2CXFA

Run domain of rap2 interacting protein x, crystallized in c2 space group
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
167
structure length
167
Chain Sequence
MANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEVNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the RUN Domain of the RAP2-interacting Protein x
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords rap2 interacting protein x
total genus 38
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2005-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02759 RUN RUN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2cxfA00
3CWZB 2CXLA 2CXFA 2DWKA 4GIWA 2DWGA
chains in the Genus database with same CATH superfamily
2KMFA 5HEHA 2VQET 2RP4A 3SOLA 4UV8B 1MIVA 2IAKA 2XAFB 3LK3B 4A97A 2W0GA 2MTQA 5CA1E 5EK2A 2FJEA 2V8SV 2NW8A 2WBLA 2WB5A 2C0SA 2X66A 4O4IE 3RGLA 4F8HA 4PJMA 4BAYB 4IDQA 4LF6T 4AI6A 1QUUA 3TLVA 2YDSA 2BBHA 1FIOA 2W00A 5LJNA 1NAFA 1KNPA 1QLBA 2HHHT 4X64T 4U7YA 2DL1A 3LK2B 5ADXL 5HWXA 5L4EA 2L9QA 3CX8B 2ZLYA 4ZI2D 2JMHA 4DIDB 5EK3A 4K0UA 5CFBA 5CA0E 1ZKEA 5ABFB 5IYZE 4JI5T 4GK0E 4B3RT 3JCFA 5JDLA 4PFOA 1NWMX 3E22E 5FL0A 4AQFC 3LFMA 4IDOA 1HG5A 4JBWF 4PJJA 4AIUA 3ZMZB 3M3ZB 4Z91A 3IHRA 1YW0A 5HEOA 3AAAB 5H6RB 1HR0T 5AQHB 2VVSA 5FXWA 4OX9T 4YTMA 2DWGA 1OXZA 2RA1A 2SPCA 4ILUA 5LMUT 4DR3T 2N2NA 3RYIE 5HXEA 4EZHA 1W0BA 2EHOA 3BK9A 4O4HE 3UFEA 2PBIA 3JC6D 2D5UA 4WW0A 1G8XA 4IHJE 1R8IA 2JQKA 2YK0A 3QUJA 1VCTA 3PURA 5EK4A 3ZYMA 2XQ6A 3E0ZA 4A5XA 3PUYF 4YTNA 4B3MT 3N9PA 2VKHA 4IT4A 1UX5A 5DJQC 5HXSA 1YXRA 3AB3B 3LSVA 4ILAA 1WLXA 1DU2A 1IBMT 4Q25A 1YKEB 4U3CA 4ISTA 4UELA 5AQSB 4O2AE 5J0ZA 4K0KT 3AEFA 2E9XB 4YT0A 2YN6A 4DR4T 2XSAA 2WU2A 3P4SA 3LJCA 1KNRA 3NZQA 3PJAJ 1N32T 2NP9A 4DNDA 5AFUL 3KV5A 2X0YA 4TZ4C 1MMAA 3EUHA 5ABHA 2HPLA 2BG9E 2R6GF 4PAGA 4M1PA 2LEHA 5KX5E 2LE8A 1D0ZA 1UURA 2LRKA 4OYKA 4JI0T 1SE7A 3CQXC 2Q9QA 3ZEFB 2WCAA 2A2FX 5HAXA 3AVSA 4KMCA 4HKAA 4WBOA 3WAKA 4JLEA 3K3OA 2MYSA 5IWAT 4H9NC 2LRLA 2Y8DA 3RX6A 3NRXA 3L39A 3ZPOA 2X51A 3CMLA 3ZCJA 1KEYA 3FHNA 3RYFE 3O1IA 2W62A 3OPCA 3OYXA 4DR7T 1OWAA 3H37A 4EAHA 4CI1B 4I4TE 4HFCA 2V5CA 4GK5E 2XQ4A 1FMVA 3AECA 3RQWA 2CCQA 5LHIB 3I1AA 2CE7A 4YJ2E 1KK7A 4O4LE 1IBLT 2PFVA 4AKIA 4H9QC 3V5SA 1XMQT 3UFGA 2IC9A 1FMWA 2DNXA 5FXZA 3R6NA 3ZJ1A 3P4RA 3C50A 4TWHA 4HWFA 4G2AA 4H63H 4QX8B 3K3QC 1LVKA 4NUUA 4ASKA 2J62A 4JEUB 4PK6A 2XQ5A 2D0TA 3EAMA 3EDUA 2CXLA 2J47A 5DABA 5C8YE 2CEAA 4TWFA 2C5JA 4ZS2A 3H3MA 3MXZA 2CLYB 4GKJT 5AQRB 4LF5T 3P8CD 4KBMB 2I6HA 2MAWA 4UVCB 3VHLA 2X0LB 3CX7B 3KBUA 5LJMA 5C3JA 5JDNA 5CGMA 1GQEA 4FJOA 5LA6E 3Q5XA 2HN1A 4CI3B 4U33A 5JR9A 3TLWA 2XHEB 5JDGA 3ONLC 5C2TA 2BBJA 2HH7A 2Q9QC 4B3ST 1IJ5A 2VK9A 3R84B 2E9XC 4ZOLE 2WMNA 3AVRA 3AXJB 2UXXB 4ILCA 2CA5A 2CBIA 2XJ7A 4H9RC 3FBZA 1VCSA 3FXDB 4ZHQE 4C90A 5BMVE 5LHGB 1U5PA 2M6BA 4CZZB 3B5MA 4HN9A 3AE3A 3VRBA 3WAJA 2LHNA 2XM1A 3ZMTB 3TLSA 2BG9A 3C64A 3K8PC 4MLKA 2HN2A 4JI2T 2ODVA 3PUXF 3PUZF 2Q9QB 5ETWA 2HPJA 4U2YA 5AQIB 3ZSTA 2K5BB 3F31A 3OYZA 4DV1T 4DR2T 5KDMC 3I0QA 5AQPB 4UF0B 4XAXB 4IGUA 2YDRA 2K9AA 2J4GA 3OKQA 2JIWA 3T1HT 4AXPA 2E9XA 3FBLA 4AKRB 2V26A 1ZV4X 2VQFT 3QK6A 5JR9C 4JYAT 2A9UA 2XQYA 3HL6A 3QNUA 3EVYA 5GONE 2X68A 3PUSA 4ANJA 2YKSA 5JRCB 3NZPA 1XDPA 2BZBA 3HKDE 3ZYKA 2NTXA 2CBJA 2N1GA 3HA4A 3PTRB 4ZI7E 1D0YA 4HTEA 2BG9C 4JUYA 3MJXA 4O2BE 5FYMA 3RIUA 3TLTA 2D9DA 2E9XD 5FVKA 3O9XA 4AKHA 5DQWA 2BVMA 5JH7E 4KUMB 2CLYC 4PNIA 3K3NA 3ZN0B 5L47A 4HFVA 4GYRA 5LXTE 3F2EA 1IBKT 1WR6A 3VR8A 1ZP0A 3HKBE 3GN5A 3ESLA 4BA9A 3IEEA 3MZKB 4JI7T 2XQ7A 3VKHA 1IJ6A 1CHUA 4EIWA 4ZZCA 2L8KA 2V6YB 5IHYA 4CI2B 3MA9A 5L3EB 1HNZT 5ABEA 3AE6A 1HG2A 4I0UA 3PE0A 5L4HA 5L2LA 2DI4A 4DO0A 5FY1A 4DUZT 2IUBA 3KBTA 3KV9A 3N2GE 4AQYT 2WDVA 2P9BA 3S4UA 4X66T 2K24A 1HNXT 4GKKT 4DV0T 5JDFA 2YEVC 4DV6T 1X79A 3NWIA 4NXNT 2V6YA 4NXMT 3KFWX 5HXHA 1WCRA 4IIJE 2LT3A 4P0BA 5AQVB 4EXTA 5F3JA 4UVAB 3ZSSA 2XY8B 2QVAA 3AAIA 3PU3A 4OYJA 4HWCA 1I94T 4P0AA 4WBNE 3UUXB 2CRBA 2KWHA 4QXCB 5AQQB 3CKDA 3RLFF 5JDQA 1BR1A 1N34T 3N9OA 2FJDA 2WZHA 3C4XA 3KVBA 4LMJA 5KMGP 1M7KA 5AQGB 2B1EA 1WR0A 4B6XA 2UU9T 4JI3T 2XQAA 3P4QA 1BR2A 5HEJA 3QC9A 2D0UA 2JQ9A 2MOZA 1YD8G 3J7Yq 2XAJB 4DV4T 1XWMA 5JRCA 2A72A 3ZKRA 3RKGA 3JADA 4YY3T 2WDQA 3IA3A 3LK42 4IE7A 