2CXXA

Crystal structure of a probable gtp-binding protein engb
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
184
structure length
184
Chain Sequence
b'ATIIFAGRSNVGKSTLIYRLTGKKVRRGKRPGVTRKIIEIEWKNHKIIDMPGFGFMMGLPKEVQERIKDEIVHFIEDNAKNIDVAVLVVDGKAAPEIIKRWEKRGEIPIDVEFYQFLRELDIPTIVAVNKLDKIKNVQEVINFLAEKFEVPLSEIDKVFIPISAKFGDNIERLKNRIFEVIRER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable GTP-binding protein engB
publication title Crystal structure of a probable GTP-binding protein engB
rcsb
source organism Pyrococcus horikoshii
molecule tags Cell cycle
total genus 65
structure length 184
sequence length 184
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2cxxA00
1G291 1EX6A 4JVSB 2EQBA 3DHWC 4ASUD 4BE7B 1DAMA 2Q0HA 1NBME 2GILA 1WE2A 4Y0AA 2XSZA 2WSSD 3WY9A 3U4QA 3PUVA 4V0OA 2O8BA 3ZDQA 1KI9A 2CJWB 3MFYA 3WHLA 3NDBB 4G5GA 4B73A 3GLHB 1X3SA 4D4LA 4MGYR 5EE1A 4TMVA 2ZAOA 2QM8A 3JVUA 1I2DA 5C4GB 5UKDA 3WNBA 2YC2C 3C41J 4GP7A 3QIAA 4JLJA 2F1IA 2CJWA 1NVUQ 3RANA 3AF2A 4TTQA 3D8BA 5BN5A 3SYLA 1NJFA 1GDDA 1G9XA 1TF2A 5BN3A 4MH0R 1H8EA 2R2AA 3KQUA 2AWOA 3SC3A 1IBRA 3KKMA 2FOLA 3FHCB 4HAXA 4AKEA 3ZVMA 4RJLA 3VX4A 3VR5A 1AK2A 3GEHA 1JI0A 1Q1BA 5EE5B 1Q57A 5JRZA 5C2JB 3H2YA 3ADBA 2X19A 2UKDA 1P4SA 4Q47A 4DLZA 3QF7A 2VL7A 3A8TA 1DADA 4B3DA 4OQMA 1UDXA 2ZJOA 2WKQA 1AZSC 2W6ID 2JLQA 1F6BA 1G20E 4JSYA 2YNMA 5AJYA 2H18A 5A0FA 3NBXX 3ZS8A 1DBSA 1EFRA 1G4UR 2DFNA 4DCTA 2IF0A 1DARA 3HR7A 4RD2A 1G41A 3AKEA 1NSTA 1E4VA 3U3KA 4TYYA 4DIDA 4WXPA 5HPYB 3V4FA 4ESHA 1PZNA 4LUCA 5LDDC 4NP6A 4A0FA 3B8HA 4RZUA 4MRNA 1E0JA 1D5CA 1Z0AA 4FW9A 4XWKA 3Q7QA 1KI8A 1YR7A 4ZI2A 2X1VA 4FWTA 1T9HA 2OBNA 3FPAA 3OFNA 1N5KA 4Q02A 3GFPA 3DM5A 3AGQA 5JJLA 2PZEA 1VG0B 3QEJA 1BMFA 1OKKD 1OXXK 2N46A 3SZRA 4OHXA 1NLYA 1J8MF 1CKEA 1E0KA 4ZCIA 5J4YA 4Q1CA 4PHGA 3ASZA 4OI4A 1RE0A 2GDJA 3GJ8A 1ZYUA 4QBIA 1R0WA 4JSTA 2GA8A 1UKEA 3DL0A 2JLWA 3FGNA 4OQLA 4IOLA 4BLOA 4C7OB 1U9IA 2V7QA 1W2HA 4DEXA 3CLVA 1Z0DA 1G64A 4FCVA 3LNCA 5G3ZA 5FBQB 5IK2A 2VPPA 3LO5A 2ZXUA 3U60B 4QBFA 4MQBA 5EJEA 1IJEA 1BIFA 2F1RA 2GJKA 3DOEA 2FA9A 1FTNA 4NKRA 3F8TA 3ZQ6A 521PA 2OESA 1GZSA 3GPLA 3IUYA 4WZ6A 3NTUA 1CP2A 2FEOA 4B2IA 4ZCLA 3PG5A 3MAAC 2MSDB 2WZQA 3OHMA 5GADl 2ZS8A 2R65A 3K9NA 3KJGA 5JS7A 3OEHA 1NMYA 3I1FA 4NPHA 3R9IA 3U3JA 1J70A 5JHHB 1QHHA 1X8JA 1X8LA 2OSBA 3BJIC 2XZPA 1OW3B 4Q1EA 1AS2A 4P4SB 1CXZA 2A5JA 3GLGA 1J2JA 3U7GA 2YHSA 1AS0A 5DE3A 