2CWHA

Crystal structure of delta1-piperideine-2-carboxylate reductase from pseudomonas syringae complexed with nadph and pyrrole-2-carboxylate
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
332
structure length
332
Chain Sequence
b'TQTVSYPQLIDLLRRIFVVHGTSPEVADVLAENCASAQRDGSHSHGIFRIPGYLSSLASGWVDGKAVPVVEDVGAAFVRVDACNGFAQPALAAARSLLIDKARSAGVAILAIRGSHHFAALWPDVEPFAEQGLVALSMVNSMTCVVPHGARQPLFGTNPIAFGAPRAGGEPIVFDLATSAIAHGDVQIAAREGRLLPAGMGVDRDGLPTQEPRAILDGGALLPFGGHKGSALSMMVELLAAGLTGGNFSFEFDWSKHPGAQTPWTGQLLIVIDPDKGAGQHFAQRSEELVRQLHGVGQERLPGDRRYLERARSMAHGIVIAQADLERLQELA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords delta1-piperideine-2-carboxylate reductase
molecule tags Oxidoreductase
source organism Pseudomonas syringae pv. tomato
publication title Crystal structures of Delta1-piperideine-2-carboxylate/Delta1-pyrroline-2-carboxylate reductase belonging to a new family of NAD(P)H-dependent oxidoreductases: conformational change, substrate recognition, and stereochemistry of the reaction
pubmed doi rcsb
total genus 119
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 1.4.1.17: N-methylalanine dehydrogenase.
pdb deposition date 2005-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 2cwhA01
3.30.60.50 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Hypothetical oxidoreductase yiak; domain 3 2cwhA03
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 2cwhA02
1Z2IA 1NXUA 1X0AA 1VBIA 1V9NA 2G8YA 2CWFA 2CWHA 4FJUA 1S20A 2X06A 1XRHA 4FJSA 3UOEA 4H8AA 3I0PA 1WTJA
chains in the Genus database with same CATH superfamily
2VRWB 2KCXA 2CWHA 3OXLA 2XRCA 1HNXH 4YHHH 2YQPA 2SGDI 4JVHA 5E3QA 4E1RA 5LMUH 4LF9H 2KMRA 2M6QA 4FKDA 4A24A 4L9MA 5FUWA 3VDPA 1OMTA 1N32H 1X4MA 5DAEA 2ANRA 3QTLD 2ENNA 4LF4H 2QPOA 2E3UA 2Y0MA 4JI8H 2CTJA 2ORVA 3QD7X 2N71A 3NCVA 4OCHA 1N34H 2UZ3A 2JZXA 4E1PA 4WP4A 1I6UA 2PY9A 4LFAH 2QQCA 2ANNA 4JCVE 1KMAA 1HJAI 3VE5A 3B4VC 2D9IA 3KDKA 3T1YH 3OXGA 4LF6H 2OZUA 2SGFI 1WVNA 1IY5A 4LF7H 1Z2IA 1CT0I 2SGPI 5J8CA 2LEOA 5EX3A 5IT9W 3AEVB 