2CWEA

Crystal structure of hypothetical transcriptional regulator protein, ph1932 from pyrococcus horikoshii ot3
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
191
structure length
191
Chain Sequence
b'AKKVKVITDPEVIKVMLEDTRRKILKLLRNKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTEMKGNLVEKYYGRTADVFYINLYLGDEELRYIARSRLKTKIDIFKRLGYQFEENELLNIMDRMSQKEFDATVRISKYIEEKEDALKDFSNEDIIHAIEWLSTAELARDEEYLELLKRLGSILKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical transcription regulator protein, PH1932
publication title Crystal structure of hypothetical transcriptional regulator protein, PH1932 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Gene regulation
total genus 74
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2005-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2cweA01
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2cweA02
4F7ZA 3AZHB 5CPJB 3VH5W 4HBLA 3M9AA 2FNPA 3WTUC 1J0RA 3REHA 2NS0A 1P3KA 1FLIA 5B0ZD 3K0LA 1M18B 5B1MA 3X1SA 2PYOA 1F1EA 2ZFWA 2FBHA 4IPAA 2NZDC 4X23B 4WU9C 4ZUXB 3VH5A 4R8PB 2F8NA 1F66D 1WKMA 1FSHA 1U5TA 3A6NB 5FB2A 2YX7A 1VTNC 4EVIA 3KXBC 1XD7A 2EJRA 2VT2A 4UNOA 2V1DA 1R1VA 4KUDC 4P5OA 4L5IA 1E2XA 4H9QB 2HIOB 5BT1C 5L3BA 1GVJA 1SMTA 2GIVA 4CHUA 4S05A 4OINF 1KQ0A 3X1UC 3REHC 4KUDD 2BYMB 1K78B 5DNMA 4Z2MG 1ON2A 3KSYA 2KJCA 4ZYHA 5BNVA 3RYRA 4U0VA 5CPKA 3X1SC 3AZNA 2PYOC 2QUFA 3AN2D 4CSRA 3U1DA 2JSSA 3CO6C 2EFOA 3M1EA 1BFMA 3X1UD 3LAJA 1P3FC 3D5LA 3TDZC 3GO5A 4KMFA 5CPIB 4UVBA 3AV2B 3W96D 4KN7X 2PEXA 2H6BA 2EB7A 2V1XA 4I98B 4JK1X 5ILUA 5ILVA 2OBPA 4XSZF 3B02A 3WTSC 4QLCA 2ZBKA 2ZJ2A 5JRGC 3REIA 1TAFB 3R6SA 3ULQB 5B0ZB 1FX7A 4Z66D 3AZKD 3I71A 4IRIA 3DEUA 4M6YA 5DNMC 3REJD 2PJPA 3GUDA 5JRGD 3AZGA 1JE8A 4ETSA 4KHAB 1J9IA 4J8XA 3HYIA 2CV5C 3W97C 1BBYA 3WTPE 1ZN2A 1P3OD 5DUIA 3PQKA 4M73A 2ADUA 1RZ4A 1USTA 4LG0B 3KP5A 1AWCA 1IUYA 2L4AA 3AFAA 3BPVA 3W97D 5CP6D 4DRAA 1J59A 1HW2A 5AVBA 3X1VA 3WU1B 1XSDA 3KCCA 3REIC 1ZG3A 2H27A 2XKPA 4XBFA 4H9OB 4KUDB 4GCVA 5A2QK 4OU0A 4EV0A 1WRJA 4KA4A 1RUOA 4IJAA 3KETA 1M19A 3ZMTA 1X3UA 1A04A 3CDHA 5HDNA 1XDSA 1EQZA 3ERED 2PMHA 2QBYB 3AN2B 1XSVA 2DK8A 3AZGC 1XMAA 1TQMA 1HKSA 5AVCA 3X1UB 3WAAD 4J8XC 2NAZA 2FJ7A 2O03A 3C1DA 2HR3A 5B1LA 4L5JA 5F99D 1YIOA 3X1SB 1GXPA 2PYOB 4U0YA 3JAMZ 3WU0A 2HYGD 3ABTA 5FLXK 4J8UC 4G92B 1P3FB 4HLYA 3AFAC 3X1TA 1LDDA 1G3YA 3AZMD 3MVDA 4CXFA 3X1VC 1P3PA 2PLYA 1MDMA 3F23A 5B2IA 3VODA 5BO0A 5JI6A 5JRGB 5K5QA 1M19C 3UTAA 4KUMA 1IN6A 1KU9A 1ZLKA 4MTEA 2E1NA 5AONA 5DCMB 2IVMA 1EQZC 2F8NH 5D5XB 5HS9A 3QPHA 2ACJA 5AVCC 4MNUA 5ED4A 2EA4A 2VBWA 5DNMB 4G7OF 3MGRA 3RKWA 5CVVA 4KFCA 5B1LC 4KMUX 1LDKB 2Z5UA 4Q4ZF 2CSOA 4L9NA 5B32A 2CV5B 1P3AC 3W97B 4HQMA 5LEJA 1ZH5A 1SD7A 2VOOA 3ZPLA 3O6BB 1TQPA 3X1TC 2V79A 2VXZA 5H6QA 5BNXB 4HYEA 5ICGA 3MVDC 3SFZA 3B73A 4J8WD 1S32C 1P3PC 5CVIA 4Z5TD 3QU6A 3EQLF 5B2JA 4G7ZF 4EM0B 4OIOF 3BROA 4Q48A 3K69A 2OZUA 1GHCA 1S3JA 3J80Z 4LGWA 4Q47A 3UTAC 1KX5A 3K9TA 3RPUA 2EFQA 4KGCD 2WC2A 3WAAB 3DKWA 1S32D 4RB2C 1R23A 5GXQA 2BEOA 1GXQA 2XHKA 4OIPF 4A5NA 1ZYRF 2Z99A 4PZJA 4WX9A 5B24C 3KWQD 3U9GA 3D0SA 4J8XB 2GQQA 2QQBA 5B32C 5DUKA 2HYFA 1IXSB 3FF5A 5DNND 1XGMA 2X0LA 3MCZA 1BJAA 5E5AA 2DLLA 2ESNA 5B24D 3M7GA 4J8UB 1TQIA 5ILSA 3TDUC 1I6XA 4PDKA 3UTBA 3JTGA 2L02A 1KX4A 3MGPA 2R3SA 3V7RA 5B2JC 3BZ6A 3T8TA 2YFVB 5AV5A 4KICA 1H3OA 1LJ9A 1SD4A 1SFUA 3I0TA 4H9NA 2H94A 2ZCWA 2O3FA 3FMRA 3BJ6A 1LEBA 2CO5A 3Q9VA 5K5RA 5AV8D 5L3DA 1U6GA 2ZNYA 4XZQD 1EQZB 2IA0A 2HFHA 3B6FD 5TRDA 4MEYF 3M8EA 5AVCB 1QO0D 4MHGA 5D5VB 4LD5A 4ZYGA 1YLFA 1KX3C 1JGSA 3WTTC 1JFIA 5GT0C 2QYOA 3REOA 1MJAA 5BPDA 5B1LB 2F5EA 4J8WB 3TU4A 2MBFA 3MAJA 1P3AB 4WXCA 1P34C 2R7FA 1ZG1A 4WWCA 2AROD 4CO8A 3ZP5A 1P3MA 2R7DA 5AV6C 3UTBC 2EA2A 2PN6A 4YS3A 1KX3D 1MD0A 3MGPC 4M9ZA 5AV5C 2VBZA 1T38A 2PBIA 3Q9SA 4MQVA 2XVCA 1S32B 2XGXA 1H9TA 2DQRA 4ZH4F 4AWXB 2FBIA 3CJNA 5LRRA 4MGRA 2K27A 3B0BA 3WGIA 5AV6D 3TO9A 2ESHA 5BO0B 3UTAB 4H9PB 5CVUA 2IT0A 3O3KA 3RKYA 2KIMA 1T6SA 5D6EA 5TJJA 1USSA 1YW8A 3TOBA 3KLNA 5B24B 3LQQA 4IRGA 4E45A 3P9CA 3S2WA 3AZJC 3BP8A 1FP2A 1B9NA 2J5OA 4NB5A 3WODF 4YS3C 2V6CA 2NQBD 4M9XA 3K2ZA 4KYWA 4EJTA 1P3GD 4LK1F 5AV8B 1O7LA 4KNYA 1UHWA 3AZJD 3WA9D 3AZLA 3B6FB 3E97A 3AZID 2ISZA 3O62A 2W25A 2V9VA 2P7CB 3B0DC 2ZNZA 2MA3A 2E1CA 3WKJD 3LJAA 1K79A 3SZTA 4GO1A 1Z91A 3AZFA 3WTPD 4A6EA 3GWZA 5FFXA 4WNNB 2P6SA 4A0YA 2GZWA 1R1TA 3FHZA 2AROB 3CO7C 2P5KA 1HSTA 1YYVA 3VOEA 2C6YA 3RIRA 4RAZA 3W99C 1KX3B 4YM6A 5GT0B 3C1BC 5CPJD 1ZG5A 3EDPA 5FGMA 3FM5A 2W57A 4LK0F 4YIIA 4AIKA 2FNAA 4WXDA 4YFNF 3GFJA 1P34B 1M18D 2STTA 4HX7A 1WQ2A 3J81Z 4CZZA 2EV0A 1P92A 3LZ0A 5AV6B 3UTBB 3MZHA 3W99D 5BQTA 3IL2A 3C1BD 1YG2A 4ZUXD 1H3OB 1W7PA 4R8PD 4IVNA 3O62C 1IRGA 1TW2A 2XAQA 1J2XA 3RJPA 4LD9C 3LJAC 3OV8A 2HEOA 3AZEC 5CLSA 3AZFC 3WE2A 2IO5C 3HRTA 3GFLA 1MZBA 1KA8A 1OYIA 3ML6A 4JJNC 2LNBA 3E5XA 4LD9D 2DBBA 1UHMA 1IAWA 3F6OA 1DPUA 4HZFA 1JFIB 5HLIA 3DPTA 2OQGA 3AYWA 2OU2A 3NQJA 1ZGJA 2IJLA 1G6NA 1IXRC 3B6GC 1QQIA 1P3GB 5LGUA 4UUZA 1QGPA 2PFBA 4JJND 3AZJB 5JHUA 5LGTA 3LZ0C 4EGYA 2LY8A 3AZIB 5J8FA 3WKJB 2QQ9A 4PGGA 3QP5A 3B6GD 