2CWEA

Crystal structure of hypothetical transcriptional regulator protein, ph1932 from pyrococcus horikoshii ot3
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
191
structure length
191
Chain Sequence
AKKVKVITDPEVIKVMLEDTRRKILKLLRNKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTEMKGNLVEKYYGRTADVFYINLYLGDEELRYIARSRLKTKIDIFKRLGYQFEENELLNIMDRMSQKEFDATVRISKYIEEKEDALKDFSNEDIIHAIEWLSTAELARDEEYLELLKRLGSILKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical transcription regulator protein, PH1932
publication title Crystal structure of hypothetical transcriptional regulator protein, PH1932 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Gene regulation
total genus 74
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2005-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2cweA01
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2cweA02
2XASA 3FMRA 3HUGA 4AWLC 2L54A 1JHFA 4WU9B 5B0ZB 2QZ8A 3REJD 2BV6A 3K1PA 3V8KA 2A07F 5DNNA 3O62A 5CYVA 4J8UB 2FXAA 2L4MA 2L01A 2Q0OA 1XMKA 5HS7A 5AVCC 3ERED 3UTAA 1V3FA 3AZFD 2K4BA 3J7AO 4IXAA 3NEUA 1HSTA 3MNNA 1ZLAD 3NQUA 1YS7A 4H9NB 1J2XA 4WU8A 4XSZF 3REKB 3KP3A 2LF8A 1F66D 4ZYEA 3SFZA 2XAQA 5B2IB 5B40C 2FJ7B 1IXSB 4J8XC 1KX5B 1LDJA 4RGXA 3KP5A 3WTZA 1KX4D 2HTJA 2RDPA 4M74A 2L3DA 4EJUA 3MGRA 5B2JD 1G3TA 2L4AA 4G91B 3RYRA 5CP6B 1BFMA 1ZG5A 4RB0A 2H27A 3DKWA 3X1VA 5AV8C 1U8RA 2EA4A 3ECHA 5AVBC 1FBUA 3R45B 5AV5D 5TJJA 4IF4A 4ESJA 4GYGA 1EV7A 3HRSA 1I6XA 2VBYA 3DQVC 4RAZA 4EMSA 4ZBJB 3L00A 2BYKA 1QZZA 2NQBB 1H0MA 3WA9C 2CYYA 5CVJA 4XUJA 4RB2C 3AZGC 5LHHA 1SFXA 3CTAA 1ZRCA 4IRHA 2HIOD 3L9FA 3RDIA 2PYOA 3DPLC 1K78B 5B0YA 1R7JA 1P3KA 5GT3B 1USSA 3W96D 5JA4A 5FUGA 3MGQA 1TZYB 3TO7A 3VH5T 5B33D 3NQJA 1FLIA 1WWIA 4XSXF 3I0TA 3KZZA 3FF5A 2PI0A 2DI3A 5E5AB 1P3IC 2PBIA 5HS8A 3WTWC 1TW3A 3L09A 2QBYB 4EV0A 4JK1X 3DV8A 1YLFA 3ECOA 4KGCB 4LG0A 2W25A 2JSSA 4J8WB 1P3GD 5K1YA 3KXBA 1MJAA 2QQBA 3KWQC 3ZN0A 5ILUA 3C1CD 4M9SA 1TW2A 3CJNA 5IT3A 4Z5TC 3FMSA 4L5IA 1YG2A 1B9NA 2ZO4A 4Z66C 4L9NA 1ZH5A 4RS8A 4G7HF 5AVCA 3RELC 1H9TA 5F99D 1QQIA 1U3EM 1U78A 2IO5C 3T0YA 1J59A 1P3PB 1XMAA 4G7OF 2WTEA 3AZKB 4YFXF 1C0WA 2DAOA 4I0BA 5BT1D 1LDDA 3LZ1C 4RGUA 3O3KA 4HA8A 3RPUA 4HOBA 4KA4A 4U7BA 3LJAD 5B40A 1E2XA 3K1MA 5B32C 4J8XA 3A6ND 4JJNB 2KIFA 4ON0A 1SD5A 5AONA 2FF4A 2XAGA 4ZUXB 2RQPA 2L5AA 3ABTA 1Z7UA 3F8BA 2EK5A 3SQNA 5B1LA 5AV8A 2QENA 5AVBA 2CSOA 1D3YA 1FY7A 3AZMD 5HLGA 4EM2A 2E1NA 1SFUA 3VH6T 2K7LA 1RUOA 1YW7A 5LGTA 4CSRA 5AIQA 1H3OA 4R8PD 3C7JA 1FPQA 1J5YA 3AZGA 1YS6A 4LB6B 1IUYA 1O3TA 4I98B 3I64A 2F8ND 1M18D 5D5UB 3MZHA 3K0LA 1P2FA 1TAFA 4QLCD 3ZN1A 5JRGC 3O62B 3AZID 1P3BD 5KVRA 2BE5F 4A0XA 2JZYA 3ML6A 2WWYA 2HKXA 2IRFG 5FO5A 3AV2C 3LFKA 1P3OD 3AZJB 4HLYA 4ZYDA 3KP4A 5B1MD 1PP7U 3HTUA 3Q5FA 2YFVA 3AV1D 1P3IA 3HSRA 5CPIC 3NQUB 1B6AA 2CV5C 3GLXA 5FD6A 4KIFA 3WAAC 4WU8B 1P3FB 4Y13A 1BBYA 2IA2A 3HYIA 3N97A 4EJOA 1JFIA 4WF2A 1FOKA 3KEOA 5ILVA 4CYDA 5LEKA 5AV6D 1TQIA 3TQNA 3L7WA 3EQLF 1I1SA 4Z5TA 2W57A 4HQMA 4CO8A 5D8KB 2FBKA 4Z66A 3MGRB 4LD9C 2P6SA 1BOAA 4A5NA 5BO0A 3B6FC 5CVUA 2EFPA 3RELA 5DNMD 1AOYA 4K2EA 4AIJA 1S7AA 2MD5A 3B0CT 2F2EA 3OV8A 3X1VB 2YFWA 3SHFA 2QLZA 4BQAA 3GYHX 3TU4B 1P92A 2J5OA 1O7FA 3CUQB 5ILSA 2VBWA 3QOPA 1YQAA 5GT0B 5E8GA 1T39A 3LZ1A 3F8CA 1IN5A 4HYEA 4YFKF 5FB2A 2M30A 4BHBA 4G6QA 5B32A 1S32D 3JW4A 4IPAA 1QGPA 1QPMA 1Z05A 1EQZC 3WTYC 4Z2MG 5LEJA 3R4KA 5B0YB 2F5FA 3W97D 3I4PA 2M5WA 2P7CB 3X1SC 2MLKA 1OR7A 2VE9A 3TKYA 3I59A 3NQJB 4M73A 1P3LC 1U6GA 3AFAD 3C1DA 3GZ6A 2EJRA 5K5RA 1VTNC 3J81Z 3X1UD 1ID3D 1T6SA 4OIPF 4YS3C 4ZYGA 1GXPA 5FLXK 5GSUB 5CPKC 5KDMA 1U35A 2W85A 2RV8A 2LF7A 3V7CA 3KSYA 3BPXA 3REJC 2DO7A 5LHGA 3LA7A 2DW4A 1IN8A 2W84A 4OMYA 4AWLB 1E17A 3AZFC 3G73A 1N1JA 5JRGA 1MZBA 4G92B 3ROUA 4X23D 5J8FA 5AVCB 3AZEB 3PQJA 3AV2A 2V79A 1IRFA 4GXOA 3IRRA 5DD4A 1TNSA 3FMQA 3B0BA 3QU3A 2ETHA 1F66C 3KLNA 3RI4A 5CPIA 1KX3D 3WAAA 5FFXA 4G7ZF 5ERIA 3MGSD 1QZYA 1KX4C 2ZJ2A 4AWXB 3WKJD 5B2JC 2K27A 4UV8A 3WTUC 1HQ3D 1ZREA 2QUFA 2XKPA 5E18F 3C1BD 2DQLA 3H92A 5GXQD 1OPCA 4LD9A 4Z2YA 5B24D 5AV5C 3B6FA 3VEPA 1FX7A 3WE2A 2A61A 4A2UA 5AY8D 3W99C 1BM9A 2HEOA 2JRTA 1IN6A 2J5PA 5B1LB 5AV8B 1P3AD 1M1AB 3GO5A 2UXNA 1MKMA 1U5TC 4NE3A 1FYLA 4EVIA 3I53A 4RGSA 5K5OA 3TO6A 4E44A 2ISZA 3WTPB 4LMYA 1W7PA 1ULYA 2HIOC 1B1BA 4G9YA 4J8UD 3ELKA 1D8KA 2GA1A 3AZGB 1ZRFA 4HX8A 3W96C 5ICFA 4WWCA 3R60A 1JHHA 2YSRA 3AZNB 2ZNZA 3HHGA 1EQZA 3E6CC 3MGPD 3KZYA 2DK8A 1Z6RA 1XGMA 4HAMA 4JBAA 1FP1D 1L3LA 2QQ9A 3X1SA 2KIMA 3REKD 2O0YA 5HLIA 3G3ZA 5LHIA 4U0YA 3FHZA 4GYIA 1W5SA 5B2ID 4YS3A 1P3GC 2FJ7D 1P3IB 5E17F 3KUYD 1KX5D 4KMFA 3C1CC 2Q8KA 4IJAA 2Y48A 4CAYB 2BYMA 3F23A 4A12A 3H3ZA 3REJA 1J7KA 2HTSA 5CP6D 2DQRA 2OBPA 3R0JA 4MQVA 1TNTA 4FHTA 3AZFA 3UTBC 4S05A 5AV9D 1O3RA 3B73A 1WRJA 1EH7A 5A2QZ 4BXUA 2NQBD 2OAZA 1QBJA 2YFWB 3W98D 1F66A 4QWQA 3FM5A 3V4GA 3B6GB 3A6NC 3SZPA 1SMTA 5GT3D 1TZYD 1UHMA 1SAXA 5B2JA 1AOIC 2CQKA 4HF1A 3W6JB 2IA0A 2FA5A 2H94A 1K6OA 4UUVA 3EDPA 4H0EA 4H9RA 3U1DA 5E5AD 3V9RB 1REPC 5AV5A 2ACJA 3AZMC 1HKTA 1KU9A 1SD4A 1MJBA 1S8NA 3W99A 5HS9A 4P55A 4KGCD 1XB4A 3I59B 