2CXXA

Crystal structure of a probable gtp-binding protein engb
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
184
structure length
184
Chain Sequence
ATIIFAGRSNVGKSTLIYRLTGKKVRRGKRPGVTRKIIEIEWKNHKIIDMPGFGFMMGLPKEVQERIKDEIVHFIEDNAKNIDVAVLVVDGKAAPEIIKRWEKRGEIPIDVEFYQFLRELDIPTIVAVNKLDKIKNVQEVINFLAEKFEVPLSEIDKVFIPISAKFGDNIERLKNRIFEVIRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Probable GTP-binding protein engB
publication title Crystal structure of a probable GTP-binding protein engB
rcsb
source organism Pyrococcus horikoshii
total genus 65
structure length 184
sequence length 184
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2cxxA00
4OI4A 3K53A 3KDSE 2AWOA 5EE0A 5JHHB 1ZU4A 2QE7A 1T6NA 1L4YA 3CBQA 2ORIA 4HLCA 4X8HA 4Z8YA 2BBTA 2ZEJA 2Q3MA 2H17A 4Q4JA 3L0SA 1NVUQ 2PJZA 2RGEA 1GKUB 1FOEB 1JXOA 3DKPA 3FHTA 3FWYA 1Q1ZA 1VIAA 4XSHA 3L8ZA 4G0NA 4KV9A 5TARA 1E9CA 2OLKA 3KKQA 1NVXQ 1NMZA 2QQ0A 1W0JD 1XXHE 1KMQA 1OHHA 1IN7A 4LV5B 3QF7A 1FFHA 3LH5A 5KDDA 1E4YA 2H16A 2ZRBA 5JLJA 4M1WA 1RRCA 4HUQB 1ZM9A 2VO1A 1GTVA 3H0KA 1G3UA 4YQFA 1EESA 2VP4A 3CWQA 1E0SA 3JVVA 4KSCA 4EPWA 2DCUA 4DB4A 4XJXA 4BZQA 3CR8A 3LW8A 1RE0A 3QXJA 4OQFA 3AVTA 2GHIA 3U7GA 1NMYA 1NVVQ 4GP7A 3RDPA 3KZ1E 4URVR 3GJXC 1OXSC 4OI1A 4Z54A 4Q4HA 1XMVA 4Q9LA 2JLQA 2IHBA 2JJ1A 3TAHA 4KODA 4BZXA 2IT1A 1IM2A 3KKNA 4JVLA 3WYGA 5JBQA 3TGPA 2C99A 3QOFA 3W34A 3R7WB 2W0SA 1DAKA 1R5NA 2PEZA 3GMTA 5K8LA 1KI9A 4GDFA 2VHUA 3CR7A 4NYIQ 4DKXA 4IVQA 2G1KA 4DRZA 4UXJA 1YR9A 5TY0A 4MUBA 5J4YA 1BOFA 1NN0A 2BJWA 4JLNA 4CZ2A 2YC4C 3D8BA 3QKUA 4DBLC 2IEZA 4EPXA 4OK3A 2QPTA 1SVOA 3EZ6A 2DWPA 3CX7A 2V54A 4ZIRA 1P6XA 1O87A 1EWQA 3KXKA 4FWIB 3SI7A 4NCKA 3TR0A 5JEEA 2BBWA 2F1IA 2IUTA 2QPOA 4ZDWA 3T1QA 3HPRA 2O8EA 3SJAA 2GTPA 1FL9A 1JJ7A 4GI7A 1HYQA 4TTRA 4B32A 4EJSA 4AKEA 4OI0A 1G3RA 2JGNA 1KOFA 2PBRA 3HYRA 2JDIA 2R62A 1JAHA 3AV0B 1KSFX 2EFDB 2GA8A 1IXSB 2IK8A 4LYAA 3GLIE 3VU9A 2LCFA 1TAGA 2BWJA 2R6DA 2Z83A 2ZTSA 4P3YA 1ZD1A 3CONA 5KHOC 4BGDA 3OEED 3SYLA 3GJ8A 4B2IA 5HCNA 2JLWA 3BERA 2FPMA 1C1YA 3CNLA 3EPHA 2RH5A 2G3YA 4PQYA 4CW7A 1FTSA 1U8ZA 3K0EA 3IUYA 2O8DB 4R2IA 1II8A 3E1SA 1NKTA 1NLYA 2PEYA 2IYLD 4BLTA 1XTRA 1XX6A 1UBCA 3DKVA 4YC7A 5KU1A 3B5JA 3OIVA 1AZTA 2QAGC 2V55B 3H86A 4GNKA 1CR4A 1NVVR 3A4LA 4QNRA 3IIMA 4N3NA 2NMVA 3GLGA 3VHLB 1TU4A 4D0LB 1JECA 5TVKA 3HWSA 1A82A 4TL7A 4XVQA 3AVPA 3CZQA 1KI8A 1GITA 4NCNA 3QENA 4U00A 4G3XA 1TUIA 1G7TA 4WZAE 5FTMA 1UPTA 2QMUA 2C9YA 2WOJA 1G7RA 1COWD 2H1LA 4M9XA 5GVRA 1Z22A 2J0SA 2CL7X 3BFKA 5KO2A 5JFGA 2JJ2D 1YKSA 3EA5A 3LBNA 2GZHA 3T1VA 2NO6A 4V0ME 1XD2B 1F2TA 1T3SA 3GEEA 4US1R 3K0SA 1US8B 2EWWA 2OCBA 4PXAA 1G19A 1E2LA 4HAUA 2O0JA 2V9PA 5JSZB 2ZREA 2ZRCA 4A2QA 3HJNA 3KKMA 3MJRA 3LRPA 4QNMA 4NKRA 1S3SA 3R9IA 4ACAA 3MFYA 5JJLA 2EFCB 2C9OA 2KBEA 1HT2E 1Z6YA 3SJCA 4YMVA 2QBYA 1JXMA 1MO3A 2VRWA 3OIUA 3NDPA 1CRPA 1X8JA 3PUYA 4CIDA 4XVUA 1N0VC 5GJCA 4QGHA 4TMWA 2ZRHA 5L3SA 1Z63A 5E4FA 1S1CA 4Q9IA 4DC9A 2GXSA 1OW3B 2Q3HA 1EFUA 2Z0MA 3B2EA 3KUCA 3BB3A 3QVVA 5G3ZA 3OAAA 3K09A 4Q7MB 3RANA 2J0UA 4A0FA 3L82B 5KOYA 4D4MA 4MH0R 1KI4A 5FBLB 4GBMA 3DL0A 1E96A 1MT0A 5TDHA 5AWFC 4B44A 3VR1A 2A3RA 2KI5A 2VSFA 4ZCIA 1VIYA 2FJUA 3OEEA 2BC9A 1E2KA 5G41A 5UKDA 4TL8A 5DN6D 3KJGA 3L43A 1KO1A 3AVQA 4UNSA 4LGMA 2PH1A 3QI2A 2IS2A 4M1OA 4XWKA 2DY1A 2A5DA 4HDOB 3BK7A 3DVLA 2AL7A 3ZJYA 4K81B 3CF2A 4DEXA 2HCJB 4PO8A 1Z06A 1E2EA 4HUTA 4IOMA 2GEDA 1PLKA 4PPFA 4QG7A 1FX0B 2XB4A 2ZUCA 3W6OA 2V4ZA 1HTWA 3IO5A 4FW9A 3BE4A 2CVFA 1NLFA 3EXAA 4TYWA 4JL6A 3SBEA 2YWEA 5A5GA 5KTYA 1VPLA 4TYNA 4JBXA 4RZXA 2FA9A 2IWHA 1FUKA 3TNFA 4KLZA 1SVWA 1Z2AA 2R8RA 2QMHA 3L0OA 3AVYA 1CULC 1KSGA 4HUQA 5JHGB 3LQRA 3Q9LA 1E69A 1COWA 3HP1A 5L8VA 3NBFA 1AQYA 5LB4A 3A8TA 4HLQB 3BAFA 2QAGB 1OPXA 3L8YA 1E4VA 1H65A 3CNNA 4DSOA 1XWIA 4DHEA 2OAQ1 2QGNA 3DM9B 4Q1FA 3WMFA 2IYTA 3SS8A 3K8YA 4GMDA 3BD9A 1W46A 1KDPA 3C14C 1U99A 3BS4A 1IBRA 2DBYA 3MMPA 2K5UA 3BRWD 4PZYA 2J59A 2IYZA 4TMKA 3T35A 2PZGA 3ECCA 3WHLA 4D81A 1G20E 2ZS8A 2JLYA 1HE8B 4DCNA 621PA 4OBEA 4OYHA 2LKDA 3UANA 1E9BA 4Q9JA 2GZDA 3U2QA 1V5WA 4M1MA 2IYUA 4UXIA 4Q7JB 4TWZA 1DAIA 2BVNA 4D2IA 1TEXA 4XWOA 2GXAA 3QVUA 5IT5A 3RSOA 1NN1A 2F1RA 1UDWA 2RGNC 1A7JA 4EFLA 4XTCS 5HE9A 1Q1EA 1IY0A 1W4CA 2RMKA 2VP6A 3OEHD 2DR3A 2H57A 3M4YA 3TE6A 1XNJA 1GVNB 5KSOA 1G41A 4MYHA 3VX3A 1G3MA 1G8YA 1E79D 1GFIA 3RS7A 2R6GA 2FPLA 4IXMA 4NCJA 1TEVA 4R7ZA 1VYTA 2GBLA 3KJEA 1G4UR 3C8UA 3A1UA 5DN6A 3LVRE 3W8RA 4B73A 2WTUA 1CBUA 1P9WA 3PENA 2VLIA 4Q7LA 1G8PA 4V0KA 5J4KA 3SU8A 3EWSA 1B23P 2N46A 5BN5A 1BIFA 1DG1G 1SZPA 2ZSFA 4JLOA 3ZVNA 2B7CA 5FH9A 1RJ9A 2WIAA 1KHTA 4HI0E 5JJIA 4HAZA 3EIHA 1QHSA 1R2QA 3A1VA 2XZLA 3IBGA 3PR1A 1DPFA 1R4AA 4DSTA 1QHHA 1S2MA 3W3ZB 1N6PA 1UEIA 3K9HA 2O8DA 1P75A 3ONWA 2AK3A 4PAOA 3T12A 3U3RA 1KAGA 1PLLA 3FVQA 3PITA 4KFUA 3M1IA 4B3BA 4DVGA 4AG5A 4GP6A 2GJSA 4EJSC 3AUXA 5FOXA 1E1QA 3QNUA 1S3GA 2WKRA 4MRSA 1VG1A 4M1TA 2OM2A 1M1YE 1NG1A 3B78A 4G01B 4D4JA 1JBKA 1X8LA 3K1JA 3A4MA 4HAVA 5FR2A 2N1BA 2QORA 2LWIA 2N42A 2P5SA 3J81k 2YWGA 4IEIA 3AP2A 4RSGA 1ESNA 1ZUIA 2WWFA 3K9NA 