2CXFA

Run domain of rap2 interacting protein x, crystallized in c2 space group
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
167
structure length
167
Chain Sequence
MANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEVNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rap2 interacting protein x
publication title Crystal Structure of the RUN Domain of the RAP2-interacting Protein x
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 38
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2005-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02759 RUN RUN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2cxfA00
2DWKA 3CWZB 2DWGA 4GIWA 2CXLA 2CXFA
chains in the Genus database with same CATH superfamily
3LJCA 3ZJ1A 4YLHA 3NRXA 2VL8A 4IL9A 3KVBA 5AQLB 2NW8A 4CN6A 2NR4A 4UF0B 4IREA 4ZOLE 3C51A 1FMWA 4WBNE 2IC6A 2JMKA 5J0ZA 4AXPA 1OWAA 4EEDA 2ES0A 5LP6E 3O1IA 1ZEEA 5HWXA 2BDEA 2V6YA 1OEDA 1BR4A 5FVKA 2WWVA 3UU6A 2WM9A 2RP4A 3ZYLA 1YKHB 5HXHA 1S35A 4HFEA 4X65T 3T1HT 5L3BB 4QHOA 4EXTA 4HFVA 1J5ET 1VCTA 2QYWA 2UXXB 1HS7A 2MYSA 2V7MA 4U74A 1N33T 3L39A 4CN4A 4EYUA 2N9DA 3KV5A 1IAPA 4QWNB 3ZMSB 3OKQA 5HEHA 4B3ST 2B76A 4U33A 4LFCT 2V7LA 4XBFB 3RC8A 2BKNA 4BAYB 2WDRA 1JNZA 4ILUA 4MLKA 4TNVA 3SFDA 4LFAT 3C4ZA 4X1YE 3NZPA 4IE4A 3PJAJ 3A8YC 2E5VA 4AKLA 2CBIA 3HKBE 1HCIA 3ZN1B 4PJMA 1SA0E 1HNWT 2WSSV 1R8IA 2LOSA 3I0OA 4H9NC 4YHHT 4DO0A 3ZEFB 3MA9A 4X66T 3LK42 5ABGA 5FL1A 2DLRA 2VQFT 1HNZT 2N1GA 5FXXA 3OPCA 2E9XC 3EHZA 3ZSTA 2JJ9A 4QXBB 2IAKA 4XAXB 1FJGT 1D0XA 4LFBT 1WYCA 2V8SV 5HEUA 2FJEA 4JYAT 4LMLA 4DV7T 3K1SA 4EGWA 5J2TE 5L47A 4QXHB 4KX6A 3CX8B 3RPUA 3FZLB 5AQGB 4IDZA 3AVSA 4UIGA 3KBUA 1Z8UA 2BKPA 2K9AA 3RC3A 2D0UA 2W4XA 3RLFF 2XQ4A 3NRYA 4ILCA 3AE8A 4GKJT 3FHNA 3RIFA 3UU8A 4MHCA 3AEEA 3AAIA 4FJOA 2W0GA 3LBXA 4DR7T 3DP7A 3PUGA 4V1Av 2DI4A 2NW9A 2WMNA 4YJ3E 2OLTA 4QH4A 4B3RT 4H9QC 3O9XA 5JDMA 3LK3B 3ZMZB 4ZZCA 2XY8B 1G73A 4H9PC 2WQYA 5IWAT 5ADXL 3N9LA 3CIRA 2JMHA 2GK9A 3AB3B 5JDNA 1QLBA 3B13A 2VVNA 1KNRA 2W63A 3UU4A 1YD8G 4EYYR 5FKYA 4GK5E 3JCFA 2W2UA 4L9IA 2CXLA 4TUYE 2L8KA 2CXDA 4MFRA 5EK4A 3IHRA 3OYXA 2MBGA 3UUNA 3L09A 3V5SA 3RI5A 4NXNT 4YXDA 1GQEA 2YK0A 2J4GA 4ZI3D 4PFPA 3K3NA 3KINB 2X9YA 4HWFA 1KF6A 2LKHA 2YDSA 2Q9QC 3PUAA 3B5MA 4I50E 3AA1B 2BBHA 5FY0A 2YDRA 2XZEA 4NUVA 4YTPA 4O2AE 3TLWA 5LJMA 3I9WA 1YW0A 4X62T 1WRDA 3VKGA 1T7SA 3SFEA 2BVLA 3IBPA 3D0TA 4Z8XA 3P4PA 2CE7A 3AE9A 4A56A 3EUHA 3PE0A 2KMFA 4UVBB 5H6QB 5JR9A 4WZXA 5CGMA 4DIDB 4DMWA 4DV5T 4B3MT 4YSYA 3UFGA 2VASA 3ZT7A 2BG9E 2P9BA 3PUZF 1NWMX 3OYZA 2UU9T 4OK0A 3OJAA 3PV0F 1N34T 2F4VT 1MIVA 1XNQT 3HA4A 3RKOA 2R6GF 5IYZE 4DUZT 3ZPOA 4X1IE 2LHRA 4A5XA 5L3FB 3SOLA 4J2CA 2WZIA 3I9YA 1UK5A 4KP3C 4GOUA 2Y6XA 5CFBA 4CI1B 3SWHA 5LNKA 3EDUA 5ABEA 5JDQA 2D2SA 3H3MA 2UXCT 2BS3A 3AXJA 2VWAA 5FP3A 2WS3A 2IHR1 3W15B 4P0AA 2Q9QB 3ESLA 2HH7A 4WW0A 4GIWA 2XQAA 1I6ZA 2WDQA 3ZMVB 4H9SE 1N32T 4HKAA 2C5KT 2I0MA 3FZMB 3IF8B 1U4QA 3C64A 5L3GB 4IHJE 1L0VA 3M65A 4WBOA 1HR0T 3AE4A 5CJ5A 2FUPA 3RYCE 2Y48B 1DU2A 2LRLA 5LJNA 2BG9B 5ABFB 1OEDC 4WYVA 3U78A 4CXWA 5JTGA 2HN1A 4DV2T 1X79A 4PAGA 3HI2A 4HWIB 1YKEB 2FJBA 4X1KE 3E0ZA 4IL4A 5AQOB 4O4LE 5LOVE 1D1CA 3MXZA 1IBKT 3N9QA 2BS2A 3VU7H 4X5TA 1VCSA 3OBVE 3RYFE 3RX6A 2WB5A 1NEKA 5AQNB 2HPJA 5DQVA 4UF0A 5DABA 4P0BA 3ZYMA 3LK2B 4TWFA 4CQIA 3FZFB 3JC6C 3K3QC 4Z91A 4UV9B 4EZHA 2OV9A 2HHHT 4YHJA 5IHYA 3EABA 3CVRA 1IJ6A 3N9PA 1UGOA 5AQVB 4ANJA 3PURA 2CCQA 2D9DA 3JAEA 4NIQA 4PJLA 3UU3A 4AQFA 4FI5A 4ILAA 3O1HA 1Y01A 3UU5A 1WR0A 4IIJE 3QNUA 1I94T 2YN6A 3Q2MA 3RRCA 1QUUA 4K0KT 3KV4A 3GN5B 3NZQA 3T1YT 3QOFA 2VKOA 3RIUC 2VVSA 3PJAA 4DV4T 1WYBA 4TWHA 1IBMT 4LF9T 2WP9A 3ZCJA 1KNZA 1XDOA 2ZLYA 1D1AA 2UXBT 5LA6E 3A5XA 4L5GA 3SS1A 2KSRA 4YTNA 4IDQA 3RYIE 5C8YE 3EAMA 4X64T 3ONJA 3Q9DA 4P1NA 4LF4T 4AQGA 2UXDT 5C2TA 2MPKA 3V5UA 2CEAA 2XUEA 3QUJA 3UTKA 1V9DA 2H89A 3UUXB 2DWGA 4ILBA 5LMNT 4G2AA 3RQWA 2YKSA 1LVFA 3PUYF 3BQKA 5JVDE 4E7SA 4JV5T 4GYSA 4ZI7E 2A3DA 1BR2A 4TWDA 5JRCB 4H63V 4DR3T 4IE7A 2H7OA 2BZBA 3F2EA 4JI0T 2LM9A 4DV0T 2WAUA 4KI0F 3AE7A 4KHZF 3K8PC 2CA5A 2YOEA 2CWOA 5KX5E 1O3XA 3L8RA 2IW5B 4UV8B 2AXDS 4JI7T 3EI0A 4JEUB 3PTRB 3N2GE 3RGLA 2IMLA 3GWHA 2KWIB 4TZ4C 3CK6A 2CBJA 2V7KA 2ZM0A 5A1LA 5F5WA 3N9MA 4ZHQE 2IDOB 