2CWHA

Crystal structure of delta1-piperideine-2-carboxylate reductase from pseudomonas syringae complexed with nadph and pyrrole-2-carboxylate
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
332
structure length
332
Chain Sequence
TQTVSYPQLIDLLRRIFVVHGTSPEVADVLAENCASAQRDGSHSHGIFRIPGYLSSLASGWVDGKAVPVVEDVGAAFVRVDACNGFAQPALAAARSLLIDKARSAGVAILAIRGSHHFAALWPDVEPFAEQGLVALSMVNSMTCVVPHGARQPLFGTNPIAFGAPRAGGEPIVFDLATSAIAHGDVQIAAREGRLLPAGMGVDRDGLPTQEPRAILDGGALLPFGGHKGSALSMMVELLAAGLTGGNFSFEFDWSKHPGAQTPWTGQLLIVIDPDKGAGQHFAQRSEELVRQLHGVGQERLPGDRRYLERARSMAHGIVIAQADLERLQELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Delta1-piperideine-2-carboxylate/Delta1-pyrroline-2-carboxylate reductase belonging to a new family of NAD(P)H-dependent oxidoreductases: conformational change, substrate recognition, and stereochemistry of the reaction
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Oxidoreductase
molecule keywords delta1-piperideine-2-carboxylate reductase
total genus 119
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 1.4.1.17: N-methylalanine dehydrogenase.
pdb deposition date 2005-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 2cwhA01
3.30.60.50 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Hypothetical oxidoreductase yiak; domain 3 2cwhA03
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 2cwhA02
1Z2IA 1S20A 1NXUA 1V9NA 1X0AA 4FJSA 4FJUA 1VBIA 4H8AA 2CWFA 3I0PA 1WTJA 1XRHA 2X06A 3UOEA 2CWHA 2G8YA
chains in the Genus database with same CATH superfamily
4LFCH 1NUBA 2F4VH 2SGQI 1I6UA 4UXHA 5A2QW 4JI3H 4AQYH 3NCVA 3VE5A 4A24A 1PPFI 5EX3A 2QPOA 4G08A 4X64H 1XNQH 1U5KA 3D00A 5FUVA 1X0AA 2BUSA 1Q9BA 5CCLA 4GKKH 4X66H 2VQFH 4DR2H 2YUUA 1UVFA 3OETA 4JI1H 2GKRI 2WGCA 2NN6G 4YHHH 1MJ9A 3FAUA 2RIJA 4JI2H 3OTOH 4LFAH 3QWPA 1W4RA 4B3SH 1IBLH 3E59A 1J4WA 4X62H 3RF2A 1PCEA 1PJUA 4B8TA 3V69A 4E1PA 1HNWH 1UG8A 2E73A 2SGDI 2LB7A 4DV5H 1LR7A 4JI4H 4JI7H 2JZXA 1WKXA 2N17A 2OVOA 3FSYA 3SB1A 1HR0H 2UXBH 2M5XA 2DB6A 2L8EA 2ANRA 4UXIA 2MJHA 