2CXXA

Crystal structure of a probable gtp-binding protein engb
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
184
structure length
184
Chain Sequence
ATIIFAGRSNVGKSTLIYRLTGKKVRRGKRPGVTRKIIEIEWKNHKIIDMPGFGFMMGLPKEVQERIKDEIVHFIEDNAKNIDVAVLVVDGKAAPEIIKRWEKRGEIPIDVEFYQFLRELDIPTIVAVNKLDKIKNVQEVINFLAEKFEVPLSEIDKVFIPISAKFGDNIERLKNRIFEVIRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable GTP-binding protein engB
publication title Crystal structure of a probable GTP-binding protein engB
rcsb
source organism Pyrococcus horikoshii
molecule tags Cell cycle
total genus 65
structure length 184
sequence length 184
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2cxxA00
3Q8XB 1FPMA 3N70A 4M1MA 2WIAA 5JEEA 2F3TA 1KIMA 2KBEA 4BRUA 4OI4A 4Z54A 4GL2A 3LBIA 5J4HA 3TSOA 1TMKA 4TYNA 3HJNA 3RABA 3GP8A 3WXMA 2P6RA 2DFTA 4O2RA 2R65A 2QBYA 4KAXA 4Q4AA 3QKSA 4A6PA 3Q85A 3UPUA 2LKDA 3NH6A 2OG2A 2ORWA 3NBFA 2NO0A 2HV8A 2QE7A 1JEDA 1E2EA 2H57A 2EVWX 4A8JA 4ITRC 4GOKA 4BEJA 4LZZA 4R71A 1XMIA 3DZDA 2OCAA 5AJXA 5FOUA 4L15A 1IBRA 4FN5A 5FL7D 4EPYA 2CNWD 3MFYA 4C0KA 2HT1A 3TGPA 1NIJA 4NYJR 3A1VA 3EXAA 3ZH9B 1P9WA 2GDJA 1KI6B 4X8LA 1G17A 1OXUA 1RE0A 3A1TA 4JT4A 5GVRA 5JJKA 3NWJA 2EFEB 2SHKA 2PLRA 2F9MA 4KSBA 4WXRA 1RW4A 4BFYA 4P3YA 4E09A 1ELOA 2WBLC 4G01B 5EUMA 2OILA 2ONJA 2AN9A 4Q9JA 1GVNB 4P4TA 5FI1B 2Z43A 4YDSA 3EIQA 1SKYE 1E1RD 2QAGB 4TL9A 2GCOA 1R0WA 4RFSA 3T1QA 4LGMA 3QKTA 2ZRGA 1G3RA 1U0LA 2WAYA 2BCGY 2W6JD 4CGZA 3H1TA 1AKYA 2CXXA 2VP0A 4G5OA 3AUYA 2GXAA 2ORIA 1N5KA 4X8OA 2GF9A 4MITA 1S3SA 1V43A 2AK2A 3BRWD 1UBCA 4PX9A 3DKVA 1E2GA 2F43A 1P9NA 3AP2A 3CRW1 3NHBA 1W5TA 2OZEA 3K09C 2C78A 3SC3A 1OFUX 4K81B 1JEEA 3CB4A 3EZ2A 1NP6A 2FWRA 1WB9A 3W3ZB 3K0AA 3OEHA 2GJAA 4V0LA 4YMSA 5TV2A 2FSFA 3EZFA 2BEKA 3CRMA 3T5DA 1KK2A 3N2IA 4OJKA 5FPSA 5D3MA 3B85A 1IOZA 2JEOA 2O52A 2QRNA 3OIUA 5EXPA 3ZQ6A 3L0OA 1KI8A 2UKDA 3ZIAA 3EX7C 1CR1A 5JRJA 4B3DA 4NMMA 2AR7A 5EP3A 4CEIB 1OH7A 5FOWA 4PAQA 1RRPA 2BMDA 1S1CA 4PANA 2QTHA 2GJ9A 2IYSA 4PO1A 2ZANA 5DHAA 2ODNA 1G7CA 1L4UA 4G1UC 3SYLA 1PLKA 1E98A 1E3MA 3NHAA 4PTLA 4IDQA 1UADA 4QKQA 1NVXQ 1P7CA 5FI0B 2WKPA 2GA8A 2ZJAA 4RKFA 2ZE5A 1NVVR 4Q1FA 1P2TA 4KVAA 2ZR7A 1G7TA 1MO4A 4LV8B 5CIQA 2BBOA 4YONB 2GNOA 3A8TA 5CDFE 2VL7A 3D8BA 3SI7A 4K46A 4JLDA 1C1YA 4NBSA 4QFMA 3KXLA 5KDLA 1W0JA 1FQJA 4IHQA 3RAPR 1E4YA 2J0QA 2DWPA 4Q48A 2ZYWX 4JJZA 1JXOA 3FE2A 2JJ1D 1AQUA 1Z83A 2XGJA 5EP4A 2R2AA 5K8LA 2IYXA 1L8QA 4LUCA 4TL8A 1AIPA 1WBBA 2XZOA 3AGPA 2O8FA 4D0LB 4Z1MD 4D0NA 3B82A 2HF8A 2ZUCA 4TL6A 4CDGA 1D5CA 4ASUA 1OPXA 3K0CA 3K9GA 1Z8FA 3SJAA 1TF2A 5JS8A 2IT1A 1EFCA 5KSYA 2ZJBA 3K70D 3DPUA 2GHIA 4PQRA 1QHGA 2CCJA 3OE7A 2GEUA 4Q7LA 4C2TA 4PAMA 1N0WA 3SJCA 3KKQA 1G9XA 4XWKA 3UG6A 3WMGA 5L3RA 2Q9BA 2D7DA 1E2NA 1W5SA 2CL6X 2ZE8A 3A4LA 3P26A 3CH5A 2RGAA 3B60A 2ZI5A 3P32A 2NQ2C 4ZI3A 3I72A 3NBZC 4JZKA 5G40A 2UZIR 3CH4B 5DN6D 1ZP6A 4PPQA 2P65A 4CRWB 2N42A 1ZVQA 1ZAKA 3KFVA 1VECA 3OAAA 4D26A 3I62A 2J0UB 3ADBA 4BPBA 4Q00A 4TYWA 1Z2AA 1VG9B 5AUQA 3R8CA 4HUTA 2O8EB 4AWXA 2AD1A 1CTQA 1UEIA 3GLFE 3NDBB 3QF4B 2QA5A 3P1JA 3NKVA 1NG9A 3SQWA 4QGFA 5FL3A 1LV7A 1XPOA 1MOZA 1FFHA 2ZM5A 2ZS7A 3NBYC 2YWHA 3TJZA 4DEXA 2DB3A 3RRNA 5CJ2A 2QTFA 1FP6A 1KHTA 1H8ED 3BBPA 2QM8A 2IYYA 3FKSA 4XH9B 4UJ5A 4XVRA 3EIEA 2C96A 4TLCA 3H84A 1N6KA 1TQ2A 1VCNA 4V0NA 1L4YA 2HLDA 2ZJZA 3KZ1E 4IOKA 1RZ3A 4A1FA 2JLSA 2AFIE 4O25A 4TMKA 4RFSB 5KDDA 3K0SA 1U9IC 1OIWA 1VKJA 5C18A 3VKGA 1YR8A 3QE0A 1E9DA 2J41A 4RCYA 4TL7A 3ZQJA 4DCTA 4DT1A 1FNMA 1MV5A 5BN5A 3PXGA 5G3YA 4OQFA 3B8HA 5JSZB 2WSSD 3LWNA 5FTNA 1OE0A 5G3ZA 1HT2E 1NG1A 1UKZA 1CS4C 4WOPA 5FPKA 5KHOC 2PMKA 2NIPA 1VDZA 4Q1AA 4RCZA 4UNRA 2JCSA 1OB5A 1OKKA 3BB3A 1MO5A 3SZRA 3UWKA 8OHMA 4KITB 2V54A 4UKDA 1BO6A 4MRRA 2ZSFA 1Z5ZA 2OXCA 3ASZA 2YWEA 4TSFA 2OBMA 3ND8A 4AD8A 2IYWA 3K0AB 5HZKA 1NIPA 3IGFA 1Z0DA 4DZZA 2CK3A 3THWA 2J1LA 2P3SA 1QG4A 2HT6A 4XIGS 1D9XA 5FFMA 3X1XA 1XEFA 4RZXA 5AWFC 5HE8A 2JATA 2ZE6A 1IY1A 4P0TA 4A0GA 1IM2A 1TUEA 1XCPA 2LCFA 2J7PD 4JL5A 4B6EA 5GJCA 1BYIA 3AVWA 1HUQA 3LW8A 3LNCA 3HR7A 2JIZA 1QHHA 3HYTA 1OXTA 3DM9B 2ZRCA 1TF5A 3EG5A 4KCGA 5EP1A 2CLSA 3FYHA 5DIFA 4IKEA 4UJ3A 3RDPA 4B76A 1Z29A 2ZJ5A 1M8PA 1N6LA 1T3SA 5AJZA 4OK3A 4QBIA 3UMRA 4HDCA 2PLFA 1E9RA 5EZ5A 4GSYA 4R98A 3EPJA 5EE0A 3AVXA 3CNOA 4AG5A 3C5HA 4AKEA 2IS1A 3I61A 4IXMA 2XXAA 2D74A 4LY6A 4B2PA 5IK2D 4L8GA 1GILA 1COWA 2X1VA 3S1AA 3C5CA 2VEDA 4DLRA 2BOVA 1Q12A 2E87A 4FWIB 3ZS9A 2OFWA 2KSQA 3A1WA 4R9UC 1WE2A 2L0XA 4C9BA 3ZDQA 1E9AA 1JQLB 1Q1ZA 1IN7A 1R4AA 5TVKA 1Q22A 2RGNC 1FL9A 1TUIA 3MJHA 4N0EA 5LB2A 3U3JA 4A2PA 2WJVA 1KO4A 2P67A 1KI3A 4CYMA 2A7QA 3PIRA 5H68A 4URWR 1HYQA 1GDDA 2GCPA 4W5WA 2IXGA 1K8RA 5DGXA 2YKGA 1WA5A 1KSFX 5FOXA 3GQBA 4F92B 4URXR 2FV8A 3J81k 1TEXA 5HTKA 4WXPA 4JJKA 4UNNA 4F91B 3MAAC 2ZRDA 1YU9A 3L0PA 4Z8XA 1JECA 4ZDKA 1B23P 2QN6A 5FBLB 4B2LA 3U7HB 5EE9A 3B78A 1J8MF 2YOHA 2B8TA 2WHXA 5AK0A 3GFOA 3PR1A 1Q1BA 3KKPA 2F1RA 2EQBA 1XB2A 4MYCA 5J5CA 2FH5B 1N0UA 4O0MA 5CDFA 3VTKA 3LA6A 1JB1A 1XXHE 2ZETA 4II7A 1G8HA 5DI9A 1ZU4A 2Q21A 2R6AA 4M1KA 3BK7A 2JJ2D 