2CWEA

Crystal structure of hypothetical transcriptional regulator protein, ph1932 from pyrococcus horikoshii ot3
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
191
structure length
191
Chain Sequence
AKKVKVITDPEVIKVMLEDTRRKILKLLRNKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTEMKGNLVEKYYGRTADVFYINLYLGDEELRYIARSRLKTKIDIFKRLGYQFEENELLNIMDRMSQKEFDATVRISKYIEEKEDALKDFSNEDIIHAIEWLSTAELARDEEYLELLKRLGSILKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical transcriptional regulator protein, PH1932 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Gene regulation
molecule keywords hypothetical transcription regulator protein, PH1932
total genus 74
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2005-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2cweA01
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2cweA02
5FD6A 1XSDA 4I02A 2Q2EA 3L7WA 2TDXA 2DO7A 2XUBA 1SD4A 1U78A 2YSRA 3KFWX 1BC8C 3MAJA 4J8UB 3KXBD 1E17A 3AN2D 5K5OA 3OOPA 1ZARA 1YYVA 5KDMB 3A6NB 3QU6A 3K69A 3ZP5A 1B59A 1BFMA 3UT9B 2KJBA 4OMZA 3AZNC 1OR7A 2FF4A 4H9OB 3X1VB 1PUEE 1YO5C 1FSHA 1R5GA 1FX7A 3AZGD 2A5YB 3LAJA 4RB3C 3A6NA 2M87A 4EM0B 3LELA 3IHUA 3X1SB 1R22A 1IN7A 5E8GA 1KA8A 2E1CA 2EFPA 2GXGA 4Z66C 1BI0A 3B0DC 1EQZC 3WAAD 1QQIA 4Z5TC 4F7ZA 2Y48A 2C6YA 3RYRA 3F22A 1SD5A 1LQ1A 3P7NA 5AVBA 5DV5A 2RGVA 2ESNA 4ASNA 1P34D 3BROA 1ZG1A 2K4BA 1GXPA 3KP3A 4XUJB 2F5EA 4HX4A 5AY8C 1Z91A 5HOOA 5F99B 1IXCA 1G6NA 4EJWA 2L3DA 4KGCB 3P9IA 5B1LA 3TDZC 3WKJB 5D6FA 3LQRA 5LHHA 3B6FB 4WV4B 3REKB 1PP8F 1P3OC 1P3KB 2XGXA 4CAYA 5B0YB 4QWQA 1HW1A 4LG0B 1O7LA 1U35C 1F66A 4HV6A 4LFUA 3GO5A 5DCMB 3WTXC 3ERED 4QLCA 5CP6B 3W97D 5B1LB 2VN2A 3FZVA 3HTSB 3AZEB 3ZPLA 3CDHA 3LZ0C 4IXAA 5E5AB 1O3TA 4YFKF 2KIFA 1M18A 3MGRA 3VB2A 2H27A 2OZUA 3WGIA 4R79A 3GXOA 4HGAC 3EETA 3B0CT 1R00A 3HOSA 1XMAA 3BWGA 4OMYA 1IN5A 1TW2A 3V9RA 5ICCA 2QBYA 4WU9C 1G3TA 1TZYD 4UUZA 3J80K 3K1PA 3AZKD 1R7JA 4R8PD 3F8CA 3GZ5A 5K1YA 2LY8A 3REHB 5B31A 4WX9A 4HF2A 1ZN2A 1BI2A 2BEOA 1RZ4A 3TO7A 2YFVA 3NEUA 1YTYA 1ZLKA 2QBYB 4M6XA 5B1MA 1ID3C 3X1SD 4I01A 5D4RA 4U88A 2JPBA 1WWSA 3B6FD 4OINF 4E70A 3REKD 5B0ZD 3TKYA 1R23A 2EFWA 4J8WB 1HSJA 5F1RA 3VFZA 3AV2B 1LJ9A 3HOTA 3X1SC 1JXSA 4I2OA 4LLGF 1HQ3C 2QQBA 4HLXA 5B31G 1S32D 4O6JA 4J8WA 2JPCA 1T38A 4H9RA 3FMSA 1P3IA 5CLSA 2XHKA 4HDVA 2HIOD 3KEQA 5DYMA 2GA2A 5DEQA 3AZGA 5BNVB 4M6BA 2L54A 4GXOA 3VEPA 3KUYD 5CPIB 3WE2A 1FLIA 4TV7A 5HDGA 1D5VA 5GT0C 1KX5B 1KX3B 5B33A 5E1XA 5B24C 1P3GB 2MA3A 2ZNYA 5C3IB 3CUQA 2PN6A 3ZMUA 5LEKA 3TOBA 3W99A 4G91B 1EH6A 3CO7C 1B67A 1FP2A 2XAFA 1ZLAC 4MGRA 1TZYB 4Z2YA 4J8XD 4Q47A 5CPKC 2BYKB 2Z33A 5HLGA 3ABTA 2ZO4A 5LRRA 2NQBB 5GXQA 1OYYA 1P3MB 5B40C 1SAXA 4I0AA 1S8NA 3GX4X 4RB0A 2ZCWA 5ILSA 5BS7C 3QU3A 2O03A 2MH9A 3HUGA 4XSXF 4I09A 1G4DA 4X23B 3F72A 4NB5A 1P2FA 2RV8A 5AV6A 2ACJA 1HTAA 3R45B 1WI9A 3I59A 2QLZA 3AZFD 2BV6A 1HKSA 4HDUA 3KWQD 4JJNB 1Q1HA 4ZBJB 4Y15A 4ZBJC 3X1TD 5AV6B 3ZMDA 4WU8D 5E18F 3MGSA 1JHFA 2AROD 5CVJA 1P3GD 5AV8D 4P9FA 2F2EA 5CVUA 3E5UA 1EQZA 4YM6D 5FFZA 4J8UD 3M1EA 3VOEA 1XGSA 3KUYC 1FBSA 1B4AA 1I1SA 4L9NA 3MGPC 2RC4A 3MCZA 4A12A 1AOIA 2FNAA 3KP5A 3QP5A 2QM3A 1P3OD 5GXQC 3REKA 4UVCA 5B0ZA 4A5MA 2BYVE 4N9HA 4WXCA 1U35B 1T2KA 4G7ZF 1FBUA 2AS5F 4MEXF 2G7HA 5GT0A 3GZ6A 2YX4A 4ZYEA 4EGZA 3AN2C 2OU2A 3CJNA 4YS3C 3EYIA 2FEZA 5HS8A 3MEXA 4IHSA 5FUGB 3AZMA 4FT8A 4KGCC 3TU4C 5CJ9A 4JBAA 3AV2D 3ZMZA 5D5WB 2EB7A 1IN6A 5GSUD 5GT0B 2XKPA 2HEOA 3Q9VA 5LEJA 2CV5C 1BI1A 3MVDC 3FMRA 3KP6A 3B02A 1P3PA 4P9UA 1XGOA 4H9SC 4U0VA 3B6GC 3WAAA 5L3EA 3MGQA 2GZWA 4LD9B 4KT5C 2RQPA 5TJJA 3PFIA 1U5TB 3KXBB 3UTAD 1R1TA 3AZHB 1FSEA 1V4RA 1QBJA 3AZLB 3VH6T 3RPQA 5F99A 1BC7C 2NYXA 1P3AA 3W97C 4ENKA 2IO5C 4YFXF 2B0LA 4L0YB 1BIAA 1RUOA 4EJVA 3WTSC 4JJND 3OV8A 2ETHA 2H6CA 3X1TC 5CP6D 3W97B 2PYOD 3F8NA 3MNNC 2ZJ2A 4KHAA 3AZHC 4CHUA 4KMFA 1FNNA 2AROC 4K2EA 1U5TC 3V8JA 2AROB 3I58A 3IWZA 2A61A 3W96B 5B40B 1ZGJA 5CPJD 3W97A 2KIUA 2ZMEB 3GFMA 5FB2A 2BBYA 5DNNB 2HIOC 4MQVA 3MGRB 4AIKA 2LF7A 3D5LA 3REHC 3HIFA 1LDDA 4KICA 1MKMA 5AVCC 3BPVA 1T98A 3REID 2PEXA 5KDMA 4WU9B 1TLHB 5HDNA 3NRVA 3AZGC 1G3WA 4LD9D 2DPUA 5B2IC 1P3FA 5JR3A 2A3SA 2GAUA 3MGSD 1P3BC 5HLHA 5B33B 3WU1B 1P3GA 5D8KB 1T6SA 1BH9A 5CYVA 3J7AO 1IN4A 2HKOA 3O2PE 5CPIC 3LELB 5B1MB 5B1MC 1ID3A 1YS6A 3X1SA 1RI7A 2A69F 4OU0A 5DD8A 5CVVA 1P3BB 1V3FA 5B2IB 2VC1A 5JI6A 3C1CA 4O5VA 1U2WA 4IHTA 3REKC 1IXSB 1IZ1A 4H9QB 1P34A 2YFWA 5B40D 5GXQB 3R6SA 2FJ7D 1HQ3B 4CSRA 2XASA 1O7FA 3EUHA 1QZZA 1B1BA 4G92C 3AYWC 5CPKA 3RPUA 1S32A 1ZG3A 3O3KA 4X23A 5AY8B 4YM6C 4DNCA 4EJOA 5B1LD 3BP8A 4L9TA 1OMIA 1S29A 3WKJA 3AZKB 4I7HA 2YFWB 3LZ1B 1SD7A 3LZ0A 3BZ6A 5B2JA 4MTDA 2A07F 2HUEC 3O6BB 4CAYB 2LNBA 5B0YA 3V7CA 3WTTC 3KZZA 1ZG5A 5BO0A 3R61A 3WODF 3CO6C 3RIRA 3RDIA 5CPJC 2FBIA 3MQ0A 3IL2A 3ML6A 1WKMA 4U0YA 4Q5SF 2VE9A 1L0OC 1XSVA 1KU3A 3V8KA 4BH9A 1H9TA 3MGQD 1PDNC 2CSOA 5D5VB 3RKWA 3C18A 3WTVC 4YFNF 1TZYC 4AD9A 1XGMA 3H3UA 4ON0A 3HRMA 1KX4C 5DUKA 2HTJA 2PMHA 3R0AA 3V9RB 3GFJA 5H20A 1AOIB 2XRNA 1EH7A 4MEYF 3VH6A 1P3MC 1ULYA 4ZYDA 5DNMB 4Q48A 3M7GA 2ISYA 5BPDA 5L3GA 3AZLD 