4OK0A 4UXNB 4UR9A 2IW5B 2WZIA 5LG3A 3FZLB 3AEAA 3Q2MA 4UEMA 2N9DA 1SHZC 5JR9B 1XNQT 1OEDB 2VVNA 3HR0A 4O4JE 3UU6A 1EZ3A 1W0AA 3TLUA 4JV5T 1V9DA 4QH4A 4PFPA 4U7IA 2LHRA 2M67A 3HI2A 4MALA 4PJLA 3PV0F 3RRWA 3AA7B 2VASA 3UU8A 1LRZA 2IIUA 5AQOB 2DCFA 4LF7T 2LSJA 3AA1B 3AAEB 2EHOC 1XZYA 2UUCT 2ES0A 2QYWA 2GK9A 4UV9B 1O3XA 3PUQA 4AKGA 4DBQA 2UXDT 2LLYA 2ZM2A 3RYCE 5A1LA 5LGUB 4LFCT 2UUBT 5J2UE 3CQCB 5LBMA 4ZI3D 1B7TA 2V7IA 4ZI3C 2FJBA 4ADZA 3PUVF 5HCMA 4L5GA 2CPTA 4EGWA 3JC6C 1NENA 2LJLA 2WQYA 2Z6EA 3N9NA 4PK4A 4YHJA 5FXXA 5LYJE 3CX6B 4NUVA 3AE5A 3RF1A 3ZLIA 3O1JA 1UCUA 4LFBT 3QB5A 4DMVA 3UUBA 3L09A 4QWNB 4ZEYA 4ISSA 4OFZA 5LHHB 4X62T 4TN7B 4IDZA 4I43B 3KV6A 3M65A 4HEAA 3HKCE 5JTGA 1Y01A 2ZM6T 4TWDA 4QH5A 3UQ7A 4TV9E 2K3WA 3F57A 4HWHA 3OJAA 5HEGA 2A3DA 3DTOA 2PTFA 4YTPA 4JEHB 4CXYA 2X9YA 1IAPA 2BS2A 3FXEB 4H63V 2WSSV 4L9IA 4NIQA 3P4PA 4QH1A 1JNZA 3RKOA 3SRZA 3U3IA 3AEGA 2WWVA 4X65T 2LOPA 2KNDA 1WYBA 1UX4A 4H9SE 3U78A 2X9XA 4LMLA 4HFEA 2H7OA 1HF8A 4JI8T 1WYCA 2BKOA 4HGAA 4DV5T 3QOFA 4TV8E 2XM2A 5LGTB 1D1BA 3I9YA 3Q5EA 2KZ7B 2W61A 3FZHB 3RYHE 3HKEE 3ZJ2A 2AE9A 4HFHA 5HWYA 4N78D 3RH3A 5KXJA 1MMGA 2V7KA 2CHOA 2LOSA 3FZKB 3FZMB 1VRBA 1WRDA 2W4XA 3BQIA 4QXBB 5JQGE 3CPZA 3OVUA 4E7SA 1YQ3A 2C5IT 2KINB 4YJ3E 1M62A 3EDVA 3UUMA 3UULA 1JNRA 1CUNA 5ABGA 1L0VA 3ZN1B 1J5ET 3C51A 2EHOB 1E1HB 2NW7A 3GWHA 4FI5A 3CVRA 5FMNA 3RC3A 1MNEA 4LFAT 2XAQB 4EYYR 1LVFA 1X9BA 2E8IA 2I0MA 2LSKA 3C4WA 3N5LA 3O4XE 5L3GB 1NEKA 3UU3A 3AA6B 2VWAA 2V7LA 4KP3C 5FNVE 1W9RA 3AE4A 4QKNA 3EABA 2QRXA 3ETVA 4HE8A 5JVDE 1HTJF 4OHFA 1T98A 3KVAA 4NPPA 3I9WA 4AISA 4GYSA 4WYVA 2VURA 2KSRA 4CQIA 2D2SA 4JI4T 1XNRT 2WY2A 2CWOA 3BQKA 2OA5A 4QX7B 4YXDA 1J5WA 2DHRA 3AEEA 3AE1A 3PUAA 5LCYA 2ZM8A 2FBWA 3Q9DA 4UVBB 3A7MA 5L3DB 3RIFA 5L3BB 3IBPA 2E2AA 5LG4A 2UXCT 2WS3A 4Z90A 2ODUA 5AQMB 3OBVE 3Q5DA 2EHOD 2JMKA 3UTKA 4DV7T 4TNWA 2MBGA 3H3AA 2LSYA 2WMOA 2UXNB 3C4ZA 3CWZB 1HFAA 3ONXA 3RPUA 1S94A 4CN4A 4U2ZA 3JAFA 3NRYA 4LMKA 4ERRA 3AA0B 4E7ZA 5HYAA 1AJ3A 4QXHB 1FEWA 4ZS3A 3AXJA 3JAEA 4IDNA 2ZMAA 2CHNA 1ZHCA 2LSIA 3UT5E 3DJBA 1HNWT 2V7MA 4KHZF 3CIRA 3BQLA 2WAUA 5AQNB 2CM0A 4IL4A 2XASB 4ILBA 3ANWA 3RRCA 3ZT5A 4EOZB 1HS7A 3ZMUB 3PUGA 4X5TA 5L3CB 5HEUA 2VKDA 3PDYA 3N9LA 1T7SA 4DVDA 5AQFB 4DMWA 2W67A 2DLRA 2W2UA 5FP3A 2X9WA 3PU8A 2KT9A 3UU5A 3B13A 4HFDA 3C98B 4CXWA 2V5DA 4YSZA 4U72A 2MPKA 2UUAT 4YSXA 2Q9QD 3RIUC 3SFEA 3ZMVB 3LDQB 4AKLA 3ZC1A 4IDPA 4P1NA 4DV3T 3TKLB 1MMDA 2H89A 3ANWB 3NKZA 3SFDA 1US7B 3AEBA 2VKJA 4YLHA 2YU1A 4LF8T 4ZZBA 3MK7C 4EYUA 3FB2A 2CXFA 2V1DB 3DP7A 5F5WA 2W66A 2LM9A 5J1GA 5LP6E 5BR8T 4TNVA 5LMNT 5AQUB 3QB5K 3V5UA 3ZC0A 1MIYA 1S35A 2FUPA 3UQ4A 2B76A 1LKXA 4BJMA 1FJGT 3AEDA 1Z8UA 4ZXLA 3X1DA 1HX8A 3AE9A 1BR0A 5TAOA 2H3RA 3N2KE 2E5VA 3A5XA 3VR9A 3GMIA 1UGOA 5E0OA 5LOVE 2M6IA 3ABVA 2XSBA 2NW9A 1MNDA 1U4QA 3N2OA 4G63A 1T8BA 2JJ9A 3RI5A 1E7PA 1H7CA 3P50A 4IE5A 3KV4A 4CN6A 5FVLA 5JDHA 4YHHT 4A56A 4XBFB 3ZCIA 3N9QA 3N9MA 5FY7A 4H9PC 1OEDA 3AE7A 3AE8A 1UK5A 5LBQB 4A98A 4LF4T 1Y64B 2IHR1 2Y48B 3PUWF 2OLTA 2LM2A 2NOXA 4JI6T 4L0RA 2CWYA 3KDSE 3NVOA 4EEBA 1KF6A 2WWUA 2XPKA 2YOEA 5F8PA 2H88A 2YINA 2ACXA 5HXRA 2YDQA 1ZEEA 4IE6A 4IE0A 2G0UA 5H6QB 3GA8A 3E08A 4YFSA 4F6RC 2F4VT 4GIWA 2JPFA 2BS4A 2K48A 3GN5B 4YSYA 1N36T 2WU5A 3CQGB 2XUEA 5HXCA 1YQ4A 2Y6XA 5LNKA 4DV2T 3T8OA 4AQFA 5L3FB 2E5LT 1XMOT 4HWDA 5AQJB 4HFIA 4IREA 2V7JA 4HFBA 4IL9A 4KI0F 1E2AA 1G73A 2KXPB 2WP9A 1J1JA 1SUMB 4MBQA 2YU2A 4Z8XA 4JI1T 3W15B 2ACZA 5JREA 4COFA 2L3LA 2J1DG 2XAHB 1D1AA 1WFDA 3PJAA 5FY0A 5DQVA 1HCIA 2VKOA 3D0TA 3IF8B 4I55E 2OV9A 3L8RA 1HX1B 2KLQA 4U31A 2UXBT 3VU7H 2JRKA 3WI3A 2X9HA 4TX5A 5M4YA 5J2TE 4CXXA 1ZOYA 2VB6A 4CN1A 5CJ5A 2RPAA 4EEDA 4PK5A 3ZT7A 2QGSA 3VRAA 3G06A 1OEDE 4X20E 4BJNA 2IMLA 4EB6E 2XAGB 4C91A 5FL1A 3EI0A 3B57A 2BG9B 3VKGA 5EZYE 4LF9T 3ZYLA 5JDMA 4H9OC 3O1HA 2V6XA 1SA0E 1BR4A 1Z0PA 2H7VC 1UUSA 3EHZA 4P09A 5AQTB 2XTLA 2C5KT 2PG8A 4X1IE 2FJAA 2VL8A 2BVLA 2JQHA 4V1Av 5AQKB 4AQGA 5ABFA 2NR4A 1KFYA 2W63A 2LKGA 2XZEA 1YKHB 2WM9A 4X1KE 3MACA 4DR1T 3SS1A 3RQUA 1KNZA 2ZM0A 4DBRA 2X67A 4UF0A 1W09A 1I6ZA 4EZ4A 2LKHA 2BKNA 3FZFB 4X1YE 2X0HA 4KHPT 4PW8A 3P7IA 2XQ9A 2AXDS 1T72A 1OEDC 3UU4A 3ONJA 4KX6A 4EV6A 2XQ3A 4DUYT 4MHCA 2I59A 4U74A 5LB7B 4MFRA 2CXDA 1VOMA 4UIGA 3T1YT 3L3PA 2BS3A 3K1SA 3SWHA 4GOUA 4HWIB 1MMNA 2PJQA 4QHOA 2BDEA 3ZMSB 3ZT6A 4ZI2C 3I0OA 1N33T 3LG7A 3LBXB 5AQLB 4PJNA 5LGNB 3AE2A 3KINB 3CK6A 4IE4A 4DR5T 2IC6A 3A8YC 1MIWA 2BKPA 2LSGA 5FKYA 3MKDA 2XQ8A 3NBXX 3RHWA 3P4WA 3Q5WA 4XZCA 2DWKA 2VL0A 5IUXA 4J2CA 1XDOA 5CB4E 5HCJA 4TUYE 1IZNB 5FXVA 4DR6T 2NTYA 2KWIB 1QSDA 1D0XA 2NWBA 2CMRA 2IDOB 3OTOT 3RC8A 1D1CA 4WNKA 4WZXA 4O8SA 2QA7A 3UUNA 4B3TT 3LBXA 3RIAA 2JQQA 3J9X1 4I50E 3ETUA 2WDRA