4ZZLA 3QAHA 2BE5F 4R1HA 5AIPA 2XUBA 3WTWC 1HKTA 3AV2D 1D8JA 2DTRA 3WTPB 4RB1A 4EM2A 5B31A 2F8NG 2KIUA 2VC0A 3B0DB 2A6EF 3F8BA 1FYLA 1PDNC 4LLLA 4HAMA 4E44A 1T2KA 1HQ3C 3FWEA 4EM1A 5BOXA 3AYWC 2GXBA 1Z9CA 3FMSA 4H9SA 5IT3A 3W99B 3C1BB 3RELA 4Y13A 1JXSA 2FMLA 3JW4A 1FOKA 1FYMA 1HQ3D 1BC8C 1WWXA 3GW2A 4CAYA 4KDPA 2CWEA 3KUYA 1L0OC 3W96A 4KN4X 5JA4B 2M45A 1R58A 2M87A 3NEUA 2LDUA 2NZDD 4WU9D 1XCBA 5B0YA 1BM9A 2VE9A 3O62B 3SQNA 5BS7A 4I7HA 1LNWA 4LD9B 4KIGA 3MZYA 3KP7A 1OPCA 2HOEA 1L3LA 4RAYA 3I59A 3KXBD 3AZEB 4RB0A 3MWMA 3G73A 4WZSB 3EYIA 5JR3A 1S7OA 4Z66A 4MEXF 1ZRCA 4P9UA 1P3KC 3AV1A 2QENA 5B1MC 4WU8A 3REJA 2DU9A 3SZPA 3P9KA 4JJNB 5BT1D 4ZYDA 3GVAA 4FX0A 3ZMZA 1YW9A 1KU7A 3RELC 2VONA 5E1WA 2BBYA 3REHD 3B6GB 4A2UA 1P2FA 1U5TC 1REPC 3X1SD 2RNJA 2PYOD 4TV7A 3W98A 3W6KB 2LKPA 1EH6A 4EQQA 5CP6A 5HDKA 3ELKA 3JAMK 5B0YC 1P3FD 3GXOA 1SD5A 3LELA 3I58A 3HTUA 3ZMDA 2LSOA 2KJBA 1HBXG 3WTXC 1U35A 4EJVA 2VOPA 3MGQA 1Y0UA 4J8VA 2V1UA 5DD8A 2QQAA 3AV1C 5HDGA 4HF0A 4H9RA 2UXXA 5CPKC 3AZNC 1O3TA 4LFUA 3LA3A 2G9WA 4ESJA 4LB5A 1CF7A 1HQ3B 3L09A 2EFWA 2VT3A 1P3IA 3GYHX 3AYWB 5DNMD 3JSPA 2Q8KA 1P6RA 2DK5A 4WU9B 2NZDB 4QLCU 2H09A 2BYKA 3AZND 4U7DA 3W98C 3TGNA 2CV5D 4EO5C 4OMYA 5E8GA 5AV9A 1ZRDA 4QLCC 4GGGA 3KXBB 3AZMA 5FUGB 2WWYA 2MC3A 3W6JB 3LELC 3VH6T 4LB6B 2IA2A 5AIQA 3T1BA 3K1NA 1F5TA 2RN7A 1U35C 4IHTA 4P9FA 5KDMB 3JSOA 4QLCD 1U78A 1SFEA 3TQNA 4M72A 3C7JA 2VBXA 5L3EA 4J8VC 3REID 3HRUA 1IF1A 2A69F 1PP8F 5B40A 4HA8A 1PUEE 2RVCA 2STWA 4HX8A 3REHB 1QZYA 3REKA 3K1MA 1P3KB 1S6LA 3MGSA 4EMSA 1H0MA 3HSEA 5B1MB 4EJWA 2F5FA 2MD5A 4A0XA 1IRFA 3RELB 3AZGD 4ENKA 3ECHA 4A6DA 3HIFA 1BH8A 5F6FA 5BMZA 2JPCA 4J8XD 2F8NB 4NE6A 1KQ9A 1U5TB 5AV9C 3C1CA 1LQ1A 3LFKA 3DFGA 5AVBC 1WSUA 4A12A 2ZMEA 1P4XA 2L3DA 5B32G 2UZKA 4NE5A 5C3IC 4J8UD 3FM3A 4P55A 4IRHA 4IXAA 3AFAD 1E17A 3ZN0A 4RGRA 5GT3A 2KIFA 3ZMVA 5AVBD 3X1VD 2GXGA 2XIGA 1K7AA 2DW4A 5B40C 1FP1D 1QBJA 3WGHA 3EETA 3REKC 3KP2A 4AIJA 2FJ7C 1B9MA 1YQAA 3MFKA 1SD6A 3MGSC 5BNVB 1M19D 1TLHB 1G3TA 5CPKB 4BHPA 2BYVE 3AZNB 1O57A 2PG4A 1EQZD 2NYXA 4CSRB 4JQFA 1WWSA 5HS8A 2VN2A 5ICEA 5AVCD 3HUGA 2VODA 2FU4A 1OYWA 2IW5A 2PMUA 2YU3A 5B1LD 2YPRA 2FSWA 3C1CC 2CYYA 4OIQF 1P3AD 2OAZA 3DXJF 2F5DA 4EO5B 1TZYA 3E5QA 1BIAA 2RQPA 5D8LB 5B2IC 4QLCB 1XGNA 3REIB 4OOIA 5DV5A 3X1TD 1M1AA 3M8FA 4R8HA 5A2QZ 2P5LC 4DRBA 4M9SA 3MVDD 5GT3C 1P3PD 5LGNA 4L0YB 3H92A 3TO7A 2MH9A 2WTEA 2RVQC 1KYZA 1IN5A 1HQCA 4U7BA 3MGRC 3AZGB 3UTAD 1ID3A 1ODDA 2G7UA 1XGOA 4PGHA 2PQ8A 5D5UB 2YSRA 1I1SA 2RVQD 1FT9A 4ENMA 1MJBA 4NFTA 3LZ1A 1P3LA 4M6XA 2FMYA 4ZBJC 2CGPA 4Z2MH 5B32D 5AY8A 1ZARA 5L3CA 3AFAB 1TZYC 2YX4A 5AV9B 4S04A 2XKOA 5AVBB 3X1VB 4G9YA 2QM3A 3NRVA 1JHHA 3RPQA 3FXRA 5C3IB 1KX5C 1Q9CA 2E7XA 1R5GA 3MNNA 2MH2A 1M19B 5GXQC 5B2JD 2NRAC 3WTVC 4ESBA 2GA2A 4G91C 5B40B 1MGTA 1KX5D 1ID3C 1FBUA 1ZLAA 2FJ7B 3R45A 2RDPA 2EK5A 2IA1A 3HHHA 1FBQA 5GXQD 4HF1A 2FRHA 2K4BA 2DI3A 1P3BA 5E5AC 2KKOA 3V4GA 1P3LC 3R0AA 1KX4C 4EJOA 3N4MA 3X1TB 4Y17A 5GT0D 1DDNA 3KP4A 3MVDB 2NQBA 3TO6A 1D5VA 4KT5C 4G7HF 1P3PB 3B0CT 1AOYA 5E5AD 1B4AA 1P34D 1AOIA 1MDMB 5B2IB 3MEXA 3MQ0A 1BI1A 4I02A 3UTBD 1DUXC 3MNNC 3MGPD 1I1GA 2EV5A 4IF4A 3CUOA 5GSUA 5AV5D 4FT8A 2ETHA 5GT3B 1ZREA 3QU3A 4Q5SF 4BQAA 5G49A 1Z1DA 1HKQA 1C0WA 2Z33A 1RIOH 1XSXA 2AXLA 3MGRB 3R0JA 2XAHA 4CDGA 5B33A 2YFWA 3V9RA 4HDVA 3TU4C 2L54A 2HTJA 3KZZA 3VH6W 1FY7A 1IN4A 5B32B 1P3BC 4XUJA 1QNTA 3EUHA 5L3FA 3AZHA 3E6MA 1P3MC 2M8EA 3E6CC 2BV6A 3ZMSA 1IZ1A 4CYDA 1LB2A 2DPDA 1M18A 3TU4D 4ZBJB 1W5SA 1UCRA 3R61A 2UXNA 3H3UA 4YIFA 1STZA 3KEOA 2L4MA 3IWFA 3VH6A 5B2JB 1AOIC 2JTVA 2P6TA 3RYPA 4X23A 5K1YA 4YS3D 5E8IA 1KX5B 3LA2A 1YS6A 1PP7U 5GSUC 4R8PA 1Z6RA 2E7WA 2Q2EA 3HOTA 4A5MA 4XLPF 3A6NA 5GXQB 2FOKA 5FD6A 4N0BA 2QZ8A 4HGAC 3HOSA 3V7SA 4UUVA 5E1XA 1TW3A 1R22A 4G91B 1HXDA 3QPTA 1J5YA 5B33C 1ID3B 2QLZA 3FZVA 3LA7A 4RB3C 5CHLB 4H9QA 2P8TA 2HIOA 4E70A 4UXNA 2XV4S 4XUJC 4ESFA 4MQ9F 4DQ2A 3AZHC 4LLGF 1U2WA 5K5OA 5E5AB 2BYMA 1ZGAA 1G3SA 1SMYF 2LF7A 5HLHA 4UVAA 1I27A 1TNSA 1KX4B 3MGPB 3UT9A 5AV5B 3GX4X 4LMYA 3AZLC 1OYYA 4RGUA 1B1BA 3O2PE 4WV4B 5L3GA 2K7LA 4H9NB 2OA4A 4UVCA 5CPIA 2OQRA 3AV2A 2HKOA 3A6NC 3I5UA 3BOQA 5CVRA 4BXUA 5EEHA 5LRSA 3AZLD 5DD4A 1FNNA 4HV5A 1T39A 3DQVC 3O62D 2L5AA 2HTSA 1HSJA 4HLXA 3LJAD 1J75A 1WI9A 3GLXA 5E17F 5FO5A 5B31G 3AZED 3WGGA 4YM6C 3DF8A 3VEPA 3AZFD 2XROA 5B0ZA 5FFZA 3RDIA 3P9IA 5D4RA 3TU4B 3LAPA 1U8RA 5IT9Z 4WF2A 1RNLA 3N97A 1XGSA 3CTAA 4I0AA 4L9JA 1P3MB 2DPUA 1S7AA 4YS3B 4KHAA 3UT9C 1ZAOA 2O8XA 1F66A 5LBQA 4OIRF 5J6XA 1CGPA 2YR2A 4M71A 1BOAA 4ON0A 2XAJA 5CPIC 3LZ0D 1K6OA 4LG0A 1QPMA 4NE3A 3ZMUA 4B09A 2H6CA 2XASA 4QWQA 2W84A 3QRFF 1FZPB 1SAXA 4R79A 3KLOA 5JVTA 4H9OA 2G7HA 1BI2A 2OD5A 4KUDA 1G4DA 4AVPA 1YFHA 1HW1A 3COAC 1R1UA 3DPLC 2QBYA 3AN2A 5D5WB 5DCFA 1U3EM 2A68F 3X1UA 3I54A 4IHSA 3E6DA 5BS6A 3AYWD 2M5WA 5LHHA 3T0YA 1F66C 2CQKA 2GA1A 3EYYA 2K4JA 3SXYA 5CJ9A 3FXUA 3AZLB 3I4PA 4BH9A 5B31C 1BIBA 3ROUA 1P3FA 1H9GA 5ICFA 3LJAB 2X4HA 3AZFB 2M30A 1R00A 4N9IA 4ZZDA 2DO7A 2IO5B 3AZKA 3RI4A 1B6WA 1D8KA 5B31D 5JRGA 3B0CW 2JRTA 1EV7A 2FE3A 2RC4A 1TTYA 4H9SC 1P4WA 5DCMA 4YM6B 3AN2C 