4YMVA 2DY1A 3T15A 1OHHA 3E5HA 1A4RA 4KU4A 1NNEA 1GL9B 1OH5A 3AF4A 5LPNA 2IYTA 5A4JA 3RYTC 2DFNA 1RYHA 3UXMA 2A5GA 2ZJOA 2QMEA 1IN4A 3I4LA 3THXA 1E2PA 1ZMXA 2DFKB 4IVQA 3T1VA 3TR0A 3WMEA 3SR0A 4JLAA 2JASA 4PC6A 1ZCBA 3L0IB 2RGEA 2QROA 1G3MA 3B2EA 3SHFA 3VR3A 2GESA 5KO2A 2OFOA 1EFUA 1ZM4A 2DFLA 2R44A 3GLGE 1XCMA 2FOLA 2IF2A 1FMLA 2J3EA 2O0JA 1XTRA 3HDTA 4L4UA 3CBQA 4W7SA 4I1UA 3VAAA 4WIAA 3AKCA 4CT5A 3THYA 1R5NA 4PZYA 2CVHA 2P5SA 4IOJA 1GAJA 5CLQA 1M74A 4NP6A 2MMGA 1IN6A 1LF0A 2IX3A 4KVGA 3LY5A 2V55B 4DDWA 2ATVA 1NL3A 3T35A 3U3RA 3BB4A 4KI0A 1II9A 1ZYUA 3OFND 5E3HA 4GBMA 1ODFA 1IXZA 3SQXA 3GLFA 2H7VA 2RGDA 2ZI6A 2V4ZA 4OQMA 1P9RA 2FZ4A 4MDFA 4G5RA 2YWFA 2QP3A 5AR1A 4NCIA 1N0VC 3MMPA 1ZC3A 4I1OA 1G64A 1AA9A 4LHYA 1US8A 3SFVA 3ICEA 1U2RA 3MWLA 1IHUA 2HEIA 2ZRAA 5HZHA 1TQ4A 4C0HA 1G7RA 1KK0A 2QUZA 4B3CA 1OH8A 1W0KA 4PSAA 2C98A 2GK7A 1TEVA 4NYIR 4FMCF 2IEZA 2IUUA 2O8BB 2JDID 3WRYC 4JVMA 4XTRA 4US2R 2QU8A 3U60B 1SKYB 3BIFA 5CLLA 4CF7A 4GP6A 1Q21A 4PQYA 5C1BA 2C9CA 4NYMR 5AUOB 2FSHA 1HV8A 1A82A 2PEZA 1OIXA 2W0SA 3BAFA 1G20E 1YR7A 3PVSA 1M6NA 5EXTA 1X8LA 3I32A 1UBEA 3B1ZA 3C8UA 3UKDA 1C9KA 1NJFA 1XD2B 2CHGA 1UKYA 5H70A 2FFQA 2XITA 1KAGA 3GD7A 3WNCA 2GZHA 2GEDA 4HATA 5DH9A 5FBRB 5LB4A 1QVRA 3IDQA 1AGRA 5TMPA 3D7MA 3DOFA 1FNNA 3NC0C 5FUVA 2WWGA 4HLUC 2ZJ2A 3LLUA 4GNKA 4QNRA 1HH4A 1K5DA 1Q20A 2NMVA 3A58B 5K8UA 4TMWA 3P4YA 2X77A 5BWMA 3CWQA 2ZAMA 3H0KA 2DWQA 1GUAA 1TL7C 1W4AA 3KUCA 2ZRKA 3CR8A 1TU3A 5CIWA 3SFZA 3KJEA 5GVSA 2OAQ1 3IO5A 2VYFA 1TQDA 3BH6A 3F3YA 3K8YA 1XP8A 4B44A 1LNZA 3AH8A 3AEZA 4C4PA 3VU9B 4DIEA 5J4VA 3OZXA 5AJVB 2FEOA 4DVGA 4WZBE 4MRSA 2HUPA 2VBCA 3L8YA 1T6NA 3T12A 2WPDA 2ZIAA 2ZXUA 3QXHA 1D6JA 1CXZA 3QNUA 4R2IA 4ABYA 1G19A 2QORA 3A1UA 3KTAB 1AJEA 1IN8A 4LV6A 5D3QA 4B3BA 3HYRA 3KX2A 4XJXA 1HTWA 2XOKA 3MRSA 1VPLA 2FFHA 3FOZA 1VCOA 4JYBA 1S9DA 1SVMA 4JL6A 4CEHB 2XZPA 2J0SA 2VP2A 4ESHA 3EIHA 4YLGA 3OESA 2W58A 1NMZA 4HZIA 4PPGA 3SN6A 3DL0A 4JLJA 4XWAA 3AP1A 4HAZA 3GJXC 3L43A 4QOSA 1NF3A 3AVTA 1JI0A 3C41J 3LLMA 3KKMA 2XNDA 1NVVQ 2OO7A 2ZU6A 4XD7A 4HAWA 3AVPA 4OHZA 2F1JA 4TT3A 1RIFA 1S4QA 4J0QA 5IHPA 1GNRA 5EZ6B 1NRJB 3CWZA 3QKUA 4MUAA 2O5VA 2VLIA 5BYKA 1U0JA 1G3IA 5KUTA 3K9LA 1ANKA 1RFLA 1NY6A 1XEXA 4C0QC 5AUNB 1DS6A 1JR3A 1NBMA 1CJKC 4C7OA 3NH9A 4M1OA 1XPUA 4NCHA 1AGPA 4KHZA 4YDHB 3EPKA 1EFRA 5EJEA 3PEWA 1N6OA 4LOAA 2D7CA 2WWHA 1XXHA 3QEOA 3FMIA 4JT2A 3WNBA 4LBYA 2LWIA 3QPVA 4NZYA 2WKRA 2CCGA 1N5IA 4EJSC 4PC7A 3RS3A 2Q0HA 3QQ5A 4D4LA 4LJ7A 1H8HA 3EARA 2WWYA 2EU8A 1E6CA 1J8YF 2QM7A 3GLFB 2ZU0C 5HKKA 1U98A 2GJKA 5B64A 3DEFA 1X1RA 1JPJA 4ZIRA 4G5GA 2OBLA 2J5XA 1UBGA 4GDFA 4TLAA 2ZREA 1KMHA 2R6CA 3E70C 4PHFA 2DYKA 1RRFA 2GCNA 1XJCA 3C7KA 3IEUA 2R6GA 4HAXA 5FOTA 1JAHA 2G83A 3Q7QA 3TBKA 1T3HA 4IDOA 3SYKA 3RRZA 1OV4A 2RH5A 4QL3A 5KPJA 3PUZA 2ZI9A 3WMFA 3EASA 3KKOA 4QGAA 3K9HA 3BERA 5A0FA 2R6DA 2VF8A 3PJRA 3TAHA 1G41A 4DHEA 1MT0A 4LPSA 1KKLA 2Z4RA 1W2GA 4PC3A 4RFVA 4FWTA 3WP1B 3V4RA 1NN5A 3A4MA 2ANBA 5JJIA 2CMKA 4EDHA 4BZPA 1KO8A 5FBQB 1ZW6A 4M53A 3U7GA 3EA5A 4BZXA 4DSUA 3F0TA 621PA 1E1QD 1QDEA 4PFSA 3CRQA 2Z4SA 4A2WA 3R9IA 2MSCB 1OFTA 3GJ7A 2QQ0A 1SVLA 2G0TA 4PR0A 2R8RA 2ZRFA 4MKFA 4OJQA 2V1XA 3X1YA 1XD9A 3NDPA 2GBLA 5EE1A 4CIDA 2WJGA 4Q4HA 4DB2A 1FOEB 4RKEA 1CRPA 4NPHA 2FNAA 3VR1A 1SKQA 2QENA 2VSXA 3CW2A 1ESMA 4MUBA 3SS8A 4WA7A 3BFXA 221PA 3QIAA 1OYYA 3WHLA 5L3QA 2FPMA 4A8JC 4Q1DA 1M34E 4DB4A 3DZ8A 2W6IA 4LWZA 4Q5IA 4D6PA 1LFDB 5F3WB 2C77A 4NONA 3VR6A 1X8KA 4A9AA 1NLYA 2WWIA 1XMSA 2Q9AA 5JHGB 5FH9A 2QE7D 1L7VC 5JWRA 3U44B 1ZINA 1J99A 4X8MA 1K5GA 2AK3A 1DO0A 2CNWA 4E03A 3PEVA 4TYPA 3DKPA 3LV8A 4CT4B 3IHLA 3CM0A 4U00A 2YZ2A 2QL6A 1D2NA 4P31A 5JRZA 1WMSA 3KUDA 3PFIA 3ZYCA 1OFHA 2KE5A 3RS4A 2QPTA 5ELXA 2AKAB 4LYJA 1HY3A 4W9MC 4YMTA 1P61B 2JLYA 2QSZA 4DKXA 2BMFA 1QF9A 2ODWA 1VHLA 1E1RA 2BKUA 4Q01A 4Q4JB 4HUQB 4M1WA 3T61A 4LJ5A 4ZDIA 3PUXA 2VHQA 3CR7A 3OEEA 1E2DA 2PT7A 1N6IA 2ZAOA 3QKRA 2CHVA 4KFTA 4KLZA 2QPOA 4QHTA 1DAFA 2NO9A 1F2UB 1S1MA 1QHYA 2BBTA 5JI3E 4D4MA 1GNQA 5C46F 1DELA 4G5QA 3W3AA 1D8TA 1SHKA 3X1ZA 4HSEA 2WOOA 3I8XA 4QHSA 3NEYA 2VO1A 4MRNA 1Z6AA 1E2FA 2B7BA 4LSGA 4ZCLA 1T8UA 2O8CA 2EFHB 2VHCA 1DPFA 5FTJA 1CULC 1GRNA 1UF9A 1XXHB 1BMFD 4EJSB 2F1IA 3GEEA 4TTRA 3VNVA 3KQLA 2GVZC 1MABA 3OEHD 4MYUA 4B48A 1N2CE 1P72A 4HZUA 4DSOA 4DCNA 4B74A 2DR3A 4JLNA 3UWOA 2D2EA 2GWHA 3UIEA 1PLLA 3QOFA 2HXSA 3GLHA 3JZAA 1W2HA 2BBWA 4GOJA 2WWFA 3ZIAD 1F5NA 2GJ8A 1NN1A 5GJBA 2C9YA 1OLOA 5E7IA 4A0RA 4TMZA 3TR5A 4Q18A 1LTQA 1P62B 5EXXA 1Z2CA 4ARZA 1T5LA 4QBGB 4V0OA 1EWQA 4HDOB 3ZGXA 3MWKA 1I2MA 3GLGB 1VCMA 3QF7A 5HCNA 3QI2A 4QC2A 3O47A 3ZVLA 4RD3A 2CJWB 3LBHA 2FA9A 1XD8A 4FMCB 1ESNA 3PUWA 1P75A 2PCLA 1IONA 3PUVA 5HPYB 2Q3MA 4D0GA 2OLKA 2QI9C 2I4IA 3DMDA 5IT5A 3F8TA 4DLUA 4P4SA 4H9GA 2WJIA 4RD2A 1CEEA 1EK0A 5GJVC 3ZVNA 1W46A 4E5UA 4ZDWA 2C99A 1U8ZA 1ZNYA 2HJGA 3U5ZB 1FW6A 2HCBA 2Q3HA 3TRFA 1DAMA 2ZROA 3AKEA 4BEBA 5JLJA 4IEEA 2FFBA 5KU1A 5L8VA 3ADDA 2PJZA 4KO8A 4RZUA 721PA 4IDNA 2CBZA 2IXFA 3CONA 1TTTA 2ORVA 1ETUA 1RJ9A 1DOAA 2IUTA 5DNYB 3AVUA 2FPLA 4LBVA 3R8FA 1Z08A 3K0CC 5CITA 