2CXFA

Run domain of rap2 interacting protein x, crystallized in c2 space group
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
167
structure length
167
Chain Sequence
b'MANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEVNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDLDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rap2 interacting protein x
publication title Crystal Structure of the RUN Domain of the RAP2-interacting Protein x
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 38
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2005-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02759 RUN RUN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2cxfA00
2DWGA 2CXFA 2CXLA 3CWZB 2DWKA 4GIWA
chains in the Genus database with same CATH superfamily
1ZKEA 4IDQA 4EAHA 3LBXB 4P09A 5JDLA 4CXYA 2WWVA 4CN4A 2XQ6A 3SWHA 4JI3T 2MYSA 3RIAA 3CX6B 2BKPA 4HE8A 3HR0A 4TV8E 2E5LT 4H9NC 4I4TE 2QVAA 3ZPOA 3RGLA 2W4XA 3AEFA 2Z6EA 5DABA 2V6YB 3ZCJA 2YU1A 5CA1E 5LHIB 1W0AA 3E08A 4ERRA 5JDNA 5JR9B 3IEEA 4O4LE 1SHZC 3VRAA 3FB2A 1O3XA 4LMJA 3ZMZB 3AE6A 4O2AE 3IHRA 2X67A 3ZSSA 3N9LA 1SE7A 3L8RA 1MNEA 2JQ9A 4LF7T 5LXTE 2CHNA 2V7LA 3UT5E 2XHEB 5JRCA 5L47A 2UXNB 3PU8A 2LSJA 2X66A 4H9QC 2VQFT 5HXHA 2CCQA 4LFCT 5H6RB 4ILAA 4UXNB 3IA3A 3QB5K 1HNXT 2W67A 5HXRA 4YLHA 3RKGA 3LDQB 2D2SA 2HHHT 1MIYA 2GK9A 4JI6T 3KV5A 5CFBA 5LNKA 4LMKA 2KMFA 4IE7A 3Q5DA 3O1IA 3ZMUB 1FJGT 1YQ3A 3ZYMA 4AQYT 3UU8A 2XAQB 2CRBA 3ETUA 3IBPA 2M6IA 2LSKA 4NUVA 4I55E 2IC6A 3U3IA 4PJJA 2YDSA 5GONE 4IL4A 2WZIA 3ZC0A 2JPFA 4AKLA 4M1PA 3ZN0B 3S4UA 4N78D 3RHWA 1I94T 3K8PC 3NRXA 4ZHQE 4PK5A 4NIQA 4ZS3A 2BKNA 3MA9A 4Z90A 3GN5B 5FVKA 3CPZA 1B7TA 5FKYA 3VKHA 3PJAA 2WMOA 5JDGA 3RKOA 4DVDA 4WNKA 2NWBA 1HR0T 4I50E 2KWIB 2PJQA 2K5BB 2PTFA 2YK0A 4OK0A 2UXBT 4IIJE 4HWFA 3R84B 1Y64B 2CE7A 2IHR1 2LSGA 4YXDA 1YKEB 3SRZA 1FIOA 2QGSA 1KF6A 2LM2A 2YU2A 2V7IA 4IHJE 1HNZT 3OBVE 3ESLA 5FYMA 2V5DA 1LRZA 3H37A 5IUXA 5DQWA 3PUQA 3V5SA 1J5WA 4WYVA 3AEAA 3TLSA 4DO0A 3F31A 2NOXA 4GK5E 5L3DB 1QUUA 1N32T 5KX5E 4HFIA 5LJNA 4JBWF 3N9OA 2WP9A 2BDEA 1LVFA 4BJMA 1H7CA 1JNZA 2OV9A 2NW7A 4YFSA 4QKNA 2W0GA 4DUYT 4ZS2A 3FZFB 5AQUB 3HKBE 2KLQA 4JI7T 4X65T 4ILCA 4ZI2D 4GKKT 5JDFA 4UVCB 2MOZA 4HFBA 4OYKA 2BS3A 4EB6E 3RLFF 5AQNB 4O8SA 2CBJA 3ZSTA 5C2TA 5A1LA 3PV0F 4QX8B 4LF4T 3AE1A 2K9AA 2WBLA 4YTMA 4LFBT 4DR2T 3UQ4A 2HN1A 2D9DA 4OFZA 4O4JE 3HKEE 3RYFE 4DV5T 2WY2A 4IE4A 5LBQB 3PUXF 1ZEEA 3OVUA 5ADXL 4AISA 4PK4A 2XQ9A 3JAEA 5JR9C 4L0RA 1D1CA 1HF8A 2QA7A 5ABFA 4PJNA 5FMNA 2N1GA 2DL1A 5FL1A 4QXBB 3U78A 4EV6A 2KWHA 3I1AA 4KI0F 1MMNA 4UEMA 3KV6A 4EYYR 2XQ3A 4IE6A 4B3TT 4CN6A 3CX7B 1IBLT 2J1DG 3C51A 4U74A 4ZXLA 5EZYE 1HX8A 4KX6A 3UQ7A 5HEUA 4NXNT 5IWAT 2XQYA 2YN6A 3EI0A 2FJBA 5J2UE 2YINA 3FHNA 2DCFA 3ZMVB 1IJ6A 4IDPA 4X1KE 1T72A 4Q25A 4DV6T 4YJ3E 4LMLA 3DJBA 4F6RC 5HCJA 3RIUA 1D1AA 1KEYA 2XJ7A 3CWZB 1XNQT 4UV8B 2JMKA 3IF8B 1G8XA 1LKXA 1IZNB 4L9IA 2ZLYA 2LOSA 3B57A 4E7ZA 3AXJA 2MBGA 3CVRA 3OJAA 5KXJA 4DV1T 3C4XA 3UUBA 2VURA 5EK2A 1J1JA 4ISTA 4AKGA 4U72A 2WMNA 3H3AA 4JI4T 3BQKA 3C50A 1X9BA 2NTYA 1KNZA 2DI4A 3X1DA 2XASB 5JREA 3LK42 2C5KT 1XZYA 4GYSA 4YSYA 3LBXA 4TV9E 5AQSB 3UU5A 3N9NA 1WRDA 3P4RA 3NVOA 2WS3A 3NKZA 3QC9A 1FMWA 4U3CA 4WBOA 3CQCB 3NWIA 4QXHB 1US7B 5J2TE 4YTPA 1ZHCA 4XBFB 1T98A 4DV3T 4WBNE 1Y01A 1DU2A 3AE4A 2CMRA 3K1SA 3J9X1 1U4QA 2J62A 3EAMA 3UUNA 2H3RA 1XMOT 3T1YT 2W2UA 2V26A 4ADZA 2XQ4A 2D5UA 5HAXA 1X79A 4ZZBA 4PJLA 4HWCA 3ZJ2A 3V5UA 5DQVA 2XSBA 3L09A 3FZLB 2ACZA 4KHZF 4X1YE 3PE0A 4JI5T 2ZM2A 3CX8B 1HG2A 4CQIA 4AI6A 5L4HA 4TZ4C 5HXSA 3ZT7A 3JC6D 2BBJA 1VCTA 2KXPB 4JYAT 3LJCA 4H9PC 2ZM6T 3P4QA 1WYCA 4AQFC 2M6BA 1BR4A 1D0ZA 3L39A 2CHOA 4DNDA 3PJAJ 4KP3C 5LOVE 2RPAA 1MNDA 5ABGA 3N5LA 3PUWF 3C64A 3AEBA 5HEGA 4P0AA 4O4HE 2C5JA 4OHFA 4DR1T 3Q5EA 2CPTA 4DIDB 4H9RC 2IDOB 3GMIA 4QWNB 5LMUT 4B3MT 2V7JA 3L3PA 2UXDT 3DTOA 2CWYA 4DR5T 1JNRA 3T8OA 2XAJB 2XUEA 1YW0A 3HKDE 1IBKT 3ZJ1A 2KNDA 1NENA 1OWAA 4FI5A 3RQUA 5AQQB 3P8CD 1D1BA 5C8YE 4ZI3D 2YEVC 5LJMA 4IDOA 4EXTA 1MMGA 3RF1A 3FZKB 3GN5A 3VRBA 3HL6A 2WSSV 1UUSA 5AQOB 2W62A 2LKHA 4P0BA 1WR0A 5L3BB 3AVSA 3VR9A 2H89A 2WDRA 3MZKB 3CKDA 1OEDE 2FUPA 3AA7B 5J0ZA 5FP3A 3FXEB 1FEWA 4AQGA 4QH4A 5FXWA 4HFDA 4A97A 1VRBA 4DBQA 1IBMT 2H7OA 