2CXFA

Run domain of rap2 interacting protein x, crystallized in c2 space group
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
167
structure length
167
Chain Sequence
MANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEVNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the RUN Domain of the RAP2-interacting Protein x
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords rap2 interacting protein x
total genus 38
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2005-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02759 RUN RUN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2cxfA00
4GIWA 2CXLA 2DWKA 2CXFA 3CWZB 2DWGA
chains in the Genus database with same CATH superfamily
3FZKB 1QUUA 3AE6A 2LJLA 1BR1A 1YQ4A 3NWIA 3PUGA 4CI1B 3QK6A 3LK42 1HNXT 5FVKA 1HNZT 4CQIA 3IHRA 4IE0A 2BVLA 3L3PA 3OKQA 4XZCA 3KV4A 4X64T 4DVDA 5AQGB 2ES0A 1LVFA 4DMVA 4ZOLE 2V8SV 1S94A 2QRXA 3MA9A 3L8RA 4TN7B 3ZSSA 2NR4A 1H7CA 3EI0A 2NW8A 1I6ZA 1NAFA 2WP9A 4IE4A 4UR9A 4JI5T 3CX6B 2WQYA 4MFRA 4WW0A 5KX5E 2LM9A 3IEEA 5JVDE 1XWMA 4A56A 1WCRA 5LHHB 4H9RC 3KINB 4TUYE 3P4PA 2XQ7A 1HX8A 4ZZCA 1VCSA 2UUAT 2NOXA 5JQGE 1HNWT 3LJCA 2I6HA 2DI4A 1I94T 4AKRB 4C90A 5JDNA 4LFCT 5FP3A 2XM2A 5GONE 5JREA 2YEVC 3KBUA 3X1DA 4JI1T 3F57A 3LBXA 3Q5WA 3KV9A 4EGWA 3ZLIA 2HHHT 3DP7A 5LA6E 4ADZA 3AA0B 3LBXB 2DLRA 2IAKA 2ODUA 3GMIA 3LK2B 3LK3B 4GYRA 5JH7E 2YDRA 2ZM6T 3DJBA 2ZLYA 3FXDB 3JAFA 4GIWA 3GA8A 3TLVA 2X9YA 1XNRT 2XAHB 4HN9A 2H88A 3P50A 3EAMA 5L3FB 3T8OA 2LT3A 3UULA 1D0YA 2DHRA 3ETUA 4KP3C 1X79A 3RF1A 5HEOA 2CLYB 3RYHE 2M67A 1W0BA 1ZV4X 4ILUA 4DO0A 1JNRA 4ZI7E 5LCYA 1LRZA 2D5UA 1XDPA 5JDHA 3T1YT 4ZS2A 2UUCT 4DR4T 5DABA 5HWYA 3RRCA 4U74A 3KDSE 1SE7A 4DV2T 2F4VT 2L9QA 1NENA 3ESLA 4DV3T 2EHOA 4CXWA 3UUNA 5LMNT 2XQ9A 1OWAA 5AQRB 4JI0T 5FYMA 2VQFT 5HEJA 5FXZA 3AE9A 4QX8B 3N9PA 5JDLA 3V5SA 4X1KE 3LSVA 1MMNA 2QA7A 1J1JA 1KF6A 4PFOA 4YLHA 5HXRA 2ZM2A 3UU5A 2YN6A 2UXNB 4O4LE 5JR9A 3RC8A 2K3WA 2WBLA 5LG4A 5FMNA 4AKHA 4YY3T 2WCAA 2YK0A 3CX8B 3QB5K 4WBNE 5LYJE 2CXFA 3ZYKA 2Y6XA 3HKCE 3JAEA 1CHUA 3NVOA 3TLTA 4YXDA 3J7Yq 1WFDA 2HH7A 3HKBE 3N2GE 4HWCA 4ZI3D 3B5MA 4ZXLA 2KINB 2WZHA 2X0YA 4QH5A 2KSRA 4IE6A 5BR8T 4PFPA 2VVSA 4U2ZA 2IMLA 3H37A 2Q9QC 4X20E 5J1GA 1O3XA 2WWUA 3UUMA 4DBQA 5L47A 3F31A 5LP6E 1E7PA 5EZYE 2BBHA 4OYJA 4AQYT 3FZHB 1QLBA 5AQKB 1HCIA 4U7IA 3AVSA 5FNVE 4O2BE 1IBLT 1XMQT 2FJBA 3I9WA 4JYAT 3RYFE 4L0RA 4YSZA 2I0MA 4AISA 3M65A 2D0UA 5AQUB 3VKHA 4O4HE 3ZMZB 2ACXA 2L3LA 2HN2A 4BA9A 4EIWA 2KT9A 5KXJA 3AEDA 4DV5T 1AJ3A 4XBFB 4H9NC 2LOSA 3C4WA 3EVYA 3SFDA 1NWMX 3RIAA 2ZMAA 4A5XA 4EYUA 5ABHA 5LXTE 1YKEB 2X9HA 4Z91A 3CQXC 3KVAA 1Z0PA 4K0UA 4TNVA 4YHJA 4CXXA 4ERRA 1M62A 4A98A 2IW5B 3N9OA 2MOZA 1OEDB 1FEWA 3F2EA 1YQ3A 3K3OA 3AEAA 3RRWA 2W0GA 2X9XA 3G06A 3IF8B 2QVAA 3UUBA 3AAAB 2X51A 3RIUC 4CN4A 2BG9C 2KWIB 3RH3A 2XQ4A 3AAIA 2V1DB 5LMUT 4OYKA 1T8BA 5ABFA 3PUWF 2HN1A 3GN5B 3V5UA 3C4ZA 3VR8A 1CUNA 1YD8G 4CI2B 1KEYA 3H3MA 4PNIA 4EEDA 3ETVA 5HEUA 3ZC0A 5H6RB 3AAEB 2BKPA 5EK4A 5AQLB 4H9OC 2J62A 2EHOB 3EABA 5LHGB 2BZBA 3AE1A 2JPFA 4UXNB 4ZS3A 5AQNB 1IJ6A 3CWZB 3BQIA 2DL1A 4OFZA 2C5KT 5L3BB 4GKJT 1W9RA 1BR2A 2MTQA 5LB7B 2BG9E 4HFCA 2WMOA 4U3CA 3KV6A 4AQFC 3PDYA 2CCQA 5F3JA 2JMKA 3VRBA 2XTLA 5JDQA 3RYIE 4NUUA 2WDRA 4H9PC 2JQ9A 5JTGA 5F5WA 5LJNA 2UXDT 4UF0A 4QWNB 4X5TA 3K8PC 2G0UA 3ZT6A 3PJAA 4YJ3E 3RIUA 1JNZA 1NEKA 2WWVA 5KDMC 3VU7H 3ZMTB 2VK9A 4JEUB 2N9DA 4COFA 4DUZT 3AE4A 4ILCA 2W4XA 3ZYLA 5LHIB 3PE0A 3ZJ1A 4JUYA 4KBMB 4B3RT 2JQQA 4AXPA 1OXZA 2WS3A 4HKAA 5FL1A 3VR9A 1T72A 1XDOA 3CMLA 3FBLA 3PJAJ 5DQWA 4YJ2E 1OEDC 4IHJE 5HYAA 4ZHQE 2A9UA 5HEGA 3Q2MA 2XHEB 1T98A 3A5XA 3R84B 2BG9B 3CKDA 4ANJA 5AQMB 4V1Av 4LF4T 3CIRA 5AQPB 5F8PA 4YTNA 4G2AA 3R6NA 1N33T 4AQFA 1UGOA 5FVLA 5HXCA 2CM0A 4QHOA 2WB5A 5AQJB 2VQET 2IC9A 3U3IA 4TWFA 4UVAB 3W15B 3ZT7A 4AKGA 4HFHA 4LF7T 3P7IA 1IJ5A 3UT5E 2CPTA 2XQ6A 2NW9A 4ASKA 1T7SA 2VKDA 1ZKEA 4QX7B 1HR0T 3N2OA 3ZN0B 2XASB 3NBXX 4GYSA 4U33A 5CB4E 3RPUA 4IDNA 3ZEFB 4CZZB 4EAHA 2LSJA 2H3RA 4HWDA 4PJJA 3CX7B 2H89A 4UV9B 2ACZA 2E5VA 4UF0B 1SUMB 5AQHB 2J47A 4MALA 5M4YA 3WAJA 2UXXB 5AQFB 1OEDA 5HXSA 5JR9B 2M6BA 4LF9T 1BR0A 2LM2A 2YU1A 2V6XA 4PJMA 4XAXB 1W0AA 2MAWA 1WRDA 3P4WA 4UIGA 3ZCIA 4DIDB 4IE7A 1IAPA 4GKKT 3ZMUB 