1DUXC 4A0ZA 3O62C 3T5XA 2L01A 4XZQC 5CPID 2CV5B 4UXNA 2K27A 5B1MD 3SFZA 2OQGA 1O57A 5GT3C 1B9NA 3QRFF 1R5HA 4O3MA 6PAXA 1MJAA 4WK8F 1M19B 4LLLA 1Z1DA 1ZH5A 4YS3A 4L5JA 1M19D 3AZFA 3I53A 1O3RA 1MJ9A 4GGGA 5FD5A 5B32A 3C1DA 4KN4X 2M30A 3O62A 4XZQB 3MZHA 3REIA 3FMQA 3X1TA 2DPDA 3M8EA 1P34C 3NQUB 5IT3A 1ZAOA 5HS9A 4NE5A 1P3LA 4G7OF 2L4MA 1AOIC 1P3FD 4R8HA 4PGHA 3MGPB 4NQWA 3J81Z 4M71A 4ENNA 4YM6A 5LGUA 2XKOA 3IC7A 3KUYA 2Y75A 2XAGA 2F5CA 3DF8A 3C1BA 3R60A 2PBIA 1F66B 2G9WA 4ENJA 3GF2A 3F6VA 3DP7A 3SXYA 3FXRA 4ZH4F 3WTYC 2IP2A 5HLIA 1XDUA 4Z2MG 1ZREA 2P4WA 3X1VC 3GWZA 2M8EA 3WTUC 1O3QA 1W4MA 4KYWA 4OIQF 5B0ZB 3AZNB 1DPUA 3C1CD 2CV5D 4LD9C 2FJ7A 5TRDA 1RIOH 1ODDA 3LJAC 3GFLA 5CPKD 2CW0F 3FWEA 3C7JA 2COMA 2NRAC 2CG4A 3AZIB 2OA4A 3WTPD 1STZA 3KP4A 4AWLC 4EGYA 3WKJD 2A6HF 1KGSA 5J8CA 2KRFA 3DV8A 3JSOA 3MZYA 2A68F 4IVNA 4BYYA 1XCVA 4AVPA 4WU9A 2RDPA 1P3PD 2NQBC 2EV6A 2E7XA 4AIHA 2K86A 2IA2A 3I5UA 5ED4A 4HGAB 1ZLAB 1HXDA 5AV6D 2HR3A 1MZBA 5HVQC 4RGUA 5G49B 4J8VB 4WNNB 2FRHA 3LWFA 3N97A 1F1EA 4OOIA 3FHZA 4JJNA 5ICFA 4XSZF 1P3BA 3KCCA 3GLXA 2PYOA 1ZLJA 4G6DA 1K78A 5CHLB 1M1AC 4RAYA 3KZYA 2JZYA 4UHTA 3C1CB 2LKPA 2AROA 3AZIC 1KU7A 3U2RA 4OIRF 1Z9CA 4EV0A 3I54A 1HQ3A 4CSRB 3MGPD 3MFKA 2G7UA 1P3KA 3JSPA 4J8UA 4A0XA 1R4VA 1ONVA 3U1DA 5CPIA 1DP7P 1TAFA 5JA4A 2DW4A 3FXQA 5D4SA 5JVTA 3AZJD 4XLNF 3WGGA 2CO5A 3E6MA 2HIOB 4HQMA 5DNNC 1P3OA 1YW9A 1CF7A 1TNSA 2K4JA 4LB5A 1WQ2A 2V1DA 4DRBA 4YS3D 3CUOA 5GT0D 1XCBA 4E45A 3CLOA 3DPLC 3W99B 4UV8A 1LVAA 4LD5A 3A6NC 1KU9A 4Q4ZF 5B32G 2BYKA 2FXAA 3CUQC 3VH5W 2LSOA 3E5XA 5AVBB 1ID3D 3KEOA 3W98B 2ESHA 2XROA 3W98D 2RVCA 2P5KA 4HOBA 3KWQC 4JK1X 4L18B 1M19C 1P3PB 1H0MA 1R1UA 4H9NA 3ABUA 1M18C 4BHBA 4G7HF 1B9MA 3B6GB 1P3GC 2QUFA 3RELD 3FXUA 1KX5C 5LBQA 4HBLA 2DLLA 2CV5A 4Y17A 4UV9A 1D8JA 2FBHA 1FOKA 4IPAA 1FZPB 1P3AB 2OBPA 5AIQA 5CP6A 2HKXA 3I4PA 3ZMVA 2PQ8A 4CO8A 3LZ0B 2HYFA 1EH8A 4KHAB 3LZ0D 1O3SA 3L09A 5B1LC 3AZFB 1SFUA 1HW5A 2L4AA 2JSSA 5BO0B 2HQRA 4ESJA 3W6KB 5E1WA 2YR2A 1B6WA 2DT5A 3UTBB 2EFQA 4HAMA 3REJC 4KGCD 1BIBA 2NS0A 5DD4A 5AV5B 3REIC 3AFAD 2VBXA 4S05A 4HQEA 3B0CW 1VTNC 3KUYB 2CYYA 3E97A 1S3JA 2HFHA 4N0BA 5AV9A 3NQJA 1I1GA 3X1VD 3PQJA 3AZMB 5DNMA 1KX4D 1FYKA 1QO0D 4BNCA 3ROUA 2OQRA 3KLNA 4HZFA 4KN7X 2DQRA 2P8TA 1LEAA 3L2CA 1GVJA 1YS7A 2M45A 5K5QA 2V1UA 3J80Z 2VT3A 1IN8A 4D0PA 1XD7A 1H9GA 4GCVA 5A2QZ 3I71A 1KU2A 3V7RA 3UTBC 3J81K 2ZFWA 3MVDD 1P3FC 2FJ7C 3HRUA 5F6FA 5GT3D 1P3IB 3IRRA 5GSUB 4UVBA 3R45A 4XZQA 1BI3A 4FX4A 4M9XA 4PDKA 2HS5A 4UVAA 4I0BA 3KE2A 5DDGA 5BNXB 5F64A 3KP7A 4X23D 1FT9A 1I6XA 3H3ZA 4M9SA 4RGRA 2A6EF 3N4MA 1BN5A 5LHGA 5B2JD 2PYOC 5B2JB 2NZDC 5J8FA 2MH2A 1S7AA 3W96A 2J5OA 3TU4A 1FBQA 4YIFA 1UHMA 5B24B 2PYOB 2JRTA 3HRSA 3BJ6A 4AWLB 1YLFA 2EJRA 3RI4A 3AZID 1U3EM 5JRGA 3RYPA 3TQNA 1WWIA 4Y13A 1Z6RA 4BXUA 1J59A 1TQIA 5AVBD 2OD5A 2X0LA 5EEGA 3WA9B 3RTRA 4BQAA 3W96C 1OYIA 2HGCA 4XLPF 2D45A 2Q0OA 1D3YA 3WG9A 5CVRA 1JE8A 1UFMA 5LGTA 5L3CA 3IKVA 3W98C 1P3FB 1QPMA 3MGQC 4M73A 3QPHA 2BYMB 4B09A 1YIOA 3LJAA 4NE3A 4B8XA 3T1BA 3UT9A 4KUDD 1SMTA 4L9VA 4KUDB 4XUJA 5CPJB 2GQQA 2OZ6A 1YG2A 3C3WA 2QVOA 1KQ9A 1OYWA 3GFIA 1HBXG 3K9TA 3K1NA 3MGRD 1M19A 4H9QA 1P34B 3F8FA 5D5UB 5B32D 1U5TA 2STWA 4ZYGA 3O62D 3AN2A 2P5VA 2P5LC 2BE5F 4AIJA 4N9IA 3QPTA 4H9NB 5AV9D 1REPC 3HSRA 2XAHA 3S2WA 5DNMD 5ICGA 4MHGA 4KFCA 1SD6A 3MGPA 5JHUA 3AN2B 1IRGA 1P3KD 1TAFB 5JA4B 3C1BD 3C1BB 1KQ0A 3WE3A 2PFBA 3BJAA 3WU0A 3BDDA 3B6FA 1J5YA 3LZ1D 3AZED 5FUGA 1FC3A 4GYGA 3AZJC 3MVDA 1LNWA 4MNUA 1XN7A 3JAMZ 4A5NA 4EQQA 1P3IC 2NNNA 1XB4A 2FNPA 1OKRA 4QLCB 3TO9A 4XZQD 4P96A 4RB2C 2FJ7B 4HW0A 2ZXJA 3HSEA 4WWCA 1ZRCA 1N1JA 3MNNA 3WTPA 2IVMA 3MGSC 2MBFA 1M18B 1P3ID 4ZYHA 4R8PB 1P3PC 2NQBD 2KKOA 4MTEA 3REHD 3ECHA 1T0FA 1RUNA 5B0ZC 2UWMA 4WU9D 3TU4D 1JFIA 1S7OA 4LB6B 1CGPA 4UNOA 2QWWA 2O3FA 5FLXZ 4HX8A 1G3SA 2HWVA 2HYGD 3AZKC 3WTPC 2IPQX 4KA4A 3ZMSA 4RB1A 1W7PB 4J8XB 2IA0A 3KLOA 4OIPF 2YX7A 2YFVB 4GYIA 2FQ3A 2KJCA 3F23A 1AWCA 2VODA 3REJB 4ZUXC 1BH8A 3P9KA 3X1TB 2DI3A 1FYLA 1Z05A 3UTBD 4KMUX 5CPKB 3UTAC 4J8XA 4G94A 3KSYA 4ESBA 2FMYA 5K5RA 1HQ3D 1SFXA 4ZZDA 3I0TA 3LA3A 5AIPA 2RVQD 3LELC 3LJAD 1L3LA 1FYMA 3UT9D 5BT1D 5D5XB 1Q9CA 2NZDA 2F8NK 5AV5A 1F9NA 2QYOA 4FHTA 2M1BA 3D0SA 4U7BA 2M5WA 2JTVA 3AZGB 2L02A 1BBYA 1DPRA 1TNTA 2W84A 2QQ9A 3Q9SA 1T39A 3I64A 3TU4B 4CYDA 1P4AA 2GXBA 1U8RA 5AVCA 3AV1C 2DBBA 2NZDB 3JTGA 4DQ2A 4E44A 1KX4A 2GWRA 3IRQA 1K7AA 2O6GE 2AXLA 1JHHA 5IT9K 5KK1A 3BJOA 5DNND 3VH6W 5AVBC 3CUQB 1J2XA 1GHCA 5LHIA 1Y0UA 1EQZD 1Z7UA 4Z5TD 3W98A 1J7KA 5CVIA 4LMYA 2CFXA 3V8LA 4NE6A 1TQMA 2V6CA 3REOA 4J8XC 3W99C 2OAZA 1KYWA 1M1AD 2QZ8A 1ZLAA 4LJZF 3RELA 3WTPE 4JQFA 2F8NB 2BYMA 3X1UA 4EO5C 5B33D 1HQCA 2EWNA 5D8LB 3LJAB 4WU8C 3AZLC 3W6JB 4A2UA 3G3ZA 2F8NH 3F8MA 2F8NG 2W25A 5ICEA 4XBFA 1S32C 3MNND 1E2XA 2HDCA 2L5AA 1OPCA 2FE3A 4EO5B 4WU8B 5E20A 1ZRFA 2WWYA 4YG2F 3W96D 1BM9A 3LZ1C 3E3VA 4U0WA 1F66C 5GXQD 3CTAA 3HRTA 2FU4A 3L00A 4YM6B 2WC2A 2Y0MA 3JTHA 2IJLA 4LLNA 5BOXA 3GEZA 1Z6TA 4A6DA 3LA7A 1TW3A 3K0LA 3F21A 1CF7B 5DUIA 4WCGA 2PJPA 3WA9A 2D1VA 3IKTA 3C1BC 4LG0A 1IAWA 1U35D 3LQQA 4AWXB 1P3AD 