3QB5A 2HPLA 2XQ8A 1I6ZA 2BS2A 3N9MA 3RH3A 3D0TA 2PFVA 3AE7A 3AE9A 5LGNB 4DV7T 2VKJA 2Q9QA 2W63A 4HFVA 1XWMA 2YDRA 2CLYB 4AKIA 5JDHA 4KUMB 3RIFA 3JAFA 3AE8A 1N34T 2XZEA 4FJOA 5IHYA 2UUCT 5L3FB 4KMCA 1WCRA 3LFMA 3HKCE 3AVRA 4IDZA 3PURA 3JC6C 4ISSA 3ZLIA 5L4EA 3PUSA 4AQFA 4TX5A 3C4ZA 2VB6A 2H88A 3E22E 4K0KT 2YKSA 4BAYB 2FJAA 3O9XA 2X68A 2WAUA 5HEHA 3ZMTB 1G73A 3N9QA 3RI5A 1CUNA 3PTRB 2V8SV 3AEDA 4DR6T 4U7YA 3RC3A 3R6NA 4EOZB 2WB5A 4PK6A 4AXPA 4DMVA 2XSAA 3N9PA 1HNWT 3P7IA 1EZ3A 5AQFB 3FBZA 1BR2A 2LSIA 4JV5T 2VVNA 5FVLA 1YKHB 2UXXB 4C91A 4MLKA 4ZI3C 1WYBA 4PNIA 5LYJE 3FZMB 3M65A 2NP9A 4HFHA 2WCAA 4TWDA 2Q9QB 1M7KA 1BR0A 5AFUL 1N36T 5HEJA 4PJMA 3CK6A 5LGTB 2A2FX 2L8KA 3QOFA 3AAAB 1XDOA 2CEAA 3UTKA 1UGOA 3RIUC 2IIUA 1VCSA 1M62A 2WZHA 5M4YA 3UU3A 4PFPA 4EGWA 4IDNA 2CA5A 5TAOA 5LHHB 3ZCIA 3AEGA 1CHUA 3MJXA 2LJLA 2CXDA 4JI8T 3KBUA 2VKHA 2X9HA 4LF9T 5HXCA 1D0XA 4UELA 3A7MA 4MALA 1HCIA 3PUVF 2YOEA 5F3JA 2X9YA 1OEDB 3EDUA 4J2CA 3BK9A 2W00A 3N2KE 4G2AA 4QHOA 3AA6B 5C3JA 2E5VA 1KFYA 2VWAA 4L5GA 5BR8T 1E7PA 2XY8B 3T1HT 4OX9T 3MXZA 4KHPT 3C98B 1AJ3A 2Q9QD 4CXWA 4A98A 2Y6XA 4Z8XA 1HS7A 2L3LA 3GWHA 5JH7E 4NPPA 3K3NA 3ONLC 2E9XA 3ETVA 1U5PA 5JTGA 3VKGA 3UULA 1W9RA 2E8IA 4XAXB 4JI1T 4ZOLE 5LP6E 2JQQA 4MFRA 1D0YA 4EEBA 4IGUA 3DP7A 4WW0A 3NZPA 3PUYF 2JJ9A 2XTLA 2JRKA 2BS4A 2XQ7A 5J1GA 1KK7A 4O2BE 2VQET 3UFEA 2N2NA 4CI2B 2B1EA 5FXZA 4X64T 2XAHB 4DUZT 2CWOA 1N33T 2Y8DA 2NTXA 3I0QA 2FJEA 5CGMA 4TUYE 2VL0A 3AAIA 5L3CB 2CLYC 5HCMA 2QYWA 3KV4A 2R6GF 4JLEA 5ABHA 4DMWA 3O1HA 2WM9A 3SOLA 4JEUB 1UK5A 3FZHB 4X5TA 4MBQA 4A56A 2BG9E 4HWDA 2FJDA 2VL8A 1S35A 4DR4T 3KVAA 3G06A 4P1NA 2BKOA 2AXDS 2WU5A 4ZI2C 5L3GB 3VR8A 3ZN1B 3P4PA 1HTJF 4IT4A 1ZV4X 3WAKA 4ILBA 4Z91A 2LM9A 4DBRA 2E9XB 3WAJA 2DHRA 3C4WA 4ASKA 1Z8UA 4AKHA 5LCYA 4UF0B 1Z0PA 5FY1A 1YD8G 1V9DA 5AQPB 2V5CA 2P9BA 5ABEA 2HN2A 2IMLA 2VKDA 4H63H 3UUXB 3ZMSB 4U2YA 3QUJA 4JEHB 3MACA 2JMHA 4TWFA 1J5ET 2Q9QC 1QLBA 4E7SA 3MK7C 3FBLA 3KINB 1MIWA 1MIVA 5JQGE 1GQEA 4UVAB 2UU9T 2AE9A 5E0OA 4YJ2E 4EZHA 1IAPA 4CI1B 1UURA 5EK3A 2JIWA 3OYZA 4GYRA 5F5WA 2IAKA 4YSXA 3P4WA 5FXVA 2BG9A 2C0SA 2LHRA 5LB7B 2W66A 4UIGA 4IE0A 4EZ4A 4HFEA 3ZYKA 3CMLA 5FXXA 3K3QC 3ONXA 2XM1A 2LLYA 3I9WA 3LG7A 5FY0A 3ZKRA 2OA5A 3AA1B 3AE5A 3VHLA 4QH1A 1UX4A 5LMNT 5ETWA 3QNUA 4B6XA 2XAGB 2JQHA 4B3ST 5HXEA 4YT0A 4EIWA 4HFCA 3Q5WA 3NBXX 3EDVA 5HYAA 4YHJA 2KZ7B 1XMQT 1OEDC 2E9XD 2IUBA 2ZMAA 3ABVA 2V1DB 4JI0T 3UU4A 5JDMA 3TKLB 2X9XA 3AA0B 2HPJA 4C90A 3MKDA 2OLTA 4TN7B 2BZBA 3I0OA 3TLUA 4LF8T 3RYCE 4KBMB 3PDYA 3PUZF 5FY7A 4X20E 2F4VT 4JI2T 4GKJT 5CB4E 2X51A 3M3ZB 3EABA 2HH7A 3RQWA 4YHHT 2BG9B 2XQ5A 2I59A 2VKOA 1WLXA 5AQRB 5EK4A 3QK6A 4HKAA 3ZT5A 1XNRT 3N2GE 1MMAA 2CXFA 3EHZA 3P50A 3F57A 4IREA 2PG8A 1HG5A 2XAFB 4TNWA 3CQGB 3AEEA 5LG3A 3WI3A 5JVDE 2NW9A 2FBWA 4HTEA 1FMVA 2EHOB 4QX7B 2NR4A 3JCFA 4GOUA 4X62T 3LK3B 3RYIE 3ONJA 5LBMA 3CIRA 2VK9A 2E2AA 3NZQA 3E0ZA 3H3MA 4WZXA 4X66T 4DV0T 2X9WA 5AQKB 2LRLA 5AQTB 2LHNA 1WR6A 2QRXA 2BVMA 4I43B 3KV9A 3ANWA 3RX6A 4MHCA 1UCUA 1SA0E 1OEDA 3RC8A 3AECA 1OXZA 2A9UA 1KNRA 1KNPA 3UUMA 2W61A 2E9XC 2N9DA 2L9QA 3BQLA 2KINB 3F2EA 5JRCB 2IC9A 4CZZB 4LFAT 4YSZA 4NUUA 3K3OA 3PUGA 2X0YA 2D0UA 1W0BA 2X0LB 2LRKA 2ACXA 3LSVA 1NEKA 5AQVB 3OPCA 2WWUA 1S94A 3ZC1A 4TWHA 2A72A 4HN9A 4I0UA 5AQLB 1NWMX 3Q2MA 4PW8A 3RYHE 3SFDA 5L3EB 1IJ5A 5BMVE 4LF6T 1MMDA 2EHOD 2CM0A 2WU2A 3JADA 3A5XA 4PFOA 4AKRB 1W09A 2V7KA 4CI3B 2IW5B 5F8PA 2ZM8A 5LHGB 2BBHA 3ANWB 4PAGA 4F8HA 4JUYA 2DNXA 2XM2A 4EYUA 4H63V 2DWKA 2BVLA 5AQIB 3SFEA 5KDMC 5H6QB 2RP4A 5CA0E 2DWGA 3B13A 5JDQA 4DR3T 2Y48B 3AAEB 2PBIA 2UXCT 4U2ZA 2VASA 4AIUA 3ZEFB 3W15B 2JQKA 3Q5XA 4UV9B 2I0MA 4GIWA 3UU6A 4YY3T 4QXCB 3AE3A 3O4XE 3ZT6A 2LEHA 2V7MA 4DV2T 3KDSE 3RRWA 2ODVA 4BJNA 5LG4A 3RPUA 4DR7T 3EUHA 5AQJB 4UR9A 4UF0A 4U31A 3RRCA 3TLWA 2VVSA 5AQMB 3SS1A 1E1HB 4O4IE 2WDQA 5AQGB 3P4SA 3HI2A 2BG9C 2MTQA 2G0UA 4H9OC 2WDVA 4V1Av 2CBIA 1XDPA 2K3WA 3I9YA 3EVYA 4EEDA 1ZP0A 2MPKA 3HA4A 1WFDA 1QSDA 2XQAA 4HGAA 4G63A 2WQYA 2KT9A 3A8YC 4BA9A 1R8IA 4U33A 2A3DA 4QH5A 1UX5A 4IE5A 2I6HA 1HX1B 3FXDB 5AQHB 4H9SE 1NAFA 2K48A 2UUAT 3OTOT 2EHOC 3AE2A 1T8BA 4HWHA 4OYJA 4UVBB 2YDQA 2ZM0A 4HEAA 2LE8A 2RA1A 4X1IE 2SPCA 5LA6E 4ZZCA 5IYZE 3GA8A 2NW8A 5FNVE 4CN1A 1SUMB 4B3RT 2X0HA 5CJ5A 5KMGP 4IL9A 4K0UA 4CXXA 3KFWX 2K24A 2ES0A 5ABFB 2LT3A 2H7VC 3LK2B 4COFA 4GK0E 2J4GA 3O1JA 1HFAA 3KBTA 5HWXA 4LF5T 3NRYA 3N2OA 2C5IT 1ZOYA 2V6YA 2UUBT 1LVKA 2D0TA 3UFGA 4TNVA 4XZCA 1YQ4A 5JR9A 2B76A 2CXLA 3PU3A 4YTNA 2DLRA 5HWYA 3OYXA 3ZYLA 3KVBA 4U7IA 1YXRA 2MAWA 2ODUA 4NXMT 3B5MA 2M67A 2XPKA 5LGUB 4HWIB 2LSYA 2J47A 2KSRA 5HEOA 4A5XA 3AB3B 4ZEYA 2LOPA 4ZI7E 3VU7H 3CQXC 3OKQA 3AXJB 2V6XA 1T7SA 3BQIA 5FL0A 3TLVA 4DV4T 1E2AA 1BR1A 3Q9DA 3J7Yq 5DJQC 3PUAA 3TLTA 5L2LA 4ILUA 4ANJA 2LKGA 1VOMA 2EHOA 1L0VA