2IIUA 4F6RC 1OEDE 2E9XD 4CN6A 2EHOC 2KXPB 2NW7A 2YU2A 3OPCA 4LMKA 5CA0E 4LF6T 4AI6A 3UUXB 4EZ4A 2CWYA 3LDQB 3C64A 4EEBA 5JRCA 2EHOD 3HI2A 2E9XC 3O1JA 4CN1A 2E5LT 2RPAA 4L5GA 2BDEA 3JC6D 3O1HA 4HWFA 5FY7A 2FBWA 2CRBA 2HPLA 3AA7B 3HL6A 3PUXF 5JDFA 3AEEA 4ZI3C 4B3MT 1FJGT 4YSXA 2Q9QA 4ILAA 2E9XB 4UVBB 4YHHT 2BS4A 4I50E 4P09A 4U2YA 4FJOA 1V9DA 2CLYC 3KV5A 4DV6T 4F8HA 1WR0A 3KFWX 1MIWA 1UURA 2PTFA 2ZM8A 4OK0A 3PURA 2CBJA 1HFAA 3A8YC 2V7JA 2ZM0A 3I9YA 3MXZA 3AE3A 3FXEB 4JBWF 4BJNA 4DNDA 2OA5A 2NWBA 5AQIB 5L4HA 1SA0E 5AQSB 2AE9A 4GK5E 1N32T 2YINA 2BKNA 3ABVA 2JRKA 3Q5DA 4AKLA 3N9MA 3NZPA 3ZT5A 3AE2A 3VKGA 2M6IA 5J0ZA 4HFBA 4JI6T 1FIOA 1X9BA 2BG9A 3NZQA 1XMOT 3O4XE 2UXCT 2KMFA 3NKZA 4KUMB 4YFSA 2VKHA 4ZZBA 4DR5T 1B7TA 4JI7T 2CHOA 2JQKA 2CHNA 2QYWA 4X1IE 1ZHCA 2RA1A 5LGUB 3JCFA 2W67A 4H9QC 4JI8T 4PAGA 1KFYA 3CK6A 5HXEA 4Z8XA 3ONXA 2WSSV 4Q25A 4TV8E 2V7KA 1G8XA 2OV9A 2DNXA 2BVMA 2QGSA 4P0AA 3QC9A 1MMDA 2WU5A 4U31A 2X9WA 3WI3A 4ILBA 2H7VC 2K24A 3PUSA 4WBOA 1L0VA 4DMWA 2P9BA 4B3TT 5E0OA 1LKXA 2FUPA 3D0TA 4IDZA 3QB5A 4LFBT 2XY8B 2J1DG 1HG5A 2KZ7B 3LG7A 3PUYF 3OBVE 3T1HT 1E1HB 2YOEA 3N9LA 2LOPA 2YKSA 5LGNB 3ZMVB 4EYYR 5JDMA 1SHZC 5HCMA 2WY2A 3N5LA 2D9DA 4WYVA 3AEFA 4HTEA 1GQEA 2NTXA 4IIJE 1VOMA 2A3DA 4ZEYA 2I59A 3UQ4A 1D0ZA 3UTKA 2CMRA 3AEGA 5IHYA 4ISSA 3UU8A 1HTJF 2WAUA 4EV6A 4K0KT 3FZFB 3P4RA 4WNKA 1US7B 2XPKA 1U4QA 1Y64B 5ABGA 5C2TA 5CGMA 4NXMT 2X67A 4QXBB 5LG3A 1LVKA 4NUVA 3RI5A 2Q9QB 1VRBA 4HWHA 5EK2A 3L39A 2DCFA 3WAKA 2AXDS 1UX5A 2K5BB 4P1NA 3SS1A 3PU3A 2XUEA 1HG2A 3PTRB 3AA6B 4U72A 3RQWA 4QXHB 2WU2A 3ONJA 5EK3A 5HAXA 2C5IT 2FJDA 4I55E 1D1BA 4DR6T 3CQCB 4DR7T 3PUAA 4I0UA 4PK6A 2BBJA 2NTYA 3RC3A 3FZMB 5BMVE 1J5WA 4DR1T 2VURA 1W09A 2CXLA 2JJ9A 1R8IA 3OTOT 2NP9A 3RKOA 2LSYA 3PUZF 3B13A 4HFVA 5J2UE 5IWAT 4JV5T 2KWHA 4LMJA 4JLEA 3PV0F 2LSGA 4LMLA 4UEMA 2R6GF 2V5CA 2XSAA 3E0ZA 4O8SA 5AFUL 5L2LA 3P4SA 2PFVA 2VVNA 3A7MA 1WR6A 2Q9QD 2PJQA 4P0BA 5HCJA 1XNQT 4UV8B 3ZMSB 4KX6A 3HKEE 5AQTB 3M3ZB 5CJ5A 5ABEA 4X66T 5FY0A 2CWOA 3SOLA 1UK5A 1S35A 3JADA 2JMHA 2N1GA 5JDGA 5H6QB 2CEAA 3RKGA 4AKIA 1VCTA 2VASA 3FB2A 3IBPA 5FKYA 3E22E 3U78A 4ISTA 3VRAA 2VKOA 5J2TE 4I4TE 3I1AA 5DJQC 4MLKA 3EDVA 1XZYA 2PG8A 2E9XA 4AIUA 5L3CB 2K48A 3Q5XA 4PW8A 2W62A 3BK9A 3H3AA 4H63V 2C0SA 4HFDA 1ZEEA 4IDPA 2XJ7A 4E7SA 4HFEA 2CXDA 3AE5A 3CQGB 3E08A 5FY1A 2FJAA 5FXVA 2FJEA 2V7IA 3L09A 2W61A 3MJXA 4QKNA 4AQGA 4HWIB 2X66A 4YSYA 3UFGA 3TKLB 1FMWA 3RYCE 4C91A 5IYZE 2XSBA 2MBGA 1BR4A 4HE8A 1MNDA 3NRYA 4IGUA 4A97A 4X62T 2W2UA 2HPJA 3MK7C 5LNKA 2BS3A 1FMVA 3OVUA 1WLXA 1HS7A 1Z8UA 4QH4A 3TLUA 5ABFB 4LF5T 3C51A 3AXJA 5KMGP 3AE8A 2JQHA 3N9QA 3ANWB 1KNZA 3B57A 1KNPA 5AQOB 3P8CD 5AQVB 3ZPOA 4HGAA 5LJMA 3ANWA 3UQ7A 3K3QC 4CXYA 3AA1B 2W66A 4H63H 2LKGA 1KK7A 2CBIA 2D2SA 2WZIA 3S4UA 4PK4A 4B6XA 2UU9T 2IUBA 3IA3A 3TLWA 4IREA 4Z90A 4FI5A 4H9SE 3ZC1A 5CFBA 2XM1A 4X1YE 1UX4A 3EDUA 2J4GA 2A2FX 4DV1T 4NXNT 1N34T 4QH1A 5L3GB 2LKHA 2DWGA 3Q5EA 1ZOYA 2VL8A 2XAJB 3ZKRA 1YW0A 5AQQB 4CI3B 3KVBA 1G73A 2LE8A 3ZCJA 4X65T 2XQYA 2LRLA 3AECA 3FZLB 4GOUA 3TLSA 5C3JA 4IT4A 2KNDA 2XAGB 2XZEA 1U5PA 2V5DA 4WZXA 3AVRA 3HKDE 2X0HA 3J9X1 2WM9A 4NIQA 3ZN1B 3UU4A 3Q9DA 4M1PA 2UUBT 3ZJ2A 5JRCB 3RHWA 2LSKA 3FBZA 2C5JA 1M7KA 3C98B 3RIFA 2VWAA 5HWXA 4OX9T 5FL0A 2Y8DA 3O9XA 3CVRA 1EZ3A 5LGTB 4O4IE 1MIVA 2YDQA 5LOVE 3RLFF 2IHR1 4TZ4C 4O2AE 5HEHA 3SFEA 1KNRA 1MNEA 2LLYA 4KMCA 3ZYMA 2VKJA 4PJNA 2V7LA 2XQAA 2ODVA 4KI0F 4MBQA 4BJMA 3LFMA 3MACA 1Y01A 2YDSA 1D1CA 2CE7A 3BQLA 5ADXL 2MYSA 3EHZA 2X0LB 1HF8A 2VB6A 3QOFA 3QUJA 4HEAA 4O4JE 2LRKA 3OYXA 2A72A 2B76A 3KBTA 3PUQA 3RX6A 3AB3B 2Y48B 4N78D 1D1AA 3C50A 3MZKB 4BAYB 4ZI2C 4DV7T 4YTPA 1IBKT 1UCUA 4MHCA 1N36T 3N9NA 4LF8T 4TWDA 5L3EB 3GN5A 4DR2T 1YKHB 3CPZA 3UFEA 2XQ8A 5ETWA 3VHLA 1IBMT 3GWHA 2LEHA 3P4QA 4ZI2D 1DU2A 4L9IA 1ZP0A 2LSIA 2IDOB 4GK0E 1MMGA 4IL4A 2XAQB 2XQ5A 3I0QA 4EXTA 3RGLA 1J5ET 2IC6A 3FHNA 4TV9E 3I0OA 4IDQA 4JI3T 4TWHA 3C4XA 2D0TA 2V7MA 4IDOA 5TAOA 3ZSTA 5CA1E 5L4EA 3JC6C 2LHRA 3AXJB 4OHFA 2LHNA 2OLTA 2XQ3A 5LBMA 4JI2T 4QXCB 4JI4T 5JR9C 3RQUA 4DV0T 2H7OA 2SPCA 5LBQB 3HA4A 3NRXA 3OJAA 2UXBT 3ONLC 2WMNA 5IUXA 1MIYA 1QSDA 2WDQA 4TX5A 3SRZA 4UVCB 1HX1B 2XAFB 3BQKA 3DTOA 3EUHA 4DBRA 3K3NA 4IE5A 4DV4T 3UU3A 2E2AA 5A1LA 4EB6E 4J2CA 4DUYT 2Z6EA 4KHZF 2B1EA 1IZNB 1D0XA 3QNUA 3AE7A 4G63A 2JIWA 2VL0A 4JEHB 2BS2A 4PK5A 2KLQA 4EZHA 4KHPT 2V6YA 1MMAA 3SWHA 4U7YA 3K1SA 2K9AA 2PBIA 3HR0A 4YTMA 4YT0A 1YXRA 2MPKA 4EOZB 2W63A 4E7ZA 2V6YB 1E2AA 2WDVA 4PJLA 2BKOA 3PUVF 4I43B 2DWKA 4NPPA 2RP4A 3O1IA 4LFAT 1WYBA 2W00A 3AEBA 1WYCA 4TNWA 5C8YE 3OYZA 4HFIA 4UELA 3MKDA 5DQVA 1UUSA 2N2NA 3N2KE 5FXXA 3PU8A 2GK9A 3UU6A 4B3ST 2X68A 5FXWA 5HXHA 2V26A 4DR3T 5L3DB 2E8IA 4IL9A 2CA5A 2L8KA