1QBKC 3ZYCA 2FX3A 3WYGA 4NHOA 4C0QC 2QQEA 1KZ7B 4MRRA 1VTKA 1L4YA 2XOKD 2Z83A 4M1MA 4FMCB 4X8MA 1NMZA 4U02A 3ZD7A 2VHCA 3ASYA 2J46A 1JJVA 3QXJA 2BMEA 4P4SA 1N3BA 4AYWA 4DSUA 3L0IB 3U7FB 1ZW6A 4DUGA 4WAUA 2P2LA 2XEXA 1Z22A 2MMCA 4CVNA 3FKQA 4EQ6A 5G3YA 1XCGB 1CJMA 1LS6A 2GJ8A 2GVZC 4N1AA 1FQKA 3ZIAA 1DAIA 1BYUA 4MKIA 4GOKA 1FTSA 3O8CA 4E07A 1JR3E 3EA5A 4OJQA 4NBSA 5FTKA 3OZXA 1GVNB 2ZJ5A 3N70A 4FWIB 1R7RA 2QT1A 4FIDA 4PXAA 4MUBA 1TMKA 4IDQA 2PJRA 1ZCBA 4LJAA 2NQ2C 1Z2CA 2W6JD 3UMSA 2IUTA 4EFNA 3CO5A 4MDEA 3M4YA 1F2TA 2ZRBA 1NJGA 3EZ6A 3V4RA 1R4AA 2GCOB 3I4LA 2ZRDA 4PHTA 1W47A 1U81A 1Y3AA 2O5VA 4MDFA 4LJ8A 2WOJA 3TMKA 1QHSA 2WPDD 3UMFA 2AKYA 4PQRA 5K8UA 4B76A 1U99A 1OFTA 1VCOA 4LGMA 4D0NA 2CL0X 1MABA 3VHXA 3VFDA 4GPTA 2AK2A 1QHXA 5AUQA 4RCZA 4BFVA 1IXZA 2JIZA 2RMKA 1KAGA 1TUIA 1US8A 2IEZA 1E3MA 1AM4D 4HLUA 1W44A 4Q4HB 5EP2A 1KO1A 4M9XA 2WBLC 3T5DA 3KKPA 2C9CA 3QI2A 2ORIA 2BEKA 3UXMA 1XPOA 3ADDA 1CLUA 4OQXA 4IVRA 2WVJA 2JEOA 3AH8A 3GEIA 1HE1C 3P4XA 4HZIA 2FZ4A 4O2LA 2VYFA 3BRWD 4DC9A 3L2OB 4OHYA 4RKFA 2R9VA 4Q4HA 3B60A 5JCPA 3KXKA 3QPUA 1AGRA 2O8CB 3LAWA 4MYHA 4UNQA 1N6HA 3HU2A 3QXCA 3HP1A 4XTCS 1YZLA 4A4DA 3U5ZB 5FPSA 5C46F 3EIHA 1IM2A 4PC3A 3THYA 4UKDA 4ZDKA 3B78A 4D82A 2B92A 1G5PA 2O8CA 4GOJA 2C78A 4FN5A 1W36C 4PC7A 2FMXA 2ECKA 4KYUA 2YJTD 1PV4A 2OZEA 3GJXC 4XWOA 1QF9A 2XB4A 3RC8A 2YWHA 1XEXA 4IOMA 4HYYA 4QG7A 2XXAA 1N2CE 3BB4A 2CHGA 3AF1A 4PHFA 1W0JD 2WKPA 3QUSA 3WYFA 1SKYE 3GMTA 5DISB 1LB1B 4AKIA 1E79D 4IRUB 1U98A 4A8JA 2C98A 1G7SA 2G6BA 2RGXA 4LDJA 1G3MA 4TZ0A 1NBMA 3IPYA 3LBNA 2OAQ1 4KLZA 4QNMA 1KZGB 2XITA 1FFHA 2YOHA 4M1SA 4F4CA 2BKUA 3T34A 2FSIA 2IHBA 4DJTA 2PEZA 3KQNA 1G8FA 5GJVC 4QJ4A 1OPXA 3TGPA 1TNDA 2XTMA 2KBFA 2GXQA 4L4UA 1T0HB 2AR7A 2CLCX 4A2PA 2F9LA 4IW3B 1FUKA 4H1UA 1BS1A 2XNDD 4PO8A 3WP1B 1E99A 3Q7PA 5JRJA 4AKHA 1YHNA 3KJHA 1N6NA 2JJ1A 4TLCA 1GL6A 1NMXA 2CL6X 2OXCA 3P27A 1T8TA 2BBOA 3BH6A 5JZVA 1LS1A 1S9HA 1JQLB 2BCJQ 1G3IA 4AYXA 5EQTA 1KJZA 1JAHA 3ZZTA 4L5BA 2D2FA 2ZROA 1QVRA 4CGZA 2R6GA 3RRYA 1CR2A 4WW0A 1P2VA 4LV8B 3IQXA 4A82A 2WICA 4HAVA 1EFTA 3P4YA 3TQFA 2GJAA 4LHZA 4TLAA 3CRQA 1XMVA 2Z4RA 2RHDA 3K0CC 2B8TA 3O8DA 4M1KA 4Q19A 4TYPA 1IN7A 4Q9LA 2NG1A 3KX2A 1G7RA 2VRWA 4PSAA 2NO7A 1AZTA 4PSVA 2OT3B 4TMKA 3I5XA 5GVRA 1R8QA 3U3MA 4N0DA 3ND8A 1Z47A 2XTNA 1E96A 5EXTA 2GXSA 3L43A 1OE0A 3FMPB 2JLVA 4BLRA 4TTRA 1V5WA 2JJ2A 1KDTA 1Q0UA 5BN4A 1OIXA 1OYWA 3EZFA 3KL4A 3UIEA 