3VKEA 2O4CA 2CTFA 3GABA 1XNRH 2LTLA 4LFCH 1S20A 3TO7A 3OVOA 4UXJA 4JV5H 4JI4H 2CTLA 5BR8H 2L8EA 1PJUA 1YTPA 3TOBA 1YU6C 2WVJA 2YQRA 4LIJA 1SGNI 3FAUA 4AIMA 2DGRA 2L7XA 1PTRA 2NU4I 3OETA 2FPHX 2CWFA 1MT1A 2LRRA 1J4WA 1U5KA 2QQ0A 3KY9A 2B8TA 3OL0A 3KDGA 1X9ZA 2X52A 3UGDA 4GI3C 1LR7A 3FC3A 1CE3A 1SGRI 2Y3MA 2UUBH 1KBFA 2UVOA 4OX9H 1SGEI 1J5EH 4WALA 2FMRA 1VBIA 2F4VH 4YY3H 4HGUA 2UXDH 1K7VA 1J5KA 2BL5A 4IFDG 3E2IA 1BUSA 5LMNH 1S03G 2ZQEA 3OSSD 1P9GA 1IBKH 5FLXW 3QAHA 1WKXA 2GKTI 4DR1H 3PDNA 2V1CA 3TOAA 1HPTA 1WHRA 3R5BA 4DUYH 4DV7H 2W0TA 1F0XA 1PPFI 1TBNA 3V69A 2F3CI 2OU2A 2QQDA 1FAQA 1IBMH 4B6DA 2DKVA 4AQYH 2ENZA 2P2RA 2SGQI 5LL6b 5E3RA 3RF2A 3TJQA 1SGYI 2B0UC 1CSOI 5FUXA 3D00A 3J80W 3GR5A 3R5DA 1I94H 1VIHA 2AXYA 4NZTM 2JYYA 4NXNH 2N1AB 1ZZIA 5CCLA 4FJSA 1UG8A 5JHWC 2CWGA 4BA1I 1KBEA 2KMOA 4LF5H 4DR4H 2X06A 2ZM6H 2ODDA 2CTMA 5HI7A 1Y1CA 2GKVA 4AM3A 5JEAG 1PTQA 2JEAI 1MJBA 5CCMA 1HDLA 4GKJH 1OVOA 1DTJA 1CGII 4DR3H 2DIPA 9WGAA 2UXBH 2P6AC 1DS2I 1Y8FA 3T1HH 1ZTGA 4GKKH 2CPQA 1TUSA 2K9HA 1XNQH 1HR0H 1K7TA 1FYBA 1MSZA 5A2QW 2HH2A 1N33H 5IWAH 1M8CA 4DV6H 2A1SA 1AN7A 4B3RH 2SGEI 4JI7H 1Z7KB 2LTMA 4OO1G 7WGAA 1AN1I 1N13A 4K0KH 2LUYA 4LF8H 1HNWH 2E73A 3GOXA 1OYVI 1TUAA 4E9JA 1SGPI 2JA1A 1MJAA 1V1HA 2JEBI 2CTEA 1TBQR 2WCYA 3HH2C 4JI1H 5HQ8A 2E5LH 1R79A 3E59A 4X64H 5FUYA 1SGQI 3MEKA 3OXFA 2PQUA 5C0XG 1NXUA 4DV1H 4QMFB 3FSXA 1MJ9A 4OD6A 2G8YA 3R5AA 1X4SA 4NXMH 2NU3I 3GKUA 3I0PA 3OTOH 4DV2H 3U1KA 2GKRI 2LB7A 4B3MH 1IY6A 4DNCA 4OVOA 2J9RA 4B8TA 1SGDI 1DS3I 1WGCA 3UGIA 4NZRM 1UVFA 2Z0SA 4JI2H 4NBQA 2CTKA 2RIJA 1EC6A 1K1GA 4DR2H 1UVGA 1CGJI 4DR7H 2VKCA 1FARA 2K1HA 1TURA 5E3PA 2KMPA 1WE8A 3SGQI 3RU0A 2CPMA 1ULKA 4EC5A 1RFHA 2QQEA 4DV3H 1CHOI 4B8CD 4DR5H 4X66H 2JW6A 4MPIA 3UEJA 1ZZKA 1UUCA 4JI3H 2ARPF 5FUVA 4DV0H 1TBOA 4JI0H 1IW4A 1PQXA 1TIHA 1SEIA 4B3SH 2A20A 4H8AA 2GIVA 1IBLH 1ULNA 3CXLA 4SGBI 1V8CA 3UFFA 5J8FA 2NN6G 1ULMA 4JYAH 3UOEA 4KHPH 1CT2I 3VDUA 1TGSI 1NUBA 1Y1BA 2JA9A 1K7UA 1X74A 2FNFX 1UHAA 1VDDA 2UU9H 1FKAH 2VQFH 2MJHA 4LFBH 2M8WA 4FJUA 2FFMA 2JVZA 1R0RI 2ELIA 4X65H 