chains in the Genus database with same CATH topology
1QUUA 2LJLA 1BR1A 4CI1B 3PUGA 3QK6A 3LK42 4CQIA 3IHRA 4IE0A 2BVLA 3L3PA 3OKQA 4XZCA 3KV4A 4DVDA 2ES0A 1LVFA 4DMVA 4ZOLE 1S94A 3MA9A 4TN7B 1H7CA 2NW8A 1NAFA 4IE4A 3CX6B 4WW0A 4MFRA 5KX5E 2LM9A 3IEEA 5JVDE 4A56A 5LHHB 4H9RC 3KINB 4TUYE 1HX8A 2NOXA 3LJCA 2DI4A 4AKRB 4C90A 5JDNA 5FP3A 5JREA 5GONE 2YEVC 3KBUA 3F57A 3LBXA 3Q5WA 3KV9A 3ZLIA 3DP7A 5LA6E 4ADZA 3AA0B 3LBXB 2DLRA 2IAKA 2ODUA 3GMIA 3LK2B 3LK3B 4GYRA 5JH7E 3DJBA 2ZLYA 3FXDB 4GIWA 3GA8A 2X9YA 2XAHB 4HN9A 5L3FB 3T8OA 2LT3A 3UULA 1D0YA 2DHRA 3ETUA 4KP3C 1X79A 2CLYB 3RYHE 2M67A 1ZV4X 4ILUA 4DO0A 4ZI7E 5LCYA 1LRZA 2D5UA 5JDHA 4ZS2A 5DABA 5HWYA 3RRCA 4U74A 3KDSE 2L9QA 3ESLA 2EHOA 4CXWA 3UUNA 1OWAA 5FYMA 5FXZA 4QX8B 3N9PA 5JDLA 3V5SA 4X1KE 1MMNA 2QA7A 4PFOA 4YLHA 5HXRA 2ZM2A 4O4LE 2UXNB 5JR9A 3RC8A 2WBLA 5LG4A 5FMNA 4AKHA 2YK0A 3CX8B 4WBNE 5LYJE 2CXFA 3ZYKA 2Y6XA 3HKCE 3J7Yq 3N2GE 2HH7A 3HKBE 4ZI3D 2KINB 4IE6A 4PFPA 3H37A 2Q9QC 4X20E 5J1GA 1O3XA 2WWUA 3UUMA 4DBQA 5LP6E 3F31A 5EZYE 4OYJA 1HCIA 5FNVE 3AVSA 4O2BE 3I9WA 3RYFE 4L0RA 3M65A 2D0UA 4O4HE 3ZMZB 2ACXA 2L3LA 4BA9A 4EIWA 1AJ3A 2KT9A 4XBFB 4H9NC 3EVYA 2LOSA 3C4WA 4EYUA 1NWMX 2ZMAA 5LXTE 1YKEB 2X9HA 3CQXC 3KVAA 1Z0PA 4K0UA 4YHJA 4CXXA 4ERRA 5KMGP 2IW5B 3N9OA 2MOZA 3RRWA 1FEWA 3F2EA 3K3OA 2W0GA 2X9XA 3IF8B 3AAAB 2X51A 2KWIB 3RH3A 3AAIA 2V1DB 4OYKA 3GN5B 4AKGA 3C4ZA 1CUNA 1YD8G 4CI2B 4PNIA 3ZC0A 3ETVA 5H6RB 3AAEB 5EK4A 4H9OC 2EHOB 5LHGB 2BZBA 4UXNB 2JPFA 4ZS3A 1IJ6A 3CWZB 3BQIA 4OFZA 2C5KT 5L3BB 1BR2A 2MTQA 2WMOA 3KV6A 4AQFC 3PDYA 2CCQA 5F3JA 2JMKA 2XTLA 5JDQA 3RYIE 4NUUA 4H9PC 5LJNA 4UF0A 4QWNB 3K8PC 2G0UA 4YJ3E 5KDMC 3VU7H 3ZMTB 2VK9A 4JEUB 2N9DA 3ZYLA 5LHIB 3PE0A 3ZJ1A 4JUYA 4KBMB 2JQQA 4AXPA 1OXZA 4HKAA 3FBLA 3CMLA 4YJ2E 5HYAA 5DQWA 4IHJE 4ZHQE 3Q2MA 2XHEB 1T98A 3A5XA 3R84B 3CKDA 4ANJA 4V1Av 5F8PA 4G2AA 3R6NA 4AQFA 5HXCA 2CM0A 4QHOA 2IC9A 3U3IA 4UVAB 3W15B 3P7IA 1IJ5A 3UT5E 2NW9A 4ASKA 2VKDA 1ZKEA 4QX7B 3N2OA 3ZN0B 2XASB 3NBXX 4GYSA 5CB4E 3RPUA 3ZEFB 4CZZB 4EAHA 2LSJA 2H3RA 4PJJA 3CX7B 4UV9B 4UF0B 4MALA 5M4YA 3WAJA 2UXXB 5HXSA 5JR9B 1BR0A 2YU1A 4PJMA 4UIGA 1WRDA 3ZCIA 4IE7A 1IAPA 3ZMUB 4F6RC 2E9XD 2EHOC 2KXPB 2NW7A 2YU2A 5CA0E 4AI6A 3UUXB 4EZ4A 2CWYA 3C64A 5JRCA 2EHOD 3HI2A 2E9XC 3O1JA 4L5GA 2BDEA 3JC6D 3O1HA 5FY7A 2HPLA 3AA7B 3HL6A 5JDFA 4ZI3C 2Q9QA 2E9XB 4UVBB 4I50E 4P09A 4FJOA 1V9DA 2CLYC 3KV5A 3KFWX 1MIWA 2ZM8A 4OK0A 3PURA 1HFAA 2V7JA 2ZM0A 3I9YA 3MXZA 4DNDA 3FXEB 4BJNA 2OA5A 2NWBA 1SA0E 4GK5E 2YINA 2JRKA 4AKLA 3N9MA 3NZPA 3VKGA 1FIOA 3NZQA 3O4XE 2KMFA 4YFSA 4KUMB 2VKHA 1B7TA 4X1IE 1ZHCA 2RA1A 5LGUB 4H9QC 4PAGA 5HXEA 4Z8XA 3ONXA 2WSSV 4TV8E 2V7KA 1G8XA 2QGSA 2DNXA 2BVMA 4P0AA 3QC9A 1MMDA 2X9WA 3WI3A 2H7VC 2K24A 3PUSA 4WBOA 4DMWA 2P9BA 5E0OA 1LKXA 3D0TA 4IDZA 2J1DG 1HG5A 2KZ7B 3LG7A 3OBVE 1E1HB 3N9LA 2LOPA 5LGNB 3ZMVB 4EYYR 5JDMA 1SHZC 3N5LA 4HTEA 2NTXA 4IIJE 1VOMA 2A3DA 2I59A 1D0ZA 3UTKA 2CMRA 5IHYA 4ISSA 1HTJF 2WAUA 4WNKA 1US7B 1U4QA 1Y64B 2X67A 4QXBB 1LVKA 4NUVA 2Q9QB 1VRBA 5JQGE 5EK2A 2DCFA 3WAKA 1UX5A 2K5BB 3SS1A 3PU3A 2XUEA 1HG2A 3PTRB 3AA6B 4U72A 4QXHB 5EK3A 5HAXA 2C5IT 4I55E 1D1BA 3CQCB 3PUAA 4PK6A 2NTYA 3RC3A 5BMVE 2CXLA 2JJ9A 2NP9A 3RKOA 2LSYA 5J2UE 3B13A 4HFVA 2KWHA 4JLEA 2LSGA 4UEMA 3E0ZA 4O8SA 5AFUL 5L2LA 2PFVA 1WR6A 2Q9QD 2PJQA 4P0BA 4UV8B 3ZMSB 3HKEE 5FY0A 2CWOA 3SOLA 1S35A 2JMHA 2N1GA 5JDGA 5H6QB 2CEAA 4AKIA 2VASA 3FB2A 3U78A 3IBPA 3E22E 4ISTA 2VKOA 5J2TE 4I4TE 3I1AA 5DJQC 4MLKA 3EDVA 2E9XA 2PG8A 5L3CB 2K48A 3Q5XA 4PW8A 2W62A 3BK9A 3H3AA 4H63V 2C0SA 1ZEEA 4E7SA 2CXDA 3CQGB 3E08A 5FY1A 5FXVA 4AQGA 2V7IA 3L09A 2W61A 3MJXA 4QKNA 2X66A 3TKLB 1FMWA 3RYCE 4C91A 5IYZE 2MBGA 1BR4A 4HE8A 1MNDA 3NRYA 4IGUA 2HPJA 3MK7C 5LNKA 1FMVA 1WLXA 1HS7A 3C51A 3N9QA 3ANWB 1KNZA 3B57A 3ZPOA 3P8CD 4HGAA 3ANWA 3K3QC 4CXYA 