4EC5A 5E3QA 1KHMA 2JE6I 4DV2H 1AN7A 4JI0H 2A20A 2KCXA 1TGSI 3E2IA 1UUCA 1WHRA 5DAEA 4JV5H 1S03G 4X65H 1UHAA 1DTJA 4DR7H 1R79A 3J7AK 1J5KA 1NXUA 1ZTGA 4DV4H 3SGBI 3QTLD 3UEJA 1RFHA 1IBMH 2LTLA 1OYVI 7WGAA 2VQEH 1SGEI 2KMPA 1XX6A 4OVOA 4DR3H 1Z2IA 1PTRA 2JEAI 1WGCA 1CSOI 4JI5H 2KMQA 1XRHA 2J87A 1HNZH 4LF7H 2K1HA 4K0KH 1Z7KB 2JXDA 1KBFA 2UUAH 1X4MA 2JEBI 1AN1I 1DT4A 3MEKA 2ZM6H 1ODHA 2J9RA 1XNRH 2QQEA 2HH2A 1TBRR 1X4SA 3VDUA 1V9NA 3CXLA 1K1GA 1ULNA 2VRWB 2VKCA 1M8CA 2JVZA 4E1RA 2SGEI 2OPVA 2X3TA 4LFBH 2E3UA 3TOBA 5LMNH 1BUSA 3GKUA 5FLXW 2CPQA 4B3RH 2CTMA 2M6QA 3R5DA 2CTKA 1CT4I 2N71A 2QNDA 2FNFX 1X4NA 1EC6A 5E3PA 1HEVA 4DNCA 3UOEA 1MT1A 4L9MA 1FKAH 4LF6H 5HQ8A 4DV1H 5FUXA 2FPHX 2GIVA 4B8CD 4E9JA 1DS3I 2CTLA 2QQ0A 1CT2I 1CT0I 4YY3H 1TIHA 3QD7X 4DUYH 2PQUA 2K9HA 1WVNA 1OMUA 3R5AA 4DV6H 1N34H 1SEIA 3AEVB 4QMFB 4BA2I 2M8WA 2Z0SA 4DR5H 2E5LH 2NU0I 4WALA 1P9ZA 3KY9A 4SGBI 3KDGA 4H8AA 1R0RI 1SGYI 5JEAG 2LUYA 2ODDA 4DUZH 2LTMA 3QAHA 3J80W 3U1KA 1K7UA 3UFFA 2CTEA 2X06A 1X74A 4LF5H 1W3SA 3TO6A 4JYAH 1CGII 1YTPA 2CWFA 2ORWA 2PY9A 2YQPA 1CGJI 2DIPA 5BR8H 1IBKH 2FFMA 1H0ZA 3T1YH 2JW6A 1TBOA 2WVJA 4NZRM 2ENZA 2KMOA 3TO7A 2UU9H 3GR5A 1OMTA 2HH3A 4GI3C 2NU2I 4DR4H 1FYBA 2SGFI 1I94H 3J81W 1LR8A 3I0PA 4LF9H 1KBEA 1UVGA 4AIMA 2G8YA 2ERWA 1YU6C 1XMQH 1Y1CA 4UXJA 4JVYA 5EX0A 2N52A 2JA1A 1KMAA 1PQXA 4WP4A 5LMUH 2N1AB 2OU2A 1SGNI 2ANNA 2P6AC 3EZJA 2L7XA 1MSZA 3GOXA 2KMRA 3TOAA 3KDKA 4MPIA 2JA9A 3SGQI 5CCMA 2DGRA 1M8BA 2PQ8A 5LL6b 3R5CA 2AXYA 2UUCH 1SGQI 2ZQEA 2SGPI 2CTJA 5JHWC 2OD1A 2X52A 1HPTA 3UGDA 3UEYA 2BL5A 1WE8A 1TOTA 4GKJH 1IY5A 1V1IA 2GKTI 1MJBA 2GKVA 4DR1H 1ULMA 4JI8H 2RC4A 1VIGA 9WGAA 2ELIA 4IFDG 3VDPA 2UXCH 1VBIA 1P9GA 2CJSC 1ZZIA 1BMOA 4LIJA 4NBQA 1FJGH 1ZZKA 2YQRA 4DR6H 5K36G 2XRCA 4WANA 3TJQA 2F3CI 3OL0A 1LR9A 2UXDH 3T1HH 1CE3A 3RU0A 1CHOI 2V1CA 3SEKC 4LF4H 4KHPH 5J8CA 1FAQA 2UUBH 2DKVA 1F0XA 1VIHA 4HGUA 2BA0A 1TURA 3UGIA 1TUSA 2JZMA 5E3RA 1V1HA 5DT9A 2Y3MA 2ARPF 2E5RA 2CPMA 2D9IA 1TUAA 4OCHA 3BJIA 1N33H 3FSXA 2P2RA 1HJAI 3OXGA 4AMLA 1V8CA 4B3MH 2CWGA 4DV7H 