4AVPA 4J8WD 1F1EA 1XGNA 3BY6A 1R4VA 1FWZA 1U5TA 4XZQC 4R8PC 2OQGA 5E20A 5E1ZB 5KDMB 1U35B 1FC3A 2XGXA 4NHJA 2HKOA 5AIPA 1RUNA 2HIOA 1M18C 3FXRA 2ESNA 3GFMA 1L0OC 4L0ZB 3P9IA 3EETA 3AZIC 3W96A 3WU0A 2MH2A 3REIC 4XBFA 4BNCA 2RVQD 2A68F 5CVRA 1P3OC 1M19D 1N1JB 1TLHB 3HOSA 4CZZA 3AZKD 2YU3A 4OIOF 3J81K 2CG4A 1SD7A 4KN7X 1FBQA 2ZXJA 4GCVA 1P3GA 2RGVA 5CPIB 4O5VA 4ENNA 3C1CA 5IT9Z 3CUOA 3JSOA 5AV6C 2NRAC 3PQKA 3U2RA 1MDMA 2H09A 4ZUXD 4MEYF 4EO5C 5CJ9A 3QP6A 5LGUA 3UTBA 1UCRA 2LSOA 2HUEC 4LD9B 4KT5C 3HRUA 1IN4A 3B6FB 3T8RA 3E6DA 4ZZLA 1ZLJA 1LNWA 4WV4B 2K02A 2EFOA 5B31B 4HQEA 5DYMA 3R6SA 4LLGF 5G49B 3F3XA 4L0YB 1WKMA 3AYWB 1S32C 3A6NA 2XHKA 2D2WA 4OINF 1W7PB 4YM6A 4KDPA 2CWEA 2XAJA 2GAUA 4PGGA 1AOIA 2E7WA 3IRQA 2HDCA 2GIVA 3W97C 2NZDB 3X1TC 3AZJD 2YR2A 1AWCA 1R1UA 4ENKA 3HTSB 1EQZB 2EV6A 4LLNA 3AFAC 5ICEA 3I54A 3X1UC 3AZMA 1FT9A 1ID3C 4KIBA 1G4DA 1IAWA 1R1TA 2GZWA 4WU8D 3MVDB 1P3FD 1W4MA 5C3IC 2X0LA 2VT3A 4PDKA 1GHCA 4MEXF 1HKSA 1EH6A 1UHWA 4XZQA 4R8PA 3N4MA 5H20A 4YS3B 2P5LC 3F22A 1T0FA 5H6QA 3QP5A 3RKWA 1HSJA 1R22A 1YYVA 3ZP5A 5DV5A 3DXJF 3GEZA 3MGRD 3E97A 2BYMB 1IZ1A 5BMZA 3REJB 3AZIA 1XGOA 4J8VB 5FD5A 2M87A 4X23C 3REIA 1ZG3A 3X1VD 2NYXA 2ZMEB 3EYIA 2GXBA 1O3QA 1P3OA 2OU2A 3TU4D 2XIGA 5CPJD 5D4RA 1B67A 1CF7A 5EEHA 1S29A 5GT0D 2ISYA 3V8JA 1KX3C 1Q1HA 4QLCU 4P5OA 1KYWA 4B8XA 4N9HA 3T1BA 4CHUA 3LZ0D 3MGSC 2Y0MA 2R7DA 1F66B 3MCZA 3REHB 3WKJC 5D5WB 1HQ3C 1BN5A 3TOAA 5AV6A 4LD5A 3WTSC 3GFJA 2V6CA 3BJAA 5B0YD 2NNNA 3C1BC 2AROD 5GXQC 3ZMDA 1P34B 1YW9A 3AAFA 1UB9A 5D6FA 1I5ZA 5BPDA 5B24C 2PMHA 2EFWA 2P4WA 1BC7C 4UV9A 2XKOA 3MZYA 3Q9SA 1P3AC 3RKYA 1PUEE 3I58A 3LA2A 5GSUD 3WA9A 2DBBA 3F6OA 1FSHA 1ONVA 1I1GA 3W99B 3QU6A 1HBXG 2OA4A 3VH5W 2EFNA 2FQ3A 2HOEA 5DNNB 5LGNA 3M1EA 3LELC 1S32A 2EV5A 2NS0A 3D5LA 3R61A 4EJWA 5E8IA 4BHCA 3UTAB 2FRHA 1P6RA 4H9OA 3MGPC 1NHAA 2E1CA 5AVCD 2MC3A 3AZED 3W97A 3W96B 1R5GA 3MNNB 3HOTA 3X1TA 5L3EA 3LQRA 3JAMK 3REKC 3ZMSA 4BAYA 3AFAA 4L5JA 3AZHD 4WX9A 1STZA 2OQRA 3E5QA 1KQ0A 2RKHA 1ID3A 1FBSA 3S2WA 5B2IC 3D0SA 3KWQA 2FJ7C 2D1VA 3KUYC 4OIQF 1KX5C 3JTGA 2D45A 4H9PA 5L3DA 4N0BA 4KFCA 3ULQB 2FBHA 4RB3C 3HHHA 4KUDD 2M45A 1XCBA 4WK8F 1TQPA 1XSXA 3O2PE 1J9IA 5CHLB 1XSDA 4NE6A 4G91C 4ENMA 3KE2A 2P8TA 5CP6C 1MDMB 5B31G 3UT9D 3LQQA 1KQ8A 5AV9C 5DDGA 2Z9OA 3V8LA 2FSWA 4PGHA 4X23A 2QYOA 2Y75A 5B1LD 2OZ6A 1M1AD 1MD0A 1HTAA 4L9TA 4A6DA 2Z99A 3UTBB 2NQBC 1ZLKA 4CXFA 2BYKB 3DF8A 2IJLA 3W98C 1RIOH 4XUJB 3WTPD 5F1RA 2F8NH 3AZLD 4BYYA 3MGSA 2STWA 3T5XA 2BYVE 5FGMA 4EJTA 5GT3C 2PYOB 2MLGA 1TZYC 1R00A 3AZND 5IT9K 1P3KB 3AN2D 4U0WA 4HZFA 5JHUA 1HQ3A 5JA4B 5FUGB 3MGQB 4WNNA 1D8JA 4E45A 5F64A 3GF2A 2A6HF 2C6YA 4YM6B 3C1BA 1J0RA 5GXQA 2UWMA 5E5AC 5B24A 4U7DA 1AOIB 1KA8A 2DU9A 4EQQA 1DPRA 2DTRA 2RNJA 4KGCC 1P3AA 4J8WC 5L3CA 3K1NA 4LG0B 3V7RA 3KXBB 3MAJA 4WXHA 3BPVA 3DP7A 3BP8A 4XZQB 4ASNA 4H9QA 5DCMA 3C3WA 2DPDA 3LELA 3M7GA 1ZLAC 3CO6C 2RVQC 2BGCA 2X4HA 3MGPA 4HV6A 1M19C 4YFNF 1P3MD 3AZIB 5BOXA 3AZKC 3DEUA 4H9NA 3GWZA 3KP2A 3REIB 1BJAA 2VN2A 3F8FA 2CV5A 3REKA 1XN7A 1P3OB 2F8NK 4I0AA 5LLQA 1BI2A 3ABUA 3ZMTA 1CF7B 4CGZA 2DPUA 5B2IA 3KUYA 3B6GD 1KX5A 5K5QA 5D5XB 5B40B 4J8XB 5JI6A 3ZMUA 4RAYA 3V7SA 3F8NA 4IHTA 4M9XA 2BBYA 1O7LA 4HDUA 2W24A 4XRFA 5CP6A 5AV6B 3C18A 4IRIA 3E3VA 5F6FA 4UXNA 5AV9A 4P96A 5AVBB 2QWWA 3VODA 1KU5A 2NQBA 4FX4A 4GGGA 1F9NA 3RJPA 4CSRB 5DEQA 2HUEB 2L02A 4WU9D 1YTYA 5B0ZD 3W98A 2KKOA 3WTXC 1U35D 4MTEA 4EM0B 1H3OB 3WA9B 2EV0A 4OU0A 1ZHFA 2OZUA 2NNYA 2FNAA 2V1DA 1HKQA 1B4AA 1TTYA 3HRMA 5B33C 3KCCA 5GT3A 3RPQA 1TZYA 3F6VA 1TAFB 4KNYA 2LNBA 4BHPA 2HQNA 3AZJC 1QO0D 3NRVA 1S3JA 1P3LA 2PMUA 3CDHA 3F72A 4H9OB 4HF2A 5E5AA 3KETA 5DD8A 2VOPA 1BH8A 4KN4X 5CPKA 4I09A 2YFVB 3M8FA 3X1TB 2HZTA 4WU8C 1P3FC 1USTA 1ODDA 3IHUA 2HQRA 2A5YB 4KGCA 4OMZA 1R5HA 4J8WA 3AFAB 3BROA 3LWFA 5CPID 1ID3B 1SD6A 2RC4A 3KWQB 5CVVA 5C3IB 1JFIB 5BPIA 4H9PB 4HV5A 4M6YA 4ETSA 1ON1A 4XLNF 4Z5TB 1GXQA 2PLYA 1P4WA 5F99C 2JSCA 1A04A 4Z66B 1OYWA 3K9TA 1KGSA 5BO0B 1ZLAA 1PP8F 3RYPA 5BNXA 3RELB 4L9JA 2EA2A 1M19A 2IO5B 5BT1C 1J75A 3TU4C 1LJ9A 3CUQC 5CPJC 3WG9A 3QPHA 3AZKA 3HIFA 2Z3YA 2ZBKA 5GT0C 1ZGJA 3LJAC 1IXCA 1XSVA 3BOQA 2YX4A 1BIBA 5B31D 4B09A 3LZ0C 4HGAC 3LZ1B 1KX4A 2UZKA 4A6EA 3P9CA 4KUMA 4XLPF 1H9GA 3AYWD 4KICA 1BC8C 1XDUA 2MA3A 2YPRA 4MNUA 1W7PD 4EGYA 5B32B 1T38A 3IL2A 2BEOA 1D5VA 2AROC 3QPTA 2MH9A 2PEXA 5JVTA 5KK1A 2NZDD 2O03A 2PG4A 2O8XA 5J6XA 4WNNB 1EQZD 1WWXA 2CW0F 1KYZA 4R1HA 3C1BB 3E5UA 2R3SA 4F7ZA 5GSUC 1U2WA 5J8CA 3MVDD 1XGSA 2AS5F 2XV4S 2M8EA 3R0AA 1DP7P 4I02A 4YS3D 4HW0A 1ON2A 4MQ9F 1X3UA 5CLSA 1S7OA 4QLCC 1KU7A 1P3BC 3WGIA 2HYGD 5B33A 5BQTA 4EJVA 2A69F 5HVQC 1P3PD 4J8VD 1RZ4A 4WXCA 4G92C 4H9QB 2KJBA 5DCMB 5JRGB 2FE3A 3AZEC 4N9IA 4I2OA 5B1MC 4UUZA 4G94A 3LELB 3AV1C 2PFBA 3AZJA 1EH8A 2AXLA 3AV2B 3MGPB 3AZHC 2V9VA 1UFMA 3FXQA 2HYFA 4HX4A 4ENJA 2GXGA 4OOIA 4FX0A 1P3FA 5BS7C 4JJND 3KEQA 2CV5B 1Z6TA 2D1HA 3WAAB 1ZGAA 1MGTA 3REHD 4DRBA 4KUDC 5LRRA 2VXZA 5BS6A 3KUYB 2PN6A 4O3MA 1P34D 5DNMC 3UT9C 5F99A 5FFZA 2VOOA 3WGHA 5CVIA 2ZFWA 3DFGA 4LK1F 4M9ZA 1CGPA 3CO7C 5B1LC 4Q5SF 1M1AC 5BNVA 3EYYA 4S04A 1LDKB 