3J9X1 4AKGA 3F31A 2CHNA 3VHLA 4KHPT 2UUAT 4I43B 3FZHB 3C4XA 3MK7C 3P4QA 3UQ4A 3I0QA 3ZMUB 1N36T 3JADA 4IE5A 1KFYA 2XJ7A 1HX1B 4JBWF 4HE8A 4PFOA 1WCRA 3KV6A 3FXEB 3KV9A 3AEBA 4A97A 2X9XA 4O2BE 5LGNB 2LRKA 2LSJA 1HTJF 3RQUA 3E22E 5HCJA 1XMOT 2HN2A 3UFEA 2PBIA 4DR6T 2DWKA 3RHWA 3IEEA 4KBMB 5FXWA 5IUXA 2CPTA 5F3JA 1WR6A 4PNIA 2VKHA 3KFWX 4UELA 4I55E 2E9XB 1UX4A 5JDHA 4EB6E 4N78D 2W66A 3ZJ2A 4PK6A 1LRZA 2LE8A 2E2AA 5FXZA 2X0LB 4LF5T 5LGTB 4F6RC 2XQ3A 2A9UA 3RRWA 2PFVA 4YSZA 2K24A 3AEFA 2XPKA 3VR9A 2PJQA 2X0YA 1WFDA 2OA5A 2LKGA 4EV6A 4OFZA 3HR0A 4HEAA 4HN9A 1YQ4A 4DUYT 5L4EA 3WAJA 2E8IA 5J1GA 4JI6T 3VRBA 2LT3A 5J2UE 2E9XD 2VK9A 2UXNB 3AE1A 1YQ3A 3CQGB 2DHRA 4EOZB 3HKEE 2NW7A 2ZM6T 3WI3A 4PK5A 5L2LA 1VRBA 1HG2A 2EHOC 3JAFA 3J7Yq 3TLVA 4X20E 3P50A 2J62A 5JQGE 4HFIA 2NP9A 4YT0A 3PU8A 2FJAA 3AA0B 1EZ3A 3AE5A 4DV1T 4OYKA 2ACZA 1T98A 2AE9A 4JI3T 2CLYC 1E1HB 1KK7A 3UQ7A 5LB7B 1Y64B 2A72A 5AQKB 3RH3A 5HXSA 4B6XA 4U2ZA 4Z90A 2N2NA 1E7PA 5HEJA 1X9BA 2JRKA 2NWBA 5HAXA 3ZN0B 3EDVA 2LM2A 2CM0A 2Q9QA 2WDVA 4BJNA 2LLYA 4YSXA 2K5BB 3T8OA 3WAKA 5LGUB 1MIWA 2X9WA 3TKLB 2IUBA 3B57A 3UULA 2YEVC 1MIYA 4LF8T 4EIWA 3PUQA 4DBQA 2W62A 2V5DA 1BR0A 3PUXF 4KMCA 3FBZA 1IBLT 4JEHB 5C3JA 5EK2A 1J1JA 2I6HA 4LMJA 5LBQB 3RF1A 3CPZA 4A98A 4ISTA 2XAGB 2BG9A 5ABFA 2XSAA 3FZKB 3CKDA 3AEGA 2HPLA 1E2AA 1XNRT 1UURA 2EHOB 3NVOA 4HWCA 4IDOA 3N9NA 2JQ9A 3AECA 2CRBA 3TLSA 3RYHE 3P4WA 3MJXA 1OEDE 5L3DB 2VURA 2WY2A 4H9RC 1D0ZA 2Q9QD 3LDQB 1VOMA 2VB6A 5JDLA 4QKNA 2J1DG 4U31A 5LBMA 2V7JA 3UUMA 2UUBT 3KVAA 4ASKA 4I4TE 4H63H 1FMVA 4U2YA 3I1AA 3P8CD 5BMVE 5HYAA 2CWYA 5GONE 2V7IA 5LYJE 2H88A 3ZLIA 3AA6B 3OTOT 2C5JA 2XM1A 2X9HA 1IJ5A 2NOXA 1JNRA 4E7ZA 4CZZB 1LKXA 2XAFB 3ANWB 2X66A 1QSDA 1KEYA 4BA9A 3ONXA 3ZMTB 1OXZA 3QB5K 3C4WA 2WCAA 2PTFA 5LXTE 4CXXA 2CMRA 3CX6B 4M1PA 3GN5A 1MNEA 3AEDA 4AKIA 2FBWA 2JQKA 3ONLC 2M67A 2W67A 1W0BA 3ZSSA 4OX9T 2VL0A 2LSGA 1T8BA 2YU1A 1XMQT 3R6NA 1S94A 4JI5T 1KNPA 5HCMA 1HX8A 4DR2T 3Q5XA 4HWDA 2Y8DA 3QK6A 2LSKA 4IGUA 4JI4T 4ZZBA 3K3OA 4CI3B 3ETUA 3ZT5A 2V6YB 5CB4E 1WLXA 1OEDB 3RKGA 1G8XA 1IZNB 3P4SA 5AQHB 3N9OA 2ZMAA 4ZXLA 4CI2B 4G63A 2SPCA 4HFBA 2JIWA 2BS4A 3PDYA 2K48A 4UEMA 1MMGA 4TNWA 5TAOA 5HEGA 4ZI2D 4O4HE 2DNXA 1U5PA 4P09A 5AFUL 5AQTB 2B1EA 5AQJB 3UT5E 5F8PA 5JRCA 1CUNA 2A2FX 4YJ2E 1SE7A 2L9QA 3ETVA 3P4RA 5BR8T 2WBLA 1CHUA 5AQPB 2XQ6A 2MAWA 2XSBA 2XQ9A 3ZCIA 4IDPA 2C5IT 4UVCB 4CN1A 3O4XE 1ZOYA 4GKKT 4MBQA 4LF7T 4Q25A 3AVRA 5L4HA 4ZI3C 4NUUA 3M3ZB 2JQHA 5AQSB 3DJBA 3ZYKA 2KZ7B 3F57A 3AE6A 4ADZA 4TV9E 5M4YA 4QXCB 3CQXC 5LHIB 1XZYA 3VRAA 3RIUA 4KUMB 1T72A 2XAQB 3OVUA 5EZYE 2C0SA 3MZKB 3NWIA 3TLTA 1SUMB 2KNDA 4AKRB 2VKDA 5JH7E 3FXDB 3HKCE 3JC6D 4U7YA 5JDGA 5LG3A 2X51A 1BR1A 4ZS3A 1HG5A 5HXRA 5LHGB 3PU3A 3ZT6A 1ZP0A 4DR4T 4IE0A 2I59A 3MACA 5DJQC 4EAHA 3AEAA 2XHEB 2ACXA 2XM2A 1H7CA 2NTYA 4U72A 5HWYA 3CMLA 5LCYA 4HWHA 2KXPB 4PK4A 2BVMA 2J47A 4WNKA 5CA1E 4U3CA 4H9OC 1W09A 5JDFA 3QB5A 1D0YA 4GK0E 3U3IA 3RIAA 2XQ8A 4AQYT 2X67A 5H6RB 4HFDA 2LOPA 5LHHB 3KDSE 2XAHB 4DV3T 1M62A 2IC9A 3LBXB 3VR8A 3O1JA 3PUVF 4AKHA 2DCFA 1Z0PA 4PJNA 2E9XA 3LSVA 3ABVA 4BJMA 3AAAB 5FNVE 5JR9C 2V26A 4CXYA 2KLQA 4L0RA 4DNDA 3EVYA 2WZHA 4AISA 4DR1T 4ZS2A 3AAEB 2RA1A 4C91A 4ERRA 5LG4A 3Q5EA 4JUYA 2G0UA 3BQIA 4O4JE 2D0TA 3H37A 2QA7A 4I0UA 4JI1T 4LMKA 3BQLA 1NENA 2NTXA 4YTMA 2MOZA 2X68A 5HEOA 2W00A 2ZM8A 2ODVA 5FXVA 4EZ4A 2DL1A 1HNXT 4UR9A 3C50A 4HTEA 2FJDA 4O8SA 4IDNA 2H3RA 4GYRA 5DQWA 2QGSA 4DV6T 3HKDE 4HFCA 4JI2T 3BK9A 1J5WA 5LMUT 5AQMB 5FY1A 4B3TT 4IE6A 2LJLA 1W9RA 4AIUA 2W61A 4JI8T 3DTOA 3R84B 1D1BA 2JPFA 1YXRA 2WMOA 2XAJB 1UCUA 2KT9A 2KWHA 2ODUA 2WU5A 4QX8B 2LEHA 2LSIA 4QH5A 2CHOA 4AI6A 3E08A 1UUSA 5AQIB 2ZM2A 4TV8E 5FYMA 2H7VC 2XQYA 5L3CB 1AJ3A 4PJJA 1B7TA 3LG7A 2XTLA 4QX7B 3PUWF 3N2KE 3NKZA 1MMNA 4NXMT 4IT4A 1ZKEA 1ZV4X 2D5UA 3FBLA 2BG9C 4TN7B 2LSYA 5JR9B 2L3LA 3S4UA 3ZC1A 5AQQB 3CX7B 2XQ7A 1MMAA 3N2OA 3AA7B 2RPAA 2WU2A 1LVKA 4OHFA 1M7KA 4ISSA 3MKDA 3P7IA 3AE3A 2M6IA 4U7IA 2BBJA 5CA0E 4QH1A 5E0OA 3CWZB 2MTQA 3G06A 3NBXX 1UX5A 2E5LT 4HFHA 5ETWA 5HXCA 1HF8A 2V6XA 4NPPA 5JREA 5KXJA 2K3WA 3ZC0A 1XDPA 2VKJA 4C90A 4YFSA 1FEWA 2XASB 5ABHA 4MALA 3HL6A 5EK3A 2M6BA 3Q5WA 4PW8A 3AE2A 3A7MA 5HXEA 3IA3A 3PUSA 2KINB 3KBTA 4K0UA 4TX5A 3N5LA 2VQET 4EEBA 3QC9A 5FL0A 4COFA 2QVAA 4DR5T 3L3PA 3X1DA 1FIOA 3AXJB 2CXFA 2Z6EA 4ZEYA 2BKOA 2V1DB 1SHZC 5AQRB 4LF6T 4DMVA 2EHOA 4ZI2C 2JQQA 2X0HA 5L3EB 4AQFC 4DBRA 1MMDA 2LHNA 4F8HA 4UVAB 2PG8A 5FY7A 2UUCT 3GMIA 4O4IE 5FMNA 1US7B 4UXNB 4XZCA 1XWMA 1MNDA 3GA8A 3TLUA 3ZKRA 1NAFA 3Q5DA 2YDQA 4YY3T 5AQFB 2QRXA 4DVDA 2IIUA 2CLYB 2XQ5A 1HFAA 2YINA 2YU2A 3VKHA 1W0AA 3FB2A 1ZHCA 3UUBA 3CQCB 3SRZA 2V5CA 5KDMC 3H3AA 4HGAA 5FVLA 3ANWA 3C98B 5AQUB 5KMGP 4OYJA 2EHOD 4JLEA 3LFMA 2WWUA