2GJKA 1QZXA 5CLLA 2MSCB 3FKSA 4WBSA 3FHOA 3LY5A 5FBQB 3VX4A 4BFSA 2KWIA 1XD2A 1IONA 4S35A 5C18A 4F4CA 1H8HD 1ETUA 1KK0A 1US8A 3HDTA 3N2EA 5LD2C 3PQCA 2PLRA 4LJ6A 5FBVB 1XCMA 4HAXA 3TR5A 5IRCD 5KSYA 4Q4AB 1G5PA 2GNOA 2OCYC 3TLXA 4GZMA 4AKHA 4WZ6A 3PEVA 2JIZD 2MSEB 3Q5EA 3C4JA 2PX3A 2OSBA 1NL3A 1D8TA 4MUAA 1DS6A 2BMEA 4PPQA 2IBMA 2I1QA 4R98A 5BW8A 3OEHA 1P60A 1BYIA 3GEHA 4TQ9A 2FZ4A 2A5JA 1CR0A 1YHNA 3Q7PA 1UBEA 4G5GA 1ODFA 3C15C 3KX2A 2HDNB 1YZQA 5FPHA 3DEFA 1E79A 2FWRA 1XEFA 4TT3D 4RZ2A 2ZIAA 3RS3A 3ZQ6A 4M9SA 1GL6A 4LJYA 4IDPA 1W48A 1TQDA 1AJEA 2HJGA 4YMWA 3RNLA 2OILA 4M9ZA 5FOUA 5KDLA 3X1DA 1G7SA 4OQMA 1PJRA 3AB3A 4ZPXA 2LKCA 2QSZA 2FV8A 3G82C 3KKPA 1VTKA 4KHZA 4C7OA 3CRRA 2PJRA 1CJMA 2YNMA 2F3TA 3RC8A 2P67A 3EIQA 1F48A 1VYUA 5DI9A 4TLEA 5M04A 1CS4C 1KDTA 3UMFA 1KZ7B 1VECA 3IEVA 4PSKA 3QPVA 1HV8A 2C98A 1TX4B 4LI0A 2ZI9A 1KKMA 2ZRIA 1TMKA 1ZRHA 3GFTA 4ERNA 1KNXA 1NIPA 4NYMQ 4Q4HB 3SDZA 5C4MA 3OIYA 5FUXA 4UNPA 1TF2A 4TLDA 3RRZA 421PA 4XIGS 2KBFA 2MMGA 4QKQA 4C30A 1SXJE 1TF5A 1KSJA 1OFHA 3P27A 2Z4RA 1U81A 2VYFA 5FTJA 3WBJA 1D6JA 2XNDD 1YVDA 4GOXA 2OXRA 2BMJA 2CHVA 1DVRA 4HDQB 1LTQA 2ZRPA 1GAJA 1GUAA 3QPWA 1W4AA 3CH4B 1N5JA 1S9HA 1PV4A 3NH9A 3W5JA 4LC1A 4QXAA 4YXWA 3KXLA 2NIPA 4AYTA 3VR6A 2PMDA 1YRBA 3FDIA 1IY1A 1MO6A 4GZLA 2F1HA 1FP6A 3TH5A 1W36C 3VTKA 3B7GA 5E95A 2QAGA 2GJ8A 5KNBA 2AXPA 1E2NA 2O8EB 2JAQA 3DDCA 4RZ3A 4BFVA 4EJSB 5B64A 1H8HA 4FMDF 1BO6A 4QFMA 3LFUA 4EFMA 4Q4LA 1XEWY 5K8IA 1YRAA 2F9LA 1J7KA 2HUPA 2XTZA 4FWTA 4ITRC 3BB1A 5GVSA 2XTMA 3NIBA 4BZPA 4FXPA 3N5CA 2R65A 4Q1EA 2PZEA 4P4UA 5JEDA 5CK5A 2GESA 1J90A 2JIZA 3GJ0A 2ZYVX 1FPMA 4KU4A 4JZKA 3AF4A 2CLDX 3TVTA 5CITA 2QZ4A 4PHTA 1W5TA 1VCIA 2XJ9A 2EW1A 5DSZA 1YZKA 1BS1A 1ZM4A 3TBKA 2IF0A 2V7QD 4QBGB 4DLXA 3ZD7A 2V6IA 5BXQC 1F6BA 1I2MA 1II8B 1WP9A 2QP9X 2C96A 3CLVA 4Q02A 2F1JA 3I32A 3ASYA 4C0LA 5GJVC 1HA3A 2P5TB 3T1TA 3X1WA 1I4TD 3GLGB 4PSVA 1Z0DA 1CTQA 1ZCAA 4QGAA 2BKEA 2Y8EA 4NYMR 3T5GA 3OFNA 4CRWB 2F43B 1RC8A 4LBZA 1GRNA 1LF5A 4AK9A 1T3HA 2HEIA 2OLJA 3BIFA 2AXNA 4P4TA 1X8KA 2GRJA 1JALA 2RKOA 2NO0A 4ESVA 2I4IA 4MGZR 4TMTA 5G40A 4R9UC 1G6HA 2WICA 4LV8B 2ZJ2A 4B43A 4DLTA 1W5SA 3KTAB 1QHXA 2QI9C 1F2TB 1AS0A 1YR6A 1EFRA 4Q48A 1S8FA 5CM8B 3FB4A 3TAUA 2GETA 2XJ4A 3QBVA 2R2AA 4HATA 2XGJA 2IW3A 4QRHA 5G3YA 2EYUA 4C3ZA 1QBKC 2OE2A 2J41A 5ANRB 2J7KA 4N1AA 4ON9A 1IXRC 2XNDA 1KI6B 4W5HA 4QGGA 3CWZA 4W5WA 3MCAA 1XXHA 3PG5A 2REOA 4HZIA 2RGXA 4F38A 3LXXA 2QBYB 2RGCA 1SKYB 3B60A 3DMDA 2J45A 4QL3A 5DNYB 4NP6A 2V3CC 4BUJA 4YMUA 1Z6GA 2ZS7A 4BLQA 1N25A 3EAQA 3KXIA 1P2TA 1Z29A 4HB2A 5CLQA 1E3MA 2XSZA 4NYJQ 4IDQA 1ZU5A 4QC2A 4DIDA 4A8JC 3A36A 4MKFA 1R5OA 5H1YA 2Q0HA 4LJAA 1II0A 5CJPA 5AUQA 3W9YA 5KUTA 1KZGB 1E9DA 1NSTA 4D82A 5K8UA 1P7CA 2FZLA 2YJTD 3GLHE 1E98A 1RRPA 3NDBB 5CJ2A 3WXMA 3UMSA 3SE0A 4BFTA 2FDCA 3FMOB 3IQXA 4NPHA 4Q4AA 1QG2A 1W36B 3OZXA 1DTSA 1BMFD 5EXTA 5FL7A 5J47A 2VTKA 1UFQA 4AIIA 4JMPA 2ZVPX 4NZYA 1XEXB 3K0AA 2WAXA 1NNEA 1E1RD 1Z83A 5CDFA 5FOTA 1E2PA 1KI2A 1Z0IA 1X86B 4ACBA 1DO2A 4CT4B 4KLNA 1GILA 3LBIA 1KO4A 8OHMA 4PX9A 1QG4A 1G8HA 2C9CA 5SZHB 3PUZA 4TL6A 4KYUA 5AUPB 1DAHA 4EPRA 1OYYA 1HE1C 4MKIA 4OJQA 1NN3A 2R9VA 3NHAA 3FYHA 2OCPA 1Z08A 2ATXA 4CDGA 3P4YA 1ZM3A 4JBWA 5DISB 2DPXA 3BH6A 4WIAA 3ADCA 2WKQA 3LW7A 3ZS9A 4GT1A 2RGNA 2WBLC 1FTNA 1UKZA 2L0XA 4A92A 3GPLA 2ZM5A 1K5GA 4Q01A 5J40A 2X19A 1ZIOA 1T9HA 4MA4A 3ZZTA 1U8AA 1D9ZA 2VL7A 2QM7A 5HCIA 2VF7A 3DPUA 4P31A 1Y3AA 1I4DD 1AK2A 4RJLA 2NO9A 3KKOA 3GLFE 4UNNA 4B76A 4XD7D 1ZJ6A 5CIQA 1ZNXA 2EYQA 4II7A 1N6NA 4CF7A 1VMAA 3B85A 1RIFA 4NYJR 4V0LA 1U0JA 5EXSA 5BYJA 1T8UA 1CR2A 1W0KD 1Z47A 3L2OB 4UNQA 5E3HA 2ZR9A 2F9MA 3E2IA 2WSSD 2DB3A 3AF2A 3EW9A 5EP2A 1Z28A 1ZAKA 3EX7C 5J4VA 4FI3C 1E94E 2Q3FA 2VF8A 1Q3TA 1P62B 5EE3A 4XTRA 3KQUA 4NU0A 4L5BA 5FOSA 4ZDKA 4LHVA 4DCUA 4DIEA 3PFIA 5F3WB 1SQ5A 2BIFA 3D7MA 1VG8A 2CE2X 5EP3A 2YINC 2W58A 1RRFA 5ELXA 2IYRA 2ZYTX 3FMPB 3PVSA 5FPYA 1NVWQ 1SHKA 1OJLA 2QA5A 4B3CA 4EPVA 4URYR 4Q9KA 1OB5A 3BOSA 1OB2A 3FPAA 4NDZA 4TLBA 3LLMA 4GOJA 1TNDA 1AIPA 3OE7D 2BHRA 3IQWA 1TTTA 3KQKA 1BH2A 4OQXA 2QU8A 2I3BA 3TVDA 2O52A 2VA8A 721PA 4M1SA 2IS6A 4NCIA 4FMBB 4RVCA 3RABA 4B3DA 3CRVA 1T3LA 2ZSEA 1BMFA 4LHZA 2IXFA 3X1ZA 2ZYUX 2B6HA 2W83A 1Q57A 3KFXA 2NO1A 3OIWA 1ZM2A 4OHVA 4A8JB 4TMZA 2MMCA 1RJ9B 3QEJA 1W36D 1U0HC 4HB3A 2P6NA 1WRBA 3TW4A 5EXXA 2OEPA 5EP1A 3AP3A 3NKVA 4TZ6A 1KI1A 1QHHB 3PUXA 2WJJA 4U7DA 1PZNA 4O2RA 2IXGA 4OHXA 3TIFA 1Z0FA 5GADl 1SVMA 4IVPA 3SNHA 2D3WA 1OFTA 1Z6TA 2IYWA 2X2FA 4PHGA 1IQPA 1W0JA 4DUGD 1GDDA 3B9QA 1LB1B 4FN5A 1KKLA 1OLOA 2A5FA 4MYUA 4PC3A 4OK5A 1T5LA 4TYYA 4B3XA 4RD3A 2PMKA 3Q5DA 1HURA 2IHYA 4YONB 1ZM7A 3U3KA 4RCYA 4IFBA 1J2JA 2J0VA 3U6KA 2P6UA 3AF3A 5DLQC 1LY1A 3IIKA 1T4GA 2G0NA 1T91A 3LD9A 4A1FA 2F43A 4H1VA 1KK3A 4KSBA 5EXPA 1GL9B 3EZ9A 4AG6A 1TADA 4DLYA 4B2LA 2ZANA 3AUYA 5CIWA 5DE3A 1E99A 4IFEA 3KTAA 3QF4B 4A0GA 1IN4A 4QHYA 5FOWA 2G83A 2VHQA 1W0KA 2Q9BA 1E0AA 2GAOA 2DWQA 2HXYA 3CPHA 2WSSA 2ZJ8A 2HT6A 4KBFA 1KO7A 1FMJA 1R8SA 3U3JA 4A15A 1KI6A 2CHGA 2HYIC 3SYKA 3KQNA 2GXQA 2CLSA 3HR7A 1P2SA 1MR3F 3M0EA 