1OV4A 3CX7A 3TBKA 1JPNA 5L8VA 5DGXA 1KO5A 1BO6A 3AM1A 4RD1A 3K0SA 2R6CA 2GXUA 3FTQA 2JATA 1ZD1A 4NZYA 1R8SA 2F1JA 2KBEA 2IHYA 3UATA 4OHWA 5KNCA 1S3GA 2QQ0A 1W5SA 2WIAA 3AVWA 3TW8B 3TH5A 1R5BA 4DSNA 5KDDA 3NHBA 2PZGA 1E2IA 5HTKA 4LHVA 1XF9A 3SJZA 1XX6A 1TL7C 4HI0E 2H7VA 5FFMA 4B33A 1IY2A 4TMTA 4GRAA 4PQYA 4ZDIA 4A6PA 4KFSA 3HYTA 3A1UA 4JL6A 1LNZA 1T6NA 1DELA 3C14C 5FBLB 2D7CA 3U2QA 1E2KA 4A9AA 1E9RA 5CK5A 1YJ5A 1E2HA 3B9PA 3LLMA 2WJGA 1SKQA 4QBHA 2GF9A 4P4UA 1U8YA 1II8B 3VMFA 1VYTA 1YRBA 2AXPA 3CF2A 3IQWA 2V6JA 2I1VB 4KV9A 5DLQC 4BLTA 2RGDA 4D4JA 4Z51A 1SZPA 3OE7D 1NN5A 3DKPA 1XZQA 3RS2A 4ZCMA 3KQLA 1LF0A 4K81B 3NC1C 1GRRA 1G18A 4TSFD 5AJZA 3WMFA 3LLUA 2JGNA 2ORWA 2OFWA 3DZDA 4CEIB 2V6IA 2QE7D 1C4OA 3IKJA 1LFDB 1XD2B 3QPVA 2WWHA 2I4IA 2AFHE 5CJ2A 2CCGA 2CE7A 1G1MA 1XTJA 5LD2C 2VTKA 5B2ZA 3MG9A 2H17A 2TMKA 4WA7A 4CEIA 3X1XA 3T1TA 2XAUA 1XD2A 1FP7A 4WIAA 4YDSA 2C9YA 4EFLA 2CMKA 1R5OA 2ZRKA 3SS8A 1WA5A 4ZI3A 2QY9A 2GEUA 1G3UA 1IHUA 2H57A 2HLDD 2ZJ2A 3B9QA 3BERA 2KJQA 2ZRMA 2YKGA 2WIBA 1ZUNB 2OCBA 5A5GA 1OFIA 4ACBA 2Z0MA 2IA5A 5KSPA 1IY1A 4PZZA 1ZIPA 2AKAB 3FOZA 5F9FA 5SZJA 1G5RA 1JR3A 2CHVA 2CNWD 3EARA 2F7SA 1NN1A 4G1UC 3RRZA 2GXAA 1W36D 2QROA 4XTRA 2HF8A 3CUEF 4JLNA 4HB0A 3MLEA 2XSZD 2IUUA 1NLZA 1LTQA 1M7HA 1FL9A 2C9OA 5FTMA 2BC9A 1CRPA 4JLOA 4MGKR 1N6PA 4RKEA 4BUJA 1NVVQ 1DPFA 3FVQA 3K0AB 4H9GA 4KFTA 4M1YA 1OXVA 4RFVA 4A92A 1Z29A 4HLUC 1W7AA 1KJYA 1G8GA 3CZQA 3ZVRA 3EPHA 2IS1A 2J7PA 2JAQA 5JECA 1AS3A 3K0AA 1J99A 3PFIA 1E4YA 3SJAA 3W8NA 3HYRA 3JVVA 3RS3A 5HR5A 2FV8A 4DLWA 2RH5A 1LVGA 5K8IA 5EZ6B 3IBYA 3C16C 3QE0A 3CX8A 1FX0B 1H8ED 2KI5A 4Z8XA 3VKGA 4W5WA 2ZRJA 1U8ZA 2QPOA 5KHOC 1Q22A 3BAFA 3I72A 4S35A 3IILA 5F2EA 1XEWX 5FOWA 3AP1A 2QP3A 2QAGC 4P3YA 2FDCA 3MUFA 3RSLA 221PA 2PJZA 3GCGA 4KHZA 2LCFA 2QI9C 2CEAA 5GJCA 5FI0B 4XWAA 1Y63A 1D2MA 5JSZB 4LHYA 4W5HA 4URUR 4AK9A 1TADA 1S4QA 4UXIA 3ICEA 4URXR 1IOZA 2ZE6A 1W4AA 4CW7A 2DBYA 5JSZA 4M9QA 4A8JC 5JI2E 1EFRD 4UJ5A 2NO9A 2O52A 2RGNA 3PVSA 2V1XA 1G16A 2YYZA 2C8VA 2ZE7A 1U94A 1GKUB 2ATVA 1VPLA 1VYUA 1G8PA 3AKDA 5DI3B 4ZV4A 1S3SA 5FTLA 5EP3A 2YOGA 1UADA 5DYIA 4JIMA 4US0R 3LV8A 2HCJB 1ESMA 1MO5A 2WJVA 2D74A 3NKVA 4LCBA 1E2DA 1Z63A 1KY2A 1X6VA 2QUZA 3CM0A 3QXHA 5HKKA 1MR3F 2FJUA 5JLJA 4B43A 3C5CA 3CZPA 3K0FA 1KDRA 1ZIOA 3VKWA 1BMFD 3PJRA 4NONA 4B44A 2LKDA 1M34E 1W0KA 2ZRIA 3BIFA 3RNLA 3KFXA 1XD8A 2C96A 2XTZA 3TSWA 1J8YF 1TF5A 1N5JA 2QTFA 3D7MA 