4BHCA 5FD5A 1P3OA 1P3KD 4LLNA 2RGVA 1BC7C 2GWRA 5B1MD 4G6QA 5LHGA 2FQ3A 3KUYC 3LZ0B 3W96C 2D2WA 3IRRA 3UT9B 4U0WA 3RELD 2CV5A 1JHFA 5KK1A 2IPQX 3W97A 1HW5A 2XRNA 5LHIA 1W7PB 4G92C 2F8ND 1OMIA 5BS7C 5CYVA 3KUYD 6PAXA 1IN7A 4YFKF 5BNXA 1FPQA 3ZQ7A 4HV6A 1RUNA 2KRFA 4Z66C 3AZKC 4HQEA 1UB9A 4BYYA 5B0YD 1DPRA 4BHBA 4WCGA 2FA5A 3WTYC 4WU8C 3GF2A 3REJC 3R60A 1MJ9A 5H6RA 3GZ6A 1FC3A 1KU2A 3WAAA 2ELHA 5ICCA 2FEZA 2JPBA 3NQJB 1FBSA 5F99A 3PQJA 1P3OC 4H0EA 3I64A 4UUZB 3AV1D 4Y15A 4WU8D 3T8RA 5CPKD 2ZXJA 3GFMA 3K1PA 5LLQA 2HS5A 2D1HA 1F66B 2P4WA 5CP6C 4AWLC 1RI7A 1ON1A 1N1JA 3W98D 4J8UA 5B31B 5EEGA 3V8LA 3MGQC 1B67A 3IKTA 2YFVA 4AD9A 3LELD 1BI3A 5F1RA 2IP2A 3DV8A 3J80K 3VB2A 1U35D 3WAAC 1P3IC 4Z2YA 4DNCA 4KIBA 3GFIA 3MGQD 5F99C 1XCVA 1IXCA 2MLGA 4J8VD 3KP3A 4NHJA 3V8KA 2OZ6A 2JSCA 2WV0A 4BAYA 1QZZA 4ENNA 4CAYB 3L00A 3F21A 1P3ID 1Q1HA 3G3ZA 3KUYB 2UWMA 3W96B 1O3QA 3AZMC 5DYMA 5JFRA 3F8NA 4J8WA 4U88A 1P3AA 2Z3YA 4Z5TA 4M6BA 4WK8F 5B0YB 2COMA 5J8CA 4I01A 2Y48A 5AV9D 2EFNA 1IW7F 3I59B 4KGCA 2HQRA 4A0ZA 1S32A 4Z66B 3AZKB 3WG9A 3AV1B 5D8KB 5H20A 1P4AA 4YG2F 4WU8B 3REJB 3KWQA 4H9PA 5HOOA 1XDUA 3VFZA 5B40D 3BJAA 4WXHA 3REKD 1P3OB 2FJ7D 1WWIA 1BI0A 3ECOA 5DNNA 3MGSD 3BY6A 1T0FA 3IHUA 3HTSB 5B24A 3W98B 3F22A 4L0ZB 2A07F 3H3ZA 2O6GE 3GZ5A 4J8WC 2NNNA 4HW0A 5E18F 5HVQC 3CUQA 4Z5TC 5CP6B 3CLOA 5D6FA 2Q0OA 2HUEC 4AWLB 2BGCA 2DT5A 4ENJA 3JTHA 2K02A 3LELB 2EFPA 1NHAA 3C3WA 3C1CD 5F64A 4KGCC 1U35B 1R36A 4LJZF 3MGQB 1F1ZA 2VC1A 5B2ID 5AV8A 4RGSA 2DAOA 4J8VB 1YO5C 3J7AO 4XZQA 4L9TA 1B6AA 4H9RB 3WTZA 3B6FA 2A61A 2ISYA 2HGCA 2XAFA 3RTRA 3SHFA 3KE2A 4AIHA 3QOPA 3KWQC 5GT3D 4XRFA 1XN7A 1FWZA 1CF7B 1P3IB 2F5CA 2HKXA 3LQRA 5F99B 5DDGA 5FLXZ 1KU3A 1DP7P 5DNNC 3MGRD 5KVRA 4N9HA 4WNNA 1LEAA 1R7JA 4MTDA 2D45A 2JT1A 2BYKB 3OOPA 4G8XA 3TOAA 2P7VB 1BH9A 1S8NA 2P5VA 2AROA 2QWWA 4HF2A 2A3SA 2HWVA 3CUQC 5E20A 1FSEA 1KX3A 5GT0A 3NQUA 3AZMB 5LEKA 1EH8A 4L9VA 1M1AC 2W85A 1IN8A 3KP6A 3V7CA 2A5YB 1P34A 2A6HF 1N1JB 1YS7A 2NNYA 1ZHFA 1OKRA 1TZYD 5AV6A 3VH5T 3ZN1A 1ONVA 4FX4A 1Z05A 2TDXA 5AV8C 4YFXF 2ZKZA 4XZQC 4UV9A 3E3VA 2IRFG 1M1AD 3B6FC 2EV6A 3F8CA 2JZYA 4HX4A 1YTYA 3REKB 4EJUA 2DFIA 4ZYEA 1R5HA 3MGSB 1LDJA 2MLKA 2GAUA 3BPXA 4I09A 1D3YA 3L7WA 2FXAA 2RV8A 4G94A 3BWGA 1ID3D 3LZ1C 1O3RA 1BH8B 4CICA 2K86A 2O0YA 2AROC 5AY8C 3L2CA 1TBXA 5DEQA 1J7KA 1O3SA 3C1CB 4M74A 2ZMEB 1B59A 1MKMA 4KIFA 4UHTA 4D0PA 1P3GA 4Z5TB 3RKXA 3LZ1D 3IC7A 1P3LD 2HUEB 3AZJA 3WA9A 1OR7A 5AY8D 1KX4D 3J81K 3AZIA 5D4SA 4PCQA 2CW0F 3QP6A 3WKJA 4KGCB 5CVJA 3BDDA 1EH7A 3HRMA 1LVAA 3KZYA 4G6DA 1ZLJA 3I53A 2PI0A 1ZLAC 3WTPA 3MNND 4XLNF 2HZTA 3IRQA 3KWQB 3E5UA 2QVOA 1KQ8A 1XMKA 4K2EA 3AAFA 5CPJA 4RS8A 1ULYA 4UV8A 5HS7A 1ZLAD 2Y75A 3LWFA 5DNNB 2L01A 2DQLA 3IKVA 5HLGA 2NQBC 3FMQA 1P3BD 3F8FA 1TZYB 3WE3A 3LSTA 1P3GC 3CUQB 3W99A 3C1BA 4GYGA 1P3MD 1I5ZA 5BPIA 5IT9K 4ZUXA 3WA9C 1M1AB 3AZIC 3WKJC 1YW7A 5JA4A 1AOID 3L9FA 4O3MA 3ABUA 3R4KA 4CGZA 3HHGA 4EGZA 1FYKA 3GEZA 3WTPC 2F8NK 4XZQB 2HDCA 4ASNA 4L18B 3V8JA 5GSUD 1KGSA 3PFIA 3F72A 3T5XA 3HRSA 4LD9A 3FX3A 5E1ZB 1G3WA 2Y0MA 2VBYA 3AZEA 3E6BA 4O6JA 1R4VA 5CPJC 1O7FA 1K78A 2O61A 1TNTA 5B33D 3LZ1B 1P3LB 1M18C 4JJNA 4NQWA 1BH9B 5AY8B 4XUJD 1W5TA 3DP7A 1F4KA 3AZHD 5ERIA 3NQUB 4GXOA 4X23C 4ZUXC 2CFXA 2RKHA 3HSFA 4OMZA 3B6GA 2M1BA 2LF8A 3F6VA 4R8PC 3NQOA 1BN5A 2AS5F 1V4RA 3MNNB 4BNCA 3BJOA 1S29A 3HSRA 4X23D 3P7NA 2F2EA 1ZRFA 1KU5A 4JBAA 2HQNA 1ZLAB 1TAFA 1Z7UA 2HIOC 2VE8A 3R45B 3A6ND 1XB4A 2Z9OA 4HOBA 2D1VA 1Z6TA 1KYWA 1HTAA 1P3BB 1F9NA 2XAGA 1V3FA 4B8XA 4HDUA 4I2OA 4RGXA 2B0LA 2HIOD 3Q5FA 3F3XA 2EWNA 4FHTA 4YM6D 3ISPA 4XSXF 1HQ3A 2NQBB 2W24A 4GYIA 2J5PA 1AOIB 4O5VA 1SFXA 3KFWX 3U2RA 4P96A 2NZDA 3AV2C 1A7WA 4WU9A 3WA9B 1UFMA 3C18A 3F8MA 3UT9D 5GSUB 2FF4A 1W7PD 5G49B 1T98A 3KXBA 4HGAB 5FUGA 2ZO4A 3IWZA 2FBKA 5CPID 2CG4A 3FXQA 5B33B 2YFWB 3TKYA 3V9RB 5B0ZC 1W4MA 5KDMA 4I0BA 4XUJB 3KEQA
chains in the Genus database with same CATH superfamily
4KISA 4F7ZA 3AZHB 5CPJB 3VH5W 4HBLA 3M9AA 4C3JJ 4E7ZA 2FNPA 3A2KA 3WTUC 1J0RA 3REHA 4CZCA 5E79C 1AU7A 2NS0A 1P3KA 1FLIA 1R4NB 5B0ZD 2JJ7A 3K0LA 1M18B 5B1MA 3X1SA 4AC0A 3LMMA 3HJEA 2PYOA 2LKXA 1F1EA 1WJEA 2ZFWA 1T08B 3PSIA 5C3EJ 3HDDA 2FBHA 1ZQ3P 1RRJA 5FRMA 3ZR8X 4IPAA 3WG7H 3BZKA 1IV6A 2NZDC 2ZJRF 4X23B 4WU9C 4ZUXB 3TMOA 3DCFA 4BE0A 1JGGA 9ANTA 3BR3A 1W2EA 3VH5A 5F27A 2IAIA 2XSDC 4R8PB 2F8NA 1F66D 1WKMA 1FSHA 1U5TA 1Z67A 2Q2EB 3A6NB 1NK3P 5FB2A 2YX7A 3DBLB 1VTNC 4EVIA 3KXBC 1XD7A 1D0XA 2EJRA 2VT2A 4UNOA 1G8XA 3CJQB 2NVYJ 1YHQI 3DWLE 2V1DA 3AG2H 3LOCA 3CD6I 3PIPF 1ZELA 1R1VA 4KUDC 3HOZJ 1ITYA 4CCOA 2M3AA 3X2QH 1VZ0A 4P5OA 3SFIA 4L5IA 2LTPA 1E2XA 2BXYA 4H9QB 4D7NA 2HIOB 5BT1C 1S7EA 5L3BA 4A93J 1GVJA 3S16J 2R93J 1SMTA 2GIVA 4DGWB 4XK4A 2M8GX 4XKCA 1W36C 3EG5B 4CHUA 4S05A 4OINF 1HDPA 4BEHA 1KQ0A 4CCKA 3X1UC 3REHC 2BYMB 4KUDD 1K78B 5DNMA 4Z2MG 1A5JA 1ON2A 3KSYA 2KJCA 2QQ8A 2VXDA 4ZYHA 5BNVA 2HOAA 3OYJA 3RYRA 2KP6A 4U0VA 3X1SC 5CPKA 1T3UA 3AZNA 2PYOC 2QUFA 3S3MA 3MKLA 2M2EA 3AN2D 4CSRA 5B1BH 3U1DA 2JSSA 1W36D 3CO6C 2EFOA 3M1EA 4X6AJ 3X1UD 1BFMA 1NH3A 1V5EA 3LAJA 1P3FC 3MZ8A 3D5LA 1R5ID 3TDZC 3GO5A 4KMFA 