2CWHA

Crystal structure of delta1-piperideine-2-carboxylate reductase from pseudomonas syringae complexed with nadph and pyrrole-2-carboxylate
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
332
structure length
332
Chain Sequence
TQTVSYPQLIDLLRRIFVVHGTSPEVADVLAENCASAQRDGSHSHGIFRIPGYLSSLASGWVDGKAVPVVEDVGAAFVRVDACNGFAQPALAAARSLLIDKARSAGVAILAIRGSHHFAALWPDVEPFAEQGLVALSMVNSMTCVVPHGARQPLFGTNPIAFGAPRAGGEPIVFDLATSAIAHGDVQIAAREGRLLPAGMGVDRDGLPTQEPRAILDGGALLPFGGHKGSALSMMVELLAAGLTGGNFSFEFDWSKHPGAQTPWTGQLLIVIDPDKGAGQHFAQRSEELVRQLHGVGQERLPGDRRYLERARSMAHGIVIAQADLERLQELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords delta1-piperideine-2-carboxylate reductase
publication title Crystal structures of Delta1-piperideine-2-carboxylate/Delta1-pyrroline-2-carboxylate reductase belonging to a new family of NAD(P)H-dependent oxidoreductases: conformational change, substrate recognition, and stereochemistry of the reaction
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Oxidoreductase
total genus 119
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 1.4.1.17: N-methylalanine dehydrogenase.
pdb deposition date 2005-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 2cwhA01
3.30.60.50 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Hypothetical oxidoreductase yiak; domain 3 2cwhA03
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 2cwhA02
1NXUA 1X0AA 2CWHA 3I0PA 1S20A 1WTJA 1XRHA 4FJSA 2G8YA 4FJUA 3UOEA 1V9NA 1VBIA 4H8AA 2CWFA 1Z2IA 2X06A
chains in the Genus database with same CATH superfamily
3R5CA 1BUSA 2E5LH 5BR8H 3UOEA 4LFAH 3TOAA 2QNDA 4EC5A 2HHHH 4OX9H 3TO9A 2DB6A 2YQPA 4OVOA 2ANNA 5EX3A 5C0XG 3FAUA 1KMAA 4LF6H 1WGCA 2GKTI 2F4VH 4AIMA 2BL5A 3KDKA 3SEKC 1J5EH 2OZUA 4NBQA 1WHRA 2CWFA 2N17A 1K7VA 3D00A 1VIGA 2LTLA 4UXJA 4B3MH 1PJUA 2QQCA 5E3RA 4WALA 1CT0I 2W0TA 1WTJA 1N32H 1DS3I 1XA6A 1FAQA 2O4CA 5LL6b 2G8YA 1RFHA 3BJIA 1TBRR 5E3PA 4B8CD 4E1PA 3U1KA 2VQEH 1PQXA 2A20A 1XMOH 2ERWA 4AMLA 1M8CA 1TBNA 3SGBI 4H8AA 1SGRI 2D9IA 1TUSA 4JI6H 1CHOI 