1RC8A 4JLDA 1IY0A 2ONJA 4W9MC 1M7GA 1EGAA 4LJ9A 4LBVA 5EUMA 4IDPA 1N6OA 1T4GA 4ON9A 4PAOA 4OHZA 3PQCA 1FNMA 1E98A 2G0TA 4A36A 5CYOA 3TSZA 5FL3A 3VNVA 1I4TD 3IEUA 1PLJA 2OV2A 4FINA 4XD7D 1E2JA 1EX7A 1KOFA 2QZ4A 3TNFA 4B6EA 4UJ3A 4BLPA 4DSOA 1OH5A 2XZLA 4AWXA 1OH7A 4RD6A 2H5EA 2OBLA 4JVNA 4GMDA 2IYSA 3AKCA 3C8UA 3U3OA 2CHQA 3UANA 3X1ZA 2Q3MA 4KVGA 1XEFA 4EFMA 4Z8YA 2I3BA 4RD0A 2JASA 3K1JA 1F2UB 1D9ZA 4BEJA 2IX3A 1R2QA 2J5XA 4I1UA 2IYLD 3CPJB 3PITA 4LJ5A 1IXRC 4D81A 4X8OA 2J0QA 4C9BA 1WP9A 1NY6A 4FMDF 2WWWA 5DYGA 1DTSA 2OBMA 1CEEA 2D4HA 1E2FA 3EG5A 4E03A 1OH8A 2DFTA 2G0NA 4S2EA 4DUGD 4C0KA 1NRJB 2QMEA 1GUAA 2ZUCA 1FMLA 3TUZC 3W6PA 1SVMA 3QNUA 1RRGA 4HAYA 3V9PA 1VIAA 3I32A 5AJXA 4LK2A 4LJ6A 2P6UA 3KQKA 3R8CA 2RGCA 3FFAA 1OHHD 3QPWA 4OI0A 3NEYA 2A9KA 3LH5A 3UWOA 5H8WA 4HUQB 3CPHA 1G8YA 1GKYA 1QDEA 2G88A 1ZUIA 4D26A 5ELXA 4AY2A 1TUEA 2GK6A 2WMNB 3SHFA 3VU9B 3U6KA 1YU9A 1P5ZB 2FSGA 3QVVA 1T8UA 2G3YA 2HJVA 3BB3A 2NIPA 4TL8A 1H8HA 4B6FA 3IPXA 4JLPA 3UG6A 1CJUC 1F5NA 1D2NA 1AA9A 1JEDA 2IEYA 1MO4A 1SXJC 4OHVA 5EXXA 2F3TA 2Z6VA 5E7MA 3VU9A 3AF4A 2B6HA 3E2IA 4K8OA 1N5IA 1S0UA 2ZRAA 4NYIR 1A7JA 3EWAA 4U5XA 3TJZA 2ZYTX 3GLHA 1ZP6A 2NZ8A 2QP9X 3K53A 2VH5R 4GNKA 4KCGA 2J3EA 1RYHA 2JIZD 2GZHA 2HYDA 4AKGA 5DN6D 4EPRA 1XJ0A 4US1R 3AGPA 5IDVA 1KHTA 4HB2A 2AD5A 1GNRA 1N25A 1SVIA 1SHKA 1E9SA 4IHQA 4K46A 3RC3A 1WMSA 1W49A 3THXB 1NLFA 3VR1A 5EXSA 2BCGY 3G82C 1UBEA 3I62A 4Q9JA 4IVQA 2IYTA 3LVRE 1XWIA 4B71A 2JLZA 2OLJA 4AG5A 1RPZA 2WWIA 4POAA 2C77A 5TARA 2IT1A 2W83A 3U7EB 4RD4A 2RB4A 4NH0A 4BFYA 4LYJA 5LPNA 2W0SA 5TMPA 2WAYA 3A1WA 3CONA 3QKUA 4PPFA 4F7WA 2O0HA 2BKEA 1M6NA 3KUDA 4TYNA 4TYQA 2QT0A 2CCJA 4E09A 2R8RA 5FI1B 2ODWA 2ZE5A 1QZXA 3T1OA 1CR4A 1VHTA 4EPYA 4N0EA 2WJIA 1XFAA 2DR3A 1VG1A 3RRMA 4RD3A 3GJ6A 1FP6A 2OFXA 1GILA 1KDOA 3HR8A 4KJZA 4G3XA 3WBKA 4A2WA 3DMNA 2ZRFA 3BWDD 1W48A 2P5TB 4Q4AB 4AYTA 2VP5A 2ZI6A 2WHXA 3LX8A 2ZM5A 2HCBA 4FMBB 3SNHA 1E9AA 1Z28A 4PSKA 2WKRA 2QRNA 3TQCA 4TYWA 5KOYA 4A0HA 2JA1A 1XTIA 1JAIA 5AUPB 1YZTA 2KB0A 2EWWA 4JT4A 2WWFA 2VP6A 4M8NE 2D2EA 1HT1E 5G53C 1CBUA 1XCPA 1R0ZA 4F38A 4IXNA 4A0GA 2WMOB 4BPBA 1G17A 1G4AE 1E2QA 1HTWA 3T1VA 5KYKA 4C7OA 4DCSA 2PT7A 3P1JA 3UK6A 4Q9HA 1DO0A 3LFUA 3GLIE 5JCZA 2QRZA 3A4NA 4E5UA 4DRZA 1P60A 2AX4A 4BEBA 5AUNB 1COWA 3IEVA 4TMZA 4URVR 2QBYB 3ZS9A 1MO6A 1QHNA 3MJHA 4QNRA 2O8FB 4NDZA 4R7ZA 1VCNA 2FPKA 2FSFA 2RGNC 3AKYA 2V8OA 3FDIA 1WRBA 1U90A 4BRWA 