4DLUA 4LPSA 4BFWA 4EKDA 4ZV4A 3AVOA 3RS5A 5JI3E 3I8SA 4JL5A 3VKGA 2ORVA 2FPKA 2WPDD 4QM7A 5AJZA 5BN3A 3EARA 1RKBA 4QJ5A 2GF0A 5HZKA 2FFHA 1MV5A 3BFVA 4BLOA 1P4SA 4HZUB 5J4LA 3R8FA 4FCVA 4LV6A 4NHOA 2QG6A 5DHFA 1K6MA 2OCAA 4RD1A 1D9XA 5P21A 3OE7A 2NO7A 3V4FA 1ZBDA 2ZI5A 1UKEA 2PX0A 4M0LA 4XH9B 3GJ6A 3UXMA 4XOIA 3IHWA 2ERYA 4W5JA 3VR4A 4LYFA 2NOAA 2YYZA 4JJKA 4EDHA 4C7OB 2ANCA 4ZKDA 2ZAMA 2JLZA 3H1TA 4DCTA 4FCTA 4AURA 1N6RA 5FTLA 1G6OA 2CLCX 1I4LD 2B92A 3VR3A 1FQJA 1KO5A 3EG5A 5JRJA 1QHIA 2JLXA 5F9HA 1XEXA 1RW4A 2X1VA 2XOKD 4JSTA 4C9BA 2V1XA 2CBZA 2RHMA 4LX0A 3LA6A 1LFDB 2QP4A 2HT1A 1IJEA 4DUGA 5C1BA 4QJ4A 2RB4A 5BQ5A 3QPUA 2ZRKA 4MITA 3FMIA 2CVHA 4TLAA 4MRRA 1GIAA 3VR5A 4B74A 1RRGA 3HU2A 2PL3A 1QHGA 2ODEA 3MRSA 4KCGA 1IY2A 1SVIA 3QQ5A 5JECA 1ZNYA 3CB4A 3KQLA 4I81A 3PEYA 1FW6A 3ND8A 1B0UA 3NBYC 4TYPA 2AD1A 2HLDD 1O3YA 3MWYW 5DHAA 3VNUA 2YWFA 2Z4SA 2D2FA 2DFLA 4IEEA 1XF9A 4G1UC 5JCPA 2JJ2A 4PTLA 3LQQA 3AVVA 2YV5A 3QSYA 4C0AC 1E9SA 2J9RA 3I3SR 1XPUA 1QDEA 3T61A 4D4LA 4O3MA 2CXXA 5C2JB 2CCGA 5HR5A 4LDJA 4WW0A 1H8ED 5AJWA 6Q21A 4W9MC 1Z0AA 1XMJA 2F7SA 4Q03A 4AD8A 1W1WA 3DM5A 3AVUA 1SXJD 2ANBA 2WPDA 1XCGB 2ZJBA 1IAQA 1G1MA 2C04A 4CEJA 4I4LA 4NBSA 4PR0A 2WOOA 4JLKA 3WHKA 3G0HA 1WQ1R 2W0MA 4BECA 2ONJA 1R0YA 3A37A 2JA1A 3KFVA 4JVNA 1DARA 1KGDA 3M6AA 2ZRJA 4HB4A 2F6RA 3MD0A 2D74A 1Q21A 4IDNA 4JLPA 3K0FB 4EAQA 4DLWA 1R7RA 3R20A 4WZBE 1R6BX 1KMHB 2ONKA 3RYTC 2GWHA 5KNCA 4JLJA 3DO6A 1CLUA 3Q3JB 4NTZA 4JVMA 3F3YA 4HAYA 2JATA 4I1OA 2QROA 3DOFA 4MGKR 4JLAA 1RPZA 3GFPA 3CX6A 2OFWA 3AH8A 4L8GA 4P4SB 4O25A 1X1SA 3B1YA 1GP2A 4JL8A 1XP8A 5CB8A 2XOKA 3C41J 4OKSA 4A8JA 4ARZB 3CH5A 4V0OA 3SJZA 1N6HA 3KQHA 1X3SA 1Q1QA 3ADKA 2IA5A 3I4LA 5EE5B 4CGZA 3AM1A 4A2WA 1MO5A 4ASUD 1P73A 2DFNA 2E87A 2PT7A 4DCSA 1JR6A 5IK2D 2DFTA 3PJRA 4DB2A 1ZC3A 4KI0A 1E0KA 3JZMA 3UG6A 1A4RA 3AKCA 3IILA 1U90A 2A78A 5AUNB 2J7PD 3EPKA 3BORA 1XBTA 3I62A 2ASEA 1XXHB 3MGCA 1LF0A 1UBGA 3L0PA 5E7JA 5C4GB 3WNDA 3TJZA 2P2LA 3LO5A 4GPTA 3RRNA 5CYPA 3ICEA 2CNWD 4AKGA 2YC2C 4AKIA 4QM6A 2HLDA 3RHFA 4CEHB 1UF9A 4Q7KA 5DI3A 1G3IA 3TMKA 4PHFA 1EK0A 2BDTA 4IRUB 1KDRA 3CRMA 4IDHA 3S1AA 4JLMA 4LWZA 3O8CA 1SVSA 3PUVA 1WF3A 4BLSA 2VIIA 3AF1A 5LDDC 3QF4A 3ZYCA 5KNDA 3ZD6A 3EC1A 3O8DA 5TV2A 4B34A 2ZSDA 1P5ZB 2FFAA 4RD0A 2B8WA 4V03A 5LBIA 1CF4A 4URWR 4TMVA 4F93B 1YQTA 1KJYA 2OBNA 4E5UA 4DEYA 2WKPA 3VR2A 1YE8A 3EPJA 1E2DA 3U4QA 2WMNB 3A1WA 1QHYA 2XX3A 3K0AB 1TQ4A 3O47A 2QL6A 1CJVC 2XZOA 5B2ZA 4G5OA 3REGA 3A6PC 1KJWA 1VKJA 1OFIA 2O0KA 3H2YA 3Q85A 1XTSA 4Q18A 2ORWA 3KJIA 2VP5A 4KFRA 2KSQA 1ZIPA 5TB5A 4HZUA 1PUJA 4M53A 1EX7A 4M1KA 4CT5A 4LJ7A 1JQJC 1NF3A 2J5XA 4HDCA 2CEAA 1DELA 3QY0A 4NL4H 4C0BA 1RZ3A 1IJFA 3SOPA 3NC1C 3K70C 4IW3B 5TMPA 3GCGA 2O8CA 3MWLA 1U9IA 2QSYA 4E09A 2ZXUA 5EZ6B 3GLIB 3UPUA 5IF9A 1S4QA 2H92A 4JBYA 1G9XA 2JCSA 1P2UA 3FHCB 2ZPTX 1OIWA 4TSFD 2JLVA 2ZJOA 1LS1A 1E9EA 2GILA 5D3MB 4KO8A 4CYMA 1U94A 5A4JA 2RGGA 1OF1A 2GF9A 4RKFA 4PO9A 3AQ4A 2J0QA 1Q3HA 4KFTA 3FTQA 3THYB 2XTNA 5IK2A 4RD4A 3AF0A 4X8MA 1OYWA 1EFCA 2CL6X 3NBZC 4DLVA 4A82A 4BEBA 4B33A 2CMKA 2J7PA 3Q8XB 2FX3A 2AR7A 2FSHA 1M74A 1W44A 4V0NA 3P20A 5F2EA 1XFAA 3BH7A 2CNWA 3QE0A 4DDVA 1YZTA 3LVQE 4YDHB 2ZYWX 4PZLA 4JSYA 1G21E 1W4BA 1ANKA 2EWVA 2GJ9A 1T0JB 2XAUA 3N70A 3U60B 4F4JA 2FGKA 2O8BB 1G5TA 2WJYA 4DSUA 2FOLA 4MRPA 4HB0A 1C9KA 1AKYA 4KBGA 5D3QA 5SZKB 5HPYB 3R9WA 4OHYA 1A2BA 2NZ8A 3U3MA 2BEJA 5JWOA 2VSOA 1ZUNB 2MSDB 4B75A 2VP0A 5DO9A 2J3EA 4LC0A 1TUEA 4D4KA 1HY3A 1SVLA 1J8YF 2GVZC 5H70A 1NY5A 1CR1A 4B47A 1UBFA 4E07A 4ZI3A 2VEDA 3SFZA 1QVRA 3FFAA 2C77A 2R6CA 4B3FX 1L4UA 3NEYA 4QHTA 3AKEA 1JQLB 2XEXA 1YR8A 4IOLA 1GKYA 2QT1A 3CKLA 3LWNA 4OK6A 1OE0A 1AZSC 2A9KA 5HZHA 2A2ZA 3U5ZB 1JR3E 2P6RA 5FPTA 2ODBA 2EU8A 2FGJA 4JKIA 3QBTA 2IC5A 5DH9A 2X8AA 2WSMA 3QJYA 5LD2B 1DG3A 1R0XA 3MWKA 5JS7A 2V1UA 3IGFA 4TT3A 2QTHA 521PA 3C7KA 2WJIA 2VSXA 3AGPA 4FINA 2AK2A 5FPKA 1AS3A 2JASA 5DGXA 2QRZA 3K0FA 2WIBA 4DJTA 1Z0JA 1W49A 1KMHA 2DWOA 4IXNA 4PANA 4PC1A 4LSGA 2W2XA 1YZLA 3VFDA 3R8CA 1XTKA 4MRNA 1MH1A 2D2EA 3CW2A 3U61B 2WAYA 4LBVA 1NJGA 1GM5A 1X1RA 4DCVA 4TN1A 1G291 2JLSA 2FSFA 4KAXA 3UK6A 4EUNA 3TSWA 3NXSA 3QKSB 4UJ5A 5JCZA 3ADDA 1NBME 4P4SA 1UADA 2D62A 3O8BA 2EFEB 4MYTA 4A2PA 4ARZA 2AKYA 1T0HB 1AGRA 2DFKB 2GAAA 3HU3A 3IHLA 4HLUC 4LY6A 1OSNA 1OIVA 2FSIA 4N0EA 3W6PA 3L0IB 3K70B 3V9PA 4ZO4A 1Z8FA 4LJ5A 3SHWA 4Q21A 3SN6A 2V8OA 3EZ7A 2BV3A 3RS2A 2EQBA 2ZVQX 4RD6A 2HYDA 2ZU6A 1RYHA 1W7AA 1G4AE 4O0MA 5AUOB 3I73A 2QAJA 3SC3A 2G6BA 4M8NE 1PLJA 2BBOA 5BYKA 3I92A 5JZVA 4L15A 1OIXA 1MO4A 2QQEA 2BJVA 4NCHA 1RYFA 1TPZA 2WJHA 3KUDA 3NTUA 1OT3A 4OJKA 4DDWA 4CEHA 1ZW6A 4URZR 1XPRA 1N6LA 5C46F 3TQFA 1MRNA 2ZUBA 5CM9C 1F3OA 4JLBA 1G16A 1XMIA 5L3RA 4JYBA 1E9FA 4JKYA 1U98A 3QUSA 1WE2A 4MGIR 4AYWA 3THWB 3WBKA 2CDNA 4GOKA 1SKQA 1HQYE 2B21A 3THOA 2C78A 2HXSA 3QXCA 2OUKA 2KE5A 4PHHA 3RSLA 4UNRA 3HU1A 1WCV1 2BM1A 4GRAA 3EIEA 2V7QA 3FKQA 1FNMA 2YHSA 3HYTA 2ECKA 2KJQA 2EVWX 4PC7A 2ZRFA 1E32A 2AWNA 3X2SA 2JLRA 2E9SA 3K0CC 3SHFA 3GQBA 1CJKC 4N0DA 2PT5A 4ZKEA 1K8RA 2YVUA 1U8YA 2JDID 2VH5R 1KAOA 4BLRA 