRA 1ZLAB 1PDNC 1P3MB 2P6TA 3RELD 1F4KA 4LIUA 3BR0A 3BC8A 1OR7A 4XKBA 2JVGA 2KIUA 2OCEA 5FGMA 3CUQA 2PMZN 3ML6A 3W6VA 3AZIC 3CC2I 3R61A 3AV1D 2OC6A 2CQKA 4RLFA 2HUEC 4IRIA 1FYMA 1ZHFA 4XN3A 3IKVA 2HS5A 5C4JJ 3DLLF 4LD5A 3JRAA 4UB8C 4D5CA 4HDVA 2H09A 1L0OC 5EG0A 1SMTA 3HTSB 4Z66A 4QPQA 3RQ4A 1FIAA 1EQZC 3LA7A 2RVCA 2FD5A 3M8EA 1WWXA 3CP2A 1APLC 4NE3A 1F5TA 2VC1A 1WPKA 3GZ6A 3LSPA 2IS2A 4UPKA 3IAS2 4JX6A 4CO8A 2LK2A 2VOOA 2NVXJ 4DZJA 5HLGA 3MGRA 2RNGA 1ZKGA 2L5QA 1KX3B 3ABTA 4J8VC 1U9OA 2CV5A 2VJ5A 2W25A 3REKB 1SD7A 3OYHA 3E3VA 3G3ZA 2JRTA 3WKJD 1XSVA 2Z2SB 3WU2C 1TZYB 4HGAB 1F66D 4QLCA 2K3PA 3DFGA 2A5YB 1P3IA 1H89C 4CAYA 3W96D 2E34A 3I53A 2HKOA 4OU0A 2H94A 1XN7A 5JRGC 1KQ8A 2VBZA 1ZRCA 1M1AB 2FFFB 5EZHA 5F99C 3AG2H 3H3ZA 1P3MC 1Q1HA 1HKTA 2GOMA 4XMYA 4Z66D 1P3PD 2VKVA 4E7ZA 3N97A 5B3SH 3BZKA 3IKTA 4OINF 2MG4A 5GT0A 4CCOA 1XD7A 2EZLA 3OYFA 3FM3A 3BG5A 3FK6A 1KZHA 1TLHB 1LKXA 3KUYB 4A0YA 1P3BB 2AO9A 4A3CJ 1LQ1A 4HV6A 2XIGA 5AV6C 3CMMA 1I27A 2LVSA 2IRFG 2CV5D 4BE0A 1JUMA 2ZMEA 3MGQD 3G1LA 3AZND 3M3YJ 4P96A 3I3LA 4QLCD 5B2JC 2UXNA 5B40B 3V9RA 4IF4A 4ZBJB 4EM0B 3AZMB 3JRGA 2K3FA 1P3KB 4XNFA 5LHIA 2BY3A 2CU7A 5TRDA 2M45A 4N4NB 1O3QA 1QVUA 3CMYA 1TW2A 3DBHB 2Y2ZA 3BCBA 2F4IA 2JT1A 5FKKA 3AZGB 5B32D 3B73A 3NARA 5KAIC 1KYWA 1P3AD 3REKC 2CFOA 5BT1D 1S32A 2DJNA 3L7WA 4C9YA 1TZYC 2GQQA 3HRUA 3X1TA 4G7ZF 1XGNA 4WXDA 2ZB9A 3S3NA 1WH7A 3W98B 4HSRA 3AZHC 4RAZA 3DCFA 1D8JA 2FJ7C 2A6TA 2Y2GA 3F6VA 3W99D 1RZ4A 3REHA 1M1AC 3DEEA 2WB1A 3CZ6A 1U8RA 1E0EA 2OPTA 3GZNB 5CPKB 3BZ6A 1MGTA 3CLOA 4RGRA 5F0HA 1YJ9I 2DQLA 1MJ9A 5DCFA 3VYUB 1LNWA 2L4AA 3S93A 1ZLKA 1AOIB 3HXLA 1HQ3A 3IAM2 3PQJA 4IKFA 4J8XA 2DA1A 2BV6A 5J40A 1YX5A 3HJEA 2IPQX 5GTHC 4ZYDA 2DT7B 1ZR2A 3ZGKA 3V8JA 1WQ2A 3K4BA 3GTMJ 3HPHA 1D5VA 3KFUG 2W84A 2NQBC 1P3BC 1XX5A 4L0YB 4ENJA 4KHAA 3VYSB 4Z5TC 1Y0NA 4JOMA 3B0BA 3KXBB 2HFHA 2RNJA 4B44A 3LJAA 3KYLA 1V5GA 1Y8RB 1OISA 3QPHA 4UUSB 4IZZA 1DDNA 1G3WA 4XRFA 1R7JA 4LB6B 5AVBB 5CPJB 1USTA 