2DMUA 5CPIB 4UVBA 3AV2B 3W96D 2QKLB 2HDWA 4KN7X 4PJMA 5GTIC 4BE2A 2VUMJ 2PEXA 1XC5A 3DLLF 2H6BA 2IEKA 4JOMA 2ZY2A 2EB7A 2V1XA 4I98B 4JK1X 5ILUA 5ILVA 1EJ9A 3IAM2 2OBPA 1W1WE 3B02A 4XSZF 3H36A 2CJJA 3WTSC 2ZJQF 4QLCA 2ZBKA 1D1AA 1JKQC 2ZJ2A 2NS7A 5JRGC 4RA2A 3REIA 5M5YJ 1TAFB 3G1LA 3R6SA 3ULQB 2B7EA 5B0ZB 1FX7A 4Z66D 2VKEA 3AZKD 3I71A 3S17J 1DGRM 3Q3SA 1UG2A 2ZXWH 4IRIA 3DEUA 2KFDA 5EGOB 4M6YA 5DNMC 3REJD 1Z3XA 3DLAA 2PJPA 3GUDA 1XMXA 5JRGD 3AZGA 1X4OA 4B3XA 3IP4C 1JE8A 4ZDOA 4ETSA 4KHAB 1AA7A 2RIQA 3H0DA 1NK2P 1J9IA 4J8XA 3HYIA 2CV5C 3TBIA 3W97C 1BBYA 4EO5B 3WTPE 3UKGA 1ZN2A 5E3MA 1P3OD 5DUIA 2ELKA 3HEFA 3PQKA 1WZ2A 4M73A 2ADUA 2E2JJ 1RZ4A 1USTA 4LG0B 3EUAA 3KP5A 1AWCA 3FK6A 1FTZA 1UMQA 4DOZA 4QPOA 1YJ9I 1IUYA 2LMDA 2L4AA 3KYCB 2L7ZA 3AFAA 3BPVA 3G2BA 4RLFA 5CP6D 3W97D 3GCMA 1I3AA 2KRCA 3A1IA 4DRAA 1J59A 1I50J 4YRVA 4E7IA 1HW2A 5AVBA 3WU1B 3X1VA 1XSDA 3KCCA 3REIC 1ZG3A 2H27A 4A3MJ 2XKPA 4XBFA 3I4MJ 4H9OB 1BR4A 4KUDB 4GCVA 4PJJA 5A2QK 4OU0A 4EV0A 1WRJA 4KA4A 1RUOA 2OUMA 4IJAA 3KETA 3OYFA 3ZMTA 1X3UA 2XRLA 1A04A 3CDHA 1M19A 5HDNA 1XDSA 3GBGA 2VPRA 2AHQA 3L2WA 1EQZA 3ERED 1PUFA 4UB8C 2PMHA 2QBYB 2JK3A 2BVLA 4RAGA 2Y2MA 3AN2B 4HSRA 1XSVA 2DK8A 3AZGC 1XMAA 4I6ZA 1TQMA 1FOYA 1HKSA 5AVCA 2GOXB 3X1UB 2V9PA 3WAAD 4J8XC 2NAZA 4IX7A 2FJ7A 2O03A 3C1DA 2HR3A 5B1LA 4L5JA 5F99D 2AQEA 1YIOA 3X1SB 5GAEJ 1GXPA 2PYOB 2LD5A 4U0YA 3JAMZ 3WU0A 1WHUA 2F6CA 2HYGD 1MSFC 2BVMA 2L7MP 3ABTA 5FLXK 4J8UC 4G92B 5GADJ 2Y2ZA 1P3FB 2LBFB 4HLYA 1Y1WJ 3AFAC 3X1TA 1LDDA 1WJFA 2XGEA 1G3YA 1S72I 3AZMD 4UB6C 3MVDA 4CXFA 3MD2A 2G5IC 3X1VC 1P3PA 2PLYA 5J4VA 3S14J 4RMNA 3F23A 1MDMA 5B2IA 3VODA 5BO0A 3ZQCA 5JI6A 5JRGB 5K5QA 1M19C 3UTAA 4KUMA 1IN6A 1KU9A 2K85A 1ZLKA 4MTEA 3ZQFA 2E1NA 5AONA 5DCMB 1ETKA 2IVMA 1EQZC 2F8NH 3FISA 5D5XB 2VI6A 3CESA 5HS9A 3QPHA 2ACJA 3OSGA 5AVCC 1QVTA 4MNUA 5ED4A 3G1MA 1DP3A 2EA4A 2TCTA 2VBWA 1B72A 5DNMB 4G7OF 3MGRA 4PK4A 3RKWA 5CVVA 5IOYA 4C2TA 2XDVA 4M3GA 4KFCA 2ME0A 5B1LC 4JX4A 4KMUX 1LDKB 4CA0A 2Z5UA 4Q4ZF 2CSOA 3F0CA 4J19A 5IYDJ 2MSYA 5GTHC 4ITVA 4L9NA 4C30A 5B32A 1WFXA 2E35A 3HBLA 2CV5B 1P3AC 4D1QA 3W97B 4HQMA 2M9HA 2QGUA 5LEJA 4DJAA 1ZH5A 1J09A 1SD7A 4IHWA 4AYBN 4RAFA 2VOOA 2W4SA 3ZPLA 3O6BB 3K10A 1TQPA 3X1TC 1VNDA 2V79A 1X19A 2VXZA 4X1EA 4XR6A 5H6QA 5BNXB 4HYEA 3H1CA 3H35A 5ICGA 1XPXA 3MVDC 3SFZA 4C2UA 1OCPA 2K3PA 3B73A 4J8WD 1S32C 1P3PC 2AXTC 5CVIA 4Z5TD 4NDLA 3QU6A 3EQLF 4GDFA 5B2JA 4G7ZF 4EM0B 4OIOF 3BROA 4Q48A 3K69A 1E0EA 2OZUA 2A5WA 1GHCA 1S3JA 1ETVA 3A1KA 2CW7A 2DT7B 3K70D 3J80Z 4LGWA 4Q47A 3TEDA 3UTAC 3FKIJ 1KX5A 2TRTA 3K9TA 1XG1A 3RPUA 2EFQA 4KGCD 4HPQA 2WC2A 2PMZA 3WAAB 3DKWA 2BXZA 1S32D 4BQOA 3VYSB 4RB2C 1R23A 2OJED 3S32A 5GXQA 2VLAA 2BEOA 4V19K 1S5LC 2X1CA 5KNLA 1GXQA 2XHKA 2BW3A 1T0FC 4OIPF 3BR6A 4A5NA 3RZOJ 2WB1N 3OL4A 1ZYRF 2Z99A 4PZJA 2CUZA 4WX9A 5B24C 3KWQD 3U9GA 5HLTA 3D0SA 1HF0A 2OC6A 4J8XB 2GQQA 2QQBA 5IPAA 5B32C 2LY9A 1FMVA 3CCLI 5DUKA 2HYFA 1IXSB 3FF5A 5DNND 1XGMA 3CCYA 3DTEA 1DU6A 2WAEA 2X0LA 2E5ZA 2XF6A 1BJAA 1OFCX 2FD5A 2DLLA 2K9SA 3MCZA 2ESNA 5E5AA 5B24D 3M7GA 4J8UB 2DOEA 1TQIA 2W1OA 5ILSA 4Y7NJ 3TDUC 1I6XA 4PDKA 3UTBA 1IJWC 3OYHA 1Z3YA 3JTGA 1VQ8I 2L02A 2IS6A 1KX4A 3S1MJ 3MGPA 2R3SA 3V7RA 2VQLA 5B2JC 3BZ6A 4JX5A 3T8TA 2YFVB 5AV5A 2LVSA 4KICA 1H3OA 1LJ9A 1SD4A 2DA3A 2K3FA 3IUOA 1OJLA 1SFUA 2G0EA 2E60A 3I0TA 2Q1ZB 2MYSA 3HM5A 4H9NA 1LKXA 2H94A 2ZCWA 4MLOA 3QYEA 2O3FA 2EPFA 2K9NA 3FMRA 3BJ6A 1LEBA 2CO5A 3Q9VA 5K5RA 5AV8D 5L3DA 3HXLA 1U6GA 4A69C 2ZNYA 2OTLI 4FCYA 4XZQD 1EQZB 4HNUA 2IA0A 1WH5A 1V5FA 2HFHA 3B6FD 5TRDA 1U9NA 2Y0SA 3M07A 1JKRC 4MEYF 3M8EA 5HNFA 5AVCB 1QO0D 4MHGA 4GFBA 5D5VB 4LD5A 4ZYGA 1YI2I 3C2BA 4ANJA 1YLFA 1KX3C 1JGSA 3WTTC 1JFIA 2JRMA 2HPMA 2QYOA 3REOA 1MJAA 5BPDA 5B1LB 5GT0C 3DU5A 2F5EA 4J8WB 3TU4A 2MBFA 3MAJA 2ICWG 3KYDB 1P3AB 1W5CC 4WXCA 2CUJA 3BQYA 2R7FA 1P34C 1ZG1A 4WWCA 4KT6A 3JRAA 2AROD 4CO8A 3ZP5A 2ECCA 2ZXIA 1P3MA 2R7DA 2EBIA 5AV6C 3UTBC 2EA2A 2PN6A 4YS3A 3OYBA 1KX3D 1MD0A 3MGPC 2LK2A 1R9TJ 3CF5F 4M9ZA 1ACIA 5AV5C 2VBZA 1T38A 4BDZA 2PBIA 3Q9SA 4MQVA 2XVCA 4CYCB 4XLEA 2XGXA 3ZQHA 1S32B 1YITI 1H9TA 1BR2A 2DQRA 1QPIA 4ZH4F 3VSLA 1Y1VJ 4BBRJ 3BG3A 2FBIA 4AWXB 3CJNA 1HC8A 5LRRA 4MGRA 2K27A 2XAUA 3B0BA 3WGIA 1VQNI 2WV1A 3JRHA 3TO9A 5AV6D 2EZLA 1I6HJ 2ESHA 5BO0B 3E1SA 2KRHA 3UTAB 2JA2A 4H9PB 4EATA 5CVUA 1Z2CB 2IT0A 3RQIA 3O3KA 1UHSA 3RKYA 1GUUA 2KIMA 3AG3H 1MH3A 5IYBJ 1T6SA 5D6EA 5TJJA 3OYLA 2CFOA 1USSA 2YUSA 5GPAA 3KZIC 1YW8A 3I56I 3TOBA 2VKVA 3KLNA 2A05A 4FQGA 5JLXA 4B4CA 5B24B 1JTYA 2LYCA 3LQQA 4W1UA 5IP6A 4IRGA 3VYRB 2MGQA 4S0HB 4E45A 2CH0A 3P9CA 3S2WA 3IH4A 1NG6A 3AZJC 1OR7C 3BP8A 3E0JB 1FP2A 3MN2A 1B9NA 4E7LA 2DJIA 2J5OA 2GXAA 3BTLA 4NB5A 3K6GA 3WODF 1MNDA 2V6CA 4YS3C 2R5YB 2NQBD 4M9XA 3PIOF 4BKXA 1WH7A 3K2ZA 4KYWA 3A1YA 3JREA 4EJTA 2VKDA 2ZM5A 3DBRB 1P3GD 4LK1F 5AV8B 1O7LA 4KNYA 1UHWA 5HNHA 3AZJD 3ERMA 3WA9D 3B6AA 4II3A 2H8RA 3AZLA 3B6FB 2JMWA 3ABLH 3E97A 3AZID 2ISZA 3O62A 2W25A 2V9VA 2P7CB 3PO2J 3B0DC 2ZNZA 1DGWY 2MA3A 3P5JA 2E1CA 3WKJD 3LJAA 1K79A 3SZTA 2E2IJ 4GO1A 2BHYA 2BY1A 1Z91A 2VJIA 3AZFA 5GP9A 3KIOA 1H88C 1QHHD 3S1NJ 4G12A 3WTPD 