2AFHE 1R5BA 4Q1CA 4Q5IA 4B6FA 1PUIA 4B35A 2IWRA 1CP2A 3BH0A 1DO0A 4A6XA 5L3QB 4PPGA 1WBBA 3GFOA 1GOTA 1ONBA 4ZCLA 1QHNA 4UKDA 4ZDJA 2O8FB 2Q21A 2ZU0C 4LYJA 3GLIA 3B1XA 3IPYA 1XD8A 4M21A 4CEIB 3C16C 3QXXA 1ZNZA 3BJIC 3I8XA 3IBYA 3THXB 4L16A 1SXJC 1SGWA 1FMLA 1XDBA 1VCNA 2WV9A 3NVAA 3SEAA 5D3MA 4KITB 4J0QA 3Q7QA 3DZ8A 5FTNA 5B30A 221PA 4NMMA 1MABB 3RLFA 3EZFA 4MKHA 1J70A 3FFBA 1OH5A 4PZZA 3KJHA 2IYXA 3THYA 1OXTA 4BFZA 1ZINA 5F98A 2W2VA 1I2DA 3P32A 1YU9A 1NLZA 1L8QA 2QENA 5JWRA 3ZLJA 5FUYA 2ERXA 2ZROA 1E9RA 3K9GA 3IO3A 4Q19A 3K70D 1WXQA 3SBDA 1Q22A 1VCOA 5KDOA 2QM8A 1EFHA 4NH0A 3WP1B 1N6KA 4CEJB 2ZRMA 1LS6A 3CRW1 2VHJA 1U9IC 3PIRA 4KVAA 4PPNA 5FFMA 1UDXA 3F8TA 2O8BA 4A4DA 5J4HA 1CU1A 3UWKA 1J8MF 2BOVA 4ILEA 4P32A 4G5RA 1GNQA 1NSFA 2CJWB 3EZ2A 4RZUA 4BE7B 2XB2A 2IYVA 2QY9A 4G5SA 4RKEA 4XWAA 5BN4A 1BKDR 3N2IA 4WA7A 3AP1A 1QVAA 1VDZA 3I1FA 5FUVA 2RGDA 4V0MA 2R6AA 3FMFA 1SHZA 3WRYC 4A6PA 5CDFE 4O2LA 3EASA 1OXXK 4QBFA 2NZJA 1X6VA 4LHXA 4B3GA 1ZVQA 3TUZC 3U44B 1KSHA 3D3QA 2QTFA 1LV7A 3WNCA 2IYQA 3RVBA 3ASZA 4LHYA 1AN0A 1G17A 1E1RA 3WMGA 3TKLA 4W7SA 4QBHA 3OAAD 4BWYA 1J99A 2DYKA 2QN6A 2YOFA 2XNSA 3EA0A 3HPQA 4BASA 1IN5A 1AM4D 2GZAA 2ZI3A 1W2HA 4TZ0A 2YZ2A 1N5LA 1EX6A 4YLGA 2UZ3A 1G7CA 4URXR 4P33A 3TQCA 3BBPA 1Q44A 1JEEA 2IX3A 1G8GA 2UVQA 4A9AA 4H1UA 4WXPA 2JLUA 3I5XA 2VBCA 4LPKA 3CPEA 3SR0A 1JB1A 1JJVA 1Z6XA 2QT0A 4TQUS 5DI3B 5B58C 1XCPA 2ZR7A 2P0EA 2ZE6A 4P0TA 4MDEA 3FE2A 1F60A 3F0TA 4Q1BA 1KYIA 2XZPA 1E2HA 4OHWA 1M7GA 3S1AB 2CK3D 3QKSA 3W90A 1FP7A 2YOGA 2VP2A 5CYOA 1JI0A 1FZQA 2ZRGA 4I1UA 2UKDA 3SQWA 1YJ5A 3QG1A 3ZIAD 1XJ0A 4XD7A 2WWWA 5JWHA 3UWOA 2H18A 1GRRA 5KSPA 5BWMA 2AD5A 1G5RA 3H4MA 3EPLA 1OXVA 2GJAA 4X8OA 2ZS9A 4B6EA 4DXAA 2G88A 1YR7A 2REBA 2GEVA 2QPAA 4MKGA 4LJ8A 1UKVY 3U7FB 2GKSA 2FF7A 3U3OA 5EQTA 1SXJB 1L2TA 3BB4A 3ZZUA 1ESMA 1CXZA 3U4QB 2OESA 1DBSA 1KO8A 1P9RA 3R9XA 5FR1A 4ZCMA 4NYIR 2IEYA 5FI0B 2QMOA 3LX5A 5DYGA 3IIJA 2A5YB 3PEUA 1HUQA 5JJKA 5JMTA 2G9NA 4FMCB 5AJXA 1M6NA 3RRMA 1OH8A 1ZD8A 1MOZA 4POAA 2NTYC 1E0JA 3LDAA 4U5XA 1MRSA 121PA 3WRXC 1GRQA 4TTPA 5CB6A 2D7DA 2ZRLA 3D31A 1OH6A 4JIMA 2WWIA 5L3VA 2ZJZA 3CF0A 2GXUA 2J87A 2V6JA 2AFIE 4UJ3A 1OKKD 1CRQA 3JZAA 3BFXA 3AVXA 1T8TA 2O8CB 1ZNWA 1M7BA 3T1OA 3THWA 2C2HA 4AWXA 1EGAA 4BRWA 3TW8B 4C0HA 1ZC4A 2NQ2C 3VHXA 2EFHB 2WMOB 3NG1A 4D0NA 1U2RA 2OHFA 5J5CA 1TU3A 1XZQA 2OAP1 4DDTA 2YKGA 4GL2A 4YMTA 2RAPA 5CK4A 2JJ8A 2AKAB 1E2FA 2ZAOA 3KL4A 1E2GA 5EP4A 3GP8A 4PAQA 1KNQA 1KIMA 4I99A 3QXSA 1GZSA 3GLGE 1NKSA 4A0HA 3ZQJA 1CKEA 3NWJA 1RFLA 3A1SA 4LCBA 5EE1A 3T5DA 4AYXA 2FU5C 4LHWA 5B57C 3MUFA 4LK2A 1P3JA 4EQ6B 3NEJA 3RWOA 4C0JA 2IS4A 2QUZA 3ND9A 3P26A 2E1RA 4L4UA 2IS1A 2RHDA 5L3QA 3ZVRA 4JT2A 3BWDD 3QKRB 1XU4A 2P3SA 1TQ6A 4V02A 4DT1B 1PVOA 4F4IA 3DOEA 4L9WA 4JLDA 1NY6A 2KB0A 2QMEA 2O8FA 4L9SA 3REFA 3AEZA 2CK3A 4A36A 2IUSA 1T5IA 4CEIA 4FIDA 4NONA 4US0R 2WJVA 1N3BA 1XJCA 3CF6R 1RVDA 3VMFA 3WMEA 3THXA 1VHLA 4MRVA 3ZIAA 4Z1MD 2YWHA 3VQTA 4G5QA 2QEQA 2H5EA 2BCJQ 5FBRB 2ZSBA 4Q00A 3AKDA 1MABA 1UM8A 1JAIA 1IHUA 4A0RA 3CRQA 4D6PA 3I5YA 1N5KA 1SKYE 2WWHA 3ZDQA 4E03A 1G3QA 1YZNA 4RFSB 1WMSA 1E1QD 2VP9A 1M7HA 4LBWA 2ODNA 3W3AA 2G77B 1KI7A 3W5IA 2NGRA 2CL0X 2HJVA 2ZQ5A 5GJBA 4TLCA 3PXGA 1SVKA 2FH5B 2NPIA 1E2IA 3EC2A 2B7BA 1ZD9A 3NHBA 1R0ZA 1XJQA 4TQAA 2W6ID 2X77A 4FMDB 2X2EA 5A0FA 3RWMB 1P2VA 1IXZA 3E70C 1Z2CA 1S96A 4HLUA 2FN4A 4PC6A 4ZI2A 3ZVMA 1AKEA 2ZRNA 4IDOA 5EE9A 5SZIA 1D2NA 2OXCA 2BCGY 2F55A 1Z3IX 2QNRA 4TYQA 4DLSA 4QOSA 3FKSD 5EUMA 2FG5A 1WA5A 3Q72A 1P9NA 4Q1AA 5HKKD 2O5VA 1KK1A 1D5CA 2CJWA 2XXAB 1OKKA 2OFXA 4MGYR 2BEKA 1Y63A 1CJUC 1DOAA 1ZP6A 2EFGA 1YZGA 3R7WA 3CO5A 4JLVA 4C2TA 3DHWC 4KYIB 4PQFA 3GLHB 1M8PA 5FI1B 5AK0A 3T34A 3WYFA 1DAEA 4Q47A 1ZYUA 2DHRA 1E2QA 2OO7A 3LNCA 5LPNA 2FFQA 3NBXX 3I61A 3LLUA 5HE8A 3CX8A 4YDSA 3RRYA 3U44A 4ABYA 1F2UB 2HF9A 2ZUDA 2O0HA 4WAUA 2ZJAA 1R8QA 1DADA 1G64A 1N0WA 2ZE5A 3SJBA 1XEWX 3RAPR 1GG2A 1XD9A 4D80A 3SZRA 5GJWC 1TF7A 4F7WA 1Z07A 1JR3D 1IN8A 5DIFA 2GCOB 5E7IA 1FNNA 4M22A 2RGBA 1OXUA 2D7CA 1C4OA 1LW7A 3FOZA 5JRZA 1W2GA 1ZMXA 1EXMA 3PEWA 2D06A 2G1JA 5KPJA 1LNZA 2QP3A 1GNPA 1M34E 1UEJA 2FMXA 3GJ4A 2IXEA 3TSOA 5KYKA 4XVRA 1ZUHA 1XRJA 4BEJA 1A1VA 4R71A 4QJ3A 4F91B 4ZDIA 4R2HA 3V4RA 5E7MA 5AR1A 4GMXA 3K0CA 2WWGA 1N6OA 2SHKA 1AS2A 1S1MA 3B13B 4WXRA 5G53C 1VHTA 4Z1MA 1VYVA 2F3RA 1R10A 5H68A 2QTVB 4C0SA 1VG9B 3DMNA 2C8VA 2WWXA 4BPBA 2IL1A 1OV4A 1QRAA 1NBMD 2ZI4A 2Q9CA 3WP0A 3ZH9B 4DZZA 4FD2A 1DEKA 4D25A 3RS0A 3GLFB 2ZI7A 1EG7A 1TQ2A 3B6EA 1XTIA 3I72A 4HLDA 1H8EA 5HTKA 1OFUX 1XTQA 1XTJA 1JEDA 4EFNA 2ZITA 4D0GA 4EIWA 3W6NA 1TL7C 1SXJA 2BMFA 2W6IA 1F5NA 1E2MA 1P72A 3ETLA 1KTVA 3NH6A 1HH4A 5F9FA 4YXWD 1N5IA 2FE4A 4MDFA 1Z6AA 2OFOA 2PZFA 3IKJA 4Y0AA 3KB1A 3IEUA 1GSIA 2IUUA 4US2R 2ZRDA 4HSEA 3A1TA 1HT1E 1OH7A 2WZQA 2P65A 4LYHA 4JYCA 5HKKA 4FMCF 4M9QA 3HR8A 1W47A 2GK6A 2J46A 3CPJB 1DAMA 1AGPA 1ELOA 4LJ9A 2Q9AA 5JSZA 3ADBA 4M1YA 1BYUA 2G0TA 2W6JD 4OI2A 2OBLA 2ZE7A 3C5HA 3TUIC 2H7VA 4PFSA 4C4PA 3MWJA 4QBIA 4RY2A 3TSZA 1HEIA 3B9PA 3V00A 5IHPA 2FNAA 2CCKA 1DE0A 1IOZA 4Q4JB 1NG9A 2WJGA 4UQOA 