4DV0H 2B8TA 1N13A 4OD6A 1HDLA 3PDNA 2LRRA 1IY6A 4NZTM 3TO9A 4JI6H 3UGLA 1K7VA 2A1SA 1WGTA 3FC3A 1ZZJA 2HHHH 1Y8FA 1HNXH 5HI7A 2UVOA 1FARA 5C0XG 2UZ3A 1Y1BA 1X9ZA 5IWAH 3OSSD 2GVIA 1K7TA 5FUWA 1DS2I 1SGDI 1MJAA 3GABA 4NXMH 2ROWA 3L7ZC 2CWHA 3VKEA 4OO1G 4BA1I 4FKDA 2ORVA 1SGPI 5IT9W 1VDDA 3OXLA 2Y0MA 1N32H 1XA6A 4DV3H 2V1CC 2NU3I 2CTFA 2O4CA 2QQCA 1S20A 2WCYA 4JVHA 2OPUA 1FY7A 2ENNA 3OVOA 1ULKA 4JCVE 4AM3A 5FUYA 3HH2C 1J5EH 1IW4A 1TBNA 2OZUA 2NU4I 4B6DA 1WTJA 4PDBA 2QQDA 2V53A 3OXFA 3JAMW 2B0UC 1XBTA 3B4VC 1TBQR 2JYYA 2LF0A 2FMRA 4FJSA 4B3TH 1SGRI 4NXNH 1PTQA 1N36H 2LEOA 3R5BA 4FJUA 1XMOH 4OX9H 4LF8H 1OVOA 2W0TA 2NU1I 5J8FA 2PT7G
chains in the Genus database with same CATH topology
1Z2IA 1S20A 1NXUA 1V9NA 1X0AA 4FJSA 4FJUA 1VBIA 4H8AA 2CWFA 3I0PA 1WTJA 1XRHA 2X06A 3UOEA 2CWHA 2G8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z2I A;  1S20 A;  1NXU A;  1V9N A;  1X0A A;  4FJS A;  4FJU A;  1VBI A;  4H8A A;  2CWF A;  3I0P A;  1WTJ A;  1XRH A;  2X06 A;  3UOE A;  2CWH A;  2G8Y A; 
#chains in the Genus database with same CATH topology
 4LFC H;  1NUB A;  2F4V H;  2SGQ I;  1I6U A;  4UXH A;  5A2Q W;  4JI3 H;  4AQY H;  3NCV A;  3VE5 A;  4A24 A;  1PPF I;  5EX3 A;  2QPO A;  4G08 A;  4X64 H;  1XNQ H;  1U5K A;  3D00 A;  5FUV A;  1X0A A;  2BUS A;  1Q9B A;  5CCL A;  4GKK H;  4X66 H;  2VQF H;  4DR2 H;  2YUU A;  1UVF A;  3OET A;  4JI1 H;  2GKR I;  2WGC A;  2NN6 G;  4YHH H;  1MJ9 A;  3FAU A;  2RIJ A;  4JI2 H;  3OTO H;  4LFA H;  3QWP A;  1W4R A;  4B3S H;  1IBL H;  3E59 A;  1J4W A;  4X62 H;  3RF2 A;  1PCE A;  1PJU A;  4B8T A;  3V69 A;  4E1P A;  1HNW H;  1UG8 A;  2E73 A;  2SGD I;  2LB7 A;  4DV5 H;  1LR7 A;  4JI4 H;  4JI7 H;  2JZX A;  1WKX A;  2N17 A;  2OVO A;  3FSY A;  3SB1 A;  1HR0 H;  2UXB H;  2M5X A;  2DB6 A;  2L8E A;  2ANR A;  4UXI A;  2MJH A;  4EC5 A;  5E3Q A;  1KHM A;  2JE6 I;  4DV2 H;  1AN7 A;  4JI0 H;  2A20 A;  2KCX A;  1TGS I;  3E2I A;  1UUC A;  1WHR A;  5DAE A;  4JV5 H;  1S03 G;  4X65 H;  1UHA A;  1DTJ A;  4DR7 H;  1R79 A;  3J7A K;  1J5K A;  1NXU A;  1ZTG