3AA1B 4H63H 3S4UA 4B6XA 1KK7A 2D2SA 4PK4A 3ZC1A 4FI5A 4H9SE 4X1YE 1UX4A 3EDUA 2A2FX 5L3GB 2DWGA 2VL8A 2XAJB 1YW0A 4CI3B 3KVBA 1G73A 2LE8A 3ZCJA 2XQYA 4GOUA 2KNDA 2XAGB 1U5PA 3AVRA 3HKDE 3J9X1 2WM9A 3ZN1B 3Q9DA 4M1PA 3ZJ2A 5JRCB 2LSKA 3FBZA 2C5JA 5HWXA 3C98B 2VWAA 2Y8DA 3O9XA 3CVRA 1EZ3A 5LGTB 4O4IE 1MIVA 5LOVE 3V5UA 4TZ4C 4O2AE 4BAYB 3ZYMA 1MNEA 4KMCA 2VKJA 4PJNA 2V7LA 2ODVA 4MBQA 4BJMA 3LFMA 3MACA 1D1CA 2CE7A 3BQLA 5ADXL 2MYSA 2X0LB 1HF8A 2VB6A 3QUJA 4HEAA 4O4JE 4XAXB 3OYXA 3PUQA 2A72A 3KBTA 3RX6A 3AB3B 2Y48B 4N78D 1D1AA 3C50A 3MZKB 4ZI2C 1UCUA 4MHCA 3N9NA 5L3EB 3GN5A 1YKHB 3CPZA 3UFEA 5ETWA 3VHLA 3GWHA 2LEHA 4ZI2D 4L9IA 2LSIA 4GK0E 1MMGA 2XAQB 3I0QA 4EXTA 2IC6A 3FHNA 4TV9E 3I0OA 3C4XA 2D0TA 2V7MA 5TAOA 5CA1E 3JC6C 2LHRA 4OHFA 5LBMA 2LHNA 4QXCB 5JR9C 2H7OA 2SPCA 5LBQB 3HA4A 3NRXA 3OJAA 2WMNA 1MIYA 1QSDA 4TX5A 3SRZA 4DBRA 4UVCB 2XAFB 3DTOA 3BQKA 3EUHA 3VKHA 3K3NA 4IE5A 5A1LA 4EB6E 4J2CA 2Z6EA 2B1EA 1IZNB 1D0XA 4G63A 4JEHB 5LJMA 4PK5A 4EZHA 2KLQA 3SWHA 1MMAA 2K9AA 2PBIA 3HR0A 4EOZB 2W63A 4E7ZA 4PJLA 4I43B 2DWKA 2RP4A 3O1IA 1WYBA 2W00A 5C8YE 1WYCA 3OYZA 4UELA 3MKDA 5DQVA 2N2NA 3N2KE 5FXXA 3PU8A 2GK9A 2X68A 5FXWA 5HXHA 2V26A 5L3DB 2E8IA 2CA5A 2L8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GIW A;  2CXL A;  2DWK A;  2CXF A;  3CWZ B;  2DWG A; 
#chains in the Genus database with same CATH topology
 3FZK B;  1QUU A;  3AE6 A;  2LJL A;  1BR1 A;  1YQ4 A;  3NWI A;  3PUG A;  4CI1 B;  3QK6 A;  3LK4 2;  1HNX T;  5FVK A;  1HNZ T;  4CQI A;  3IHR A;  4IE0 A;  2BVL A;  3L3P A;  3OKQ A;  4XZC A;  3KV4 A;  4X64 T;  4DVD A;  5AQG B;  2ES0 A;  1LVF A;  4DMV A;  4ZOL E;  2V8S V;  1S94 A;  2QRX A;  3MA9 A;  3L8R A;  4TN7 B;  3ZSS A;  2NR4 A;  1H7C A;  3EI0 A;  2NW8 A;  1I6Z A;  1NAF A;  2WP9 A;  4IE4 A;  4UR9 A;  4JI5 T;  3CX6 B;  2WQY A;  4MFR A;  4WW0 A;  5KX5 E;  2LM9 A;  3IEE A;  5JVD E;  1XWM A;  4A56 A;  1WCR A;  5LHH B;  4H9R C;  3KIN B;  4TUY E;  3P4P A;  2XQ7 A;  1HX8 A;  4ZZC A;  1VCS A;  2UUA T;  2NOX A;  5JQG E;  1HNW T;  3LJC A;  2I6H A;  2DI4 A;  1I94 T;  4AKR B;  4C90 A;  5JDN A;  4LFC T;  5FP3 A;  2XM2 A;  5GON E;  5JRE A;  2YEV C;  3KBU A;  3X1D A;  4JI1 T;  3F57 A;  3LBX A;  3Q5W A;  3KV9 A;  4EGW A;  3ZLI A;  2HHH T;  3DP7 A;  5LA6 E;  4ADZ A;  3AA0 B;  3LBX B;  2DLR A;  2IAK A;  2ODU A;  3GMI A;  3LK2 B;  3LK3 B;  4GYR A;  5JH7 E;  2YDR A;  2ZM6 T;  3DJB A;  2ZLY A;  3FXD B;  3JAF A;  4GIW A;  3GA8 A;  3TLV A;  2X9Y A;  1XNR T;  2XAH B;  4HN9 A;  2H88 A;  3P50 A;  3EAM A;  5L3F B;  3T8O A;  2LT3 A;  3UUL A;  1D0Y A;  2DHR A;  3ETU A;  4KP3 C;  1X79 A;  3RF1 A;  5HEO A;  2CLY B;  3RYH E;  2M67 A;  1W0B A;  1ZV4 X;  4ILU A;  4DO0 A;  1JNR A;  4ZI7 E;  5LCY A;  1LRZ A;  2D5U A;  1XDP A;  5JDH A;  3T1Y T;  4ZS2 A;  2UUC T;  4DR4 T;  5DAB A;  5HWY A;  3RRC A;  4U74 A;  3KDS E;  1SE7 A;  4DV2 T;  2F4V T;  2L9Q A;  1NEN A;  3ESL A;  4DV3 T;  2EHO A;  4CXW A;  3UUN A;  5LMN T;  2XQ9 A;  1OWA A;  5AQR B;  4JI0 T;  5FYM A;  2VQF T;  5HEJ A;  5FXZ A;  3AE9 A;  4QX8 B;  3N9P A;  5JDL A;  3V5S A;  4X1K E;  3LSV A;  1MMN A;  2QA7 A;  1J1J A;  1KF6 A;  4PFO A;  4YLH A;  5HXR A;  2ZM2 A;  3UU5 A;  2YN6 A;  2UXN B;  4O4L E;  5JR9 A;  3RC8 A;  2K3W A;  2WBL A;  5LG4 A;  5FMN A;  4AKH A;  4YY3 T;  2WCA A;  2YK0 A;  3CX8 B;  3QB5 K;  4WBN E;  5LYJ E;  2CXF A;  3ZYK A;  2Y6X A;  3HKC E;  3JAE A;  1CHU A;  3NVO A;  3TLT A;  4YXD A;  3J7Y q;  1WFD A;  2HH7 A;  3HKB E;  3N2G E;  4HWC A;  4ZI3 D;  3B5M A;  4ZXL A;  2KIN B;  2WZH A;  2X0Y A;  4QH5 A;  2KSR A;  4IE6 A;  5BR8 T;  4PFP A;  2VVS A;  4U2Z A;  2IML A;  3H37 A;  2Q9Q C;  4X20 E;  5J1G A;  1O3X A;  2WWU A;  3UUM A;  4DBQ A;  5L47 A;  3F31 A;  5LP6 E;  1E7P A;  5EZY E;  2BBH A;  4OYJ A;  4AQY T;  3FZH B;  1QLB A;  5AQK B;  1HCI A;  4U7I A;  3AVS A;  5FNV E;  4O2B E;  1IBL T;  1XMQ T;  2FJB A;  3I9W A;  4JYA T;  3RYF E;  4L0R A;  4YSZ A;  2I0M A;  4AIS A;  3M65 A;  2D0U A;  5AQU B;  3VKH A;  4O4H E;  3ZMZ B;  2ACX A;  2L3L A;  2HN2 A;  4BA9 A;  4EIW A;  2KT9 A;  5KXJ A;  3AED A;  4DV5 T;  1AJ3 A;  4XBF B;  4H9N C;  2LOS A;  3C4W A;  3EVY A;  3SFD A;  1NWM X;  3RIA A;  2ZMA A;  4A5X A;  4EYU A;  5ABH A;  5LXT E;  1YKE B;  2X9H A;  4Z91 A;  3CQX C;  3KVA