2J0SA 1M74A 2CCKA 1T5LA 3CF6R 2K5UA 5FTJA 1XJQA 1FZQA 2BWJA 2GWHA 5EZ5A 4Q7KA 4LX0A 3UKDA 2Q9AA 1I4LD 3OF5A 5CYPA 2O8FA 1P6XA 3HPRA 3FHTA 1NG1A 2C95A 3IIJA 2REXB 2W00A 4YONB 2C04A 4R71A 2B7CA 2VIIA 1KNQA 4D80A 4B35A 4LY6A 1CS4C 3IIMA 1VMAA 2ODNA 4M21A 3W6NA 4Q9KA 4D4KA 4Q1AA 1NKSA 4V0LA 1IN4A 2SHKA 2QPAA 2WJYA 2D7DA 5J5CA 2ZSBA 1QG2A 3MWJA 3RWOA 4IEEA 1NVWQ 4AURA 4OBEA 4NCIA 1DO2A 4TT3D 5FUVA 4PC1A 2VP0A 5TB5A 1M8PA 4IOKA 2WWGA 2Q3FA 3MGCA 2YV5A 4MYCA 1KAOA 4MYTA 4L16A 3BXZA 3NDPA 4IVPA 1ZNYA 2C03A 4Z1MD 4C3ZA 4P4TA 1KTVA 3WNCA 1E2NA 3PEYA 4KBFA 1SQ5A 2GCOA 4ASUA 3EIEA 3TRFA 2P6RA 3FFBA 4FMDB 4LBYA 4TLBA 3ZJYA 4B32A 1RKBA 1ONBA 2FH5B 2REOA 2HXSA 2NPIA 2WSSA 1ZM2A 3ETLA 3Q5DA 5JWRA 1W4BA 4EJSC 5CIQA 1KDPA 3QJYA 4IKEA 1DAHA 4X8HA 3TLXA 5L3SB 4CDGA 1DAFA 1XJCA 3ZVLA 4JVMA 1ZVQA 2OUKA 3CRW1 1VCMA 2ZRNA 3NBZC 4KFUA 1N6KA 1SXJD 4P33A 4XSHA 2EYUA 4W7SA 4MKHA 1ZU5A 1ZNWA 2F55A 3EPKA 1CU1A 2C5LA 4MRPA 1K8RA 2IYYA 2A2ZA 3ADKA 1SVLA 2GJ9A 3B85A 5FL7D 3OAAD 1E6CA 3QBTA 3M0EA 1HE8B 3T06B 2PCJA 5EP1A 1N6RA 1P2UA 2QA5A 4H1VA 1VECA 2ERXA 1J7KA 1GM5A 1G6OA 2PLRA 4KO8A 2CBZA 2MMGA 4BLQA 3D6TB 2NTYC 3UWKA 3WHKA 3AVUA 1N0VC 1B23P 4R98A 4LJYA 1QHGA 4WZBE 2WWXA 4BRUA 4ZKDA 2IYWA 2ZREA 1UKYA 2ZU0C 3CIOA 2QEQA 3L0PA 4NL4H 4C30A 2ORVA 3CR8A 1GG2A 4TWZA 1M2OB 4I1VA 1JR3D 5DIFA 2GAOA 3RS5A 5JFGA 1TTTA 2W6IA 4RCYA 1LW7A 4FD2A 4V0ME 4C2UA 2QMUA 1P73A 1W4CA 3OIYA 5FOTA 3UMRA 5CB6A 1SULA 2BV3A 2L0XA 4MRVA 2ZR7A 1UPTA 4A15A 4JLMA 1CR1A 4B48A 4LI0A 1OJLA 1FPMA 4WVFA 3IIKA 4URYR 2QPTA 1RRPA 2FPMA 4B2LA 2ZS9A 4IDOA 1GRQA 4QL3A 5JMTA 1NF3A 1DG3A 4LRWA 1DEKA 4DHEA 4UXJA 3T5GA 3X1WA 1E1RA 2VLIA 4B34A 3LVQE 4F4IA 4HDCA 4JYBA 3REFA 3GLFB 1KNXA 4V02A 4O3MA 1W5TA 1XBTA 3EWSA 1OKKA 2DFLA 2V54A 2OILA 2R6DA 5HE8A 4B2PA 3PEVA 1ZC4A 3R20A 3B2EA 2IYRA 1NY5A 4A2QA 1GAJA 1MO3A 1UF9A 2NZJA 2YC4C 4QC2A 3B13B 2J9RA 4DWJA 2V3CC 4D25A 5AR1A 2GEDA 1VCIA 3KXIA 5HZHA 4GFDA 2IS6A 2CK3D 2IYZA 1NN0A 1K6MA 1E69A 1GNQA 5D3MB 5J4KA 4KSCA 1D6JA 1E1QA 3KB1A 4A0RA 1L2TA 1YRAA 4I99A 3LBHA 3EPLA 5K8TA 4PANA 5FBRB 1KI7A 1KO7A 3SFVA 1OYYA 5BYKA 3PUZA 2IC5A 3U44B 1XXHB 3AB3A 1NL3A 5JJKA 5D3MA 4R9UC 1XNJA 4KSBA 4OI1A 1XB2A 1GKIA 2G77B 3W9YA 1B0UA 2ZVQX 2ZRHA 4W5JA 2UZ3A 3U44A 2QTVB 4B47A 3BBPA 1KSGA 3CRMA 4TL7A 2JDID 2V55B 2PX0A 4LPKA 5F3WB 3THWB 4C0JA 4IXMA 5KDLA 2AN9A 4G01B 3E5HA 4ILEA 4JZKA 4LV5B 4TMWA 4DVGA 1KY3A 3EZ7A 5CIWA 3MMPA 2XOKA 3QXXA 2KSQA 2RGGA 