chains in the Genus database with same CATH topology
1ZKEA 2X9WA 5EK2A 4EAHA 3LBXB 2LHNA 4ISTA 4AKGA 1WR6A 3EDUA 4J2CA 4U72A 3BK9A 2WMNA 4P09A 3H3AA 2BVMA 3BQKA 2W00A 5JDLA 3C50A 4I43B 4CXYA 3KV9A 3ANWA 2NTYA 1KNZA 3RX6A 2DI4A 3SWHA 2XASB 5JREA 2MYSA 4MHCA 3CX6B 3LK42 3N2KE 1UCUA 2C5KT 4G2AA 3AA6B 4QHOA 1SA0E 4GYSA 4HE8A 3HR0A 4TV8E 3RC8A 4H9NC 3LBXA 4I4TE 3ZPOA 4TV9E 1OXZA 2Z6EA 5DABA 3N9NA 1WRDA 2VWAA 3UUMA 3ZCJA 2YU1A 2W61A 5CA1E 2E9XC 2N9DA 4L5GA 5LHIB 2L9QA 3BQLA 3E08A 4ERRA 5JDNA 3QC9A 5JR9B 1FMWA 3MXZA 4WBOA 3CQCB 3IEEA 4O4LE 4QXHB 1US7B 5J2TE 4XBFB 1ZHCA 1SHZC 1T98A 3C98B 4WBNE 1AJ3A 3FB2A 2Q9QD 1O3XA 2KINB 4CXWA 3F2EA 3ZMZB 5JRCB 2IC9A 2Y6XA 4CZZB 4Z8XA 2CMRA 4O2AE 1HS7A 2L3LA 3J9X1 4NUUA 3IHRA 2X67A 3GWHA 3N9LA 5JH7E 1U4QA 3K3OA 3K3NA 3UUNA 2H3RA 2E9XA 3PUGA 3ETVA 2V26A 4ADZA 1MNEA 1U5PA 2D0UA 2D5UA 5HAXA 3VKGA 2X0LB 1X79A 3UULA 5LXTE 4PJLA 2E8IA 4XAXB 3ZJ2A 4ZOLE 2ACXA 2V7LA 3UT5E 2XHEB 3V5UA 5DQVA 5LP6E 2JQQA 5JRCA 2UXNB 4MFRA 3L09A 3PU8A 1D0YA 2LSJA 4IGUA 3DP7A 2WWUA 4WW0A 1S94A 3ZC1A 3NZPA 2X66A 4H9QC 5HXHA 2CCQA 2JJ9A 5H6RB 2XTLA 2A72A 4HN9A 2JRKA 4UXNB 5J1GA 1KK7A 4O2BE 4X1YE 3PE0A 5HXRA 2N2NA 3UFEA 4YLHA 4CI2B 2B1EA 2D2SA 2ZM2A 3CX8B 5FXZA 2XAHB 1NWMX 1HG2A 1MIYA 2GK9A 4CQIA 4AI6A 2CWOA 3KV5A 3Q2MA 4PW8A 4TZ4C 5HXSA 3RYHE 2Y8DA 2NTXA 3I0QA 5LNKA 4TUYE 3AAIA 2KMFA 3JC6D 5L3CB 2CLYC 4IE7A 5L3EB 1IJ5A 5BMVE 2KXPB 3KV4A 3O1IA 3LJCA 4H9PC 4JLEA 1MMDA 4DMWA 3ZMUB 2EHOD 1WYCA 2CM0A 2WM9A 3O1HA 3ZYMA 3A5XA 3SOLA 2XAQB 4PFOA 4AQFC 4AKRB 2V7KA 4JEUB 3ETUA 4CI3B 3IBPA 1BR4A 2LSKA 2IW5B 4NUVA 5F8PA 4I55E 2IC6A 1D0ZA 3U3IA 4DNDA 4PJJA 4KP3C 5LOVE 4MBQA 2ZM8A 1MNDA 5LHGB 5GONE 4A56A 3ZC0A 3N5LA 2JPFA 3ANWB 4PAGA 3C64A 4JUYA 4AKLA 4M1PA 2VL8A 1S35A 4O4HE 4P0AA 2C5JA 3ZN0B 4OHFA 2DNXA 3S4UA 4N78D 3KVAA 4H9RC 4EYUA 4H63V 2DWKA 2BVLA 3GMIA 5KDMC 4QWNB 2RP4A 5H6QB 5CA0E 2DWGA 3K8PC 3NRXA 4ZI2C 5L3GB 2V7JA 3B13A 3L3PA 3ZN1B 5JDQA 3DTOA 2CWYA 4ZHQE 2Y48B 3T8OA 4PK5A 2XAJB 2XUEA 1HTJF 1YW0A 4ZS3A 3HKDE 3MA9A 3ZJ1A 2KNDA 3AAEB 3GN5B 2PBIA 3CPZA 1OWAA 1ZV4X 3WAKA 4FI5A 1B7TA 2VASA 3P8CD 1D1BA 3ZEFB 5C8YE 3W15B 4ZI3D 3Q5XA 2YEVC 4UV9B 5LJMA 2LM9A 4DBRA 3VKHA 2E9XB 3WAJA 2DHRA 3C4WA 4ASKA 2WMOA 5JDGA 3RKOA 4GIWA 4EXTA 4AKHA 4DVDA 5LCYA 4WNKA 2NWBA 4UF0B 1Z0PA 1MMGA 5FY1A 4I50E 3GN5A 2KWIB 1YD8G 4QXCB 1V9DA 2PJQA 2K5BB 2YK0A 3O4XE 2LEHA 2P9BA 2V7MA 3HL6A 4OK0A 2WSSV 3KDSE 4IIJE 3RRWA 2ODVA 4BJNA 5LG4A 2VKDA 2W62A 4H63H 3R84B 3RPUA 3UUXB 4P0BA 3EUHA 3ZMSB 1Y64B 2CE7A 2LSGA 5L3BB 3QUJA 4UF0A 1YKEB 3AVSA 3RRCA 3SRZA 4JEHB 3MACA 3MZKB 3CKDA 3SS1A 1FIOA 2QGSA 1E1HB 2JMHA 3AA7B 4O4IE 2Q9QC 5FP3A 3FXEB 2YU2A 1FEWA 4AQGA 2V7IA 3MK7C 4IHJE 4E7SA 5FXWA 3FBLA 3OBVE 3KINB 1VRBA 4DBQA 3HI2A 1MIWA 3ESLA 1MIVA 2H7OA 5FYMA 5JQGE 2HPLA 4UVAB 2MTQA 1LRZA 2G0UA 3H37A 4H9OC 4V1Av 3N9MA 5E0OA 5DQWA 4YJ2E 4EZHA 3PUQA 3V5SA 1IAPA 3I9YA 4CI1B 3RH3A 3D0TA 3EVYA 2PFVA 3HA4A 5EK3A 5LGNB 2VKJA 4DO0A 2Q9QA 2NOXA 3F31A 2W63A 1QSDA 3OYZA 4HFVA 4GK5E 4HGAA 5L3DB 4GYRA 4G63A 1QUUA 2IAKA 2CLYB 4AKIA 2KT9A 5KX5E 5FXVA 2C0SA 4BA9A 2LHRA 5LJNA 5JDHA 4KUMB 4UIGA 2A3DA 4IE0A 4FJOA 5IHYA 4EZ4A 5L3FB 3ZYKA 1UX5A 3N9OA 3CMLA 4KMCA 2BDEA 3LFMA 3HKCE 4IE5A 3AVRA 5FXXA 3K3QC 3ONXA 1LVFA 4BJMA 4IDZA 1H7CA 3I9WA 3PURA 3JC6C 4ISSA 2NW7A 3FXDB 3LG7A 4H9SE 4YFSA 4QKNA 1NAFA 5FY0A 2W0GA 2OA5A 2K48A 3AA1B 3VHLA 3ZLIA 4ZS2A 3PUSA 2EHOC 1UX4A 4AQFA 5ETWA 3HKBE 4B6XA 2KLQA 2XAGB 4OYJA 4UVBB 4TX5A 4ZI2D 3C4ZA 2VB6A 2ZM0A 4HEAA 3E22E 2LE8A 5HXEA 5JDFA 4UVCB 2MOZA 2RA1A 4BAYB 4OYKA 4X1IE 2SPCA 4EB6E 5LA6E 5IYZE 4EIWA 4O8SA 3Q5WA 3O9XA 3GA8A 2X68A 3NBXX 2NW8A 5A1LA 3EDVA 5FNVE 5HYAA 4YHJA 2KZ7B 2WAUA 4QX8B 3ZMTB 2K9AA 2WBLA 1G73A 3N9QA 2E9XD 1CUNA 3PTRB 2ZMAA 2V1DB 3RC3A 5KMGP 3R6NA 