5H6RA 1MDMA 5B0YC 2IW5A 3X1VA 2EFOA 1YW8A 3WKJC 5E5AA 1B6AA 3P9CA 5C3IC 2W57A 4RAZA 2MLGA 1C0WA 5GT3B 2ZBKA 2XIGA 4FX0A 5AV8A 1MDMB 3DKWA 2E1NA 4KUDA 3KETA 3O62B 1P3MD 5CPJA 4XUJD 3LFKA 2QENA 5BPIA 4EVIA 2Z9OA 2IA1A 5DNMC 2JSCA 4M74A 5GT3A 1R36A 5AV5D 1X3UA 2FOKA 4H9PB 4Z66B 4Z66D 3WTZA 5B31B 1RNLA 4EM1A 3AZHD 4HA8A 5E8IA 3MGRC 2R3SA 4J8VA 1YW7A 2FA5A 4IF4A 5AY8D 4IJAA 2DQLA 3B73A 4EMSA 4LD9A 2X4HA 3AZMD 1W7PA 4BAYA 1D8KA 3UT9C 5DNNA 1F4KA 3AV2A 1ON1A 1G3YA 4M9ZA 4P5OA 4WF2A 2LF8A 4ETSA 4J8UC 2HUEB 2WV0A 4Z5TA 3HHGA 4OIOF 5ILVA 1LEBA 4HLYA 2ADUA 2O8XA 5BS6A 3MVDB 3AZIA 1NHAA 1P4WA 5E17F 1K79A 1FY7A 4L9JA 3E6DA 1MJBA 5B40A 3UTAA 3AYWB 4HF0A 4ZZLA 3X1UD 2ZMEA 3JW4A 2E7WA 5BT1C 1HSTA 3RKYA 2NNYA 2EFNA 2V9VA 5JRGC 5LLQA 1P92A 2DK5A 5D6EA 2LDUA 3REHA 4WXDA 5G49A 5E5AC 4S04A 2HZTA 4Z2MH 3COAC 1KX4B 3ZQ7A 1K78B 1XSXA 4BHCA 4H9SA 1HKTA 3WA9D 2H94A 3DQVC 3B6GA 3REJA 5JFRA 1A7WA 1FP1D 2NAZA 5AV6C 2ZKZA 4I98B 4ZUXD 4J8WC 2Q8KA 4JJNC 2K7LA 3AZMC 3HYIA 2IT0A 1MD0A 2W85A 2F8NA 3I59B 2CWEA 2PG4A 5LRSA 2VOOA 2VBWA 2HOEA 5HDKA 5L3BA 1YQAA 1J75A 2NZDD 1AOYA 5BS7A 3LZ1A 3AZND 1YFHA 3AZEA 5AV9C 5ILUA 3MGSB 1KX5A 2EV0A 2JT1A 3DEUA 4MQ9F 3U9GA 1P3LC 3EYYA 3DPTA 4LK0F 5AVCD 2RKHA 2YU3A 5B31C 1IW7F 2F5FA 2UXNA 3AV1D 5ERIA 5H6QA 3G73A 3AV1B 3AZJB 1P3LD 3VH5T 1W5SA 3TDUC 2DK8A 2NQBA 3DFGA 4H0EA 5B33C 4LGWA 3FM5A 3F6OA 3IWFA 3WTWC 4HX7A 1P3AC 5BQTA 3A6ND 3M8FA 5B0YD 2ISZA 1WSUA 2D2WA 1UHWA 2VBZA 4G91C 3KP2A 3HTUA 3V7SA 5J6XA 5KVRA 3SZTA 3NQUA 1UCRA 3TGNA 1H3OB 1FPQA 3RJPA 1LB2A 2MLKA 1KX3C 5F99C 2FMLA 1IRFA 3F3XA 4XUJC 4BHPA 2HTSA 4PCQA 2KIMA 3LSTA 4CGZA 5FO5A 3UTBA 1W5TA 3BY6A 3F8BA 3WAAB 1H3OA 4ZUXB 1IF1A 4WXHA 5A2QK 1I27A 3H92A 5B32B 1K6OA 2P7VB 3AZLA 4M72A 2R7FA 2F5DA 5DCMA 1F66D 4ESFA 1P3LB 1JGSA 2IO5B 2RNJA 2H09A 3B0BA 1IUYA 3KXBC 4R8PC 1WWXA 1R58A 2QQAA 3REJD 3BPXA 2STTA 1P3BD 4IRHA 2DFIA 3GVAA 4HF1A 4EM2A 1P6RA 5E5AD 5EEHA 3C1CC 4HYEA 5L3DA 1M1AB 1SMYF 5AV8B 3JAMK 1GXQA 4IRGA 4H9OA 4PGGA 1KYZA 2UZKA 2XAJA 2ZNZA 3WGHA 1P3MA 3QAHA 4G9YA 3SHFA 4J8VC 5CP6C 5BMZA 3K1MA 1M1AA 3M9AA 1ZLAD 3ECOA 4QLCC 1KX5D 1BH9B 4CZZA 1KX3D 3B6FC 4J8VD 2IRFG 4L5IA 1ZYRF 2PI0A 3EDPA 3QOPA 4HV5A 5AV8C 1W7PD 3ISPA 4H9RB 5JRGB 2EA2A 2O0YA 2HIOA 3X1UC 1P3OB 2YPRA 2Z99A 3RKXA 4Z5TB 2VONA 3B0DB 1EQZB 4G6QA 3GYHX 3R0JA 3PQKA 1S32B 4G8XA 1P4XA 3E5QA 5FFXA 3MWMA 2PMUA 2RVQC 3ZMTA 2MD5A 5AONA 3VODA 1F5TA 3UTAB 3AYWA 2D1HA 2WTEA 2CGPA 3ELKA 2XVCA 1U35A 3L9FA 2UXXA 2RN7A 4NHJA 2ELHA 5B24D 3W99D 4KUDC 2XV4S 3ZN1A 1LDJA 2BGCA 2FBKA 1TZYA 3MNNB 3FX3A 3WTPB 3DXJF 3WA9C 3WAAC 3GUDA 2FSWA 1IXRC 2W24A 1ID3B 1HKQA 1J9IA 4R8PA 4CDGA 1MGTA 5B31D 3HSFA 1U6GA 4CICA 3BOQA 5IT9Z 5B2IA 3AZJA 2VE8A 4KIFA 5LGNA 2DU9A 4KGCA 4KUMA 2HQNA 3NQOA 4P55A 4H9PA 2VT2A 4Z66A 3RELB 1QZYA 4GO1A 1LDKB 3X1UB 3Q5FA 3KXBA 1TBXA 3AZHA 2K02A 4UUVA 4XRFA 1SFEA 4RGXA 1ZRDA 3KWQA 3TO6A 1ZGAA 1ZHFA 4LK1F 1BH8B 5AY8A 3RELC 5FGMA 4YIIA 1TQPA 3SQNA 4J8WD 4NFTA 3AZEC 4WU8A 1DDNA 1J0RA 5B2JC 4YS3B 3LELD 3TOAA 1EV7A 3KWQB 3QP6A 3AFAC 3LAPA 2VC0A 2VBYA 4RS8A 1KU5A 1N1JB 2VOPA 1AOID 2EV5A 4EJTA 3NQJB 5AV9B 4WZSB 3T8RA 2EA4A 4UUZB 3FF5A 3AV2C 3FM3A 1ON2A 2GIVA 4DRAA 5E1ZB 5GSUC 1R1VA 1KX3A 4A0YA 3V4GA 3HHHA 4KIGA 2XAQA 3K2ZA 2GA1A 5HS7A 2J5PA 1JFIB 4CXFA 3AV1A 2MC3A 4KIBA 1PP7U 3T8TA 3E6BA 5FLXK 1QGPA 1BOAA 3LA2A 4R1HA 2O61A 4G92B 4EJUA 5GSUA 4A6EA 4QLCD 1S6LA 4PZJA 4KNYA 1XGNA 4M6YA 1XMKA 3MGQB 5JRGD 1FWZA 1USTA 1M18D 4X23C 1BJAA 2P7CB 3AZFC 3AFAA 2CQKA 5DCFA 3B6GD 3AYWD 5B32C 3EQLF 1USSA 4RGSA 2P6SA 2H6BA 2V79A 5BNVA 5AV5C 3REIB 5L3FA 2EK5A 3E6CC 5F99D 1UB9A 1HW2A 3T0YA 2DTRA 2R7DA 2P6TA 1XDSA 2PLYA 4KDPA 2V1XA 4ZUXA 1QNTA 2VXZA 5B24A 1A04A 3R4KA 4ENMA 1TTYA 2Z5UA 3AFAB 3AZKA 4QLCU 2Z3YA 3GW2A 2F8ND 3SZPA 3ZN0A 4IRIA 3AAFA 1P3KC 1WRJA 4WNNA 3VH5A 5BNXA 4U7DA 2DAOA 1KQ8A 1I5ZA 3ULQB 5AVCB 4L0ZB 3AZNA 1F1ZA 5B2ID
chains in the Genus database with same CATH superfamily
1SVLA 5FD6A 1XSDA 4I02A 2Q2EA 3L7WA 2TDXA 1ETVA 1W0UA 5DS9A 2DO7A 4XIDA 3OR1C 3DTIA 2XUBA 1SD4A 3VYUB 1VF9A 4UY8I 1U9NA 2WB1A 3ZR8X 1U78A 2YSRA 3KFWX 1BC8C 2F5VA 3MAJA 4J19A 4J8UB 3LFUA 3KXBD 1E17A 3AN2D 4HNTA 5K5OA 1LPQA 3OOPA 1ZARA 1YYVA 5KDMB 4ZDOA 3A6NB 3QU6A 1WJAA 3K69A 3ZP5A 2K40A 2LFBA 3SJMA 3LSJA 1B59A 1BFMA 3UT9B 2KJBA 4IOCF 2HI3A 4OMZA 3AZNC 3H1CA 4DGWB 1OR7A 3HDDA 2FF4A 5CKTA 4H9OB 3X1VB 3X2QH 4CCNA 1PUEE 3IH4A 1YO5C 3M07A 5M5WJ 3S14J 1WJEA 1FSHA 2H8RA 1R5GA 1FX7A 5K7HA 3AZGD 2A5YB 3Q0WA 3LAJA 4HPQA 4RB3C 3A6NA 2M87A 4EM0B 3HOVJ 3LELA 1S7EA 3IHUA 3X1SB 1R22A 4HRIA 1IN7A 5GTHC 5E8GA 4BE1A 2K3PA 2RQQA 4BEHB 1KA8A 3H9QA 4LOCA 2E1CA 2EFPA 2GXGA 3EPZA 4Z66C 3RQIA 1ZELA 5F1JA 1BI0A 3B0DC 1EQZC 2AO9A 3WAAD 1QQIA 1AU7A 4GRIA 1QA6A 4F7ZA 2Y48A 5FKLA 2L5QA 2C6YA 3RYRA 1FTTA 4Z5TC 3F22A 5EF6A 4F3QA 1SD5A 1LQ1A 3P7NA 1RPWA 1S5LC 4G6TB 3HOXJ 5AVBA 5DV5A 1R6RA 2ESNA 2RGVA 3ZQQA 4ASNA 1P34D 3BG9A 3BROA 1ZG1A 2K4BA 4E4HA 2V1NA 3KP3A 1GXPA 4XUJB 2F5EA 4HX4A 4DYQA 5AY8C 1LUJB 2E71A 1Z91A 2VUMJ 5HOOA 4A3KJ 4ZDLA 5F99B 1IXCA 4DOZA 5GAEJ 1G6NA 2KRCA 2MFZA 4EJWA 4QIWN 2LBFA 2L3DA 4KGCB 3P9IA 5B1LA 3TDZC 3WKJB 2QGUA 5D6FA 