chains in the Genus database with same CATH topology
3LJCA 2LHRA 4EB6E 4N78D 3ZJ1A 4MBQA 3ZJ2A 4PK6A 1LRZA 4YLHA 3NRXA 3AVRA 2LE8A 2VL8A 4ZI3C 3SOLA 5L3FB 4NUUA 3KVBA 4J2CA 2NW8A 3I9YA 3DJBA 3ZYKA 2KZ7B 4UF0B 3F57A 5FXZA 4KP3C 2X0LB 4GOUA 2Y6XA 4ADZA 4ZOLE 3SWHA 4CI1B 4TV9E 3C51A 4F6RC 1FMWA 5LGTB 3EDUA 5LNKA 4QXCB 5M4YA 3CQXC 5JDQA 2D2SA 5LHIB 3RRWA 4WBNE 2IC6A 2PFVA 2JMKA 2K24A 4KUMB 4AXPA 1OWAA 2XAQB 5EZYE 2ES0A 2PJQA 2C0SA 5LP6E 3O1IA 2VWAA 3MZKB 5FP3A 4P0AA 3W15B 1ZEEA 5HWXA 2KNDA 2BDEA 2OA5A 2Q9QB 4AKRB 3ESLA 2HH7A 4OFZA 3HR0A 4HEAA 2VKDA 4HN9A 4WW0A 5JH7E 3FXDB 1BR4A 3HKCE 3JC6D 2WM9A 2RP4A 4GIWA 5JDGA 2X51A 1BR1A 3ZYLA 4ZS3A 1YKHB 1HG5A 5HXRA 5HXHA 3ZMVB 3WAJA 2E8IA 4H9SE 5J1GA 1S35A 5LHGB 4HKAA 3PU3A 2C5KT 2LT3A 4IE0A 5L3BB 4QHOA 2I59A 3IF8B 3MACA 1U4QA 3C64A 5DJQC 4HFVA 4EXTA 5J2UE 4EAHA 2XHEB 2E9XD 5L3GB 4IHJE 2ACXA 2VK9A 2UXNB 2UXXB 1HS7A 2MYSA 3M65A 1H7CA 2NTYA 4WBOA 3CQGB 4U72A 5HWYA 3CMLA 5LCYA 2V7MA 2DHRA 4U74A 2KXPB 4PK4A 2BVMA 4EYUA 3RYCE 2N9DA 2Y48B 4WNKA 3HKEE 4EOZB 5CA1E 3KV5A 2NW7A 4H9OC 5LJNA 1IAPA 4QWNB 5JDFA 3WI3A 1D0YA 4PK5A 3ZMSB 5L2LA 1VRBA 4GK0E 3OKQA 1HG2A 3U3IA 2EHOC 3U78A 3J7Yq 4CXWA 2V7LA 2X67A 5H6RB 4XBFB 2LOPA 5LHHB 3RC8A 3KDSE 4X20E 2XAHB 4BAYB 1X79A 5JQGE 2NP9A 2IC9A 4ILUA 4PAGA 3LBXB 3PU8A 3HI2A 4MLKA 1YKEB 3AA0B 4X1KE 3O1JA 1EZ3A 3E0ZA 4OYKA 4AKHA 2DCFA 1Z0PA 4O4LE 2E9XA 4PJNA 1T98A 3C4ZA 5LOVE 1D1CA 3MXZA 4X1YE 3NZPA 4IE4A 4BJMA 3N9QA 2CLYC 1E1HB 3VU7H 3AAAB 4AKLA 3OBVE 5FNVE 3RYFE 1KK7A 3HKBE 3RX6A 5JR9C 2V26A 4CXYA 1HCIA 3ZN1B 4PJMA 2KLQA 4L0RA 1SA0E 2WSSV 4DNDA 2HPJA 5DQVA 3EVYA 4UF0A 1Y64B 5DABA 2LOSA 2A72A 3I0OA 4H9NC 4ZS2A 3AAEB 2RA1A 4P0BA 3ZYMA 3LK2B 4C91A 3RH3A 4DO0A 4ERRA 4CQIA 5HXSA 3JC6C 5LG4A 3K3QC 4B6XA 3ZEFB 3MA9A 2N2NA 4JUYA 2G0UA 3LK42 3BQIA 4O4JE 4UV9B 2D0TA 3H37A 4EZHA 2QA7A 2DLRA 2JRKA 4YHJA 2NWBA 3BQLA 2N1GA 5HAXA 3ZN0B 5FXXA 5IHYA 2NTXA 3EDVA 3CVRA 2MOZA 2X68A 2CM0A 2W00A 1IJ6A 2E9XC 2ODVA 2Q9QA 2ZM8A 3N9PA 5FXVA 4EZ4A 4BJNA 4ANJA 2K5BB 2JJ9A 2CCQA 3C50A 3PURA 4HTEA 4QXBB 3T8OA 3WAKA 4O8SA 2IAKA 5LGUB 1MIWA 2X9WA 4XAXB 3TKLB 1D0XA 4PJLA 4AQFA 3UULA 3B57A 4FI5A 2H3RA 1WYCA 2YEVC 1MIYA 4EIWA 4GYRA 3PUQA 5DQWA 2QGSA 4DBQA 2W62A 3O1HA 3HKDE 1BR0A 4KMCA 4IIJE 5J2TE 3BK9A 3Q2MA 3RRCA 4QXHB 1QUUA 3FBZA 5FY1A 4JEHB 5EK2A 3KV4A 3CX8B 3GN5B 3NZQA 4IE6A 3RPUA 2LJLA 2W61A 2VKOA 3DTOA 4IDZA 3AVSA 5LBQB 3R84B 1D1BA 4UIGA 2JPFA 3KBUA 2WMOA 2XAJB 1UCUA 3CPZA 2KT9A 2KWHA 2ODUA 4ISTA 4QX8B 2XAGB 2K9AA 3RC3A 2D0UA 3CKDA 2LEHA 2LSIA 1WYBA 3NRYA 2HPLA 4AI6A 3E08A 2EHOB 2ZM2A 4TV8E 3ZCJA 3FHNA 1KNZA 3N9NA 2ZLYA 1D1AA 5LA6E 3A5XA 3RYHE 4L5GA 4MHCA 5FYMA 2H7VC 3SS1A 2XQYA 5L3CB 1AJ3A 4PJJA 3MJXA 3AAIA 1B7TA 3LG7A 2XTLA 4FJOA 3RYIE 2W0GA 3LBXA 5L3DB 4QX7B 5C8YE 3DP7A 3PUGA 4H9RC 4V1Av 2DI4A 3N2KE 2NW9A 1D0ZA 2WMNA 1MMNA 4YJ3E 2Q9QD 3Q9DA 1ZKEA 4AQGA 4H9QC 3O9XA 1ZV4X 1VOMA 2VB6A 5JDLA 2D5UA 3FBLA 5JDMA 3LK3B 4QKNA 3ZMZB 3V5UA 2CEAA 2J1DG 5LBMA 1G73A 2V7JA 2XUEA 3UUMA 4H9PC 4TN7B 2LSYA 5JR9B 2L3LA 3QUJA 3KVAA 3UTKA 1V9DA 3S4UA 3ZC1A 4ASKA 4I4TE 2DWGA 3CX7B 3UUXB 5ADXL 1MMAA 3N2OA 1FMVA 3N9LA 4G2AA 3I1AA 4H63H 3P8CD 3AA7B 1LVFA 3BQKA 5BMVE 5HYAA 1LVKA 5JVDE 2JMHA 4OHFA 2GK9A 4E7SA 3AB3B 5JDNA 2CWYA 5GONE 4ISSA 2V7IA 3MKDA 4GYSA 5LYJE 4ZI7E 3P7IA 2A3DA 1BR2A 3B13A 3ZLIA 5JRCB 4H63V 5CA0E 4IE7A 5E0OA 3CWZB 2H7OA 3AA6B 2W63A 2MTQA 2BZBA 3F2EA 3NBXX 2C5JA 2LM9A 2X9HA 1UX5A 5ETWA 1IJ5A 2NOXA 1YD8G 5HXCA 4E7ZA 4EYYR 1HF8A 2WAUA 4CZZB 1LKXA 5JREA 3ZC0A 2XAFB 2VKJA 3ANWB 3K8PC 4YFSA 4GK5E 4C90A 2X66A 2CA5A 1QSDA 4BA9A 1FEWA 2XASB 3ONXA 2CWOA 4MALA 3ZMTB 1OXZA 5KX5E 1O3XA 4L9IA 2CXLA 3HL6A 2L8KA 4TUYE 5EK3A 3C4WA 2IW5B 2CXDA 3Q5WA 4MFRA 4PW8A 5LXTE 4CXXA 2CMRA 4UV8B 5EK4A 3CX6B 5HXEA 3IHRA 3OYXA 3PUSA 4M1PA 2KINB 3KBTA 2MBGA 