4EOZB 5JDMA 3TKLB 4K0UA 4CXXA 3KFWX 2K24A 2X9XA 4OFZA 4PK6A 2ES0A 2HPJA 3AA0B 4O4JE 4C90A 4AXPA 3HKEE 3MKDA 3N9PA 2LT3A 4DMVA 3RYFE 4TN7B 2H7VC 3LK2B 3P7IA 1EZ3A 3FBZA 2BZBA 1BR2A 3I0OA 4IE4A 2LSIA 3RYCE 5LBQB 1ZEEA 5ADXL 1YKHB 4PK4A 2UXXB 4C91A 4MLKA 4KBMB 4ZI3C 4GK0E 1WYBA 3PDYA 4L0RA 4PNIA 5JR9C 5LYJE 3O1JA 1D1CA 3M65A 1HFAA 3KBTA 1HF8A 5FY7A 4X20E 2NP9A 2QA7A 5HWXA 4PJNA 3NRYA 5FMNA 2N1GA 3N2OA 2C5IT 4QXBB 3U78A 2Q9QB 5CB4E 2KWHA 3I1AA 1LVKA 2X51A 2D0TA 1MMNA 4UEMA 1BR0A 5AFUL 3KV6A 4XZCA 2HH7A 5JR9A 2CXLA 3PU3A 4EYYR 4PJMA 2I59A 2VKOA 1WLXA 4IE6A 2DLRA 5EK4A 3OYXA 5HWYA 3KVBA 3QK6A 4HKAA 3ZYLA 5LGTB 2A2FX 2L8KA 3CX7B 2ODUA 2J1DG 3AAAB 2CEAA 3N2GE 3C51A 1MMAA 4U74A 3UTKA 2M67A 2CXFA 5EZYE 5LGUB 1HX8A 2XQYA 3F57A 2LSYA 5J2UE 2PG8A 2YINA 1HG5A 3FHNA 2DCFA 3ZMVB 1IJ6A 3AB3B 2XAFB 4X1KE 2LOPA 3CQGB 5M4YA 4YJ3E 4ZI7E 4PFPA 3DJBA 3VU7H 3WI3A 4F6RC 5JVDE 3CQXC 2NW9A 1D1AA 3OKQA 2CA5A 5TAOA 5LHHB 3CWZB 3ZCIA 4UV8B 4HTEA 3MJXA 2LJLA 2CXDA 3BQIA 1FMVA 2EHOB 2JMKA 4QX7B 3IF8B 4GOUA 3KBUA 1G8XA 1LKXA 1IZNB 3LK3B 2VKHA 4L9IA 1BR1A 2X9HA 2ZLYA 3Q9DA 2LOSA 3B57A 5DJQC 3RYIE 3J7Yq 3PUAA 5LBMA 5L2LA 5HXCA 4E7ZA 2VK9A 1D0XA 3NZQA 4ILUA 2MBGA 3E0ZA 4ANJA 4UELA 3CVRA 3OJAA 4MALA 1HCIA 1VOMA 3C4XA 2EHOA 5F3JA 2X9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWG A;  2CXF A;  2CXL A;  3CWZ B;  2DWK A;  4GIW A; 
#chains in the Genus database with same CATH topology
 1ZKE A;  4IDQ A;  4EAH A;  3LBX B;  4P09 A;  5JDL A;  4CXY A;  2WWV A;  4CN4 A;  2XQ6 A;  3SWH A;  4JI3 T;  2MYS A;  3RIA A;  3CX6 B;  2BKP A;  4HE8 A;  3HR0 A;  4TV8 E;  2E5L T;  4H9N C;  4I4T E;  2QVA A;  3ZPO A;  3RGL A;  2W4X A;  3AEF A;  2Z6E A;  5DAB A;  2V6Y B;  3ZCJ A;  2YU1 A;  5CA1 E;  5LHI B;  1W0A A;  3E08 A;  4ERR A;  5JDN A;  5JR9 B;  3IEE A;  4O4L E;  1SHZ C;  3VRA A;  3FB2 A;  1O3X A;  4LMJ A;  3ZMZ B;  3AE6 A;  4O2A E;  3IHR A;  2X67 A;  3ZSS A;  3N9L A;  1SE7 A;  3L8R A;  1MNE A;  2JQ9 A;  4LF7 T;  5LXT E;  2CHN A;  2V7L A;  3UT5 E;  2XHE B;  5JRC A;  5L47 A;  2UXN B;  3PU8 A;  2LSJ A;  2X66 A;  4H9Q C;  2VQF T;  5HXH A;  2CCQ A;  4LFC T;  5H6R B;  4ILA A;  4UXN B;  3IA3 A;  3QB5 K;  1HNX T;  2W67 A;  5HXR A;  4YLH A;  3RKG A;  3LDQ B;  2D2S A;  2HHH T;  1MIY A;  2GK9 A;  4JI6 T;  3KV5 A;  5CFB A;  5LNK A;  4LMK A;  2KMF A;  4IE7 A;  3Q5D A;  3O1I A;  3ZMU B;  1FJG T;  1YQ3 A;  3ZYM A;  4AQY T;  3UU8 A;  2XAQ B;  2CRB A;  3ETU A;  3IBP A;  2M6I A;  2LSK A;  4NUV A;  4I55 E;  2IC6 A;  3U3I A;  4PJJ A;  2YDS A;  5GON E;  4IL4 A;  2WZI A;  3ZC0 A;  2JPF A;  4AKL A;  4M1P A;  3ZN0 B;  3S4U A;  4N78 D;  3RHW A;  1I94 T;  3K8P C;  3NRX A;  4ZHQ E;  4PK5 A;  4NIQ A;  4ZS3 A;  2BKN A;  3MA9 A;  4Z90 A;  3GN5 B;  5FVK A;  3CPZ A;  1B7T A;  5FKY A;  3VKH A;  3PJA A;  2WMO A;  5JDG A;  3RKO A;  4DVD A;  4WNK A;  2NWB A;  1HR0 T;  4I50 E;  2KWI B;  2PJQ A;  2K5B B;  2PTF A;  2YK0 A;  4OK0 A;  2UXB T;  4IIJ E;  4HWF A;  3R84 B;  1Y64 B;  2CE7 A;  2IHR 1;  2LSG A;  4YXD A;  1YKE B;  3SRZ A;  1FIO A;  2QGS A;  1KF6 A;  2LM2 A;  2YU2 A;  2V7I A;  4IHJ E;  1HNZ T;  3OBV E;  3ESL A;  5FYM A;  2V5D A;  1LRZ A;  3H37 A;  5IUX A;  5DQW A;  3PUQ A;  3V5S A;  1J5W A;  4WYV A;  3AEA A;  3TLS A;  4DO0 A;  3F31 A;  2NOX A;  4GK5 E;  5L3D B;  1QUU A;  1N32 T;  5KX5 E;  4HFI A;  5LJN A;  4JBW F;  3N9O A;  2WP9 A;  2BDE A;  1LVF A;  4BJM A;  1H7C A;  1JNZ A;  2OV9 A;  2NW7 A;  4YFS A;  4QKN A;  2W0G A;  4DUY T;  4ZS2 A;  3FZF B;  5AQU B;  3HKB E;  2KLQ A;  4JI7 T;  4X65 T;  4ILC A;  4ZI2 D;  4GKK T;  5JDF A;  4UVC B;  2MOZ A;  4HFB A;  4OYK A;  2BS3 A;  4EB6 E;  3RLF F;  5AQN B;  4O8S A;  2CBJ A;  3ZST A;  5C2T A;  5A1L A;  3PV0 F;  4QX8 B;  4LF4 T;  3AE1 A;  2K9A A;  2WBL A;  4YTM A;  4LFB T;  4DR2 T;  3UQ4 A;  2HN1 A;  2D9D A;  4OFZ A;  4O4J E;  3HKE E;  3RYF E;  4DV5 T;  2WY2 A;  4IE4 A;  5LBQ B;  3PUX F;  1ZEE A;  3OVU A;  5ADX L;  4AIS A;  4PK4 A;  2XQ9 A;  3JAE A;  5JR9 C;  4L0R A;  1D1C A;  1HF8 A;  2QA7 A;  5ABF A;  4PJN A;  5FMN A;  2N1G A;  2DL1 A;  5FL1 A;  4QXB B;  3U78 A;  4EV6 A;  2KWH A;  3I1A A;  4KI0 F;  1MMN A;  4UEM A;  3KV6 A;  4EYY R;  2XQ3 A;  4IE6 A;  4B3T T;  4CN6 A;  3CX7 B;  1IBL T;  2J1D G;  3C51 A;  4U74 A;  4ZXL A;  5EZY E;  1HX8 A;  