1OMUA 2LF0A 2HHHH 4UXHA 1BMOA 4DUZH 1WTJA 1V1IA 1N36H 4JI5H 4WANA 2QNDA 2VQEH 1FJGH 2OPUA 2M5XA 2GVIA 2HH3A 3J81W 1V9NA 3EZJA 4DV4H 2WGCA 4PDBA 2UXCH 1X4NA 1W3SA 3TO6A 3BJIA 2PQ8A 1FY7A 3L7ZC 1VIGA 2JE6I 3UEYA 1XX6A 4JI6H 1HNZH 4B3TH 4BA2I 2CJSC 3SGBI 1X0AA 3SB1A 2ROWA 1TBRR 4DR6H 1KHMA 3JAMW 1TOTA 1XRHA 2OPVA 1XA6A 2PT7G 1H0ZA 1WGTA 2J87A 3UGLA 2N52A 3SEKC 1PCEA 2X3TA 2ORWA 5EX0A 3QWPA 2JXDA 2JZMA 3TO9A 1W4RA 2YUUA 2UUAH 1ZZJA 3J7AK 3R5CA 1LR8A 2ERWA 2NU1I 1ODHA 2RC4A 4DV5H 4G08A 1XBTA 1LR9A 1XMQH 5DT9A 1Q9BA 2E5RA 1HEVA 4JVYA 4X62H 1DT4A 2NU2I 2BA0A 4UXIA 1XMOH 2V53A 5K36G 2KMQA 2V1CC 4AMLA 2BUSA 2N17A 2OVOA 2NU0I 1M8BA 1P9ZA 2OD1A 3FSYA 2DB6A 1CT4I 2UUCH
chains in the Genus database with same CATH topology
1Z2IA 1NXUA 1X0AA 1VBIA 1V9NA 2G8YA 2CWFA 2CWHA 4FJUA 1S20A 2X06A 1XRHA 4FJSA 3UOEA 4H8AA 3I0PA 1WTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z2I A;  1NXU A;  1X0A A;  1VBI A;  1V9N A;  2G8Y A;  2CWF A;  2CWH A;  4FJU A;  1S20 A;  2X06 A;  1XRH A;  4FJS A;  3UOE A;  4H8A A;  3I0P A;  1WTJ A; 
#chains in the Genus database with same CATH topology
 2VRW B;  2KCX A;  2CWH A;  3OXL A;  2XRC A;  1HNX H;  4YHH H;  2YQP A;  2SGD I;  4JVH A;  5E3Q A;  4E1R A;  5LMU H;  4LF9 H;  2KMR A;  2M6Q A;  4FKD A;  4A24 A;  4L9M A;  5FUW A;  3VDP A;  1OMT A;  1N32 H;  1X4M A;  5DAE A;  2ANR A;  3QTL D;  2ENN A;  4LF4 H;  2QPO A;  2E3U A;  2Y0M A;  4JI8 H;  2CTJ A;  2ORV A;  3QD7 X;  2N71 A;  3NCV A;  4OCH A;  1N34 H;  2UZ3 A;  2JZX A;  4E1P A;  4WP4 A;  1I6U A;  2PY9 A;  4LFA H;  2QQC A;  2ANN A;  4JCV E;  1KMA A;  1HJA I;  3VE5 A;  3B4V C;  2D9I A;  3KDK A;  3T1Y H;  3OXG A;  4LF6 H;  2OZU A;  2SGF I;  1WVN A;  1IY5 A;  4LF7 H;  1Z2I A;  1CT0 I;  2SGP I;  5J8C A;  2LEO A;  5EX3 A;  5IT9 W;  3AEV B;  3VKE A;  2O4C A;  2CTF A;  3GAB A;  1XNR H;  2LTL A;  4LFC H;  1S20 A;  3TO7 A;  3OVO A;  4UXJ A;  4JV5 H;  4JI4 H;  2CTL A;  5BR8 H;  2L8E A;  1PJU A;  1YTP A;  3TOB A;  1YU6 C;  2WVJ A;  2YQR A;  4LIJ A;  1SGN I;  3FAU A;  4AIM A;  2DGR A;  2L7X A;  1PTR A;  