3UUNA 3GN5A 1MNEA 4AKIA 4K0UA 4TX5A 3N5LA 4JEUB 3L09A 3PTRB 2M67A 3N2GE 3V5SA 3GWHA 2LSGA 3QC9A 2KWIB 4TZ4C 2YU1A 2YK0A 3R6NA 1S94A 4ZI3D 4PFPA 3K3NA 3KINB 2X9YA 3L3PA 1FIOA 2V7KA 1HX8A 2CXFA 2Z6EA 3Q5XA 2ZM0A 2Q9QC 2Y8DA 2LSKA 2V1DB 3QK6A 1SHZC 4IGUA 5A1LA 3PUAA 3N9MA 4I50E 4DMVA 2EHOA 3AA1B 3K3OA 5FY0A 4CI3B 4ZHQE 3ETUA 4ZI2C 3J9X1 2JQQA 5CB4E 1WLXA 4AKGA 3F31A 5L3EB 4AQFC 4NUVA 1MMDA 4DBRA 1G8XA 2LHNA 3VHLA 4O2AE 4UVAB 5LJMA 1IZNB 3I9WA 3N9OA 1YW0A 2ZMAA 2PG8A 4I43B 1WRDA 5FY7A 3C4XA 3MK7C 3VKGA 3GMIA 4O4IE 5FMNA 3I0QA 1US7B 4CI2B 4UXNB 3ZMUB 4XZCA 4G63A 2BVLA 2SPCA 3IBPA 1MNDA 3GA8A 3D0TA 4Z8XA 2CE7A 4A56A 1NAFA 4IE5A 3PDYA 2K48A 3EUHA 2KMFA 3PE0A 4UEMA 1MMGA 4UVBB 5H6QB 5JR9A 5TAOA 4HE8A 4DMWA 4PFOA 4DVDA 4ZI2D 4O4HE 2DNXA 3KV6A 2CLYB 3FXEB 1HFAA 2YINA 3KV9A 1U5PA 4P09A 5AFUL 2YU2A 2B1EA 3VKHA 2X9XA 5F8PA 3UT5E 2VASA 4O2BE 5LGNB 5JDHA 2LSJA 2P9BA 1HTJF 3FB2A 1NWMX 3E22E 1ZHCA 3OYZA 4OK0A 5JRCA 1CUNA 3OJAA 2A2FX 3UFEA 2PBIA 4YJ2E 3ETVA 2L9QA 2DWKA 3CQCB 3SRZA 1MIVA 5KDMC 3IEEA 4KBMB 5FXWA 3HA4A 2WBLA 3H3AA 3RKOA 4HGAA 5F3JA 1WR6A 4PNIA 3ANWA 3ZCIA 2C5IT 2VKHA 3KFWX 4UVCB 5IYZE 3C98B 3ZPOA 4UELA 4I55E 2E9XB 3O4XE 5KMGP 1UX4A 4OYJA 2EHOD 4JLEA 3LFMA 4X1IE 2WWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWK A;  3CWZ B;  2DWG A;  4GIW A;  2CXL A;  2CXF A; 
#chains in the Genus database with same CATH topology
 3LJC A;  3ZJ1 A;  4YLH A;  3NRX A;  2VL8 A;  4IL9 A;  3KVB A;  5AQL B;  2NW8 A;  4CN6 A;  2NR4 A;  4UF0 B;  4IRE A;  4ZOL E;  3C51 A;  1FMW A;  4WBN E;  2IC6 A;  2JMK A;  5J0Z A;  4AXP A;  1OWA A;  4EED A;  2ES0 A;  5LP6 E;  3O1I A;  1ZEE A;  5HWX A;  2BDE A;  2V6Y A;  1OED A;  1BR4 A;  5FVK A;  2WWV A;  3UU6 A;  2WM9 A;  2RP4 A;  3ZYL A;  1YKH B;  5HXH A;  1S35 A;  4HFE A;  4X65 T;  3T1H T;  5L3B B;  4QHO A;  4EXT A;  4HFV A;  1J5E T;  1VCT A;  2QYW A;  2UXX B;  1HS7 A;  2MYS A;  2V7M A;  4U74 A;  1N33 T;  3L39 A;  4CN4 A;  4EYU A;  2N9D A;  3KV5 A;  1IAP A;  4QWN B;  3ZMS B;  3OKQ A;  5HEH A;  4B3S T;  2B76 A;  4U33 A;  4LFC T;  2V7L A;  4XBF B;  3RC8 A;  2BKN A;  4BAY B;  2WDR A;  1JNZ A;  4ILU A;  4MLK A;  4TNV A;  3SFD A;  4LFA T;  3C4Z A;  4X1Y E;  3NZP A;  4IE4 A;  3PJA J;  3A8Y C;  2E5V A;  4AKL A;  2CBI A;  3HKB E;  1HCI A;  3ZN1 B;  4PJM A;  1SA0 E;  1HNW T;  2WSS V;  1R8I A;  2LOS A;  3I0O A;  4H9N C;  4YHH T;  4DO0 A;  3ZEF B;  3MA9 A;  4X66 T;  3LK4 2;  5ABG A;  5FL1 A;  2DLR A;  2VQF T;  1HNZ T;  2N1G A;  5FXX A;  3OPC A;  2E9X C;  3EHZ A;  3ZST A;  2JJ9 A;  4QXB B;  2IAK A;  4XAX B;  1FJG T;  1D0X A;  4LFB T;  1WYC A;  2V8S V;  5HEU A;  2FJE A;  4JYA T;  4LML A;  4DV7 T;  3K1S A;  4EGW A;  5J2T E;  5L47 A;  4QXH B;  4KX6 A;  3CX8 B;  3RPU A;  3FZL B;  5AQG B;  4IDZ A;  3AVS A;  4UIG A;  3KBU A;  1Z8U A;  2BKP A;  2K9A A;  3RC3 A;  2D0U A;  2W4X A;  3RLF F;  2XQ4 A;  3NRY A;  4ILC A;  3AE8 A;  4GKJ T;  3FHN A;  3RIF A;  3UU8 A;  4MHC A;  3AEE A;  3AAI A;  4FJO A;  2W0G A;  3LBX A;  4DR7 T;  3DP7 A;  3PUG A;  4V1A v;  2DI4 A;  2NW9 A;  2WMN A;  4YJ3 E;  2OLT A;  4QH4 A;  4B3R T;  4H9Q C;  3O9X A;  5JDM A;  3LK3 B;  3ZMZ B;  4ZZC A;  2XY8 B;  1G73 A;  4H9P C;  2WQY A;  5IWA T;  5ADX L;  3N9L A;  3CIR A;  2JMH A;  2GK9 A;  3AB3 B;  5JDN A;  1QLB A;  3B13 A;  2VVN A;  1KNR A;  2W63 A;  3UU4 A;  1YD8 G;  4EYY R;  5FKY A;  4GK5 E;  3JCF A;  2W2U A;  4L9I A;  2CXL A;  4TUY E;  2L8K A;  2CXD A;  4MFR A;  5EK4 A;  3IHR A;  3OYX A;  2MBG A;  3UUN A;  3L09 A;  3V5S A;  3RI5 A;  4NXN T;  4YXD A;  1GQE A;  2YK0 A;  2J4G A;  4ZI3 D;  4PFP A;  3K3N A;  3KIN B;  2X9Y A;  4HWF A;  1KF6 A;  2LKH A;  2YDS A;  2Q9Q C;  3PUA A;  3B5M A;  4I50 E;  3AA1 B;  2BBH A;  5FY0 A;  2YDR A;  2XZE A;  4NUV A;  4YTP A;  4O2A E;  3TLW A;  5LJM A;  3I9W A;  1YW0 A;  4X62 T;  1WRD A;  3VKG A;  1T7S A;  3SFE A;  2BVL A;  3IBP A;  3D0T A;  4Z8X A;  3P4P A;  2CE7 A;  3AE9 A;  4A56 A;  3EUH A;  3PE0 A;  2KMF A;  4UVB B;  5H6Q B;  5JR9 A;  4WZX A;  5CGM A;  4DID B;  4DMW A;  4DV5 T;  4B3M T;  4YSY A;  3UFG A;  2VAS A;  3ZT7 A;  2BG9 E;  2P9B A;  3PUZ F;  1NWM X;  3OYZ A;  2UU9 T;  4OK0 A;  3OJA A;  3PV0 F;  1N34 T;  2F4V T;  1MIV A;  1XNQ T;  3HA4 A;  3RKO A;  2R6G F;  5IYZ E;  4DUZ T;  3ZPO A;  4X1I E;  