3LQRA 5LHHA 4A3FJ 3B6FB 4WV4B 2VJIA 5EEAA 3REKB 1PP8F 2BY0A 1P3KB 1P3OC 4XLHA 2XGXA 4CAYA 5B0YB 4QWQA 4FE4A 2DFFA 1HW1A 4LG0B 1VNDA 1O7LA 1K61A 1U35C 1F66A 4HV6A 3KYCB 3GO5A 4LFUA 5DCMB 3WTXC 3ERED 3CCRI 2VXDA 2M4GA 1ETOA 1SVMA 5CP6B 3GZNB 3K70D 5B1LB 3W97D 2VN2A 3FZVA 3HTSB 2R5YA 3ZPLA 3AZEB 3CDHA 3LZ0C 4IXAA 5HODA 1K4TA 1NTCA 5E5AB 1O3TA 4YFKF 2H1KA 4XQFA 1UMQA 2KIFA 1BW5A 1F43A 1M18A 4B47A 3MGRA 3VB2A 2H27A 2OZUA 3WGIA 4R79A 3GXOA 4HGAC 5J4YA 3EETA 3B0CT 1R00A 2A05A 2E60A 3HOSA 1XMAA 1NK3P 3G71I 3BWGA 4OMYA 2Y2IA 3F9KA 5DM6F 1IN5A 1TW2A 4XRSG 3V9RA 2ZXIA 5ICCA 2QBYA 2E34A 4WU9C 1G3TA 2PJRB 2IS4A 1TZYD 4UUZA 3J80K 3OYEA 3K1PA 2CMPA 3A0HC 3AZKD 2N8GA 1R7JA 1ZR2A 3RZOJ 1FTZA 3F8CA 3GZ5A 5K1YA 3F6TA 4R8PD 4BL0B 2LY8A 3REHB 5B31A 3MKZA 2CV1A 3Q3SA 4WX9A 3BG3A 4HF2A 1ZN2A 1BI2A 2BEOA 2MGQA 2DJIA 1RZ4A 3TO7A 2UWXA 3IH3A 3NEUA 4KITB 1YTYA 1ZLKA 4M6XA 2QBYB 2YFVA 5B1MA 1ID3C 2Z16A 4D7NA 3X1SD 2L9VA 4I01A 3WG7H 4U88A 5D4RA 1E0EA 1X1CA 2JPBA 5FKKA 1H89C 1WWSA 4CSWA 3B6FD 4OINF 4E70A 3BG7A 3REKD 5CQGA 5B0ZD 3TKYA 1R23A 2EFWA 5C3EJ 4J8WB 1HSJA 5F1RA 2XF5A 4UUSA 3VFZA 4XORA 2V9PA 3AV2B 1LJ9A 3S8PA 3HOTA 3OYCA 1YRNA 3X1SC 1JXSA 2NVYJ 4I2OA 2QA4I 2LMDA 4PJNA 4LLGF 1HQ3C 2QQBA 2CQ7A 2FJ1A 4HLXA 2QF7A 4DW6A 3P5JA 5B31G 3ONQA 1S32D 4N4OB 2CQNA 4O6JA 5E3LA 4J8WA 2JPCA 1T38A 4H9RA 3GTQJ 3FMSA 4A3DJ 2G5HC 4UB8C 1P3IA 5CLSA 2XHKA 4Y33A 4HDVA 2HIOD 1YRNB 4E7SA 1FMVA 3KFUG 3K4CA 3KEQA 5DYMA 2GA2A 5DEQA 3AZGA 5BNVB 4M6BA 2L54A 3BR1A 1YE9A 2BXYA 1ETWA 4CZCA 4GXOA 3VEPA 3KUYD 3OSGA 5CPIB 3WE2A 1HCRA 3A1IA 3PNTA 3SDBA 2WY7Q 1WPKA 3B6CA 1FLIA 5GADJ 3BR3A 5C44J 4E6KG 4TV7A 4HSRA 3E7LA 5HDGA 1D5VA 5GT0C 2LH9A 1KX5B 1KX3B 4FISA 1Y1VJ 3GMEA 3LMMA 5B33A 5E1XA 5B24C 1P3GB 2MA3A 2M0CA 2ZNYA 5C3IB 3OYBA 3CUQA 4PK4A 2PN6A 1U9OA 4UUTA 3ZMUA 2DOAA 1TWFJ 5LEKA 3TOBA 2NS7A 3W99A 1MNEA 5B5EC 4G91B 1EH6A 3LSIA 4IO9F 3IAM2 3CO7C 3K6GA 5E3NA 1B67A 1FP2A 2XAFA 4C30A 4MGRA 1ZLAC 2X1CA 1TZYB 4Z2YA 4J8XD 4Q47A 5K7FA 5CPKC 3QQAA 2BYKB 4FASD 2Z33A 5HLGA 2L7KA 3ABTA 1WGXA 2ZO4A 4XKVA 5LRRA 4MFDA 4MLOA 3S15J 5GXQA 2NQBB 3GTGJ 1OYYA 3JRDA 5B40C 1P3MB 1SAXA 4I0AA 4JX6A 3B6AA 1S8NA 3GX4X 2R4GA 4RB0A 3CCLI 2ZCWA 5ILSA 5BS7C 3QU3A 2O03A 2MH9A 3HUGA 4XSXF 4I09A 2PMZA 1G4DA 4X23B 3F72A 4NB5A 1E3HA 3QYFA 1P2FA 4JX5A 3OS2A 2RV8A 5AV6A 2ACJA 1HTAA 3R45B 1WI9A 3A2KA 1X1BA 1POGA 3I59A 2QLZA 3FHNA 1BR4A 1X4PA 3AZFD 3I9V2 2BV6A 1HKSA 4HDUA 2DOEA 2CUZA 3HUGB 3KWQD 4JJNB 2RNGA 1Q1HA 1X4OA 4ZBJB 4Y15A 4B43A 4ZBJC 2WBMA 5J1UA 3H0MC 3X1TD 2ELJA 5AV6B 3ZMDA 4XNFA 2X6WA 2K85A 4WU8D 5E18F 3MGSA 3BR0A 1JHFA 2AROD 5CVJA 4F93B 1P3GD 2V4JC 2Y9YA 5AV8D 3C2HA 3RZDJ 4P9FA 2F2EA 3QPSA 5CVUA 1JKOC 4OAYA 3E5UA 1EQZA 1MW7A 4II3A 5FFZA 4YM6D 4J8UD 3M1EA 3VOEA 1XGSA 3KUYC 1ITYA 1FBSA 2NVQJ 1B4AA 3EUHC 4CCJA 4L9NA 1I1SA 1HOMA 1DU0A 3MGPC 1JUPA 2Q2EB 5FRNA 2WAQN 2RC4A 3MCZA 4A12A 1AOIA 2ZY4A 1NG7A 2FNAA 3KP5A 3QP5A 2QM3A 1P3OD 5GXQC 3REKA 4UVCA 1TC3C 2I8DA 2KT0A 5B0ZA 1WJDA 2BY3A 4A5MA 2BYVE 4N9HA 4WXCA 1HA8A 2X48A 4G7ZF 1FBUA 1T2KA 4M3DA 1XC5A 3GTMJ 1U35B 2AS5F 4MEXF 1MBGA 2DT7B 2G7HA 3GZ6A 2YX4A 4ZYEA 4EGZA 5GT0A 3CLQA 1B8IA 3PIPF 3AN2C 3MVPA 2OU2A 3CJNA 2V6EA 4YS3C 3EYIA 2FEZA 5HS8A 3MEXA 2R7RA 4IHSA 5FUGB 3AZMA 2HYJA 1MBHA 4FT8A 4KGCC 3TU4C 5CJ9A 3L1PA 1R71A 2DA7A 4JBAA 3AV2D 3NAUA 3ZMZA 5D5WB 2EB7A 1IN6A 5GSUD 5GT0B 2XKPA 2HEOA 3Q9VA 5LEJA 2CV5C 3HM5A 3TL4X 2JQ7A 1VQ9I 1BI1A 3MVDC 1K83J 4M3EA 3FMRA 3KP6A 3B02A 3HOYJ 1P3PA 4P9UA 1XGOA 2DDBA 4IHWA 4H9SC 4U0VA 3B6GC 3OYAA 3WAAA 5L3EA 3S3MA 2GZWA 3MGQA 5JLXA 2R7UA 4LD9B 4KT5C 5F0FA 2RQPA 5TJJA 3PFIA 3M4OJ 1U5TB 5KNLA 3E0JB 4ANJA 3KXBB 3UTAD 1R1TA 3BG6A 2Y30A 5CQEA 4IL6C 1FSEA 3AZHB 2VKDA 1APLC 1V4RA 1QBJA 3AZLB 5DM7F 3RPQA 3VH6T 5F99A 1BC7C 2NYXA 1P3AA 5TGTA 2CW8A 3KEYA 4ENKA 3W97C 3WHCA 2IO5C 3OR2C 4YFXF 2CS3A 2B0LA 4L0YB 3GTPJ 1LE8B 5IYDJ 1BIAA 2L9NA 1RUOA 4EJVA 3WTSC 1V5EA 3OV8A 2ETHA 4DYCA 4JJND 3HB9A 2H6CA 3X1TC 5CP6D 1PZRA 2PYOD 3W97B 3F8NA 1MMAA 2M34A 3MNNC 1DGWY 2ECCA 2ZJ2A 3ZXSA 4KHAA 5HNFA 3AZHC 4CHUA 4KMFA 1FNNA 4DBRA 4K2EA 2AROC 1U5TC 3V8JA 2AROB 2XD5A 2W8SA 3I58A 3IWZA 2A61A 4RM3A 5GPCA 3W96B 5B40B 3CMYA 1ZGJA 5CPJD 3W97A 1VQNI 2KIUA 2ZMEB 4Z6YA 3GFMA 1HC8A 2M7AA 5FB2A 2BBYA 3FXKA 5F08A 3ABKH 2DOFA 5DNNB 2X1EA 4XK4A 4BUPA 2HIOC 4MQVA 3MGRB 4AIKA 2LF7A 3D5LA 4BE0A 3REHC 3HIFA 4XKCA 1LDDA 4KICA 4JOMA 3CCUI 4E7IA 2LY2A 1MKMA 5AVCC 3BPVA 1T98A 1W36D 2JA5J 3REID 2PEXA 5KDMA 2X1DA 4WU9B 5KHDA 1TLHB 3Q0VA 5HDNA 3NRVA 3AZGC 2KMUA 1G3WA 4LD9D 2DPUA 2COBA 5B2IC 4XM3A 1P3FA 5JR3A 1VI0A 2KLOA 1U8BA 2A3SA 1GDTA 2GAUA 3MGSD 1P3BC 5HLHA 5B33B 5J1RA 3WU1B 1P3GA 5D8KB 1T6SA 1BH9A 5CYVA 3J7AO 1IN4A 2HKOA 3O2PE 5CPIC 3DEWA 3LELB 5B1MB 4MIMA 3CDLA 5B1MC 1YS6A 1ID3A 4RBOA 3ESWB 3X1SA 2NVUB 5EG0A 3HOUJ 2Y2LA 1RI7A 2A69F 4OU0A 3PNVA 5DD8A 5CVVA 1P3BB 3OYNA 4PFPA 1V3FA 5B2IB 2VC1A 4UUSB 2W4SA 1RKWA 5JI6A 3C1CA 4E7KA 1WHUA 4O5VA 4A93J 4BJ5C 1U2WA 2R7OA 4LITA 4IHTA 3HKZN 1IXSB 1IZ1A 3ASNH 4H9QB 1FOYA 2YFWA 3BR5A 5GXQB 3R6SA 4IQJA 3NWTA 5B40D 1HQ3B 4CSRA 1R9TJ 2XASA 2FJ7D 1O7FA 3EUHA 1QZZA 1B1BA 4G92C 3AYWC 5CPKA 4PJMA 3RPUA 