4Z1MA 4DSTA 1XMVA 4H1VA 1BKDR 1KI1A 3VHLB 1BYUA 2ZS8A 1W36C 1KO7A 1KKMA 2DCUA 3CLVA 1E2QA 4AURA 4BASA 2H16A 3UATA 2Z6VA 4IW3B 3ASYA 3IO3A 4LYHA 4GFDA 2QBYB 4JMPA 4Q4AB 3BFVA 3QKSB 3U3MA 1EX6A 4U02A 4QRHA 4DCVA 1EWRA 3ZD6A 3LQQA 1DAGA 1Z0IA 3GEIA 2OCPA 4LJAA 4OHVA 4R7ZA 4A8JB 5EQTA 4A15A 3KXKA 4UXJA 1Z28A 3Q5EA 4N3NA 2J46A 3FPAA 4A6XA 2WJYA 2V7QA 1EFHA 5CJPA 2KJQA 1SVOA 4QJ5A 3CUEF 3DDCA 4D81A 3D6TB 2C95A 2IS2A 2VHJA 3C14C 2P6UA 5TARA 5F9FA 4LC0A 2QT0A 3OAAD 3SHWA 4A0HA 4LHZA 3M4YA 2G1JA 4Q19A 4B43A 3MWYW 4BECA 1ZIOA 1YHNA 3LBNA 4JIMA 3A1SA 3CNNA 5BQ5A 4NYMQ 4LJYA 4M0LA 2BIFA 2H92A 1ZRHA 1QHSA 4TZ6A 3BJIC 1ZNWA 1XWIA 2QRZA 3W5IA 4LJ8A 1RYFA 1SVKA 2Q9CA 1LVGA 1CF4A 2GTPA 1X8JA 2OEPA 1P2SA 2IF0A 1JAIA 2GCOB 1DADA 3QVVA 3AKDA 4A4DA 3KB2A 2GEVA 4Q7JB 1GIAA 1SVSA 3G5UA 4M2LA 3R7WA 3Q3JB 3W9YA 2CE7A 3MJRA 1IY2A 4DLSA 1AZSC 2ZQ5A 1IAQA 3EAQA 4DLYA 2HLDD 1TX4B 1A7JA 1NSFA 1H65A 3QKRB 4UXIA 4B32A 3BD9A 4BFSA 1FTSA 2PEYA 3RWMB 4BWYA 3PEYA 2F43B 1HURA 1KSHA 2VF7A 4OBEA 1VIAA 4GP7A 5SZIA 4C0AC 3FHCB 5HCIA 2NPIA 4G0NA 4P32A 4QXAA 1YVDA 1MKYA 4K8OA 3QG1A 2FFAA 4JKIA 4Q4LA 2DPXA 1FX0A 3B1VA 3LVRE 5D3MB 4I99A 4Q1EA 3E2IA 5JI2E 3DM5A 1A2BA 3TIFA 3FHTA 2ZUDA 4B6FA 1RC8A 4TSFD 1YKSA 1NMXA 4M9XA 1KMQA 4I1SA 3I8SA 1OIVA 2D06A 2ZYUX 4EAQA 4HZUB 1B0UA 4URUR 4TZ0A 3GLIA 4JLVA 1R6BX 4PO8A 1GNPA 2JGNA 3FDIA 4M1TA 3IBYA 2J7PA 1ZBDA 3WP0A 3OIWA 3KXIA 4QM6A 1E2MA 4DUGA 3QY0A 4WVFA 1OT3A 2P5TB 5TXGA 4WW0A 4Z51A 2RB4A 4TYQA 1Y63A 2IYLD 1S0UA 3K0FA 1SHZA 2QMHA 4N1AA 3Q7PA 5KPDA 5J4LA 3RS7A 4N0DA 3V4FA 2XSZD 4GZLA 1OJLA 5BN3A 4U7DA 2EWWA 4MGKR 5FUXA 4QM7A 2WJHA 3LVQE 4Q66C 5SZKB 2BBSA 2VHTA 2W00A 3VKHA 1AS3A 3M6AA 2N46A 4NE2A 4D4JA 1SXJA 4LHVA 2HDNB 3GFTA 5TY0A 2EFCB 3NC1C 4IDPA 5IK2A 4DJTA 1S8FA 4LC1A 1OXVA 1T0JB 3TW8B 1MO6A 1NVWQ 1QHXA 1QHIA 1Q1QA 1Q57A 4XSGA 1XTSA 1W1WA 121PA 2IYRA 3CO5A 3WBKA 1COWD 2PZFA 4Q1BA 3NVAA 1VMAA 2G9NA 2NTYC 3B9PA 5F9HA 1KSJA 1ZM3A 3Q5DA 2O8FB 5EP2A 3ETLA 3V9PA 3IEVA 1RJ9B 4FIDA 2WICA 4DIDA 4MYTA 3RHFA 3B1XA 3CX8A 2H18A 3GPLA 2JLXA 3P27A 2J45A 2GVDC 4F7WA 1G21E 4IRUB 1FP7A 1W36B 1JPNA 2QMUA 3K9NA 3FTQA 5L3SA 3B9QA 1FTNA 1T4GA 3TVDA 4IOLA 4I81A 3BH0A 2EWVA 1JR3E 1NBME 3BC1A 1E9SA 2V3CC 4B71A 1CR2A 1IJEA 2BJVA 3I1FA 4RVCA 1JBKA 4F4IA 1T0HB 3WHKA 3X1WA 3EWSA 5DO9A 1ZM2A 4RJLA 1LF5A 2IL1A 4H1UA 4NHOA 3TQCA 1XDBA 3QXCA 3AUXA 2WV9A 5HR5A 2VPPA 3PEUA 1C4OA 2JJ8A 2W83A 4PC2A 4DDUA 5DYGA 6Q21A 1PUIA 3U6BA 2VH5R 3CRRA 3TVTA 4TMVA 3CRVA 4ACAA 4XVQA 1CIPA 2AWOA 4M1SA 2GXSA 4NDZA 1W4CA 2EYQA 4OL0A 1KDOA 5CM9C 1ZIPA 3KJGA 1D2MA 1YRAA 2J7KA 1FUUA 5CK5A 3UK6A 5J40A 1Z6XA 1KSGA 2AXNA 4AKHA 5H8WA 1UPTA 1MO3A 1YJ5A 4E07A 5LDDC 3C16C 3D3QA 2W2TA 3HPRA 3C4JA 1HQYE 3VR2A 3LQRA 4Z8YA 4DT1B 4FCVA 3R7WB 5GADl 1R5BA 2IXEA 1E2JA 4FINA 4TMTA 2GETA 2I1QA 4V0MA 2P2LA 1LY1A 1GRRA 1WF3A 4ON9A 1DAIA 4R2HA 2ZRPA 1RVDA 3U4QA 4OHYA 2NO1A 1J2JA 3QENA 2QSYA 1EXMA 2A3RA 2VHUA 4AKIA 1OB2A 2RMKA 3CZQA 3FMFA 4GPTA 5FR1A 4PPNA 1F48A 2ZS9A 3RRYA 3THWB 1FX0B 1G6OA 1ZD8A 2G77B 2REBA 4GMXA 4JBYA 3BS4A 3VQTA 4O3MA 4V02A 2FGKA 3PG5A 1F3OA 5KSPA 2CVFA 2JA1A 1WXQA 2YJTD 3IIKA 4LI0A 3SDZA 1RPZA 2AXPA 1T3LA 4EFNA 1SVIA 2WTUA 1X6VA 3TSZA 1KK1A 3VMFA 4NYJQ 2PZEA 1EX7A 1M7GA 1HT1E 3W8RA 2V8OA 1II8A 1QHHB 4OQLA 1W0KD 4BLOA 4MGIR 1F2TA 1Q44A 4JLKA 1TNDA 4GMDA 3IPYA 1KDTA 4JLOA 4JL8A 4Y0VA 3AVOA 3JVVA 3AKYA 2ZI4A 1KO5A 2WJJA 3AF0A 4MQBA 1DG3A 2X8AA 2JLWA 3K0FB 4L16A 3TUZC 1XEWX 3QUSA 4JKYA 4LCBA 3WRXC 1U8YA 1AN0A 1E96A 5LBIA 1DO2A 2XXAB 2ZVPX 2PCJA 2W2VA 3LAWA 3QJYA 1Z47A 3S1AB 4BFXA 2B8WA 1WCV1 1PUJA 1PLJA 2GRJA 1KO1A 2B21A 3SBEA 2FJUA 2XEXA 4UNPA 3WY9A 3GJ3A 5CB6A 3ADCA 2ZYTX 1G3UA 5DHFA 1BH2A 3MG9A 4KBFA 1A2KC 2QG6A 5FOVA 3BWDD 1YQTA 2WM9B 4B33A 4HB0A 2PJRA 1SVWA 3RNLA 4BFTA 3T1TA 2VRWA 1N6HA 4ESVA 1E32A 2UZ3A 1HA3A 4EFMA 5L3SB 1GFIA 1AM4D 2VQSA 2YNMA 3QXJA 3GMTA 1I4DD 3I3SR 1V5WA 1NN3A 3B13B 5BW8A 1ZUNB 5J47A 2MSEB 2FN4A 1CR0A 5C2JB 4IJMA 4JVSB 1NLZA 4C2UA 4PHTA 5JZVA 1QHNA 2QMOA 2WPDD 3TK1A 5JWHA 4IVPA 3EWAA 2VP5A 4AG6A 1DE0A 2XOKD 3LX5A 4EIWA 1OH6A 4UXHA 4B34A 4KYUA 4HLCA 1KI6A 3FGNA 4C0LA 2C2HA 1TU4A 1ZUHA 3KB1A 4G5SA 2IUSA 1G8PA 3GLHE 2NPFA 3THXB 2NO7A 2NZ8A 3HU2A 1CU1A 2FMXA 4LJ9A 4KJZA 4V0KA 2EFDB 2W2XA 4IDHA 4BFZA 3HU1A 3ZVRA 1E2HA 1Z3IX 5CB8A 4CVNA 2V6IA 3KQHA 5FPHA 1N6NA 3IILA 5EXSA 2WMNB 1NN0A 3RS2A 5BYJA 4FMBB 5FBVB 4PO9A 1N6PA 2XNDD 1AZTA 1P5ZB 1E9EA 1PJRA 2YV5A 1Z0JA 4HDQB 4HEJA 1W48A 4TT3D 3KFXA 4D25A 1X3SA 3QXSA 2OXRA 3THYB 1UBFA 2VA8A 4BFWA 1U81A 1Z6GA 4C0BA 3ZZ0A 3IIMA 4AK9A 1E9CA 5FUYA 1KJWA 4PXAA 2GAAA 1E9FA 1U90A 4B3FX 1KGDA 1G5RA 2Z83A 5KSOA 4RD4A 1JR3D 1NBMD 2XJ4A 2WAXA 2JLZA 1LS1A 2RCNA 1DTSA 2DHRA 2HYDA 5JWOA 4OYHA 1G4AE 2ZRLA 4AYXA 4BUJA 5IDVA 2Z5FA 4JSYA 3ICQB 1E0KA 3WYFA 1IJFA 1M2OB 1O87A 1AQYA 1UKEA 4B35A 4QJ4A 2ERXA 1ZCAA 3CF2A 3TUIC 1H8HD 3ZD7A 1CRQA 1US8B 4KV9A 1ZM7A 3W6PA 5HKKD 2ZRHA 1M7HA 3U6KA 2V6JA 4CEIA 1ZD1A 3NXSA 1P2VA 4NCNA 5TB5A 5M04A 4QGGA 3I5YA 4BLTA 3G82C 3AF1A 4IVRA 3O8DA 5G41A 5DLQC 2RGCA 3RC8A 4YXWD 2EW1A 1SZPA 2FPKA 5JEDA 4Q9KA 2I3BA 4LRWA 1P3JA 3VR4A 4BGDA 1JQJC 1VYUA 1GKUB 4JVLA 1G5TA 1CJUC 3SJZA 1N5JA 1E79A 2QQEA 2BKEA 3HWSA 3BOSA 3IKJA 2ASEA 1CLUA 4DWJA 5L3VA 5DYIA 3DOEA 4PHHA 4MGYR 1AS0A 2NG1A 4AIIA 2FDCA 1G1MA 2OCBA 2BJWA 3L0SA 1GTVA 1DAHA 4W5JA 3AP3A 3E1SA 2DBYA 3QG5A 4WZAE 5EUQB 5BXQC 4MGZR 3EPHA 4DDVA 2ZRBA 3RWOA 4KLNA 2R62A 3ZZUA 2GBLC 1XX6A 4Q9HA 3CF6R 3HU3A 2VP6A 2ANCA 4AY2A 3K0EA 4BE7B 2G6BA 4BLSA 2PZGA 2G3YA 421PA 1WBDA 1G18A 4PZLA 1WQ1R 4TN1A 1Z0FA 1TPZA 2YHSA 1E69A 1KY3A 2GF0A 3U2QA 4L5BA 1VIYA 5A5GA 1UM8A 2ZJYA 4BLRA 1EGAA 3BXZA 5B58C 3PQCA 4NKRA 2CEAA 1KOFA 2REXB 2XTZA 2WIBA 3I92A 4Q7KA 2BV3A 2A5DA 3TSWA 3LXXA 3EC1A 5B30A 5LD2C 1ZU5A 2WWWA 2AD5A 4D4KA 1YZKA 2QGZA 3O8RA 2W6ID 4OI2A 4WZ6A 5FL7A 1LS6A 4BQSA 4XTCS 1DAKA 2IHYA 1S3GA 1UDWA 3L82B 2VP9A 4JVNA 3MUFA 1T5IA 4BLQA 2XB2A 1KI7A 1DARA 5EE3A 3U7EB 1Q3TA 4POAA 2J0UA 3CIOA 4TTQA 2W0MA 1A5TA 1JALA 3IIJA 3A36A 3TKLA 4BZQA 2O8EA 3CF0A 5AJWA 2N1BA 2R9VA 1I4LD 1RKBA 3AGQA 3QF4A 4HB2A 3U3KA 2F55A 3OIYA 5IRCD 2P0EA 3GLIE 4HAYA 4GOXA 1DBSA 1K6MA 3HPQA 4PZZA 3AF3A 2C04A 1OSNA 3QVUA 2QGNA 4QHYA 3DVLA 2W6JA 4B2IA 1XBTA 3VHXA 1Q3HA 4TQ9A 4DLTA 2ZRMA 4US1R 2X19A 2KBFA 2B92A 4TYYA 2ZRIA 1SULA 4OHXA 2Q3FA 3IUYA 4RD1A 1NVUQ 1FUKA 4DDTA 1XEXB 2A9KA 3OEED 4Q1CA 3NBXX 2OFXA 4LJ4A 1KAOA 2YC2C 1D9ZA 4C7OB 1SXJE 1XCGB 1UJ2A 2Q6TA 4FD2A 2IW3A 2IS6A 2CHQA 5EE5B 1WDTA 2QP9X 3T06B 3UMSA 4BRWA 5JSZA 1JJVA 2GXUA 3LRPA 2HXYA 1RRCA 3QPWA 2PT5A 1U94A 4DLWA 2I1VB 2QNRA 3PITA 2C9OA 3SNHA 3SJBA 3K09A 4XSHA 2PX0A 3BB1A 5KOYA 2J59A 1IXSB 3OHMA 4EKDA 1M1YE 4RSGA 2WVJA 1BMFA 3AQ4A 4UNSA 1CBUA 1T8TA 2O0HA 1AK2A 2F9LA 4QJ3A 4C3ZA 1VYVA 1X86B 4PC1A 4ZIRB 3T5GA 3FFBA 5CM8B 2EYUA 1KMHB 3H2YA 4TLBA 3GJ5A 3RSLA 3SE0A 3EPLA 1MRNA 5JJLA 1R0ZA 4BFVA 2CLDX 2RKOA 1BOFA 3QBTA 4HI0E 1VG0B 1UDXA 2OBNA 1TAGA 2XNSA 4TLEA 2B7CA 2CDNA 4OK6A 4JLMA 2QT1A 4RD6A 3N5CA 3RRMA 3R9XA 4JSTA 4CW7A 4DRZA 4A0FA 5CK4A 1LW7A 1X1SA 5DSZA 2C8VA 3O8BA 4AYWA 5KTYA 1HE1C 2WWXA 4DEYA 1XTKA 2G0NA 3OIVA 2ZSAA 3SU8A 3T1OA 1BIFA 1VTKA 5KNBA 4OI1A 1HEIA 1YZUA 4DSNA 3ZJYA 5TDHA 3KQKA 4US0R 4PSVA 1GOTA 3P20A 2GXQA 1EFTA 2ATXA 1QRAA 4URZR 3W6NA 3I5XA 4OI0A 2OCYC 1W0JD 1KTVA 1ONBA 2A5JA 2A78A 2A5YB 2FU5C 5AJYA 1NSTA 2JJ1A 5B57C 3LX8A 4TLDA 1W4RA 1YR9A 2ZR9A 1QG2A 3L2OB 3EC2A 2BMJA 4ZO4A 2CE2X 5C4GB 4ZKDA 1MR3F 4EPWA 4RD0A 1S96A 4IFBA 2NO6A 1G3QA 2GKSA 2WZQA 3EA0A 3WNDA 3ECCA 4RZ3A 4Q4HB 4ACBA 1KK3A 3MD0A 2FEMA 4ASUD 3UMFA 2OV2A 4DCUA 3K70C 2ZITA 4Q47A 1W36D 4Q02A 4DBLC 4B3GA 2BHRA 2OUKA 1SGWA 2FG5A 1XF9A 3QSYA 2BC9A 3OE7D 3IQWA 2LKCA 1XU4A 1E0SA 3I73A 3T34A 5L3QB 3GJ8A 1UEJA 1G291 1JNYA 4EPXA 4EPTA 3WYAA 4V0ME 4HB3A 4GRAA 2IWHA 2A5FA 2FGJA 1GL7A 1VG8A 1YZLA 3KKNA 4AYTA 5DN6A 5LD2B 2FSIA 1E94E 1J90A 2CLCX 4GT1A 2OSBA 4NYIQ 5KYKA 1GKIA 1ZNZA 2V7QD 3H86A 3NEJA 1QBKC 1CJMA 1KI9A 1OW3B 2YOGA 4ILEA 2V1UA 3EZ7A 1T91A 5DISB 1HE8B 4DLZA 4G3XA 3LO5A 2XB4A 3KJHA 4NL4H 4JS0A 4C0JA 5J4KA 2QY9A 4S35A 3ONWA 4FCWA 4LHWA 4TWZA 1U99A 3Q72A 1H8EA 2GAOA 4QBFA 3BE4A 5BN4A 1XTQA 2JLQA 1LB1B 4QGHA 2Z0MA 3TQFA 1XZPA 1Z6YA 3AVQA 2E9SA 5UKDA 3FKSD 4KSCA 3SEAA 5HE9A 4CZ2A 1FZQA 2H17A 4LBZA 3R20A 2D2FA 4LYAA 1E9BA 3U7FB 2AFHE 3ZS8A 4DLXA 4L9WA 3X2SA 1XJ0A 1G8FA 4UNQA 4JBWA 4FI3C 2WSSA 1JXMA 2HYIC 1NI3A 2ODEA 3NIBA 1U9IA 2KWIA 2KI5A 2IEYA 2OM2A 3GCGA 2KB0A 1I4TD 3KDSE 2Y8EA 3AF2A 4ZPXA 3KQUA 1OKKD 1S9HA 1XNJA 3CPHA 1KZ7B 4A2QA 4M1YA 1PVOA 2O8CB 2K5UA 3LW7A 1NY5A 2JLRA 5FTMA 1XTIA 2NGRA 3LD9A 3A37A 3C15C 2D62A 1MABB 3BFKA 1KDPA 2IYZA 5J4YA 4M22A 2CK3D 4ZKEA 4D2IA 2RHDA 4FMDF 5FPYA 3RS5A 2CCKA 3FVQA 1R2QA 2C03A 2RAPA 1TF7A 3AV0B 3GLHB 3NTUA 1D2EA 3B1YA 4Q21A 1N5LA 4LX0A 3W6OA 1YZQA 2YC4C 3FKQA 4AC9A 3MSXA 2OAP1 1N3BA 3QXXA 4AI6A 4OK5A 3FFAA 5KNDA 3PV0A 1NKSA 2OE2A 3CZPA 2TMKA 2JIZD 2F6RA 2ZUBA 4M9QA 4LHXA 3RC3A 3TLXA 4ARZB 3EZ9A 2O8BA 1I2DA 5E7JA 2FX3A 2V9PA 2J9RA 4DUGD 3VX3A 1G5PA 3UANA 4E22A 2EFGA 5F2EA 2J87A 2GZAA 3CPEA 2XSZA 1OXSC 3MLEA 3IBGA 4QNMA 2ONKA 1SXJC 5FPTA 1S2MA 4B75A 2HF9A 3GJ0A 2B6HA 3JVUA 4P4SB 3VX4A 2OT3B 4B73A 1CKEA 2GK6A 1XD2A 521PA 1P73A 2NOAA 1OF1A 2IYVA 1SXJD 3B7GA 3QEJA 1TADA 3HR8A 1E4VA 821PA 1G4UR 1DG1G 3QPUA 4GI7A 4TMXA 2FZLA 3REGA 4OQXA 3IQXA 1MH1A 3VFDA 4ZCIA 1IN5A 1R8SA 3B6EA 3SBDA 1KYIA 2BMEA 3V00A 2FSGA 1Q1EA 2ZPTX 4QG7A 1KI4A 1GM5A 2RGNA 1RRGA 1Z22A 4OQNA 2QEQA 2MSDB 3K70B 1W7AA 1KDRA 1ZD9A 3W90A 4OHWA 1XFAA 2QPAA 5DI3A 4MYHA 1WP9A 3UG7A 1Z6TA 3VNUA 1G8GA 4M9ZA 3VU9A 2F7SA 3IHWA 4HB4A 4NCJA 4URYR 1XTJA 2NZJA 3GEHA 1GKYA 1CR4A 3SYNA 4M8NE 1XMJA 2RHMA 4C30A 4M21A 5AUPB 2H8KA 1UAAA 4HAVA 1YE8A 2VSFA 2ZYVX 4D82A 1DVRA 4JBXA 2AWNA 3AVYA 3KTAA 4LDJA 1P4SA 3MCAA 2JJ2A 3DMNA 4LYFA 2BWJA 3FHOA 2R6FA 1O3YA 1ZC4A 2ZSDA 4URVR 4HYYA 3IPXA 2G1KA 1Q0UA 1OHHD 4HLDA 1Z63A 2AL7A 4ZCMA 1XZQA 5KNCA 3K53A 3LXRA 4CEHA 5CYPA 1YZGA 4EFLA 4BLPA 4V03A 4UQOA 4LPKA 4PSKA 4F4JA 1OFIA 4YQFA 3GJ6A 3CNLA 1XPRA 3BGWA 1G6HA 4XOIA 1DEKA 2X2EA 1KY2A 1II0A 1DAEA 2O0KA 3K1JA 1XJQA 1R0XA 3W5JA 1HQCA 1FMJA 4IXNA 4TTPA 1R8QA 4DC9A 1PV4A 3AB3A 2DWOA 4EQ6A 2QTVB 1KI2A 1P60A 1KNXA 4IOMA 4QBHA 2OHFA 2O8DA 4M9SA 2FE4A 2ZSEA 4JLBA 2ZVQX 4L9SA 4NU0A 3RSOA 3W8NA 