4Z2MH 2K86A 2TDXA 5AV9B 1W5TA 1R1VA 2KJCA 3TU4A 3CUQA 5CPJA 1O57A 5ICCA 3W99D 5FLXZ 1MJ9A 4A0ZA 2V1XA 5GT0A 3WTPC 3LJAA 3BZ6A 3VB2A 3AZLC 3KP7A 5L3BA 3LZ0A 3W98B 3O62D 5TRDA 5DNND 1Z1DA 1K7AA 4DRAA 3AZNC 3AN2C 1IN7A 1LVAA 2DFIA 1BI0A 3UTAD 3TDZC 2O3FA 4O6JA 2LDUA 2AROA 2F5CA 3MNND 3P7NA 3I71A 1I27A 4A5MA 3X1SB 3O6BB 2P6TA 5HDGA 2OD5A 4E70A 2PJPA 2A3SA 1P3LB 3GX4X 4YG2F 5GSUA 3LSTA 1G6NA 2O6GE 1OYIA 4YIIA 1BH8B 5CPKB 4EM1A 4M6BA 5HDNA 1BH9A 2IW5A 5D5VB 2M1BA 1RNLA 2DLLA 4GO1A 2CFXA 4HF0A 1T98A 2F8NA 1M18A 3K69A 3MFKA 3MEXA 1YFHA 2FEZA 4CDGA 1DPUA 1B6WA 4QLCA 1P3BA 2EB7A 2HR3A 3AZFB 3TGNA 3RTRA 1G3SA 4Y17A 1P3MC 4UVCA 5B32G 3AZEA 3PFIA 5B1MA 4FT8A 3L2CA 3AV1A 2ZNYA 1ZLAB 3UTBD 5BNXB 4LB5A 3AZHA 1M19B 1JE8A 2F5EA 4LFUA 1OYYA 4M6XA 4XUJD 1WSUA 5LBQA 5D4SA 1K79A 5BS7A 3B6GC 6PAXA 5HDKA 5JR3A 2VE8A 2GWRA 1T2KA 2PYOD 4KUDA 1KX4B 1IF1A 5JFRA 2VC0A 1P3KD 3MGQD 3GUDA 3U9GA 4HX7A 5B2JB 3E6MA 2EFQA 1RI7A 3B0DC 3IWFA 3RKXA 4YM6D 5AY8C 5DNMA 4KMUX 3UT9A 3M9AA 4HDVA 2CO5A 1LB2A 1AOID 4H9RB 4U0VA 2DK5A 5AV5B 3FXUA 5A2QK 2H6BA 4ESBA 1M1AA 5E1XA 4WCGA 2Z5UA 4MTDA 5HLHA 4LJZF 3KXBD 3LA3A 5ICGA 4WU9C 5B0ZC 4ZZDA 2IA1A 1U35C 1U5TB 2XUBA 4J8UC 4I01A 1SFEA 5DCFA 3JTHA 2COMA 5DUIA 3M8EA 1DUXC 3WTPA 1ZRDA 4UNOA 1B59A 1XCVA 3J80Z 4EGZA 3QRFF 4XZQD 3AZLA 2HIOB 1IRGA 3FX3A 1HW5A 1KU3A 2Q2EA 1IXRC 2Z33A 3WTPE 4M71A 4PZJA 3AZNA 4WXDA 3AN2A 4RB1A 2WV0A 4I7HA 2KIUA 3BJOA 2XAHA 2HFHA 3I5UA 1FYMA 1G3WA 3H3UA 5B33B 2K4JA 4NFTA 1HXDA 2IVMA 3REID 2E7XA 4WZSB 3X1UA 4KIGA 2EWNA 4UUZB 1LEAA 3GXOA 2XVCA 4KYWA 2XAFA 3ISPA 4AIKA 3IC7A 3Q9VA 4UVAA 1Z91A 5B40D 1P3GB 4H9SC 4J8XD 4CAYA 3VH5A 2GA2A 2HGCA 4AD9A 3C1CB 2FMLA 3KFWX 4DNCA 4L18B 1WI9A 1Q9CA 3FZVA 2P5KA 3F8MA 4DQ2A 2FMYA 3BDDA 5AV8D 4IVNA 4Q48A 2RN7A 1PDNC 4ZBJC 1OKRA 1A7WA 3HSFA 5AVBD 3HRTA 1O3SA 5F99B 4NQWA 1P3MA 4P9FA 4NB5A 3GZ5A 1S6LA 4D0PA 3WU1B 1WWSA 1KX3A 1HW1A 5BNVB 3E5XA 3WA9D 2WC2A 5B31C 3E6BA 1P4AA 5CPJB 2ADUA 3AZGD 4R8HA 3F21A 3GW2A 4G8XA 2P5VA 3AYWC 3B6GA 3WKJA 4KHAA 3LJAB 2DT5A 3RIRA 1QNTA 2RVCA 5LRSA 2ZKZA 3A6NB 4NE5A 3LZ0B 4HGAB 5ED4A 4ESFA 2KRFA 2F5DA 1ZG1A 2V1UA 2VODA 3B02A 2NZDC 4BH9A 2VT2A 3REOA 3VH6W 2G9WA 2H6CA 2IT0A 2VC1A 4M72A 5AY8A 2STTA 2PQ8A 3V9RA 4L9VA 1FYKA 4LLLA 1BI1A 3KLOA 2AROB 3ZMZA 2JPBA 3GFLA 1P3ID 3X1TD 3IWZA 3MVDC 3AZMB 2VBXA 3BWGA 1YO5C 3SXYA 4U88A 2ESHA 1XDSA 4R79A 3VOEA 4WU9A 3KWQD 5B0ZA 4LGWA 4J8UA 4R8PB 5EEGA 3IKTA 1BH9B 1Z9CA 1V4RA 4Z5TD 4MGRA 2JTVA 2UXXA 2F8NB 1M18B 4Z66D 1YW8A 1P3PC 4J8VC 2FBIA 2JPCA 4QLCB 2XRNA 3RELD 1P3BB 3ZPLA 3VH6A 4HLXA 3WE3A 2QM3A 4CICA 1ZYRF 5B1MB 2FJ7A 3AV1B 4Q47A 2CGPA 4UHTA 2LKPA 4JJNC 3LZ1D 3AZHB 1WQ2A 1FP2A 1F5TA 3REHC 4ZUXC 2P7VB 1YIOA 2HS5A 4YIFA 4P9UA 4H9SA 5B32D 4IRGA 1JGSA 1XD7A 3OOPA 1G3YA 1BIAA 1LEBA 4HBLA 3MWMA 3B0CW 1KQ9A 3COAC 1P34C 4KUDB 4AIHA 3R45A 1R58A 2MBFA 4EO5B 5H6RA 3ZMVA 3WTVC 3TOBA 5DNMB 1TBXA 3WTTC 3UT9B 4MHGA 3SZTA 4LK0F 3K2ZA 4G6DA 1BI3A 1HW2A 5HOOA 3JSPA 5L3FA 1FZPB 3LAJA 3GVAA 5B31A 1K78A 3DPTA 3T8TA 5G49A 3FM3A 3O62C 5DNNC 3BJ6A 1JXSA 3TDUC 3AYWA 1ZAOA 2IPQX 1S32B 3UTAC 3AZLB 4Q4ZF 5JRGD 1Y0UA 4UVBA 2QQAA 4RGRA 3LELD 3MNNC 2B0LA 4IHSA 3FWEA 2NZDA 3AN2B 3W97B 1F1ZA 3AV2D 2QBYA 4Y15A 1R23A 1R36A 2FNPA 3MVDA 3X1UB 2CV5D 1FSEA 3WAAD 3LAPA 1SMYF 4ZH4F 5DUKA 3NQOA 1ZARA 2O61A 3MGRC 5E1WA 1GVJA 1HQCA 3J80K 3ZQ7A 1P4XA 1KU2A 3X1VC 2G7UA 2QVOA 3WODF 4LD9D 1P3PA 4J8VA 1ZN2A 2FOKA 3B6FD 3HSEA 1TQMA 2ZMEA 1DDNA 4X23B 2A6EF 3WGGA 3W6KB 4A0YA 5D6EA 1P3MB 4XUJC 4OIRF 2R7FA 1IW7F 3CLOA 4JJNA 1KX3B 2IP2A 2YX7A 4PCQA 2VBZA 2G7HA 2FU4A 3MQ0A 3REHA 1B9MA 2PYOC 5B0YC 4ZUXA 3MGSB 3IKVA 1P3KC 2ZCWA 2XROA 3MGQC 3WKJB 4KHAB 3QAHA 1HQ3B 3TO9A 4YM6C 1LQ1A 4ZYHA 1P34A 1F4KA 2HWVA 2JT1A 2NAZA 2VONA 5GXQB 3GFIA 3X1SD 5B24B 2GQQA 2LY8A 4TV7A 1FNNA 3B0DB 2F8NG 1P3LD 5L3GA 2ELHA 5AY8B 4JQFA 1OMIA 3JAMZ 5D8LB 3KP6A 3P9KA 1P3AB 3EUHA 3VFZA 3KXBC 5CPKD
chains in the Genus database with same CATH superfamily
1ENHA 3PNYA 2XASA 3BG3A 3K70D 3FMRA 3HUGA 4A93J 4AWLC 2L54A 1X4OA 3MKWB 2GLOA 2CQ7A 2LBFA 1JHFA 4WU9B 1T56A 5B0ZB 2QZ8A 2OTLI 3REJD 1A6QA 2BV6A 3K1PA 3V8KA 2A07F 1T0FC 5CYVA 5DNNA 2FXAA 3O62A 4J8UB 2L4MA 2L01A 2Q0OA 1XMKA 5HS7A 3JRFA 2CW7A 3FISA 2DCEA 2DODA 3BR0A 3OS1A 2DQNC 5AVCC 3ERED 1WJCA 3UTAA 4D5CA 1V3FA 3AZFD 4Y33A 2K4BA 3MN2A 3J7AO 4IXAA 5GADJ 1LKXA 3NEUA 4NC8A 2UV1A 1HSTA 4BGDA 3MNNA 1ZLAD 4A3KJ 1JGGA 3NQUA 1YS7A 1U9OA 1D1CA 4H9NB 3ERMA 1J2XA 2CQXA 4NC6A 4WU8A 3M4OJ 4XSZF 2QSFX 3AFHA 3NAUA 3OYBA 3KP3A 1ZR4A 2DMUA 3REKB 2LF8A 1F66D 4ZYEA 2LY2A 3SFZA 2XAQA 2R5YA 5B2IB 5B40C 2FJ7B 2IGMA 1IXSB 4J8XC 2F2AC 1KX5B 1LDJA 4RGXA 3KP5A 4CZCA 1MNMC 3WTZA 1KX4D 1G59A 1X4PA 2HTJA 2RDPA 2LK2A 4M74A 2L3DA 1BJZA 4EJUA 3OIPA 3MGRA 5B2JD 1G3TA 2R7WA 1SVLA 1Q1VA 2Y2GA 4IL6C 2L4AA 3CCRI 2JA5J 4AM3A 4NDLA 4G91B 3RYRA 4MO7A 5CP6B 1BFMA 1ZG5A 4RB0A 2H27A 3DKWA 4XORA 3X1VA 2M34A 3H9GA 5AV8C 1U8RA 1GV5A 2EA4A 2FUG2 3ECHA 5AVBC 3EPLA 1PUFA 1FBUA 3R45B 5AV5D 3FXLA 1FJLA 5TJJA 4IF4A 2M7AA 4GYGA 4ESJA 2HOSA 1EV7A 3HRSA 1I6XA 2L0KA 2VBYA 3DQVC 4RAZA 3OYFA 4EMSA 4ITVA 4ZBJB 1GT0C 3L00A 2BYKA 1QZZA 2XPVA 3A1KA 2NQBB 2XF7A 