chains in the Genus database with same CATH topology
2KMFA 2RP4A 3SOLA 4UV8B 1MIVA 2IAKA 2XAFB 3LK3B 5CA1E 2W0GA 2MTQA 5EK2A 2NW8A 2WBLA 2X66A 2C0SA 4O4IE 4PJMA 4BAYB 1QUUA 1FIOA 2W00A 5LJNA 1NAFA 5ADXL 3LK2B 5HWXA 2L9QA 3CX8B 2ZLYA 4ZI2D 2JMHA 5EK3A 4K0UA 5CA0E 1ZKEA 5IYZE 4GK0E 5JDLA 4PFOA 1NWMX 3E22E 4AQFC 3LFMA 1HG5A 4PJJA 3ZMZB 3IHRA 1YW0A 3AAAB 5H6RB 5FXWA 2DWGA 1OXZA 2RA1A 2SPCA 4ILUA 2N2NA 3RYIE 5HXEA 4EZHA 3UFEA 2EHOA 3BK9A 4O4HE 2PBIA 3JC6D 2D5UA 4WW0A 1G8XA 4IHJE 2YK0A 3QUJA 5EK4A 3PURA 3ZYMA 3E0ZA 3N9PA 2VKHA 1UX5A 5DJQC 5HXSA 3AB3B 1WLXA 1YKEB 4ISTA 4UELA 4O2AE 2E9XB 3LJCA 3NZQA 2NP9A 4DNDA 5AFUL 3KV5A 4TZ4C 1MMAA 3EUHA 2HPLA 5KX5E 4PAGA 4M1PA 2LEHA 2LE8A 1D0ZA 4OYKA 3CQXC 2Q9QA 3ZEFB 2A2FX 5HAXA 3AVSA 4KMCA 4HKAA 4WBOA 3WAKA 4JLEA 3K3OA 2MYSA 4H9NC 2Y8DA 3ZPOA 3RX6A 3NRXA 2X51A 3CMLA 3ZCJA 3FHNA 3RYFE 3O1IA 2W62A 3OYXA 1OWAA 3H37A 4CI1B 4I4TE 4GK5E 1FMVA 2CCQA 5LHIB 3I1AA 2CE7A 4YJ2E 1KK7A 4O4LE 2PFVA 4AKIA 4H9QC 3V5SA 2IC9A 1FMWA 2DNXA 5FXZA 3R6NA 3ZJ1A 3C50A 4G2AA 4H63H 4QX8B 3K3QC 1LVKA 4NUUA 4ASKA 4JEUB 4PK6A 2D0TA 3EDUA 2CXLA 5DABA 5C8YE 2CEAA 2C5JA 4ZS2A 3MXZA 2CLYB 3P8CD 4KBMB 4UVCB 3VHLA 2X0LB 3CX7B 3KBUA 5LJMA 5JDNA 4FJOA 5LA6E 3Q5XA 4CI3B 5JR9A 2XHEB 5JDGA 2HH7A 2Q9QC 1IJ5A 2VK9A 3R84B 2E9XC 4ZOLE 2WMNA 3AVRA 4L0RA 2UXXB 5FXVA 2CA5A 4H9RC 3T8OA 5LHGB 3FBZA 3FXDB 5BMVE 4ZHQE 4C90A 1U5PA 4CZZB 4HN9A 3WAJA 2LHNA 3ZMTB 3C64A 3K8PC 4MLKA 2ODVA 5ETWA 2Q9QB 2HPJA 2K5BB 3F31A 3OYZA 5KDMC 3I0QA 4UF0B 4XAXB 4IGUA 2K9AA 3OKQA 4AXPA 2E9XA 3FBLA 4AKRB 2V26A 1ZV4X 3QK6A 5JR9C 2XQYA 3HL6A 3EVYA 5GONE 2X68A 3PUSA 4ANJA 5JRCB 3NZPA 2BZBA 3HKDE 3ZYKA 2NTXA 2N1GA 3HA4A 4ZI7E 3PTRB 1D0YA 4HTEA 4JUYA 4O2BE 3MJXA 5FYMA 3O9XA 2E9XD 4AKHA 5DQWA 2BVMA 5JH7E 4KUMB 2CLYC 4PNIA 3K3NA 3ZN0B 4HFVA 4GYRA 5LXTE 3F2EA 1WR6A 3HKBE 3GN5A 3ESLA 4BA9A 3IEEA 3MZKB 3VKHA 1IJ6A 4EIWA 2L8KA 5IHYA 4CI2B 5L3EB 3MA9A 1HG2A 5L2LA 3PE0A 2DI4A 4DO0A 5FY1A 3KBTA 3KV9A 3N2GE 2P9BA 3S4UA 2K24A 5JDFA 2YEVC 1X79A 3KFWX 5HXHA 4IIJE 2LT3A 4P0BA 4EXTA 5F3JA 4UVAB 3AAIA 3PU3A 4OYJA 4P0AA 4WBNE 3UUXB 2KWHA 4QXCB 3CKDA 5JDQA 1BR1A 3N9OA 3C4XA 3KVBA 5KMGP 2B1EA 4B6XA 1BR2A 3QC9A 2D0UA 2MOZA 1YD8G 3J7Yq 5JRCA 2XAJB 2A72A 4IE7A 3LK42 4OK0A 4UXNB 2IW5B 5JR9B 3Q2MA 4UEMA 2N9DA 1SHZC 3HR0A 4O4JE 1EZ3A 1V9DA 4PFPA 2LHRA 2M67A 3HI2A 4MALA 4PJLA 3RRWA 3AA7B 2VASA 1LRZA 2DCFA 2LSJA 3AA1B 3AAEB 2EHOC 2ES0A 2GK9A 4UV9B 1O3XA 3PUQA 4AKGA 4DBQA 3RYCE 2ZM2A 5A1LA 5LGUB 5J2UE 3CQCB 5LBMA 4ZI3D 1B7TA 2V7IA 4ZI3C 4ADZA 4EAHA 4L5GA 3JC6C 2LJLA 2Z6EA 4PK4A 3N9NA 5FXXA 5LYJE 4YHJA 3CX6B 4NUVA 3ZLIA 3O1JA 1UCUA 4DMVA 3L09A 4QWNB 4ISSA 4OFZA 5LHHB 4TN7B 4IDZA 4I43B 3KV6A 3M65A 4HEAA 3HKCE 4TV9E 3F57A 3OJAA 2A3DA 3DTOA 4JEHB 4CXYA 2X9YA 1IAPA 3FXEB 4H63V 4L9IA 2WSSV 3RRCA 3RKOA 3SRZA 3U3IA 2LOPA 2KNDA 1WYBA 1UX4A 4H9SE 3U78A 2X9XA 2H7OA 1HF8A 1WYCA 4HGAA 4TV8E 5LGTB 1D1BA 3I9YA 2KZ7B 2W61A 3RYHE 3ZJ2A 3HKEE 5HWYA 4N78D 3RH3A 1MMGA 2V7KA 2LOSA 5JQGE 1VRBA 1WRDA 3BQIA 4QXBB 3CPZA 4E7SA 2C5IT 2KINB 4YJ3E 3UULA 3UUMA 3EDVA 1CUNA 3ZN1B 3C51A 2EHOB 1E1HB 2NW7A 3GWHA 4FI5A 3CVRA 5FMNA 3RC3A 1MNEA 2XAQB 4EYYR 1LVFA 2LSKA 2E8IA 3C4WA 3N5LA 3O4XE 5L3GB 3AA6B 2VWAA 2V7LA 4KP3C 5FNVE 5JVDE 4QKNA 3ETVA 4HE8A 1HTJF 4OHFA 1T98A 3KVAA 3I9WA 4GYSA 4CQIA 2D2SA 2CWOA 3BQKA 2OA5A 4QX7B 2DHRA 3PUAA 5LCYA 2ZM8A 3Q9DA 4UVBB 5L3DB 5L3BB 3IBPA 5LG4A 2ODUA 3OBVE 2EHOD 2JMKA 3UTKA 2MBGA 3H3AA 2LSYA 2WMOA 2UXNB 3C4ZA 3CWZB 1HFAA 3ONXA 3RPUA 1S94A 3NRYA 4ERRA 4E7ZA 3AA0B 5HYAA 1AJ3A 4QXHB 1FEWA 4ZS3A 3UT5E 2ZMAA 1ZHCA 2LSIA 3DJBA 2V7MA 3BQLA 2WAUA 2CM0A 2XASB 3ANWA 4EOZB 1HS7A 3ZMUB 3PUGA 5L3CB 2VKDA 3PDYA 3N9LA 4DVDA 4DMWA 2DLRA 5FP3A 2X9WA 3PU8A 2KT9A 3B13A 3C98B 4CXWA 4U72A 2Q9QD 3ZMVB 4AKLA 3ZC1A 3TKLB 1MMDA 3ANWB 1US7B 4YLHA 2VKJA 2YU1A 3MK7C 4EYUA 