3X1XA 2Z5FA 3LBHA 2AHOA 3ICQB 1JPJA 2HCBA 2WM9B 3GJ7A 4DDUA 1FUUA 3IPXA 3OHMA 4S2EA 4PSAA 2C03A 1LVGA 3UMRA 3G5UA 3MJHA 4EPTA 4RFVA 1JR3A 2IYSA 2D4HA 4LZZA 4CVNA 4B48A 3KB2A 5H8WA 1WBDA 1UAAA 3E5HA 2JEOA 4ASUA 1M2OB 2CE7A 1AQUA 4JS0A 2REXB 2B8TA 1KJZA 3UG7A 1CEEA 1G18A 2A30A 2FSGA 2VHTA 4IJMA 4BLPA 4EPYA 3H84A 3TK1A 2BKUA 4C0KA 2ZJ5A 2GCPA 4JJZA 4DLZA 3SQXA 2A5GA 2XITA 1II9A 3OFND 4E22A 5EJEA 1UJ2A 4IOKA 3VAAA 1VCMA 4EQ6A 2WWYA 4C2UA 4I1SA 3U7HB 2W00A 2BBSA 4AC9A 1HQCA 2ODWA 3T06B 3MSXA 1GL7A 1JNYA 3K9LA 1S9DA 3PUWA 4KXFB 3QKRA 3RC3A 5KPDA 4OQLA 3C5CA 4H9GA 3VKWA 5EUQB 4DT1A 1JPNA 2ATVA 4BFYA 2R6FA 2ZRAA 3VNVA 5FL3A 3CZPA 4C0QC 2IF2A 5IDVA 1EFRD 1VG0B 4AY2A 4URUR 1NP6A 2WVJA 1NBMA 1NIJA 3B1WA 1FX0A 4BFUA 3K09C 3T15A 1Q0UA 3CIOA 3B1VA 4DLRA 3U7EB 1G8FA 3ZS8A 3B82A 4KVGA 2HV8A 1NJFA 3LV8A 3PCRB 1E2JA 3ZVLA 1K5DA 5EZ5A 2H8KA 3QEOA 4JVSB 1XMSA 4I1VA 2AN9A 2ZJYA 4PAMA 3WY9A 3LAWA 2C95A 3B1ZA 2HF8A 4RFSA 3SFVA 4MYCA 3CUEF 4PC2A 2NPFA 4ZIRB 4DWJA 1AA9A 3DZDA 1L7VC 3P4XA 3UIEA 1XB2A 3BGWA 4D26A 2ZSAA 3IDQA 2XSZD 5DYIA 1CIPA 2BM0A 4UXHA 1D2MA 1KK2A 2VHCA 2BMDA 4TMXA 2OBMA 1XZPA 1NN5A 4LOAA 3X1YA 4IVRA 3VU9B 2FEMA 4Z8XA 2GCNA 2W6JA 2W2TA 3NC0C 4Y0VA 2GEUA 4HAWA 1KI3A 4TTQA 2CCJA 3MAAC 2RGAA 2GVDC 2XXAA 1R0WA 3U6BA 2J1LA 4QGFA 3A58B 1EFTA 1DAFA 2A7QA 2PCJA 3GD7A 1NI3A 2FFBA 3GEIA 3RS4A 2QE7D 2CHQA 2YOHA 2GK7A 3JVUA 2AX4A 3QKTA 3GLHA 4JT4A 5FL7D 4BRUA 4HYYA 4YMSA 3MG9A 4TSFA 1QF9A 4NE2A 2QGZA 1N2CE 1MKYA 1Z0KA 3CNOA 1WB9A 821PA 1F2UA 3ZGXA 1NMXA 4PO1A 4X8LA 4MQBA 3BXZA 1KY3A 3AVWA 1N0UA 4RD2A 3AGQA 4TL9A 4OHZA 4M2LA 3BC1A 4K8OA 1KDOA 5JS8A 4PQRA 3FGNA 1YZUA 4LBYA 4OQNA 5FBWB 2PLFA 1OHHD 4RCZA 3WNBA 1W4RA 2GCOA 4LRWA 2I1VB 5FUWA 5LB2A 3LXRA 1XPOA 2OV2A 3AKYA 2FEOA 1A2KC 1U0LA 3GJ3A 4IKEA 2Z6VA 1GWNA 2RCNA 4B2PA 1V43A 4OL0A 4HEJA 3TUJC 1CJTC 1GNRA 1Q1BA 4Q9HA 3O8RA 4F92B 4BQSA 1E9AA 3OF5A 2PCLA 2ZETA 4B71A 1S0UA 2TMKA 3P1JA 3EWAA 5FTKA 4GSYA 2GDJA 4Q66C 5K8TA 4WOPA 4KJZA 2ZE8A 4U02A 3UATA 1P61B 4AI6A 3PV0A 4Q1DA 1DAGA 4XSGA 3QXHA 3GJ5A 2OT3B 1E6CA 1SULA 3F5FA 3MLEA 5JI2E 3VKHA 1Z5ZA 3TRFA 2C5LA 2JJ1D 3OESA 4K46A 4KFSA 3QG5A 4BFXA 5AJVB 3GLFA 3SYNA 2GBLC 3B8HA 1ZCBA 4QHSA 4FCWA 4IOJA 3LX8A 3QIAA 4M4SA 2NG1A 5TXGA 4Z51A 5L3SB 4IHQA 1N6IA 2UZIR 5SZJA 3W8NA 1KY2A 2R44A 3CM0A 1IN6A 1FQKA 2OZEA 2J0UB 3D6TB 4GFDA 2Q6TA 1UKYA 1GKIA 2WHXA 5KSZA 4WVFA 2OG2A 5FOVA 2Z43A 2IYYA 1Q12A 2ZR0A 1Q20A 4LJ4A 3ZZ0A 4LUCA 1NRJB 1EWRA 4DSNA 1D2EA 5AJYA 5FPSA 2ZI6A 1WDTA 2VPPA 3A4NA 2VQSA 3WYAA 4ESHA 1A5TA 3UKDA 2QRNA
chains in the Genus database with same CATH superfamily
4TQGA 3NANA 1B0PA 1SEPA 2C92A 2DTEA 2IZ6A 1P1RA 2ODPA 4OI4A 4PLWA 1PFGA 1TMYA 3L6OO 4GX2A 4HLCA 3R5TA 2QKYA 1U4SA 3V2UA 4BMSA 2BBTA 4E14A 2ZEJA 2I1WA 3ORRA 1N5DA 4G86A 3U7QA 1J5EB 1INLA 3EW7A 2W2QA 3AXSA 1HFJA 2FB9A 4J03A 3VO1A 3TL3A 3O74A 1A4IA 3FHTA 3FWYA 1Q1ZA 3QOYA 4QDOA 4IV0A 4XSHA 3WL8A 5C5DA 2PKXA 5EXDA 4TV8F 3ZDRA 1IBKB 2OLKA 2RGWA 3GZJA 3KKQA 4EO4A 5AVWA 4IIHA 1C2YA 4FT4A 1O4WA 2CUZA 3D02A 1Z2PX 4K87A 5A0TA 1OFVA 4LV5B 4AZ0A 5KX5A 1FFHA 1E4YA 4A3SA 1H0RA 3EA4A 1KQPA 1IUOA 4WOKA 4DL9A 1UDAA 2JF0A 3DUFB 3ENNA 4J29A 4MR9B 4EG0A 1G3UA 3GFQA 1QTQA 2JAHA 2X8JB 3TXXA 3E9QA 1EESA 2HEGA 3F4KA 3V8PA 1E66A 3Q3CA 2BFBA 4KSCA 2XCUA 2I8LA 2CHEA 1RE0A 2DUWA 3QXJA 3PYLA 1WV0A 1TZBA 3BWYA 4RQAA 4BE4A 3KZ1E 4JC8A 3SHTA 2XZDA 3IR6A 4RELA 5D6OA 5THKA 1N9GA 4P83A 4OI1A 3ZY3A 1XMVA 3FNHA 5IHXA 2AOXA 4BKQA 2W2KA 3ZLVA 1WDKA 5JRDS 1GRVA 4HTFB 5IVHA 3OZFA 3OPYA 2IT1A 1IM2A 3WYGA 1Z0UA 3RVRA 3QOFA 2K2QB 4TTAA 5AICA 1PP4A 3W34A 4L0DA 4YV1A 1R5NA 2PEZA 4F8JA 5IKPA 5K8LA 1ISGA 2XUDA 5AP9A 1KI9A 3UA4A 3JRNA 4QDKA 3TLZA 5HBRA 1XOIA 1V1RB 4INJA 4A1OA 1BOFA 5I7FA 5J4YA 2ZZMA 2ZYIA 3K15A 3QKUA 5ALVA 2IEZA 4N5NA 3UXEA 2WTNA 4RGYA 2B2CA 1SVOA 2Q29A 2HQRA 4M46A 2YNMC 3OQBA 2NSLA 4I66A 4YRAA 1O87A 3KXKA 1Y3IA 4L2IA 3GUUA 4FWIB 1XZDA 1A8QA 2ZOSA 3TR0A 2VDNB 2F1IA 4DLPA 1TVKB 4OREX 2O8EA 3K0HA 1KEWA 4GXRA 3I6YA 4D9HA 5LKRA 1MIOA 4TTRA 1KJNA 1DJLA 1MT3A 4ZHQB 2VYND 1KOFA 1P7PA 2QRGA 3K8OE 2JDIA 3FB1A 4MVJI 1PNTA 1ZDMA 5EMMA 4M86A 2HDHA 1V8FA 4LYAA 3VU9A 2LCFA 4MW9A 5LMCA 1AF7A 1R64A 2A9FA 4P3YA 3RVLA 3EVGA 5I7RA 1ZD1A 4WLUA 4L22A 3QGMA 5KHOC 3OEED 3GJ8A 4YRIA 4JQCA 4S0ZA 3W2TA 4UCQA 1TLFA 4L27A 5K3OA 2DETA 3SQDA 5FI5A 3BTSA 4RJIA 5GQSA 3VO2A 4B4WA 4D4IA 1Y6ZA 3ORHA 3VR3D 1C1YA 1V71A 3SMQA 2QLMA 1YR1A 3H3FA 5JYDA 4IXTA 4MW0A 1PBTA 3HNOA 4QFDA 3TBHA 1U8ZA 1IE3A 2C4UA 2GEBA 3K0EA 2ZZNA 4S0XA 4KGDA 1VDMA 2O8DB 3ZLTA 3QPAA 3MERA 3SSNA 3V1UA 1QF6A 4W5OA 1ENOA 1QB8A 2AYZA 3E1SA 3RKUA 1NFQA 4KR3A 4IJUA 1NM5C 2PEYA 2IYLD 1VIMA 1XTRA 3DKVA 3ZDZB 3KETA 1EIWA 3OWOA 3OIVA 4INPA 2QAGC 1CWUA 2AQKA 1O7JA 1GPDG 3JQBA 1CR4A 2QJRA 3T5MA 5ALLA 1BFUA 3KLPX 2MDTA 1SBHA 3IEKA 4I9NA 4DA4A 4D0LB 1WUIS 4LYGA 4UDOA 4V0QA 3AETB 1A82A 3HWSA 5AIAA 3AVPA 3GFVA 3TCKA 5C32A 5AW7A 2GOYA 3QENA 4WY2A 2WUVA 4WZAE 4DNOA 1A7KA 3GGJA 3D7LA 3ITKA 5AO9A 4KK4A 2WOJA 5E2BA 4BMDA 2YW2A 2FYTA 3ZBTA 1DV1A 1OMOA 1QH0A 3L6CA 4M9XA 1L5LA 3SIWA 1D03A 2J0SA 1QQBA 5JFGA 3N7AA 4NI5A 2E0IA 5BSKA 