2PMZA 3OL4A 5IP7J 3OIPA 5IYDJ 4KITB 4J8UC 4NE5A 2MH9A 5B40C 3KZYA 5LEJA 5BNVA 3F72A 3WGGA 4ZBJC 3DQVC 1R1VA 1BN5A 4CH7A 4E7KA 4XKCA 5B2IC 2R7XA 4NUBA 4CA0A 4U0WA 1U35D 3QPTA 1CF7B 3AZGC 4LMYA 4BNCA 2IA2A 2AXLA 3REHD 5H6QA 1I1GA 2DT5A 1JE8A 2GAUA 3AYWB 3RPUA 2XKPA 4O6JA 4D1QA 2BXZA 3AZJA 3O6BB 3VB2A 2DAOA 1YX3A 1IN5A 2PLYA 4IHSA 1HQ3D 3CO6C 1IAWA 1MBKA 4PCQA 2M2EA 3M1EA 3V42A 2FEZA 1X2NA 3KEYA 2YFVA 2ME0A 2BYMA 3E7LA 1EJ9A 1FNNA 1FTZA 2NOGA 1W1WE 2Y2HA 3HKZN 1EV7A 3LJAD 5B1MA 3AZFC 5F1JA 5EZGA 3C1CB 3OY9A 3JRIA 1BH9A 3P5JB 3H92A 1MBGA 2Y30A 5J8FA 3KWQC 2VOPA 1BI1A 4O3MA 3KLOA 1J5YA 1IN4A 2LSOA 2LBFA 2VXZA 5B1AH 4XZQB 3W97C 3SEQA 4WWCA 4KJZA 1PJRA 5HS9A 2AROB 3LELD 4J8WC 1KX4B 3E1SA 3AZID 1U6GA 1KONA 3LSJA 4X0GA 3RPUD 2GA1A 3OOPA 1MBFA 2L2OA 5CVRA 4BJTA 2DCEA 3B6GB 2DT6A 2XUBA 3AFAD 2JRMA 5JLWA 4WU9A 3X1SB 2R7RA 1P34C 2HZDA 2BYKB 1ZN2A 5F6FA 3TU4A 1HA8A 2BVLA 4IJAA 1U2WA
chains in the Genus database with same CATH topology
5F1RA 3B0DB 2QENA 4LD9A 1KX5B 1WRJA 4EGZA 3AYWC 5B1MD 4ESJA 1XSXA 4DQYB 3R0AA 2O8XA 4ENKA 2P6SA 4N0BA 3HTUA 2V9VA 1P3FD 1ZGAA 5C3IB 3I59A 1Z6TA 4AIJA 2K7LA 1ZRFA 2Q2EA 3F8NA 3F23A 2PYOC 3K2ZA 4KGCA 4H9QB 1KU5A 1S8NA 4KUDB 1P4WA 2EV6A 3C1CC 5BNXA 3C3WA 3ISPA 4Z2MH 5E17F 4WU9D 3MGPC 3TU4D 2IVMA 1KX4C 1IRGA 4LLGF 3JAMK 4MQVA 5DNMC 5CPIA 5GSUA 1TAFA 3B6GC 4YS3B 1W5SA 2FRHA 4Q5SF 3VH5A 4CSRA 5AV6D 3WA9A 2Y75A 3GEZA 1XB4A 2YU3A 2RVQD 4MGRA 3VH6T 2VBXA 4G92B 2DK5A 3B0DC 4ZZDA 2RC4A 1KX5C 3LZ1A 3UTAB 1RUOA 3EPJA 3NQJA 4ZZLA 2OAZA 4F7ZA 4I0BA 3EYYA 3O62B 4CXFA 4S05A 1JXSA 3HHHA 1BFMA 5B24A 4WU8A 4U0VA 5BO0A 4A6DA 2K4BA 3RELB 1B67A 3SQNA 3F3XA 5GSUD 4Z2MG 3AV1B 1WWIA 4H9SA 5LGTA 2L02A 3WA9D 2JPBA 4U7BA 1O7LA 3FHZA 4UVAA 5BMZA 1SD5A 3FMRA 5FO5A 2IA0A 5LBQA 1E17A 4EGYA 2NQBD 3F8FA 4YS3C 1P3GA 4Z5TD 1P6RA 3C1BB 4IRHA 5E1XA 3PQKA 4H9PB 4G92C 5B24D 1OMIA 3TGNA 4WU8D 4JK1X 5AY8C 3LWFA 4H9OB 2YFWA 3WKJB 5B2ID 2PI0A 1F66B 3I71A 1RNLA 2O0YA 3W96B 1SMYF 2MD5A 3HOTA 