2V9PA 4HATA 1ZBDA 5KPDA 3GJ5A 1U9IC 1E2MA 4LC1A 2DFKB 1HURA 1P7CA 2EYQA 4I4LA 2AK3A 3NVAA 1PLKA 3SE0A 4QHSA 4GSYA 5K8LA 3KQHA 1EFHA 1W0KD 3QY0A 4JJZA 1HY3A 4DDTA 2VBCA 4TN1A 3NH9A 2NO0A 2ZSDA 1EWRA 3C15C 2BMDA 3O8BA 1F60A 2O8DB 4M22A 5FOVA 3FYHA 2R6AA 3SOPA 2P0EA 2E1RA 4OK5A 3GLIB 3VQTA 3WRYC 3C4JA 1R0XA 2DWPA 4JL5A 2EFEB 1WBDA 1PJRA 1Z83A 2P5SA 1N6LA 1DAKA 1Q21A 3PV0A 2WTUA 2O8DA 3RAPR 4XJXA 3RS4A 1UBFA 5FOSA 3BH7A 3K9HA 3GLIA 3L8YA 3S1AB 2WPDA 3H1TA 1KI3A 3AV0B 4R2IA 3DEFA 3LW8A 4FI3C 3SQXA 2ZYWX 1II8A 2IS2A 3BORA 3KJEA 4QHTA 2FSHA 4YXWA 3VR4A 3L8ZA 3ND9A 2PCLA 3S1AA 4OYHA 3U61B 3X1YA 2J1LA 1E2GA 1AN0A 1S8FA 2DCUA 2P67A 4M1TA 4NE2A 4BZXA 5KSZA 4EIWA 3AUYA 3AP2A 3Q85A 5TXGA 4L9WA 3CNLA 4LZZA 1L7VC 2WOOA 1Z0IA 3Q9LA 2RHMA 1ZM7A 3PUWA 2ZJYA 1OIVA 2A5GA 1J90A 5H70A 2ZVPX 4WBSA 1R6BX 2E87A 1KSFX 4OI2A 4WOPA 1WBBA 1LV7A 1RRFA 2ZE8A 2ZETA 3CH4B 2JLRA 2Q9CA 3MWKA 4B3GA 2FF7A 3L0OA 1P2TA 3QKRB 3B1VA 2C99A 2DWQA 4ZIRB 2ZUDA 3BOSA 2XX3A 3AVPA 1YR9A 3EAQA 1M7BA 4NTZA 4C0AC 3EPJA 1FW6A 3SHWA 4DB2A 2FG5A 1IN5A 2BM0A 4YMTA 1KK0A 3CRVA 4PC6A 4XH9B 2HJGA 2GBLA 4HLCA 3T15A 3AP3A 3RVBA 3QKRA 3DZ8A 4ZIRA 4EUNA 5FUWA 1ZAKA 1QHYA 1ZM3A 1NIJA 3EC1A 2IF2A 4IDNA 3A36A 2ZR9A 3MRSA 1EFCA 1WF3A 2AL7A 3I5YA 1XRJA 2GESA 3U3RA 1TPZA 2PT5A 3QG1A 4B74A 1E79A 3H4MA 2Z43A 4PPGA 5E7IA 5FR1A 4DCUA 1E9FA 5KSOA 2Q21A 721PA 1Z0JA 4B75A 2X2EA 4J0QA 1IN6A 1NKTA 1S9DA 2OAP1 3OIUA 2J87A 3CNNA 5B58C 1XMJA 4TQUS 3ZH9B 5CITA 3VR6A 3KTAB 3N5CA 5CLLA 3P20A 1FOEB 3T1QA 2BVNA 4JLVA 3UPUA 2XNDA 1EESA 1Z08A 2ZJBA 1P72A 2J45A 1XTQA 3N2IA 2LKCA 1TU3A 1YZQA 4LHXA 3TUJC 1GWNA 1RJ9B 4I1SA 1FX0A 5JS8A 1KIMA 4RFSB 4KODA 4LJ4A 4MKGA 3NG1A 1KJWA 5J40A 5L3QB 1I4DD 3W5IA 1P61B 2EFGA 2W0MA 4RFSA 4L15A 2IWHA 1KK2A 1DAEA 4HDOB 2HF9A 2ANCA 5DO9A 5L3QA 1S1MA 1ESNA 5IRCD 4TMXA 1X1SA 1Z07A 1C9KA 3T61A 3MCAA 3CPEA 1WQ1R 2F3RA 2LWIA 2ZEJA 1KMHB 4MGZR 4Q66C 1K5DA 4II7A 2ONKA 1AQUA 5GJBA 4MA4A 1P75A 1ZCAA 5BWMA 1HUQA 4UXHA 4V0MA 3ZZUA 2AHOA 2I1QA 2J0UB 4C0SA 4TL6A 3OFND 4TQAA 5DI3A 4DSTA 3LBIA 4HZUB 3WMEA 4C4PA 2ZRLA 4XOIA 2ASEA 3A1SA 2F1HA 2XJ4A 3MSXA 1CRQA 4KYIB 1SVKA 4LYAA 2ZSFA 4DKXA 4QJ5A 1UFQA 3NWJA 4Q01A 4ITRC 4HZUA 3M6AA 3SBDA 2UVQA 3B5JA 5TV2A 4GDFA 1KO4A 1S2MA 3OEEA 2QTHA 4RVCA 2V7QD 1OXUA 1CTQA 2J7KA 3DVLA 4XSGA 1G7TA 4M9SA 5H1YA 3RWMB 1RW4A 2ZJAA 1OF1A 2PEYA 4Q03A 3LXRA 1OXTA 2V1UA 3RS0A 5IK2D 1S96A 1HEIA 3PXGA 4N3NA 5TY0A 2F9MA 4NYJR 2IW3A 