3KQNA 1E2IA 4RY2A 3WYGA 4U5XA 2FF7A 3KL4A 2IWRA 1YRBA 2A2ZA 2WSMA 3RLFA 3PENA 4LK2A 1Z06A 3AM1A 4DLVA 3OFNA 4LBWA 3KJIA 4ZDJA 3ZLJA 4ZI2A 5E4FA 3THOA 5FTKA 1GZSA 1R10A 4LJ6A 4S2EA 4TQUS 4Y0AA 1L2TA 4CEJA 5JFGA 2YOFA 3SOPA 1VYTA 2REOA 5KDOA 3MGCA 4MKHA 5FOSA 1PZNA 4D80A 2MMCA 4DCSA 5E7MA 4P33A 4MKGA 3LFUA 4HLQB 1F60A 1R0YA 1R5OA 3GLIB 4LV5B 2JDIA 2ZTSA 4JLPA 3TMKA 2ZI3A 3W34A 1R7RA 4EPRA 3N2EA 4MKIA 1KZGB 1KJYA 1TQ6A 4ERNA 4F38A 3O8CA 3TH5A 5JS7A 4KYIB 2VP4A 1VHTA 4KFRA 2F1HA 5JCZA 3JZMA 4GZMA 2ZRJA 2WKQA 2RGBA 1G8YA 3CX7A 5SZHB 2D4HA 2ZR0A 3DHWC 3FMPB 1Z07A 2PH1A 1T9HA 3AVVA 2ZJ8A 2VIIA 1SXJB 1EESA 2HCJB 5FBWB 2VTKA 2YINC 2ZSBA 2WOJA 3ND9A 1E2KA 1ZJ6A 1NMYA 4YMUA 2E1RA 2BDTA 1A1VA 3CPJB 4KXFB 5CYOA 1XEWY 5JMTA 3LDAA 1GWNA 1E0JA 1U0HC 1ZNXA 3FB4A 4HLUA 2UVQA 5P21A 3TNFA 1AKEA 2ZRNA 4A82A 1G7SA 1BS1A 2BEJA 4PHGA 4FCTA 4MDEA 2A30A 2IC5A 4Q03A 1M7BA 3MWJA 4JYCA 1IXRC 1GL6A 2ODBA 2J0VA 1YZTA 2BVNA 3CX6A 1W4BA 3Q9LA 4DXAA 3ZVMA 4W5HA 1E2LA 5DI3B 1N6RA 3U3OA 2RGGA 2ZEJA 1OXXK 2PMDA 2D3WA 5F98A 3TE6A 3TUJC 5FUWA 1YZNA 4ZV4A 1G16A 2GJSA 1CJTC 2PBRA 4Q9LA 3R9WA 4KFUA 3U44A 3PCRB 2QP4A 1W44A 1P2UA 1QZXA 2CL7X 4HAUA 5H1YA 5SZJA 5JECA 3QBVA 4O2LA 4Q9IA 3REFA 4NCKA 5IF9A 2JLUA 1MRSA 4IEIA 4EPVA 2XX3A 4KBGA 2IBMA 3F5FA 3BORA 1EG7A 2GZDA 5E95A 4XD7D 3M1IA 4MRVA 1GP2A 4I4LA 1CP2A 2QAGA 1NJGA 2ZE7A 3X1DA 2JAQA 2IS4A 2QAGC 5K8TA 3NG1A 4WBSA 1UFQA 4FW9A 5G53C 3FMOB 3U61B 3EZ6A 1J70A 2F3RA 1FQKA 4Q4JA 4A92A 2IA5A 4HUQA 1KJZA 1NLFA 1GG2A 3ADKA 3HP1A 2IHBA 1U8AA 2WMOB 2XJ9A 3H4MA 2O8DB 5K8IA 3VR5A 5C4MA 1F2UA 4F93B 5JBQA 1SQ5A 3PUYA 3ZZTA 4BFUA 3RVBA 4MRPA 1E0AA 5KSZA 1EFRD 1W47A 1N25A 3TW4A 3U4QB 1Z0KA 5JCPA 2CL0X 3GFPA 2HJVA 2BCJQ 4KFSA 4YMWA 1IY0A 2RGXA 4B3XA 1VCIA 4WAUA 3OF5A 2ZI7A 2ERYA 2G88A 3FWYA 4Q7MB 2YVUA 4EJSA 2AHOA 2C5LA 4B47A 4RZ2A 1XRJA 2P6NA 1AS2A 2JLVA 1IQPA 4CEJB 1E99A 1KNQA 1Y3AA 1YR6A 3DO6A 5FTLA 1CJVC 4P4UA 3LH5A 4YC7A 3CKLA 2YWGA 3EW9A 4M4SA 1JJ7A 2IYQA 1ZUIA 2IK8A 2OESA 4MH0R 4PPFA 4EUNA 4F4CA 1II8B 1NKTA 1VG1A 1W49A 2H5EA 3A4NA 3BH7A 1P6XA 4FMDB 4TQAA 1QVAA 5GJWC 1JR6A 1F2TB 4EQ6B 2BM1A 3B5JA 5ANRB 1UKVY 3P4XA 2PX3A 4OKSA 2IYUA 3WBJA 2XTMA 1J7KA 1ZM9A 4NTZA 4IFEA 5FR2A 3RANA 2AX4A 3GLGA 2XZLA 4YXWA 3TAUA 2OLJA 2AKYA 4PAOA 2CJWA 1OYWA 2QZ4A 5B2ZA 1GSIA 2GILA 5DE3A 2H1LA 4X8HA 2X2FA 3G0HA 4C0SA 3RS0A 4XWOA 1E79D 4FXPA 4PQFA 4MA4A 2YYZA 5JHHB 3GJ4A 1E1QA 3B1WA 2ECKA 2PL3A 3D31A 2XAUA 1GITA 2QAJA 1GRQA 4NH0A 1F6BA 3L8ZA 3A6PC 4XVUA 2BM0A 2VSOA 4KODA 4AKGA 1Z0AA 4I1VA 1WRBA 2XTNA 3M0EA 4A36A 3VKWA
chains in the Genus database with same CATH superfamily
3TD6A 4GYYA 4HMQA 3C3DA 1JTEA 3FN4A 4M1MA 2GO1A 3WWYA 4Q93A 3DEAA 4C4TA 1V8OA 4TV8F 1JKFA 1KBZA 2KBEA 1NBAA 3CF4A 3D0QA 4BRUA 4ROSA 3RC9A 3PNVA 4Z54A 4Q3KA 3Q2OA 5C32A 2CWWA 1TC1A 3LBIA 3VPDA 3WVNA 1GQRA 1AC5A 3H05A 4TYNA 3L6UA 3S44A 3V1NA 1E18A 4K9NA 2H2FA 1ODTC 1XU9A 2HJRA 4L8LA 3RABA 4P5PA 3FUWA 3I39X 3IV6A 4I5EA 3DB1A 4O2RA 4AZ0A 2F4NA 2QBYA 1FSPA 2IOFA 3O4HA 4DQ0A 3UPUA 5DPMA 2OG2A 1KFKB 4KTVE 1PBNA 4OLBA 1FLVA 2P68A 4NJEA 3TX6A 2QE7A 3VR6D 1JEDA 3HB7A 4H7HA 2EVWX 4M6WB 4A8JA 2I54A 5LA6F 4QEKA 3HN7A 4UUQA 5JVDF 1QP0A 4KQEA 3M5PA 4R71A 4JJ4A 3AJ9A 2VZLA 4Q82A 4L15A 4WINA 3VRHA 2IHZA 1F6WA 2GD6A 2VSQA 4FN5A 3SQNA 4EPYA 1MB0A 1Y7TA 3SFTA 2GPWA 2LPMA 4OF4A 3EXAA 3BL8A 3ZH9B 2Q3EA 1P9WA 1SIBE 2AZTA 4X66B 1L7AA 2P5UA 1RE0A 2FPPB 4D0RA 3V8QA 1V47A 2E2WA 3NWJA 2Z8YA 4LG1A 3T94A 1JYEA 2SHKA 3BD6A 4WASA 3JWJA 3GUZA 4CLRB 3B7PA 4IXDA 5AI9A 4LXTA 2WZCA 3R76A 3T7DA 2VATA 4P3YA 4RA9B 3QELA 1KJNA 4KO2S 3SQDA 3NTLA 2OILA 4Z0HO 3P0EA 4R3UC 2XCOA 4MUIA 2IITA 1Z25A 2HC9A 1T2UA 4P4TA 5FI1B 4UU8A 4AJJA 4FBGA 1QRDA 1VE9A 1L8LA 3SP1A 1BXZA 5EWMB 2WYUA 5BMVF 4IDAA 2GCOA 2JLBA 3LGSA 2BMVA 5EZSA 2JJMA 3T1QA 4CKXA 3QKTA 3L7KA 3DLBA 1G3RA 4HRYA 2JK0A 5JANA 2W6JD 3M1LA 1AKYA 3W79A 5LYJF 3AUYA 3E1GA 1GT6A 3M81A 5ARDA 4YR7A 1T6BY 1QK5A 3H2KA 1Y80A 1U0OC 2XCTB 4PTZA 3D8NA 4M1ZA 2FEAA 3EOBI 4OEHA 4U0JA 3DT8A 4GLJA 3EFOB 3EQ9A 3DE4X 4PX9A 2QIPA 4XGKA 3DKVA 3LSYA 5HCUA 3ZEAA 5IU6A 1L7NA 1Z4KA 3NHBA 2W2KB 1RSZA 2FLVA 2BTQB 3CB4A 1BXGB 3K0AA 4Q0MA 5TV2A 3VAZA 3W2EA 1JHVA 1YUBA 2FSFA 2IPMA 2ON6A 2W8ZA 3EZFA 1D03A 3GW8A 2KQUA 3MPUA 4WKNA 5FNVB 3WLKX 1TIPA 1N34B 1BDIA 4YRZA 3D8UA 3IQZA 2PJDA 3OIUA 4FX2A 1XKLA 4YV2A 1QRSA 1G63A 3L0OA 1FFYA 2ORYA 3PFBA 2AJLI 1L5FA 2Q5JA 1N5OX 4J76A 2ALJA 2JCXA 3ZX5A 2O20A 2AOTB 4K9KA 3ZWKA 4G89A 3LSTA 3WWPA 3HXQA 3AF5A 3TLBA 3UM9A 1J21A 1XZJA 1ISRA 2IYSA 2H2IA 3M4NA 4ZVQA 2ZANA 3JQ9C 1EM6A 1PQYA 5EJGA 5J1TB 4DV1B 3GV0A 1THTA 1L4UA 4D0SA 3NFYA 3UJCA 1PLKA 1E98A 1IHDA 1S5PA 3N07A 3IOMA 4D97A 5HF6A 2QX8A 4IDQA 1EWVA 3FYDA 4HVTA 3ESAA 4RJ2A 3W5VA 2NYVA 1Z6ZA 3E9RA 3HY3A 3BIOA 1XQ1A 4MPPA 2WT9A 5EZYF 2FHPA 1HOXA 3COVA 5THQA 3ONEA 1P2TA 3OO0A 3L4SO 4X95A 1B8UA 2NNWB 3OUUA 2AJ8A 3AOEC 4RXMA 1PT7A 4YN3A 1VI6A 2M6KA 4M38A 5BWLA 1OAOC 3A8TA 3ZWVA 5CDFE 1G5FA 2QDKA 3OUZA 1PR9A 1OLSA 2FEXA 1QO7A 4JLDA 1P2BA 3EXHB 1EZ4A 1GPJA 1W0JA 2PN1A 3IHTA 1L6IA 1DIGA 3RAPR 5AW4A 1B8VA 1E4YA 1XDGA 3CE9A 2IQIA 2ZYWX 4Q48A 2J0QA 4JJZA 