1ODHA 4AQYH 4K0KH 2ARPF 2N71A 4FJSA 2KMQA 5A2QW 4A24A 1IBLH 3TOBA 2JYYA 4DR4H 3GABA 3OVOA 2SGPI 2V53A 3PDNA 7WGAA 1PTRA 1OMTA 1R79A 3I0PA 1ZZIA 3EZJA 4G08A 1SGPI 1NXUA 1J5KA 2X3TA 1P9GA 3R5AA 4E1RA 2JA9A 3E59A 4UXHA 4BA1I 1SGNI 2L7XA 1BMOA 2OU2A 3E2IA 1ULNA 1UVGA 4UXIA 5DAEA 2SGFI 9WGAA 4NXNH 4DUYH 2YUUA 1N34H 2CTKA 4JI7H 1S03G 1PTQA 2BUSA 4LF5H 1OVOA 2NU4I 1FYBA 1HJAI 1WVNA 3UGIA 2SGDI 1TOTA 4X62H 2OD1A 1FY7A 1PCEA 3VKEA 1V8CA 1XNRH 4DV6H 1HDLA 3J7AK 1DT4A 2Z0SA 4JI8H 4LF4H 5E3QA 1J4WA 3GOXA 2AXYA 2JZMA 4DR5H 4JI2H 1AN1I 2ENZA 3GR5A 4JI4H 1HPTA 1FARA 2VQFH 3OXLA 1R0RI 1IW4A 3R5DA 4GI3C 2V1CC 1ULMA 1X4NA 4JVHA 3OSSD 2QQDA 1YTPA 4B6DA 3NCVA 1KBFA 2UXDH 4WP4A 4E9JA 4JI0H 2JW6A 2ROWA 3T1YH 1TGSI 4PDBA 4LIJA 4GKJH 2PQ8A 2DKVA 2XRCA 3UGDA 2M8WA 2NN6G 3FSXA 1DS2I 1XBTA 2B0UC 1K1GA 3OETA 1XMQH 2ORVA 3OL0A 5FUWA 5IT9W 2P2RA 2VKCA 2M6QA 2KCXA 2UZ3A 2ENNA 3JAMW 2HH2A 1KBEA 4LF9H 2CJSC 2E5RA 1HEVA 4LFBH 2RIJA 1CT2I 2UUAH 2UVOA 1XNQH 1LR7A 4JI1H 1PPFI 4B3TH 1LR9A 3QAHA 2FMRA 4DV7H 1F0XA 2E73A 1N33H 1VBIA 5J8FA 3FSYA 3OXGA 3FC3A 4DR7H 2Y0MA 2JEAI 1IBMH 1UHAA 4OO1G 2LTMA 5FUVA 4DV2H 1V1HA 3R5BA 1YU6C 4OCHA 2ORWA 4JI3H 1CGII 1I94H 2QQ0A 1WKXA 2CWHA 3KDGA 3OTOH 3VE5A 4JCVE 1SGYI 1OMUA 1ZTGA 1MJBA 5K36G 1SGDI 2M5XA 1X4MA 2X52A 1ZZKA 1TBQR 5LMUH 4WANA 2NU1I 4LFCH 1DTJA 4JVYA 3RU0A 5J8CA 1ZZJA 4OD6A 3UEYA 3CXLA 2K9HA 1UVFA 3TO6A 2DGRA 4DR1H 3SB1A 4DV4H 1W3SA 5FLXW 2KMPA 2KMRA 2LRRA 2GKRI 2A1SA 4LF7H 2VRWB 5LMNH 1CT4I 1MT1A 1AN7A 3T1HH 4X64H 2B8TA 2UUCH 1W4RA 2ANRA 1K7TA 1Z7KB 2JXDA 2CTMA 3VDPA 2UXBH 3UEJA 4SGBI 2CTFA 1X9ZA 1WGTA 4GKKH 2UU9H 1TURA 3RF2A 2GKVA 1TIHA 1EC6A 1IY5A 2LUYA 2ZQEA 1K7UA 1HNWH 1FJGH 3MEKA 2PQUA 1CE3A 4FJUA 1UUCA 4BA2I 3HH2C 2X06A 5FUXA 5CCLA 4KHPH 3QTLD 2SGEI 1MJ9A 1VIHA 1OYVI 2ZM6H 5JEAG 1S20A 1UG8A 2CTJA 3OXFA 3J81W 1X4SA 1KHMA 2PY9A 1HNZH 4JI5H 1V9NA 3TO7A 4B3RH 3UFFA 4DR2H 4DNCA 3QD7X 4FKDA 4YHHH 4HGUA 1X74A 1P9ZA 4YY3H 5DT9A 2LF0A 4NXMH 1NUBA 2OVOA 1N36H 2JZXA 1U5KA 4AM3A 3J80W 2V1CA 4DUZH 1SGQI 2MJHA 4JYAH 2E3UA 2KMOA 2K1HA 2JVZA 2DIPA 3UGLA 4IFDG 4DV5H 1Y8FA 4DV0H 2YQRA 1H0ZA 2JE6I 1M8BA 3QWPA 2QPOA 1Y1CA 3KY9A 2NU0I 2NU2I 1Z2IA 4QMFB 2Y3MA 2J87A 5HQ8A 1FKAH 2CWGA 2WVJA 2OPUA 2QQEA 2ODDA 2BA0A 1V1IA 4DR3H 1N13A 3GKUA 2CTEA 2SGQI 4DV1H 2LB7A 4LF8H 2P6AC 2CPMA 4NZTM 1IBKH 3AEVB 2OPVA 1SGEI 1SEIA 2WGCA 1VDDA 1MSZA 4JV5H 2ELIA 1ULKA 2L8EA 1HNXH 1LR8A 2NU3I 2PT7G 2GVIA 2UUBH 1TBOA 2N1AB 5FUYA 1XX6A 4DR6H 5HI7A 4MPIA 1WE8A 4DV3H 3VDUA 1MJAA 5CCMA 2HH3A 1CGJI 3TJQA 2GIVA 2FNFX 2RC4A 4X66H 3V69A 4L9MA 4X65H 4B8TA 5EX0A 1HR0H 1Q9BA 3SGQI 2JA1A 2CTLA 2FPHX 2WCYA 1I6UA 2JEBI 1X0AA 1XRHA 2J9RA 5JHWC 2UXCH 1Y1BA 2LEOA 3B4VC 2F3CI 1IY6A 5IWAH 3L7ZC 4NZRM 4B3SH 2N52A 2CPQA 1CSOI 2FFMA 1TUAA
chains in the Genus database with same CATH topology
1NXUA 1X0AA 2CWHA 3I0PA 1S20A 1WTJA 1XRHA 4FJSA 2G8YA 4FJUA 3UOEA 1V9NA 1VBIA 4H8AA 2CWFA 1Z2IA 2X06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NXU A;  1X0A A;  2CWH A;  3I0P A;  1S20 A;  1WTJ A;  1XRH A;  4FJS A;  2G8Y A;  4FJU A;  3UOE A;  1V9N A;  1VBI A;  4H8A A;  2CWF A;  1Z2I A;  2X06 A; 
#chains in the Genus database with same CATH topology
 3R5C A;  1BUS A;  2E5L H;  5BR8 H;  3UOE A;  4LFA H;  3TOA A;  2QND A;  4EC5 A;  2HHH H;  4OX9 H;  3TO9 A;  2DB6 A;  2YQP A;  4OVO A;  2ANN A;  5EX3 A;  5C0X G;  3FAU A;  1KMA A;  4LF6 H;  1WGC A;  2GKT I;  2F4V H;  4AIM A;  2BL5 A;  3KDK A;  3SEK C;  1J5E H;  2OZU A;  4NBQ A;  1WHR A;  2CWF A;  2N17 A;  1K7V A;  3D00 A;  1VIG A;  2LTL A;  4UXJ A;  4B3M H;  1PJU A;  2QQC A;  5E3R A;  4WAL A;  1CT0 I;  2W0T A;  1WTJ A;  1N32 H;  1DS3 I;  1XA6 A;  1FAQ A;  2O4C A;  5LL6 b;  2G8Y A;  1RFH A;  3BJI A;  1TBR R;  5E3P A;  4B8C D;  4E1P A;  3U1K A;  2VQE H;  1PQX A;  2A20 A;  1XMO H;  2ERW A;  4AML A;  1M8C A;  1TBN A;  3SGB I;  4H8A A;  1SGR I;  2D9I A;  1TUS A;  4JI6 H;  1CHO I;  1ODH A;  4AQY H;  4K0K H;  2ARP F;  2N71 A;  4FJS A;  2KMQ A;  5A2Q W;  4A24 A;  1IBL H;  3TOB A;  2JYY A;  4DR4 H;  3GAB A;  3OVO A;  2SGP I;  2V53 A;  3PDN A;  7WGA A;  1PTR A;  1OMT A;  1R79 A;  3I0P A;  1ZZI A;  3EZJ A;  4G08 A;  1SGP