3FB2A 2CXFA 2V1DB 3DP7A 5J1GA 5LP6E 2LM9A 4AI6A 3V5UA 3ZC0A 1MIYA 1S35A 4BJMA 1LKXA 1HX8A 1BR0A 5TAOA 2H3RA 3N2KE 3A5XA 3GMIA 5E0OA 5LOVE 2NW9A 1MNDA 1U4QA 3N2OA 4G63A 2JJ9A 5JDHA 1H7CA 4IE5A 3KV4A 4XBFB 4A56A 3ZCIA 3N9QA 3N9MA 5FY7A 4H9PC 5LBQB 1Y64B 2Y48B 2NOXA 2CWYA 3KDSE 2WWUA 5F8PA 2YINA 5HXRA 2ACXA 1ZEEA 4IE6A 4IE0A 2G0UA 5H6QB 3GA8A 3E08A 4YFSA 4F6RC 4GIWA 2JPFA 3GN5B 2K48A 3CQGB 2XUEA 5HXCA 2Y6XA 5LNKA 5L3FB 4AQFA 2V7JA 1G73A 2KXPB 4MBQA 2YU2A 4Z8XA 3W15B 5JREA 2L3LA 2J1DG 2XAHB 1D1AA 5FY0A 5DQVA 1HCIA 2VKOA 3D0TA 3IF8B 4I55E 2KLQA 3VU7H 2JRKA 3WI3A 2X9HA 4TX5A 5M4YA 5J2TE 4CXXA 2VB6A 4PK5A 2QGSA 4X20E 4BJNA 4EB6E 2XAGB 4C91A 3B57A 3VKGA 5EZYE 3ZYLA 5JDMA 4H9OC 3O1HA 1SA0E 1BR4A 2H7VC 1Z0PA 4P09A 4EZ4A 2XTLA 2C5KT 2PG8A 4X1IE 2VL8A 2BVLA 4AQGA 4V1Av 2W63A 1YKHB 2WM9A 4X1KE 3MACA 3SS1A 1KNZA 2ZM0A 4DBRA 2X67A 4UF0A 4X1YE 4PW8A 3P7IA 4MHCA 2I59A 4U74A 4MFRA 2CXDA 1VOMA 4UIGA 3L3PA 3SWHA 4GOUA 1MMNA 2PJQA 4QHOA 2BDEA 3ZMSB 4ZI2C 3I0OA 3LG7A 3LBXB 5LGNB 4PJNA 3KINB 4IE4A 2IC6A 1MIWA 2LSGA 3MKDA 3NBXX 3Q5WA 4XZCA 2DWKA 4J2CA 5CB4E 4TUYE 1IZNB 1QSDA 1D0XA 2KWIB 2NTYA 2NWBA 2CMRA 3RC8A 1D1CA 4WNKA 4O8SA 2QA7A 3UUNA 3LBXA 2JQQA 3J9X1 4I50E 3ETUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWZ B;  2CXL A;  2CXF A;  2DWK A;  4GIW A;  2DWG A; 
#chains in the Genus database with same CATH topology
 2KMF A;  5HEH A;  2VQE T;  2RP4 A;  3SOL A;  4UV8 B;  1MIV A;  2IAK A;  2XAF B;  3LK3 B;  4A97 A;  2W0G A;  2MTQ A;  5CA1 E;  5EK2 A;  2FJE A;  2V8S V;  2NW8 A;  2WBL A;  2WB5 A;  2C0S A;  2X66 A;  4O4I E;  3RGL A;  4F8H A;  4PJM A;  4BAY B;  4IDQ A;  4LF6 T;  4AI6 A;  1QUU A;  3TLV A;  2YDS A;  2BBH A;  1FIO A;  2W00 A;  5LJN A;  1NAF A;  1KNP A;  1QLB A;  2HHH T;  4X64 T;  4U7Y A;  2DL1 A;  3LK2 B;  5ADX L;  5HWX A;  5L4E A;  2L9Q A;  3CX8 B;  2ZLY A;  4ZI2 D;  2JMH A;  4DID B;  5EK3 A;  4K0U A;  5CFB A;  5CA0 E;  1ZKE A;  5ABF B;  5IYZ E;  4JI5 T;  4GK0 E;  4B3R T;  3JCF A;  5JDL A;  4PFO A;  1NWM X;  3E22 E;  5FL0 A;  4AQF C;  3LFM A;  4IDO A;  1HG5 A;  4JBW F;  4PJJ A;  4AIU A;  3ZMZ B;  3M3Z B;  4Z91 A;  3IHR A;  1YW0 A;  5HEO A;  3AAA B;  5H6R B;  1HR0 T;  5AQH B;  2VVS A;  5FXW A;  4OX9 T;  4YTM A;  2DWG A;  1OXZ A;  2RA1 A;  2SPC A;  4ILU A;  5LMU T;  4DR3 T;  2N2N A;  3RYI E;  5HXE A;  4EZH A;  1W0B A;  2EHO A;  3BK9 A;  4O4H E;  3UFE A;  2PBI A;  3JC6 D;  2D5U A;  4WW0 A;  1G8X A;  4IHJ E;  1R8I A;  2JQK A;  2YK0 A;  3QUJ A;  1VCT A;  3PUR A;  5EK4 A;  3ZYM A;  2XQ6 A;  3E0Z A;  4A5X A;  3PUY F;  4YTN A;  4B3M T;  3N9P A;  2VKH A;  4IT4 A;  1UX5 A;  5DJQ C;  5HXS A;  1YXR A;  3AB3 B;  3LSV A;  4ILA A;  1WLX A;  1DU2 A;  1IBM T;  4Q25 A;  1YKE B;  4U3C A;  4IST A;  4UEL A;  5AQS B;  4O2A E;  5J0Z A;  4K0K T;  3AEF A;  2E9X B;  4YT0 A;  2YN6 A;  4DR4 T;  2XSA A;  2WU2 A;  3P4S A;  3LJC A;  1KNR A;  3NZQ A;  3PJA J;  1N32 T;  2NP9 A;  4DND A;  5AFU L;  3KV5 A;  2X0Y A;  4TZ4 C;  1MMA A;  3EUH A;  5ABH A;  2HPL A;  2BG9 E;  2R6G F;  4PAG A;  4M1P A;  2LEH A;  5KX5 E;  2LE8 A;  1D0Z A;  1UUR A;  2LRK A;  4OYK A;  4JI0 T;  1SE7 A;  3CQX C;  2Q9Q A;  3ZEF B;  2WCA A;  2A2F X;  5HAX A;  3AVS A;  4KMC A;  4HKA A;  4WBO A;  3WAK A;  4JLE A;  3K3O A;  2MYS A;  5IWA T;  4H9N C;  2LRL A;  2Y8D A;  3RX6 A;  3NRX A;  3L39 A;  3ZPO A;  2X51 A;  3CML A;  3ZCJ A;  1KEY A;  3FHN A;  3RYF E;  3O1I A;  2W62 A;  3OPC A;  3OYX A;  4DR7 T;  1OWA A;  3H37 A;  4EAH A;  4CI1 B;  4I4T E;  4HFC A;  2V5C A;  4GK5 E;  2XQ4 A;  1FMV A;  3AEC A;  3RQW A;  2CCQ A;  5LHI B;  3I1A A;  2CE7 A;  4YJ2 E;  1KK7 A;  4O4L E;  1IBL T;  2PFV A;  4AKI A;  4H9Q C;  3V5S A;  1XMQ T;  3UFG A;  2IC9 A;  1FMW A;  2DNX A;  5FXZ A;  3R6N A;  3ZJ1 A;  3P4R A;  3C50 A;  4TWH A;  4HWF A;  4G2A A;  4H63 H;  4QX8 B;  3K3Q C;  1LVK A;  4NUU A;  4ASK A;  2J62 A;  4JEU B;  4PK6 A;  2XQ5 A;  2D0T A;  3EAM A;  3EDU A;  2CXL A;  2J47 A;  5DAB A;  5C8Y E;  2CEA A;  4TWF A;  2C5J A;  4ZS2 A;  3H3M A;  3MXZ A;  2CLY B;  4GKJ T;  5AQR B;  4LF5 T;  3P8C D;  4KBM B;  2I6H A;  2MAW A;  4UVC B;  3VHL A;  2X0L B;  3CX7 B;  3KBU A;  5LJM A;  5C3J A;  5JDN A;  5CGM A;  1GQE A;  4FJO A;  5LA6 E;  3Q5X A;  2HN1 A;  4CI3 B;  4U33 A;  5JR9 A;  3TLW A;  2XHE