1KOGA 2SKDA 2GZHA 3B8EA 4J0KA 4Q3EA 3K9BA 4V0ME 4UCFA 1EK2A 1EFAA 2H2IA 1L4NA 5JH7F 4MIKA 4L0MA 4CV0A 3KYDB 4PXAA 3AUAA 2G80A 2OC9A 3AONB 2LGJA 3OZGA 1IM5A 1B4DA 4A2QA 1PT6A 3HJNA 3KKMA 3WMWA 4JI3B 3ZCRA 4D3XA 3O93A 3LGSA 2BFEB 1KAMA 3HY6A 4QNMA 4B4KA 5I7SA 4LF5B 5JJLA 2YV4A 3MFYA 5T8KC 3I5AA 2DJ5A 3U3DA 4K9RA 3DAPA 2KBEA 5ERYA 3LK6A 2ZSKA 4LMAA 1HT2E 1Z6YA 3TLEA 1QGUA 2W43A 1GAWA 3KAPA 3L5KA 1Z6ZA 3K0BA 3FDXA 3NDPA 5KOJA 1NOKA 1ABEA 5H16A 5HBGA 4EW2A 1N0VC 5GJCA 4YUXA 2ESRA 1Z63A 4Q9IA 4DC9A 1SCUB 3ZHRA 4QDJA 5JR3A 1EFUA 1Z0ZA 4YAJA 1NLMA 3BB3A 3QVVA 2XBLA 4YQEA 3EXHC 2QD4A 3K09A 4CKCA 2GN0A 3V80A 4ND8B 1ACLA 4E5YA 1T5TA 4EI9A 5FBLB 4EVSA 4FFOA 1EX9A 2Q6VA 3DL0A 4PWZA 1TJYA 1MT0A 2ACVA 2PRIA 2Q3CA 1J5PA 3C7AA 1TXGA 2OGWA 1IH8A 4B44A 2JFUA 2KI5A 3QNMA 2VSFA 4HF7A 4OH1A 3D8UA 5I3CA 1R4NA 4KK3A 2VZ8A 3UKJA 2EFJA 3AY6A 5BWCA 1FFGA 4Q3DA 1KZ4A 4TL8A 3KJGA 5UKDA 3ROXA 2HGSA 3A6EA 4BN0A 4DZRA 3VJMA 3SS9X 4LGMA 4YCMA 2PH1A 3HLYA 4WZBA 3WK7A 4NCXA 4TWBA 2PK3A 2HK6A 3OOHA 5F5LA 3C1OA 3ZHQA 2PKQP 4XWKA 5MGBA 1ZJWA 4P8RA 2AL7A 3G2MA 5BW4A 2W37A 2YYYA 4NDNE 2B8JA 2HWXA 2PS0A 2BGLA 1P1IA 1E2EA 1XCBA 2IPNA 1R15A 1EP2B 4KXQA 1CS0B 5FB3A 2WHPB 1Y1SA 1M2WA 1PLKA 1QV9A 4RM3A 1L7PA 3DXXA 3L4KA 2PUAA 4Q3KA 1K6XA 1NX9A 2OENG 1BMQA 3DMYA 4JC5A 2V4ZA 6ADHA 3WJ1A 1HFEL 2CVFA 1NLFA 3ACBA 5IFKA 5LOVF 1J0AA 3AG6A 4G5HA 2I76A 5ARDA 4B4VA 4RTLA 4TYNA 1SB9A 2VQEB 2DJIA 2Q49A 1KBQA 2O3TA 1K68A 1V5EA 1FUKA 4RV4A 1U80A 4NQZA 4CL3A 1Z2AA 2R8RA 2RDMA 2YJZA 3I2YX 4QSHA 1RPTA 5EG5A 2G5PA 3WA7A 1U28A 3OO0A 1I5EA 4L07A 1KSGA 2RHGB 3DUFA 3PFWO 1ZFNA 5BYAA 1KQ3A 1EG2A 5L8VA 2GPBA 1JUDA 1RPAA 3AWDA 4QXOA 4WD3A 5LXTF 4B6QA 4HLQB 2YIVX 1M34A 3CUVA 1G5QA 2ROQA 2WF9A 2WINI 4LQCA 1H65A 3CNNA 4DIBA 1XWIA 3KAKA 3B2NA 3KSZO 1Y4AE 3DM9B 4NBLA 4YJDA 1EMDA 4DHEA 4V1CI 3UHOA 2A9VA 3JD4A 3BD9A 3CLUC 1VE7A 2QI9F 4G36A 5EAIA 3PL1A 3JQEA 1D6MA 1U99A 3BS4A 2DBYA 4Q12A 3VKUA 3ERCA 2K5UA 2RCYA 3BRWD 2DZDA 1I7DA 3T0FA 2ZG6A 1Q2UA 4G9EA 1KFKB 1XNHA 1LXCA 3ECCA 3KZCA 3T35A 2JLYA 1AO0A 2PRKA 4BNZA 3DLHA 3NLLA 3CVVA 5BP7A 3UAXA 4AX8A 1PJQA 2FEPA 2PZAA 4IIJB 1TQHA 1D2CA 3FLBA 1WQ3A 3QEMB 3VR2D 5J2UB 1JPUA 4J8PA 3I9OA 2ECFA 3R3YA 1Q84A 4Q7JB 4KOEC 3T38A 1EM6A 2JZOA 2BVNA 3NKFA 1V1RA 3QVUA 3GVIA 4G0XA 4B8WA 2QTTA 4NBRA 1CD5A 1NN1A 2F1RA 3QU2A 4FNGA 2NU9B 4EKEA 2IPOA 1A7JA 4GPBA 1EINA 5JATA 2XOEA 5FHQA 3K9CA 4GZ3A 3K0KA 4DR7B 1P91A 3F3MA 4XGIA 3OEHD 2VDKB 2WAOA 4WFJA 4QUJA 1O9BA 1XNJA 1JJFA 3CXUA 1GVNB 1DFIA 1G41A 2IXAA 4FFDA 4ZYZA 4HDNA 4Y6LA 1G3MA 1G8YA 1E79D 1GFIA 3I09A 2RH8A 2PMBA 3AR8A 2FKNA 3I9LA 4II2A 3C6YA 4NCJA 3E15A 3ELDA 3N0WA 1VYTA 4ZHQA 2WD7B 3KJEA 4HKTA 2VFAA 4RMNA 4H18A 3C8UA 1UMDB 3DKIA 4I1YA 3WQHA 3O84A 3QV1A 5DCLA 5DKFA 1T4MA 5B36A 4B73A 3BHNA 4OU4A 1RJDA 3PENA 4MIEA 2ISSD 4JUIA 1BEUB 4N01A 3EWSA 3S2ZA 5BN5A 1DG1G 3CUTA 3MCTA 5TJHA 5AVQA 2B7CA 5J59A 1RJ9A 1J6UA 1HZJA 1TZJA 4CG0A 4ZT6A 2XZLA 1R4AA 1UM9B 3SQMA 4DSTA 5JAHA 2JAOA 1TIKA 2YZGA 2JFBA 4HADA 1UEIA 2KM1A 2O8DA 5JDIC 1P75A 2GBCA 1YRWA 4ILKA 3NTQA 4ZJPA 3M34A 3P0JA 1C7QA 3L7OA 5FFNA 3CXRA 2IUEA 5D84A 4LHSA 1X7GA 1N1EA 5B3JA 3S0JA 3QX3A 3LUCA 3OJ0A 3F1LA 4NE7A 5FOXA 4GYKA 4CFSA 3UV7A 3HA3A 3LBAA 3QNUA 4UHDA 1Q3KA 1S3GA 4H7JA 2CD7A 1QZ3A 3R8XA 5B3AA 4M1TA 1R6XA 3EHEA 4GR9A 1NG1A 2C42A 3UGQA 2NU7A 4D4JA 3PPIA 3FUVA 4HAVA 3BXPA 4JP2A 2RFLA 1HLGA 4B3SB 1QO7A 2QORA 1XCJA 5A4KA 2WSYB 4FS3A 4BRSA 3M81A 4R3WA 2Y76A 3MIZA 5HRAA 3JAKB 4DA8A 5CH5A 3FZGA 1V35A 3UMJA 3HKDA 3KC2A 3RROA 3T9CA 1RKQA 1JE1A 3H5WA 4TROA 4ZP1A 3KT0A 1MXFA 5THXA 1L3IA 5J5VA 2EG5A 1Y4ZA 4BO2A 2MINB 2MSCB 2ZDQA 5KNBD 5LYYA 4BFSA 1MU0A 4S35A 5C18A 2GPSA 1UWKA 1GEGA 2VAWA 4YAIA 3KYDA 3N2EA 4Z86A 3Q8WA 4FX5A 4IO1A 5ES3A 5C1DA 4LJ6A 1FRVA 2A92A 2P35A 5FBVB 4DMHA 2GO7A 1RXSA 3KQWA 2P78A 4MLDA 4L6CA 5EPUA 4WBNF 5IFLA 2GNOA 5L7TA 2JBHA 1XE3A 2IQ5A 5BWOA 3TQTA 3PEVA 3UBMA 3STYA 3OX3A 2CV0A 4CUKA 3MCWA 2A1TS 1UPUA 5JG7A 2VUTA 1N2XA 3A9SA 3C4JA 4FGUA 4FI3F 2QUIA 2C4HA 2IZ0A 2BMEA 1I7LA 2HU7A 4HGPA 4HOYA 1Q1GA 3SSAA 4R98A 4TQ9A 1BE0A 1TUBB 3ZX4A 1CR0A 1UFVA 2X4DA 3JWJA 4TPKA 3K9FC 3KOOA 4I4NA 3WLLA 5DTIA 1NW9B 1SCUA 1FVHA 2GCIA 3KX2A 2UXBB 1YZQA 2QR3A 4QDUA 3PA6A 1NF2A 3DB2A 2BFCA 5LWHA 3UJ3X 4RZ2A 4ND8A 5AJHA 3RS3A 2I29A 3TIIA 3TS1A 4IDPA 4P7BA 2HJGA 3OM1A 4CKZA 2OILA 4R81A 5ECDA 4MAFA 4ED9A 2H52A 4HEA1 2G67A 4M9ZA 2I80A 5KDLA 2RC5A 3NTLA 4WKOA 1G2QA 1TIBA 1G7SA 2H29A 4MQ5A 4YIKA 1PJRA 4YVFA 3AB3A 1N2ZA 2LKCA 2QSZA 2XDYA 2RAUA 3B1FA 3G82C 3NASA 4KHZA 5TS2A 3CRRA 2XE4A 3HO6A 4YJ2F 4EYOA 3PB3A 5CFRA 4ER3A 5CUQA 1RXIA 4DTIA 3A7DA 3G0DA 3HDGA 2BTOA 2VPQA 2P67A 4YTEA 1F48A 2UUAB 1VYUA 4JEMA 5AESA 1JIQA 2YJ5A 3NM4A 1L8OA 4W6ZA 3E7XA 1KQNA 3HB9A 3OIDA 1AK1A 2X0IA 4JA2A 2G82A 1KZ7B 3AFGA 1L9KA 2ACKA 4LZAA 4PSKA 1PYOA 3TJRA 1DB3A 3PHJA 4DA7A 3L7IA 4RE6A 5ICCA 5JMWA 3GH1A 1TZCA 3OKCA 5KJCA 2PAAA 1ZRHA 4LSZA 1CS0A 4RDIA 2WHPA 4KGZA 3SDZA 13PKA 5C4MA 3ULKA 3SEZA 2B8EA 3BTVA 1EBUA 1ZS9A 3IP5A 4E7PA 3QLJA 4XIGS 2MMGA 2X58A 4HWRA 4FGWA 1JI3A 4RD2A 1KIAA 3IQHX 3TGWA 4K6FA 4DCMA 3A1FA 4OYYA 2O2CA 2XR1A 2Z4RA 