4A6EA 3GWZA 5FFXA 4WNNB 2BW3B 2P6SA 4A0YA 3TL4X 2GZWA 1R1TA 3FHZA 1I39A 4BXXJ 2AROB 3CO7C 2P5KA 4OAYA 1HSTA 1YYVA 4DBQA 4A3LJ 3VOEA 2C6YA 3RIRA 4RAZA 2HVSA 1SEUA 3W99C 1KX3B 4YM6A 5GT0B 3C1BC 4PJ0C 5CPJD 1GVDA 1ZG5A 3EDPA 5FGMA 5JHFA 3AFHA 3FM5A 4Y52J 2ZXHA 2W57A 4LK0F 4YIIA 3BLYA 4AIKA 2FNAA 4WXDA 4YFNF 3GFJA 1N75A 1P34B 1M18D 2STTA 4HX7A 1WQ2A 3J81Z 4CZZA 2EV0A 1P92A 1HA8A 2FUG2 3LZ0A 5AV6B 3UTBB 3MZHA 3W99D 1X3ZB 5BQTA 5M5XJ 3AKZA 3IL2A 3C1BD 1YG2A 4U87A 4ZUXD 2MD0A 2JE5A 4RLQA 1H3OB 4M3DA 5K7ZA 1W7PA 2X9DA 4R8PD 2VKHA 4IVNA 3O62C 2BY3A 2X6YA 1IRGA 1POGA 1TW2A 2XAQA 4CCNA 2UWXA 5FKMA 1J2XA 2HVRA 3RJPA 3FXOA 1IRZA 4LD9C 1TWFJ 3LJAC 2ELJA 3OV8A 2HEOA 1Z77A 3AZEC 5CLSA 3AZFC 4A3GJ 3UR3C 2V4JC 3GTGJ 3WE2A 5FLMJ 2IO5C 3HRTA 1AKHA 3GFLA 1MZBA 1KA8A 1OYIA 4AU7A 1Y6IA 3ML6A 4JJNC 2LNBA 3S1RJ 3E5XA 4LD9D 2DBBA 1UHMA 1IAWA 3F6OA 3ZCOA 4M3EA 1DPUA 3BZCA 4HZFA 1JFIB 5HLIA 3CMYA 3DPTA 5IOZA 2VL8A 3D5SC 2OQGA 3AYWA 2OU2A 4IOCF 1ZGJA 3ZXSA 1UG0A 1G6NA 1IXRC 2IJLA 3NQJA 1QQIA 3B6GC 4PJLA 1P3GB 3ESWB 5LGUA 1G2HA 5KHDA 4UUZA 1QGPA 3H5AA 4C2MJ 2PFBA 3OYEA 2QF7A 4JJND 3AZJB 2FX0A 5JHUA 1MBJA 5LGTA 3LZ0C 4EGYA 2LY8A 2JA7J 5J8FA 1PZRA 3AZIB 5BNGA 5EG0B 3FXJA 5IP9J 3WKJB 2QQ9A 2XGCA 1EA3A 2VJ4A 1AHDP 3PJRA 4PGGA 3QP5A 3B6GD 4ZZLA 3QAHA 2BE5F 4R1HA 4OAZA 3GTKJ 3BCBA 5AIPA 1MMNA 2B63J 2XUBA 3WTWC 1HKTA 2DYSH 1D8JA 2DTRA 1VQ4I 3AV2D 1X1CA 3WTPB 5F04A 4D5CA 1SVLA 2P81A 4RB1A 4EM2A 3E7LA 5B31A 3KFUG 3PUBA 3WHCA 2F8NG 2KIUA 1U9OA 2VC0A 2R7UA 1RR7A 3B0DB 2A6EF 3W2AA 3F8BA 1ZGWA 1FYLA 3LFUA 1PDNC 3LSRA 4LLLA 4HAMA 2DOAA 2X51A 2I5UA 2JA8J 4E44A 1T2KA 3K4NA 3K7AJ 1HQ3C 1I3QJ 2V9KA 1VQOI 3FWEA 4A3IJ 4EM1A 5BOXA 3AYWC 2GXBA 1Z9CA 3FMSA 1IGNA 3IH2A 4H9SA 5IT3A 2QKMB 3W99B 2K9LA 2NVTJ 3C1BB 3RELA 4Y13A 1JXSA 4B44A 2FMLA 3JW4A 1FOKA 1FYMA 3LSGA 1HQ3D 1BC8C 1WWXA 3GW2A 3A01B 4LIVA 4KDPA 2CWEA 1FTTA 4CAYA 3KUYA 2VIXA 2CQXA 1L0OC 4BQNA 3W96A 1UJ8A 4KN4X 5JA4B 2M45A 4XN3A 1N25A 1R58A 2M87A 3GTOJ 3NEUA 2LDUA 2EQRA 3CC7I 2Z1DA 2NZDD 4WU9D 1U8BA 1XCBA 2E5NA 5B0YA 4RM2A 1BM9A 2VE9A 3O62B 3SQNA 5BS7A 4I7HA 1LNWA 3O8HA 4KIGA 4E4HA 4LD9B 3MZYA 3KP7A 1OPCA 2HOEA 1L3LA 4RAYA 3I59A 1ETOA 3KXBD 3AZEB 4RB0A 3MWMA 3VPRA 1LUJB 3HZJA 2ZSHB 3G73A 4WZSB 3EYIA 5JR3A 2EINH 1S7OA 4Z66A 1V54H 2NOJB 4MEXF 1ZRCA 2JQ7A 4XKWA 4P9UA 1P3KC 3AV1A 2QENA 1UELB 5B1MC 4WU8A 3REJA 2DU9A 3SZPA 3P9KA 4NQWB 5DM7F 4JJNB 5BT1D 4ZYDA 2L7KA 3GVAA 1LFBA 4FX0A 3ZMZA 1R71A 1YW9A 3HGGA 5GAGJ 4XM3A 2MC4A 2RREA 1KU7A 3RELC 1ERDA 3DEEA 2VONA 5E3LA 5E1WA 1Y8QB 2BBYA 3REHD 3B6GB 3RQ4A 1OQYA 1P2FA 4A2UA 4BXFA 5H2FC 3PO3J 1U5TC 3FBNB 1REPC 4IEJA 4A3FJ 3X1SD 2RNJA 5FROA 1MSEC 4BQQA 4TV7A 2PYOD 3W6KB 3W98A 3A0BC 1IDYA 2Y2HA 2L9VA 1B8IB 2LKPA 4B43A 3TP0A 1WJDA 4HNVA 4UUSB 3VSKA 2XPUA 1EH6A 4N4OB 2XC7A 3FKJA 4EQQA 5CP6A 5HDKA 3ELKA 3JAMK 4QTRA 3OYMA 1W0UA 5B0YC 1P3FD 2HVQA 1YJWI 3GXOA 2X6XA 1SD5A 3LELA 3I58A 3HTUA 1EKEA 2I10A 1R6RA 3ZMDA 2ZY3A 1TT5B 2LSOA 2KJBA 4C3HJ 3WTXC 3OWTA 1HBXG 2DODA 1U35A 4EJVA 2VOPA 3EPLA 4HRIA 3MGQA 1BL0A 1Y0UA 3LSPA 1TC3C 3OS0A 4J8VA 2V1UA 5DD8A 2QQAA 3AV1C 5HDGA 4HF0A 4H9RA 2UXXA 5FKNA 5CPKC 1X3WB 3AZNC 1FJLA 4II2A 1O3TA 3S3OA 4LFUA 4IQ4A 2VPLA 3LA3A 1Q1VA 2G9WA 4ESJA 4E7HA 4LB5A 1CF7A 3S2HJ 1HQ3B 1YX3A 2NS8A 3L09A 2EFWA 2VT3A 1P3IA 2KDOA 2DMNA 4MIMA 1ETQA 2CW8A 3PNVA 4CCJA 3GYHX 3AYWB 3KX2A 4B3AA 4D5FA 5DNMD 3JSPA 1IO2A 2Q8KA 1LFPA 2O7OA 2DFEA 1P6RA 2DK5A 1WI3A 4WU9B 2NZDB 3HC7A 4QLCU 2H09A 1YJNI 2BYKA 3AZND 4U7DA 2D5VA 3W98C 3MKWB 2ZC2A 1OCOH 3TGNA 2CV5D 4EO5C 4OMYA 2R7TA 5E8GA 5AV9A 4XKVA 1ZRDA 1P7JA 4Y3OA 2W8SA 4QLCC 4GGGA 3KXBB 3AZMA 5FUGB 2WWYA 2MC3A 1G59A 3W6JB 3LELC 3M1CA 1A31A 3VH6T 4LB6B 3ASOH 3GMEA 2IA2A 5AIQA 3T1BA 3K1NA 1F5TA 2RN7A 1U35C 4CUGA 1RC9A 1SAUA 4IHTA 2CU7A 4P9FA 3CC4I 5KDMB 2KPMA 3JSOA 4QLCD 1U78A 1SFEA 3TQNA 2IGMA 3EUKL 4M72A 3C7JA 2VBXA 5L3EA 4J8VC 3REID 3HRUA 4ZTJA 2A69F 1PP8F 1IF1A 5B40A 4HA8A 1PUEE 2RVCA 2STWA 4HX8A 3REHB 1QZYA 1TWAJ 1HDDC 3REKA 3CCUI 1FIAA 3K1MA 1P3KB 1S6LA 3MGSA 3K4JA 2HXIA 4EMSA 1H0MA 2PMZN 3HSEA 4BBSJ 5B1MB 1OISA 4EJWA 4DIQA 1HCRA 2F5FA 5F0FA 2MD5A 3IAS2 2RNGA 4A0XA 1IRFA 3K4KA 3RELB 3G71I 3AZGD 3HG9A 4ENKA 3ECHA 4A6DA 3HIFA 1LVKA 1BH8A 1PVEA 5F6FA 2KZVA 5BMZA 2JPCA 2R4GA 1KZHA 4J8XD 1T33A 1X1PA 3OYGA 4NE6A 2F8NB 1KQ9A 1U5TB 5B3SH 5AV9C 3DBHB 1LQ1A 3LFKA 3C1CA 3DFGA 4LIUA 5EEAA 5AVBC 1WSUA 4A12A 4UUTA 2ZMEA 5FKKA 1P4XA 2L3DA 5B32G 3PFYA 2UZKA 4NE5A 5C3IC 3S1QJ 1P7IA 2JCHA 4J8UD 2IS4A 2I8DA 2IGOA 1ZTRA 3FM3A 4BY7J 1MNEA 4P55A 2F48A 4IRHA 4IXAA 3AFAD 3EPHA 1LFUP 1E17A 3ZN0A 1WJBA 4RGRA 4X0GA 5GT3A 2KIFA 3ZMVA 3FDYA 5DS9A 1VF9A 2GXGA 2XIGA 1K7AA 5AVBD 2DW4A 3X1VD 2DFFA 5M3MJ 5B40C 1IDZA 3EPZA 1FP1D 2QSFX 4BEHB 2LY1A 1QBJA 3WGHA 3EETA 3LSKA 3QQAA 3J7AY 3REKC 3KP2A 4AIJA 2FJ7C 1B9MA 1YQAA 3MFKA 1SD6A 3MGSC 5BNVB 2R0QC 1M19D 2UUZA 3IP4B 1TLHB 1G3TA 3HL2A 5CPKB 2LG4A 2BYVE 3MMYB 4BHPA 3AZNB 1O57A 2PG4A 2X6OA 3CCQI 4BY1J 1EQZD 2NYXA 3M3YJ 2IGKA 2HPIA 4NC8A 4JQFA 1WWSA 4CSRB 5HS8A 5GAHJ 2VN2A 1VQKI 5ICEA 3OL3A 4W97A 2Y0SN 5AVCD 3GTQJ 4F3QA 1GT0C 4CSWA 1A6IA 1D5YA 3HUGA 2O8KA 2VODA 4XONA 2FU4A 1OYWA 