2BEJA 2FPLA 2H1LA 4LV6A 4XIGS 2E9SA 3K9GA 5AK0A 3PUXA 4PFSA 2P3SA 2GVDC 4RZ2A 5AJVB 5EE9A 3TUIC 4YMUA 4XVQA 1VG9B 2F6RA 3B1YA 2EU8A 4HDQB 3OEHD 3DM9B 4D0LB 2RGBA 1E0AA 4KU4A 3GD7A 4DLYA 3DKVA 3HPQA 5EP4A 1JB1A 3LX5A 2VSOA 3GJ4A 1IJFA 2NO6A 4OL0A 4HAUA 3IHWA 4BQSA 3AUXA 4UNPA 2ZRPA 3OE7A 2YWGA 3LWNA 4HB3A 2A5FA 4M9ZA 1F2UA 5SZKB 1JALA 4CZ2A 3EX7C 4TSFA 1UKZA 4BZQA 2ZYUX 3WNDA 6Q21A 3SEAA 3KXLA 3HWSA 4F93B 4OQFA 3AVXA 2PX3A 1Q1ZA 1P2SA 1G7CA 2QE7A 2UZIR 2QENA 4EAQA 4PPQA 3WRXC 5FBVB 3F3YA 5C18A 4PZLA 1T0JB 4Q1FA 3BE4A 3GJ3A 3QXSA 3ZIAD 1NNEA 4LWZA 4TLEA 4Z54A 4KI0A 4U7DA 4QGGA 2Z5FA 3W3AA 1X86B 3AF0A 2YVUA 3LY5A 1BYIA 2GZAA 2ZITA 2D62A 1NG9A 3F0TA 3TAUA 5B57C 4NCNA 5FPTA 1E2PA 3KZ1E 4NCJA 5DSZA 1TEXA 3E70C 5AUOB 3SU8A 1W36B 1ETUA 3A4MA 2OCPA 3TKLA 3T35A 3G5UA 4GZLA 4HUQA 3LQRA 3NHAA 1F3OA 3WYAA 1CR0A 2CNWA 4M1OA 3U4QB 4QBGB 4GMXA 1KK3A 4D0GA 5FR2A 2IXEA 2O8BB 1ZRHA 1GSIA 2J41A 3SYKA 4M0LA 4UNSA 3FMFA 2NMVA 4GZMA 3VTKA 4DLXA 1N6IA 3A1VA 2BHRA 2OCAA 4CYMA 1OFUX 2EFDB 1T3SA 1Z06A 2CL7X 2G83A 2X8AA 5HCNA 4BWYA 2JLUA 2QMHA 5JBQA 3GLFE 2X2FA 2GCPA 1JECA 3K9LA 4LPSA 4HLQB 1Z6YA 4YMVA 1A1VA 3KKQA 1ZNZA 2BBSA 1YZKA 3KB2A 2CLSA 4AIIA 1II9A 3FB4A 3CX6A 3MJRA 4HUTA 2BDTA 3THXA 3I3SR 3TSOA 4B3CA 4JLKA 2ZR0A 4HB4A 1YE8A 1VKJA 1WDTA 3A6PC 1XZPA 1CJVC 2FU5C 4QGHA 3SDZA 1Z5ZA 2VHTA 2IYXA 3FKSA 4PC2A 2GBLC 1MH1A 3TR5A 2G1JA 1UBGA 4NYIQ 1UM8A 1ODFA 5P21A 1XXHE 1OFHA 1U0JA 2HUPA 1Q20A 3QENA 3OIVA 1NP6A 1VYVA 4IFBA 4HSEA 1GITA 2NO1A 4Q7MB 1EWQA 3ZD6A 3OESA 2FGKA 3NH6A 2AWNA 3EZ2A 3T12A 1YKSA 5JI3E 2YZ2A 2H92A 4OKSA 2FFHA 2VF8A 3K0CA 2IL1A 1NBMD 1RIFA 1W46A 2A78A 2ZSAA 3SYNA 4DB4A 1UDWA 2NGRA 5FH9A 1IONA 1JXMA 1UKVY 3NC0C 3I73A 2GZDA 4YQFA 4GL2A 1JNYA 3AQ4A 1XPRA 1BKDR 5HCIA 2VEDA 3NBYC 1PLLA 4JLBA 1JPJA 5BXQC 2OM2A 3CR7A 4DDWA 1KI2A 2VP9A 4Q4AA 821PA 3KFVA 5G41A 1T91A 1E1RD 3LXXA 1E9BA 5DI9A 2IYVA 2CDNA 2AFIE 4JT2A 2JJ1D 4AD8A 4F4JA 3W6OA 1P9RA 1W2GA 1A2KC 3GEEA 3PUYA 1CULC 3CRRA 1NIPA 8OHMA 4G5SA 421PA 5FUYA 4F91B 2QSYA 1CIPA 1H65A 3IHLA 4YMSA 4M4SA 1NN3A 5FOXA 2OG2A 1N0WA 1D2EA 2J0VA 1HYQA 2ODBA 1GNPA 5FOUA 1O3YA 3VR3A 1DE0A 1OXSC 3CBQA 1V43A 2EVWX 2QAJA 2WJJA 2VA8A 1HT2E 4CT5A 1VG8A 4EPVA 3KKNA 3AVYA 1D9XA 1U0HC 1ANKA 5CM8B 4V0NA 2XZOA 2QSZA 1UAAA 4FXPA 4WZAE 3E1SA 5BW8A 3A1TA 4XD7A 4YMWA 3SN6A 1E1QD 1TU4A 2Q9BA 4P0TA 4BFWA 4I81A 2ZI3A 2QBYA 2WSMA 3AVQA 1G3RA 2EWVA 3GP8A 1JQJC 1XDBA 3OIWA 2O0JA 1A4RA 