1UBTS 2VYFA 4UAGA 4TVOA 3CJTA 2ZIZA 1C7FA 3CT4A 4GOXA 3ZLUA 2Q6KA 3C7CB 2HMYB 4ZCRA 2EKPA 2BMJA 5JROA 4HDQB 2X7HA 4K6CA 4QPCA 1GUAA 3PSHA 1N5JA 1S9HA 4E70A 1QHEA 2NO5A 1UXHA 5H3LA 3TI7A 4JI1B 4BPRA 2NTJA 1A8PA 1CY1A 5LQSA 2NIPA 4TRNA 3DEJA 2NN3C 5TC4A 2R1ZA 3KAQA 1MO6A 3NYRA 1ZR2A 4F60A 1ZR4A 2AXPA 2C20A 4MPTA 1J7JA 4PGMA 1JIIA 5B64A 1H8HA 1QBGA 1DXQA 4FMDF 4QFMA 3FA2A 3WK6A 5KKCA 3PFCA 1QOQB 4IG9A 4XJVA 3NYIA 3RTAA 2F9LA 1J7KA 3CZ4A 1W52X 4H4EA 5C1PA 1OGIA 3PNMA 1ZK0A 4L28A 4BP1A 4BO7A 4BZPA 2R65A 3VNAA 1KRWA 3RH0A 4AM8A 5KU1A 4HMQA 2Q5OA 4Y2SA 3PZBA 1U3VA 1K06A 1KWKA 1EXNA 4N6GA 4RK4A 1GXSB 2F62A 4JB0A 4DR6B 1GQRA 4IIJA 4LDRA 1AQJA 2G36A 1CZKA 2QZ4A 1W5TA 3SX2A 3D8NA 5HUJA 3QEMA 3JYNA 4DPMA 4E5KA 2EW1A 3MWEB 1MQ8B 1YZKA 5DSZA 4CNBA 5J2UA 4F04A 2AMYA 2V7QD 3A70A 1HG1A 2G63A 3IRUA 4MRAA 2VT6A 2IYAA 3AERA 3AW8A 2C54A 3CLUD 3L40A 2NU9A 4KACA 2YVLA 1DXHA 1F6BA 4X1YB 1HDCA 2F8MA 3SF0A 2L18A 2AJCA 4KQ1A 1G4HA 2DAPA 5IYZB 2F17A 1EDBA 4DV5B 5B1DA 1QK3A 5JTTA 2VF5X 2JAWA 3LVBA 4NAHA 3GLGB 1T26A 2GZRA 3LTNC 1ZCAA 4DDKA 1QCCA 2WD7A 3DXFA 4G65A 1A50B 1UEXC 3Q1LA 3RWBA 2HAEA 2RGRA 4MCJA 4J1NA 2XCOA 2ZBFA 3C4QA 4KXVA 5F78A 4HNAA 1NVEA 3LUAA 4FDUA 1SFRA 3A26A 5TEWA 2AXNA 1QIHA 4L4YA 1XTPA 1JFLA 1GGEA 1JALA 1Q1AA 3F90A 4K6KA 4DV4B 4TMTA 4ESVA 2IGBA 3T9BA 4B43A 3N07A 3C3PA 1TJ5A 4DUPA 4URHA 5FHRA 1F2TB 5EHXA 1ODKA 4ISBA 2CB9A 2JANA 2ZSHA 3ZHVA 1UM9A 5FLKA 1TMGE 3LSTA 1DJOA 4HATA 3A11A 4L5YA 5DHPA 4C3ZA 2VEOA 4E2WA 5ANRB 2J7KA 4ON9A 4YUZA 3LL4A 1KI6B 3FKJA 4RLSA 4URFA 5JSUA 1TA0A 3CWZA 4QGGA 5CNIA 3D8TA 1I4EB 1WUHS 4G23A 1EE2A 2REOA 2V96A 1V7QA 2RGXA 4WLNA 4ZAWA 4F38A 2QBYB 5IBRA 2WFMA 4C29A 3GAZA 1K66A 4RMIA 5EJ7A 4OYRA 2HPHA 2MIIA 4C3UA 4BUJA 2B82A 2QVCA 4G5YA 4N3CA 4BLQA 3RUHA 3KPUA 2XA1A 1CUGA 3KJXA 4WY5A 5TGZA 1P2TA 5CB4F 1W0CA 3HYNA 3NWEA 5ULLA 2MT9A 4YN3A 1Y9EA 3TNLA 1AKMA 1DEAA 3FI9A 3I04A 1E8DA 3NUZA 4DIDA 4MKFA 4KIUA 4L78A 2E1PA 2XUIA 5AUQA 3IULA 5EOVA 4BQRA 3SY8A 2WIGA 3IS3A 4FM9A 1L5OA 2WG1A 5KYVA 2XWQA 4JX8A 1P7CA 2FZLA 3GLHE 4JUDX 1RRPA 4ARBA 5CJ2A 5CNKA 1DRKA 2EJTA 3WXMA 3OQNA 2E85A 4BFTA 1MB4A 2GAJA 2ICAA 2P5UA 2ZTLA 4QPPA 3FMOB 3IQXA 3WO1A 1JU9A 3OZXA 2P9TA 2WLSA 4BKPA 3HU5A 2FUNB 1LDYA 3RFUA 5FL7A 5EXTA 2P4HX 1NAIA 1IY9A 2VTKA 4PLHA 4JMPA 1KDYA 1XEXB 4CETA 2ZVJA 1BWPA 1PR0A 2GARA 2YS6A 3WGYA 4XLZA 2C3OA 3DHNA 1E2PA 1KI2A 2IQIA 4GD3Q 3UXYA 3WVNA 2PGNA 1NV9A 2RJ3A 3L1VA 4CT4B 1K9SA 3R6DA 4QPZA 4CHGA 1TUBA 2B3TA 3QELA 1M2FA 3EUAA 1EQ2A 3GR6A 1Y3DE 1KO4A 3JD3A 5BPHA 4PQGA 2PUHA 1G8HA 4V0SA 2C0CA 5SZHB 1U2SA 3NHLA 1OBOA 1GHTA 1IJBA 3V7FA 1DAHA 1YCHA 4FYWA 2XUZA 3H2JA 4TUYB 2A9RA 4B7CA 4OJQA 3NHAA 5JW6A 4TLMB 1VMKA 3FYHA 3T5TA 3U16A 4K28A 4QTTB 4JBWA 1VSBA 3FGZA 4X84A 2Z56A 1O2DA 3ZS9A 3TQRA 3O1JC 5AVXA 2WBLC 4N4AA 4OFZA 1OLUB 5LJIA 2R3SA 4Z7QB 1T8PA 1T9HA 4MA4A 1Z4PX 2PKEA 4YYEA 4GG1A 4U4AA 3M4XA 4AFNA 3AUUA 3PXBA 3RODA 1D9ZA 2VL7A 2XQVA 3H1AA 1E9VA 2VF7A 3OLWA 3HRKA 1TGVA 1URPA 2LE0A 3OM8A 4ZZ3A 1FFEA 1I9CA 1K5HA 1Q6ZA 4NG4A 4LW8A 4P31A 5K6AA 1ZCZA 2PRJA 4Z53A 4RJLA 2XMQA 3OZAA 1UFRA 1ULZA 1Z26A 3VOAA 4I5DA 4OQ4A 2QN9A 3NYQA 3OJFA 4M76B 2DFDA 1ZJ6A 4D0RA 2ZGVA 3IUSA 3MGAA 5CIQA 4II7A 1YC2A 2GKGA 3DJYA 1IPEA 3FPFA 4BVKA 4EKYA 5B2EA 2W2OA 3H8SA 4DIOA 1W0KD 4EZEA 5HRCA 5IULC 1Z47A 5KZMB 2M1ZA 5DF1A 5EKDA 2F9MA 2DB3A 4EYGA 3AF2A 2N1MA 3EW9A 2NNWB 3WL3A 3AI7A 5K4GA 5KQMA 1ZAKA 3EX7C 4P38A 4P98A 4BBZA 5J4VA 1PX2A 1E94E 2Q3FA 3P19A 5K7SA 3QYJA 3KQUA 4NU0A 3ZNPA 1C9EA 4L5BA 5JNTA 5LFAA 1QP7A 4XQCA 2VS1A 5FOSA 4LHVA 4UAUA 4YJHB 3KDAA 4I4TF 2JGRA 2IY9A 2BIFA 2IDMA 1EBFA 1VG8A 5EP3A 4MVJE 3KVRA 5AOAA 4OB6A 3HI4A 2W58A 1IEWA 2PJDA 3HGMA 3G0OA 4G1MB 4G56A 4UE3S 1U6KA 2VAMA 3FMPB 3EBOA 1NUTA 3PWTA 1NZDA 1UKAA 3LFHA 1NVWQ 3PVSA 3CVUA 2PY6A 2QA5A 2MSNA 1EFLA 1ZRMA 1BD4A 3DXYA 3EMKA 3BIJA 1RWXA 1UXOA 2CNBA 3KZVA 3LLMA 4GOJA 1KYYA 1AIPA 1TNDA 2BHRA 3H65A 2XMPA 1QZTA 3RTDA 4OQXA 1FS4A 4RAQA 3A3NA 3KQKA 2O3RA 1SRQA 2VDVE 4JB2A 3SZGA 1EEXB 4N65A 4NCIA 3RABA 2C8KA 2NVUA 3AO0B 4B3TB 2QPLA 2X9QA 1BMFA 2VAXA 1YK0A 2IXFA 3G5TA 1RI5A 1L8XA 2B6HA 2C4MA 3U7IA 2W83A 3KFXA 4OHVA 1WLYA 2I3ZA 2NO1A 3W1VA 5IWCA 5IM4F 1HYBA 2PFGA 1JMYA 1TC1A 3P9IA 3FETA 1WRBA 2Z04A 5EXXA 3DOUA 1UJCA 3HKEB 2IEBA 5ALXA 1FUIA 4J1TA 5GGYA 3VVBA 1HDRA 4DR2B 5JADA 1KIFA 4IUBS 4QTUB 4DG5A 1UXIA 3QKWA 2DECA 5F1KA 5BRNA 1FMTA 2GN1A 1GTL1 1YZVA 4YO8A 3TIFA 2IOFK 2R5NA 3BL8A 5C8DA 3L0CA 3GWGA 3N39C 4X1YA 1ZXLA 1GPKA 2QD3A 1OFTA 5ITZB 2IYWA 4LC9A 1LB1B 3W5AA 1OLOA 2FWJA 4MYUA 4PC3A 5IYZA 1T5LA 2Q5JA 2PMEA 4TYYA 1FP2A 1I3KA 2IEAA 3TL6A 1HE2A 3Q5DA 2IHYA 3ZE1B 5E6UB 1L5SA 1O58A 4IFBA 3GGSA 4E21A 2P6UA 3N2YA 4AVYA 4BAZA 4DV7B 2I9KA 4PGAA 1LY1A 3IIKA 1ZJ4A 1EI9A 4UUBA 2B4AA 2NVOA 3ABIA 4WT7A 1PD0A 2EBFX 1KK3A 4KSBA 1T1IA 5EXPA 1DHRA 1GL9B 2HD4A 1UR5A 1OBHA 4FSXA 5IKMA 5AKHA 4C1NA 5TEVA 1N2JA 4MV0A 2XWSA 3E9EA 3ZE7A 4CLXA 5KQGA 2XW6A 2EATA 5CIWA 5DE3A 5L4NA 1NWCA 1Y3HA 3GP3A 4TX1A 4TLLB 1PE0A 1IN4A 2AC4A 3BG5A 3PJDA 3HFRA 1ONOA 1OZGA 5FOWA 4D1YA 3ND7A 4Y2VA 1JLKA 2ADMA 1O6BA 2YHUA 1F20A 3ILXA 3M6WA 4CL2A 1SKUA 5IJ9B 