4KX6 A;  3UQ7 A;  5HEU A;  4NXN T;  5IWA T;  2XQY A;  2YN6 A;  3EI0 A;  2FJB A;  5J2U E;  2YIN A;  3FHN A;  2DCF A;  3ZMV B;  1IJ6 A;  4IDP A;  4X1K E;  1T72 A;  4Q25 A;  4DV6 T;  4YJ3 E;  4LML A;  3DJB A;  4F6R C;  5HCJ A;  3RIU A;  1D1A A;  1KEY A;  2XJ7 A;  3CWZ B;  1XNQ T;  4UV8 B;  2JMK A;  3IF8 B;  1G8X A;  1LKX A;  1IZN B;  4L9I A;  2ZLY A;  2LOS A;  3B57 A;  4E7Z A;  3AXJ A;  2MBG A;  3CVR A;  3OJA A;  5KXJ A;  4DV1 T;  3C4X A;  3UUB A;  2VUR A;  5EK2 A;  1J1J A;  4IST A;  4AKG A;  4U72 A;  2WMN A;  3H3A A;  4JI4 T;  3BQK A;  3C50 A;  1X9B A;  2NTY A;  1KNZ A;  2DI4 A;  3X1D A;  2XAS B;  5JRE A;  3LK4 2;  2C5K T;  1XZY A;  4GYS A;  4YSY A;  3LBX A;  4TV9 E;  5AQS B;  3UU5 A;  3N9N A;  1WRD A;  3P4R A;  3NVO A;  2WS3 A;  3NKZ A;  3QC9 A;  1FMW A;  4U3C A;  4WBO A;  3CQC B;  3NWI A;  4QXH B;  1US7 B;  5J2T E;  4YTP A;  1ZHC A;  4XBF B;  1T98 A;  4DV3 T;  4WBN E;  1Y01 A;  1DU2 A;  3AE4 A;  2CMR A;  3K1S A;  3J9X 1;  1U4Q A;  2J62 A;  3EAM A;  3UUN A;  2H3R A;  1XMO T;  3T1Y T;  2W2U A;  2V26 A;  4ADZ A;  2XQ4 A;  2D5U A;  5HAX A;  1X79 A;  4ZZB A;  4PJL A;  4HWC A;  3ZJ2 A;  3V5U A;  5DQV A;  2XSB A;  3L09 A;  3FZL B;  2ACZ A;  4KHZ F;  4X1Y E;  3PE0 A;  4JI5 T;  2ZM2 A;  3CX8 B;  1HG2 A;  4CQI A;  4AI6 A;  5L4H A;  4TZ4 C;  5HXS A;  3ZT7 A;  3JC6 D;  2BBJ A;  1VCT A;  2KXP B;  4JYA T;  3LJC A;  4H9P C;  2ZM6 T;  3P4Q A;  1WYC A;  4AQF C;  2M6B A;  1BR4 A;  1D0Z A;  3L39 A;  2CHO A;  4DND A;  3PJA J;  4KP3 C;  5LOV E;  2RPA A;  1MND A;  5ABG A;  3N5L A;  3PUW F;  3C64 A;  3AEB A;  5HEG A;  4P0A A;  4O4H E;  2C5J A;  4OHF A;  4DR1 T;  3Q5E A;  2CPT A;  4DID B;  4H9R C;  2IDO B;  3GMI A;  4QWN B;  5LMU T;  4B3M T;  2V7J A;  3L3P A;  2UXD T;  3DTO A;  2CWY A;  4DR5 T;  1JNR A;  3T8O A;  2XAJ B;  2XUE A;  1YW0 A;  3HKD E;  1IBK T;  3ZJ1 A;  2KND A;  1NEN A;  1OWA A;  4FI5 A;  3RQU A;  5AQQ B;  3P8C D;  1D1B A;  5C8Y E;  4ZI3 D;  2YEV C;  5LJM A;  4IDO A;  4EXT A;  1MMG A;  3RF1 A;  3FZK B;  3GN5 A;  3VRB A;  3HL6 A;  2WSS V;  1UUS A;  5AQO B;  2W62 A;  2LKH A;  4P0B A;  1WR0 A;  5L3B B;  3AVS A;  3VR9 A;  2H89 A;  2WDR A;  3MZK B;  3CKD A;  1OED E;  2FUP A;  3AA7 B;  5J0Z A;  5FP3 A;  3FXE B;  1FEW A;  4AQG A;  4QH4 A;  5FXW A;  4HFD A;  4A97 A;  1VRB A;  4DBQ A;  1IBM T;  2H7O A;  3QB5 A;  2HPL A;  2XQ8 A;  1I6Z A;  2BS2 A;  3N9M A;  3RH3 A;  3D0T A;  2PFV A;  3AE7 A;  3AE9 A;  5LGN B;  4DV7 T;  2VKJ A;  2Q9Q A;  2W63 A;  4HFV A;  1XWM A;  2YDR A;  2CLY B;  4AKI A;  5JDH A;  4KUM B;  3RIF A;  3JAF A;  3AE8 A;  1N34 T;  2XZE A;  4FJO A;  5IHY A;  2UUC T;  5L3F B;  4KMC A;  1WCR A;  3LFM A;  3HKC E;  3AVR A;  4IDZ A;  3PUR A;  3JC6 C;  4ISS A;  3ZLI A;  5L4E A;  3PUS A;  4AQF A;  4TX5 A;  3C4Z A;  2VB6 A;  2H88 A;  3E22 E;  4K0K T;  2YKS A;  4BAY B;  2FJA A;  3O9X A;  2X68 A;  2WAU A;  5HEH A;  3ZMT B;  1G73 A;  3N9Q A;  3RI5 A;  1CUN A;  3PTR B;  2V8S V;  3AED A;  4DR6 T;  4U7Y A;  3RC3 A;  3R6N A;  4EOZ B;  2WB5 A;  4PK6 A;  4AXP A;  4DMV A;  2XSA A;  3N9P A;  1HNW T;  3P7I A;  1EZ3 A;  5AQF B;  3FBZ A;  1BR2 A;  2LSI A;  4JV5 T;  2VVN A;  5FVL A;  1YKH B;  2UXX B;  4C91 A;  4MLK A;  4ZI3 C;  1WYB A;  4PNI A;  5LYJ E;  3FZM B;  3M65 A;  2NP9 A;  4HFH A;  2WCA A;  4TWD A;  2Q9Q B;  1M7K A;  1BR0 A;  5AFU L;  1N36 T;  5HEJ A;  4PJM A;  3CK6 A;  5LGT B;  2A2F X;  2L8K A;  3QOF A;  3AAA B;  1XDO A;  2CEA A;  3UTK A;  1UGO A;  3RIU C;  2IIU A;  1VCS A;  1M62 A;  2WZH A;  5M4Y A;  3UU3 A;  4PFP A;  4EGW A;  4IDN A;  2CA5 A;  5TAO A;  5LHH B;  3ZCI A;  3AEG A;  1CHU A;  3MJX A;  2LJL A;  2CXD A;  4JI8 T;  3KBU A;  2VKH A;  2X9H A;  4LF9 T;  5HXC A;  1D0X A;  4UEL A;  3A7M A;  4MAL A;  1HCI A;  3PUV F;  2YOE A;  5F3J A;  2X9Y A;  1OED B;  3EDU A;  4J2C A;  3BK9 A;  2W00 A;  3N2K E;  4G2A A;  4QHO A;  3AA6 B;  5C3J A;  2E5V A;  1KFY A;  2VWA A;  4L5G A;  5BR8 T;  1E7P A;  2XY8 B;  3T1H T;  4OX9 T;  3MXZ A;  4KHP T;  3C98 B;  1AJ3 A;  2Q9Q D;  4CXW A;  4A98 A;  2Y6X A;  4Z8X A;  1HS7 A;  2L3L A;  3GWH A;  5JH7 E;  4NPP A;  3K3N A;  3ONL C;  2E9X A;  3ETV A;  1U5P A;  5JTG A;  3VKG A;  3UUL A;  1W9R A;  2E8I A;  4XAX B;  4JI1 T;  4ZOL E;  5LP6 E;  2JQQ A;  4MFR A;  1D0Y A;  4EEB A;  4IGU A;  3DP7 A;  4WW0 