2IW5A 2PMUA 2YU3A 1LPQA 5B1LD 2YPRA 2FSWA 3C1CC 5CPRB 2CYYA 3C2GA 4J01A 3S3NA 2K5CA 1SANA 2ZMEC 4OIQF 1P3AD 4M3FA 1JT6A 2OAZA 2F5DA 3DXJF 2MFZA 1TZYA 1LE8A 1FEXA 2F4OB 3E5QA 3L2UA 4XRMA 1BIAA 1N78A 2RQPA 5D8LB 4I76A 5B2IC 4QLCB 2Y2QA 1XGNA 1V5GA 3HOYJ 2YS9A 3EPKA 3REIB 4OOIA 5DV5A 2VASA 3X1TD 4M6VA 3M8FA 4R8HA 5A2QZ 1M1AA 1F36A 2P5LC 4V2GA 4DRBA 4M9SA 3MVDD 2OTJI 5GT3C 4CH7A 1T8IA 1P3PD 2DQNC 4NBQA 4FTHA 2G5HC 3M4OJ 5LGNA 4L0YB 2X85A 3HPGA 3H92A 4JP0A 3TO7A 2MH9A 2WTEA 2RVQC 1KYZA 1IN5A 1HQCA 3LNQA 1IV8A 4U7BA 3MGRC 5M3FJ 3AL0C 3CP2A 3OIOA 3CCEI 3UTAD 3AZGB 4XIDA 2M0CA 1ID3A 2HYJA 1NG7A 1ODDA 3LSHA 5TGTA 5F08A 2G7UA 1XGOA 4PGHA 2PQ8A 3JR9A 3FXMA 4ZC3A 5D5UB 2YSRA 4IOAF 1MBFA 3QWLA 1I1SA 2DCEA 2RVQD 1K6YA 1FT9A 4ENMA 1WPKA 3KEYA 3L2QA 2DTZA 4DZPA 1VQ6I 3JRIA 4NNJA 1MJBA 4NFTA 3LZ1A 1P3LA 4M6XA 2L9RA 2FMYA 4ZBJC 2CGPA 4Z2MH 5B32D 5AY8A 4NUBA 1ZARA 5L3CA 3AFAB 1TZYC 2YX4A 5AV9B 4S04A 2XKOA 5AVBB 3X1VB 4G9YA 2GIZA 2QM3A 2QSHX 1JUSA 2WAQN 1JHHA 3NRVA 3RPQA 3FXRA 5C3IB 1KX5C 1Q9CA 2E7XA 1R5GA 5IYCJ 1EF4A 3MNNA 2MH2A 5J40A 4CCMA 1M19B 5GXQC 5B2JD 3BC8A 5EJCA 2NRAC 1MNMC 4J00A 1FIPA 5FKLA 1PUFB 3W2VA 3WTVC 4ESBA 5GPCA 2GA2A 4G91C 5B40B 3IH3A 1MGTA 2Y31A 1KX5D 1ID3C 3RPUD 4NC7A 1FBUA 1HLVA 3OYNA 1ZLAA 2FJ7B 3R45A 2RDPA 2EK5A 2JVHA 2Y2GA 2IA1A 2O5RA 3HHHA 1FBQA 3GTLJ 5GXQD 2HI3A 1K61A 4HF1A 2FRHA 4E7SA 4F52A 5M5WJ 1XS9A 2K4BA 1VQ5I 2DI3A 1P3BA 3CQZJ 3PSFA 1ZR4A 5E5AC 1Z7LA 2KKOA 3V4GA 2CQNA 1P3LC 3R0AA 1KX4C 4EJOA 3OSFA 3N4MA 3X1TB 4Y17A 5GT0D 1DDNA 3KP4A 4JX6A 3MVDB 2NQBA 3TO6A 4BUPA 1D5VA 4KT5C 2EZHA 4G7HF 1BW5A 1P3PB 5LD2C 1FOXA 3B0CT 1AOYA 5E5AD 2BHZA 1B4AA 1X1DA 1P34D 1AOIA 1MDMB 5B2IB 3MEXA 3MQ0A 1BI1A 4I02A 3UTBD 1DUXC 3MNNC 5LFAA 3A03A 2L9SA 3MGPD 1I1GA 3NWTA 2EV5A 4IF4A 3CUOA 5GSUA 5AV5D 4FT8A 2ETHA 2PX9A 5GT3B 1ZREA 3QU3A 4OWRB 3W3CA 4Q5SF 5B66C 4BQAA 5G49A 1Z1DA 3JRGA 1HKQA 3TP3A 1C0WA 2Z33A 5J3LA 1XSXA 2AXLA 3I9V2 1RIOH 1B72B 3R0JA 3MGRB 5K7HA 3AL0B 2XAHA 4CDGA 5B33A 2YFWA 2VQCA 1YRNA 3V9RA 4HDVA 4BJ6C 3TU4C 2L54A 2HTJA 3KZZA 3VH6W 1FY7A 1IN4A 5B32B 1P3BC 3OY9A 4XUJA 2OV7A 2M7BA 1QNTA 3EUHA 5L3FA 4MO7A 3AZHA 3E6MA 2WAQA 1P3MC 2CQQA 2M8EA 3E6CC 1JJ8C 2BV6A 2XPWA 2RQQA 3ZMSA 2B9SA 1PYVA 3I55I 5CKTA 3CJTB 3DEWA 1IZ1A 4CYDA 3OYKA 1LB2A 2DPDA 1M18A 3S93A 3TU4D 4ZBJB 1W5SA 1VQMI 2LKSA 1UCRA 3R61A 2UXNA 1SC7A 1CQTA 3H3UA 2QA4I 4YIFA 1STZA 3KEOA 2L4MA 1QVUA 3IWFA 3H5RA 4XLAA 3VH6A 2JTVA 3G6EI 5B2JB 1AOIC 2P6TA 3B6CA 3RYPA 5EDNA 4X23A 1JTXA 2DA6A 5K1YA 2DMPA 4XNFA 1JJ6C 4YS3D 3O8GA 4XMYA 5E8IA 3ABKH 1KX5B 3LA2A 1YS6A 1PP7U 5GSUC 4R8PA 1Z6RA 3UNGC 3RCOA 2DF4C 2E7WA 2Q2EA 4A5MA 4XLPF 3HOTA 3A6NA 3KPHA 4MFEA 2FOKA 5FD6A 4N0BA 2QZ8A 5GXQB 2BY0A 4HGAC 1WJ5A 3V7SA 3VYUB 3HOSA 4UUVA 1E3HA 3W2WA 3HGYA 5E1XA 1TW3A 3L2RA 1R22A 3BCAA 4G91B 1HXDA 3QPTA 4FISA 1J5YA 2IBDA 5B33C 2M7AA 1ID3B 2QLZA 3FZVA 3LA7A 4RB3C 5CHLB 4H9QA 2P8TA 2HIOA 2Y9YA 4E70A 4UXNA 4BJ5C 2XV4S 4XUJC 4ESFA 4MQ9F 4DQ2A 1ORKA 1MBGA 3J7ZI 2IS2A 4QPQA 2HOTA 3FBIB 4LLGF 3AZHC 3BT9A 1U2WA 5K5OA 2OPTA 3JRCA 1SFOJ 5E5AB 1XX5A 2BYMA 1ZGAA 1G3SA 1SMYF 2LF7A 3SZGA 5HLHA 4KJZA 2KQRA 4HG2A 4UVAA 1I27A 1GV2A 1TNSA 3VWBA 1KX4B 3MGPB 3UT9A 1MMGA 5AV5B 3GX4X 4IKFA 4LMYA 1O4XA 3AZLC 2LRDA 1OYYA 4RGUA 1B1BA 2F4IA 3NWSA 3O2PE 4WV4B 5L3GA 2K7LA 4BDYA 1MMSA 1SVOA 4H9NB 2OA4A 2P0WA 4UVCA 5CPIA 2OQRA 3AV2A 2HKOA 1R4MB 3A6NC 3I5UA 2DA4A 3BOQA 5CVRA 4ABZA 4BXUA 2R7OA 5EEHA 5LRSA 3AZLD 1K4TA 1FNNA 4HV5A 5DD4A 1T39A 3DQVC 3CF2A 2CS3A 2V1NA 3O62D 2JA5J 2L5AA 2HTSA 3JRDA 2GBYA 3PUFA 3OYDA 1HSJA 4HLXA 3LJAD 1J75A 1WI9A 2EH3A 3GLXA 5FO5A 5E17F 3L1PA 5B31G 3AZED 3WGGA 4YM6C 3DF8A 3VEPA 3AZFD 2XROA 5B0ZA 5FFZA 2XB5A 3RDIA 3P9IA 5D4RA 3TU4B 1BJZA 4FE7A 1IUFA 3LAPA 1U8RA 5IT9Z 5KAIC 4WF2A 1RNLA 3N97A 5EGOA 3SEZA 3CCVI 1XGSA 3CTAA 4I0AA 4L9JA 1YIJI 1P3MB 5C44J 1D0YA 3VDXA 4F92B 2DPUA 2ID6A 2Z16A 1OCCH 1S7AA 4YS3B 4KHAA 3UT9C 1ZAOA 1Y8RB 2M0MA 4BU2A 2O8XA 1F66A 2OCEA 5LBQA 4LG3A 4OIRF 5F0HA 3DU6A 5DTDA 1ENHA 1QHGA 1RKWA 4XRSG 3ZQGA 3FXKA 5J6XA 1CGPA 2R7WA 2YR2A 4M71A 2R7RA 3H0GJ 1BOAA 4ON0A 2XAJA 5CPIC 3LZ0D 1K6OA 3L2VA 4LG0A 3GTMJ 1SFKA 1QPMA 3A4CA 4NE3A 3ZMUA 4B09A 3QPLA 2H6CA 1QU3A 3SYTA 2XASA 4QWQA 2L2OA 2W84A 1VQPI 1ETXA 3QRFF 1FZPB 2KIQA 3K4CA 1SVMA 4R79A 1YOVB 1SAXA 3KLOA 5E3OA 3BR2A 2CQ7A 1X1BA 5JVTA 4H9OA 4ZDLA 2G7HA 1BI2A 2OD5A 4KUDA 1G4DA 4AVZA 4ZTFA 4B1RA 4BE1A 3HOUJ 3H0MC 4AVPA 1YFHA 1DQUA 1X58A 2KHMA 1HW1A 4XRSA 3COAC 2V7FA 4B47A 1R1UA 3DPLC 1HOMA 2QBYA 1T56A 3AN2A 1P9QC 1OLTA 5DCFA 5D5WB 1U3EM 5IP7J 2A68F 3X1UA 3I54A 3EPJA 4IHSA 2HQAA 4BS9A 3S15J 3E6DA 5BS6A 3AYWD 2M5WA 5LHHA 3T0YA 1F66C 2LOOA 4QSHA 4RBOA 2CQKA 2GA1A 4AIDA 3EYYA 2K4JA 3SXYA 4UPKA 5J1YA 1DU0A 5CJ9A 3FXUA 2JUCA 4EEFG 3I4PA 4BH9A 3AZLB 2COBA 5B31C 2XSJC 1BIBA 3ROUA 1Y39A 2LBFA 2J8PA 1H9GA 2E1MC 5ICFA 5CQGA 1P3FA 3P5JB 3LJAB 4XL9A 3BG6A 2X4HA 1UAAA 3AZFB 2M30A 1R00A 4A3EJ 4N9IA 4ZZDA 2DO7A 2IO5B 3AZKA 3RI4A 2MW8A 1E3OC 4XOTA 1MH4A 1B6WA 1D8KA 5B31D 2QCOA 3BTJA 2E1OA 5JRGA 3B0CW 2JRTA 1EV7A 1RETA 2OCCH 3DTKA 2GM4A 2FE3A 2RC4A 1TTYA 3CZ6A 4H9SC 1N77A 1P4WA 3HOVJ 5DCMA 3N05A 4YM6B 2GOMA 