2QSGX 1OISA 1H0MA 3WA9C 2CYYA 4N4NB 2CRGA 5CVJA 4XUJA 4RB2C 3AZGC 2E35A 1SVMA 5LHHA 5M3MJ 1SFXA 3ZRGA 3CTAA 3A0HC 4L5EA 4N4OB 1ZRCA 3S14J 4IRHA 2HIOD 3L9FA 2R7OA 3RDIA 2PYOA 3DPLC 1K78B 5B0YA 1R7JA 1RKWA 5IY5H 1P3KA 3W3CA 1USSA 2DDBA 5GT3B 5JA4A 3W96D 1T3UA 5FUGA 3MGQA 1TZYB 5GAEJ 3TO7A 3VH5T 3KIOA 4Y4RA 1Y8QB 4M3DA 5B33D 5KCMA 3NQJA 1FLIA 1WWIA 4XSXF 3CCVI 3I0TA 2WADA 3KZZA 3FF5A 2V6EA 2PI0A 2DI3A 2Y9YA 5E5AB 1P3IC 2K9LA 2PBIA 5HS8A 2XGCA 3WTWC 4W97A 1QHHD 1Z2CB 1TW3A 3L09A 2HPIA 2QBYB 4EV0A 3EPKA 4PFOA 3S8PA 4JK1X 3DV8A 4KT6A 1YLFA 3ECOA 3FXKA 4LG0A 4KGCB 2W25A 5AVBD 1J09A 4DOZA 2JSSA 3FIWA 4J8WB 1P3GD 5K1YA 3KXBA 1MJAA 2QQBA 3KWQC 2XAUA 3C2HA 4M3EA 3ZN0A 5ILUA 1AKHB 1N75A 3C1CD 1RR7A 4IQJA 4M9SA 3VSKA 4ZDPA 1TW2A 4RDUA 2E5ZA 3CJNA 5IT3A 5M3FJ 4Z5TC 1QA6A 2FX0A 3FMSA 4L5IA 1X3WB 1YG2A 1B9NA 2ZO4A 4Z66C 1MBJA 1NTCA 4L9NA 2TRTA 1ZH5A 4RS8A 4G7HF 5AVCA 3DTKA 3HXLA 4UUSA 2BHZA 3RELC 1H9TA 4BS9A 2R0QC 5F99D 4FASD 2I5UA 4FTHA 1QQIA 4XMYA 4E7JA 1U3EM 1U78A 2KP6A 3T0YA 1J59A 2IO5C 3LSMA 3FXMA 3BT9A 4A3DJ 1P3PB 2ZY2A 1XMAA 4M3GA 3OYCA 3IH2A 3BQZA 4G7OF 2WTEA 3AZKB 4YFXF 1WH7A 2UWXA 3OR2C 1C0WA 2DAOA 4I0BA 5BT1D 4XM3A 5H2FC 4IOCF 1LDDA 3E7LA 3LZ1C 4RGUA 3O3KA 1W1WE 4HA8A 3CC4I 3RPUA 4HOBA 4KA4A 2PJRA 4U7BA 4M6VA 3HOZJ 3LJAD 5B40A 1A6IA 2EZKA 4QPOA 1E2XA 3K1MA 5B32C 4J8XA 3A6ND 1ERDA 4JJNB 2KIFA 4ON0A 1SD5A 5AONA 2FF4A 2XAGA 4ZUXB 2RQPA 2L5AA 3ABTA 1Z7UA 3F8BA 4DW6A 2W8SA 2EK5A 2BY3A 2WBMA 3SQNA 1BL0A 1YHQI 5C4JJ 3KYDB 5B1LA 5AV8A 4QPQA 3BG6A 4FE4A 2QENA 3SDBA 2QA4I 2CSOA 5AVBA 1D3YA 2LC2A 1FY7A 1GDTA 3AZMD 1X58A 5HLGA 4EM2A 4B1RA 2E1NA 2BW3A 1SFUA 1JT0A 3VH6T 2K7LA 1RUOA 1YW7A 2X1CA 5GTIC 4ANJA 5LGTA 2Y69H 5AIQA 4CSRA 2R5ZA 3D5RC 3CESA 2DMPA 1H3OA 2E34A 4R8PD 1YX5A 3C7JA 1FPQA 4B3XA 2F4MB 1V5FA 1J5YA 3AZGA 1YS6A 5DM6F 3IH3A 2LKSA 3IAS2 2XDVA 3HGGA 4LB6B 4A3JJ 1IUYA 1O3TA 4I98B 3VYTB 1VQPI 3I64A 2F8ND 1M18D 3HUGB 5D5UB 1PZRA 3EG5B 3A4CA 3MZHA 3K0LA 1P2FA 1TAFA 4QLCD 2ME6A 2KHMA 3ZN1A 4YIRX 5JRGC 3O62B 3AZID 1P3BD 2HU9A 2BE5F 3QYBA 5KVRA 4A0XA 2JZYA 3ML6A 2WWYA 2HKXA 2IRFG 4FCYA 3CLQA 5FO5A 3KX2A 1U0JA 5JVGF 3LFKA 3AV2C 3VYSB 2VQRA 3GTJJ 1P3OD 3IH4A 3AZJB 3LSPA 4HLYA 4ZYDA 4LIVA 3KP4A 2YU9J 1PP7U 5B1MD 2DJIA 3HTUA 2XGDA 4I76A 3Q5FA 2YFVA 3AV1D 1P3IA 4A3CJ 3HSRA 4G6TB 5CPIC 3NQUB 1B6AA 2CV5C 3GLXA 5FD6A 4KIFA 3WAAC 4WU8B 2NXNB 1P3FB 3F9KA 4Y13A 1BBYA 1TWHJ 1YITI 1MSEC 3K4JA 4DZPA 2CS3A 2M8GX 1BR4A 2IA2A 3HYIA 3NARA 4H4KC 3N97A 2R5YB 4EJOA 5DM7F 1JFIA 4DBRA 4WF2A 1Y1VJ 3KEOA 1FOKA 5ILVA 1N77A 4CYDA 5LEKA 5AV6D 1OJLA 2H1KA 1TQIA 3TQNA 3ZGKA 4CCMA 3L7WA 3EQLF 1I1SA 4Z5TA 2W57A 4HQMA 4CO8A 2KZVA 3MZ8A 5D8KB 1WJBA 2VQCA 2FBKA 3BR6A 4Z66A 3MGRB 4LD9C 2P6SA 3I56I 1BOAA 3CCLI 4A5NA 4PSXA 4RA2A 5BO0A 3GCMA 3B6FC 3CMYA 5CVUA 2EFPA 3RELA 2Y2MA 1AOYA 3GTLJ 1MBGA 5DNMD 4K2EA 2PYOC 3GTOJ 4AIJA 1S7AA 2MD5A 3B0CT 2F2EA 2DOEA 3OV8A 4RLFA 2YFWA 3X1VB 1X2NA 3SHFA 2QLZA 3DBRB 4BQAA 2MD0A 1PUFB 3ZOBA 5FRMA 3ASOH 3GYHX 3TU4B 1P92A 2J5OA 1O7FA 2QQ8A 3CUQB 4UPKA 5ILSA 2VBWA 2ZB9A 2ZJRF 3QOPA 1JTYA 4HG2A 2KL4A 4AYBA 4F93B 4OWRB 1R6RA 1YQAA 5GT0B 1W0TA 5E8GA 1K61A 4XRSG 1I3AA 1T39A 2DA6A 3LZ1A 2W1OA 3F8CA 1IN5A 4HYEA 4YFKF 2LY1A 3S1QJ 5FB2A 1R4NB 2M30A 4BHBA 4G6QA 2OV7A 3CD6I 2B9SA 1MNEA 5B32A 1S32D 3PIPF 3JW4A 1O4XA 4IPAA 1QGPA 2JJ7A 2E2HJ 2XSJC 1QPMA 1Z05A 5FLVA 1EQZC 3WTYC 4Z2MG 5LEJA 3R4KA 5B0YB 2F5FA 4RAGA 4BUPA 3W97D 4IEJA 3I4PA 2M5WA 1DU6A 2P7CB 3X1SC 2MLKA 2EIJH 4FISA 2CQQA 1OR7A 1MNDA 2VE9A 3TKYA 3I59A 3NQJB 4M73A 1LFPA 1P3LC 1U6GA 3AFAD 3C1DA 3GZ6A 3FKJA 4C2TA 2EJRA 2H1LA 5K5RA 1VTNC 5E79C 3J81Z 2UUZA 3X1UD 1ID3D 1IV8A 1T6SA 4OIPF 4YS3C 3VPRA 4ZYGA 3L2VA 1GXPA 3RQIA 5FLXK 1TWFJ 3ABLH 5KDMA 1S5LC 5GSUB 1U35A 4RLQA 3TP3A 2W85A 2RV8A 3EPJA 2LF7A 3V7CA 1WJAA 3K70C 2OPTA 2E71A 5TISC 3KSYA 4D9JA 1JJ6C 3BPXA 4RMNA 3QODA 3PUFA 3J7ZI 3REJC 3W2AA 2L9VA 2DO7A 2MW8A 5LHGA 3LA7A 5C44J 2DW4A 1IN8A 2W84A 5CQEA 4OMYA 4AWLB 2WY8Q 1E17A 2VKEA 3AZFC 3G73A 1WI3A 5K7FA 1N1JA 3ZCOA 5JRGA 1MZBA 2AHQA 4G92B 3A02A 3ROUA 3S3MA 5J8FA 1JKRC 4X23D 2M9HA 2WB1A 1YIJI 5AVCB 3AZEB 3PQJA 4IHXA 3DKYA 3AV2A 2V79A 1IRFA 4GXOA 3IRRA 5DD4A 2EIKH 1LVKA 1TNSA 3FMQA 2XRLA 4XLAA 3B0BA 2L9RA 2ETHA 2PMZN 3QU3A 1F66C 1WJEA 4XN3A 3KLNA 3RI4A 5CPIA 1KX3D 1TC3C 4YELA 5GAGJ 5F04A 2ZJPF 4AUXA 4HNUA 2WAQN 3WAAA 5FFXA 1Z67A 1EKEA 4G7ZF 5ERIA 3MGSD 2LTPA 3A03A 1QZYA 4HEA2 1KX4C 2ZJ2A 4AWXB 2F48A 3OYEA 2E5NA 2MYSA 1VQ4I 2PJRB 3WKJD 5B2JC 1XC5A 2E1MC 2NS7A 2K27A 4UV8A 1BR2A 2HXIA 3WTUC 1ZREA 1HQ3D 3ASNH 2QUFA 5FROA 2XKPA 5E18F 3C1BD 1RKTA 3IP4B 2DQLA 3H92A 5GXQD 1OPCA 2VQHA 2DFFA 2ZY5A 4LD9A 1UAAA 4Z2YA 5B24D 5AV5C 3W98A 3B6FA 1BOBA 3VEPA 1FX7A 1VQ9I 3WE2A 2A61A 4A2UA 5AY8D 3W99C 1BM9A 5HLTA 2HEOA 2JRTA 1IN6A 2J5PA 5B1LB 5AV8B 1P3AD 1M1AB 3GO5A 2UXNA 3S93A 1MKMA 4A3GJ 1XX5A 1NG7A 2VLAA 1U5TC 4NE3A 1FYLA 4EVIA 3I53A 4RGSA 3ZQLA 1ZTRA 5K5OA 2WV1A 3TO6A 4E44A 2NOGA 2ISZA 3WTPB 3OSGA 1MBHA 2R5ZB 3H0DA 4LMYA 1W7PA 1ULYA 2HIOC 1B1BA 3BG9A 4G9YA 4Y52J 1HDDC 2MSYA 4J8UD 3ELKA 3G71I 2DMQA 1D8KA 3ZQCA 2GA1A 3AZGB 3CZ6A 1ZRFA 4XONA 2Q2EB 4HX8A 4P1WA 3W96C 5ICFA 4WWCA 