A;  1Z0P A;  4K0U A;  4TNV A;  4YHJ A;  4CXX A;  4ERR A;  1M62 A;  4A98 A;  2IW5 B;  3N9O A;  2MOZ A;  1OED B;  1FEW A;  3F2E A;  1YQ3 A;  3K3O A;  3AEA A;  3RRW A;  2W0G A;  2X9X A;  3G06 A;  3IF8 B;  2QVA A;  3UUB A;  3AAA B;  2X51 A;  3RIU C;  4CN4 A;  2BG9 C;  2KWI B;  3RH3 A;  2XQ4 A;  3AAI A;  2V1D B;  5LMU T;  4OYK A;  1T8B A;  5ABF A;  3PUW F;  2HN1 A;  3GN5 B;  3V5U A;  3C4Z A;  3VR8 A;  1CUN A;  1YD8 G;  4CI2 B;  1KEY A;  3H3M A;  4PNI A;  4EED A;  3ETV A;  5HEU A;  3ZC0 A;  5H6R B;  3AAE B;  2BKP A;  5EK4 A;  5AQL B;  4H9O C;  2J62 A;  2EHO B;  3EAB A;  5LHG B;  2BZB A;  3AE1 A;  2JPF A;  4UXN B;  4ZS3 A;  5AQN B;  1IJ6 A;  3CWZ B;  3BQI A;  2DL1 A;  4OFZ A;  2C5K T;  5L3B B;  4GKJ T;  1W9R A;  1BR2 A;  2MTQ A;  5LB7 B;  2BG9 E;  4HFC A;  2WMO A;  4U3C A;  3KV6 A;  4AQF C;  3PDY A;  2CCQ A;  5F3J A;  2JMK A;  3VRB A;  2XTL A;  5JDQ A;  3RYI E;  4NUU A;  2WDR A;  4H9P C;  2JQ9 A;  5JTG A;  5F5W A;  5LJN A;  2UXD T;  4UF0 A;  4QWN B;  4X5T A;  3K8P C;  2G0U A;  3ZT6 A;  3PJA A;  4YJ3 E;  3RIU A;  1JNZ A;  1NEK A;  2WWV A;  5KDM C;  3VU7 H;  3ZMT B;  2VK9 A;  4JEU B;  2N9D A;  4COF A;  4DUZ T;  3AE4 A;  4ILC A;  2W4X A;  3ZYL A;  5LHI B;  3PE0 A;  3ZJ1 A;  4JUY A;  4KBM B;  4B3R T;  2JQQ A;  4AXP A;  1OXZ A;  2WS3 A;  4HKA A;  5FL1 A;  3VR9 A;  1T72 A;  1XDO A;  3CML A;  3FBL A;  3PJA J;  5DQW A;  4YJ2 E;  1OED C;  4IHJ E;  5HYA A;  4ZHQ E;  2A9U A;  5HEG A;  3Q2M A;  2XHE B;  1T98 A;  3A5X A;  3R84 B;  2BG9 B;  3CKD A;  4ANJ A;  5AQM B;  4V1A v;  4LF4 T;  3CIR A;  5AQP B;  5F8P A;  4YTN A;  4G2A A;  3R6N A;  1N33 T;  4AQF A;  1UGO A;  5FVL A;  5HXC A;  2CM0 A;  4QHO A;  2WB5 A;  5AQJ B;  2VQE T;  2IC9 A;  3U3I A;  4TWF A;  4UVA B;  3W15 B;  3ZT7 A;  4AKG A;  4HFH A;  4LF7 T;  3P7I A;  1IJ5 A;  3UT5 E;  2CPT A;  2XQ6 A;  2NW9 A;  4ASK A;  1T7S A;  2VKD A;  1ZKE A;  4QX7 B;  1HR0 T;  3N2O A;  3ZN0 B;  2XAS B;  3NBX X;  4GYS A;  4U33 A;  5CB4 E;  3RPU A;  4IDN A;  3ZEF B;  4CZZ B;  4EAH A;  2LSJ A;  2H3R A;  4HWD A;  4PJJ A;  3CX7 B;  2H89 A;  4UV9 B;  2ACZ A;  2E5V A;  4UF0 B;  1SUM B;  5AQH B;  2J47 A;  4MAL A;  5M4Y A;  3WAJ A;  2UXX B;  5AQF B;  1OED A;  5HXS A;  5JR9 B;  2M6B A;  4LF9 T;  1BR0 A;  2LM2 A;  2YU1 A;  2V6X A;  4PJM A;  4XAX B;  1W0A A;  2MAW A;  1WRD A;  3P4W A;  4UIG A;  3ZCI A;  4DID B;  4IE7 A;  1IAP A;  4GKK T;  3ZMU B;  2IIU A;  4F6R C;  1OED E;  2E9X D;  4CN6 A;  2EHO C;  2KXP B;  2NW7 A;  2YU2 A;  3OPC A;  4LMK A;  5CA0 E;  4LF6 T;  4AI6 A;  3UUX B;  4EZ4 A;  2CWY A;  3LDQ B;  3C64 A;  4EEB A;  5JRC A;  2EHO D;  3HI2 A;  2E9X C;  3O1J A;  4CN1 A;  2E5L T;  2RPA A;  4L5G A;  2BDE A;  3JC6 D;  3O1H A;  4HWF A;  5FY7 A;  2FBW A;  2CRB A;  2HPL A;  3AA7 B;  3HL6 A;  3PUX F;  5JDF A;  3AEE A;  4ZI3 C;  4B3M T;  1FJG T;  4YSX A;  2Q9Q A;  4ILA A;  2E9X B;  4UVB B;  4YHH T;  2BS4 A;  4I50 E;  4P09 A;  4U2Y A;  4FJO A;  1V9D A;  2CLY C;  3KV5 A;  4DV6 T;  4F8H A;  1WR0 A;  3KFW X;  1MIW A;  1UUR A;  2PTF A;  2ZM8 A;  4OK0 A;  3PUR A;  2CBJ A;  1HFA A;  3A8Y C;  2V7J A;  2ZM0 A;  3I9Y A;  3MXZ A;  3AE3 A;  3FXE B;  4JBW F;  4BJN A;  4DND A;  2OA5 A;  2NWB A;  5AQI B;  5L4H A;  1SA0 E;  5AQS B;  2AE9 A;  4GK5 E;  1N32 T;  2YIN A;  2BKN A;  3ABV A;  2JRK A;  3Q5D A;  4AKL A;  3N9M A;  3NZP A;  3ZT5 A;  3AE2 A;  3VKG A;  2M6I A;  5J0Z A;  4HFB A;  4JI6 T;  1FIO A;  1X9B A;  2BG9 A;  3NZQ A;  1XMO T;  3O4X E;  2UXC T;  2KMF A;  3NKZ A;  4KUM B;  4YFS A;  2VKH A;  4ZZB A;  4DR5 T;  1B7T A;  4JI7 T;  2CHO A;  2JQK A;  2CHN A;  2QYW A;  4X1I E;  1ZHC A;  2RA1 A;  5LGU B;  3JCF A;  2W67 A;  4H9Q C;  4JI8 T;  4PAG A;  1KFY A;  3CK6 A;  5HXE A;  4Z8X A;  3ONX A;  2WSS V;  4Q25 A;  4TV8 E;  2V7K A;  1G8X A;  2OV9 A;  2DNX A;  2BVM A;  2QGS A;  4P0A A;  3QC9 A;  1MMD A;  2WU5 A;  4U31 A;  2X9W A;  3WI3 A;  4ILB A;  2H7V C;  2K24 A;  3PUS A;  4WBO A;  1L0V A;  4DMW A;  2P9B A;  4B3T T;  5E0O A;  1LKX A;  2FUP A;  3D0T A;  4IDZ A;  3QB5 A;  4LFB T;  2XY8 B;  2J1D G;  1HG5 A;  2KZ7 B;  3LG7 A;  3PUY F;  3OBV E;  3T1H T;  1E1H B;  2YOE A;  3N9L A;  2LOP A;  2YKS A;  5LGN B;  3ZMV B;  4EYY R;  5JDM A;  1SHZ C;  5HCM A;  2WY2 A;  3N5L A;  2D9D A;  4WYV A;  3AEF A;  4HTE A;  1GQE A;  