A;  3NZP A;  3PUY F;  2JJ9 A;  2XTL A;  2JRK A;  2BS4 A;  2XQ7 A;  5J1G A;  1KK7 A;  4O2B E;  2VQE T;  3UFE A;  2N2N A;  4CI2 B;  2B1E A;  5FXZ A;  4X64 T;  2XAH B;  4DUZ T;  2CWO A;  1N33 T;  2Y8D A;  2NTX A;  3I0Q A;  2FJE A;  5CGM A;  4TUY E;  2VL0 A;  3AAI A;  5L3C B;  2CLY C;  5HCM A;  2QYW A;  3KV4 A;  2R6G F;  4JLE A;  5ABH A;  4DMW A;  3O1H A;  2WM9 A;  3SOL A;  4JEU B;  1UK5 A;  3FZH B;  4X5T A;  4MBQ A;  4A56 A;  2BG9 E;  4HWD A;  2FJD A;  2VL8 A;  1S35 A;  4DR4 T;  3KVA A;  3G06 A;  4P1N A;  2BKO A;  2AXD S;  2WU5 A;  4ZI2 C;  5L3G B;  3VR8 A;  3ZN1 B;  3P4P A;  1HTJ F;  4IT4 A;  1ZV4 X;  3WAK A;  4ILB A;  4Z91 A;  2LM9 A;  4DBR A;  2E9X B;  3WAJ A;  2DHR A;  3C4W A;  4ASK A;  1Z8U A;  4AKH A;  5LCY A;  4UF0 B;  1Z0P A;  5FY1 A;  1YD8 G;  1V9D A;  5AQP B;  2V5C A;  2P9B A;  5ABE A;  2HN2 A;  2IML A;  2VKD A;  4H63 H;  3UUX B;  3ZMS B;  4U2Y A;  3QUJ A;  4JEH B;  3MAC A;  2JMH A;  4TWF A;  1J5E T;  2Q9Q C;  1QLB A;  4E7S A;  3MK7 C;  3FBL A;  3KIN B;  1MIW A;  1MIV A;  5JQG E;  1GQE A;  4UVA B;  2UU9 T;  2AE9 A;  5E0O A;  4YJ2 E;  4EZH A;  1IAP A;  4CI1 B;  1UUR A;  5EK3 A;  2JIW A;  3OYZ A;  4GYR A;  5F5W A;  2IAK A;  4YSX A;  3P4W A;  5FXV A;  2BG9 A;  2C0S A;  2LHR A;  5LB7 B;  2W66 A;  4UIG A;  4IE0 A;  4EZ4 A;  4HFE A;  3ZYK A;  3CML A;  5FXX A;  3K3Q C;  3ONX A;  2XM1 A;  2LLY A;  3I9W A;  3LG7 A;  5FY0 A;  3ZKR A;  2OA5 A;  3AA1 B;  3AE5 A;  3VHL A;  4QH1 A;  1UX4 A;  5LMN T;  5ETW A;  3QNU A;  4B6X A;  2XAG B;  2JQH A;  4B3S T;  5HXE A;  4YT0 A;  4EIW A;  4HFC A;  3Q5W A;  3NBX X;  3EDV A;  5HYA A;  4YHJ A;  2KZ7 B;  1XMQ T;  1OED C;  2E9X D;  2IUB A;  2ZMA A;  3ABV A;  2V1D B;  4JI0 T;  3UU4 A;  5JDM A;  3TKL B;  2X9X A;  3AA0 B;  2HPJ A;  4C90 A;  3MKD A;  2OLT A;  4TN7 B;  2BZB A;  3I0O A;  3TLU A;  4LF8 T;  3RYC E;  4KBM B;  3PDY A;  3PUZ F;  5FY7 A;  4X20 E;  2F4V T;  4JI2 T;  4GKJ T;  5CB4 E;  2X51 A;  3M3Z B;  3EAB A;  2HH7 A;  3RQW A;  4YHH T;  2BG9 B;  2XQ5 A;  2I59 A;  2VKO A;  1WLX A;  5AQR B;  5EK4 A;  3QK6 A;  4HKA A;  3ZT5 A;  1XNR T;  3N2G E;  1MMA A;  2CXF A;  3EHZ A;  3P50 A;  3F57 A;  4IRE A;  2PG8 A;  1HG5 A;  2XAF B;  4TNW A;  3CQG B;  3AEE A;  5LG3 A;  3WI3 A;  5JVD E;  2NW9 A;  2FBW A;  4HTE A;  1FMV A;  2EHO B;  4QX7 B;  2NR4 A;  3JCF A;  4GOU A;  4X62 T;  3LK3 B;  3RYI E;  3ONJ A;  5LBM A;  3CIR A;  2VK9 A;  2E2A A;  3NZQ A;  3E0Z A;  3H3M A;  4WZX A;  4X66 T;  4DV0 T;  2X9W A;  5AQK B;  2LRL A;  5AQT B;  2LHN A;  1WR6 A;  2QRX A;  2BVM A;  4I43 B;  3KV9 A;  3ANW A;  3RX6 A;  4MHC A;  1UCU A;  1SA0 E;  1OED A;  3RC8 A;  3AEC A;  1OXZ A;  2A9U A;  1KNR A;  1KNP A;  3UUM A;  2W61 A;  2E9X C;  2N9D A;  2L9Q A;  3BQL A;  2KIN B;  3F2E A;  5JRC B;  2IC9 A;  4CZZ B;  4LFA T;  4YSZ A;  4NUU A;  3K3O A;  3PUG A;  2X0Y A;  2D0U A;  1W0B A;  2X0L B;  2LRK A;  2ACX A;  3LSV A;  1NEK A;  5AQV B;  3OPC A;  2WWU A;  1S94 A;  3ZC1 A;  4TWH A;  2A72 A;  4HN9 A;  4I0U A;  5AQL B;  1NWM X;  3Q2M A;  4PW8 A;  3RYH E;  3SFD A;  5L3E B;  1IJ5 A;  5BMV E;  4LF6 T;  1MMD A;  2EHO D;  2CM0 A;  2WU2 A;  3JAD A;  3A5X A;  4PFO A;  4AKR B;  1W09 A;  2V7K A;  4CI3 B;  2IW5 B;  5F8P A;  2ZM8 A;  5LHG B;  2BBH A;  3ANW B;  4PAG A;  4F8H A;  4JUY A;  2DNX A;  2XM2 A;  4EYU A;  4H63 V;  2DWK A;  2BVL A;  5AQI B;  3SFE A;  5KDM C;  5H6Q B;  2RP4 A;  5CA0 E;  2DWG A;  3B13 A;  5JDQ A;  4DR3 T;  2Y48 B;  3AAE B;  2PBI A;  2UXC T;  4U2Z A;  2VAS A;  4AIU A;  3ZEF B;  3W15 B;  2JQK A;  3Q5X A;  4UV9 B;  2I0M A;  4GIW A;  3UU6 A;  4YY3 T;  4QXC B;  3AE3 A;  3O4X E;  3ZT6 A;  2LEH A;  2V7M A;  4DV2 T;  3KDS E;  3RRW A;  2ODV A;  4BJN A;  5LG4 A;  3RPU A;  4DR7 T;  3EUH A;  5AQJ B;  4UR9 A;  4UF0 A;  4U31 A;  3RRC A;  3TLW A;  2VVS A;  5AQM B;  3SS1 A;  1E1H B;  4O4I E;  2WDQ A;  5AQG B;  3P4S A;  3HI2 A;  2BG9 C;  2MTQ A;  2G0U A;  4H9O C;  2WDV A;  4V1A v;  2CBI A;  1XDP A;  2K3W A;  3I9Y A;  3EVY A;  4EED A;  1ZP0 A;  2MPK A;  3HA4 A;  1WFD A;  1QSD A;  2XQA A;  4HGA A;  4G63 A;  2WQY A;  2KT9 A;  3A8Y C;  4BA9 A;  1R8I A;  4U33 A;  2A3D A;  4QH5 A;  1UX5 A;  4IE5 A;  2I6H A;  1HX1 B;  3FXD B;  5AQH B;  4H9S E;  1NAF A;  2K48 A;  2UUA T;  3OTO T;  2EHO C;  3AE2 A;  1T8B A;  4HWH A;  4OYJ A;  4UVB