B;  5JDG A;  3ONL C;  5C2T A;  2BBJ A;  2HH7 A;  2Q9Q C;  4B3S T;  1IJ5 A;  2VK9 A;  3R84 B;  2E9X C;  4ZOL E;  2WMN A;  3AVR A;  3AXJ B;  2UXX B;  4ILC A;  2CA5 A;  2CBI A;  2XJ7 A;  4H9R C;  3FBZ A;  1VCS A;  3FXD B;  4ZHQ E;  4C90 A;  5BMV E;  5LHG B;  1U5P A;  2M6B A;  4CZZ B;  3B5M A;  4HN9 A;  3AE3 A;  3VRB A;  3WAJ A;  2LHN A;  2XM1 A;  3ZMT B;  3TLS A;  2BG9 A;  3C64 A;  3K8P C;  4MLK A;  2HN2 A;  4JI2 T;  2ODV A;  3PUX F;  3PUZ F;  2Q9Q B;  5ETW A;  2HPJ A;  4U2Y A;  5AQI B;  3ZST A;  2K5B B;  3F31 A;  3OYZ A;  4DV1 T;  4DR2 T;  5KDM C;  3I0Q A;  5AQP B;  4UF0 B;  4XAX B;  4IGU A;  2YDR A;  2K9A A;  2J4G A;  3OKQ A;  2JIW A;  3T1H T;  4AXP A;  2E9X A;  3FBL A;  4AKR B;  2V26 A;  1ZV4 X;  2VQF T;  3QK6 A;  5JR9 C;  4JYA T;  2A9U A;  2XQY A;  3HL6 A;  3QNU A;  3EVY A;  5GON E;  2X68 A;  3PUS A;  4ANJ A;  2YKS A;  5JRC B;  3NZP A;  1XDP A;  2BZB A;  3HKD E;  3ZYK A;  2NTX A;  2CBJ A;  2N1G A;  3HA4 A;  3PTR B;  4ZI7 E;  1D0Y A;  4HTE A;  2BG9 C;  4JUY A;  3MJX A;  4O2B E;  5FYM A;  3RIU A;  3TLT A;  2D9D A;  2E9X D;  5FVK A;  3O9X A;  4AKH A;  5DQW A;  2BVM A;  5JH7 E;  4KUM B;  2CLY C;  4PNI A;  3K3N A;  3ZN0 B;  5L47 A;  4HFV A;  4GYR A;  5LXT E;  3F2E A;  1IBK T;  1WR6 A;  3VR8 A;  1ZP0 A;  3HKB E;  3GN5 A;  3ESL A;  4BA9 A;  3IEE A;  3MZK B;  4JI7 T;  2XQ7 A;  3VKH A;  1IJ6 A;  1CHU A;  4EIW A;  4ZZC A;  2L8K A;  2V6Y B;  5IHY A;  4CI2 B;  3MA9 A;  5L3E B;  1HNZ T;  5ABE A;  3AE6 A;  1HG2 A;  4I0U A;  3PE0 A;  5L4H A;  5L2L A;  2DI4 A;  4DO0 A;  5FY1 A;  4DUZ T;  2IUB A;  3KBT A;  3KV9 A;  3N2G E;  4AQY T;  2WDV A;  2P9B A;  3S4U A;  4X66 T;  2K24 A;  1HNX T;  4GKK T;  4DV0 T;  5JDF A;  2YEV C;  4DV6 T;  1X79 A;  3NWI A;  4NXN T;  2V6Y A;  4NXM T;  3KFW X;  5HXH A;  1WCR A;  4IIJ E;  2LT3 A;  4P0B A;  5AQV B;  4EXT A;  5F3J A;  4UVA B;  3ZSS A;  2XY8 B;  2QVA A;  3AAI A;  3PU3 A;  4OYJ A;  4HWC A;  1I94 T;  4P0A A;  4WBN E;  3UUX B;  2CRB A;  2KWH A;  4QXC B;  5AQQ B;  3CKD A;  3RLF F;  5JDQ A;  1BR1 A;  1N34 T;  3N9O A;  2FJD A;  2WZH A;  3C4X A;  3KVB A;  4LMJ A;  5KMG P;  1M7K A;  5AQG B;  2B1E A;  1WR0 A;  4B6X A;  2UU9 T;  4JI3 T;  2XQA A;  3P4Q A;  1BR2 A;  5HEJ A;  3QC9 A;  2D0U A;  2JQ9 A;  2MOZ A;  1YD8 G;  3J7Y q;  2XAJ B;  4DV4 T;  1XWM A;  5JRC A;  2A72 A;  3ZKR A;  3RKG A;  3JAD A;  4YY3 T;  2WDQ A;  3IA3 A;  3LK4 2;  4IE7 A;  4OK0 A;  4UXN B;  4UR9 A;  2IW5 B;  2WZI A;  5LG3 A;  3FZL B;  3AEA A;  3Q2M A;  4UEM A;  2N9D A;  1SHZ C;  5JR9 B;  1XNQ T;  1OED B;  2VVN A;  3HR0 A;  4O4J E;  3UU6 A;  1EZ3 A;  1W0A A;  3TLU A;  4JV5 T;  1V9D A;  4QH4 A;  4PFP A;  4U7I A;  2LHR A;  2M67 A;  3HI2 A;  4MAL A;  4PJL A;  3PV0 F;  3RRW A;  3AA7 B;  2VAS A;  3UU8 A;  1LRZ A;  2IIU A;  5AQO B;  2DCF A;  4LF7 T;  2LSJ A;  3AA1 B;  3AAE B;  2EHO C;  1XZY A;  2UUC T;  2ES0 A;  2QYW A;  2GK9 A;  4UV9 B;  1O3X A;  3PUQ A;  4AKG A;  4DBQ A;  2UXD T;  2LLY A;  2ZM2 A;  3RYC E;  5A1L A;  5LGU B;  4LFC T;  2UUB T;  5J2U E;  3CQC B;  5LBM A;  4ZI3 D;  1B7T A;  2V7I A;  4ZI3 C;  2FJB A;  4ADZ A;  3PUV F;  5HCM A;  4L5G A;  2CPT A;  4EGW A;  3JC6 C;  1NEN A;  2LJL A;  2WQY A;  2Z6E A;  3N9N A;  4PK4 A;  4YHJ A;  5FXX A;  5LYJ E;  3CX6 B;  4NUV A;  3AE5 A;  3RF1 A;  3ZLI A;  3O1J A;  1UCU A;  4LFB T;  3QB5 A;  4DMV A;  3UUB A;  3L09 A;  4QWN B;  4ZEY A;  4ISS A;  4OFZ A;  5LHH B;  4X62 T;  4TN7 B;  4IDZ A;  4I43 B;  3KV6 A;  3M65 A;  4HEA A;  3HKC E;  5JTG A;  1Y01 A;  2ZM6 T;  4TWD A;  4QH5 A;  3UQ7 A;  4TV9 E;  2K3W A;  3F57 A;  4HWH A;  3OJA A;  5HEG A;  2A3D A;  3DTO A;  2PTF A;  4YTP A;  4JEH B;  4CXY A;  2X9Y A;  1IAP A;  2BS2 A;  3FXE B;  4H63 V;  2WSS V;  4L9I A;  4NIQ A;  3P4P A;  4QH1 A;  1JNZ A;  3RKO A;  3SRZ A;  3U3I A;  3AEG A;  2WWV A;  4X65 T;  2LOP A;  2KND A;  1WYB A;  1UX4 A;  4H9S E;  3U78 A;  2X9X A;  4LML A;  4HFE A;  2H7O A;  1HF8 A;  4JI8 T;  1WYC A;  2BKO A;  4HGA A;  4DV5 T;  3QOF A;  4TV8 E;  2XM2 A;  5LGT B;  1D1B A;  3I9Y A;  3Q5E A;  2KZ7 B;  2W61 A;  3FZH B;  3RYH E;  3HKE E;  3ZJ2 A;  2AE9 A;  4HFH A;  5HWY A;  4N78 D;  3RH3 A;  5KXJ A;  1MMG A;  2V7K A;  2CHO A;  2LOS A;  3FZK B;  3FZM B;  1VRB A;  1WRD A;  2W4X A;  3BQI A;  4QXB B;  5JQG E;  3CPZ A;  3OVU A;  