I;  1NXU A;  1J5K A;  2X3T A;  1P9G A;  3R5A A;  4E1R A;  2JA9 A;  3E59 A;  4UXH A;  4BA1 I;  1SGN I;  2L7X A;  1BMO A;  2OU2 A;  3E2I A;  1ULN A;  1UVG A;  4UXI A;  5DAE A;  2SGF I;  9WGA A;  4NXN H;  4DUY H;  2YUU A;  1N34 H;  2CTK A;  4JI7 H;  1S03 G;  1PTQ A;  2BUS A;  4LF5 H;  1OVO A;  2NU4 I;  1FYB A;  1HJA I;  1WVN A;  3UGI A;  2SGD I;  1TOT A;  4X62 H;  2OD1 A;  1FY7 A;  1PCE A;  3VKE A;  1V8C A;  1XNR H;  4DV6 H;  1HDL A;  3J7A K;  1DT4 A;  2Z0S A;  4JI8 H;  4LF4 H;  5E3Q A;  1J4W A;  3GOX A;  2AXY A;  2JZM A;  4DR5 H;  4JI2 H;  1AN1 I;  2ENZ A;  3GR5 A;  4JI4 H;  1HPT A;  1FAR A;  2VQF H;  3OXL A;  1R0R I;  1IW4 A;  3R5D A;  4GI3 C;  2V1C C;  1ULM A;  1X4N A;  4JVH A;  3OSS D;  2QQD A;  1YTP A;  4B6D A;  3NCV A;  1KBF A;  2UXD H;  4WP4 A;  4E9J A;  4JI0 H;  2JW6 A;  2ROW A;  3T1Y H;  1TGS I;  4PDB A;  4LIJ A;  4GKJ H;  2PQ8 A;  2DKV A;  2XRC A;  3UGD A;  2M8W A;  2NN6 G;  3FSX A;  1DS2 I;  1XBT A;  2B0U C;  1K1G A;  3OET A;  1XMQ H;  2ORV A;  3OL0 A;  5FUW A;  5IT9 W;  2P2R A;  2VKC A;  2M6Q A;  2KCX A;  2UZ3 A;  2ENN A;  3JAM W;  2HH2 A;  1KBE A;  4LF9 H;  2CJS C;  2E5R A;  1HEV A;  4LFB H;  2RIJ A;  1CT2 I;  2UUA H;  2UVO A;  1XNQ H;  1LR7 A;  4JI1 H;  1PPF I;  4B3T H;  1LR9 A;  3QAH A;  2FMR A;  4DV7 H;  1F0X A;  2E73 A;  1N33 H;  1VBI A;  5J8F A;  3FSY A;  3OXG A;  3FC3 A;  4DR7 H;  2Y0M A;  2JEA I;  1IBM H;  1UHA A;  4OO1 G;  2LTM A;  5FUV A;  4DV2 H;  1V1H A;  3R5B A;  1YU6 C;  4OCH A;  2ORW A;  4JI3 H;  1CGI I;  1I94 H;  2QQ0 A;  1WKX A;  2CWH A;  3KDG A;  3OTO H;  3VE5 A;  4JCV E;  1SGY I;  1OMU A;  1ZTG A;  1MJB A;  5K36 G;  1SGD I;  2M5X A;  1X4M A;  2X52 A;  1ZZK A;  1TBQ R;  5LMU H;  4WAN A;  2NU1 I;  4LFC H;  1DTJ A;  4JVY A;  3RU0 A;  5J8C A;  1ZZJ A;  4OD6 A;  3UEY A;  3CXL A;  2K9H A;  1UVF A;  3TO6 A;  2DGR A;  4DR1 H;  3SB1 A;  4DV4 H;  1W3S A;  5FLX W;  2KMP A;  2KMR A;  2LRR A;  2GKR I;  2A1S A;  4LF7 H;  2VRW B;  5LMN H;  1CT4 I;  1MT1 A;  1AN7 A;  3T1H H;  4X64 H;  2B8T A;  2UUC H;  1W4R A;  2ANR A;  1K7T A;  1Z7K B;  