3JR9A 1S32A 1ZG3A 3O3KA 2F2AC 4X23A 2J8PA 3IAS2 3PNYA 5AY8B 4DNCA 4EJOA 5B1LD 3BP8A 4L9TA 4YM6C 1OMIA 1S29A 3ERMA 1VQ6I 3WKJA 3AZKB 2K9MA 4I7HA 2YFWB 3LZ1B 2Y69H 1SD7A 3LZ0A 2ZMEC 3BZ6A 3S3OA 5B2JA 4MTDA 2A07F 4RM2A 2OCCH 3K70C 2HUEC 3O6BB 4CAYB 2LNBA 5B0YA 3V7CA 3WTTC 3KZZA 1ZG5A 5BO0A 2DA3A 3R61A 2LK2A 3WODF 1ERDA 3CO6C 4BDYA 3RIRA 3RDIA 5CPJC 2FBIA 1WVRA 2X51A 3MQ0A 2XPWA 3IL2A 3ML6A 1WKMA 4U0YA 2DMQA 2ECBA 4Q5SF 2VE9A 1L0OC 1XSVA 1KU3A 3V8KA 3PUBA 4BH9A 1H9TA 3MGQD 1PDNC 2CSOA 5D5VB 3RKWA 4CUGA 3C18A 2HOTA 3WTVC 5EZGA 3CC7I 4YFNF 1TZYC 2XAUA 4AD9A 1XGMA 3H3UA 2HU9A 3K4KA 4ON0A 3HRMA 3W6VA 4V2GA 1KX4C 5M3MJ 5DUKA 3H9GA 2ZSIB 2HTJA 2PMHA 3R0AA 3V9RB 3PUFA 3GFJA 5H20A 1AOIB 2XRNA 1EH7A 4MEYF 2FOWA 3VH6A 3OIOA 1ULYA 1P3MC 4ZYDA 5DNMB 4Q48A 3SZGA 1P7JA 1WZ2A 3M7GA 2ISYA 5BPDA 5L3GA 4CCMA 4NDLA 1VQPI 2ICWG 3AZLD 1AA7A 4A0ZA 1DUXC 4BDZA 3O62C 2MABA 2L01A 3T5XA 3UNGC 4XZQC 5CPID 2CV5B 4UXNA 4BJTA 2K27A 5B1MD 1EF4A 2ZXHA 3SFZA 2E2HJ 2OQGA 4IEJA 1O57A 2M2EA 4RAFA 1Z3YA 5GT3C 3AL0C 2MG4A 2JJ7A 1B9NA 3QRFF 1R5HA 1BL0A 4BQOA 1X1AA 4O3MA 6PAXA 3K4MA 1MJAA 4WK8F 2LTPA 1VFCA 2OTJI 4LLLA 1Z1DA 1ZH5A 1M19B 4YS3A 4L5JA 1M19D 3AZFA 3I53A 1O3RA 1MJ9A 4GGGA 5FD5A 5B32A 4F92B 1GUUA 3CF5F 3LSHA 3C1DA 4KN4X 2M30A 3DWLE 3G2BA 4XZQB 3O62A 3MZHA 3REIA 1G8XA 1JT6A 3FMQA 3X1TA 2DPDA 1TP4A 3M8EA 1P34C 5FKMA 3NQUB 5IT3A 1ZAOA 2CFOA 3DTKA 1LKXA 1X3ZB 2K9SA 5HS9A 4NE5A 3HGGA 2JWTA 1P3LA 1JGGA 4G7OF 2DYRH 3DU6A 2L4MA 5KCMA 1AOIC 4B48A 1P3FD 5LFAA 3TW7A 4R8HA 2VPRA 4PGHA 3MGPB 4NQWA 3J81Z 4M71A 4ENNA 3L2VA 4YM6A 5LGUA 1DP3A 2XKOA 3IC7A 3KUYA 2Y75A 4F91B 2XAGA 2F5CA 3DF8A 1OCTC 4H4KC 3FXLA 3C1BA 3R60A 2PBIA 1F66B 2G9WA 2Y0SA 4ENJA 3GF2A 3F6VA 3D1NI 3DP7A 3SXYA 3FXRA 4IOAF 4ZH4F 3WTYC 2HDWA 2IP2A 3IP4C 1P7IA 1XDUA 5HLIA 2BY1A 4Z2MG 4NC7A 1ZREA 2P4WA 3X1VC 5M5XJ 3GWZA 4NQWB 2M8EA 2DTZA 3A03A 1W4MA 3WTUC 3NWSA 1O3QA 3VYRB 4KYWA 4OIQF 5B0ZB 1F36A 1DPUA 3C1CD 5FKOA 4RLQA 1G2HA 2CV5D 2VKVA 4LD9C 2ZJPF 2FJ7A 5TRDA 3CCYA 1ODDA 3DTEA 1RIOH 3LJAC 4J00A 3GFLA 4XL9A 2F6CA 1MSFC 3BCAA 2CW0F 3FWEA 2JN6A 5EGOB 3C7JA 2COMA 1AHDP 1W0TA 3S1RJ 2NRAC 2CG4A 3AZIB 2OA4A 3WTPD 1STZA 3PSFA 2R93J 3KP4A 4PFOA 4Y52J 2DF4C 2DMPA 3L2QA 4AWLC 4EGYA 3WKJD 2NOGA 3CC4I 2A6HF 4DZJA 1KGSA 5J8CA 1ACIA 2KRFA 3DV8A 3KIOA 3JSOA 5KAIC 3K4LA 3KZIC 3MZYA 1IRZA 1ZR4A 2A68F 4IVNA 4BYYA 1GLNA 4AYBA 1XCVA 4JP0A 4AVPA 4WU9A 2RDPA 2CU7A 1P3PD 2NQBC 5IOYA 3CCMI 2EV6A 2E7XA 4AIHA 3BT9A 2BY2A 2FD5A 2ZY3A 2K86A 1BOBA 2IA2A 3I5UA 2F4OB 5ED4A 4HGAB 1ZLAB 1HXDA 1JUSA 5AV6D 3HPGA 2HR3A 1MZBA 5HVQC 4RGUA 5G49B 4J8VB 4WNNB 2FRHA 1IRXA 3LWFA 5EJCA 5J3LA 3N97A 3ZQIA 1F1EA 4OOIA 2JUCA 3FHZA 1PJRA 4JJNA 5ICFA 4XSZF 1P3BA 3KCCA 4AUXA 3AKZA 3GLXA 2PYOA 2AXTC 1ZLJA 4G6DA 3HZJA 4B1RA 1K78A 5CHLB 1M1AC 4RAYA 3KZYA 1SFKA 2JZYA 4UHTA 3VDXA 2WA0A 3C1CB 2LKPA 2DMUA 2AROA 3AZIC 4B44A 1Z21A 3H5NA 3U2RA 4OIRF 1Z9CA 1KU7A 4EV0A 2VQRA 1HF0A 3I54A 1HQ3A 4CSRB 5J4VA 3MGPD 3MFKA 2G7UA 1P3KA 3JSPA 4J8UA 4A0XA 1R4VA 1ONVA 3U1DA 3OY9A 5CPIA 1DP7P 1E3PA 3K7AJ 1FIAA 1TAFA 5JA4A 2DW4A 2HOSA 4RMNA 3FXQA 5D4SA 5JVTA 3AZJD 4XLNF 3WGGA 4XN0A 1JT0A 1W1WE 5IP6A 2CO5A 2QQ8A 3E6MA 3HG9A 5GP9A 2HIOB 4HQMA 3OYGA 3S1NJ 5DNNC 1YW9A 5IYBJ 1CF7A 1P3OA 4RA2A 1TNSA 1VQ5I 2K4JA 4P1WA 2EILH 4LB5A 5GAHJ 1ORKA 1WQ2A 3CD6I 2V1DA 2O9LA 4F52A 2YUSA 4DRBA 4YS3D 2GIZA 3CUOA 5GT0D 1XCBA 4E45A 3CLOA 1KZHA 3LSRA 2VKHA 3DPLC 5KAFC 2V7FA 3MKWB 1W36C 1IGNA 2Y31A 3W99B 4UV8A 1LVAA 1UZCA 4LD5A 2CUFA 2VJ5A 4BEHA 3A6NC 1KU9A 1MNDA 1VQMI 1MMDA 4Q4ZF 2RAEA 4XLAA 4I6ZA 2XF6A 3PO2J 5B32G 2BYKA 2FXAA 3CUQC 5FRMA 2Y2PA 3VH5W 2LSOA 3HGYA 3E5XA 1X19A 2JVHA 3CZ6A 5AVBB 4KT6A 1ID3D 2V9KA 1PVEA 3KEOA 2BXZA 2O7OA 2ESHA 2XROA 3W98B 4V2FA 4C9YA 2R0QC 2RVCA 2P5KA 4HOBA 4X1EA 3S1MJ 3KWQC 3W98D 1QHGA 4JK1X 4L18B 1M19C 1P3PB 2MD0A 1Y6IA 1H0MA 1R1UA 2O5RA 2X9DA 2UV1A 1EA3A 4PSWA 4H9NA 2IGMA 3ABUA 1M18C 4BHBA 2ZSHB 4G7HF 1B9MA 5IYCJ 4J8UC 2Y2KA 3B6GB 1P3GC 2QUFA 3RELD 3FXUA 1KX5C 1IUFA 5LBQA 3VYSB 2VQHA 4HBLA 3BCBA 2DLLA 1Z67A 1O4XA 4Y17A 2CV5A 4UV9A 1D8JA 2FBHA 2MYSA 1FOKA 1D1BA 2W00A 4IPAA 3RPUD 1FZPB 1P3AB 2LKSA 5F0CA 2FQ4A 2OBPA 2X6XA 4XRMA 5AIQA 4C3JJ 4QSHA 4FTHA 5CP6A 2ID6A 2HKXA 3I4PA 3BTCA 2PQ8A 3ZMVA 4CO8A 2Y2MA 3LZ0B 3K4BA 2HYFA 1EH8A 3S2DJ 4KHAB 1O3SA 3LZ0D 2DJNA 3FK6A 3L09A 3S3NA 5B1LC 1B72A 2R5ZB 3AZFB 1SFUA 1HW5A 2L4AA 5IY5H 2JSSA 5BO0B 5EZHA 2HQRA 4ESJA 3W6KB 5E1WA 3LSGA 2YR2A 1B6WA 5CPRB 2DT5A 2ZFUA 2EFQA 2JA2A 3UTBB 4QPQA 3SEQA 2IGOA 2E36A 3U1KA 4HAMA 1NH3A 2KQRA 3REJC 4X0GA 4KGCD 1BIBA 2NS0A 3BZCA 2Y2GA 5DD4A 5AV5B 3FXJA 3EG5B 3REIC 2E19A 1OCOH 3CJQB 4IX7A 3AFAD 4YEJA 3I4NJ 2VBXA 4S05A 4ITVA 2TCTA 4HQEA 3B0CW 1VTNC 3KUYB 2NOJB 1JTYA 1JJ8C 3A0BC 2XGCA 2A6TA 1WJ5A 2CYYA 1S3JA 3E97A 1D0YA 4ZTFA 3O8GA 1A6QA 2HFHA 4N0BA 2LY9A 5AV9A 3NQJA 1I1GA 3X1VD 1XMXA 3PQJA 2Z1DA 3CP2A 5DNMA 3AZMB 1KX4D 1FYKA 3HOZJ 2W82A 3S16J 1QO0D 4BNCA 3ROUA 2OQRA 3KLNA 4HZFA 4KN7X 2DQRA 2P8TA 3TW6A 1LEAA 3L2CA 1GVJA 2I5UA 2LREA 5H2FC 1YS7A 2M45A 5K5QA 2V1UA 3J80Z 1U0JA 2IEKA 2VT3A 1IN8A 4D0PA 3A4CA 1XD7A 1H9GA 2L9SA 4GCVA 5A2QZ 3I71A 4XR6A 1A35A 1KU2A 