3R60A 1JHHA 2YSRA 3AZNB 2ZNZA 2HQ5A 4F52A 3HHGA 1EQZA 1MIJA 3E6CC 3MGPD 2W48A 3KZYA 1POGA 2E60A 3MMYB 2DK8A 5KAFC 2FJ1A 1PJRA 3PJRA 1Z6RA 1XGMA 4HAMA 4JBAA 1FP1D 1L3LA 3SJMA 2QQ9A 3X1SA 2LRDA 2KIMA 4D7MA 4CUGA 3REKD 4C3HJ 2O0YA 4A69C 5HLIA 3G3ZA 5KHDA 5LHIA 4U0YA 3FHZA 2ME0A 4BQNA 1TL8A 4GYIA 1W5SA 1Z3YA 3GTKJ 5B2ID 3AG4H 3J7AY 4YS3A 1P3GC 5DS9A 2X1EA 2GXAA 5E17F 3KUYD 1P3IB 1KX5D 4E7KA 2IBDA 1D0ZA 4A3IJ 4KMFA 2DOFA 3C1CC 2Q8KA 4IJAA 2Y48A 4CAYB 1YRNA 2BYMA 3F23A 4A12A 3FXOA 3H3ZA 3ZQQA 2LYCA 3REJA 1J7KA 5E3OA 2HTSA 5CP6D 2DQRA 1GVDA 2OBPA 3R0JA 3QQAA 4MQVA 1TNTA 3PFYA 4FHTA 3ZQIA 3K4KA 3AZFA 2R7VA 4ZYAA 3UTBC 1SVOA 4ZDOA 4S05A 5AV9D 2KQRA 3G2BA 2FFFB 4NQWB 1O3RA 4UB6C 3B73A 1WRJA 1EH7A 4DGWB 2DA4A 5A2QZ 4BXUA 3MKLA 2R7QA 4CCLA 2KRHA 2NQBD 2XF5A 3CMEI 2IAIA 2OAZA 2JUGA 1QBJA 2YFWB 4IZZA 3BC8A 3W98D 1IGNA 3DLLF 1F66A 3NWSA 4E7LA 4QWQA 3OY9A 3BR5A 3FM5A 4HSRA 1FOWA 3V4GA 3W6VA 3B6GB 2BVLA 3A6NC 3SZPA 4LG3A 2XD1A 3LSHA 1SMTA 5GT3D 1JI8A 1TZYD 3OOUA 5C4XJ 1UHMA 3CCMI 1SAXA 5B2JA 3AG3H 1AOIC 2CQKA 4HF1A 2LG4A 2IA0A 3W6JB 1VQ7I 2FA5A 2H94A 1D1AA 3HPGA 1K6OA 4UUVA 2AO9A 3EDPA 4H0EA 4H9RA 1T95A 2ZSIB 3U1DA 5E5AD 3QYEA 5IP7J 3V9RB 4E7HA 3QPLA 1GUUA 1REPC 2ACJA 5AV5A 3AZMC 1HKTA 1XS9A 1KU9A 1SD4A 1MJBA 1S8NA 2JVGA 1M1EB 4HSTA 3W99A 2HXOA 1IDYA 4P55A 5HS9A 4KGCD 1XB4A 5FLMJ 1Y1WJ 3I59B 4AVPA 2HI3A 4J8WD 1F1EA 1IO2A 1XGNA 3BY6A 3CC2I 1R4VA 1FWZA 3WHBA 1U5TA 2ECBA 4XZQC 3ZQHA 4R8PC 1QVTA 2JQ7A 1DP3A 2OQGA 4QSHA 5E20A 5E1ZB 5KDMB 1U35B 1FC3A 3K6GA 5B1AH 2XGXA 4NHJA 2QSHX 2HKOA 1X3ZB 3OS2A 1EF4A 1A31A 5AIPA 1RUNA 2R7RA 2H8RA 2HIOA 1M18C 1X1AA 3FXRA 1Y39A 2L2OA 2ESNA 1VQLI 2VXDA 3GFMA 2DT6A 4BDYA 1L0OC 2DF4C 2V9PA 1W36D 4L0ZB 3P9IA 3EETA 3AZIC 3W96A 2ZC2A 3IUOA 3WU0A 3AG1H 2EILH 2MH2A 5EYRA 3REIC 1VQOI 2B7EA 1WJ5A 4XBFA 4BNCA 2RVQD 2A68F 5CVRA 4B43A 2DOAA 2X6OA 1P3OC 5HNHA 1M19D 2L7MP 1N1JB 1TLHB 3ZXSA 3ZQFA 2O8KA 3A0BC 1QHGA 3HOSA 4CZZA 4II2A 2V9KA 3DU5A 4DIQA 5J4YA 3AZKD 2YU3A 4PJMA 4CCJA 3DTIA 2JUCA 4OIOF 5FKNA 1QPIA 1GLNA 3CF2A 3J81K 2CG4A 1SD7A 4KN7X 3OYHA 1FBQA 1D5YA 3E1SA 2G5IC 2ZXJA 4GCVA 3SEZA 1P3GA 2RGVA 3L2RA 3LMMA 1RR8C 5CPIB 4O5VA 4PJLA 4W1UA 4ENNA 3C1CA 5IT9Z 3CUOA 3JSOA 1NK3P 4XLFA 1Z77A 5EJCA 4BE0A 2NRAC 3PQKA 2IXSA 2K9QA 3BZCA 3U2RA 1MDMA 5AV6C 2H09A 4ZUXD 2BY2A 5C3EJ 3PNTA 2ZXIA 3IV5A 2VPLA 4MEYF 4EO5C 1XTAA 5CJ9A 4X1EA 3QP6A 4PK4A 3GZNB 3HB9A 5J4VA 5LGUA 2IS6A 2L7ZA 3PSFA 3UTBA 3SFIA 1UCRA 2LSOA 2D5VA 2HUEC 4XLCA 4XQFA 4KT5C 3HRUA 4LD9B 2VPRA 1YJ9I 1IN4A 3B6FB 1MBKA 1NG6A 1VNDA 3T8RA 3E6DA 4ZZLA 4CCOA 1ZLJA 1LNWA 4A3FJ 2R7XA 4WV4B 2K02A 4PJ0C 4JX6A 2BY1A 1JUMA 2I8DA 2EFOA 3HOUJ 5B31B 2LLKA 5M5XJ 5DYMA 3R6SA 4LLGF 4HQEA 3F3XA 3S3NA 4L0YB 4X6AJ 5G49B 1WCMJ 4UB8C 1V54H 4BY7J 1WKMA 3BR3A 5FKOA 2W7NA 3AYWB 1S32C 5M5WJ 3A6NA 3C2GA 2BXYA 2XHKA 2D2WA 4OINF 4Y7NJ 2KZGA 1W7PB 4YM6A 4KDPA 2CWEA 2PX9A 3LOCA 4QIWN 2XAJA 2GAUA 4PGGA 1AOIA 2E7WA 3IRQA 1SEUA 2GIVA 5CPRB 4BXFA 2HDCA 5J3LA 3W97C 3DBLB 2NZDB 3X1TC 3AZJD 2YR2A 1AWCA 1R1UA 1Z3XA 4ENKA 2O5RA 3HTSB 5B66C 2EV6A 1AHDP 1EQZB 5FKLA 4LLNA 3AFAC 5ICEA 2VQLA 2X9DA 1P3KB 3E0JB 3I54A 3X1UC 3AZMA 1FT9A 5B5EC 1ID3C 4KIBA 1G4DA 1IAWA 1R1TA 2GZWA 4WU8D 3MVDB 1P3FD 1W4MA 5C3IC 1FMVA 2X0LA 2VT3A 3CJQB 4D7NA 5EEAA 4PDKA 2LKXA 4IHYA 1GHCA 3HKZN 1ETKA 4MEXF 1HKSA 1EH6A 3BTCA 1UHWA 4XZQA 4R8PA 3N4MA 5IPAA 5H20A 3KYLA 4YS3B 2P5LC 4NNJA 3F22A 1T0FA 2OCCH 5H6QA 3QP5A 3RKWA 2K40A 1HSJA 1R22A 4KISA 1YYVA 2RIQA 3ZP5A 5DV5A 2XPUA 3DXJF 3GEZA 2Y9ZA 3MGRD 4CCKA 4DYCA 3E97A 1YRNB 3TBIA 2BYMB 1W5CC 1IZ1A 5BMZA 2JWTA 3REJB 3AZIA 1XGOA 4J8VB 5FD5A 2CU7A 2M87A 4X23C 4C30A 3REIA 1ZG3A 3X1VD 2NYXA 2ZMEB 3EYIA 2GXBA 3HZJA 1O3QA 3PO2J 1P3OA 2ID6A 2OU2A 3TU4D 2XIGA 5CPJD 5D4RA 1B67A 1CF7A 2HVRA 5EEHA 2R93J 1S29A 1IJWC 5GT0D 2ISYA 4D1QA 3V8JA 3CCYA 1KX3C 1Q1HA 3DLAA 4XKCA 2A6TA 4QLCU 4P5OA 1KYWA 4N9HA 3T1BA 4B8XA 4CHUA 3S2DJ 3F0CA 3PNVA 3LZ0D 4OAYA 3MGSC 2Y0MA 3EPHA 2R7DA 3G4SI 1F66B 3MCZA 3REHB 2VKDA 2M2EA 4BU2A 2CH0A 3WKJC 4MLOA 2BXZA 4BY1J 5D5WB 1HQ3C 2GOXB 2ZFUA 1BN5A 3TOAA 4UY8I 5AV6A 1TWCJ 4LD5A 3WTSC 3GFJA 2V6CA 1T08B 3BJAA 5B0YD 2NNNA 2KT0A 3C1BC 1XPXA 2AROD 3CCSI 3ZMDA 4V2FA 1YW9A 3AAFA 1UB9A 2V26A 5D6FA 1I5ZA 5GXQC 3U1KA 1P34B 2HOAA 4V2GA 5BPDA 2L7KA 2Y2NA 5B24C 2PMHA 2EFWA 2P4WA 1BC7C 4J00A 1TWGJ 1HC8A 4UV9A 5F27A 1MBFA 2FD5A 2XKOA 2ZJQF 1W2EA 3AKZA 2Y2QA 4AU7A 3MZYA 1TWAJ 3Q9SA 2EZIA 3RKYA 1P3AC 3HPHA 3K7AJ 1B8IB 3I58A 3LA2A 1PUEE 4A3LJ 1KZHA 3B6CA 2O9LA 5GSUD 3HG9A 3G6EI 1AA7A 4BXXJ 3WA9A 2DBBA 2GIZA 2KIQA 3F6OA 1FSHA 1IUFA 1ONVA 3JRCA 1I1GA 4BE1A 2V4JC 2IS1A 3W99B 4C3JJ 3BLYA 3PL8A 5IYBJ 3QU6A 2NOJB 3CC7I 1MMDA 1HBXG 2LBFB 5EF6A 2HDDA 2OA4A 3VH5W 2EFNA 2FQ3A 2HOEA 4RM2A 5DNNB 3Q0WA 2ID3A 5LGNA 2F6CA 3M1EA 3LELC 2X6YA 1P7JA 2EV5A 1S32A 2NS0A 3D5LA 3R61A 4EJWA 5E8IA 4BHCA 1E0EA 5E3MA 4Z6YA 2NVUB 3UTAB 3DEEA 1HDPA 1P6RA 2FRHA 4H9OA 3MGPC 2ELJA 1NHAA 2DA1A 1IDZA 4BJ5C 4RM3A 3OL3A 2E1CA 2Y2KA 5AVCD 2MC3A 3AZED 3W97A 3W96B 1R5GA 1UHSA 3MNNB 3HOTA 3X1TA 1K83J 3PIOF 5L3EA 2VQGA 3LQRA 1YI2I 2VL8A 4IHVA 3JAMK 3REKC 3ZMSA 4BAYA 3AFAA 4L5JA 3AZHD 3H36A 4X0GA 4WX9A 