3WHBA 3AN2C 2Y2JA 4BHCA 1TL8A 1ZK8A 5FD5A 1P3OA 2VJJA 1P3KD 4LLNA 2RGVA 1BC7C 2GWRA 4Y33A 3RSNA 5B1MD 4G6QA 2ZY4A 4ZDPA 5LHGA 2FQ3A 3KUYC 3LZ0B 3W96C 2WAFA 2D2WA 3IRRA 5HODA 3SEQA 3UT9B 4U0WA 3RELD 4HEA2 2CV5A 1JHFA 4XKBA 2HXOA 5KK1A 2IPQX 3W97A 1HW5A 2XRNA 5LHIA 2KMUA 1W7PB 4G92C 2F8ND 3FXLA 2XGDA 1OMIA 1T95A 2LLKA 5BS7C 1GDTA 3JCUC 4YELA 5CYVA 3K4BA 2BG1A 3CLQA 4A3CJ 3KUYD 6PAXA 1IN7A 4YFKF 5BNXA 3OIPA 3K4MA 3Q0WA 3S8PA 1A36A 3D5RC 1FPQA 3ZQ7A 2X6WA 2VJ5A 4HV6A 4ZJZA 1RUNA 2KRFA 3IV5A 4Z66C 3CMAI 3S2DJ 3AZKC 1AKHB 1JKOC 1UB9A 1D1CA 4BYYA 2W7NA 4HQEA 1DPRA 5B0YD 4BHBA 2V6EA 4WCGA 2FA5A 3WTYC 4WU8C 3GF2A 3REJC 2DA5A 3R60A 5F1JA 1MJ9A 5H6RA 3Q0VA 1H8AC 3CMMA 4XORA 2Y2OA 2FQ4A 5DM6F 1FC3A 1KU2A 1MMDA 3GZ6A 2R7XA 3WAAA 2IGNA 2ELHA 5ICCA 2FEZA 2JPBA 3NQJB 1FBSA 5F99A 2XB0X 3PQJA 5IY5H 4D9JA 3DKYA 1P3OC 4H0EA 3I64A 4UUZB 3AV1D 1APLC 4Y15A 4WU8D 3T8RA 5CPKD 2YU9J 3VYTB 2ZXJA 3GFMA 3K1PA 5LLQA 4DYCA 3PNYA 4GRIA 2HS5A 3A02A 1GV5A 5C4XJ 2D1HA 3H3VK 1R49A 2IS1A 1F66B 2P4WA 3HOXJ 5CP6C 3OR2C 4AWLC 3QYFA 2HU9A 1Z21A 1TT0A 1ETYA 2EZKA 1RI7A 2HNHA 4RM3A 1ON1A 3SDBA 2Y69H 1N1JA 4J8UA 3W98D 2XF7A 5B31B 1VQ9I 2WADA 1VFCA 5EEGA 2NVUB 3V8LA 4DYQA 1OCZH 2JA6J 2E1MB 3BTCA 3MGQC 1YE9A 4MFDA 1B67A 3IKTA 3NARA 2KL4A 2YFVA 5FRNA 2ZY5A 4AD9A 4Z6YA 2MG4A 3I4NJ 2LR8A 3LELD 2DXIA 2K9MA 1BI3A 2Z2SB 1ZKGA 5F1RA 2Y2NA 1QRYA 2IP2A 3DV8A 3J80K 3VB2A 1U35D 3OOUA 3WAAC 3DKXA 1P3IC 4Z2YA 4DNCA 4KIBA 3GFIA 3MGQD 5F99C 2HZDA 1XCVA 4AUXA 1VQLI 2VQHA 4DYRA 1IXCA 4H4KC 2MLGA 2HOSA 4J8VD 1E3PA 3KP3A 1ZR2A 2R92J 2R7VA 4NHJA 3ASNH 2NVQJ 1RR8C 3V8KA 2OZ6A 3FHNA 5K7FA 2JSCA 2KLOA 2WV0A 2EIKH 2ZSIB 2L0KA 1QZZA 4BAYA 4ENNA 2VB6A 2BZTA 4CAYB 3L00A 3F21A 1P3ID 1Q1HA 3G3ZA 3KUYB 4F55A 2UWMA 3OS2A 1O3QA 3K4LA 1X2NA 4IHYA 3AZMC 5DYMA 3W96B 1XTAA 5JFRA 3F8NA 4J8WA 4U88A 2L9NA 3DPUA 5J1UA 3BR1A 4E7JA 2Z3YA 1P3AA 4Z5TA 2VQGA 3TW6A 4M6BA 2DMQA 4RDUA 3BR5A 1TWCJ 4WK8F 5B0YB 2COMA 3MVPA 3M8JA 4I01A 5J8CA 3QODA 2XPVA 2Y48A 2QSGX 5AV9D 2EFNA 1IW7F 3BG7A 3JRBA 4NC6A 4IHVA 3AG4H 3I59B 4KGCA 2DA7A 2HQRA 4A0ZA 3CCMI 4CYCA 1S32A 3SDGA 3HKZN 3H9GA 4Z66B 3BTIA 3AZKB 2JUGA 3WG9A 1VQ7I 2QEXI 4BJTA 4A3JJ 4E7KA 2K9QA 3AV1B 5D8KB 2JN6A 1P4AA 5H20A 5KAFC 3CC2I 4YG2F 4WU8B 3REJB 3A0HC 2LREA 2DT6A 5KCMA 1WJAA 1MBHA 3KWQA 3LSIA 3FK7A 4H9PA 5HOOA 2H8WA 1XDUA 2L5QA 3F6TA 3VFZA 1D0ZA 3H9JA 5B40D 3ZQLA 3BJAA 4WXHA 3REKD 1P3OB 2Y2PA 2FJ7D 1WWIA 1BI0A 1YX5A 3ECOA 2XD5A 5DNNA 3MGSD 3BY6A 4IHXA 1T0FA 2R5ZA 4DBRA 3IHUA 3HTSB 3GLLA 5B24A 3W98B 3F22A 3TW7A 2A07F 4L0ZB 3PL8A 3H3ZA 3ZGKA 2O6GE 3GZ5A 4J8WC 2NNNA 4HW0A 5E18F 5HVQC 3C2HA 3CUQA 4Z5TC 5C4JJ 2KDZA 5CP6B 2ID3A 3CLOA 5D6FA 2Q0OA 2HUEC 4HNTA 3MKZA 4AWLB 2BGCA 2DT5A 2N8GA 5FJ8J 4ENJA 3JTHA 2K02A 3LELB 2EFPA 5E3NA 1NHAA 2DFHA 4XN0A 3K70C 3C3WA 3HOWJ 3C1CD 2R5YA 5F64A 4L5EA 2PJRA 4KGCC 3SJMA 1U35B 1R36A 2DDBA 4LJZF 2CMPA 3MGQB 1F1ZA 2VC1A 3FIWA 5B2ID 5AV8A 1X2MA 4RGSA 3QPSA 2DAOA 1BOBA 4J8VB 1YO5C 3J7AO 4XZQA 4L9TA 1JKPC 1B6AA 2CRGA 3WTZA 4H9RB 2BOLA 3B6FA 2LH9A 2A61A 2ISYA 2HGCA 2XAFA 3RTRA 1KONA 3KE2A 3SHFA 3QOPA 4AIHA 3LL7A 1MIJA 3KWQC 5GT3D 2M34A 4XRFA 1XN7A 1FWZA 1CF7B 4B48A 1P3IB 3JRFA 2F5CA 2HKXA 3GTJJ 3OR1C 3LQRA 1IG7A 5F99B 1OCTC 5DDGA 1UZCA 5FLXZ 1KU3A 1DP7P 5DNNC 3MGRD 2A6TA 5KVRA 1MW7A 4N9HA 4WNNA 1LEAA 1R7JA 1FMWA 4MTDA 2Y30A 2D45A 2F5VA 2JT1A 2BYKB 4XOPA 3WU2C 3OOPA 4G8XA 3TOAA 2P7VB 1BH9A 1S8NA 2P5VA 2UV1A 2AROA 1VI0A 4I99C 2QWWA 4HF2A 2A3SA 2E36A 2HWVA 3CUQC 5E20A 1FSEA 1KX3A 1W0TA 1F43A 5GT0A 5F0CA 3NQUA 1D1BA 1Y56A 4F93B 5LEKA 1EH8A 3AZMB 3HKZA 5J47A 2DYRH 4L9VA 1M1AC 4IZZA 2Y2LA 2W85A 1IN8A 3KP6A 3V7CA 1WCMJ 2A5YB 1P34A 2A6HF 1N1JB 1JUMA 2FJ1A 2K40A 2E34A 1YS7A 4G6TB 2NNYA 2L7FP 4LITA 1ZHFA 1OKRA 1TZYD 5AV6A 3LSJA 3VH5T 3ZN1A 1ONVA 2NOGA 4FX4A 1Z05A 2TDXA 5AV8C 3V42A 2KT0A 4A3KJ 4YFXF 2ZKZA 2WY7Q 3GZNB 4XZQC 4UV9A 3E3VA 2IRFG 2LFBA 1M1AD 3H9QA 3B6FC 2EV6A 3F8CA 2KISA 4V2FA 2F2AC 3ZOBA 2JZYA 4HX4A 1YTYA 3REKB 4EJUA 2DFIA 4ZYEA 1U0JA 1R5HA 4DZJA 4CCLA 4HSTA 1K83J 3MGSB 1LDJA 2MLKA 2GAUA 3BPXA 3OIQA 4I09A 2WY8Q 1D3YA 3G1OA 3CCJI 3L7WA 3OYCA 2FXAA 2RV8A 4G94A 1BR1A 3BWGA 3ONQA 3LZ1C 1O3RA 1WVRA 1BH8B 1MMAA 1ID3D 4CICA 4AYBA 2K86A 1FOWA 2O0YA 2AROC 1K4SA 3Q0UA 2CUFA 2EIJH 4ZYAA 3L2CA 5AY8C 1TBXA 5DEQA 2XD1A 1J7KA 1O3SA 3C1CB 2CV0A 5EZHA 2H1KA 2EZIA 4M74A 2JSPA 1B59A 1MKMA 2ZMEB 3PM1A 4KIFA 4PUSA 2DDAA 2CV1A 4UHTA 4D0PA 1P3GA 4Z5TB 3RKXA 3OMYA 3ZQIA 3LZ1D 1BW6A 4PFPA 3IC7A 1P3LD 2HUEB 3AZJA 3WA9A 5EYRA 1OR7A 2BY2A 5AY8D 1KX4D 2LC2A 2R7QA 3J81K 5B5EC 4YIRX 1NTCA 3AZIA 4FE4A 4PJNA 4PCQA 2CW0F 5D4SA 3QP6A 4AM3A 4C9YA 5EG0A 2FOWA 2F4MB 2X48A 3PNTA 1JI8A 3WKJA 4KGCB 5CVJA 3BDDA 2DN0A 1EH7A 1S9HA 3D1NI 3HRMA 3OS1A 4A3BJ 1LVAA 4JYKA 3RKQA 3KZYA 4G6DA 1ZLJA 3I53A 2PI0A 1ZLAC 3AG1H 2AQFA 4M3BA 3WTPA 3MNND 2WB1A 4XQFA 4XLNF 2DOFA 4XICA 2ZJPF 2HZTA 3IRQA 2EILH 3KWQB 1V55H 3U21A 3E5UA 2ZB9A 1A6QA 2QVOA 5B1AH 5FKOA 1KQ8A 1XMKA 4K2EA 3RZDJ 3AAFA 2WA0A 5CPJA 4RS8A 1PJRA 1ULYA 4IL6C 2IXSA 4UV8A 2Y75A 3HUGB 5HS7A 1Z0XA 3LWFA 1ZLAD 5DNNB 2L01A 2DQLA 4N4NB 2R5ZB 3IKVA 4LOCA 5HLGA 2R7ZJ 2NQBC 3FMQA 3CDLA 2NVXJ 3NAUA 