2LHR A;  4A5X A;  5L3F B;  3SOL A;  4J2C A;  2WZI A;  3I9Y A;  1UK5 A;  4KP3 C;  4GOU A;  2Y6X A;  5CFB A;  4CI1 B;  3SWH A;  5LNK A;  3EDU A;  5ABE A;  5JDQ A;  2D2S A;  3H3M A;  2UXC T;  2BS3 A;  3AXJ A;  2VWA A;  5FP3 A;  2WS3 A;  2IHR 1;  3W15 B;  4P0A A;  2Q9Q B;  3ESL A;  2HH7 A;  4WW0 A;  4GIW A;  2XQA A;  1I6Z A;  2WDQ A;  3ZMV B;  4H9S E;  1N32 T;  4HKA A;  2C5K T;  2I0M A;  3FZM B;  3IF8 B;  1U4Q A;  3C64 A;  5L3G B;  4IHJ E;  1L0V A;  3M65 A;  4WBO A;  1HR0 T;  3AE4 A;  5CJ5 A;  2FUP A;  3RYC E;  2Y48 B;  1DU2 A;  2LRL A;  5LJN A;  2BG9 B;  5ABF B;  1OED C;  4WYV A;  3U78 A;  4CXW A;  5JTG A;  2HN1 A;  4DV2 T;  1X79 A;  4PAG A;  3HI2 A;  4HWI B;  1YKE B;  2FJB A;  4X1K E;  3E0Z A;  4IL4 A;  5AQO B;  4O4L E;  5LOV E;  1D1C A;  3MXZ A;  1IBK T;  3N9Q A;  2BS2 A;  3VU7 H;  4X5T A;  1VCS A;  3OBV E;  3RYF E;  3RX6 A;  2WB5 A;  1NEK A;  5AQN B;  2HPJ A;  5DQV A;  4UF0 A;  5DAB A;  4P0B A;  3ZYM A;  3LK2 B;  4TWF A;  4CQI A;  3FZF B;  3JC6 C;  3K3Q C;  4Z91 A;  4UV9 B;  4EZH A;  2OV9 A;  2HHH T;  4YHJ A;  5IHY A;  3EAB A;  3CVR A;  1IJ6 A;  3N9P A;  1UGO A;  5AQV B;  4ANJ A;  3PUR A;  2CCQ A;  2D9D A;  3JAE A;  4NIQ A;  4PJL A;  3UU3 A;  4AQF A;  4FI5 A;  4ILA A;  3O1H A;  1Y01 A;  3UU5 A;  1WR0 A;  4IIJ E;  3QNU A;  1I94 T;  2YN6 A;  3Q2M A;  3RRC A;  1QUU A;  4K0K T;  3KV4 A;  3GN5 B;  3NZQ A;  3T1Y T;  3QOF A;  2VKO A;  3RIU C;  2VVS A;  3PJA A;  4DV4 T;  1WYB A;  4TWH A;  1IBM T;  4LF9 T;  2WP9 A;  3ZCJ A;  1KNZ A;  1XDO A;  2ZLY A;  1D1A A;  2UXB T;  5LA6 E;  3A5X A;  4L5G A;  3SS1 A;  2KSR A;  4YTN A;  4IDQ A;  3RYI E;  5C8Y E;  3EAM A;  4X64 T;  3ONJ A;  3Q9D A;  4P1N A;  4LF4 T;  4AQG A;  2UXD T;  5C2T A;  2MPK A;  3V5U A;  2CEA A;  2XUE A;  3QUJ A;  3UTK A;  1V9D A;  2H89 A;  3UUX B;  2DWG A;  4ILB A;  5LMN T;  4G2A A;  3RQW A;  2YKS A;  1LVF A;  3PUY F;  3BQK A;  5JVD E;  4E7S A;  4JV5 T;  4GYS A;  4ZI7 E;  2A3D A;  1BR2 A;  4TWD A;  5JRC B;  4H63 V;  4DR3 T;  4IE7 A;  2H7O A;  2BZB A;  3F2E A;  4JI0 T;  2LM9 A;  4DV0 T;  2WAU A;  4KI0 F;  3AE7 A;  4KHZ F;  3K8P C;  2CA5 A;  2YOE A;  2CWO A;  5KX5 E;  1O3X A;  3L8R A;  2IW5 B;  4UV8 B;  2AXD S;  4JI7 T;  3EI0 A;  4JEU B;  3PTR B;  3N2G E;  3RGL A;  2IML A;  3GWH A;  2KWI B;  4TZ4 C;  3CK6 A;  2CBJ A;  2V7K A;  2ZM0 A;  5A1L A;  5F5W A;  3N9M A;  4ZHQ E;  2IDO B;  3J9X 1;  4AKG A;  3F31 A;  2CHN A;  3VHL A;  4KHP T;  2UUA T;  4I43 B;  3FZH B;  3C4X A;  3MK7 C;  3P4Q A;  3UQ4 A;  3I0Q A;  3ZMU B;  1N36 T;  3JAD A;  4IE5 A;  1KFY A;  2XJ7 A;  1HX1 B;  4JBW F;  4HE8 A;  4PFO A;  1WCR A;  3KV6 A;  3FXE B;  3KV9 A;  3AEB A;  4A97 A;  2X9X A;  4O2B E;  5LGN B;  2LRK A;  2LSJ A;  1HTJ F;  3RQU A;  3E22 E;  5HCJ A;  1XMO T;  2HN2 A;  3UFE A;  2PBI A;  4DR6 T;  2DWK A;  3RHW A;  3IEE A;  4KBM B;  5FXW A;  5IUX A;  2CPT A;  5F3J A;  1WR6 A;  4PNI A;  2VKH A;  3KFW X;  4UEL A;  4I55 E;  2E9X B;  1UX4 A;  5JDH A;  4EB6 E;  4N78 D;  2W66 A;  3ZJ2 A;  4PK6 A;  1LRZ A;  2LE8 A;  2E2A A;  5FXZ A;  2X0L B;  4LF5 T;  5LGT B;  4F6R C;  2XQ3 A;  2A9U A;  3RRW A;  2PFV A;  4YSZ A;  2K24 A;  3AEF A;  2XPK A;  3VR9 A;  2PJQ A;  2X0Y A;  1WFD A;  2OA5 A;  2LKG A;  4EV6 A;  4OFZ A;  3HR0 A;  4HEA A;  4HN9 A;  1YQ4 A;  4DUY T;  5L4E A;  3WAJ A;  2E8I A;  5J1G A;  4JI6 T;  3VRB A;  2LT3 A;  5J2U E;  2E9X D;  2VK9 A;  2UXN B;  3AE1 A;  1YQ3 A;  3CQG B;  2DHR A;  4EOZ B;  3HKE E;  2NW7 A;  2ZM6 T;  3WI3 A;  4PK5 A;  5L2L A;  1VRB A;  1HG2 A;  2EHO C;  3JAF A;  3J7Y q;  3TLV A;  4X20 E;  3P50 A;  2J62 A;  5JQG E;  4HFI A;  2NP9 A;  4YT0 A;  3PU8 A;  2FJA A;  3AA0 B;  1EZ3 A;  3AE5 A;  4DV1 T;  4OYK A;  2ACZ A;  1T98 A;  2AE9 A;  4JI3 T;  2CLY C;  1E1H B;  1KK7 A;  3UQ7 A;  5LB7 B;  1Y64 B;  2A72 A;  5AQK B;  3RH3 A;  5HXS A;  4B6X A;  4U2Z A;  4Z90 A;  2N2N A;  1E7P A;  5HEJ A;  1X9B A;  2JRK A;  2NWB A;  5HAX A;  3ZN0 B;  3EDV A;  2LM2 A;  2CM0 A;  2Q9Q A;  2WDV A;  4BJN A;  2LLY A;  4YSX A;  2K5B B;  3T8O A;  3WAK A;  5LGU B;  1MIW A;  2X9W A;  3TKL B;  2IUB A;  3B57 A;  3UUL A;  2YEV C;  1MIY A;  4LF8 T;  4EIW A;  3PUQ A;  4DBQ A;  2W62 A;  2V5D A;  1BR0 A;  3PUX F;  4KMC A;  3FBZ A;  1IBL T;  4JEH B;  5C3J A;  5EK2 A;  1J1J A;  2I6H A;  4LMJ A;  5LBQ B;  