1STZA 2OQRA 3E5QA 1KQ0A 5GAHJ 2RKHA 1ID3A 3A1YA 1FBSA 3S2WA 5B2IC 3D0SA 3KWQA 2FJ7C 2D1VA 3KUYC 4OIQF 1AU7A 1KX5C 3O8GA 3QPSA 3JTGA 2D45A 2OC6A 4H9PA 5L3DA 4N0BA 3KFUG 4KFCA 4XR6A 3ULQB 2FBHA 2W00A 2HPMA 4RB3C 3MVPA 3HHHA 3G1OA 2M45A 4KUDD 1XCBA 2CW8A 2NVXJ 4WK8F 2WAEA 1TQPA 2NVYJ 4XICA 3S1MJ 5J47A 1XSXA 3O2PE 1J9IA 1MW7A 5CHLB 1XSDA 4NE6A 4G91C 4ENMA 1D0XA 3KE2A 4F3QA 2P8TA 4F92B 5CP6C 1YOVB 3N05A 3H5AA 3OYKA 1MDMB 5B31G 3LQQA 3UT9D 2P81A 1KQ8A 5AV9C 4F55A 4LOCA 5DDGA 2Z9OA 3V8LA 2FSWA 4PGHA 1A36A 4X23A 4PSWA 2QYOA 1ZQ3P 4CYCA 1VQKI 2Y75A 5B1LD 2OZ6A 3CMMA 1M1AD 2VJIA 1VF9A 3S17J 1MD0A 1HTAA 4L9TA 1JKQC 2XC7A 4A6DA 2Z99A 3M3YJ 3UTBB 4YRVA 1ZLKA 2NQBC 1YX3A 4CXFA 4FE7A 4JOMA 2DA3A 1WVRA 3DF8A 5IYCJ 1YJWI 2BYKB 2IJLA 3VWBA 3W98C 4AC0A 2ELKA 1DU0A 2CV1A 4ZBJC 1RIOH 4XUJB 1JKOC 2AQFA 3WTPD 2LP0A 1ORKA 5F1RA 2F8NH 4ABZA 3AZLD 4A3BJ 1UG2A 4BYYA 3MGSA 1FTZA 2STWA 3T5XA 2BYVE 5FGMA 4EJTA 5GT3C 2PYOB 2MLGA 1R71A 1TZYC 1IRXA 1R00A 2CJJA 1SANA 5IT9K 3AZND 3AN2D 4U0WA 4HZFA 4G12A 3BZKA 5JHUA 1HQ3A 2EBIA 2OJED 5FUGB 2RNGA 4WNNA 5JA4B 3MGQB 1D8JA 1UJ8A 4E45A 3OYLA 5F64A 3GF2A 2A6HF 3F6TA 2LVSA 2C6YA 4YM6B 2Y2HA 3C1BA 1J0RA 5GXQA 4BQOA 2UWMA 1I3QJ 5E5AC 5B24A 2Y0SN 4U7DA 1AOIB 1X1CA 3MKZA 1KA8A 2DU9A 3CCQI 4EQQA 3HOYJ 4CA0A 1DPRA 2DTRA 2RNJA 3GTPJ 4KGCC 1P3AA 4J8WC 4ZTFA 5L3CA 4U87A 3K1NA 3K4LA 1VI0A 4IKFA 3DWLE 4LG0B 3V7RA 5LD2C 2FOWA 3KXBB 3MAJA 3EUKL 4WXHA 1PYVA 3BPVA 3Q3SA 3UR3C 3DP7A 3V42A 3BP8A 2DMNA 1P9QC 5CPKC 4XZQB 3ZR8X 1I6HJ 1ETVA 4ASNA 1W36C 1HA8A 4H9QA 3PM1A 5DCMA 1LFBA 3C3WA 3CMAI 1D0YA 2DPDA 3LELA 3M7GA 1ZLAC 1Y8RB 4M3BA 4UUSB 3CO6C 2RVQC 2BGCA 2X4HA 2EZLA 3MGPA 4HV6A 1M19C 4YFNF 1P3MD 3AZIB 3OR1C 1EA3A 1X19A 4C2UA 2Z16A 2Y2LA 5BOXA 3AZKC 3DEUA 5K7ZA 3GWZA 3KP2A 3TW6A 4I99C 1BJAA 3HJEA 4H9NA 3REIB 2VN2A 3F8FA 2CV5A 4B44A 4JX5A 5GPAA 1EJ9A 2G5HC 5JHFA 3REKA 1XN7A 1P3OB 2F8NK 4I0AA 5IP6A 5LLQA 2M3AA 1BI2A 1DQUA 3ABUA 3ZMTA 1CF7B 4CGZA 1ZELA 2BHYA 4XN0A 2DPUA 5B2IA 1PVEA 3KUYA 2HVQA 3B6GD 2P0WA 1MMSA 2E19A 1KX5A 5K5QA 5D5XB 2H8WA 5B40B 4J8XB 5JI6A 4DQYB 1N25A 3ZMUA 1OQYA 4M3FA 4RAYA 1HLVA 3V7SA 3F8NA 4IHTA 3I9V2 3H0MC 4M9XA 2BBYA 1CQTA 1O7LA 4HDUA 2WY7Q 2A5WA 2W24A 4XRFA 5BNGA 1SFOJ 2K9NA 5CP6A 3JRDA 5AV6B 3C18A 4IRIA 3E3VA 5EZGA 2CUFA 2M4GA 5F6FA 4UXNA 4E7SA 2JA8J 1TT5B 4QTRA 5AV9A 4P96A 1N78A 3TL4X 3TP0A 5AVBB 3S16J 1QRYA 1ZKGA 3GMEA 2QWWA 1I39A 5J1UA 2BW3B 3GTQJ 3H0RC 3VODA 1KU5A 5J1YA 2NQBA 3JREA 4MFEA 4OAZA 4GGGA 1F9NA 3RJPA 4FX4A 4CSRB 5DEQA 2HUEB 2L02A 4WU9D 3FK7A 2Y2ZA 2Y30A 1YTYA 5B0ZD 2KKOA 3WTXC 2V1NA 1U35D 4MTEA 4EM0B 1H3OB 3WA9B 2M7BA 1VQ8I 2EV0A 1MMGA 4OU0A 3WHCA 2Z2SB 1ZHFA 2OZUA 2JE5A 2GOMA 2NNYA 2FNAA 2JVHA 2V1DA 1HKQA 3ESWB 1B4AA 1TTYA 3HRMA 5B33C 2X1DA 3KCCA 3VYRB 5GT3A 3RPQA 2M4KA 3F6VA 1TZYA 1TAFB 4KNYA 3OS0A 2HQAA 3HDDA 2LNBA 4UUTA 4DYQA 5EGOA 4BHPA 2HQNA 1VQ5I 3AZJC 1VQNI 2YS9A 1QO0D 3BG7A 4XNFA 1TP4A 1S3JA 3NRVA 4BACA 2PMUA 3CDHA 3F72A 3JRBA 4H9OB 1P3LA 4HF2A 5E5AA 3X2QH 1IG7A 3NWTA 3KETA 3OYDA 5DD8A 4DJAA 2VOPA 1BH8A 4KN4X 5CPKA 4I09A 2YFVB 3M8FA 3L2UA 3X1TB 2HZTA 4WU8C 1P3FC 1USTA 4BE2A 1BW6A 1ODDA 3IHUA 2HQRA 2A5YB 3MKYB 4OMZA 2BY0A 3CCEI 4KGCA 1R5HA 4J8WA 3AFAB 1DGWY 3BROA 3LWFA 1Z7LA 5CPID 2KLOA 1ID3B 1SD6A 2RC4A 1AKHA 2KDZA 3KWQB 3BR1A 5CVVA 5C3IB 1JFIB 2KISA 5BPIA 4H9PB 3OWTA 4HV5A 4M6YA 4BBRJ 1ON1A 4ETSA 3CF5F 4XLNF 1QVUA 2CV2A 3M8JA 4Z5TB 1GXQA 2MFZA 2PLYA 1P4WA 5F99C 2JSCA 3RQ4A 2PMZA 5KNLA 1A04A 1UELB 4Z66B 3A2KA 1OYWA 3K9TA 1KGSA 5BO0B 4GDFA 2DXIA 1ZLAA 2R7UA 1PP8F 3RYPA 5BNXA 2WAQA 3HGYA 3RELB 4L9JA 2BVMA 2LR8A 2EA2A 1M19A 5LFAA 2IO5B 5BT1C 3ABMH 1J75A 3TU4C 1LJ9A 3CUQC 5CPJC 3WG9A 3QPHA 1V55H 1MMAA 3AZKA 3HIFA 2Z3YA 2ZBKA 1BR1A 4CYCB 5GT0C 2XF6A 1ZGJA 3LJAC 4WJ3C 1IXCA 1XSVA 2DFEA 2RQQA 2YX4A 3BOQA 1ACIA 1BIBA 5B31D 4B09A 3ONQA 3LZ0C 4HGAC 1Y56A 3LZ1B 1KX4A 3K10A 4E7ZA 2UZKA 4A6EA 3P9CA 4KUMA 4XLPF 1H9GA 3AYWD 2QGUA 2WAFA 4KICA 1BC8C 1XDUA 2MA3A 5K7HA 2YPRA 4MNUA 1W7PD 3OYNA 4EGYA 4LIUA 5B32B 3I4NJ 1T38A 1FOYA 3IL2A 2JA7J 2BEOA 1D5VA 2CUEA 3FXJA 3RSNA 2AROC 3QPTA 1S7EA 1ETOA 2K9SA 2MH9A 2PEXA 2R4GA 2XGEA 5KK1A 5JVTA 2NZDD 5GTHC 2O03A 2PG4A 2O8XA 3RZOJ 2DDAA 5J6XA 1UMQA 3K4CA 4HNTA 4WNNB 1WWXA 3JRIA 1EQZD 2CW0F 5M5YJ 1I50J 1KYZA 4R1HA 3DU6A 3H5RA 3C1BB 3S1NJ 3E5UA 4FQGA 2DA7A 3UKGA 1IC8A 2R3SA 4XOPA 4BQQA 3CCUI 1MSFC 4F7ZA 5GSUC 1U2WA 5J8CA 3MVDD 5GP9A 2R7SA 1XGSA 4D5FA 2AS5F 2XV4S 5GPCA 2M8EA 3R0AA 3L2WA 5IOZA 3HOVJ 3SZGA 1DP7P 4I02A 4YS3D 4HW0A 1ON2A 4MQ9F 1OCPA 5F08A 1X3UA 1FMWA 1ZK8A 4IOAF 5CLSA 1S7OA 4QLCC 3WU2C 1KU7A 3QYFA 1P3BC 3WGIA 2EQRA 3K4NA 3M1CA 1SAUA 2HYGD 1BW5A 1T8IA 2L9SA 3OYGA 5B33A 5BQTA 4EJVA 2A69F 5HVQC 1V5GA 4J8VD 1P3PD 1RZ4A 4WXCA 4G92C 4RAFA 1R49A 4H9QB 2KJBA 1X2MA 2K5CA 5DCMB 2FE3A 5JRGB 3AZEC 4N9IA 1Z0XA 3J7YJ 4I2OA 4UUZA 5B1MC 4G94A 3LELB 3AV1C 5IP9J 2PFBA 1T33A 3AZJA 3D5SC 1EH8A 3I55I 1RC9A 2AXLA 2KRCA 3AV2B 3MGPB 3AZHC 2MC4A 2Q1ZB 1UFMA 2V9VA 2HYFA 3FXQA 4HX4A 4ENJA 2GXGA 1KONA 4OOIA 3AL0C 4FX0A 3OYMA 3OL4A 1P3FA 5BS7C 4JJND 3KEQA 2CV5B 1Z6TA 2D1HA 3VYUB 4BL0B 3WAAB 1ZGAA 1MGTA 3REHD 2CQNA 2JK3A 4DRBA 4KUDC 5LRRA 