1UG0A 2RIQA 3V7RA 3UTBC 2ME0A 3J81K 2ZFWA 1K4SA 3MVDD 1P3FC 4HG2A 4XRSA 2B9SA 3HRUA 1Y8RB 5F6FA 5GT3D 1P3IB 3IRRA 1X58A 5GSUB 2R7XA 4UVBA 2QSFX 2FX0A 1OFCX 4NC6A 3R45A 4XZQA 1BI3A 3PJRA 4FX4A 3OS1A 2ZJRF 4M9XA 3H35A 4A3JJ 4PDKA 2Y0SN 1JTXA 3OSFA 2HS5A 4UVAA 4I0BA 3KE2A 5EYRA 3SEZA 5DDGA 5BNXB 1HDPA 4EEFG 5F64A 3KP7A 4X23D 2QSHX 1FT9A 1I6XA 4CH7A 3H3ZA 4M9SA 4RGRA 2CH0A 4D7MA 2A6EF 3N4MA 1BN5A 5LHGA 5B2JD 2PYOC 5B2JB 4QPOA 2NZDC 5J8FA 2MH2A 1S7AA 1X2MA 5BNGA 3W96A 2J5OA 3TU4A 1FBQA 4YIFA 3S17J 2CQQA 2OCEA 1UHMA 1MNMC 2E2IJ 5B24B 4UPKA 2ZY5A 1Y39A 1YJNI 3CDIA 2JRTA 4CA0A 2PYOB 1MH3A 2Q1ZB 3HRSA 2CUEA 3BJ6A 4S0HB 3CCVI 4AWLB 1YLFA 2EJRA 3RI4A 2B7EA 3AZID 2OC6A 1U3EM 5JRGA 3RYPA 3TQNA 1WWIA 4Y13A 1Z6RA 4BXUA 1J59A 2VJ4A 1TQIA 5AVBD 3EPLA 2OD5A 2X0LA 4E7HA 5EEGA 3WA9B 2IS1A 4AYBN 3RTRA 4BQAA 3W96C 1OYIA 2HGCA 1Q1VA 4C2TA 2AQEA 2MC4A 4XLPF 5EGOA 2KPMA 2GOXB 2XGDA 3UKGA 2D45A 2Q0OA 1D3YA 3KYDB 5CVRA 3WG9A 1JE8A 3ZQGA 2G0EA 2IAIA 1UFMA 5LGTA 5L3CA 3GLLA 3IKVA 3W98C 1P3FB 1QPMA 2R7TA 1RR8C 1X1DA 3ABMH 2JA8J 3MGQC 3ZRGA 4M73A 3QPHA 2QKMB 4I76A 3OYHA 2BYMB 2L9RA 1TWGJ 4B09A 4AVZA 3OYIA 1YIOA 4M3BA 3LJAA 4NE3A 1FMWA 1YHQI 3SDGA 4B8XA 3T1BA 3UT9A 3CESA 2Y2QA 4KUDD 3E1SA 4CCKA 1SMTA 4L9VA 4C2MJ 2X6OA 4XUJA 4KUDB 4U87A 5CPJB 1ZQ3P 1OCRH 2GQQA 2OZ6A 1YG2A 3LSPA 3C3WA 4BY1J 2QVOA 2LC2A 1KQ9A 4A3LJ 1RC9A 1OYWA 5E3MA 3GFIA 2R7VA 4IHVA 2ELKA 3K9TA 2K3FA 1Y8QB 5JLWA 1HBXG 1VQKI 1D0XA 3K1NA 3MGRD 3ZCOA 1M19A 3M8JA 4H9QA 1P34B 3F8FA 2EQRA 5D5UB 5B32D 1U5TA 3TMOA 3QYEA 2STWA 4ZYGA 3O62D 3AN2A 3HPHA 2BW3B 2EZIA 1YX5A 2P5VA 3W2VA 3LSMA 4A69C 2P5LC 2BE5F 2XDVA 3K2AA 3H0RC 4M3GA 4AIJA 4N9IA 3QPTA 3HKZA 1LE8A 4H9NB 3CCSI 5AV9D 2AHQA 1REPC 2F48A 2I10A 2XAHA 3HSRA 3S2WA 4IZZA 5DNMD 5ICGA 3K10A 4MHGA 3WHBA 4KFCA 1SD6A 5IPAA 1UAAA 4BS9A 1IDYA 5JHUA 3MGPA 3AN2B 1IRGA 1P3KD 1GVDA 2JRMA 3CCJI 1TAFB 2K9LA 5B3SH 3VPRA 4DZPA 5JA4B 3C1BD 4LIUA 3C1BB 2CJJA 1KQ0A 3WE3A 2PFBA 3BJAA 3WU0A 3IV5A 3G6EI 3TEDA 1YI2I 3BDDA 2Z2SB 3B6FA 1J5YA 3LZ1D 1VQOI 3AZED 5FUGA 1FC3A 4GYGA 3AZJC 3MVDA 1LNWA 4MNUA 5HLTA 1XN7A 2M7BA 2IBDA 3JAMZ 4A5NA 4EQQA 1P3IC 2NNNA 1XB4A 1OKRA 2FNPA 4QLCB 3TO9A 4XZQD 4P96A 4RB2C 2FJ7B 3HBLA 4HW0A 2ZXJA 5IOZA 2YU9J 2EZHA 3HSEA 1D1CA 1OCCH 4WWCA 1ZRCA 3D5SC 3K4JA 1N1JA 3JRGA 5FJ8J 3MNNA 3WTPA 5GTIC 2IVMA 3MGSC 2MBFA 1M18B 1IDZA 2HPMA 1P3ID 4ZYHA 3JCUC 4E7JA 3A01A 3JRCA 4AM3A 4R8PB 1P3PC 3QWLA 2NQBD 1FOWA 2KKOA 4MTEA 4DBQA 3REHD 2DFHA 2HXIA 3ECHA 1T0FA 4NC8A 5F04A 1RUNA 5B0ZC 4UB6C 2UWMA 3FISA 4WU9D 2AQFA 3IP4B 4LG3A 3G1MA 3TU4D 1JFIA 2VB6A 1S7OA 4LB6B 3PSIA 1CGPA 4UNOA 2QWWA 2O3FA 5FLXZ 4HX8A 4CCLA 4G12A 1G3SA 1UHSA 2HWVA 2HYGD 3AZKC 3WTPC 2IPQX 4KA4A 3ZMSA 3PM1A 5J40A 4RB1A 1JI8A 1W7PB 3UR3C 4J8XB 2IA0A 4A3IJ 3KLOA 1TT5B 3Q0UA 3AZNB 3DCFA 4OIPF 2YX7A 1SANA 2QKLB 2YFVB 4GYIA 2FQ3A 2LVSA 2KJCA 1TWCJ 3F23A 1AWCA 2VODA 3REJB 4ZUXC 1FOXA 1BH8A 2ME6A 3P9KA 3X1TB 2DI3A 3DBLB 3I4MJ 2LKXA 1Z05A 1FYLA 3UTBD 4KMUX 5CPKB 3BR2A 3HL2A 3UTAC 4XLFA 1D1AA 1I6HJ 4J8XA 4G94A 2G5IC 1AKHB 2XC7A 3KSYA 1SC7A 4ESBA 2HVSA 2FMYA 1YITI 1I50J 1KONA 5K5RA 1HQ3D 3SFIA 4PJJA 1SFXA 4ZZDA 3I0TA 3LA3A 5AIPA 2RVQD 1LFUP 3FDDA 3LELC 2VL8A 3LJAD 1L3LA 3AL0B 3LSKA 1FYMA 2Y9ZA 1ETKA 3UT9D 5BT1D 3HJEA 1XS9A 2KDZA 1ZK8A 5D5XB 3D5RC 1Q9CA 2EPFA 2NZDA 3BTLA 2F8NK 5AV5A 3JRIA 3EPHA 1F9NA 2QYOA 1V5GA 2ZXWH 3JREA 2ZC2A 2V26A 3AG2H 4FHTA 3GTKJ 2M1BA 3D0SA 1T0FC 4U7BA 2M5WA 2JTVA 3AZGB 2KDOA 2L02A 4A3CJ 1BBYA 1DPRA 1TNTA 2W84A 2QQ9A 3Q9SA 1T39A 4IHXA 2E5NA 2CV0A 3I64A 3TU4B 4CYDA 1FJLA 4XKWA 1P4AA 3PFYA 2GXBA 2R7WA 1U8RA 5AVCA 2OJED 2W7NA 3AV1C 3BR6A 2DBBA 2NZDB 2F4IA 3JTGA 4XLCA 4DQ2A 4E44A 1KX4A 2GWRA 3IRQA 1K7AA 4BBSJ 2O6GE 2AXLA 1JHHA 5IT9K 5KK1A 3PO3J 3BJOA 5DNND 3VH6W 5AVBC 2HVRA 4BJ6C 1X3WB 4B3XA 1EJ9A 3A1KA 2Y2OA 3CUQB 1J2XA 1GHCA 5LHIA 3I3LA 1Y0UA 3EPKA 3FXOA 5DTDA 1EQZD 1VZ0A 3AFHA 1Z7UA 4Z5TD 3W98A 1J7KA 5CVIA 4LMYA 2CFXA 3V8LA 1T08B 4NE6A 1TQMA 2V6CA 3REOA 4J8XC 2LG4A 3W99C 2OAZA 2M8GX 1KYWA 1Y1WJ 1M1AD 3J7ZI 2QZ8A 2B63J 1SVOA 2XF7A 2R7ZJ 1ZLAA 4LJZF 4F55A 1SEUA 1TWAJ 2UUZA 3RELA 1QVTA 2XGEA 1MSEC 3WTPE 4JQFA 3CC2I 2F8NB 2BYMA 3X1UA 4EO5C 5B33D 1HQCA 2EWNA 5D8LB 3LJAB 4WU8C 3M3YJ 3JRAA 1EKEA 3JRBA 3AZLC 3W6JB 4A2UA 3G3ZA 2JA7J 2DMTA 2E1MB 2F8NH 3F8MA 2F8NG 1N25A 1T33A 2M3AA 2W25A 2CW7A 5ICEA 1I39A 2HZDA 4D1QA 4XBFA 3JRHA 4N4NB 1S32C 2E1MC 3NARA 3MNND 1E2XA 3BC8A 2HDCA 2L5AA 1ETYA 1OPCA 2FE3A 3BG5A 4NNJA 1VQ4I 4EO5B 4WU8B 2DN0A 1BR1A 5E20A 3ABLH 4XONA 4CYCB 1S72I 1B72B 1ZRFA 2WWYA 1RETA 4YG2F 3W96D 1BM9A 1H88C 3LZ1C 3E3VA 4U0WA 1F66C 3J7YJ 3CTAA 3HRTA 3H5AA 5GXQD 2FU4A 3L00A 1RR7A 4YM6B 2WC2A 2HPIA 3HC7A 2Y0MA 2LOOA 3JTHA 2CRGA 1WJFA 2IJLA 4XOPA 5BOXA 4LLNA 3GBGA 4II2A 3GEZA 1Z6TA 4A6DA 3LA7A 1TW3A 3K0LA 4E7ZA 3F21A 4CYCA 2BG1A 3H5RA 1CF7B 5DUIA 3ZQFA 4WCGA 3OYMA 2PJPA 2Y2JA 3WA9A 4DYRA 2L7FP 3N05A 2D1VA 3PIOF 3IKTA 2R92J 3C1BC 4LG0A 1IAWA 1U35D 3LQQA 4GDFA 4AWXB 1UJ8A 1WJBA 1P3AD 5H6RA 1MDMA 5B0YC 2L0KA 2IW5A 1YJ9I 2VQLA 3I56I 1Z7LA 4FETA 1MH4A 1RKTA 3X1VA 2EFOA 2QSGX 2LLKA 1YW8A 3WKJC 3S2HJ 1B6AA 5E5AA 3P9CA 5C3IC 2W57A 3W2WA 2EBIA 4RAZA 