1RESA 1P3BD 3F8FA 3F9KA 1TZYB 3WE3A 1LE8B 4YEJA 4A3DJ 3LSTA 1P3GC 3CUQB 3W99A 3KYLA 5EZGA 3C1BA 3I3LA 4GYGA 1P3MD 1I5ZA 5BPIA 5IT9K 4ZUXA 3WA9C 1IC8A 2Y9ZA 3H0LC 1M1AB 2DA2A 4PFOA 2Y2IA 5TISC 2FFFB 3AZIC 1Y0NA 1QA6A 3A01A 4IO9F 4DW6A 2PJRB 3WKJC 1YW7A 3K2AA 3CCSI 3BQZA 2ME6A 3CMEI 5JA4A 2GLOA 1AOID 2E71A 3L9FA 4O3MA 3ABUA 3R4KA 4CGZA 4XLFA 3HHGA 4EGZA 1FYKA 3GEZA 3WTPC 2F8NK 4XZQB 1BA5A 5JVGF 2HDCA 1JUPA 4ASNA 4L18B 3V8JA 2DJNA 5FLVA 5GSUD 1KGSA 3BG5A 1X1AA 3PFIA 3F72A 3HRSA 3T5XA 4IQJA 4LD9A 3FX3A 5E1ZB 5J1RA 2XF5A 1RPWA 3EUHC 1WJCA 2V26A 1G3WA 2Y0MA 2VBYA 3AZEA 3E6BA 4O6JA 1R4VA 5CPJC 2R7SA 3CCRI 1O7FA 4KITB 1K78A 2O61A 1TNTA 2RAEA 5B33D 2OF7A 3LZ1B 1P3LB 1M18C 5J4YA 3OYAA 4JJNA 4NQWA 4E6KG 1BH9B 4F91B 2JWTA 5AY8B 3HPHA 4XUJD 2NXNB 1W5TA 3DP7A 4P1WA 1F4KA 2EIMH 3AZHD 5ERIA 3CDIA 3NQUB 4GXOA 4X23C 2AO9A 4ZUXC 2X1DA 2CFXA 2RKHA 3HSFA 4OMZA 5EF6A 2M1BA 2E2HJ 3B6GA 2Y2KA 4WJ3C 2LF8A 3F6VA 1TZLA 4R8PC 3NQOA 1BN5A 2AS5F 3LSMA 1ETWA 1V4RA 5CQEA 3MNNB 4BNCA 3U1KA 3BR0A 3H0RC 1B8IA 3BJOA 3OYIA 2WBMA 1S29A 3HSRA 4QIWN 4UUSA 2LP0A 4PSXA 2M4GA 3P7NA 4X23D 2F2EA 3BG9A 3FDDA 4C3IJ 2ZFUA 4BACA 2KZGA 1ZRFA 1KU5A 4JBAA 2HQNA 1ZLAB 2CV2A 1TAFA 1Z7UA 4Y4RA 3J7YJ 2HIOC 2JVGA 2VE8A 4FETA 3W6VA 3R45B 3A6ND 1XB4A 2DA1A 2Z9OA 1QZEA 2MABA 4HOBA 2D1VA 1Z6TA 3G4SI 1RKTA 4D7MA 3GTPJ 1KYWA 1HTAA 3ZQQA 1P3BB 1F9NA 4DQYB 2XAGA 1V3FA 4B8XA 4HDUA 2W82A 4I2OA 1TWGJ 2W00A 4RGXA 4XLHA 1JT0A 1A35A 2B0LA 2HIOD 4XLCA 3Q5FA 3F3XA 2EWNA 4FHTA 1H89C 4YM6D 3ISPA 1M1EB 2VQRA 4XSXF 5JLWA 1HQ3A 1MBKA 2ECBA 2NQBB 3MKYB 2W24A 1OCRH 4UY8I 4GYIA 3CP8A 2J5PA 1IRXA 2M4KA 4O5VA 1AOIB 1SFXA 3HB9A 3KFWX 3U2RA 4P96A 1MBEA 2NZDA 3AV2C 1A7WA 4WU9A 3WA9B 3QYBA 1UFMA 3C18A 3F8MA 3H5NA 3UT9D 3DTIA 2HQ5A 5GSUB 2FF4A 4FASD 2E19A 1W7PD 1GLNA 2W48A 2LY2A 5G49B 1T98A 3KXBA 4HGAB 5FUGA 2ZO4A 3IWZA 2CUEA 2HDDA 1WGXA 2FBKA 2DMTA 3ABMH 2O9LA 5CPID 1X4PA 2CG4A 2X1EA 3FXQA 5B33B 3ZRGA 3TKYA 4BL0B 1YRNB 2YFWB 3V9RB 5B0ZC 1TWHJ 1W4MA 3CJRB 5KDMA 4I0BA 4PSWA 2H1LA 1TP4A 4XUJB 3QOEA 3KEQA 4BGDA
chains in the Genus database with same CATH topology
4F7ZA 3AZHB 5CPJB 3VH5W 4HBLA 3M9AA 2FNPA 3WTUC 1J0RA 3REHA 2NS0A 1P3KA 1FLIA 5B0ZD 3K0LA 1M18B 5B1MA 3X1SA 2PYOA 1F1EA 2ZFWA 2FBHA 4IPAA 2NZDC 4X23B 4WU9C 4ZUXB 1W2EA 3VH5A 4R8PB 2F8NA 1F66D 1WKMA 1FSHA 1U5TA 3A6NB 5FB2A 2YX7A 1VTNC 4EVIA 3KXBC 1XD7A 2EJRA 2VT2A 4UNOA 2V1DA 1R1VA 4KUDC 4P5OA 4L5IA 1E2XA 4H9QB 2HIOB 5BT1C 5L3BA 1GVJA 1SMTA 2GIVA 3EG5B 4CHUA 4S05A 4OINF 1KQ0A 3X1UC 3REHC 4KUDD 2BYMB 1K78B 5DNMA 4Z2MG 1ON2A 3KSYA 2KJCA 4ZYHA 5BNVA 3RYRA 4U0VA 5CPKA 3X1SC 1T3UA 3AZNA 2PYOC 2QUFA 3AN2D 4CSRA 3U1DA 2JSSA 3CO6C 2EFOA 3M1EA 1BFMA 3X1UD 3LAJA 1P3FC 3D5LA 3TDZC 3GO5A 4KMFA 5CPIB 4UVBA 3AV2B 3W96D 4KN7X 2PEXA 2H6BA 2ZY2A 2EB7A 2V1XA 4I98B 4JK1X 5ILUA 5ILVA 2OBPA 4XSZF 3B02A 3WTSC 4QLCA 2ZBKA 2ZJ2A 5JRGC 3REIA 1TAFB 3R6SA 3ULQB 5B0ZB 1FX7A 4Z66D 3AZKD 3I71A 4IRIA 3DEUA 4M6YA 5DNMC 3REJD 2PJPA 3GUDA 5JRGD 3AZGA 3IP4C 1JE8A 4ETSA 4KHAB 2RIQA 1J9IA 4J8XA 3HYIA 2CV5C 3W97C 1BBYA 3WTPE 1ZN2A 1P3OD 5DUIA 3PQKA 4M73A 2ADUA 1RZ4A 1USTA 4LG0B 3KP5A 1AWCA 1IUYA 2L4AA 3AFAA 3BPVA 3W97D 5CP6D 3A1IA 4DRAA 1J59A 1HW2A 5AVBA 3X1VA 3WU1B 1XSDA 3KCCA 3REIC 1ZG3A 2H27A 2XKPA 4XBFA 4H9OB 4KUDB 4GCVA 5A2QK 4OU0A 4EV0A 1WRJA 4KA4A 1RUOA 4IJAA 3KETA 1M19A 3ZMTA 1X3UA 1A04A 3CDHA 5HDNA 1XDSA 1EQZA 3ERED 2PMHA 2QBYB 3AN2B 2Y2MA 1XSVA 2DK8A 3AZGC 1XMAA 1TQMA 1HKSA 5AVCA 3X1UB 3WAAD 4J8XC 2NAZA 2FJ7A 2O03A 3C1DA 2HR3A 5B1LA 4L5JA 5F99D 1YIOA 3X1SB 1GXPA 2PYOB 4U0YA 3JAMZ 3WU0A 2HYGD 3ABTA 5FLXK 4J8UC 4G92B 1P3FB 4HLYA 3AFAC 3X1TA 1LDDA 1G3YA 3AZMD 3MVDA 4CXFA 2G5IC 3X1VC 1P3PA 2PLYA 1MDMA 3F23A 5B2IA 3VODA 5BO0A 5JI6A 5JRGB 5K5QA 1M19C 3UTAA 4KUMA 1IN6A 1KU9A 1ZLKA 4MTEA 2E1NA 5AONA 5DCMB 2IVMA 1EQZC 2F8NH 5D5XB 5HS9A 3QPHA 2ACJA 5AVCC 4MNUA 5ED4A 2EA4A 2VBWA 5DNMB 4G7OF 3MGRA 3RKWA 5CVVA 4KFCA 5B1LC 4KMUX 1LDKB 2Z5UA 4Q4ZF 2CSOA 4L9NA 5B32A 2CV5B 1P3AC 3W97B 4HQMA 5LEJA 1ZH5A 1SD7A 2VOOA 3ZPLA 3O6BB 1TQPA 3X1TC 2V79A 2VXZA 5H6QA 5BNXB 4HYEA 5ICGA 3MVDC 3SFZA 3B73A 4J8WD 1S32C 1P3PC 5CVIA 4Z5TD 3QU6A 3EQLF 5B2JA 4G7ZF 4EM0B 4OIOF 3BROA 4Q48A 3K69A 2OZUA 1GHCA 1S3JA 3A1KA 3J80Z 4LGWA 4Q47A 3UTAC 1KX5A 3K9TA 3RPUA 2EFQA 4KGCD 2WC2A 3WAAB 3DKWA 1S32D 4RB2C 1R23A 5GXQA 2BEOA 1GXQA 2XHKA 4OIPF 4A5NA 1ZYRF 2Z99A 4PZJA 4WX9A 5B24C 3KWQD 3U9GA 3D0SA 4J8XB 2GQQA 2QQBA 5B32C 5DUKA 2HYFA 1IXSB 3FF5A 5DNND 1XGMA 2X0LA 3MCZA 1BJAA 5E5AA 2DLLA 2ESNA 5B24D 3M7GA 4J8UB 1TQIA 5ILSA 3TDUC 1I6XA 4PDKA 3UTBA 3JTGA 2L02A 1KX4A 3MGPA 2R3SA 3V7RA 5B2JC 3BZ6A 3T8TA 2YFVB 5AV5A 4KICA 1H3OA 1LJ9A 1SD4A 1SFUA 3I0TA 4H9NA 2H94A 2ZCWA 2O3FA 3FMRA 3BJ6A 1LEBA 2CO5A 3Q9VA 5K5RA 5AV8D 5L3DA 1U6GA 2ZNYA 4XZQD 1EQZB 2IA0A 2HFHA 3B6FD 5TRDA 4MEYF 3M8EA 5AVCB 1QO0D 4MHGA 5D5VB 4LD5A 4ZYGA 1YLFA 1KX3C 1JGSA 3WTTC 1JFIA 5GT0C 2QYOA 3REOA 1MJAA 5BPDA 5B1LB 2F5EA 4J8WB 3TU4A 2MBFA 3MAJA 1P3AB 4WXCA 1P34C 2R7FA 1ZG1A 4WWCA 2AROD 4CO8A 3ZP5A 1P3MA 2R7DA 5AV6C 3UTBC 2EA2A 2PN6A 4YS3A 1KX3D 1MD0A 3MGPC 4M9ZA 5AV5C 2VBZA 1T38A 2PBIA 3Q9SA 4MQVA 2XVCA 1S32B 2XGXA 1H9TA