3RF1 A;  3CPZ A;  4A98 A;  4IST A;  2XAG B;  2BG9 A;  5ABF A;  2XSA A;  3FZK B;  3CKD A;  3AEG A;  2HPL A;  1E2A A;  1XNR T;  1UUR A;  2EHO B;  3NVO A;  4HWC A;  4IDO A;  3N9N A;  2JQ9 A;  3AEC A;  2CRB A;  3TLS A;  3RYH E;  3P4W A;  3MJX A;  1OED E;  5L3D B;  2VUR A;  2WY2 A;  4H9R C;  1D0Z A;  2Q9Q D;  3LDQ B;  1VOM A;  2VB6 A;  5JDL A;  4QKN A;  2J1D G;  4U31 A;  5LBM A;  2V7J A;  3UUM A;  2UUB T;  3KVA A;  4ASK A;  4I4T E;  4H63 H;  1FMV A;  4U2Y A;  3I1A A;  3P8C D;  5BMV E;  5HYA A;  2CWY A;  5GON E;  2V7I A;  5LYJ E;  2H88 A;  3ZLI A;  3AA6 B;  3OTO T;  2C5J A;  2XM1 A;  2X9H A;  1IJ5 A;  2NOX A;  1JNR A;  4E7Z A;  4CZZ B;  1LKX A;  2XAF B;  3ANW B;  2X66 A;  1QSD A;  1KEY A;  4BA9 A;  3ONX A;  3ZMT B;  1OXZ A;  3QB5 K;  3C4W A;  2WCA A;  2PTF A;  5LXT E;  4CXX A;  2CMR A;  3CX6 B;  4M1P A;  3GN5 A;  1MNE A;  3AED A;  4AKI A;  2FBW A;  2JQK A;  3ONL C;  2M67 A;  2W67 A;  1W0B A;  3ZSS A;  4OX9 T;  2VL0 A;  2LSG A;  1T8B A;  2YU1 A;  1XMQ T;  3R6N A;  1S94 A;  4JI5 T;  1KNP A;  5HCM A;  1HX8 A;  4DR2 T;  3Q5X A;  4HWD A;  2Y8D A;  3QK6 A;  2LSK A;  4IGU A;  4JI4 T;  4ZZB A;  3K3O A;  4CI3 B;  3ETU A;  3ZT5 A;  2V6Y B;  5CB4 E;  1WLX A;  1OED B;  3RKG A;  1G8X A;  1IZN B;  3P4S A;  5AQH B;  3N9O A;  2ZMA A;  4ZXL A;  4CI2 B;  4G63 A;  2SPC A;  4HFB A;  2JIW A;  2BS4 A;  3PDY A;  2K48 A;  4UEM A;  1MMG A;  4TNW A;  5TAO A;  5HEG A;  4ZI2 D;  4O4H E;  2DNX A;  1U5P A;  4P09 A;  5AFU L;  5AQT B;  2B1E A;  5AQJ B;  3UT5 E;  5F8P A;  5JRC A;  1CUN A;  2A2F X;  4YJ2 E;  1SE7 A;  2L9Q A;  3ETV A;  3P4R A;  5BR8 T;  2WBL A;  1CHU A;  5AQP B;  2XQ6 A;  2MAW A;  2XSB A;  2XQ9 A;  3ZCI A;  4IDP A;  2C5I T;  4UVC B;  4CN1 A;  3O4X E;  1ZOY A;  4GKK T;  4MBQ A;  4LF7 T;  4Q25 A;  3AVR A;  5L4H A;  4ZI3 C;  4NUU A;  3M3Z B;  2JQH A;  5AQS B;  3DJB A;  3ZYK A;  2KZ7 B;  3F57 A;  3AE6 A;  4ADZ A;  4TV9 E;  5M4Y A;  4QXC B;  3CQX C;  5LHI B;  1XZY A;  3VRA A;  3RIU A;  4KUM B;  1T72 A;  2XAQ B;  3OVU A;  5EZY E;  2C0S A;  3MZK B;  3NWI A;  3TLT A;  1SUM B;  2KND A;  4AKR B;  2VKD A;  5JH7 E;  3FXD B;  3HKC E;  3JC6 D;  4U7Y A;  5JDG A;  5LG3 A;  2X51 A;  1BR1 A;  4ZS3 A;  1HG5 A;  5HXR A;  5LHG B;  3PU3 A;  3ZT6 A;  1ZP0 A;  4DR4 T;  4IE0 A;  2I59 A;  3MAC A;  5DJQ C;  4EAH A;  3AEA A;  2XHE B;  2ACX A;  2XM2 A;  1H7C A;  2NTY A;  4U72 A;  5HWY A;  3CML A;  5LCY A;  4HWH A;  2KXP B;  4PK4 A;  2BVM A;  2J47 A;  4WNK A;  5CA1 E;  4U3C A;  4H9O C;  1W09 A;  5JDF A;  3QB5 A;  1D0Y A;  4GK0 E;  3U3I A;  3RIA A;  2XQ8 A;  4AQY T;  2X67 A;  5H6R B;  4HFD A;  2LOP A;  5LHH B;  3KDS E;  2XAH B;  4DV3 T;  1M62 A;  2IC9 A;  3LBX B;  3VR8 A;  3O1J A;  3PUV F;  4AKH A;  2DCF A;  1Z0P A;  4PJN A;  2E9X A;  3LSV A;  3ABV A;  4BJM A;  3AAA B;  5FNV E;  5JR9 C;  2V26 A;  4CXY A;  2KLQ A;  4L0R A;  4DND A;  3EVY A;  2WZH A;  4AIS A;  4DR1 T;  4ZS2 A;  3AAE B;  2RA1 A;  4C91 A;  4ERR A;  5LG4 A;  3Q5E A;  4JUY A;  2G0U A;  3BQI A;  4O4J E;  2D0T A;  3H37 A;  2QA7 A;  4I0U A;  4JI1 T;  4LMK A;  3BQL A;  1NEN A;  2NTX A;  4YTM A;  2MOZ A;  2X68 A;  5HEO A;  2W00 A;  2ZM8 A;  2ODV A;  5FXV A;  4EZ4 A;  2DL1 A;  1HNX T;  4UR9 A;  3C50 A;  4HTE A;  2FJD A;  4O8S A;  4IDN A;  2H3R A;  4GYR A;  5DQW A;  2QGS A;  4DV6 T;  3HKD E;  4HFC A;  4JI2 T;  3BK9 A;  1J5W A;  5LMU T;  5AQM B;  5FY1 A;  4B3T T;  4IE6 A;  2LJL A;  1W9R A;  4AIU A;  2W61 A;  4JI8 T;  3DTO A;  3R84 B;  1D1B A;  2JPF A;  1YXR A;  2WMO A;  2XAJ B;  1UCU A;  2KT9 A;  2KWH A;  2ODU A;  2WU5 A;  4QX8 B;  2LEH A;  2LSI A;  4QH5 A;  2CHO A;  4AI6 A;  3E08 A;  1UUS A;  5AQI B;  2ZM2 A;  4TV8 E;  5FYM A;  2H7V C;  2XQY A;  5L3C B;  1AJ3 A;  4PJJ A;  1B7T A;  3LG7 A;  2XTL A;  4QX7 B;  3PUW F;  3N2K E;  3NKZ A;  1MMN A;  4NXM T;  4IT4 A;  1ZKE A;  1ZV4 X;  2D5U A;  3FBL A;  2BG9 C;  4TN7 B;  2LSY A;  5JR9 B;  2L3L A;  3S4U A;  3ZC1 A;  5AQQ B;  3CX7 B;  2XQ7 A;  1MMA A;  3N2O A;  3AA7 B;  2RPA A;  2WU2 A;  1LVK A;  4OHF A;  1M7K A;  4ISS A;  3MKD A;  3P7I A;  3AE3 A;  2M6I A;  4U7I A;  2BBJ A;  5CA0 E;  4QH1 A;  5E0O A;  3CWZ B;  2MTQ A;  3G06 A;  3NBX X;  1UX5 A;  2E5L T;  4HFH A;  5ETW A;  5HXC A;  1HF8 A;  2V6X A;  4NPP A;  5JRE A;  5KXJ A;  2K3W A;  3ZC0 A;  1XDP A;  2VKJ A;  4C90 A;  4YFS A;  1FEW A;  2XAS B;  5ABH A;  4MAL A;  3HL6 A;  5EK3 A;  2M6B A;  3Q5W A;  4PW8 A;  3AE2 A;  3A7M A;  5HXE A;  3IA3 A;  3PUS A;  2KIN B;  3KBT A;  4K0U A;  4TX5 A;  3N5L A;  2VQE T;  4EEB A;  3QC9 A;  5FL0 A;  4COF A;  2QVA A;  4DR5 T;  3L3P A;  3X1D A;  1FIO A;  3AXJ B;  2CXF A;  2Z6E A;  4ZEY A;  2BKO A;  2V1D B;  1SHZ C;  5AQR B;  4LF6 T;  4DMV A;  2EHO A;  4ZI2 C;  2JQQ A;  2X0H A;  5L3E B;  4AQF C;  4DBR A;  1MMD A;  2LHN A;  4F8H A;  4UVA B;  2PG8 A;  5FY7 A;  2UUC T;  3GMI A;  4O4I E;  5FMN A;  1US7 B;  4UXN B;  4XZC A;  1XWM A;  1MND A;  3GA8 A;  3TLU A;  3ZKR A;  1NAF A;  3Q5D A;  2YDQ A;  4YY3 T;  5AQF B;  2QRX A;  4DVD A;  2IIU A;  2CLY B;  2XQ5 A;  1HFA A;  2YIN A;  2YU2 A;  3VKH A;  1W0A A;  3FB2 A;  1ZHC A;  3UUB A;  3CQC B;  3SRZ A;  2V5C A;  5KDM C;  3H3A A;  4HGA A;  5FVL A;  3ANW A;  3C98 B;  5AQU B;  5KMG P;  4OYJ A;  2EHO D;  4JLE A;  3LFM A;  2WWU A; 
#chains in the Genus database with same CATH homology
 3LJC A;  2LHR A;  4EB6 E;  4N78 D;  3ZJ1 A;  4MBQ A;  3ZJ2 A;  4PK6 A;  1LRZ A;  4YLH A;  3NRX A;  3AVR A;  2LE8 A;  2VL8 A;  4ZI3 C;  3SOL A;  5L3F B;  4NUU A;  3KVB A;  4J2C A;  2NW8 A;  3I9Y A;  3DJB A;  3ZYK A;  2KZ7 B;  4UF0 B;  3F57 A;  5FXZ A;  4KP3 C;  2X0L B;  4GOU A;  2Y6X A;  4ADZ A;  4ZOL E;  3SWH A;  4CI1 B;  4TV9 E;  3C51 A;  4F6R C;  1FMW A;  5LGT B;  3EDU A;  5LNK A;  4QXC B;  5M4Y A;  3CQX C;  5JDQ A;  2D2S A;  5LHI B;  3RRW A;  4WBN E;  2IC6 A;  2PFV A;  2JMK A;  2K24 A;  4KUM B;  4AXP A;  1OWA A;  2XAQ B;  5EZY E;  2ES0 A;  2PJQ A;  2C0S A;  5LP6 E;  3O1I A;  2VWA A;  3MZK B;  5FP3 A;  4P0A A;  3W15 B;  1ZEE A;  5HWX A;  2KND A;  2BDE A;  2OA5 A;  2Q9Q B;  4AKR B;  3ESL A;  2HH7 A;  4OFZ A;  3HR0 A;  4HEA A;  2VKD A;  4HN9 A;  4WW0 A;  5JH7 E;  3FXD B;  1BR4 A;  3HKC E;  3JC6 D;  2WM9 A;  2RP4 A;  4GIW A;  5JDG A;  2X51 A;  1BR1 A;  3ZYL A;  4ZS3 A;  1YKH B;  1HG5 A;  5HXR A;  5HXH A;  3ZMV B;  3WAJ A;  2E8I A;  4H9S E;  5J1G A;  1S35 A;  5LHG B;  4HKA A;  3PU3 A;  2C5K T;  2LT3 A;  4IE0 A;  5L3B B;  4QHO A;  2I59 A;  3IF8 B;  3MAC A;  1U4Q A;  3C64 A;  5DJQ C;  4HFV A;  4EXT A;  5J2U E;  4EAH A;  2XHE B;  2E9X D;  5L3G B;  4IHJ E;  2ACX A;  2VK9 A;  2UXN B;  2UXX B;  1HS7 A;  2MYS A;  3M65 A;  1H7C A;  2NTY A;  4WBO A;  3CQG B;  4U72 A;  5HWY A;  3CML A;  5LCY A;  2V7M A;  2DHR A;  4U74 A;  2KXP B;  4PK4 A;  2BVM A;  4EYU A;  3RYC E;  2N9D A;  2Y48 B;  4WNK A;  3HKE E;  4EOZ B;  5CA1 E;  3KV5 A;  2NW7 A;  4H9O C;  5LJN A;  1IAP A;  4QWN B;  5JDF A;  3WI3 A;  1D0Y A;  4PK5 A;  3ZMS B;  5L2L A;  1VRB A;  4GK0 E;  3OKQ A;  1HG2 A;  3U3I A;  2EHO C;  3U78 A;  3J7Y q;  4CXW A;  2V7L A;  2X67 A;  5H6R B;  4XBF B;  2LOP A;  5LHH B;  3RC8 A;  3KDS E;  4X20 E;  2XAH B;  4BAY B;  1X79 A;  5JQG E;  2NP9 A;  2IC9 A;  4ILU A;  4PAG A;  3LBX B;  3PU8 A;  3HI2 A;  4MLK A;  1YKE B;  3AA0 B;  4X1K E;  3O1J A;  1EZ3 A;  3E0Z A;  4OYK A;  4AKH A;  2DCF A;  1Z0P A;  4O4L E;  2E9X A;  4PJN A;  1T98 A;  3C4Z A;  5LOV E;  1D1C A;  3MXZ A;  4X1Y E;  3NZP A;  4IE4 A;  4BJM A;  3N9Q A;  2CLY C;  1E1H B;  3VU7 H;  3AAA B;  4AKL A;  3OBV E;  5FNV E;  3RYF E;  1KK7 A;  3HKB E;  3RX6 A;  5JR9 C;  2V26 A;  4CXY A;  1HCI A;  3ZN1 B;  4PJM A;  2KLQ A;  4L0R A;  1SA0 E;  2WSS V;  4DND A;  2HPJ A;  5DQV A;  3EVY A;  4UF0 A;  1Y64 B;  5DAB A;  2LOS A;  2A72 A;  3I0O A;  4H9N C;  4ZS2 A;  3AAE B;  2RA1 A;  4P0B A;  3ZYM A;  3LK2 B;  4C91 A;  3RH3 A;  4DO0 A;  4ERR A;  4CQI A;  5HXS A;  3JC6 C;  5LG4 A;  3K3Q C;  4B6X A;  3ZEF B;  3MA9 A;  2N2N A;  4JUY A;  2G0U A;  3LK4 2;  3BQI A;  4O4J E;  4UV9 B;  2D0T A;  3H37 A;  4EZH A;  2QA7 A;  2DLR A;  2JRK A;  4YHJ A;  2NWB A;  3BQL A;  2N1G A;  5HAX A;  3ZN0 B;  5FXX A;  5IHY A;  2NTX A;  3EDV A;  3CVR A;  2MOZ A;  2X68 A;  2CM0 A;  2W00 A;  1IJ6 A;  2E9X C;  2ODV A;  2Q9Q A;  2ZM8 A;  3N9P A;  5FXV A;  4EZ4 A;  4BJN A;  4ANJ A;  2K5B B;  2JJ9 A;  2CCQ A;  3C50 A;  3PUR A;  4HTE A;  4QXB B;  3T8O A;  3WAK A;  4O8S A;  2IAK A;  5LGU B;  1MIW A;  2X9W A;  4XAX B;  3TKL B;  1D0X A;  4PJL A;  4AQF A;  3UUL A;  3B57 A;  4FI5 A;  2H3R A;  1WYC A;  2YEV C;  1MIY A;  4EIW A;  4GYR A;  3PUQ A;  5DQW A;  2QGS A;  4DBQ A;  2W62 