4E7S A;  1YQ3 A;  2C5I T;  2KIN B;  4YJ3 E;  1M62 A;  3EDV A;  3UUM A;  3UUL A;  1JNR A;  1CUN A;  5ABG A;  1L0V A;  3ZN1 B;  1J5E T;  3C51 A;  2EHO B;  1E1H B;  2NW7 A;  3GWH A;  4FI5 A;  3CVR A;  5FMN A;  3RC3 A;  1MNE A;  4LFA T;  2XAQ B;  4EYY R;  1LVF A;  1X9B A;  2E8I A;  2I0M A;  2LSK A;  3C4W A;  3N5L A;  3O4X E;  5L3G B;  1NEK A;  3UU3 A;  3AA6 B;  2VWA A;  2V7L A;  4KP3 C;  5FNV E;  1W9R A;  3AE4 A;  4QKN A;  3EAB A;  2QRX A;  3ETV A;  4HE8 A;  5JVD E;  1HTJ F;  4OHF A;  1T98 A;  3KVA A;  4NPP A;  3I9W A;  4AIS A;  4GYS A;  4WYV A;  2VUR A;  2KSR A;  4CQI A;  2D2S A;  4JI4 T;  1XNR T;  2WY2 A;  2CWO A;  3BQK A;  2OA5 A;  4QX7 B;  4YXD A;  1J5W A;  2DHR A;  3AEE A;  3AE1 A;  3PUA A;  5LCY A;  2ZM8 A;  2FBW A;  3Q9D A;  4UVB B;  3A7M A;  5L3D B;  3RIF A;  5L3B B;  3IBP A;  2E2A A;  5LG4 A;  2UXC T;  2WS3 A;  4Z90 A;  2ODU A;  5AQM B;  3OBV E;  3Q5D A;  2EHO D;  2JMK A;  3UTK A;  4DV7 T;  4TNW A;  2MBG A;  3H3A A;  2LSY A;  2WMO A;  2UXN B;  3C4Z A;  3CWZ B;  1HFA A;  3ONX A;  3RPU A;  1S94 A;  4CN4 A;  4U2Z A;  3JAF A;  3NRY A;  4LMK A;  4ERR A;  3AA0 B;  4E7Z A;  5HYA A;  1AJ3 A;  4QXH B;  1FEW A;  4ZS3 A;  3AXJ A;  3JAE A;  4IDN A;  2ZMA A;  2CHN A;  1ZHC A;  2LSI A;  3UT5 E;  3DJB A;  1HNW T;  2V7M A;  4KHZ F;  3CIR A;  3BQL A;  2WAU A;  5AQN B;  2CM0 A;  4IL4 A;  2XAS B;  4ILB A;  3ANW A;  3RRC A;  3ZT5 A;  4EOZ B;  1HS7 A;  3ZMU B;  3PUG A;  4X5T A;  5L3C B;  5HEU A;  2VKD A;  3PDY A;  3N9L A;  1T7S A;  4DVD A;  5AQF B;  4DMW A;  2W67 A;  2DLR A;  2W2U A;  5FP3 A;  2X9W A;  3PU8 A;  2KT9 A;  3UU5 A;  3B13 A;  4HFD A;  3C98 B;  4CXW A;  2V5D A;  4YSZ A;  4U72 A;  2MPK A;  2UUA T;  4YSX A;  2Q9Q D;  3RIU C;  3SFE A;  3ZMV B;  3LDQ B;  4AKL A;  3ZC1 A;  4IDP A;  4P1N A;  4DV3 T;  3TKL B;  1MMD A;  2H89 A;  3ANW B;  3NKZ A;  3SFD A;  1US7 B;  3AEB A;  2VKJ A;  4YLH A;  2YU1 A;  4LF8 T;  4ZZB A;  3MK7 C;  4EYU A;  3FB2 A;  2CXF A;  2V1D B;  3DP7 A;  5F5W A;  2W66 A;  2LM9 A;  5J1G A;  5LP6 E;  5BR8 T;  4TNV A;  5LMN T;  5AQU B;  3QB5 K;  3V5U A;  3ZC0 A;  1MIY A;  1S35 A;  2FUP A;  3UQ4 A;  2B76 A;  1LKX A;  4BJM A;  1FJG T;  3AED A;  1Z8U A;  4ZXL A;  3X1D A;  1HX8 A;  3AE9 A;  1BR0 A;  5TAO A;  2H3R A;  3N2K E;  2E5V A;  3A5X A;  3VR9 A;  3GMI A;  1UGO A;  5E0O A;  5LOV E;  2M6I A;  3ABV A;  2XSB A;  2NW9 A;  1MND A;  1U4Q A;  3N2O A;  4G63 A;  1T8B A;  2JJ9 A;  3RI5 A;  1E7P A;  1H7C A;  3P50 A;  4IE5 A;  3KV4 A;  4CN6 A;  5FVL A;  5JDH A;  4YHH T;  4A56 A;  4XBF B;  3ZCI A;  3N9Q A;  3N9M A;  5FY7 A;  4H9P C;  1OED A;  3AE7 A;  3AE8 A;  1UK5 A;  5LBQ B;  4A98 A;  4LF4 T;  1Y64 B;  2IHR 1;  2Y48 B;  3PUW F;  2OLT A;  2LM2 A;  2NOX A;  4JI6 T;  4L0R A;  2CWY A;  3KDS E;  3NVO A;  4EEB A;  1KF6 A;  2WWU A;  2XPK A;  2YOE A;  5F8P A;  2H88 A;  2YIN A;  2ACX A;  5HXR A;  2YDQ A;  1ZEE A;  4IE6 A;  4IE0 A;  2G0U A;  5H6Q B;  3GA8 A;  3E08 A;  4YFS A;  4F6R C;  2F4V T;  4GIW A;  2JPF A;  2BS4 A;  2K48 A;  3GN5 B;  4YSY A;  1N36 T;  2WU5 A;  3CQG B;  2XUE A;  5HXC A;  1YQ4 A;  2Y6X A;  5LNK A;  4DV2 T;  3T8O A;  4AQF A;  5L3F B;  2E5L T;  1XMO T;  4HWD A;  5AQJ B;  4HFI A;  4IRE A;  2V7J A;  4HFB A;  4IL9 A;  4KI0 F;  1E2A A;  1G73 A;  2KXP B;  2WP9 A;  1J1J A;  1SUM B;  4MBQ A;  2YU2 A;  4Z8X A;  4JI1 T;  3W15 B;  2ACZ A;  5JRE A;  4COF A;  2L3L A;  2J1D G;  2XAH B;  1D1A A;  1WFD A;  3PJA A;  5FY0 A;  5DQV A;  1HCI A;  2VKO A;  3D0T A;  3IF8 B;  4I55 E;  2OV9 A;  3L8R A;  1HX1 B;  2KLQ A;  4U31 A;  2UXB T;  3VU7 H;  2JRK A;  3WI3 A;  2X9H A;  4TX5 A;  5M4Y A;  5J2T E;  4CXX A;  1ZOY A;  2VB6 A;  4CN1 A;  5CJ5 A;  2RPA A;  4EED A;  4PK5 A;  3ZT7 A;  2QGS A;  3VRA A;  3G06 A;  1OED E;  4X20 E;  4BJN A;  2IML A;  4EB6 E;  2XAG B;  4C91 A;  5FL1 A;  3EI0 A;  3B57 A;  2BG9 B;  3VKG A;  5EZY E;  4LF9 T;  3ZYL A;  5JDM A;  4H9O C;  3O1H A;  2V6X A;  1SA0 E;  1BR4 A;  1Z0P A;  2H7V C;  1UUS A;  3EHZ A;  4P09 A;  5AQT B;  2XTL A;  2C5K T;  2PG8 A;  4X1I E;  2FJA A;  2VL8 A;  2BVL A;  2JQH A;  4V1A v;  5AQK B;  4AQG A;  5ABF A;  2NR4 A;  1KFY A;  2W63 A;  2LKG A;  2XZE A;  1YKH B;  2WM9 A;  4X1K E;  3MAC A;  4DR1 T;  3SS1 A;  3RQU A;  1KNZ A;  2ZM0 A;  4DBR A;  2X67 A;  4UF0 A;  1W09 A;  1I6Z