2X51A 2VXZA 2ZXHA 5BS6A 4PUSA 2JA6J 3KUYB 2VJ4A 4BJTA 4Y3OA 2M0CA 2PN6A 2L7FP 4O3MA 2NVTJ 3IP4C 1P34D 1GV2A 5DNMC 4PFPA 3UT9C 1RESA 2K9MA 5F99A 1QU3A 5FFZA 2VOOA 3WGHA 4PJNA 5CVIA 2ZFWA 3DFGA 1K4TA 1FEXA 4LK1F 4M9ZA 1E3HA 1CGPA 3CO7C 4NC7A 5B1LC 3FKIJ 4Q5SF 1M1AC 4V19K 1WHUA 5EZHA 4ZTJA 5BNVA 3EYYA 2X85A 4S04A 3H9JA 1LDKB 4Z2MH 2K86A 2TDXA 5AV9B 1W5TA 1R1VA 2KJCA 3TU4A 3CUQA 5CPJA 1O57A 5ICCA 4BJ6C 3W99D 5FLXZ 3K4BA 1MJ9A 4A0ZA 2V1XA 2Y2OA 5GT0A 3GBGA 2R7TA 3LL7A 3WTPC 3LJAA 3HM5A 3BZ6A 3VB2A 3AZLC 1OCZH 3KP7A 3VDXA 5L3BA 3LZ0A 2HZDA 4IHWA 4XOTA 3W98B 3O62D 5TRDA 5DNND 1Z1DA 3JR9A 1K7AA 1OCCH 4LITA 3H5NA 1UG0A 4DRAA 3AZNC 2KMUA 3AN2C 1IN7A 1LVAA 5CKTA 1F36A 1BI0A 2DFIA 2IS4A 3UTAD 4NUBA 3TDZC 2IEKA 2O3FA 4O6JA 5IYDJ 2LFBA 2LDUA 2AROA 3BG5A 2F5CA 2ZM5A 3MNND 3P7NA 1LE8A 3I71A 2K85A 1I27A 4A5MA 1Y6IA 5EGOB 3O6BB 3X1SB 1OFCX 2P6TA 5HDGA 1D1BA 2OD5A 4E70A 2A3SA 3H0GJ 2PJPA 3BCBA 1P3LB 1IRZA 3GX4X 4YG2F 3SEQA 1R5ID 5GSUA 3LSTA 2K3PA 1H8AC 1G6NA 2O6GE 3S2HJ 1OYIA 1RETA 3CP8A 4JX4A 1K6YA 1RPWA 4YIIA 4XK4A 4EM1A 1BH8B 5CPKB 4M6BA 5HDNA 3SYTA 3JRGA 2COBA 2L5QA 1BH9A 2IW5A 3BTJA 5D5VB 2M1BA 2KFDA 1RNLA 2DLLA 4GO1A 3KZIC 2CFXA 4HF0A 1T98A 5E3LA 4MIMA 2F8NA 3A1IA 1M18A 3K69A 2F4OB 4C3IJ 3MFKA 3MEXA 1YFHA 2FEZA 3K2AA 4CDGA 3LSGA 1DPUA 1B6WA 4QLCA 1P3BA 2AQEA 2ZXWH 2EB7A 3FBIB 3GTMJ 3Q0VA 4II3A 3OIQA 2HR3A 3AZFB 2L9NA 3H1CA 1JUPA 2LREA 4FETA 2EINH 3RTRA 3TGNA 3CQZJ 4IO9F 1G3SA 4Y17A 2ZSHB 1P3MC 4UVCA 5B32G 9ANTA 3AZEA 3PFIA 2BOLA 5B1MA 4FT8A 3L2CA 3AV1A 2ZNYA 2TCTA 1BA5A 1ZLAB 3UTBD 4DZJA 5BNXB 4LB5A 4C2MJ 2M0MA 4RBOA 3AZHA 2DMTA 1M19B 3L2QA 1JE8A 2F5EA 4LFUA 1OYYA 4M6XA 5FJ8J 4XUJD 1WSUA 5LBQA 5D4SA 2NVQJ 3P5JA 1K79A 5BS7A 2DTZA 3B6GC 1S9HA 2IGKA 6PAXA 3PO3J 5HDKA 2R7ZJ 3S15J 3H35A 2VE8A 5JR3A 4XIDA 3C2BA 2GWRA 1T2KA 1R4MB 2PYOD 2QKMB 4KUDA 4BEHA 1Y0NA 2DT7B 1KX4B 1IF1A 5JFRA 2VC0A 1P3KD 3MGQD 3A01A 3GUDA 3U9GA 3LSKA 2E2JJ 4HX7A 5B2JB 1B72A 2W82A 2E1MB 1W0UA 4AYBN 3E6MA 1LFUP 2EFQA 1RI7A 3B0DC 3IWFA 3RKXA 5E3NA 4YM6D 4AVZA 5AY8C 5DNMA 4KMUX 3UT9A 1JT6A 3M9AA 4XRMA 2CO5A 4HDVA 2ZY4A 1LB2A 1AOID 4H9RB 4U0VA 2DK5A 3EUAA 5AV5B 3FXUA 3B6AA 2CFOA 5A2QK 1OR7C 2HOTA 2H6BA 3AG2H 4ESBA 1M1AA 5E1XA 3GTGJ 4WCGA 2Z5UA 4MTDA 5EG0A 1HOMA 5HLHA 2XSDC 4LJZF 2HVSA 3LA3A 5ICGA 3KXBD 4WU9C 4ZJZA 2F4IA 5B0ZC 4ZZDA 2IA1A 3CDIA 1U35C 1U5TB 2XUBA 4J8UC 4I01A 1SFEA 5DCFA 3JTHA 2COMA 1H88C 5DUIA 3M8EA 1DUXC 3WTPA 5F0HA 1ZRDA 3S1RJ 4UNOA 4XL9A 1B59A 1XCVA 3J80Z 4EGZA 3QRFF 1FOXA 3KPHA 3TW7A 4XZQD 3AZLA 2HIOB 4ZDLA 1IRGA 3FX3A 1HW5A 1KU3A 2Q2EA 1IXRC 2Z33A 3WTPE 4M71A 4PZJA 3KEYA 3AZNA 4WXDA 3AN2A 4RB1A 1P7IA 2WV0A 4I7HA 2KIUA 3BJOA 2XAHA 2HFHA 2XD5A 3I5UA 1FYMA 1G3WA 3HKZA 3H3UA 2KDOA 5B33B 1K4SA 1VFCA 2K4JA 4NFTA 1HXDA 1WGXA 3BTIA 3CCJI 2IVMA 4MFDA 3REID 2E7XA 4WZSB 3WG7H 3X1UA 4KIGA 2WA0A 2EWNA 3PUBA 4UUZB 1LEAA 1YE9A 2X6WA 1MH4A 2HYJA 3K4MA 5FRNA 3GXOA 3H0LC 2XVCA 4KYWA 2XAFA 3ISPA 4AIKA 1XMXA 2X6XA 3IC7A 3Q9VA 3S3OA 3RPUD 4UVAA 1Z91A 1SC7A 3BTLA 5B40D 2WB1N 1P3GB 4HRIA 3FK6A 4H9SC 4J8XD 3HL2A 3OSFA 4CAYA 2HDWA 3VH5A 2GA2A 2HGCA 1XG1A 4AD9A 3C1CB 2FMLA 3KFWX 2I10A 4DNCA 4L18B 1UZCA 1WI9A 3FZVA 1Q9CA 2P5KA 4B3AA 3HC7A 4CH7A 3F8MA 3BQYA 1FIAA 4XKBA 4DQ2A 2FMYA 3BDDA 3KYCB 5AV8D 4IVNA 4Q48A 2RN7A 4XKWA 3OYAA 1OKRA 2QEXI 3HSFA 1PDNC 3QWLA 1A7WA 3HRTA 1DGRM 3ZQGA 1O3SA 4ZC3A 4KITB 1APLC 4NQWA 4E6KG 5F99B 1P3MA 1H89C 2GBYA 5HODA 2QCOA 4P9FA 1NH3A 4NB5A 3GZ5A 1S6LA 4D0PA 3WU1B 1WWSA 1KX3A 1HW1A 3IAM2 4JYKA 5BNVB 3E5XA 3WA9D 2WC2A 5B31C 3E6BA 2VKHA 1P4AA 3DKXA 2ADUA 3AZGD 5CPJB 2XB0X 4R8HA 3F21A 3GW2A 2X48A 3H9QA 4G8XA 2P5VA 1S72I 3AYWC 1P3ID 3B6GA 3WKJA 3OYJA 2XPWA 4KHAA 3LJAB 2DT5A 2FQ4A 3RIRA 1QNTA 2RVCA 4EEFG 2ZKZA 5LRSA 3A6NB 4E7IA 4NE5A 3LZ0B 4HGAB 2RAEA 1A35A 5F0FA 5ED4A 1ZR2A 4ESFA 2E1OA 2VASA 3I3LA 2VIXA 2KRFA 2F5DA 1ZG1A 2V1UA 2VODA 3I4MJ 3B02A 2NZDC 2CUZA 2VT2A 1LUJB 3REOA 4BH9A 4JP0A 3VH6W 2G9WA 2H6CA 5TGTA 2IT0A 2NS8A 2VC1A 4M72A 2Y2PA 4B4CA 1JKPC 5AY8A 2HNHA 2OCEA 1MMNA 2STTA 2PQ8A 3V9RA 2JMWA 1G2HA 4L9VA 1FYKA 4LLLA 1BI1A 3KLOA 4DBQA 2AROB 3S32A 3LFUA 2JPBA 3GFLA 3ZMZA 2O7OA 1LE8B 4XKVA 3X1TD 1JTXA 1MH3A 3IWZA 3MVDC 3AZMB 4B48A 2VBXA 3BWGA 1YO5C 1G8XA 3SXYA 1V5EA 4U88A 2ESHA 2VKVA 1XDSA 3HBLA 4R79A 3VOEA 4WU9A 3VSLA 3KWQD 3GLLA 5B0ZA 3FDDA 2IGNA 4LGWA 4J8UA 2QKLB 3RZDJ 4R8PB 4AIDA 5IOYA 3Q0UA 5EEGA 4A3MJ 2ZY3A 5J1RA 3IKTA 1BH9B 1Z9CA 3DPUA 1OCRH 1V4RA 4Z5TD 4MGRA 2JTVA 2UXXA 2F8NB 1M18B 4Z66D 1YW8A 1P3PC 4J8VC 4HNVA 2Y2IA 2Y2JA 2FBIA 2JPCA 4QLCB 4IX7A 2EH3A 2XRNA 3OYIA 4CCNA 2ZMEC 3RELD 1P3BB 3ZPLA 3VH6A 4BDZA 1HCRA 2MGQA 4HLXA 3WE3A 2GM4A 2OTJI 3DBHB 3OIOA 2QM3A 3TMOA 4CICA 1OCTC 1ZYRF 2VJJA 4GFBA 2JRMA 2LOOA 1WJDA 5B1MB 2KPMA 2FJ7A 3AV1B 4Q47A 2CGPA 3CJTB 4UHTA 2LKPA 4JJNC 3EPZA 3U21A 1X1DA 1IV6A 3TEDA 3LZ1D 4BKXA 3AZHB 2J8PA 3QOEA 1WQ2A 1U8BA 1FP2A 1F5TA 3REHC 4ZUXC 2P7VB 1YIOA 2HS5A 1R9TJ 3AL0B 4YIFA 4P9UA 2RREA 4CSWA 4H9SA 5B32D 3DCFA 3P5JB 4IRGA 4BBSJ 1A5JA 1JGSA 5AY8B 1XD7A 3OOPA 1G3YA 1BIAA 2DJNA 1LEBA 4HBLA 3MWMA 3B0CW 1VQ6I 2EPFA 1KQ9A 3COAC 1P34C 4KUDB 4BEHB 5JLXA 4AIHA 3R45A 5FKKA 5F1JA 2DA5A 