A;  3O1H A;  3HKD E;  1BR0 A;  4KMC A;  4IIJ E;  5J2T E;  3BK9 A;  3Q2M A;  3RRC A;  4QXH B;  1QUU A;  3FBZ A;  5FY1 A;  4JEH B;  5EK2 A;  3KV4 A;  3CX8 B;  3GN5 B;  3NZQ A;  4IE6 A;  3RPU A;  2LJL A;  2W61 A;  2VKO A;  3DTO A;  4IDZ A;  3AVS A;  5LBQ B;  3R84 B;  1D1B A;  4UIG A;  2JPF A;  3KBU A;  2WMO A;  2XAJ B;  1UCU A;  3CPZ A;  2KT9 A;  2KWH A;  2ODU A;  4IST A;  4QX8 B;  2XAG B;  2K9A A;  3RC3 A;  2D0U A;  3CKD A;  2LEH A;  2LSI A;  1WYB A;  3NRY A;  2HPL A;  4AI6 A;  3E08 A;  2EHO B;  2ZM2 A;  4TV8 E;  3ZCJ A;  3FHN A;  1KNZ A;  3N9N A;  2ZLY A;  1D1A A;  5LA6 E;  3A5X A;  3RYH E;  4L5G A;  4MHC A;  5FYM A;  2H7V C;  3SS1 A;  2XQY A;  5L3C B;  1AJ3 A;  4PJJ A;  3MJX A;  3AAI A;  1B7T A;  3LG7 A;  2XTL A;  4FJO A;  3RYI E;  2W0G A;  3LBX A;  5L3D B;  4QX7 B;  5C8Y E;  3DP7 A;  3PUG A;  4H9R C;  4V1A v;  2DI4 A;  3N2K E;  2NW9 A;  1D0Z A;  2WMN A;  1MMN A;  4YJ3 E;  2Q9Q D;  3Q9D A;  1ZKE A;  4AQG A;  4H9Q C;  3O9X A;  1ZV4 X;  1VOM A;  2VB6 A;  5JDL A;  2D5U A;  3FBL A;  5JDM A;  3LK3 B;  4QKN A;  3ZMZ B;  3V5U A;  2CEA A;  2J1D G;  5LBM A;  1G73 A;  2V7J A;  2XUE A;  3UUM A;  4H9P C;  4TN7 B;  2LSY A;  5JR9 B;  2L3L A;  3QUJ A;  3KVA A;  3UTK A;  1V9D A;  3S4U A;  3ZC1 A;  4ASK A;  4I4T E;  2DWG A;  3CX7 B;  3UUX B;  5ADX L;  1MMA A;  3N2O A;  1FMV A;  3N9L A;  4G2A A;  3I1A A;  4H63 H;  3P8C D;  3AA7 B;  1LVF A;  3BQK A;  5BMV E;  5HYA A;  1LVK A;  5JVD E;  2JMH A;  4OHF A;  2GK9 A;  4E7S A;  3AB3 B;  5JDN A;  2CWY A;  5GON E;  4ISS A;  2V7I A;  3MKD A;  4GYS A;  5LYJ E;  4ZI7 E;  3P7I A;  2A3D A;  1BR2 A;  3B13 A;  3ZLI A;  5JRC B;  4H63 V;  5CA0 E;  4IE7 A;  5E0O A;  3CWZ B;  2H7O A;  3AA6 B;  2W63 A;  2MTQ A;  2BZB A;  3F2E A;  3NBX X;  2C5J A;  2LM9 A;  2X9H A;  1UX5 A;  5ETW A;  1IJ5 A;  2NOX A;  1YD8 G;  5HXC A;  4E7Z A;  4EYY R;  1HF8 A;  2WAU A;  4CZZ B;  1LKX A;  5JRE A;  3ZC0 A;  2XAF B;  2VKJ A;  3ANW B;  3K8P C;  4YFS A;  4GK5 E;  4C90 A;  2X66 A;  2CA5 A;  1QSD A;  4BA9 A;  1FEW A;  2XAS B;  3ONX A;  2CWO A;  4MAL A;  3ZMT B;  1OXZ A;  5KX5 E;  1O3X A;  4L9I A;  2CXL A;  3HL6 A;  2L8K A;  4TUY E;  5EK3 A;  3C4W A;  2IW5 B;  2CXD A;  3Q5W A;  4MFR A;  4PW8 A;  5LXT E;  4CXX A;  2CMR A;  4UV8 B;  5EK4 A;  3CX6 B;  5HXE A;  3IHR A;  3OYX A;  3PUS A;  4M1P A;  2KIN B;  3KBT A;  2MBG A;  3UUN A;  3GN5 A;  1MNE A;  4AKI A;  4K0U A;  4TX5 A;  3N5L A;  4JEU B;  3L09 A;  3PTR B;  2M67 A;  3N2G E;  3V5S A;  3GWH A;  2LSG A;  3QC9 A;  2KWI B;  4TZ4 C;  2YU1 A;  2YK0 A;  3R6N A;  1S94 A;  4ZI3 D;  4PFP A;  3K3N A;  3KIN B;  2X9Y A;  3L3P A;  1FIO A;  2V7K A;  1HX8 A;  2CXF A;  2Z6E A;  3Q5X A;  2ZM0 A;  2Q9Q C;  2Y8D A;  2LSK A;  2V1D B;  3QK6 A;  1SHZ C;  4IGU A;  5A1L A;  3PUA A;  3N9M A;  4I50 E;  4DMV A;  2EHO A;  3AA1 B;  3K3O A;  5FY0 A;  4CI3 B;  4ZHQ E;  3ETU A;  4ZI2 C;  3J9X 1;  2JQQ A;  5CB4 E;  1WLX A;  4AKG A;  3F31 A;  5L3E B;  4AQF C;  4NUV A;  1MMD A;  4DBR A;  1G8X A;  2LHN A;  3VHL A;  4O2A E;  4UVA B;  5LJM A;  1IZN B;  3I9W A;  3N9O A;  1YW0 A;  2ZMA A;  2PG8 A;  4I43 B;  1WRD A;  5FY7 A;  3C4X A;  3MK7 C;  3VKG A;  3GMI A;  4O4I E;  5FMN A;  3I0Q A;  1US7 B;  4CI2 B;  4UXN B;  3ZMU B;  4XZC A;  4G63 A;  2BVL A;  2SPC A;  3IBP A;  1MND A;  3GA8 A;  3D0T A;  4Z8X A;  2CE7 A;  4A56 A;  1NAF A;  4IE5 A;  3PDY A;  2K48 A;  3EUH A;  2KMF A;  3PE0 A;  4UEM A;  1MMG A;  4UVB B;  5H6Q B;  5JR9 A;  5TAO A;  4HE8 A;  4DMW A;  4PFO A;  4DVD A;  4ZI2 D;  4O4H E;  2DNX A;  3KV6 A;  2CLY B;  3FXE B;  1HFA A;  2YIN A;  3KV9 A;  1U5P A;  4P09 A;  5AFU L;  2YU2 A;  2B1E A;  3VKH A;  2X9X A;  5F8P A;  3UT5 E;  2VAS A;  4O2B E;  5LGN B;  5JDH A;  2LSJ A;  2P9B A;  1HTJ F;  3FB2 A;  1NWM X;  3E22 E;  1ZHC A;  3OYZ A;  4OK0 A;  5JRC A;  1CUN A;  3OJA A;  2A2F X;  3UFE A;  2PBI A;  4YJ2 E;  3ETV A;  2L9Q A;  2DWK A;  3CQC B;  3SRZ A;  1MIV A;  5KDM C;  3IEE A;  4KBM B;  5FXW A;  3HA4 A;  2WBL A;  3H3A A;  3RKO A;  4HGA A;  5F3J A;  1WR6 A;  4PNI A;  3ANW A;  3ZCI A;  2C5I T;  2VKH A;  3KFW X;  4UVC B;  5IYZ E;  3C98 B;  3ZPO A;  4UEL A;  4I55 E;  2E9X B;  3O4X E;  5KMG P;  1UX4 A;  4OYJ A;  2EHO D;  4JLE A;  3LFM A;  4X1I E;  2WWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...