A;  4EZ4 A;  2LKH A;  2BKN A;  3FZF B;  4X1Y E;  2X0H A;  4KHP T;  4PW8 A;  3P7I A;  2XQ9 A;  2AXD S;  1T72 A;  1OED C;  3UU4 A;  3ONJ A;  4KX6 A;  4EV6 A;  2XQ3 A;  4DUY T;  4MHC A;  2I59 A;  4U74 A;  5LB7 B;  4MFR A;  2CXD A;  1VOM A;  4UIG A;  3T1Y T;  3L3P A;  2BS3 A;  3K1S A;  3SWH A;  4GOU A;  4HWI B;  1MMN A;  2PJQ A;  4QHO A;  2BDE A;  3ZMS B;  3ZT6 A;  4ZI2 C;  3I0O A;  1N33 T;  3LG7 A;  3LBX B;  5AQL B;  4PJN A;  5LGN B;  3AE2 A;  3KIN B;  3CK6 A;  4IE4 A;  4DR5 T;  2IC6 A;  3A8Y C;  1MIW A;  2BKP A;  2LSG A;  5FKY A;  3MKD A;  2XQ8 A;  3NBX X;  3RHW A;  3P4W A;  3Q5W A;  4XZC A;  2DWK A;  2VL0 A;  5IUX A;  4J2C A;  1XDO A;  5CB4 E;  5HCJ A;  4TUY E;  1IZN B;  5FXV A;  4DR6 T;  2NTY A;  2KWI B;  1QSD A;  1D0X A;  2NWB A;  2CMR A;  2IDO B;  3OTO T;  3RC8 A;  1D1C A;  4WNK A;  4WZX A;  4O8S A;  2QA7 A;  3UUN A;  4B3T T;  3LBX A;  3RIA A;  2JQQ A;  3J9X 1;  4I50 E;  3ETU A;  2WDR A; 
#chains in the Genus database with same CATH homology
 2KMF A;  2RP4 A;  3SOL A;  4UV8 B;  1MIV A;  2IAK A;  2XAF B;  3LK3 B;  5CA1 E;  2W0G A;  2MTQ A;  5EK2 A;  2NW8 A;  2WBL A;  2X66 A;  2C0S A;  4O4I E;  4PJM A;  4BAY B;  1QUU A;  1FIO A;  2W00 A;  5LJN A;  1NAF A;  5ADX L;  3LK2 B;  5HWX A;  2L9Q A;  3CX8 B;  2ZLY A;  4ZI2 D;  2JMH A;  5EK3 A;  4K0U A;  5CA0 E;  1ZKE A;  5IYZ E;  4GK0 E;  5JDL A;  4PFO A;  1NWM X;  3E22 E;  4AQF C;  3LFM A;  1HG5 A;  4PJJ A;  3ZMZ B;  3IHR A;  1YW0 A;  3AAA B;  5H6R B;  5FXW A;  2DWG A;  1OXZ A;  2RA1 A;  2SPC A;  4ILU A;  2N2N A;  3RYI E;  5HXE A;  4EZH A;  3UFE A;  2EHO A;  3BK9 A;  4O4H E;  2PBI A;  3JC6 D;  2D5U A;  4WW0 A;  1G8X A;  4IHJ E;  2YK0 A;  3QUJ A;  5EK4 A;  3PUR A;  3ZYM A;  3E0Z A;  3N9P A;  2VKH A;  1UX5 A;  5DJQ C;  5HXS A;  3AB3 B;  1WLX A;  1YKE B;  4IST A;  4UEL A;  4O2A E;  2E9X B;  3LJC A;  3NZQ A;  2NP9 A;  4DND A;  5AFU L;  3KV5 A;  4TZ4 C;  1MMA A;  3EUH A;  2HPL A;  5KX5 E;  4PAG A;  4M1P A;  2LEH A;  2LE8 A;  1D0Z A;  4OYK A;  3CQX C;  2Q9Q A;  3ZEF B;  2A2F X;  5HAX A;  3AVS A;  4KMC A;  4HKA A;  4WBO A;  3WAK A;  4JLE A;  3K3O A;  2MYS A;  4H9N C;  2Y8D A;  3ZPO A;  3RX6 A;  3NRX A;  2X51 A;  3CML A;  3ZCJ A;  3FHN A;  3RYF E;  3O1I A;  2W62 A;  3OYX A;  1OWA A;  3H37 A;  4CI1 B;  4I4T E;  4GK5 E;  1FMV A;  2CCQ A;  5LHI B;  3I1A A;  2CE7 A;  4YJ2 E;  1KK7 A;  4O4L E;  2PFV A;  4AKI A;  4H9Q C;  3V5S A;  2IC9 A;  1FMW A;  2DNX A;  5FXZ A;  3R6N A;  3ZJ1 A;  3C50 A;  4G2A A;  4H63 H;  4QX8 B;  3K3Q C;  1LVK A;  4NUU A;  4ASK A;  4JEU B;  4PK6 A;  2D0T A;  3EDU A;  2CXL A;  5DAB A;  5C8Y E;  2CEA A;  2C5J A;  4ZS2 A;  3MXZ A;  2CLY B;  3P8C D;  4KBM B;  4UVC B;  3VHL A;  2X0L B;  3CX7 B;  3KBU A;  5LJM A;  5JDN A;  4FJO A;  5LA6 E;  3Q5X A;  4CI3 B;  5JR9 A;  2XHE B;  5JDG A;  2HH7 A;  2Q9Q C;  1IJ5 A;  2VK9 A;  3R84 B;  2E9X C;  4ZOL E;  2WMN A;  3AVR A;  4L0R A;  2UXX B;  5FXV A;  2CA5 A;  4H9R C;  3T8O A;  5LHG B;  3FBZ A;  3FXD B;  5BMV E;  4ZHQ E;  4C90 A;  1U5P A;  4CZZ B;  4HN9 A;  3WAJ A;  2LHN A;  3ZMT B;  3C64 A;  3K8P C;  4MLK A;  2ODV A;  5ETW A;  2Q9Q B;  2HPJ A;  2K5B B;  3F31 A;  3OYZ A;  5KDM C;  3I0Q A;  4UF0 B;  4XAX B;  4IGU A;  2K9A A;  3OKQ A;  4AXP A;  2E9X A;  3FBL A;  4AKR B;  2V26 A;  1ZV4 X;  3QK6 A;  5JR9 C;  2XQY A;  3HL6 A;  3EVY A;  5GON E;  2X68 A;  3PUS A;  4ANJ A;  5JRC B;  3NZP A;  2BZB A;  3HKD E;  3ZYK A;  2NTX A;  2N1G A;  3HA4 A;  4ZI7 E;  3PTR B;  1D0Y A;  4HTE A;  4JUY A;  4O2B E;  3MJX A;  5FYM A;  3O9X A;  2E9X D;  4AKH A;  5DQW A;  2BVM A;  5JH7 E;  4KUM B;  2CLY C;  4PNI A;  3K3N A;  3ZN0 B;  4HFV A;  4GYR A;  5LXT E;  3F2E A;  1WR6 A;  3HKB E;  3GN5 A;  3ESL A;  4BA9 A;  3IEE A;  3MZK B;  3VKH A;  1IJ6 A;  4EIW A;  2L8K A;  5IHY A;  4CI2 B;  5L3E B;  3MA9 A;  1HG2 A;  5L2L A;  3PE0 A;  2DI4 A;  4DO0 A;  5FY1 A;  3KBT A;  3KV9 A;  3N2G E;  2P9B A;  3S4U A;  2K24 A;  5JDF A;  2YEV C;  1X79 A;  3KFW X;  5HXH A;  4IIJ E;  2LT3 A;  4P0B A;  4EXT A;  5F3J A;  4UVA B;  3AAI A;  3PU3 A;  4OYJ A;  4P0A A;  4WBN E;  3UUX B;  2KWH A;  4QXC B;  3CKD A;  5JDQ A;  1BR1 A;  3N9O A;  3C4X A;  3KVB A;  5KMG P;  2B1E A;  4B6X A;  1BR2 A;  3QC9 A;  2D0U A;  2MOZ A;  1YD8 G;  3J7Y q;  5JRC A;  2XAJ B;  2A72 A;  