2NTX A;  4IIJ E;  1VOM A;  2A3D A;  4ZEY A;  2I59 A;  3UQ4 A;  1D0Z A;  3UTK A;  2CMR A;  3AEG A;  5IHY A;  4ISS A;  3UU8 A;  1HTJ F;  2WAU A;  4EV6 A;  4K0K T;  3FZF B;  3P4R A;  4WNK A;  1US7 B;  2XPK A;  1U4Q A;  1Y64 B;  5ABG A;  5C2T A;  5CGM A;  4NXM T;  2X67 A;  4QXB B;  5LG3 A;  1LVK A;  4NUV A;  3RI5 A;  2Q9Q B;  1VRB A;  4HWH A;  5EK2 A;  3L39 A;  2DCF A;  3WAK A;  2AXD S;  1UX5 A;  2K5B B;  4P1N A;  3SS1 A;  3PU3 A;  2XUE A;  1HG2 A;  3PTR B;  3AA6 B;  4U72 A;  3RQW A;  4QXH B;  2WU2 A;  3ONJ A;  5EK3 A;  5HAX A;  2C5I T;  2FJD A;  4I55 E;  1D1B A;  4DR6 T;  3CQC B;  4DR7 T;  3PUA A;  4I0U A;  4PK6 A;  2BBJ A;  2NTY A;  3RC3 A;  3FZM B;  5BMV E;  1J5W A;  4DR1 T;  2VUR A;  1W09 A;  2CXL A;  2JJ9 A;  1R8I A;  3OTO T;  2NP9 A;  3RKO A;  2LSY A;  3PUZ F;  3B13 A;  4HFV A;  5J2U E;  5IWA T;  4JV5 T;  2KWH A;  4LMJ A;  4JLE A;  3PV0 F;  2LSG A;  4LML A;  4UEM A;  2R6G F;  2V5C A;  2XSA A;  3E0Z A;  4O8S A;  5AFU L;  5L2L A;  3P4S A;  2PFV A;  2VVN A;  3A7M A;  1WR6 A;  2Q9Q D;  2PJQ A;  4P0B A;  5HCJ A;  1XNQ T;  4UV8 B;  3ZMS B;  4KX6 A;  3HKE E;  5AQT B;  3M3Z B;  5CJ5 A;  5ABE A;  4X66 T;  5FY0 A;  2CWO A;  3SOL A;  1UK5 A;  1S35 A;  3JAD A;  2JMH A;  2N1G A;  5JDG A;  5H6Q B;  2CEA A;  3RKG A;  4AKI A;  1VCT A;  2VAS A;  3FB2 A;  3IBP A;  5FKY A;  3E22 E;  3U78 A;  4IST A;  3VRA A;  2VKO A;  5J2T E;  4I4T E;  3I1A A;  5DJQ C;  4MLK A;  3EDV A;  1XZY A;  2PG8 A;  2E9X A;  4AIU A;  5L3C B;  2K48 A;  3Q5X A;  4PW8 A;  2W62 A;  3BK9 A;  3H3A A;  4H63 V;  2C0S A;  4HFD A;  1ZEE A;  4IDP A;  2XJ7 A;  4E7S A;  4HFE A;  2CXD A;  3AE5 A;  3CQG B;  3E08 A;  5FY1 A;  2FJA A;  5FXV A;  2FJE A;  2V7I A;  3L09 A;  2W61 A;  3MJX A;  4QKN A;  4AQG A;  4HWI B;  2X66 A;  4YSY A;  3UFG A;  3TKL B;  1FMW A;  3RYC E;  4C91 A;  5IYZ E;  2XSB A;  2MBG A;  1BR4 A;  4HE8 A;  1MND A;  3NRY A;  4IGU A;  4A97 A;  4X62 T;  2W2U A;  2HPJ A;  3MK7 C;  5LNK A;  2BS3 A;  1FMV A;  3OVU A;  1WLX A;  1HS7 A;  1Z8U A;  4QH4 A;  3TLU A;  5ABF B;  4LF5 T;  3C51 A;  3AXJ A;  5KMG P;  3AE8 A;  2JQH A;  3N9Q A;  3ANW B;  1KNZ A;  3B57 A;  1KNP A;  5AQO B;  3P8C D;  5AQV B;  3ZPO A;  4HGA A;  5LJM A;  3ANW A;  3UQ7 A;  3K3Q C;  4CXY A;  3AA1 B;  2W66 A;  4H63 H;  2LKG A;  1KK7 A;  2CBI A;  2D2S A;  2WZI A;  3S4U A;  4PK4 A;  4B6X A;  2UU9 T;  2IUB A;  3IA3 A;  3TLW A;  4IRE A;  4Z90 A;  4FI5 A;  4H9S E;  3ZC1 A;  5CFB A;  2XM1 A;  4X1Y E;  1UX4 A;  3EDU A;  2J4G A;  2A2F X;  4DV1 T;  4NXN T;  1N34 T;  4QH1 A;  5L3G B;  2LKH A;  2DWG A;  3Q5E A;  1ZOY A;  2VL8 A;  2XAJ B;  3ZKR A;  1YW0 A;  5AQQ B;  4CI3 B;  3KVB A;  1G73 A;  2LE8 A;  3ZCJ A;  4X65 T;  2XQY A;  2LRL A;  3AEC A;  3FZL B;  4GOU A;  3TLS A;  5C3J A;  4IT4 A;  2KND A;  2XAG B;  2XZE A;  1U5P A;  2V5D A;  4WZX A;  3AVR A;  3HKD E;  2X0H A;  3J9X 1;  2WM9 A;  4NIQ A;  3ZN1 B;  3UU4 A;  3Q9D A;  4M1P A;  2UUB T;  3ZJ2 A;  5JRC B;  3RHW A;  2LSK A;  3FBZ A;  2C5J A;  1M7K A;  3C98 B;  3RIF A;  2VWA A;  5HWX A;  4OX9 T;  5FL0 A;  2Y8D A;  3O9X A;  3CVR A;  1EZ3 A;  5LGT B;  4O4I E;  1MIV A;  2YDQ A;  5LOV E;  3RLF F;  2IHR 1;  4TZ4 C;  4O2A E;  5HEH A;  3SFE A;  1KNR A;  1MNE A;  2LLY A;  4KMC A;  3ZYM A;  2VKJ A;  4PJN A;  2V7L A;  2XQA A;  2ODV A;  4KI0 F;  4MBQ A;  4BJM A;  3LFM A;  3MAC A;  1Y01 A;  2YDS A;  1D1C A;  2CE7 A;  3BQL A;  5ADX L;  2MYS A;  3EHZ A;  2X0L B;  1HF8 A;  2VB6 A;  3QOF A;  3QUJ A;  4HEA A;  4O4J E;  2LRK A;  3OYX A;  2A72 A;  2B76 A;  3KBT A;  3PUQ A;  3RX6 A;  3AB3 B;  2Y48 B;  4N78 D;  1D1A A;  3C50 A;  3MZK B;  4BAY B;  4ZI2 C;  4DV7 T;  4YTP A;  1IBK T;  1UCU A;  4MHC A;  1N36 T;  3N9N A;  4LF8 T;  4TWD A;  5L3E B;  3GN5 A;  4DR2 T;  1YKH B;  3CPZ A;  3UFE A;  2XQ8 A;  5ETW A;  3VHL A;  1IBM T;  3GWH A;  2LEH A;  3P4Q A;  4ZI2 D;  1DU2 A;  4L9I A;  1ZP0 A;  2LSI A;  2IDO B;  4GK0 E;  1MMG A;  4IL4 A;  2XAQ B;  2XQ5 A;  3I0Q A;  4EXT A;  3RGL A;  1J5E T;  2IC6 A;  3FHN A;  4TV9 E;  3I0O A;  4IDQ A;  4JI3 T;  4TWH A;  3C4X A;  2D0T A;  2V7M A;  4IDO A;  5TAO A;  3ZST A;  5CA1 E;  5L4E A;  3JC6 C;  2LHR A;  3AXJ B;  4OHF A;  2LHN A;  2OLT A;  2XQ3 A;  5LBM A;  4JI2 T;  4QXC B;  4JI4 T;  5JR9 C;  3RQU A;  4DV0 T;  2H7O A;  2SPC A;  5LBQ B;  3HA4 A;  3NRX A;  3OJA A;  2UXB T;  3ONL C;  2WMN A;  5IUX A;  1MIY A;  1QSD A;  2WDQ A;  4TX5 A;  3SRZ A;  4UVC B;  1HX1 B;  2XAF B;  3BQK A;  3DTO A;  3EUH A;  4DBR A;  3K3N A;  4IE5 A;  4DV4 T;  3UU3 A;  2E2A A;  5A1L A;  4EB6 E;  4J2C A;  4DUY T;  2Z6E A;  4KHZ F;  2B1E A;  1IZN B;  1D0X A;  3QNU A;  3AE7 A;  4G63 A;  2JIW A;  2VL0 A;  4JEH B;  2BS2 A;  4PK5 A;  2KLQ A;  4EZH A;  4KHP T;  2V6Y A;  1MMA A;  3SWH A;  4U7Y A;  3K1S A;  2K9A A;  2PBI A;  3HR0 A;  4YTM A;  4YT0 A;  1YXR A;  2MPK A;  4EOZ B;  2W63 A;  4E7Z A;  2V6Y B;  1E2A A;  2WDV A;  4PJL A;  2BKO A;  3PUV F;  4I43 B;  2DWK A;  4NPP A;  2RP4 A;  3O1I A;  4LFA T;  1WYB A;  2W00 A;  3AEB A;  1WYC A;  4TNW A;  5C8Y E;  3OYZ A;  4HFI A;  4UEL A;  3MKD A;  5DQV A;  1UUS A;  2N2N A;  3N2K E;  5FXX A;  3PU8 A;  2GK9 A;  3UU6 A;  4B3S T;  2X68 A;  5FXW A;  5HXH A;  2V26 A;  4DR3 T;  5L3D B;  2E8I A;  4IL9 A;  2CA5 A;  2L8K A; 
#chains in the Genus database with same CATH homology
 1QUU A;  2LJL A;  1BR1 A;  4CI1 B;  3PUG A;  3QK6 A;  3LK4 2;  4CQI A;  3IHR A;  4IE0 A;  2BVL A;  3L3P A;  3OKQ A;  4XZC A;  3KV4 A;  4DVD A;  2ES0 A;  1LVF A;  4DMV A;  4ZOL E;  1S94 A;  3MA9 A;  4TN7 B;  1H7C A;  2NW8 A;  1NAF A;  4IE4 A;  3CX6 B;  4WW0 A;  4MFR A;  5KX5 E;  2LM9 A;  3IEE A;  5JVD E;  4A56 A;  5LHH B;  4H9R C;  3KIN B;  4TUY E;  1HX8 A;  2NOX A;  3LJC A;  2DI4 A;  4AKR B;  4C90 A;  5JDN A;  5FP3 A;  5JRE A;  5GON E;  2YEV C;  3KBU A;  3F57 A;  3LBX A;  3Q5W A;  3KV9 A;  3ZLI A;  3DP7 A;  5LA6 E;  4ADZ A;  3AA0 B;  3LBX B;  2DLR A;  2IAK A;  2ODU A;  3GMI A;  3LK2 B;  3LK3 B;  4GYR A;  5JH7 E;  3DJB A;  2ZLY A;  3FXD B;  4GIW A;  3GA8 A;  2X9Y A;  2XAH B;  4HN9 A;  5L3F B;  3T8O A;  2LT3 A;  3UUL A;  1D0Y A;  2DHR A;  3ETU A;  4KP3 C;  1X79 A;  2CLY B;  3RYH E;  2M67 A;  1ZV4 X;  4ILU A;  4DO0 A;  4ZI7 E;  5LCY A;  1LRZ A;  2D5U A;  5JDH A;  4ZS2 A;  5DAB A;  5HWY A;  3RRC A;  4U74 A;  3KDS E;  2L9Q A;  3ESL A;  2EHO A;  4CXW A;  3UUN A;  1OWA A;  5FYM A;  5FXZ A;  4QX8 B;  3N9P A;  5JDL A;  3V5S A;  4X1K E;  1MMN A;  2QA7 A;  4PFO A;  4YLH A;  5HXR A;  2ZM2 A;  4O4L E;  2UXN B;  5JR9 A;  3RC8 A;  2WBL A;  5LG4 A;  5FMN A;  4AKH A;  2YK0 A;  3CX8 B;  4WBN E;  5LYJ E;  2CXF A;  3ZYK A;  2Y6X A;  3HKC E;  3J7Y q;  3N2G E;  2HH7 A;  3HKB E;  4ZI3 D;  2KIN B;  4IE6 A;  4PFP A;  3H37 A;  2Q9Q C;  4X20 E;  5J1G A;  1O3X A;  2WWU A;  3UUM A;  4DBQ A;  5LP6 E;  3F31 A;  5EZY E;  4OYJ A;  1HCI A;  5FNV E;  3AVS A;  4O2B E;  3I9W A;  3RYF E;  4L0R A;  3M65 A;  2D0U A;  4O4H E;  3ZMZ B;  2ACX A;  2L3L A;  4BA9 A;  4EIW A;  1AJ3 A;  2KT9 A;  4XBF B;  4H9N C;  3EVY A;  2LOS A;  3C4W A;  4EYU A;  1NWM X;  2ZMA A;  5LXT E;  1YKE B;  2X9H A;  3CQX C;  3KVA A;  1Z0P A;  4K0U A;  4YHJ A;  4CXX A;  4ERR A;  5KMG P;  2IW5 B;  3N9O A;  2MOZ A;  3RRW A;  1FEW A;  3F2E A;  3K3O A;  2W0G A;  2X9X A;  3IF8 B;  3AAA B;  2X51 A;  2KWI B;  3RH3 A;  3AAI A;  2V1D B;  4OYK A;  3GN5 B;  4AKG A;  3C4Z A;  1CUN A;  1YD8 G;  4CI2 B;  4PNI A;  3ZC0 A;  3ETV A;  5H6R B;  3AAE B;  5EK4 A;  4H9O C;  2EHO B;  5LHG B;  2BZB A;  4UXN B;  2JPF A;  4ZS3 A;  1IJ6 A;  3CWZ B;  3BQI A;  4OFZ A;  2C5K T;  5L3B B;  1BR2 A;  2MTQ A;  2WMO A;  3KV6 A;  4AQF C;  3PDY A;  2CCQ A;  5F3J A;  2JMK A;  2XTL A;  5JDQ A;  3RYI E;  4NUU A;  4H9P C;  5LJN A;  4UF0 A;  4QWN B;  3K8P C;  2G0U A;  4YJ3 E;  5KDM C;  3VU7 H;  3ZMT B;  2VK9 A;  4JEU B;  2N9D A;  3ZYL A;  5LHI B;  3PE0 A;  3ZJ1 A;  4JUY A;  4KBM B;  2JQQ A;  4AXP A;  1OXZ A;  4HKA A;  3FBL A;  3CML A;  4YJ2 E;  5HYA A;  5DQW A;  4IHJ E;  4ZHQ E;  3Q2M A;  2XHE B;  1T98 A;  3A5X A;  3R84 B;  3CKD A;  4ANJ A;  4V1A v;  5F8P A;  4G2A A;  3R6N A;  4AQF A;  5HXC A;  2CM0 A;  4QHO A;  2IC9 A;  3U3I A;  4UVA B;  3W15 B;  3P7I A;  1IJ5 A;  3UT5 E;  2NW9 A;  4ASK A;  2VKD A;  1ZKE A;  4QX7 B;  3N2O A;  3ZN0 B;  2XAS B;  3NBX X;  4GYS A;  5CB4 E;  3RPU A;  3ZEF B;  4CZZ B;  4EAH A;  2LSJ A;  2H3R A;  4PJJ A;  3CX7 B;  4UV9 B;  4UF0 B;  4MAL A;  5M4Y A;  3WAJ A;  2UXX B;  5HXS A;  5JR9 B;  1BR0 A;  2YU1 A;  4PJM A;  4UIG A;  1WRD A;  3ZCI A;  4IE7 A;  1IAP A;  3ZMU B;  4F6R C;  2E9X D;  2EHO C;  2KXP B;  2NW7 A;  2YU2 A;  5CA0 E;  4AI6 A;  