B;  2YDQ A;  2ZM0 A;  4HEA A;  2LE8 A;  2RA1 A;  4X1I E;  2SPC A;  5LA6 E;  4ZZC A;  5IYZ E;  3GA8 A;  2NW8 A;  5FNV E;  4CN1 A;  1SUM B;  4B3R T;  2X0H A;  5CJ5 A;  5KMG P;  4IL9 A;  4K0U A;  4CXX A;  3KFW X;  2K24 A;  2ES0 A;  5ABF B;  2LT3 A;  2H7V C;  3LK2 B;  4COF A;  4GK0 E;  2J4G A;  3O1J A;  1HFA A;  3KBT A;  5HWX A;  4LF5 T;  3NRY A;  3N2O A;  2C5I T;  1ZOY A;  2V6Y A;  2UUB T;  1LVK A;  2D0T A;  3UFG A;  4TNV A;  4XZC A;  1YQ4 A;  5JR9 A;  2B76 A;  2CXL A;  3PU3 A;  4YTN A;  2DLR A;  5HWY A;  3OYX A;  3ZYL A;  3KVB A;  4U7I A;  1YXR A;  2MAW A;  2ODU A;  4NXM T;  3B5M A;  2M67 A;  2XPK A;  5LGU B;  4HWI B;  2LSY A;  2J47 A;  2KSR A;  5HEO A;  4A5X A;  3AB3 B;  4ZEY A;  2LOP A;  4ZI7 E;  3VU7 H;  3CQX C;  3OKQ A;  3AXJ B;  2V6X A;  1T7S A;  3BQI A;  5FL0 A;  3TLV A;  4DV4 T;  1E2A A;  1BR1 A;  3Q9D A;  3J7Y q;  5DJQ C;  3PUA A;  3TLT A;  5L2L A;  4ILU A;  4ANJ A;  2LKG A;  1VOM A;  2EHO A;  1L0V A; 
#chains in the Genus database with same CATH homology
 1ZKE A;  2X9W A;  5EK2 A;  4EAH A;  3LBX B;  2LHN A;  4IST A;  4AKG A;  1WR6 A;  3EDU A;  4J2C A;  4U72 A;  3BK9 A;  2WMN A;  4P09 A;  3H3A A;  2BVM A;  3BQK A;  2W00 A;  5JDL A;  3C50 A;  4I43 B;  4CXY A;  3KV9 A;  3ANW A;  2NTY A;  1KNZ A;  3RX6 A;  2DI4 A;  3SWH A;  2XAS B;  5JRE A;  2MYS A;  4MHC A;  3CX6 B;  3LK4 2;  3N2K E;  1UCU A;  2C5K T;  4G2A A;  3AA6 B;  4QHO A;  1SA0 E;  4GYS A;  4HE8 A;  3HR0 A;  4TV8 E;  3RC8 A;  4H9N C;  3LBX A;  4I4T E;  3ZPO A;  4TV9 E;  1OXZ A;  2Z6E A;  5DAB A;  3N9N A;  1WRD A;  2VWA A;  3UUM A;  3ZCJ A;  2YU1 A;  2W61 A;  5CA1 E;  2E9X C;  2N9D A;  4L5G A;  5LHI B;  2L9Q A;  3BQL A;  3E08 A;  4ERR A;  5JDN A;  3QC9 A;  5JR9 B;  1FMW A;  3MXZ A;  4WBO A;  3CQC B;  3IEE A;  4O4L E;  4QXH B;  1US7 B;  5J2T E;  4XBF B;  1ZHC A;  1SHZ C;  1T98 A;  3C98 B;  4WBN E;  1AJ3 A;  3FB2 A;  2Q9Q D;  1O3X A;  2KIN B;  4CXW A;  3F2E A;  3ZMZ B;  5JRC B;  2IC9 A;  2Y6X A;  4CZZ B;  4Z8X A;  2CMR A;  4O2A E;  1HS7 A;  2L3L A;  3J9X 1;  4NUU A;  3IHR A;  2X67 A;  3GWH A;  3N9L A;  5JH7 E;  1U4Q A;  3K3O A;  3K3N A;  3UUN A;  2H3R A;  2E9X A;  3PUG A;  3ETV A;  2V26 A;  4ADZ A;  1MNE A;  1U5P A;  2D0U A;  2D5U A;  5HAX A;  3VKG A;  2X0L B;  1X79 A;  3UUL A;  5LXT E;  4PJL A;  2E8I A;  4XAX B;  3ZJ2 A;  4ZOL E;  2ACX A;  2V7L A;  3UT5 E;  2XHE B;  3V5U A;  5DQV A;  5LP6 E;  2JQQ A;  5JRC A;  2UXN B;  4MFR A;  3L09 A;  3PU8 A;  1D0Y A;  2LSJ A;  4IGU A;  3DP7 A;  2WWU A;  4WW0 A;  1S94 A;  3ZC1 A;  3NZP A;  2X66 A;  4H9Q C;  5HXH A;  2CCQ A;  2JJ9 A;  5H6R B;  2XTL A;  2A72 A;  4HN9 A;  2JRK A;  4UXN B;  5J1G A;  1KK7 A;  4O2B E;  4X1Y E;  3PE0 A;  5HXR A;  2N2N A;  3UFE A;  4YLH A;  4CI2 B;  2B1E A;  2D2S A;  2ZM2 A;  3CX8 B;  5FXZ A;  2XAH B;  1NWM X;  1HG2 A;  1MIY A;  2GK9 A;  4CQI A;  4AI6 A;  2CWO A;  3KV5 A;  3Q2M A;  4PW8 A;  4TZ4 C;  5HXS A;  3RYH E;  2Y8D A;  2NTX A;  3I0Q A;  5LNK A;  4TUY E;  3AAI A;  2KMF A;  3JC6 D;  5L3C B;  2CLY C;  4IE7 A;  5L3E B;  1IJ5 A;  5BMV E;  2KXP B;  3KV4 A;  3O1I A;  3LJC A;  4H9P C;  4JLE A;  1MMD A;  4DMW A;  3ZMU B;  2EHO D;  1WYC A;  2CM0 A;  2WM9 A;  3O1H A;  3ZYM A;  3A5X A;  3SOL A;  2XAQ B;  4PFO A;  4AQF C;  4AKR B;  2V7K A;  4JEU B;  3ETU A;  4CI3 B;  3IBP A;  1BR4 A;  2LSK A;  2IW5 B;  4NUV A;  5F8P A;  4I55 E;  2IC6 A;  1D0Z A;  3U3I A;  4DND A;  4PJJ A;  4KP3 C;  5LOV E;  4MBQ A;  2ZM8 A;  1MND A;  5LHG B;  5GON E;  4A56 A;  3ZC0 A;  3N5L A;  2JPF A;  3ANW B;  4PAG A;  3C64 A;  4JUY A;  4AKL A;  4M1P A;  2VL8 A;  1S35 A;  4O4H E;  4P0A A;  2C5J A;  3ZN0 B;  4OHF A;  2DNX A;  3S4U A;  4N78 D;  3KVA A;  4H9R C;  4EYU A;  4H63 V;  2DWK A;  2BVL A;  3GMI A;  5KDM C;  4QWN B;  2RP4 A;  5H6Q B;  5CA0 E;  2DWG A;  3K8P C;  3NRX A;  4ZI2 C;  5L3G B;  2V7J A;  3B13 A;  3L3P A;  3ZN1 B;  5JDQ A;  3DTO A;  2CWY A;  4ZHQ E;  2Y48 B;  3T8O A;  4PK5 A;  2XAJ B;  2XUE A;  1HTJ F;  1YW0 A;  4ZS3 A;  3HKD E;  3MA9 A;  3ZJ1 A;  2KND A;  3AAE B;  3GN5 B;  2PBI A;  3CPZ A;  1OWA A;  1ZV4 X;  3WAK A;  4FI5 A;  1B7T A;  2VAS A;  3P8C D;  1D1B A;  3ZEF B;  5C8Y E;  3W15 B;  4ZI3 D;  3Q5X A;  2YEV C;  4UV9 B;  5LJM A;  2LM9 A;  4DBR A;  3VKH A;  2E9X B;  3WAJ A;  2DHR A;  3C4W A;  4ASK A;  