A;  4DV4 H;  3SGB I;  3QTL D;  3UEJ A;  1RFH A;  1IBM H;  2LTL A;  1OYV I;  7WGA A;  2VQE H;  1SGE I;  2KMP A;  1XX6 A;  4OVO A;  4DR3 H;  1Z2I A;  1PTR A;  2JEA I;  1WGC A;  1CSO I;  4JI5 H;  2KMQ A;  1XRH A;  2J87 A;  1HNZ H;  4LF7 H;  2K1H A;  4K0K H;  1Z7K B;  2JXD A;  1KBF A;  2UUA H;  1X4M A;  2JEB I;  1AN1 I;  1DT4 A;  3MEK A;  2ZM6 H;  1ODH A;  2J9R A;  1XNR H;  2QQE A;  2HH2 A;  1TBR R;  1X4S A;  3VDU A;  1V9N A;  3CXL A;  1K1G A;  1ULN A;  2VRW B;  2VKC A;  1M8C A;  2JVZ A;  4E1R A;  2SGE I;  2OPV A;  2X3T A;  4LFB H;  2E3U A;  3TOB A;  5LMN H;  1BUS A;  3GKU A;  5FLX W;  2CPQ A;  4B3R H;  2CTM A;  2M6Q A;  3R5D A;  2CTK A;  1CT4 I;  2N71 A;  2QND A;  2FNF X;  1X4N A;  1EC6 A;  5E3P A;  1HEV A;  4DNC A;  3UOE A;  1MT1 A;  4L9M A;  1FKA H;  4LF6 H;  5HQ8 A;  4DV1 H;  5FUX A;  2FPH X;  2GIV A;  4B8C D;  4E9J A;  1DS3 I;  2CTL A;  2QQ0 A;  1CT2 I;  1CT0 I;  4YY3 H;  1TIH A;  3QD7 X;  4DUY H;  2PQU A;  2K9H A;  1WVN A;  1OMU A;  3R5A A;  4DV6 H;  1N34 H;  1SEI A;  3AEV B;  4QMF B;  4BA2 I;  2M8W A;  2Z0S A;  4DR5 H;  2E5L H;  2NU0 I;  4WAL A;  1P9Z A;  3KY9 A;  4SGB I;  3KDG A;  4H8A A;  1R0R I;  1SGY I;  5JEA G;  2LUY A;  2ODD A;  4DUZ H;  2LTM A;  3QAH A;  3J80 W;  3U1K A;  1K7U A;  3UFF A;  2CTE A;  2X06 A;  1X74 A;  4LF5 H;  1W3S A;  3TO6 A;  4JYA H;  1CGI I;  1YTP A;  2CWF A;  2ORW A;  2PY9 A;  2YQP A;  1CGJ I;  2DIP A;  5BR8 H;  1IBK H;  2FFM A;  1H0Z A;  3T1Y H;  2JW6 A;  1TBO A;  2WVJ A;  4NZR M;  2ENZ A;  2KMO A;  3TO7 A;  2UU9 H;  3GR5 A;  1OMT A;  2HH3 A;  4GI3 C;  2NU2 I;  4DR4 H;  1FYB A;  2SGF I;  1I94 H;  3J81 W;  1LR8 A;  3I0P A;  4LF9 H;  1KBE A;  1UVG A;  4AIM A;  2G8Y A;  2ERW A;  1YU6 C;  1XMQ H;  1Y1C A;  4UXJ A;  4JVY A;  5EX0 A;  2N52 A;  2JA1 A;  1KMA A;  1PQX A;  4WP4 A;  5LMU H;  2N1A B;  2OU2 A;  1SGN I;  2ANN A;  2P6A C;  3EZJ A;  2L7X A;  1MSZ A;  3GOX A;  2KMR A;  3TOA A;  3KDK A;  4MPI A;  2JA9 A;  3SGQ I;  5CCM A;  2DGR A;  1M8B A;  2PQ8 A;  5LL6 b;  3R5C A;  2AXY A;  2UUC H;  1SGQ I;  2ZQE A;  2SGP I;  2CTJ A;  5JHW C;  2OD1 A;  2X52 A;  1HPT A;  3UGD A;  3UEY A;  2BL5 A;  1WE8 A;  1TOT A;  4GKJ H;  1IY5 A;  1V1I A;  2GKT I;  1MJB A;  2GKV A;  4DR1 H;  1ULM A;  4JI8 H;  2RC4 A;  1VIG A;  9WGA A;  2ELI A;  4IFD G;  3VDP A;  2UXC H;  1VBI A;  1P9G A;  2CJS C;  1ZZI A;  1BMO A;  4LIJ A;  4NBQ A;  1FJG H;  1ZZK A;  2YQR A;  4DR6 H;  5K36 G;  2XRC A;  4WAN A;  3TJQ A;  2F3C I;  3OL0 A;  1LR9 A;  2UXD H;  3T1H H;  1CE3 A;  3RU0 A;  1CHO I;  2V1C A;  3SEK C;  4LF4 H;  4KHP H;  5J8C A;  1FAQ A;  2UUB H;  2DKV A;  1F0X A;  1VIH A;  4HGU A;  2BA0 A;  1TUR A;  3UGI A;  1TUS A;  2JZM A;  5E3R A;  1V1H A;  5DT9 A;  2Y3M A;  2ARP F;  2E5R A;  2CPM A;  2D9I A;  1TUA A;  4OCH A;  3BJI A;  1N33 H;  3FSX A;  2P2R A;  1HJA I;  3OXG A;  4AML A;  1V8C A;  4B3M H;  2CWG A;  4DV7 H;  4DV0 H;  2B8T A;  1N13 A;  4OD6 A;  1HDL A;  3PDN A;  2LRR A;  1IY6 A;  4NZT M;  3TO9 A;  4JI6 H;  3UGL A;  1K7V A;  2A1S A;  1WGT A;  3FC3 A;  1ZZJ A;  2HHH H;  1Y8F A;  1HNX H;  5HI7 A;  2UVO A;  1FAR A;  5C0X G;  2UZ3 A;  1Y1B A;  1X9Z A;  5IWA H;  3OSS D;  2GVI A;  1K7T A;  5FUW A;  1DS2 I;  1SGD I;  1MJA A;  3GAB A;  4NXM H;  2ROW A;  3L7Z C;  2CWH A;  3VKE A;  4OO1 G;  4BA1 I;  4FKD A;  2ORV A;  1SGP I;  5IT9 W;  1VDD A;  3OXL A;  2Y0M A;  1N32 H;  1XA6 A;  4DV3 H;  2V1C C;  2NU3 I;  2CTF A;  2O4C A;  2QQC A;  1S20 A;  2WCY A;  4JVH A;  2OPU A;  1FY7 A;  2ENN A;  3OVO A;  1ULK A;  4JCV E;  4AM3 A;  5FUY A;  3HH2 C;  1J5E H;  1IW4 A;  1TBN A;  2OZU A;  2NU4 I;  4B6D A;  1WTJ A;  4PDB A;  2QQD A;  2V53 A;  3OXF A;  3JAM W;  2B0U C;  1XBT A;  3B4V C;  1TBQ R;  2JYY A;  2LF0 A;  2FMR A;  4FJS A;  4B3T H;  1SGR I;  4NXN H;  1PTQ A;  1N36 H;  2LEO A;  3R5B A;  4FJU A;  1XMO H;  4OX9 H;  4LF8 H;  1OVO A;  2W0T A;  2NU1 I;  5J8F A;  2PT7 G; 
#chains in the Genus database with same CATH homology
 1Z2I A;  1S20 A;  1NXU A;  1V9N A;  1X0A A;  4FJS A;  4FJU A;  1VBI A;  4H8A A;  2CWF A;  3I0P A;  1WTJ A;  1XRH A;  2X06 A;  3UOE A;  2CWH A;  2G8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...