4PZUA 4J0JA 2ZJ8A 4JUAA 2BSQA 2BISA 2PQ0A 3PR2B 4YRCA 1R8SA 3NOQA 3U3JA 3LNTA 1KI6A 2LXNA 2HYIC 3A3KA 5FAXA 1FYWA 1ZD3A 4J7CA 3HR7A 1VL0A 3PXEA 3V1TC 2GD2A 2EARA 4BFWA 1RAGA 2G08A 4P3KA 5G1OA 5T5QA 3RS5A 4CM4B 2ZWMA 4YP7A 3VKGA 3OOYA 2FPKA 2WPDD 4ANFA 3DMFA 5AMXA 4RVNA 5BN3A 4XDZA 1VBFA 2WM8A 1ZAYA 4QO7A 1DEXA 4YS6A 2H6EA 1JLSA 3RRFA 1NHWA 5E1BA 5SY4A 1X80B 2L19A 1B93A 3CEPB 4BLOA 3UUWA 1ZOIA 4JXKA 2QG6A 4AJ1A 4MV9A 1K6MA 4BNYA 4RD1A 2WE7A 3CNQS 3N5KA 3QX7A 2YR0A 4JJ7A 4QUAA 2VTBB 2YFHA 3FTDA 1ZBDA 2JZNA 4M1EA 3GJ6A 3KOUA 1RCUA 3KQYA 4TS3A 5PGMA 4ZALA 2NOAA 1HPLA 1RM3A 4RY8A 4UARA 4I50B 1PQWA 2QX8A 2ZAMA 2JLZA 2ERCA 3IE1A 4Y2QA 1JEYB 3D6MA 3H1TA 1XP5A 4WI1A 4DCTA 4FCTA 1FXWA 1N6RA 3B6ZA 4Y1EA 1G6OA 1TEHA 3PBKA 4P6VF 4ZXFA 1TCVA 4QU0A 4AP6A 4EA6A 2HT1A 2QN2A 4KLRA 3SBOA 1IIBA 5H4GA 3HBFA 3IDFA 1FQJA 1R0RE 2DKFA 1EJ6A 4LG1A 5CVEA 5KYXB 2IKSA 1XEXA 4UVHA 4OJMX 1FYEA 3TB6A 2L2QA 3ZLBA 1IBSA 3MINB 4UC0A 4QXPA 1V1MA 2CBZA 2RHMA 5HKOA 4KQ2A 3LA6A 4XDGA 4RTRA 2D13A 3I9MA 4DUGA 1EX1A 1GUYA 2HIAA 3DHYA 9LDTA 2GK3A 3G8AA 3U5TA 3E3MA 3OQIB 2WC1A 2HCRA 4LMPA 1AKVA 1GIAA 1S2NA 1EJ0A 1J2YA 4HPJB 1E18A 2Z09A 2NSDA 3IOCA 4GLLA 4OLBA 4XUCA 3BEOA 1YVRA 2I33A 5HK8A 1XTVA 3RK0A 5LJLA 4KCGA 2YJGA 1ZNYA 2C07A 2W6QA 5GONB 2P68A 3FFTA 1FFXB 4A8TA 2HLPA 4CJXA 1FW6A 1OOEA 2R11A 3SXUA 2IVZA 2PLWA 2CXPA 4MGEA 2SCUA 3ZGYA 1I4WA 5DHAA 2R87A 2VSYA 3DXZA 4HQNA 2Z4SA 1VE3A 2DFLA 1XKTA 4OGLA 4EB6B 1SY7A 5CA1F 4FP9A 4G1UC 2FWIA 4QICA 2D0DA 4Q05A 5D3KA 2MSKA 2Y2VA 3HYLA 4OHBA 4PTLA 3MCUA 1RQGA 4RULA 4FLFA 3R7LA 3MMNA 1PGQA 3LDFA 3QSYA 3TTUA 3S2UA 2PKQO 4BGVA 4G8JA 4WN3A 3A10A 1CZNA 3WBBA 5DBGA 3T5CA 4C01A 4D4LA 4NF2A 4MHSA 2CXXA 4YRFA 2VZ9A 2R48A 3D4PA 3T7JA 2HLHA 3G79A 5FWDA 5FBKA 4H1HA 3ZDXB 4CUJA 4O08A 4RIHA 3TLAA 4D41A 2CF6A 2J9FA 5BSFA 5DBEX 4W9MC 3PI7A 1K63A 3PNPA 3HM2A 1W1WA 3AR7A 3NCHA 3BJZA 5F73A 3SFTA 1XZLA 2ANBA 1IZ7A 2G4CA 3DAHA 3DDSA 2XVXA 3TAXA 5BMOA 3TECE 2PNJA 4DAEA 2IXBA 3I6IA 1B8VA 1EGHA 2RI6A 4NBSA 4NV1A 1BWQA 4M0PA 4F9GA 1WQ1R 3FN4A 4R2MA 3A37A 4BX2A 2JA1A 1PFQA 5LA6B 1TYAE 1F14A 2H7XA 2D3TA 2ZRJA 2G7MC 1QLJA 3MD0A 1UIRA 1XALA 1V7ZA 2FN3A 4IDNA 4ZQCB 1N2EA 1JVNA 1JL3A 1WY7A 2IPXA 3R20A 4WZBE 1R6BX 1NTOA 3PDCA 5ADVA 5I4KA 5IJZA 1KYWA 3AIOA 3RYTC 1CLUA 4NAUA 3FZQA 4A2CA 3ZJ5A 4ZZ2A 3F3YA 4RPHA 5FT9A 4F8EA 1ODLA 4QPJC 4IDCA 4D56A 1H2WA 1RXVA 1J5XA 3GFPA 1BS2A 2PZBA 2A58A 3NFRA 3HL4A 4W9NA 3U0VA 5I4IA 4N82A 4WDQA 1HQDA 3GLUA 4GPD1 1NXPA 3GWZA 4P4SB 1I7QB 4QATA 3KLOA 3ZI0A 1YJ8A 2AVDA 4YMGA 4BMNA 1ENZA 2M9MA 2GHRA 2O3JA 2PZLA 3C41J 2ORYA 2P1DA 1X3SA 1ULHA 3OTHA 4MOWA 4MWSA 3HKEA 1JPVA 5EE5B 4EA9A 1N2OA 4A2WA 4EJ2A 2Z6AA 5K99A 5JAPA 3AM1A 2HPAA 3DV0B 2PT7A 4OLHA 1KYQA 2QLLA 4G0WA 2GPAA 2DFTA 3IELA 1D6NA 4PAWA 4KI0A 1QX3A 2OTCA 4K9DA 1USIA 3P94A 4I14A 5ITZA 2JFZA 2O6HA 5JNSA 3EPKA 4WJZA 2LTAA 5AVKA 2W70A 1F06A 2FW6A 1YJXA 3MGCA 3WNDA 1UBGA 2WZDA 3HA2A 3T3NA 4JJGA 3TJZA 3IJEB 4U7FA 4GPTA 2Z8YM 4WNYA 1RXWA 2CNWD 2XNJA 2CD9A 5FYQA 1PWXA 2ACEA 2E37A 5E6UA 3ICEA 1K8XB 4TWIA 1XK6A 1WL8A 4WK4B 4QM6A 2HLDA 3IH5A 4CEHB 6YASA 4OKNA 1FTGA 4KRYA 4YPOA 1DU4A 3QWFA 1EQAA 2WZBA 1Z5UA 3H5LA 3PIDA 3KE8A 3G7SA 4ZWNA 2A0UA 4CM9D 4NWIA 4HDSB 1N8NA 4LTNA 4HNQA 4RPGA 4Z4IA 3O8CA 1X7YB 1WF3A 4BLSA 2PNFA 3TTWA 2VIIA 1W8DA 3AF1A 3W4JA 4I9UA 3IMKA 1S7GA 3ZYCA 4I3GA 3ZD6A 1C3VA 1TLTA 2Z1NA 3EC1A 4B34A 2ZSDA 1CF9A 3PXAA 4V03A 1DOZA 3V1MA 5LBIA 4LX8A 4URWR 1R74A 1L7OA 1Z8NA 5F3DA 3G13A 3O1HB 2VF2A 3Q3HA 2OBNA 5TMDA 5ENDA 4YRBA 2VTVA 1O89A 4QYSA 1RXYA 2A1IA 3DEHA 4CDMA 1NYTA 4FQ5A 1YJQA 2XGSA 3L1IA 3T95A 3JQGA 5JUWA 4IUCS 4D42A 3QUTA 3JW8A 4CM4A 3CR3C 4LTMA 1UXKA 2RK3A 2IDZA 4J0GA 3RK1A 4J0IA 3F7NA 1LQTA 1NPTO 1VM6A 4Q0MA 4E3WA 3JYLA 3UJ8A 3WKCA 2AOVA 2BW0A 3H2YA 2H4XA 2AEEA 4IDEA 3H05A 3WJAA 2BUAA 3B2QA 1LDGA 3KJIA 4QULA 3GFRA 1X80A 3H2SA 1JHXA 1HDEA 4M53A 1EX7A 1O97D 3C24A 3OUUA 2XTAA 3CWCA 1IXYA 4LJ7A 4B46A 4BEWA 1JQJC 1NF3A 2OKCA 2VTBA 3ICOA 4UHBA 1NLUA 3VC7A 1ADJA 5A2GA 4IW3B 1P6QA 3GCGA 1DQNA 1FRNA 2IE0A 3MTGA 2FG6C 3MWLA 3T7AA 4E09A 5KCZA 2AA3A 5EZ6B 4AZ3A 3C5WP 4UUOA 1S4QA 4JNKA 4YMLA 2ZP1A 2ZB2A 5KTPA 3GB9A 1P2UA 1QDLB 3MK31 4TV8B 4KTTE 3USES 3H2BA 1X7XB 1YK1A 2G9UA 3RC7A 3VSCA 4ARCA 1XXLA 3OWHA 2B0CA 3FFWA 4OVKA 1JKJA 1EP1B 5T6BA 5JNLA 4ZVPA 4Q3NA 4PO9A 3C3EA 3DONA 2Q3JA 1DQPA 3ZH2A 3THYB 1PNRA 2VDLB 1O4VA 1K7SN 4X8MA 3NBZC 1DRJA 2CL6X 2O2IA 4EYKA 1FFCA 4B33A 4F4HA 4AS2A 2C3UA 5E4JA 2Y99A 5G1PA 4D5EA 3K1ZA 3WYBA 1W44A 2PL1A 1GZ3A 2PQ2A 3P20A 3LGXA 4DDVA 2HHHB 1E7SA 1ZL2A 3LVQE 4P4GA 5HIMA 2M6KA 2GBIA 2ZYWX 4ZJUA 4RC9A 4QUHA 5IDWA 4BFLA 4JSYA 4HC4A 1ANKA 2EWVA 2O2XA 3N70A 4S1NA 5GONA 4BQNA 2Y1LA 3LCCA 1FFXA 4FFMA 5H5JA 3M4NA 1H2XA 3EVFA 1XK7A 2PT6A 4ZI5A 5EHNA 4DSUA 1M6YA 2BGTA 2OGUA 1MQAA 4MRPA 4X54A 1XMOB 4Q3BA 4MV5A 3LDHA 2H63A 1EBBA 5SZKB 4BNXA 4AMVA 5HPYB 4OHYA 1A2BA 2ETXA 2JIRA 2NZ8A 3IALA 2PV0A 1CUUA 4RVOA 1G5FA 1BDMA 1ZUNB 4HR7A 3UW1A 1IG0A 4QDXA 4GE0A 1YIDA 2J3EA 1U2TA 2BLNA 4XRGA 4BMVA 4F12A 1QJ4A 1CR1A 1YMUA 5L95A 3MWFA 1K3UB 4E07A 1KPGA 1RLIA 2VEDA 4P53A 3FFAA 3KS9A 4P34A 3ZUGA