2WMO A;  5JDG A;  3RKO A;  4GIW A;  4EXT A;  4AKH A;  4DVD A;  5LCY A;  4WNK A;  2NWB A;  4UF0 B;  1Z0P A;  1MMG A;  5FY1 A;  4I50 E;  3GN5 A;  2KWI B;  1YD8 G;  4QXC B;  1V9D A;  2PJQ A;  2K5B B;  2YK0 A;  3O4X E;  2LEH A;  2P9B A;  2V7M A;  3HL6 A;  4OK0 A;  2WSS V;  3KDS E;  4IIJ E;  3RRW A;  2ODV A;  4BJN A;  5LG4 A;  2VKD A;  2W62 A;  4H63 H;  3R84 B;  3RPU A;  3UUX B;  4P0B A;  3EUH A;  3ZMS B;  1Y64 B;  2CE7 A;  2LSG A;  5L3B B;  3QUJ A;  4UF0 A;  1YKE B;  3AVS A;  3RRC A;  3SRZ A;  4JEH B;  3MAC A;  3MZK B;  3CKD A;  3SS1 A;  1FIO A;  2QGS A;  1E1H B;  2JMH A;  3AA7 B;  4O4I E;  2Q9Q C;  5FP3 A;  3FXE B;  2YU2 A;  1FEW A;  4AQG A;  2V7I A;  3MK7 C;  4IHJ E;  4E7S A;  5FXW A;  3FBL A;  3OBV E;  3KIN B;  1VRB A;  4DBQ A;  3HI2 A;  1MIW A;  3ESL A;  1MIV A;  2H7O A;  5FYM A;  5JQG E;  2HPL A;  4UVA B;  2MTQ A;  1LRZ A;  2G0U A;  3H37 A;  4H9O C;  4V1A v;  3N9M A;  5E0O A;  5DQW A;  4YJ2 E;  4EZH A;  3PUQ A;  3V5S A;  1IAP A;  3I9Y A;  4CI1 B;  3RH3 A;  3D0T A;  3EVY A;  2PFV A;  3HA4 A;  5EK3 A;  5LGN B;  2VKJ A;  4DO0 A;  2Q9Q A;  2NOX A;  3F31 A;  2W63 A;  1QSD A;  3OYZ A;  4HFV A;  4GK5 E;  4HGA A;  5L3D B;  4GYR A;  4G63 A;  1QUU A;  2IAK A;  2CLY B;  4AKI A;  2KT9 A;  5KX5 E;  5FXV A;  2C0S A;  4BA9 A;  2LHR A;  5LJN A;  5JDH A;  4KUM B;  4UIG A;  2A3D A;  4IE0 A;  4FJO A;  5IHY A;  4EZ4 A;  5L3F B;  3ZYK A;  1UX5 A;  3N9O A;  3CML A;  4KMC A;  2BDE A;  3LFM A;  3HKC E;  4IE5 A;  3AVR A;  5FXX A;  3K3Q C;  3ONX A;  1LVF A;  4BJM A;  4IDZ A;  1H7C A;  3I9W A;  3PUR A;  3JC6 C;  4ISS A;  2NW7 A;  3FXD B;  3LG7 A;  4H9S E;  4YFS A;  4QKN A;  1NAF A;  5FY0 A;  2W0G A;  2OA5 A;  2K48 A;  3AA1 B;  3VHL A;  3ZLI A;  4ZS2 A;  3PUS A;  2EHO C;  1UX4 A;  4AQF A;  5ETW A;  3HKB E;  4B6X A;  2KLQ A;  2XAG B;  4OYJ A;  4UVB B;  4TX5 A;  4ZI2 D;  3C4Z A;  2VB6 A;  2ZM0 A;  4HEA A;  3E22 E;  2LE8 A;  5HXE A;  5JDF A;  4UVC B;  2MOZ A;  2RA1 A;  4BAY B;  4OYK A;  4X1I E;  2SPC A;  4EB6 E;  5LA6 E;  5IYZ E;  4EIW A;  4O8S A;  3Q5W A;  3O9X A;  3GA8 A;  2X68 A;  3NBX X;  2NW8 A;  5A1L A;  3EDV A;  5FNV E;  5HYA A;  4YHJ A;  2KZ7 B;  2WAU A;  4QX8 B;  3ZMT B;  2K9A A;  2WBL A;  1G73 A;  3N9Q A;  2E9X D;  1CUN A;  3PTR B;  2ZMA A;  2V1D B;  3RC3 A;  5KMG P;  3R6N A;  4EOZ B;  5JDM A;  3TKL B;  4K0U A;  4CXX A;  3KFW X;  2K24 A;  2X9X A;  4OFZ A;  4PK6 A;  2ES0 A;  2HPJ A;  3AA0 B;  4O4J E;  4C90 A;  4AXP A;  3HKE E;  3MKD A;  3N9P A;  2LT3 A;  4DMV A;  3RYF E;  4TN7 B;  2H7V C;  3LK2 B;  3P7I A;  1EZ3 A;  3FBZ A;  2BZB A;  1BR2 A;  3I0O A;  4IE4 A;  2LSI A;  3RYC E;  5LBQ B;  1ZEE A;  5ADX L;  1YKH B;  4PK4 A;  2UXX B;  4C91 A;  4MLK A;  4KBM B;  4ZI3 C;  4GK0 E;  1WYB A;  3PDY A;  4L0R A;  4PNI A;  5JR9 C;  5LYJ E;  3O1J A;  1D1C A;  3M65 A;  1HFA A;  3KBT A;  1HF8 A;  5FY7 A;  4X20 E;  2NP9 A;  2QA7 A;  5HWX A;  4PJN A;  3NRY A;  5FMN A;  2N1G A;  3N2O A;  2C5I T;  4QXB B;  3U78 A;  2Q9Q B;  5CB4 E;  2KWH A;  3I1A A;  1LVK A;  2X51 A;  2D0T A;  1MMN A;  4UEM A;  1BR0 A;  5AFU L;  3KV6 A;  4XZC A;  2HH7 A;  5JR9 A;  2CXL A;  3PU3 A;  4EYY R;  4PJM A;  2I59 A;  2VKO A;  1WLX A;  4IE6 A;  2DLR A;  5EK4 A;  3OYX A;  5HWY A;  3KVB A;  3QK6 A;  4HKA A;  3ZYL A;  5LGT B;  2A2F X;  2L8K A;  3CX7 B;  2ODU A;  2J1D G;  3AAA B;  2CEA A;  3N2G E;  3C51 A;  1MMA A;  4U74 A;  3UTK A;  2M67 A;  2CXF A;  5EZY E;  5LGU B;  1HX8 A;  2XQY A;  3F57 A;  2LSY A;  5J2U E;  2PG8 A;  2YIN A;  1HG5 A;  3FHN A;  2DCF A;  3ZMV B;  1IJ6 A;  3AB3 B;  2XAF B;  4X1K E;  2LOP A;  3CQG B;  5M4Y A;  4YJ3 E;  4ZI7 E;  4PFP A;  3DJB A;  3VU7 H;  3WI3 A;  4F6R C;  5JVD E;  3CQX C;  2NW9 A;  1D1A A;  3OKQ A;  2CA5 A;  5TAO A;  5LHH B;  3CWZ B;  3ZCI A;  4UV8 B;  4HTE A;  3MJX A;  2LJL A;  2CXD A;  3BQI A;  1FMV A;  2EHO B;  2JMK A;  4QX7 B;  3IF8 B;  4GOU A;  3KBU A;  1G8X A;  1LKX A;  1IZN B;  3LK3 B;  2VKH A;  4L9I A;  1BR1 A;  2X9H A;  2ZLY A;  3Q9D A;  2LOS A;  3B57 A;  5DJQ C;  3RYI E;  3J7Y q;  3PUA A;  5LBM A;  5L2L A;  5HXC A;  4E7Z A;  2VK9 A;  1D0X A;  3NZQ A;  4ILU A;  2MBG A;  3E0Z A;  4ANJ A;  4UEL A;  3CVR A;  3OJA A;  4MAL A;  1HCI A;  1VOM A;  3C4X A;  2EHO A;  5F3J A;  2X9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...