The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
105
|
sequence length |
347
|
structure length |
347
|
Chain Sequence |
PKFDVSKSDLERLIGRSFSIEEWEDLVLYAKCELDDVWEENGKVYFKLDSKDTNRPDLWSAEGVARQIKWALGIEKGLPKYEVKKSNVTVYVDEKLKDIRPYGVYAIVEGLRLDEDSLSQMIQLQEKIALTFGRRRREVAIGIFDFDKIKPPIYYKAAEKTEKFAPLGYKEEMTLEEILEKHEKGREYGHLIKDKQFYPLLIDSEGNVLSMPPIINSEFTGRVTTDTKNVFIDVTGWKLEKVMLALNVMVTALAERGGKIRSVRVVYKDFEIETPDLTPKEFEVELDYIRKLSGLELNDGEIKELLEKMMYEVEISRGRAKLKYPAFRDDIMHARDILEDVLIAYGY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Ligase
|
molecule keywords |
Phenylalanyl-tRNA synthetase beta chain
|
publication title |
Structural and mutational studies of the amino acid-editing domain from archaeal/eukaryal phenylalanyl-tRNA synthetase
pubmed doi rcsb |
source organism |
Pyrococcus horikoshii
|
total genus |
105
|
structure length |
347
|
sequence length |
347
|
chains with identical sequence |
B, C
|
ec nomenclature |
ec
6.1.1.20: Phenylalanine--tRNA ligase. |
pdb deposition date | 2005-06-29 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF03483 | B3_4 | B3/4 domain |
A | PF03484 | B5 | tRNA synthetase B5 domain |
A | PF18262 | PhetRS_B1 | Phe-tRNA synthetase beta subunit B1 domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Phenylalanyl-tRNA Synthetase; Chain B, domain 1 | Phenylalanyl-tRNA Synthetase; Chain B, domain 1 | ||
Alpha Beta | 2-Layer Sandwich | Phenylalanyl-tRNA Synthetase; Chain B, domain 1 | Phenylalanyl-tRNA Synthetase; Chain B, domain 1 | ||
Alpha Beta | 3-Layer(bba) Sandwich | Phenylalanyl-tRNA Synthetase; Chain B, domain 3 | Phenylalanyl-trna Synthetase, Chain B, domain 3 |
#chains in the Genus database with same CATH superfamily 4P74 A; 2RHQ B; 2IY5 B; 4P73 A; 3TEH B; 4P72 A; 2CXI A; 2AKW B; 1JJC B; 4P71 A; 4P75 A; 2RHS B; 3PCO B; 1PYS B; 3HFZ B; 2ALY B; 1B70 B; 3L4G B; 1B7Y B; 1EIY B; 2AMC B; 4TVA B; #chains in the Genus database with same CATH topology 2EJT A; 4P74 A; 2HG7 A; 2RHQ B; 2IY5 B; 4P73 A; 4IOH A; 2LQ3 A; 1L9A A; 3NDB A; 4DDW A; 1KVV A; 3TEH B; 3AXT A; 1KVN A; 4P72 A; 1JID A; 4P3E B; 3USH A; 4DDV A; 4DDU A; 2CXI A; 1MFQ B; 5M73 B; 2AKW B; 3KTW A; 1JJC B; 4P71 A; 4P75 A; 3AXS A; 2RHS B; 2EJU A; 3DLU A; 3PCO B; 2DUL A; 1PYS B; 3HFZ B; 2YTZ A; 4XCO A; 2ALY B; 1B70 B; 3L4G B; 1B7Y B; 1ND9 A; 3DLV A; 3KTV B; 1EIY B; 2AMC B; 4TVA B; 2V3C A; 4DDT A; 1LNG A; #chains in the Genus database with same CATH homology 2EJT A; 4P74 A; 2RHQ B; 2IY5 B; 4P73 A; 4IOH A; 2LQ3 A; 4DDW A; 3TEH B; 3AXT A; 4P72 A; 3USH A; 4DDV A; 4DDU A; 2CXI A; 2AKW B; 1JJC B; 4P71 A; 4P75 A; 3AXS A; 2RHS B; 2EJU A; 3PCO B; 2DUL A; 1PYS B; 3HFZ B; 2YTZ A; 2ALY B; 1B70 B; 3L4G B; 1B7Y B; 1EIY B; 2AMC B; 4TVA B; 4DDT A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...