4IE7 A;  3LK4 2;  4OK0 A;  4UXN B;  2IW5 B;  5JR9 B;  3Q2M A;  4UEM A;  2N9D A;  1SHZ C;  3HR0 A;  4O4J E;  1EZ3 A;  1V9D A;  4PFP A;  2LHR A;  2M67 A;  3HI2 A;  4MAL A;  4PJL A;  3RRW A;  3AA7 B;  2VAS A;  1LRZ A;  2DCF A;  2LSJ A;  3AA1 B;  3AAE B;  2EHO C;  2ES0 A;  2GK9 A;  4UV9 B;  1O3X A;  3PUQ A;  4AKG A;  4DBQ A;  3RYC E;  2ZM2 A;  5A1L A;  5LGU B;  5J2U E;  3CQC B;  5LBM A;  4ZI3 D;  1B7T A;  2V7I A;  4ZI3 C;  4ADZ A;  4EAH A;  4L5G A;  3JC6 C;  2LJL A;  2Z6E A;  4PK4 A;  3N9N A;  5FXX A;  5LYJ E;  4YHJ A;  3CX6 B;  4NUV A;  3ZLI A;  3O1J A;  1UCU A;  4DMV A;  3L09 A;  4QWN B;  4ISS A;  4OFZ A;  5LHH B;  4TN7 B;  4IDZ A;  4I43 B;  3KV6 A;  3M65 A;  4HEA A;  3HKC E;  4TV9 E;  3F57 A;  3OJA A;  2A3D A;  3DTO A;  4JEH B;  4CXY A;  2X9Y A;  1IAP A;  3FXE B;  4H63 V;  4L9I A;  2WSS V;  3RRC A;  3RKO A;  3SRZ A;  3U3I A;  2LOP A;  2KND A;  1WYB A;  1UX4 A;  4H9S E;  3U78 A;  2X9X A;  2H7O A;  1HF8 A;  1WYC A;  4HGA A;  4TV8 E;  5LGT B;  1D1B A;  3I9Y A;  2KZ7 B;  2W61 A;  3RYH E;  3ZJ2 A;  3HKE E;  5HWY A;  4N78 D;  3RH3 A;  1MMG A;  2V7K A;  2LOS A;  5JQG E;  1VRB A;  1WRD A;  3BQI A;  4QXB B;  3CPZ A;  4E7S A;  2C5I T;  2KIN B;  4YJ3 E;  3UUL A;  3UUM A;  3EDV A;  1CUN A;  3ZN1 B;  3C51 A;  2EHO B;  1E1H B;  2NW7 A;  3GWH A;  4FI5 A;  3CVR A;  5FMN A;  3RC3 A;  1MNE A;  2XAQ B;  4EYY R;  1LVF A;  2LSK A;  2E8I A;  3C4W A;  3N5L A;  3O4X E;  5L3G B;  3AA6 B;  2VWA A;  2V7L A;  4KP3 C;  5FNV E;  5JVD E;  4QKN A;  3ETV A;  4HE8 A;  1HTJ F;  4OHF A;  1T98 A;  3KVA A;  3I9W A;  4GYS A;  4CQI A;  2D2S A;  2CWO A;  3BQK A;  2OA5 A;  4QX7 B;  2DHR A;  3PUA A;  5LCY A;  2ZM8 A;  3Q9D A;  4UVB B;  5L3D B;  5L3B B;  3IBP A;  5LG4 A;  2ODU A;  3OBV E;  2EHO D;  2JMK A;  3UTK A;  2MBG A;  3H3A A;  2LSY A;  2WMO A;  2UXN B;  3C4Z A;  3CWZ B;  1HFA A;  3ONX A;  3RPU A;  1S94 A;  3NRY A;  4ERR A;  4E7Z A;  3AA0 B;  5HYA A;  1AJ3 A;  4QXH B;  1FEW A;  4ZS3 A;  3UT5 E;  2ZMA A;  1ZHC A;  2LSI A;  3DJB A;  2V7M A;  3BQL A;  2WAU A;  2CM0 A;  2XAS B;  3ANW A;  4EOZ B;  1HS7 A;  3ZMU B;  3PUG A;  5L3C B;  2VKD A;  3PDY A;  3N9L A;  4DVD A;  4DMW A;  2DLR A;  5FP3 A;  2X9W A;  3PU8 A;  2KT9 A;  3B13 A;  3C98 B;  4CXW A;  4U72 A;  2Q9Q D;  3ZMV B;  4AKL A;  3ZC1 A;  3TKL B;  1MMD A;  3ANW B;  1US7 B;  4YLH A;  2VKJ A;  2YU1 A;  3MK7 C;  4EYU A;  3FB2 A;  2CXF A;  2V1D B;  3DP7 A;  5J1G A;  5LP6 E;  2LM9 A;  4AI6 A;  3V5U A;  3ZC0 A;  1MIY A;  1S35 A;  4BJM A;  1LKX A;  1HX8 A;  1BR0 A;  5TAO A;  2H3R A;  3N2K E;  3A5X A;  3GMI A;  5E0O A;  5LOV E;  2NW9 A;  1MND A;  1U4Q A;  3N2O A;  4G63 A;  2JJ9 A;  5JDH A;  1H7C A;  4IE5 A;  3KV4 A;  4XBF B;  4A56 A;  3ZCI A;  3N9Q A;  3N9M A;  5FY7 A;  4H9P C;  5LBQ B;  1Y64 B;  2Y48 B;  2NOX A;  2CWY A;  3KDS E;  2WWU A;  5F8P A;  2YIN A;  5HXR A;  2ACX A;  1ZEE A;  4IE6 A;  4IE0 A;  2G0U A;  5H6Q B;  3GA8 A;  3E08 A;  4YFS A;  4F6R C;  4GIW A;  2JPF A;  3GN5 B;  2K48 A;  3CQG B;  2XUE A;  5HXC A;  2Y6X A;  5LNK A;  5L3F B;  4AQF A;  2V7J A;  1G73 A;  2KXP B;  4MBQ A;  2YU2 A;  4Z8X A;  3W15 B;  5JRE A;  2L3L A;  2J1D G;  2XAH B;  1D1A A;  5FY0 A;  5DQV A;  1HCI A;  2VKO A;  3D0T A;  3IF8 B;  4I55 E;  2KLQ A;  3VU7 H;  2JRK A;  3WI3 A;  2X9H A;  4TX5 A;  5M4Y A;  5J2T E;  4CXX A;  2VB6 A;  4PK5 A;  2QGS A;  4X20 E;  4BJN A;  4EB6 E;  2XAG B;  4C91 A;  3B57 A;  3VKG A;  5EZY E;  3ZYL A;  5JDM A;  4H9O C;  3O1H A;  1SA0 E;  1BR4 A;  2H7V C;  1Z0P A;  4P09 A;  4EZ4 A;  2XTL A;  2C5K T;  2PG8 A;  4X1I E;  2VL8 A;  2BVL A;  4AQG A;  4V1A v;  2W63 A;  1YKH B;  2WM9 A;  4X1K E;  3MAC A;  3SS1 A;  1KNZ A;  2ZM0 A;  4DBR A;  2X67 A;  4UF0 A;  4X1Y E;  4PW8 A;  3P7I A;  4MHC A;  2I59 A;  4U74 A;  4MFR A;  2CXD A;  1VOM A;  4UIG A;  3L3P A;  3SWH A;  4GOU A;  1MMN A;  2PJQ A;  4QHO A;  2BDE A;  3ZMS B;  4ZI2 C;  3I0O A;  3LG7 A;  3LBX B;  5LGN B;  4PJN A;  3KIN B;  4IE4 A;  2IC6 A;  1MIW A;  2LSG A;  3MKD A;  3NBX X;  3Q5W A;  4XZC A;  2DWK A;  4J2C A;  5CB4 E;  4TUY E;  1IZN B;  1QSD A;  1D0X A;  2KWI B;  2NTY A;  2NWB A;  2CMR A;  3RC8 A;  1D1C A;  4WNK A;  4O8S A;  2QA7 A;  3UUN A;  3LBX A;  2JQQ A;  3J9X 1;  4I50 E;  3ETU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...