2JXD A;  2CTM A;  3VDP A;  2UXB H;  3UEJ A;  4SGB I;  2CTF A;  1X9Z A;  1WGT A;  4GKK H;  2UU9 H;  1TUR A;  3RF2 A;  2GKV A;  1TIH A;  1EC6 A;  1IY5 A;  2LUY A;  2ZQE A;  1K7U A;  1HNW H;  1FJG H;  3MEK A;  2PQU A;  1CE3 A;  4FJU A;  1UUC A;  4BA2 I;  3HH2 C;  2X06 A;  5FUX A;  5CCL A;  4KHP H;  3QTL D;  2SGE I;  1MJ9 A;  1VIH A;  1OYV I;  2ZM6 H;  5JEA G;  1S20 A;  1UG8 A;  2CTJ A;  3OXF A;  3J81 W;  1X4S A;  1KHM A;  2PY9 A;  1HNZ H;  4JI5 H;  1V9N A;  3TO7 A;  4B3R H;  3UFF A;  4DR2 H;  4DNC A;  3QD7 X;  4FKD A;  4YHH H;  4HGU A;  1X74 A;  1P9Z A;  4YY3 H;  5DT9 A;  2LF0 A;  4NXM H;  1NUB A;  2OVO A;  1N36 H;  2JZX A;  1U5K A;  4AM3 A;  3J80 W;  2V1C A;  4DUZ H;  1SGQ I;  2MJH A;  4JYA H;  2E3U A;  2KMO A;  2K1H A;  2JVZ A;  2DIP A;  3UGL A;  4IFD G;  4DV5 H;  1Y8F A;  4DV0 H;  2YQR A;  1H0Z A;  2JE6 I;  1M8B A;  3QWP A;  2QPO A;  1Y1C A;  3KY9 A;  2NU0 I;  2NU2 I;  1Z2I A;  4QMF B;  2Y3M A;  2J87 A;  5HQ8 A;  1FKA H;  2CWG A;  2WVJ A;  2OPU A;  2QQE A;  2ODD A;  2BA0 A;  1V1I A;  4DR3 H;  1N13 A;  3GKU A;  2CTE A;  2SGQ I;  4DV1 H;  2LB7 A;  4LF8 H;  2P6A C;  2CPM A;  4NZT M;  1IBK H;  3AEV B;  2OPV A;  1SGE I;  1SEI A;  2WGC A;  1VDD A;  1MSZ A;  4JV5 H;  2ELI A;  1ULK A;  2L8E A;  1HNX H;  1LR8 A;  2NU3 I;  2PT7 G;  2GVI A;  2UUB H;  1TBO A;  2N1A B;  5FUY A;  1XX6 A;  4DR6 H;  5HI7 A;  4MPI A;  1WE8 A;  4DV3 H;  3VDU A;  1MJA A;  5CCM A;  2HH3 A;  1CGJ I;  3TJQ A;  2GIV A;  2FNF X;  2RC4 A;  4X66 H;  3V69 A;  4L9M A;  4X65 H;  4B8T A;  5EX0 A;  1HR0 H;  1Q9B A;  3SGQ I;  2JA1 A;  2CTL A;  2FPH X;  2WCY A;  1I6U A;  2JEB I;  1X0A A;  1XRH A;  2J9R A;  5JHW C;  2UXC H;  1Y1B A;  2LEO A;  3B4V C;  2F3C I;  1IY6 A;  5IWA H;  3L7Z C;  4NZR M;  4B3S H;  2N52 A;  2CPQ A;  1CSO I;  2FFM A;  1TUA A; 
#chains in the Genus database with same CATH homology
 1NXU A;  1X0A A;  2CWH A;  3I0P A;  1S20 A;  1WTJ A;  1XRH A;  4FJS A;  2G8Y A;  4FJU A;  3UOE A;  1V9N A;  1VBI A;  4H8A A;  2CWF A;  1Z2I A;  2X06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...