1QZEA 3JCUC 3A01B 5B3SH 1R58A 2MBFA 3DEWA 3HOXJ 2ECCA 1B72B 2E2IJ 4EO5B 3W2WA 5H6RA 2F5VA 4NBQA 3JRAA 3ZMVA 3RKQA 3WTVC 3TOBA 5DNMB 1TBXA 3WTTC 2XB5A 3UT9B 4MHGA 3SZTA 2W4SA 4LK0F 2DYRH 3EUHC 3K2ZA 4G6DA 1WJFA 1BI3A 1HW2A 5HOOA 3JSPA 5L3FA 2E36A 1FZPB 1TT0A 1WH5A 3LAJA 3M07A 3GVAA 5EG0B 5B31A 1K78A 3DPTA 3T8TA 5G49A 3FM3A 3O62C 5DNNC 3BJ6A 1JXSA 2Y0SA 3TDUC 1ZGWA 4F91B 3FHNA 3AYWA 3CJRB 1ZAOA 2CMPA 2N8GA 4XLHA 4GRIA 1NK2P 2IPQX 1S32B 3UTAC 3LNQA 4J19A 3AZLB 1TZLA 1X1PA 4Q4ZF 4YEJA 1VZ0A 2IS2A 5JRGD 1Y0UA 4XRSA 4UVBA 5CQGA 2QQAA 4RGRA 3LELD 3MNNC 2B0LA 2JN6A 3FWEA 4IHSA 2NZDA 3LSRA 3AN2B 3W97B 1F1ZA 3AV2D 2DYSH 2QBYA 4Y15A 4I6ZA 1R23A 2OF7A 3FDYA 1RRJA 1R36A 2FNPA 2DA2A 2YUSA 1WZ2A 1ETYA 3JRHA 3MVDA 3X1UB 3G1LA 4XLEA 3RCOA 1E3OC 1FSEA 2CV5D 2JCHA 3WAAD 3LAPA 1YJNI 2JSPA 1SMYF 4EATA 2AXTC 4ZH4F 5DUKA 5FKMA 3BCAA 3NQOA 3BR2A 1U9NA 1ZARA 4DYRA 2Z1DA 2O61A 3MGRC 2B63J 4A3EJ 1ITYA 5E1WA 1GVJA 2OUMA 1HQCA 5DTDA 3J80K 1OCOH 3H3VK 1FTTA 3ZQ7A 1P4XA 3CDLA 1JUSA 1KU2A 1WFXA 3X1VC 3D1NI 2G7UA 2QVOA 1MBEA 3WODF 4LD9D 1P3PA 4J8VA 1ZN2A 2FOKA 1VQMI 3B6FD 3HSEA 3MD2A 1TQMA 2CUJA 3SDGA 2ZMEA 1DDNA 2BZTA 1Z21A 4X23B 3OMYA 5EDNA 2A6EF 3WGGA 3CP2A 3W6KB 5HNFA 2MABA 4A0YA 3HEFA 5KAIC 4C9YA 5D6EA 3UNGC 3LSJA 3G1MA 2VI6A 1P3MB 2K3FA 4XUJC 1ETWA 1JJ8C 4OIRF 2FJ7D 2R7FA 1IW7F 3DTEA 2LY9A 2QF7A 2EZHA 3CLOA 3FBNB 4JJNA 2ICWG 1KX3B 2IP2A 2YX7A 1FIPA 4PCQA 2VBZA 2LD5A 2G7HA 2FU4A 3MQ0A 5J40A 1B9MA 3W2VA 2R92J 4ZUXA 2V7FA 5B0YC 3MGSB 3REHA 5JLWA 3IKVA 5B1BH 4B47A 1HF0A 2ZCWA 2XROA 1P3KC 3MGQC 2BG1A 4KJZA 3WKJB 3L1PA 3QAHA 4KHAB 2A05A 1F43A 1HQ3B 4J01A 3TO9A 2LMDA 2VJ5A 1LQ1A 4YM6C 4ZYHA 1E3PA 2MG4A 1P34A 3LSIA 4IQ4A 1F4KA 2HWVA 2JT1A 2NAZA 2VONA 5GXQB 1ETQA 2EIMH 2DFHA 1ETXA 3ABKH 3O8HA 3GFIA 3X1SD 5B24B 1SFKA 3HOWJ 2GQQA 5F0CA 2LY8A 4TV7A 1FNNA 2VUMJ 3B0DB 1P3LD 2F8NG 5L3GA 2DN0A 2ELHA 2VB6A 1X1BA 4JQFA 4E4HA 1OMIA 3JAMZ 1LPQA 2LH9A 1B8IA 2CV0A 1OLTA 4HPQA 2G0EA 5D8LB 3KP6A 3PSIA 2JA2A 3P9KA 2Y31A 3EUHA 3VFZA 1P3AB 4S0HB 1WPKA 3KXBC 2IGOA 5CPKD 4PJJA
chains in the Genus database with same CATH topology
2XASA 3FMRA 3HUGA 4AWLC 2L54A 1JHFA 4WU9B 5B0ZB 2QZ8A 3REJD 2BV6A 3K1PA 3V8KA 2A07F 5DNNA 3O62A 5CYVA 4J8UB 2FXAA 2L4MA 2L01A 2Q0OA 1XMKA 5HS7A 5AVCC 2DQNC 3ERED 3UTAA 1V3FA 3AZFD 2K4BA 3J7AO 4IXAA 3NEUA 1HSTA 3MNNA 1ZLAD 3NQUA 1YS7A 4H9NB 1J2XA 4WU8A 4XSZF 3REKB 3KP3A 2LF8A 1F66D 4ZYEA 3SFZA 2XAQA 5B2IB 5B40C 2FJ7B 1IXSB 4J8XC 2F2AC 1KX5B 1LDJA 4RGXA 3KP5A 3WTZA 1KX4D 2HTJA 2RDPA 4M74A 2L3DA 4EJUA 3MGRA 5B2JD 1G3TA 2Y2GA 2L4AA 4G91B 3RYRA 5CP6B 1BFMA 1ZG5A 4RB0A 2H27A 3DKWA 3X1VA 5AV8C 1U8RA 2EA4A 3ECHA 5AVBC 3EPLA 1FBUA 3R45B 5AV5D 5TJJA 4IF4A 4ESJA 4GYGA 1EV7A 3HRSA 1I6XA 2VBYA 3DQVC 4RAZA 4EMSA 4ZBJB 3L00A 2BYKA 1QZZA 3A1KA 2NQBB 1H0MA 3WA9C 2CYYA 5CVJA 4XUJA 4RB2C 3AZGC 5LHHA 1SFXA 3CTAA 1ZRCA 4IRHA 2HIOD 3L9FA 3RDIA 2PYOA 3DPLC 1K78B 5B0YA 1R7JA 1P3KA 5GT3B 1USSA 3W96D 5JA4A 1T3UA 5FUGA 3MGQA 1TZYB 3TO7A 3VH5T 5B33D 3NQJA 1FLIA 1WWIA 4XSXF 3I0TA 3KZZA 3FF5A 2PI0A 2DI3A 5E5AB 1P3IC 2PBIA 5HS8A 3WTWC 1Z2CB 1TW3A 3L09A 2QBYB 4EV0A 3EPKA 4JK1X 3DV8A 1YLFA 3ECOA 4KGCB 4LG0A 2W25A 2JSSA 4J8WB 1P3GD 5K1YA 3KXBA 1MJAA 2QQBA 3KWQC 3ZN0A 5ILUA 3C1CD 4M9SA 1TW2A 3CJNA 5IT3A 4Z5TC 3FMSA 4L5IA 1YG2A 1B9NA 2ZO4A 4Z66C 4L9NA 1ZH5A 4RS8A 4G7HF 5AVCA 3RELC 1H9TA 5F99D 1QQIA 1U3EM 1U78A 2IO5C 3T0YA 1J59A 1P3PB 2ZY2A 1XMAA 4G7OF 2WTEA 3AZKB 4YFXF 2UWXA 1C0WA 2DAOA 4I0BA 5BT1D 1LDDA 3LZ1C 4RGUA 3O3KA 4HA8A 3RPUA 4HOBA 4KA4A 4U7BA 3LJAD 5B40A 1E2XA 3K1MA 5B32C 4J8XA 3A6ND 4JJNB 2KIFA 4ON0A 1SD5A 5AONA 2FF4A 2XAGA 4ZUXB 2RQPA 2L5AA 3ABTA 1Z7UA 3F8BA 2W8SA 2EK5A 3SQNA 5B1LA 5AV8A 2QENA 5AVBA 2CSOA 1D3YA 1FY7A 3AZMD 5HLGA 4EM2A 2E1NA 1SFUA 3VH6T 2K7LA 1RUOA 1YW7A 5LGTA 4CSRA 5AIQA 1H3OA 4R8PD 3C7JA 1FPQA 1J5YA 3AZGA 1YS6A 4LB6B 1IUYA 1O3TA 4I98B 3I64A 2F8ND 1M18D 5D5UB 1PZRA 3EG5B 3MZHA 3K0LA 1P2FA 1TAFA 4QLCD 3ZN1A 5JRGC 3O62B 3AZID 1P3BD 5KVRA 2BE5F 4A0XA 2JZYA 3ML6A 2WWYA 2HKXA 2IRFG 5FO5A 3AV2C 3LFKA 2VQRA 1P3OD 3AZJB 4HLYA 4ZYDA 3KP4A 5B1MD 1PP7U 3HTUA 3Q5FA 2YFVA 3AV1D 1P3IA 3HSRA 5CPIC 3NQUB 1B6AA 2CV5C 3GLXA 5FD6A 4KIFA 3WAAC 4WU8B 1P3FB 4Y13A 1BBYA 2IA2A 3HYIA 3N97A 4EJOA 1JFIA 4WF2A 1FOKA 3KEOA 5ILVA 4CYDA 5LEKA 5AV6D 1TQIA 3TQNA 3L7WA 3EQLF 1I1SA 4Z5TA 2W57A 4HQMA 4CO8A 5D8KB 2FBKA 4Z66A 3MGRB 4LD9C 2P6SA 1BOAA 4A5NA 5BO0A 3B6FC 5CVUA 2EFPA 3RELA 2Y2MA 1AOYA 5DNMD 4K2EA 4AIJA 1S7AA 2MD5A 3B0CT 2F2EA 3OV8A 3X1VB 2YFWA 3SHFA 2QLZA 4BQAA 3GYHX 3TU4B 1P92A 2J5OA 1O7FA 3CUQB 4UPKA 5ILSA 2VBWA 3QOPA 1YQAA 5GT0B 5E8GA 1T39A 3LZ1A 3F8CA 1IN5A 4HYEA 4YFKF 5FB2A 2M30A 4BHBA 4G6QA 5B32A 1S32D 3JW4A 4IPAA 1QGPA 1QPMA 1Z05A 1EQZC 3WTYC 4Z2MG 5LEJA 3R4KA 5B0YB 2F5FA 3W97D 3I4PA 2M5WA 2P7CB 3X1SC 2MLKA 1OR7A 2VE9A 3TKYA 3I59A 3NQJB 4M73A 1P3LC 1U6GA 3AFAD 3C1DA 3GZ6A 2EJRA 5K5RA 1VTNC 3J81Z 3X1UD 1ID3D 1T6SA 4OIPF 4YS3C 4ZYGA 1GXPA 5FLXK 5GSUB 5CPKC 5KDMA 1U35A 2W85A 2RV8A 3EPJA 2LF7A 3V7CA 3KSYA 3BPXA 3REJC 2DO7A 5LHGA 3LA7A 2DW4A 1IN8A 2W84A 4OMYA 4AWLB 1E17A 3AZFC 3G73A 1N1JA 5JRGA 1MZBA 4G92B 3ROUA 4X23D 5J8FA 5AVCB 3AZEB