3UUX B;  4EZ4 A;  2CWY A;  3C64 A;  5JRC A;  2EHO D;  3HI2 A;  2E9X C;  3O1J A;  4L5G A;  2BDE A;  3JC6 D;  3O1H A;  5FY7 A;  2HPL A;  3AA7 B;  3HL6 A;  5JDF A;  4ZI3 C;  2Q9Q A;  2E9X B;  4UVB B;  4I50 E;  4P09 A;  4FJO A;  1V9D A;  2CLY C;  3KV5 A;  3KFW X;  1MIW A;  2ZM8 A;  4OK0 A;  3PUR A;  1HFA A;  2V7J A;  2ZM0 A;  3I9Y A;  3MXZ A;  4DND A;  3FXE B;  4BJN A;  2OA5 A;  2NWB A;  1SA0 E;  4GK5 E;  2YIN A;  2JRK A;  4AKL A;  3N9M A;  3NZP A;  3VKG A;  1FIO A;  3NZQ A;  3O4X E;  2KMF A;  4YFS A;  4KUM B;  2VKH A;  1B7T A;  4X1I E;  1ZHC A;  2RA1 A;  5LGU B;  4H9Q C;  4PAG A;  5HXE A;  4Z8X A;  3ONX A;  2WSS V;  4TV8 E;  2V7K A;  1G8X A;  2QGS A;  2DNX A;  2BVM A;  4P0A A;  3QC9 A;  1MMD A;  2X9W A;  3WI3 A;  2H7V C;  2K24 A;  3PUS A;  4WBO A;  4DMW A;  2P9B A;  5E0O A;  1LKX A;  3D0T A;  4IDZ A;  2J1D G;  1HG5 A;  2KZ7 B;  3LG7 A;  3OBV E;  1E1H B;  3N9L A;  2LOP A;  5LGN B;  3ZMV B;  4EYY R;  5JDM A;  1SHZ C;  3N5L A;  4HTE A;  2NTX A;  4IIJ E;  1VOM A;  2A3D A;  2I59 A;  1D0Z A;  3UTK A;  2CMR A;  5IHY A;  4ISS A;  1HTJ F;  2WAU A;  4WNK A;  1US7 B;  1U4Q A;  1Y64 B;  2X67 A;  4QXB B;  1LVK A;  4NUV A;  2Q9Q B;  1VRB A;  5JQG E;  5EK2 A;  2DCF A;  3WAK A;  1UX5 A;  2K5B B;  3SS1 A;  3PU3 A;  2XUE A;  1HG2 A;  3PTR B;  3AA6 B;  4U72 A;  4QXH B;  5EK3 A;  5HAX A;  2C5I T;  4I55 E;  1D1B A;  3CQC B;  3PUA A;  4PK6 A;  2NTY A;  3RC3 A;  5BMV E;  2CXL A;  2JJ9 A;  2NP9 A;  3RKO A;  2LSY A;  5J2U E;  3B13 A;  4HFV A;  2KWH A;  4JLE A;  2LSG A;  4UEM A;  3E0Z A;  4O8S A;  5AFU L;  5L2L A;  2PFV A;  1WR6 A;  2Q9Q D;  2PJQ A;  4P0B A;  4UV8 B;  3ZMS B;  3HKE E;  5FY0 A;  2CWO A;  3SOL A;  1S35 A;  2JMH A;  2N1G A;  5JDG A;  5H6Q B;  2CEA A;  4AKI A;  2VAS A;  3FB2 A;  3U78 A;  3IBP A;  3E22 E;  4IST A;  2VKO A;  5J2T E;  4I4T E;  3I1A A;  5DJQ C;  4MLK A;  3EDV A;  2E9X A;  2PG8 A;  5L3C B;  2K48 A;  3Q5X A;  4PW8 A;  2W62 A;  3BK9 A;  3H3A A;  4H63 V;  2C0S A;  1ZEE A;  4E7S A;  2CXD A;  3CQG B;  3E08 A;  5FY1 A;  5FXV A;  4AQG A;  2V7I A;  3L09 A;  2W61 A;  3MJX A;  4QKN A;  2X66 A;  3TKL B;  1FMW A;  3RYC E;  4C91 A;  5IYZ E;  2MBG A;  1BR4 A;  4HE8 A;  1MND A;  3NRY A;  4IGU A;  2HPJ A;  3MK7 C;  5LNK A;  1FMV A;  1WLX A;  1HS7 A;  3C51 A;  3N9Q A;  3ANW B;  1KNZ A;  3B57 A;  3ZPO A;  3P8C D;  4HGA A;  3ANW A;  3K3Q C;  4CXY A;  3AA1 B;  4H63 H;  3S4U A;  4B6X A;  1KK7 A;  2D2S A;  4PK4 A;  3ZC1 A;  4FI5 A;  4H9S E;  4X1Y E;  1UX4 A;  3EDU A;  2A2F X;  5L3G B;  2DWG A;  2VL8 A;  2XAJ B;  1YW0 A;  4CI3 B;  3KVB A;  1G73 A;  2LE8 A;  3ZCJ A;  2XQY A;  4GOU A;  2KND A;  2XAG B;  1U5P A;  3AVR A;  3HKD E;  3J9X 1;  2WM9 A;  3ZN1 B;  3Q9D A;  4M1P A;  3ZJ2 A;  5JRC B;  2LSK A;  3FBZ A;  2C5J A;  5HWX A;  3C98 B;  2VWA A;  2Y8D A;  3O9X A;  3CVR A;  1EZ3 A;  5LGT B;  4O4I E;  1MIV A;  5LOV E;  3V5U A;  4TZ4 C;  4O2A E;  4BAY B;  3ZYM A;  1MNE A;  4KMC A;  2VKJ A;  4PJN A;  2V7L A;  2ODV A;  4MBQ A;  4BJM A;  3LFM A;  3MAC A;  1D1C A;  2CE7 A;  3BQL A;  5ADX L;  2MYS A;  2X0L B;  1HF8 A;  2VB6 A;  3QUJ A;  4HEA A;  4O4J E;  4XAX B;  3OYX A;  3PUQ A;  2A72 A;  3KBT A;  3RX6 A;  3AB3 B;  2Y48 B;  4N78 D;  1D1A A;  3C50 A;  3MZK B;  4ZI2 C;  1UCU A;  4MHC A;  3N9N A;  5L3E B;  3GN5 A;  1YKH B;  3CPZ A;  3UFE A;  5ETW A;  3VHL A;  3GWH A;  2LEH A;  4ZI2 D;  4L9I A;  2LSI A;  4GK0 E;  1MMG A;  2XAQ B;  3I0Q A;  4EXT A;  2IC6 A;  3FHN A;  4TV9 E;  3I0O A;  3C4X A;  2D0T A;  2V7M A;  5TAO A;  5CA1 E;  3JC6 C;  2LHR A;  4OHF A;  5LBM A;  2LHN A;  4QXC B;  5JR9 C;  2H7O A;  2SPC A;  5LBQ B;  3HA4 A;  3NRX A;  3OJA A;  2WMN A;  1MIY A;  1QSD A;  4TX5 A;  3SRZ A;  4DBR A;  4UVC B;  2XAF B;  3DTO A;  3BQK A;  3EUH A;  3VKH A;  3K3N A;  4IE5 A;  5A1L A;  4EB6 E;  4J2C A;  2Z6E A;  2B1E A;  1IZN B;  1D0X A;  4G63 A;  4JEH B;  5LJM A;  4PK5 A;  4EZH A;  2KLQ A;  3SWH A;  1MMA A;  2K9A A;  2PBI A;  3HR0 A;  4EOZ B;  2W63 A;  4E7Z A;  4PJL A;  4I43 B;  2DWK A;  2RP4 A;  3O1I A;  1WYB A;  2W00 A;  5C8Y E;  1WYC A;  3OYZ A;  4UEL A;  3MKD A;  5DQV A;  2N2N A;  3N2K E;  5FXX A;  3PU8 A;  2GK9 A;  2X68 A;  5FXW A;  5HXH A;  2V26 A;  5L3D B;  2E8I A;  2CA5 A;  2L8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...