2PSSA 3S1LA 4Z0NA 2RHCA 2V5AA 2WUGA 1Z83A 3F5MA 5EP4A 2XGJA 5JPDA 3PQEA 1USWA 3W0LB 1WBBA 3JTMA 1TCUA 3AGPA 2XZOA 1WHTA 4D0LB 2AJBA 3DT9A 4D0NA 5AVUA 2VK1A 3B82A 4BJHB 5F7ZA 5IJAA 2HF8A 4FJ2A 4LF4B 3BJRA 2FX2A 4K9MA 2QJOA 5K51A 4CDGA 5IVPA 4F8JA 3K9GA 3HP4A 2IT1A 1EFCA 1KJIA 1NONA 2RARA 2C2ZA 3GN1A 2VTEA 2AIRA 3DPUA 4NESA 4YIKA 3OQVA 2FP4B 4WJLA 4H18A 2PM8A 2FUCA 2OHXA 2CCJA 2IGTA 4F45A 1HYBA 3OLVA 4RGVA 1UINA 2XT6A 4C2TA 3C3YA 3N2YA 2WJPA 1N0WA 1MJFA 4QOGA 3VOSA 3JD4A 1GN9A 2HB6A 2QLMA 3TE7A 4XWKA 2DTDA 2Q9BA 3LRXA 3IQDB 3ME5A 1E2NA 5DKFA 3U9TA 3HHPA 4R0VA 5CA0F 5MN4A 2P2CA 3P32A 4CM9D 1PEKE 4RKRA 1WUHS 2PX6A 3KD3A 3I72A 4DCMA 4OQZA 4BQFA 1FDSA 5G40A 1JHPA 1OI4A 1PR4A 1Q1GA 2N42A 3KFVA 2OZVA 3OAAA 1V1MB 1ZRMA 1YS7A 2C5BA 2PUWA 1RBMA 2E37A 3I28A 2VBGA 4WN3A 5TQVA 3YASA 3ADBA 1LX6A 1VG9B 1SZDA 1UPCA 4FYWA 3KQVA 4JDUA 4J9VA 3R8CA 3ADPA 1VL2A 1ZA1A 3RK1A 4N76A 2AD1A 1CTQA 3HV2A 4TV9A 3SZLA 1P3DA 2QA5A 3CU5A 3I76A 3P1JA 3NKVA 3R3XA 4QFBA 1H0RA 4QGFA 5KAMA 1XPOA 1ECBA 1MOZA 1M66A 3NHSA 2ZS7A 4NBTA 5FB3A 2IUEA 2OV1A 2WU1A 4E13A 1M1NA 1K92A 2B1QA 3TTWA 3N0TA 4G07A 1FX1A 4EEZA 4XH9B 1IOVA 1LRKA 3EIEA 5AVSA 2GPSA 5HJ5A 3DE2X 3JR7A 5HGJA 2K2WA 2QLNA 3L7AA 1UBSB 2RHJA 2E5WA 4OY3A 1L4YA 2ZJZA 3AM5A 3KZ1E 4Z9AA 3DAOA 1MNAA 1VL8A 1F12A 2JLSA 3B51X 4ZO9A 4EJ0A 3E15A 3BGVA 2X2OA 7AT1A 1Y4SA 1ORWA 1T2AA 5C18A 3WLPA 3NCTA 2I03A 2Z9CA 4KN8A 4R9NA 4FGJA 5G3YA 1H2WA 1JUDA 2AZMA 4JJ8A 1U8UA 2B69A 4LX8A 1OXBB 2GN8A 1NG1A 2PA0A 1CS4C 6PFKA 2HK7A 2PMKA 4U7PB 3BRQA 3NTXA 2JCSA 3CZCA 2ZAGA 5L7TA 3RAJA 2PUHA 3A06A 5CBKA 1PGOA 4FDAA 2P62A 4MRRA 3QTLA 1P0IA 3ASZA 2YWEA 3ND8A 1GFZA 1J2RA 3BM5A 3HVUA 3K0AB 4DMHA 2WUVA 4ENPA 1NIPA 3IGFA 1P18A 3RU7A 1T4BA 1RWNA 2AVNA 4TX1A 2J1LA 2P3SA 3DP7A 4EY5A 4P34A 1O94C 1TA9A 3S40A 1LC0A 2E49A 4RZXA 4PF1A 5AWFC 4CU5A 4EABA 1IY1A 1GADO 3M1AA 4RMHA 2YMQA 2X0EA 2YV4A 3U3DA 4A0GA 8MHTA 2GZSA 2QE6A 3FNBA 1GTRA 2HK9A 2YJ5A 4IZOA 1PT5A 1L6RA 2NSYA 4JL5A 4AWAA 3AVWA 3OTIA 2NV6A 1HUQA 3ZJUA 3LW8A 1RJGA 1U7OA 2X5KO 2OP0A 5LN1A 4JNCA 3HYTA 4HAOA 3FNRA 2V96A 3TL3A 5KNDD 2ZRCA 4MMYB 1TF5A 3EG5A 1NZDA 4KCGA 1YGPA 1MPXA 3BTSA 3QNWA 1RADA 4JBNA 3O74A 1DHTA 1Z29A 4B76A 1Y6FA 2OK8A 4RESA 1M8PA 2LCIA 3N5KA 4IR7A 2XB6A 3PWTA 5EZ5A 4NPAA 4ALJA 5EE0A 2VJQA 3LJKA 3C5HA 3FFTA 4AKEA 2IS1A 2C00A 1AZLA 2OSVA 3T9CA 4MS4A 3U62A 1JFSA 2XXAA 2VS1A 2D74A 4LY6A 1KZYC 3ZBPA 5ISMA 2RD2A 2JHCA 3BE5A 5H3HA 4REQA 3WLFA 5CBPA 2Q0QA 2VEDA 1YFKA 1B00A 1K7EB 2W6OA 2M6RA 4BNTA 1RHJA 4RMGA 3H11A 5AOCA 2BGKA 4UCFA 3ZS9A 3O2SB 3C6ZA 1P7WA 4PSCA 1U2GA 1WZIA 3ZDQA 2DE0X 1OZAA 3M34A 1C1DB 1Z5OA 3OWXA 3NTQA 4JDPA 5IH3A 3WK7A 5EJAA 1HDEA 2RGNC 1XZEA 2RK3A 1XYVA 4NMXB 5AKEA 3W1VA 3DUFB 1N2CA 3ANYB 3HYCA 5DSXA 2XV1A 4AS2A 4JOQA 1JHYA 2DLDA 4R8MA 5LB2A 2EOAA 5FUQA 2QV7A 2AUMA 3G2QA 5CNIA 3ROEA 4CWAA 2ZBFA 2P67A 4Y2HA 4RW0A 2GCPA 1YCGA 1CSEE 1FRVA 1K8RA 1QORA 1R9JA 2IXGA 2QRKA 2UUOA 4WN9A 4EW6A 1KSFX 3CLUC 1C30A 1GAQA 3HS3A 1V16A 4TV8B 1H4QA 4BMVA 5HTKA 1P91A 4WXPA 4JJKA 2WK1A 3FY4A 3MHPA 4I4TA 3L0PA 4RL4A 2YMMA 1B23P 2V74B 1M8JA 2L18A 2GN0A 3U7HB 4ZA2A 2B4QA 2VT2A 2VYNA 4ZXPA 3A27A 1X7ZB 1EBFA 3CLUD 2P9BA 2DHQA 1YI8A 2B8TA 4MI9A 5AK0A 1GTZA 1KH2A 3GFOA 3F1KA 2P6PA 2H1RA 2EQBA 5CDFA 5CFRA 4UUOA 3H7IA 1IK6A 4YJFB 3LA6A 1JB1A 3KAKA 3WIDA 1TT7A 1ZU4A 2R6AA 1W34A 5JVDB 5LA6B 3T15A 2C2MA 2ZATA 4F2WA 1YDWA 5TS3A 3E5HA 2FZGA 1ZKMA 4KU4A 4TN5A 3AM4A 1WETA 2QMYA 5LPNA 2IYTA 3NHZA 1FDVA 3S8YA 2R6ZA 2QUJA 2GZ2A 2ZJOA 1ULAA 5HVNA 4MWZA 3GOHA 1FXWF 2HV9A 3KT8A 1E7RA 4IVQA 1JDZA 4OJKA 4TZKA 5ESRA 3A7EA 1ZCBA 2X76A 3K73O 4CIBA 3QH4A 4MR8A 3MHTA 4LRQA 2AMYA 2C83A 4YALA 3SHFA 5HUHA 2GESA 5ERGB 4DV2B 5DEIA 3CA8A 1DFHA 4FR2A 3G49A 4E3WA 3C3KA 2O3RA 2WE7A 1CDEA 1PWYE 2H3EA 3OT1A 4MWDA 4JXXA 3CBQA 3T6KA 3VAAA 1Y81A 2QSUA 3NHKA 3I1IA 1ZFNA 2J9XB 2W2LD 2CVHA 2P5SA 4W5TA 5KZMB 1SIUA 3WR5A 4EEXA 3KKZA 4C7XA 5I45A 5BMVB 1RYEA 1LF0A 1NNLA 2JIRA 2HX1A 3LY5A 4PZDA 4NJMB 3BRSA 4DDWA 1Y1QA 2YHIA 4DIBA 5KHAA 3BB4A 1AG9A 3QEMA 4F72A 1LKZA 1K4MA 1A7KA 1JZTA 1PJ8A 2XA2A 2Y1FA 4PG5A 1WJGA 2PWPA 5LYJB 3FKJA 2D7JA 3OFND 1PR3A 5BPHA 2HIGA 3P45A 5E3HA 3WAGA 1BVUA 1ODFA 2HR1A 2JNWA 1M10A 3SQXA 2H7VA 3I4CA 4UTVA 1P81A 3EPRA 2ZI6A 1OLUB 2P11A 2Q6KA 4RZHA 1NJ8A 4OQMA 3ZHTA 3FAZA 1P9RA 4GAEA 3HKBA 2CNOA 2FZ4A 2R00A 4ZT5A 5H5JA 4AJ9A 3ORSA 1KFBB 2PSJA 2WLTA 4HTFB 3EXEA 4I1OA 1TQHA 1WF6A 2OYSA 4G5HA 4I9UA 2WB2A 1NW7A 1US8A 4YV1A 4PFJA 1EUCB 4H1TA 4M0UA 1C9MA 1VKNA 3WC4A 1TQ4A 4HDMB 3D5EA 2C98A 3L93A 4JGGA 4B6SA 1GTG1 1TEVA 4P3OA 3O0DA 4FMCF 4NYIR 2IV7A 4H7PA 3Q7RA 1IAVA 1NI5A 2JCBA 2JDID 2IUUA 5JFTA 1G6KA 5D7BA 5EKDA 4US2R 3BIFA 2WUWE 1WKVA 4CF7A 3E48A 4ZO8A 3WGTA 1DBWA 3I45A 4GP6A 3L46A 3WADA 5C1BA 5AUOB 1Y8ZA 1HV8A 5EEHA 1Y7PA 1O03A 2WJWA 2HU5A 1SOUA 3Q0TA 2QNIA 3ZKAA 3F3SA 1INLA 3OTHA 4RVDA 3TXYA 4BNNA 2QN2A 5IDWA 2JGFA 3TECE 1X8LA 3OZUA 2PL9A 4TWBA 3TL2A 2ZTUA 4WFQA 3SSAA 1C9KA 2PUGA 4RF2A 4LE0A 4L95C 1U2PA 1V8BA 1XD2B 3I53A 2QJFA 5JALA 1LLUA 2A92A 2AZ4A 1KAGA 4W1RA 3WNCA 3NAGA 1PL8A 2GEDA 3HH8A 1DIHA 3DAPA 4MS4B 3ZDFA 5LB4A 4K9DA 3CJQA 