2MLGA 1C0WA 1OCPA 2DFEA 5GT3B 4ZJZA 1QPIA 2ZBKA 4BQNA 2XIGA 4FX0A 5AV8A 1MDMB 3DKWA 5F0HA 1B8IB 2E1NA 4XKBA 3WU2C 4W1UA 4KUDA 3KETA 3O62B 1P3MD 5CPJA 4XUJD 3LFKA 2QENA 5BPIA 3H0GJ 2K5CA 4EVIA 4C3IJ 1JUMA 4XICA 2Z9OA 2IA1A 2QEXI 5DNMC 2JSCA 3JRFA 4M74A 1JKQC 3VWBA 2NVTJ 5GT3A 1R36A 5AV5D 1X3UA 2FOKA 3FIWA 4H9PB 4Z66B 5J1YA 3A01B 4Z66D 1WI3A 3WTZA 5B31B 1RNLA 4EM1A 5HNHA 3AZHD 4HA8A 5E8IA 3MGRC 5CPKD 1Z0XA 2R3SA 5JVGF 5FROA 1YW7A 4J8VA 2FA5A 1R4NB 2LR8A 4RLFA 4HNUA 1H8AC 4IF4A 5K7ZA 1OISA 3OL4A 2O8KA 5AY8D 3FBNB 4IJAA 2DQLA 2DYSH 3B73A 4EMSA 4LD9A 1E3OC 2X4HA 2NVXJ 3AZMD 2YS9A 1W7PA 4BAYA 1D8KA 4FCYA 3UT9C 5DNNA 4WJ3C 1F4KA 3AV2A 1ON1A 1TT0A 2VIXA 5GPAA 1G3YA 4M9ZA 4P5OA 4WF2A 2LF8A 5C4JJ 4ETSA 1PUFA 2HUEB 3CP8A 2WV0A 4Z5TA 3HHGA 2WB1N 3K4NA 4OIOF 2CV2A 5ILVA 1LEBA 1R5ID 3AG1H 4HLYA 2ADUA 2O8XA 3MD2A 5BS6A 2CQXA 3MVDB 1NHAA 3AZIA 2IGNA 1P4WA 5E17F 1K79A 2EIMH 1FY7A 3OL3A 1OCZH 1T56A 4L9JA 3E6DA 1MJBA 5B40A 3OYFA 3UTAA 3AYWB 1T8IA 1IV6A 4HF0A 1G59A 4ZZLA 3OYKA 3X1UD 1WH7A 2TRTA 3C2BA 2ZMEA 3JW4A 5EDNA 2E7WA 1V54H 5BT1C 2JK3A 1HSTA 1M1EB 3RKYA 2NNYA 1IJWC 2VLAA 1W2EA 2EFNA 1ETQA 2L7ZA 2V9VA 5JRGC 5LLQA 1VQLI 1P92A 2DK5A 5D6EA 3H0DA 1UELB 2LDUA 3BLYA 5JHFA 1TL8A 3REHA 4XMYA 4WXDA 2WAQA 5G49A 2OPTA 2GXAA 5E5AC 1FEXA 3VSLA 4S04A 4DIQA 2HZTA 3FBIB 4YELA 2D5VA 4Z2MH 3COAC 1KX4B 3REKC 3ZQ7A 3FDYA 1K78B 5TISC 1BW6A 3J7AY 2Y2ZA 5J47A 2XPVA 2PMZN 2VPLA 1XX5A 1XSXA 2EINH 4BHCA 4ZDPA 3AG3H 4H9SA 3HXLA 1OQYA 1SAUA 1HKTA 3WA9D 2H94A 3CJRB 3DQVC 3B6GA 2LYCA 3REJA 5JFRA 4A3BJ 1A7WA 3S1QJ 1FP1D 2NAZA 1ZGWA 5AV6C 2ZKZA 2KP6A 4I98B 1D0ZA 4ZUXD 4J8WC 2Q8KA 4JJNC 1MMNA 2K7LA 3AZMC 3HYIA 4V19K 2IT0A 1MD0A 2W85A 4BQQA 1IG7A 2F8NA 3I59B 2CWEA 2PG4A 5B1BH 1SFOJ 4C3HJ 5LRSA 2VOOA 4DQYB 2DDAA 3DLLF 2IXSA 2VBWA 4ABZA 2R5ZA 2HOEA 5HDKA 3RKQA 2QCOA 3BQZA 5L3BA 2ZB9A 1YQAA 1J75A 4XLEA 2NZDD 1WFXA 2DXIA 2KL4A 1AOYA 5BS7A 3LZ1A 3AZND 2R5YB 2L7MP 1YFHA 5AV9C 3AZEA 5ILUA 3MGSB 3OS0A 1KX5A 2EV0A 2JT1A 3DEUA 4MQ9F 1P34A 2KIQA 5M3FJ 3U9GA 1P3LC 3EYYA 4L5EA 3DPTA 5FKNA 4HSTA 4LK0F 2LD5A 5AVCD 2RKHA 1ZKGA 3DBHB 2YU3A 5B31C 1IW7F 2F5FA 4XN3A 3L2UA 2DA5A 2UXNA 3AV1D 5ERIA 5H6QA 3G73A 3AV1B 2DT6A 3AZJB 1P3LD 1RESA 3RSNA 2RREA 3VH5T 1W5SA 3TDUC 4J01A 1Z3XA 2DK8A 2NQBA 3DFGA 2JUGA 4FE7A 4H0EA 5B33C 2VJJA 1GV5A 3FM5A 3F6OA 3IWFA 4LGWA 4PUSA 2H1LA 2OTLI 2DMNA 3WTWC 2WAFA 4HX7A 1P3AC 5BQTA 3A6ND 3M8FA 5B0YD 3M1CA 2ISZA 1Z2CB 1WSUA 2D2WA 1UHWA 2VBZA 3KPHA 4G91C 3KP2A 3HTUA 3V7SA 5J6XA 5KVRA 5E3OA 1UG2A 3QPLA 3SZTA 4AU7A 1QU3A 3F0CA 4D9JA 1ZTRA 1UCRA 3TGNA 3NQUA 4KISA 1H3OB 2GBYA 4YIRX 1FPQA 3RJPA 1LB2A 2MLKA 2X6YA 1KX3C 1NG6A 1TWHJ 2KFDA 5F99C 2DA2A 2FMLA 2HQ5A 4RAGA 2HNHA 2JVGA 2E5ZA 1DGRM 5GAGJ 3BTJA 5B1AH 1IRFA 3F3XA 4XUJC 3GCMA 4BHPA 2BW3A 4AC0A 2HTSA 4PCQA 2KIMA 4AIDA 3LSTA 3TP3A 5FO5A 4CGZA 3DKYA 3UTBA 1W5TA 3BY6A 3V42A 3P5JB 3BZKA 3F8BA 3WAAB 1H3OA 1MBFA 4ZUXB 4FQGA 4WXHA 1IF1A 2DA4A 5A2QK 4ZYAA 4PJ0C 1I27A 2BHZA 3QYBA 3OOUA 4M6VA 3H92A 4BU2A 1K6OA 3W3CA 3G1OA 3KX2A 5B32B 2WV1A 3L2WA 2X85A 3G4SI 2P7VB 2WADA 4XOTA 3AZLA 4M72A 3OYLA 2R7FA 2JMWA 1VQ8I 2F5DA 5DCMA 3VSKA 1F66D 4ESFA 1QHHD 3ZGKA 1P3LB 1JGSA 4IHYA 2IO5B 1XG1A 2KZVA 2RNJA 2OV7A 2P81A 2H09A 2DCEA 4IKFA 2M0MA 5E79C 1IUYA 3B0BA 4BY7J 2EZLA 3IH2A 3KXBC 5C4XJ 3W2AA 4PSXA 1Z77A 4R8PC 3CCQI 1WWXA 2XSJC 1I3AA 1R58A 3VYTB 2QQAA 3REJD 3BPXA 1PUFB 2STTA 4BACA 3H9JA 2JE5A 3CF2A 1ETXA 1P3BD 2JCHA 4IRHA 2DFIA 2XB5A 3GVAA 4HF1A 4EM2A 1D5YA 1X2NA 1P6RA 2M9HA 3H0LC 5E5AD 5EEHA 1YJWI 3C1CC 5FLVA 4HYEA 1BR2A 5B66C 5L3DA 4NUBA 1M1AB 4NBQA 1OR7C 1SMYF 5AV8B 3JAMK 1ENHA 1GXQA 4IRGA 2KZGA 4PGGA 4H9OA 1KYZA 2UZKA 2H8WA 2XAJA 3TBIA 2ZNZA 3WGHA 2XB0X 1P3MA 3QAHA 4G9YA 2BZTA 3SHFA 1N77A 2JA6J 3A02A 4QTRA 3LNQA 2LY1A 5CP6C 3ZQCA 5BMZA 4J8VC 1A31A 3K1MA 3RQ4A 3CMAI 1MBEA 2PX9A 4JYKA 1M1AA 4GFBA 3M9AA 1RRJA 1ZLAD 4A3GJ 2BVMA 1Y0NA 1P9QC 3ECOA 4QLCC 1KX5D 3FXMA 1BH9B 4CZZA 1KX3D 3B6FC 4J8VD 2FFFB 5FLMJ 1I3QJ 4M3FA 1IO2A 2HDDA 2R7QA 2IRFG 3ZQHA 4L5IA 4HEA2 1ZYRF 1MIJA 3IUOA 4Y3OA 2PI0A 3EDPA 1QVUA 3QOPA 2MSYA 4HV5A 5AV8C 2EZKA 3DBRB 1W7PD 3ISPA 4H9RB 3MZ8A 1R49A 1Y56A 3OWTA 1YX3A 2EA2A 5JRGB 4HNVA 2VKEA 2O0YA 2HIOA 4X6AJ 3X1UC 3CMMA 2XSDC 2YPRA 1P3OB 2BHYA 4RDUA 2WAEA 2DODA 2Z99A 3RKXA 3FKIJ 4BGDA 2VONA 4Z5TB 4I99C 4A3EJ 3B0DB 4EATA 4B4CA 1A5JA 4G6QA 3GYHX 1YIJI 1EQZB 3R0JA 2XD1A 3PQKA 1S32B 4G8XA 1P4XA 3E5QA 3C2GA 2P0WA 1WCMJ 5FFXA 3MWMA 2PMUA 2LRDA 2XPUA 2RVQC 3H36A 3ZMTA 2MD5A 2IS2A 2GOMA 4PJLA 5AONA 3VODA 4D5FA 3QODA 1F5TA 3UTAB 3AYWA 2D1HA 1W5CC 2WTEA 2WY8Q 2CGPA 3ELKA 2L2OA 1HLVA 2XVCA 2NXNB 1IV8A 3L9FA 5LD2C 1U35A 2UXXA 2RN7A 4BKXA 2HXOA 2GLOA 4NHJA 5M5YJ 2ELHA 2W48A 3QOEA 5B24D 3W99D 3ZQLA 2XV4S 2VQCA 3ZN1A 1LDJA 2BGCA 4KUDC 1A36A 2BVLA 2FBKA 3LOCA 3OMYA 2JSPA 2K9QA 1TZYA 3GTJJ 3FX3A 3MNNB 2PJRA 3HOWJ 3WTPB 3FK7A 3DXJF 3WA9C 4JX4A 3ZOBA 4LIVA 3GUDA 3WAAC 2FSWA 1QRYA 2R7SA 1IXRC 2HOAA 2DQNC 2HQAA 2FJ7C 2W24A 3MKLA 1IC8A 1ID3B 1HKQA 1J9IA 1T3UA 4CDGA 1MGTA 3DEEA 4R8PA 2EIKH 1K6YA 5B31D 1JJ6C 3HSFA 1U6GA 5IP9J 1WH5A 1MBJA 4CICA 1CQTA 4MO7A 2E1OA 3BOQA 1TZLA 5IT9Z 5B2IA 3AZJA 3PL8A 