2NU4 I;  3OET A;  2FPH X;  2CWF A;  1MT1 A;  2LRR A;  1J4W A;  1U5K A;  2QQ0 A;  3KY9 A;  2B8T A;  3OL0 A;  3KDG A;  1X9Z A;  2X52 A;  3UGD A;  4GI3 C;  1LR7 A;  3FC3 A;  1CE3 A;  1SGR I;  2Y3M A;  2UUB H;  1KBF A;  2UVO A;  4OX9 H;  1SGE I;  1J5E H;  4WAL A;  2FMR A;  1VBI A;  2F4V H;  4YY3 H;  4HGU A;  2UXD H;  1K7V A;  1J5K A;  2BL5 A;  4IFD G;  3E2I A;  1BUS A;  5LMN H;  1S03 G;  2ZQE A;  3OSS D;  1P9G A;  1IBK H;  5FLX W;  3QAH A;  1WKX A;  2GKT I;  4DR1 H;  3PDN A;  2V1C A;  3TOA A;  1HPT A;  1WHR A;  3R5B A;  4DUY H;  4DV7 H;  2W0T A;  1F0X A;  1PPF I;  1TBN A;  3V69 A;  2F3C I;  2OU2 A;  2QQD A;  1FAQ A;  1IBM H;  4B6D A;  2DKV A;  4AQY H;  2ENZ A;  2P2R A;  2SGQ I;  5LL6 b;  5E3R A;  3RF2 A;  3TJQ A;  1SGY I;  2B0U C;  1CSO I;  5FUX A;  3D00 A;  3J80 W;  3GR5 A;  3R5D A;  1I94 H;  1VIH A;  2AXY A;  4NZT M;  2JYY A;  4NXN H;  2N1A B;  1ZZI A;  5CCL A;  4FJS A;  1UG8 A;  5JHW C;  2CWG A;  4BA1 I;  1KBE A;  2KMO A;  4LF5 H;  4DR4 H;  2X06 A;  2ZM6 H;  2ODD A;  2CTM A;  5HI7 A;  1Y1C A;  2GKV A;  4AM3 A;  5JEA G;  1PTQ A;  2JEA I;  1MJB A;  5CCM A;  1HDL A;  4GKJ H;  1OVO A;  1DTJ A;  1CGI I;  4DR3 H;  2DIP A;  9WGA A;  2UXB H;  2P6A C;  1DS2 I;  1Y8F A;  3T1H H;  1ZTG A;  4GKK H;  2CPQ A;  1TUS A;  2K9H A;  1XNQ H;  1HR0 H;  1K7T A;  1FYB A;  1MSZ A;  5A2Q W;  2HH2 A;  1N33 H;  5IWA H;  1M8C A;  4DV6 H;  2A1S A;  1AN7 A;  4B3R H;  2SGE I;  4JI7 H;  1Z7K B;  2LTM A;  4OO1 G;  7WGA A;  1AN1 I;  1N13 A;  4K0K H;  2LUY A;  4LF8 H;  1HNW H;  2E73 A;  3GOX A;  1OYV I;  1TUA A;  4E9J A;  1SGP I;  2JA1 A;  1MJA A;  1V1H A;  2JEB I;  2CTE A;  1TBQ R;  2WCY A;  3HH2 C;  4JI1 H;  5HQ8 A;  2E5L H;  1R79 A;  3E59 A;  4X64 H;  5FUY A;  1SGQ I;  3MEK A;  3OXF A;  2PQU A;  5C0X G;  1NXU A;  4DV1 H;  4QMF B;  3FSX A;  1MJ9 A;  4OD6 A;  2G8Y A;  3R5A A;  1X4S A;  4NXM H;  2NU3 I;  3GKU A;  3I0P A;  3OTO H;  4DV2 H;  3U1K A;  2GKR I;  2LB7 A;  4B3M H;  1IY6 A;  4DNC A;  4OVO A;  2J9R A;  4B8T A;  1SGD I;  1DS3 I;  1WGC A;  3UGI A;  4NZR M;  1UVF A;  2Z0S A;  4JI2 H;  4NBQ A;  2CTK A;  2RIJ A;  1EC6 A;  1K1G A;  4DR2 H;  1UVG A;  1CGJ I;  4DR7 H;  2VKC A;  1FAR A;  2K1H A;  1TUR A;  5E3P A;  2KMP A;  1WE8 A;  3SGQ I;  3RU0 A;  2CPM A;  1ULK A;  4EC5 A;  1RFH A;  2QQE A;  4DV3 H;  1CHO I;  4B8C D;  4DR5 H;  4X66 H;  2JW6 A;  4MPI A;  3UEJ A;  1ZZK A;  1UUC A;  4JI3 H;  2ARP F;  5FUV A;  4DV0 H;  1TBO A;  4JI0 H;  1IW4 A;  1PQX A;  1TIH A;  1SEI A;  4B3S H;  2A20 A;  4H8A A;  2GIV A;  1IBL H;  1ULN A;  3CXL A;  4SGB I;  1V8C A;  3UFF A;  5J8F A;  2NN6 G;  1ULM A;  4JYA H;  3UOE A;  4KHP H;  1CT2 I;  3VDU A;  1TGS I;  1NUB A;  1Y1B A;  2JA9 A;  1K7U A;  1X74 A;  2FNF X;  1UHA A;  1VDD A;  2UU9 H;  1FKA H;  2VQF H;  2MJH A;  4LFB H;  2M8W A;  4FJU A;  2FFM A;  2JVZ A;  1R0R I;  2ELI A;  4X65 H;  1OMU A;  2LF0 A;  2HHH H;  4UXH A;  1BMO A;  4DUZ H;  1WTJ A;  1V1I A;  1N36 H;  4JI5 H;  4WAN A;  2QND A;  2VQE H;  1FJG H;  2OPU A;  2M5X A;  2GVI A;  2HH3 A;  3J81 W;  1V9N A;  3EZJ A;  4DV4 H;  2WGC A;  4PDB A;  2UXC H;  1X4N A;  1W3S A;  3TO6 A;  3BJI A;  2PQ8 A;  1FY7 A;  3L7Z C;  1VIG A;  2JE6 I;  3UEY A;  1XX6 A;  4JI6 H;  1HNZ H;  4B3T H;  4BA2 I;  2CJS C;  3SGB I;  1X0A A;  3SB1 A;  2ROW A;  1TBR R;  4DR6 H;  1KHM A;  3JAM W;  1TOT A;  1XRH A;  2OPV A;  1XA6 A;  2PT7 G;  1H0Z A;  1WGT A;  2J87 A;  3UGL A;  2N52 A;  3SEK C;  1PCE A;  2X3T A;  2ORW A;  5EX0 A;  3QWP A;  2JXD A;  2JZM A;  3TO9 A;  1W4R A;  2YUU A;  2UUA H;  1ZZJ A;  3J7A K;  3R5C A;  1LR8 A;  2ERW A;  2NU1 I;  1ODH A;  2RC4 A;  4DV5 H;  4G08 A;  1XBT A;  1LR9 A;  1XMQ H;  5DT9 A;  1Q9B A;  2E5R A;  1HEV A;  4JVY A;  4X62 H;  1DT4 A;  2NU2 I;  2BA0 A;  4UXI A;  1XMO H;  2V53 A;  5K36 G;  2KMQ A;  2V1C C;  4AML A;  2BUS A;  2N17 A;  2OVO A;  2NU0 I;  1M8B A;  1P9Z A;  2OD1 A;  3FSY A;  2DB6 A;  1CT4 I;  2UUC H; 
#chains in the Genus database with same CATH homology
 1Z2I A;  1NXU A;  1X0A A;  1VBI A;  1V9N A;  2G8Y A;  2CWF A;  2CWH A;  4FJU A;  1S20 A;  2X06 A;  1XRH A;  4FJS A;  3UOE A;  4H8A A;  3I0P A;  1WTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...