5EZYB 4O08A 3CNHA 1JDNA 3CZRA 1FUEA 9LDTA 5TMPA 1GZ7A 1W96A 3LHKA 4HLUC 4YMGA 4ZI7A 2ZJ2A 3H11B 1Q20A 4MUMA 2O07A 3A58B 3A9WA 2J32A 3OLYA 1BG6A 1HFEL 3UJ7A 5FWNA 3UAVA 4Z4EA 1M2KA 4NX2A 1HPLA 4CM1A 3GNQA 3AEUA 2DWQA 1W88A 1GUAA 4R1TA 4TRMA 4MQ5A 1KYXA 3KWFA 1TU3A 5CIWA 3KJEA 3QPDA 4S1OA 2BT4A 1DT5A 1GCGA 4PWZA 5JYEA 5LJIA 1YXMA 3R6DA 2E18A 3AEZA 3AINA 3UAZA 1W5BA 2R1VA 4YCNA 5ILOA 1D6MA 3WL6A 3ANTA 2PZJA 4B31A 4TYYA 4ZEVA 5IEBA 1GARA 3MVEA 3PD7A 5INTA 1D6JA 2IPLA 2WABA 4ABYA 3K4PA 3KALA 1G19A 3E2PA 3E9YA 4HGQA 3PFNA 2UXBB 1C8LA 5KWVA 2G4VA 1GG8A 1FVHA 3KX2A 5T8KC 4WPGA 3EXIA 3K71B 3MRSA 1JDBB 2NU6A 4D4HA 4TRRA 2FFHA 1P8AA 4V3BA 3FOZA 3L0CA 2V8BA 5CHEA 4EY7A 1SVMA 3V7FA 5CA0B 4M8KA 2O1XA 4ESHA 2GLXA 3H0CA 3M6UA 4I3GA 4YLGA 3OESA 4YWHA 2W58A 5E9WA 1TM4E 3AFHA 3ZCUA 4EG0A 2ZBPA 3UFXB 1ATZA 4HAZA 4QOSA 3L43A 4X61A 5IXSA 4HZGA 1JI0A 1VE5A 3C41J 2CL5A 3KKMA 4O2AF 3ZW8A 4G65A 4A2CA 2OO7A 3QA9A 3V2GA 4AJLA 4W8OA 4Q15A 3CJTA 4HAWA 4RK6A 2Q5OA 3U0BA 5LQJA 2Z8ZA 1N0HA 1D0SA 1S4QA 1VJDA 1I30A 2F1JA 3C3WA 3HSYA 4GYKA 4TT3A 3RUDA 2GAIA 6CHYA 5IHPA 1IN1A 3CWZA 3JVDA 5DTQA 4DIOA 3D2CA 4UM9B 6REQA 1Y6GA 2X4IA 2CKDA 3NANA 3OSUA 2HN9A 2VLIA 2J3KA 3WDMA 4G4GA 5AVRA 4RXTA 4FHEA 2E4ZA 5JQWA 2I9KA 1XEXA 1BJKA 1G2IA 3AWDA 4C0QC 4F8YA 6AT1A 1FBTA 2RH4A 5FHRA 5F1YA 2Z56A 1XPUA 2OHHA 1TVMA 4NCHA 1AGPA 2AG8A 4ZQCB 2XIJA 1DHRA 4BQRA 1N6OA 2KS6A 4LOAA 3CW9A 4OKIA 1UANA 3FMIA 4JT2A 4LBYA 2LWIA 2H7XA 3QPVA 1N5IA 4EJSC 3V8RA 4GM1A 5CNMA 1NMEA 2O2SA 3PNLA 4C5AA 4HH4A 3IVCA 3WX0A 2CXSA 1FDUA 2EU8A 5J5AA 3ZZMA 2ZU0C 1J5EB 3JRXA 4ZHSA 2IIQA 4FE7A 1DRVA 1R64A 3TCXB 3BJZA 3CEHA 1FU8A 4KIGA 2VUSA 1UBGA 2ZREA 2PH3A 2R8PA 2R6CA 1IRIA 4L4XA 4LSWA 4PHFA 4RV5A 1YI1A 1ZX1A 4Q24A 1CQJB 1HYHA 3U7RA 3VKVA 8ABPA 3SCZA 4DDKA 3INGA 3QLVA 5FOTA 1JAHA 2JLCA 2G83A 5TPWA 3VBCA 1ECLA 2QUAA 1RI3A 3EGXA 3KZVA 1Y8AA 4OOFA 4R3NA 4E46A 4D96A 1RI2A 2ZULA 4HPWA 4IDOA 3L4EA 2D0PB 2PXHA 1W5AA 2EL7A 3N28A 4HX9A 3K94A 1BX3A 2H9YA 4J0FA 4MUNA 5TC4A 3RRZA 2RH5A 4KXYA 4EW2A 3OZTA 4J94A 3TI9A 2PL1A 1FPQA 3LZ6A 2QI9F 5E8JA 1U0TA 1EIZA 1MB4A 3VR6H 4AT1A 3PX3A 5KOHA 4QGAA 1A96A 3K9HA 2UZAA 4WDQA 3SF8B 1CUDA 2ZJFA 4Y6RA 5AM5A 2VF8A 2RB5A 1LRJA 1HLDA 1NU6A 3NBKA 1OWNA 1W93A 2FSSA 1KXJA 4LPSA 1KKLA 1YJBA 3EHDA 3EIOA 5IYZA 1TIKA 1ZOSA 4D46A 2PR2A 2UYCA 3V4RA 1LCIA 4V38A 1ADGA 3UK2A 2CMKA 1DKRA 3HY6A 4OIMA 1OI7A 4TMFA 1KO8A 3LYHA 4WRRA 1UMKA 1WXXA 1ZW6A 2FRDA 2QTAA 4XIJA 4NEHB 1Z5NA 3Q6NA 5HFAA 1K7CA 4FFPA 2IZZA 1E1QD 4MUYA 4PFSA 1EVEA 1S8NA 3ECAA 4Z49A 1OFTA 4JZYA 2RHRA 2QQ0A 3RUHA 1SVLA 2ZB2A 4X1OA 2CMFA 1C2TA 1CNEA 1WW3A 4PR0A 3WKBA 1B6GA 2ZRFA 2BFCA 5EAIA 4QOIA 1XD9A 4O8CA 4PCLA 3HCAA 3QW4B 4FR0A 4DB2A 1TTHA 5MF6A 1J6UA 3P5SA 4V2UA 3F3KA 4GW3A 3ETNA 1RHQA 1GLNA 4GBJA 1WG8A 3EC7A 1ZH0A 2UYOA 3Q12A 2C4WA 2ES4A 3GVXA 1M6WA 3LCRA 2Z2JA 1PNVA 2J6BA 2JB9A 1DJQA 1E7WA 2H6EA 1R8XA 2YHAA 1JS1X 2HU7A 4A8JC 5JAOA 3GO4A 4NAVA 4XARA 2W6IA 3E9DA 3KSMA 4PYQA 3ZXUB 2XQJA 2HEGA 4Q5IA 1LFDB 2IP1A 3WYDA 2NVWA 2YQ4A 4NONA 5KJCA 1AXRA 4ZAGA 2CFRA 3LHSA 1JZQA 1A9SA 5B3KA 1JJFA 2VQ6A 2GDZA 1QIEA 3OPMA 5FH9A 2QE7D 5KC8A 5BUQA 3U44B 1Y98A 1TM1E 3LC2O 3IAM6 4N03A 4E3ZA 6LDHA 1PFWA 3F46A 4YUVA 3ACDA 4Q6BA 2XKJE 2AK3A 1YOBA 5BMOA 3D6AA 1K8XB 1ZAYA 4TYPA 2UUPA 4GOOD 3TLEA 3EXIB 3PLAE 1YIOA 3EISA 4EX6A 3O4IA 2GD0A 1GUZA 3DMGA 2QL6A 4JVOA 5T7BA 3OMXA 3R6TA 3IPAA 1H05A 3VC3A 4PR3A 1E7YA 1HF3A 3KSUA 1H85A 3ZYCA 2WU8A 4W82A 1SD5A 3LC0A 1YRHA 3GT4A 3K20A 4WK4B 4BQOA 4LYJA 1OFGA 1HY3A 5KKAA 4W9MC 1E64A 2H0AA 4CG0A 1RRMA 1U4OA 2QSZA 3C1OA 5A7FA 3EQ6A 1QF9A 5BV0A 3BMQA 2B3TA 3AW8A 1VHLA 1C3OA 4HUQB 4M1WA 1B0AA 3RSCA 4ZDIA 1Y9AA 2JGMA 2VHQA 3OEEA 3PUXA 4ZJUA 4YMLA 2CHVA 4PQEA 4KLZA 3L8HA 1RZVA 4JASB 4HDSB 4QHTA 1DAFA 3FBTA 1F2UB 1S1MA 1E89A 1QHYA 1CERA 3EGIA 2X41A 5I7HA 1DDIA 2XYRA 3N2KA 4RTJA 5C46F 2WMYA 3WA6A 1THGA 3ZY3A 3GUHA 1Z82A 4ZEWA 3BRWA 3BPSA 3LS2A 4OAOA 4C87A 4I50A 2IBSA 1JG1A 4U2DA 3FOBA 2POCA 3GDHA 1QOPB 1IUNA 1Z6AA 4XUEA 2ZBEA 3MERA 1WLSA 4MVYA 2X9QA 3R5KA 1O6BA 1DCMA 1X15A 2EFHB 2VHCA 1GRNA 4BCCA 4TTRA 1U9YA 1H1LB 3IP1A 3TAXA 2K4MA 4EGSA 4NENB 2RG7A 2CD7A 3GP3A 4GYJA 1T9DA 4L8FA 2DR3A 4JLNA 3OQJA 3F9RA 2DJIA 2R97A 3T9AA 5A4MS 2HXSA 1N5MA 1W2HA 1FP2A 4N47A 3BHMA 4ZZ0A 4JKOA 3I62A 4MQ4A 4XYEA 4Y9UA 2LDXA 1W4ZA 2AMVA 5GJBA 3GT0A 4A03A 3FTPA 4D98A 1MH9A 1KH3A 1T29A 4HGYA 4P82A 2XUDA 1LTQA 1MV8A 1M83A 3H6KA 5EXXA 1Z2CA 5BV7A 3Q9NA 4V0OA 5F33A 3KOXA 2A0FA 3ABOB 3QF7A 2JAHA 4QC2A 3O47A 4BTVA 1NZFA 2N75A 3PQ2A 1JSRA 3J7AC 4FDLA 3BSSA 4FMCB 4AP5A 1ESNA 3PUWA 1FY2A 1P75A 3CG0A 3IPRA 1ECGA 1IONA 3BGOS 1C29B 2ICAA 3A9TA 1JA9A 2A0UA 5IT5A 3F8TA 4DMCA 1X7XA 4P4SA 2VPYA 2WJIA 4HTAA 4EUKA 1CEEA 1FNSA 3FROA 5JTTA 2NNLD 4L0QA 3ZVNA 1EQ2A 1PHRA 2J9GA 2O1SA 3BXEA 5DB4A 1XQVA 1ZVKA 3SIWA 4R84A 2HJGA 1BW9A 2ZJ4A 5IJZA 4BEBA 1S6YA 2Q3HA 5K6AA 2ZROA 1FW6A 4IEEA 3ADDA 3ZIDA 1ND5A 3CRZA 3OKPA 1Z4NA 2CBZA 3KTOA 4U8GA 2ORVA 2PNFA 3H99A 3JW8A 3UB4A 5C8ZA 3L7LA 1SPXA 1AQJA 2QTMA 3NNDA 2IUTA 3AVUA 3OJFA 4QX6A 3OICA 2QYTA 3O8OA 4NJOA 1XRMA 4B7ZA 2BEUB 5CITA 3PC7A 1KI1A 4OHKA 3VVMA 