1PYVA 2VE8A 4KIFA 5LGNA 2LBFB 1JKPC 2VQGA 2MW8A 2GM4A 2DU9A 3MKYB 1MMSA 4KGCA 3EUAA 4KUMA 2HQNA 3NQOA 4P55A 1A6IA 4BBRJ 2A5WA 1XPXA 4H9PA 2VT2A 4Z66A 3RELB 1QZYA 3OIQA 4GO1A 1LDKB 3X1UB 1FIPA 3Q5FA 3KXBA 1BA5A 1TBXA 4BE2A 3AZHA 2DA1A 2K02A 4UUVA 3DLAA 4XRFA 1DU6A 1SFEA 4RGXA 1ZRDA 3KWQA 3TO6A 9ANTA 1ZGAA 1ZHFA 1OLTA 4LK1F 3DPUA 3RCOA 1BH8B 5AY8A 1V5FA 3RELC 5FGMA 1GV2A 1DQUA 4YIIA 1VQ7I 1TQPA 3SQNA 4J8WD 3EUKL 4NFTA 3AZEC 4WU8A 3A1YA 2ZY2A 1DDNA 1J0RA 5B2JC 4YS3B 2Y2HA 1AKHA 3GTLJ 3MMYB 3TOAA 3LELD 1EV7A 3KWQB 3S93A 1R4MB 3QP6A 5IP7J 3AFAC 2OUMA 4Y7NJ 2F4MB 4OWRB 4W97A 3MN2A 3LAPA 2EIJH 2VC0A 2VBYA 1N78A 2VASA 4RS8A 3BTIA 1KU5A 1GT0C 1N1JB 1MBKA 2VOPA 3O8HA 3BQYA 4QLCA 1AOID 2EV5A 3TP0A 4EJTA 3NQJB 5AV9B 2BOLA 3T8RA 4WZSB 2EA4A 2ZJQF 4UUZB 3FF5A 3AV2C 3FM3A 1ON2A 2GIVA 4DRAA 2E35A 5E1ZB 5GSUC 3H3VK 1J09A 1R1VA 2W1OA 3G1LA 1KX3A 4A0YA 3I55I 3CCEI 2IS6A 3V4GA 3HHHA 4KIGA 2XAQA 3K2ZA 3L2RA 2GA1A 3OYDA 4C2UA 5HS7A 2J5PA 2ID3A 4CXFA 3AV1A 1JFIB 2MC3A 4D5CA 2LP0A 4KIBA 1PP7U 3T8TA 2M4KA 3E6BA 5FLXK 1QGPA 2E2JJ 1V55H 1BOAA 2KISA 3LA2A 2KRHA 3DKXA 3FKJA 4R1HA 2O61A 1LFBA 2KHMA 2EH3A 4G92B 4CCOA 3GTOJ 4EJUA 5GSUA 4A6EA 4QLCD 2ZM5A 1S6LA 3HEFA 1QZEA 2K9NA 4PZJA 5EG0B 1XGNA 4KNYA 4M6YA 1XMKA 3SYTA 4YRVA 2CUJA 4DJAA 3MGQB 1N75A 3ASOH 3KYLA 5JRGD 4BXFA 1FWZA 4Y4RA 4ZC3A 1USTA 1M18D 4X23C 1S9HA 2HVQA 4B3AA 3U21A 1BJAA 2P7CB 1XTAA 3AZFC 3AFAA 2CQKA 1WJCA 5DCFA 3AYWD 3B6GD 4ZTJA 5B32C 4OAZA 3EQLF 2OF7A 4E7LA 1USSA 4RGSA 2P6SA 2H6BA 2V79A 2XRLA 5BNVA 5AV5C 5L3FA 3REIB 2EK5A 3CQZJ 3E6CC 5F99D 2FUG2 5F27A 3EPJA 1T95A 1UB9A 3CJTB 1HW2A 1JKRC 3T0YA 2DTRA 3CMEI 2R7DA 2P6TA 1XDSA 2PLYA 4KDPA 2V1XA 3OYJA 4ZUXA 1QNTA 3LL7A 3AG4H 4MFEA 2VXZA 5B24A 1A04A 3R4KA 4ENMA 1NK2P 4BXXJ 3S32A 1TTYA 2Z5UA 3AFAB 1X1PA 3AZKA 4QLCU 2Z3YA 3GW2A 2F8ND 3SZPA 3ZN0A 4IRIA 1LFPA 2VI6A 3DU5A 2Y2NA 3AAFA 2IGKA 4IQ4A 1P3KC 1WRJA 4WNNA 4KJZA 3VH5A 2NS8A 5BNXA 4U7DA 2DA6A 1MMGA 4A3MJ 2DAOA 1KQ8A 1I5ZA 3ULQB 5AVCB 1LVKA 1OJLA 4L0ZB 1BJZA 1HDDC 3AZNA 3OIPA 1F1ZA 1YOVB 5B2ID
chains in the Genus database with same CATH topology
5FD6A 1XSDA 4I02A 2Q2EA 3L7WA 2TDXA 2DO7A 2XUBA 1SD4A 1U78A 2YSRA 3KFWX 1BC8C 3MAJA 4J8UB 3KXBD 1E17A 3AN2D 5K5OA 3OOPA 1ZARA 1YYVA 5KDMB 3A6NB 3QU6A 3K69A 3ZP5A 1B59A 1BFMA 3UT9B 2KJBA 4OMZA 3AZNC 1OR7A 2FF4A 4H9OB 3X1VB 1PUEE 1YO5C 1FSHA 1R5GA 1FX7A 3AZGD 2A5YB 3LAJA 4RB3C 3A6NA 2M87A 4EM0B 3LELA 3IHUA 3X1SB 1R22A 1IN7A 5E8GA 1KA8A 2E1CA 2EFPA 2GXGA 4Z66C 1BI0A 3B0DC 1EQZC 3WAAD 1QQIA 4Z5TC 4F7ZA 2Y48A 2C6YA 3RYRA 3F22A 1SD5A 1LQ1A 3P7NA 5AVBA 5DV5A 2RGVA 2ESNA 4ASNA 1P34D 3BROA 1ZG1A 2K4BA 1GXPA 3KP3A 4XUJB 2F5EA 4HX4A 5AY8C 1Z91A 5HOOA 5F99B 1IXCA 1G6NA 4EJWA 2L3DA 4KGCB 3P9IA 5B1LA 3TDZC 3WKJB 5D6FA 3LQRA 5LHHA 3B6FB 4WV4B 3REKB 1PP8F 1P3OC 1P3KB 2XGXA 4CAYA 5B0YB 4QWQA 1HW1A 4LG0B 1O7LA 1U35C 1F66A 4HV6A 4LFUA 3GO5A 5DCMB 3WTXC 3ERED 4QLCA 5CP6B 3W97D 5B1LB 2VN2A 3FZVA 3HTSB 3AZEB 3ZPLA 3CDHA 3LZ0C 4IXAA 5E5AB 1O3TA 4YFKF 2KIFA 1M18A 3MGRA 3VB2A 2H27A 2OZUA 3WGIA 4R79A 3GXOA 4HGAC 3EETA 3B0CT 1R00A 3HOSA 1XMAA 3BWGA 4OMYA 2Y2IA 1IN5A 1TW2A 3V9RA 5ICCA 2QBYA 4WU9C 1G3TA 1TZYD 4UUZA 3J80K 3K1PA 3AZKD 1R7JA 3F6TA 3F8CA 3GZ5A 5K1YA 4R8PD 2LY8A 3REHB 5B31A 4WX9A 4HF2A 1ZN2A 1BI2A 2BEOA 2UWXA 1RZ4A 3TO7A 2YFVA 3NEUA 1YTYA 1ZLKA 2QBYB 4M6XA 5B1MA 1ID3C 3X1SD 4I01A 5D4RA 4U88A 2JPBA 1WWSA 3B6FD 4OINF 4E70A 3REKD 5B0ZD 3TKYA 1R23A 2EFWA 4J8WB 1HSJA 5F1RA 3VFZA 3AV2B 1LJ9A 3HOTA 3X1SC 1JXSA 4I2OA 4LLGF 1HQ3C 2QQBA 4HLXA 5B31G 1S32D 4O6JA 4J8WA 2JPCA 1T38A 4H9RA 3FMSA 2G5HC 1P3IA 5CLSA 2XHKA 4HDVA 2HIOD 3KFUG 3KEQA 5DYMA 2GA2A 5DEQA 3AZGA 5BNVB 4M6BA 2L54A 4GXOA 3VEPA 3KUYD 5CPIB 3WE2A 3A1IA 1FLIA 4TV7A 5HDGA 1D5VA 5GT0C 1KX5B 1KX3B 5B33A 5E1XA 5B24C 1P3GB 2MA3A 2ZNYA 5C3IB 3CUQA 2PN6A 3ZMUA 5LEKA 3TOBA 3W99A 4G91B 1EH6A 3CO7C 1B67A 1FP2A 2XAFA 1ZLAC 4MGRA 1TZYB 4Z2YA 4J8XD 4Q47A 5CPKC 2BYKB 2Z33A 5HLGA 3ABTA 2ZO4A 5LRRA 2NQBB 5GXQA 1OYYA 1P3MB 5B40C 1SAXA 4I0AA 1S8NA 3GX4X 4RB0A 2ZCWA 5ILSA 5BS7C 3QU3A 2O03A 2MH9A 3HUGA 4XSXF 4I09A 1G4DA 4X23B 3F72A 4NB5A 1P2FA 2RV8A 5AV6A 2ACJA 1HTAA 3R45B 1WI9A 3I59A 2QLZA 3AZFD 2BV6A 1HKSA 4HDUA 3KWQD 4JJNB 1Q1HA 4ZBJB 4Y15A 4ZBJC 3X1TD 3H0MC 5AV6B 3ZMDA 4WU8D 5E18F 3MGSA 1JHFA 2AROD 5CVJA 1P3GD 5AV8D 4P9FA 2F2EA 5CVUA 3E5UA 1EQZA 4YM6D 5FFZA 4J8UD 3M1EA 3VOEA 1XGSA 3KUYC 1FBSA 1B4AA 1I1SA 4L9NA 3MGPC 2RC4A 3MCZA 4A12A 1AOIA 2ZY4A 2FNAA 3KP5A 3QP5A 2QM3A 1P3OD 5GXQC 3REKA 4UVCA 5B0ZA 4A5MA 2BYVE 4N9HA 4WXCA 1U35B 1T2KA 4G7ZF 1FBUA 2AS5F 4MEXF 2G7HA 5GT0A 3GZ6A 2YX4A 4ZYEA 4EGZA 3AN2C 2OU2A 3CJNA 4YS3C 3EYIA 2FEZA 5HS8A 3MEXA 4IHSA 5FUGB 3AZMA 4FT8A 4KGCC 3TU4C 5CJ9A 4JBAA 3AV2D 3ZMZA 5D5WB 2EB7A 1IN6A 5GSUD 5GT0B 2XKPA 2HEOA 3Q9VA 5LEJA 2CV5C 1BI1A 3MVDC 3FMRA 3KP6A 3B02A 1P3PA 4P9UA 1XGOA 4H9SC 4U0VA 3B6GC 3WAAA 5L3EA 3MGQA 2GZWA 4LD9B 4KT5C 2RQPA 5TJJA 3PFIA 1U5TB 3KXBB 3UTAD 1R1TA 3AZHB 1FSEA 1V4RA 1QBJA 3AZLB 3VH6T 3RPQA 5F99A 1BC7C 2NYXA 1P3AA 3W97C 4ENKA 2IO5C 4YFXF 2B0LA 4L0YB 1BIAA 1RUOA 4EJVA 3WTSC 4JJND 3OV8A 2ETHA 2H6CA 3X1TC 5CP6D 1PZRA 2PYOD 3W97B 3F8NA 3MNNC