1KU7A 1SAXA 3MNNA 3RELC 1B9NA 1GXQA 1P4AA 5D5WB 1M18A 2R7DA 1P3PB 2C6YA 2STTA 2VQRA 3H0LC 2QLZA 5BS7A 3I0TA 3AV1C 5DV5A 1P3GD 3AL0C 3FXUA 3GO5A 1SFEA 1YW9A 3VODA 5DCMA 2E1CA 2CV5B 1GVJA 1SD6A 3GF2A 5CVUA 1AWCA 3MGQB 3AZNB 1Y0UA 3W97D 5CJ9A 3ZPLA 4ZUXC 2X0LA 4J8WD 3K1NA 4YFNF 1KU2A 4HV5A 5IT9Z 2FBKA 3DEUA 3IC7A 5B32B 3QRFF 5E18F 1P3AB 5GT3B 1P3LD 5CP6B 3MNND 1S6LA 4WX9A 4EM2A 1N1JB 1M18D 1F66C 2O3FA 1ON1A 3CUQC 3SXYA 1UCRA 3GX4X 4EM1A 2F8NA 3X1UD 5BOXA 2G5HC 4YG2F 3W99B 3ZN1A 2A6HF 3BJOA 1RUNA 3KEOA 1A7WA 1LJ9A 4UUZA 1KQ9A 2RIQA 3I4PA 2VODA 4Z66C 1R36A 3B6FA 3T8RA 1J7KA 3AZKD 4LLNA 2E1NA 1FYKA 1QO0D 2Y2OA 2QM3A 3LAPA 1QGPA 3UT9A 4HAMA 3QP5A 2LDUA 3REIA 4M6YA 3MGRC 3BPXA 2CV5C 1ON2A 4A0XA 3MGQC 3AZNC 1YQAA 3J81Z 3MGPD 4QLCC 2HIOA 3J7AO 1U5TB 2F8ND 1W7PA 2R3SA 1U35B 1W2EA 5DNMD 4MEYF 4Y13A 5B32C 2YSRA 1J2XA 5DEQA 3AAFA 1P3AC 3LSTA 5FFZA 5BT1C 5JHUA 1HW5A 3E6MA 4M6XA 5AV9A 1ONVA 2VT2A 4L9JA 1IXCA 5B33D 1HQ3B 5H20A 1FX7A 2F5FA 5L3FA 3B6FD 2P8TA 2K02A 5GT0C 3AZEA 5ERIA 3C7JA 3DP7A 3QU3A 2JZYA 2LY8A 4KDPA 4X23B 2ISZA 3LJAB 2M8EA 4HBLA 5GXQA 1AOYA 2FQ3A 2QVOA 2XHKA 2DFIA 4YM6D 3WU1B 3TOAA 2EA4A 2VC0A 3K0LA 2HIOD 2P5LC 2ZY2A 1W7PD 3ZN0A 1FSHA 3LELB 1WKMA 2XAHA 1B1BA 3A6NA 3AZIB 3MEXA 2L54A 2NZDA 2ZXJA 1S32C 2HUEB 3GFMA 3RJPA 5AV9D 1BOAA 3ELKA 3AFAB 1H3OA 5DUIA 3NQUA 1QNTA 4XLNF 2F2AC 1U35C 2QBYA 5LEKA 4GGGA 4KT5C 3REHC 3M8FA 5FB2A 1XDSA 4GXOA 3IWZA 3ZP5A 2EV0A 2EJRA 5GXQD 4N9IA 5LLQA 1HQ3C 1SFXA 4NHJA 1BH8A 4J8VB 4EJVA 1P3FB 5AY8D 3V7CA 5HDKA 1B9MA 2O6GE 3EYIA 1FOKA 2CYYA 3A6ND 4WNNA 3LJAC 4MQ9F 1FP2A 2NZDD 2GXBA 5JRGB 4ESFA 5BQTA 3UTBA 4G7HF 2FU4A 3TU4B 4HOBA 3BWGA 3DPTA 3W6KB 3LELC 5JI6A 3H0RC 3JSOA 2KJBA 2IW5A 2ISYA 1TQMA 3AFAC 3GW2A 3KP6A 5AV5A 5AV6B 4CICA 1R4VA 4Z2YA 1ID3A 2CGPA 3GZ5A 4BH9A 1K6OA 5B2JB 4ZUXD 2CO5A 4EQQA 5B1MC 3HOSA 3M7GA 4L9TA 4H9RB 3RIRA 2BEOA 1FPQA 3REJA 3UTBD 1P3FC 3GFJA 2P5VA 3O2PE 3TO7A 3L2CA 2R7FA 3KETA 2ZO4A 2Y2NA 1F1ZA 3G73A 3Q5FA 2EFNA 3ZMZA