5ES4B 1X1BA 1W36C 4I1PA 1KKMA 1K06A 4PZAA 4EW3A 4AUKA 3CLVA 1E2QA 1GQYA 3BL6A 3QMPA 1XZKA 1C1XB 2L2QA 3ASYA 1FSSA 4JOSA 4H60A 4LK3A 4JMPA 4Q4AB 5I7FA 3FWPA 3PHGA 5CT8A 5CH5A 3PUHA 3QBJA 1EWRA 2ID7A 4F3CA 5BWNA 3U7JA 4KGDA 3ZD6A 1CDDA 3NP7A 2OCPA 4Q3EA 4F85A 3B7WA 2QOEA 5DNCA 1Z28A 4N3NA 2IV3A 1GPWB 3NM5A 1H0SA 1QLWA 4BQIA 2KJQA 1GPUA 1SVOA 1JJAA 4BJ5A 4E1VA 1FXUA 3A4VA 4C4OA 2RHWA 3GMIA 4RTRA 3FAKA 3MGBA 3P9QA 4HKTA 4XRGA 2NT4A 5CAEA 2P6UA 4KUHA 5F9FA 5K0BA 1AU9A 3OAAD 2XR1A 2UXDB 4MQLA 3N53A 1T0PA 3HO1A 2IOYA 3E8XA 3GEPA 3VNBA 1UC8A 1YB7A 1ZIOA 4E5PA 1CS0B 1YRYE 1MQ9A 2BLLA 3A1SA 3ITDA 3QPBA 1NA5A 1B43A 4FYMA 4M0LA 1PFVA 4NIMA 2DTEA 5DK6A 3UMYA 2IHVA 1I14A 4IO1A 3BJIC 4D8YA 3ZK7A 1JNXX 5CCEA 3DPIA 2QRZA 4A0SA 3W5IA 4INJA 4LJ8A 2F8LA 3T0IA 3WQHA 1LVGA 4QJBA 2AN1A 2OEPA 4FSHA 4UBOA 1Z45A 3TOSA 1IUPA 1DUSA 1JVNA 3BIXA 4Q3NA 5AI0A 4ID9A 1T1RA 5BOSA 2QTVA 3G5UA 4M2LA 1JR2A 1KYYA 4IV8A 2VCYA 2CE7A 2X1MA 3MJRA 4O2AB 2PGXA 3L01A 4ZVOA 2VYVA 4EKNB 1QS0B 1QH8B 5IH7A 1L4NA 2I2FA 5CIYA 3NWOA 4R1OA 1PK9A 3BD9A 2PD3A 2C5EA 1SK8A 3NT2A 4EGJA 9LDBA 1SQ0A 1T9CA 3MTBA 4R2MA 2WJ4A 3UENA 4OBEA 3SZMA 2R48A 3RSZA 5HEKA 1U0RA 3IBCA 1LBQA 3H2JA 3N2KB 4K6FA 5HCIA 3WGHA 4C0AC 3TBFA 3L7BA 1E6EA 2WE8A 1THZA 1UJCA 5C31A 4ZHQA 4D82A 1YVDA 3C74A 1SG9A 1CF9A 3QG1A 4A5SA 4AAYA 4LZPA 3HM9A 4L07A 4RVSA 2DPXA 4ZK6A 3SHQA 4Q1EA 3DTYA 4UPDA 2HREA 4GBED 4D4GA 5JI2E 3TIFA 5FXMA 1Y1PA 5HMMA 2G9RA 3TBHA 1MENA 1TKCA 2TMYA 3PB3A 1U0FA 1EX1A 5IAGA 2DQSA 1YZYA 5BSTA 3H9CA 4RLHA 2NYAA 3GLVA 3PNKA 1N2ZA 4TTAA 2ZYUX 4GMFA 1EH5A 2JBAA 5JQGF 3ZR4B 1PJ4A 4YJHB 5E6SB 4WVLA 3VVBA 1E1NA 2D59A 1BQ3A 3QZUA 1V96A 4JLVA 3GLIA 4HVCA 4F9EA 2LXNA 1KC3A 1PFUA 2J4FA 3EGEA 3G2OA 4H0FA 4OREX 4ZYLA 3D5QA 1IDN1 3IBYA 1P1FA 1ZBDA 5EPOA 1A76A 1F1BA 3A1DA 5SYAA 3DBVO 2YDXA 3RD5A 4QM6A 4BFLA 3KLPX 1V39A 1OT3A 1SCJA 3PQFA 5TXGA 4ARUA 2P8SA 3D8RA 4WXYB 2GEKA 3ZQKA 2V7XA 2J33A 3PUIA 5M3BA 5KPDA 3Q7PA 4FGSA 5ALSA 3RS7A 4N0DA 1ENZA 1XRQA 4R1NA 3NYIA 3NB0A 4G24A 2XSZD 1D4OA 1OJLA 3GFGA 3V4OA 2HKIA 4R01A 4MUJA 2HRDA 4QM7A 2Q2OA 2AVDA 4BB6A 1N78A 4RS4A 4TXNA 1RAEA 4NBWA 1JTFA 2Q1TA 3M6AA 1JWLA 4QREA 2N46A 3D9QX 1LC3A 3OOYA 5D8DA 2VLBA 3RBAA 4JC8A 1A8QA 3GFTA 1L5ZA 1MQSA 1R12A 1ZICA 3NC1C 5IK2A 2B2XA 3SSOA 1JFTA 1Z2OX 2A14A 4YNBA 1OXVA 1X7XB 3AETB 3VC7A 5ENVA 4UZFA 2XWPA 1NVWQ 1E60A 3REQB 2DPMA 4L5AA 1ODIA 4XYGA 3DVSX 1Q57A 3DZBA 1U2GC 5HBGA 3WBKA 4YLYA 3VI4B 4ESOA 5H4HA 4Q1BA 3KM0A 4IUDS 4GXRA 3RODA 4LQDA 1D7AA 3NHUA 4POOA 2WDPA 5IN4A 2Z58A 3B9PA 5LZ5A 1KSJA 1VJ0A 1XCOA 1L5HA 3TINA 5A4KA 5EIFA 2WZDA 2O8FB 1TT5A 3MZ0A 3NI2A 1BS2A 1ZL2A 4JJEA 4IIXA 3VU1A 4P3PA 4N9WA 5T57A 4E1AA 2JANA 1KP2A 2UYYA 2YN2A 3CX8A 4M9UA 2JLXA 4IH9A 4F7WA 4R40A 1F4VA 2QRMA 1QYIA 4DY6A 3ZWPA 5JSHA 1U1FA 3BHIA 3K9NA 2H4ZA 4QQNA 3VYWA 4CLDA 4ZVTA 1K8QA 3UJ3X 1IOWA 3MJEA 2FVYA 1I3LA 3KFLA 1ULBA 3H1AA 4U5QA 1OLXA 4EVRA 3BC1A 1IEVA 2J3JA 3DKRA 1GG9A 1SBQA 1PZMA 4B71A 3DZIA 1IJEA 4XEHA 2BJVA 1XTZA 3ZZ1A 3I1FA 2JFPA 4IGIA 2E6UX 2CW5A 3FZGA 4KQ1A 5B6PA 2O2GA 3LHFA 5A03A 5DO9A 1T1SA 2DGDA 4RJLA 2UXCB 1NHGA 4H1UA 1BWSA 1C3JA 3TQCA 4BAZA 3KPJA 3PEUA 5CX1A 3S55A 3NIWA 3U4DA 1B3RA 2W83A 2GYWA 4PC2A 1CNFA 1S8OA 3TG8A 1ZJYA 1ILWA 2IXBA 4TXMA 4D6XA 2PS1A 1PUIA 3GRCA 1UT5A 1HEYA 5EHXA 3U6BA 3NIGB 1JT9A 2FUG1 4HNAA 4ZZIA 3HRIA 5I51A 3MYYA 4BKOA 4DM4A 1HZZA 1TYZA 4UQLA 4XVQA 2WINI 3GD5A 2BTEA 4UE2A 4NS1A 3OJOA 4COOA 1KDOA 4CV0A 4LY0A 1K5PA 1TB4A 2UZ1B 3EXG2 3F9CA 3IPLA 4UARA 2AJTA 4PX3A 2ONCA 3L8FA 5J40A 1YZVA 1BCSB 1KERA 1M6YA 3TIIA 3V8NA 1U3VA 1T3TA 2H5LA 3D3EA 4R3WA 5H8WA 2DQKA 1GTL1 2OC4A 4E07A 1QV7A 5LUBA 3K9WA 4NR0A 3CTPA 4UM9D 2W2TA 4GPZA 1VP3A 3P9IA 1Z75A 3H75A 3LQRA 2JEYA 4BIMA 1RBZA 4GWGA 1NXTA 2V4MA 4JBIA 4RF4A 4AY5A 3DKKA 1R5BA 2AN5A 3OJXA 3BWVA 4FINA 3FWHA 4J6EA 2F8TA 1U3CA 5LQAA 1QE0A 2FAXA 2P2LA 2A0YA 2FZWA 1CYDA 4XOUA 4B87A 4DY4A 1DAIA 3EIWA 3AONB 2ZRPA 2J3LA 4KB5A 3DC7A 1DX9A 3HCWA 3LTEA 2Z3WA 4Y2RA 3G2MA 3DDWA 1Z4PX 3PE6A 2NO1A 3OI7A 3QENA 4WADA 3Q0IA 2A3RA 2HU8A 1GZ6A 3HM2A 3GYBA 5IT4A 3RC1A 1L8XA 1M54A 4GXNA 3FMFA 1OWMA 2EKPA 3C6MA 4GPTA 5COQA 3RV3A 5FR1A 4PPNA 1Q7GA 4RWEA 4GMXA 1PNTA 1ZD8A 2Z2IA 3K4QA 4PBRA 5AHRA 4YVFA 1WXQA 3IIKA 2Z9BA 5CVEA 2WTUA 1SVIA 2XB9A 3K05A 3MTQA 3OF2A 3PR3A 4N5LA 2O59A 1J33A 2PY6A 5PNTA 5EFZA 3ULKA 1TA0A 3F7OA 5AIAA 3TRKA 4M86A 2V5VA 2WSYB 3QUBA 1UR5A 1II8A 3A3KA 2OMEA 1N8NA 5A62A 1QYVA 4DM3A 4U9HS 5JSYA 1V45E 5I7OA 4ND1A 3IPYA 1JP7A 1KDTA 4JLOA 3PKJA 5K45A 3VO2A 1HG0A 3NATA 1JHQA 2ZI4A 1R8JA 2WJJA 1FZTA 1WPRA 4G0WA 3ZU6A 5JS6A 1IE3A 4L16A 4K9QA 3WWZA 2PUEA 4TUYF 4G2TA 3HCBA 4EKGA 3R5XA 1JMKC 1PJCA 1HR0B 5E4YA 2Z5GA 3ASVA 1QP8A 2HSZA 1NXSA 1GAWA 5CPBA 4Y2TA 5CDUA 4UUNA 2YIJA 2YFQA 5I9SA 3DC2A 4YX9A 2R8OA 5KVSA 2B8WA 1I94B 3NS7A 4ND3A 5D01A 2H1HA 3TG2A 5K0CA 4IJ6A 2B21A 2ID9A 2KM1A 2SKCA 3VO9A 1PVVA 3G0CA 5J58A 3C70A 3WGZA 1UK8A 2PIDA 2JD2A 4EA6A 1FYWA 4MS3A 4HQOA 4KEAA 1P80A 1SC9A 3VPHA 2VDJA 1BH2A 4XQEA 5I4CA 1LQTA 2IXAA 2O6HA 5LLSA 2H5IA 3DSRA 3SHOA 1A2KC 2QG6A 4C03A 3O75A 4OLFA 5D6NA 5FOVA 1L5HB 3HBMA 5F1OA 3TB6A 2O2ZA