2PBRA 4JKIA 4LYHA 1QHHB 4MKFA 3AF3A 4PPNA 1SXJE 3EXAA 4Q1BA 2JJ2D 2PLFA 1OT3A 2IXFA 1BOFA 4DLSA 3GLGB 2ERYA 2D3WA 3VX3A 1XCMA 3B1ZA 4E22A 3CF0A 2JLXA 1QHIA 4O2RA 2P65A 1SVWA 2CE2X 3WMGA 2QN6A 2J59A 3TVDA 3BFXA 4LBWA 2GETA 1XTRA 3RRNA 3CNOA 2N42A 4NU0A 4EQ6B 1ZM4A 2DB3A 4KBGA 1TEVA 1U8AA 3Q5EA 4DLTA 3GJ7A 5LD2B 2H8KA 1P3JA 2ZJZA 3B6EA 4ABYA 4RY2A 5KNDA 4PQFA 1GOTA 2W58A 2ZI7A 3CH5A 3FMOB 4DBLC 4QFMA 1Q12A 2WAXA 1AKEA 2FFQA 1L4UA 2OHFA 3K8YA 4MGIR 4G5RA 2BIFA 4PAMA 3RDPA 5HZKA 4GI7A 4DLVA 2FN4A 2XNSA 3O47A 4C0HA 2VSXA 2GRJA 4D2IA 3AEZA 1F2TB 1OHHA 5EE3A 3O8RA 3LW7A 3PR1A 1Z8FA 2GAAA 4NMMA 1YQTA 4JBWA 5LB2A 4BFUA 3H0KA 3ICQB 4D4MA 3SI7A 3ZLJA 3BH0A 2HV8A 4JL8A 4UNNA 5BQ5A 1O87A 5KSYA 5SZHB 4EPWA 4M1WA 1VIYA 2IWRA 5JJIA 1IXSB 4M2LA 2A30A 4G5QA 2HEIA 2IK8A 2WJHA 1MABB 1Z6TA 3ZGXA 1IQPA 1SVSA 2B7BA 3GFOA 3N2EA 2OFOA 5SZIA 1PUJA 4P31A 3BFKA 5LBIA 4BASA 3LD9A 5J4LA 2IXGA 3A58B 1US8B 3C7KA 5L3SA 1KSJA 4CEHB 2PMDA 3BS4A 3SR0A 4YXWD 2DYKA 4Q1DA 4KITB 4JKYA 3Q3JB 4V0KA 4Q00A 3I8XA 3RHFA 1CJKC 3W3ZB 3SQWA 3NIBA 2OLKA 5DN6A 2ZRCA 3WBJA 1XTSA 2V4ZA 4DLUA 4GP6A 4CEHA 4B3XA 3B1XA 2JJ8A 4NYMR 5E4FA 5L3RA 2GF0A 3LA6A 1A2BA 1QG4A 1FQJA 1UEIA 3FMIA 1E0SA 3THYB 3K70C 1E9EA 2A7QA 2QU8A 4CRWB 1K5GA 1DAGA 1GTVA 2IYUA 2QAGB 3RLFA 2Q6TA 5AJWA 1OLOA 2AD1A 5DH9A 5KUTA 3LRPA 1JBKA 1ZM9A 1KSHA 2DHRA 1XP8A 1XEXB 2ZTSA 3R9XA 1MKYA 2GNOA 2XXAB 2PH1A 2QAGA 4QXAA 5F9HA 2WWYA 3EC2A 1AGPA 1MRNA 3D31A 5DNYB 1G8HA 1N0UA 1P62B 1TQDA 3CW2A 4IDHA 4URWR 4JS0A 5J4HA 4ZDJA 1VHLA 5KU1A 1RZ3A 4A8JB 3B7GA 3I92A 4Q7JB 5TDHA 3VAAA 3P26A 3SBEA 3SFZA 2R6FA 1HV8A 1MRSA 2KWIA 2ZPTX 4L8GA 1P9NA 5KPJA 2XGJA 1NI3A 4YC7A 5CK4A 3X2SA 4NYMQ 2J7PD 3LQQA 4DEYA 2AXNA 1Q3TA 1Z6AA 2BM1A 3BB1A 1IAQA 3P32A 1ZINA 4PHHA 4ARZB 4NCHA 3SJCA 1XU4A 2PL3A 3HJNA 2HYIC 1YZGA 2DY1A 2EFCB 2CVFA 3QG5A 3AVVA 1Z0KA 4CIDA 1NSFA 4R2HA 4TL9A 3TIFA 3X1DA 3GLFA 1OB2A 2ZYVX 2EW1A 3H84A 3QKSB 4ARZA 4BFSA 4KLNA 3MWYW 1JR6A 5CDFE 1G3QA 2ZI5A 1MT0A 1AQYA 1C1YA 2NOAA 5C1BA 2FZLA 5JWOA 1G6HA 2BBTA 1E9CA 4P32A 3QKSA 4UQOA 4YLGA 4IOJA 1EFUA 2ZIAA 3KJIA 3ONWA 3REGA 1YR6A 2ZAMA 3A37A 4Q48A 3C5HA 4PTLA 1W4RA 4QOSA 1GL7A 1ELOA 1YZNA 2IBMA 3QF4B 3VKHA 4JLAA 5DHFA 4V03A 1JJ7A 1F48A 2HXYA 1DS6A 2PZFA 2ZRGA 4IEIA 3FWYA 3W34A 5B64A 5KNBA 1HH4A 2P6NA 4IJMA 1XXHA 2RGEA 4OK6A 1R0YA 4HEJA 1DG1G 1ZU4A 2QMOA 3QF4A 1HQCA 1KMQA 4BLSA 1VDZA 4NCKA 1ZMXA 2Z4SA 3K09A 1WXQA 5FUXA 2ZSEA 2MSCB 4RSGA 1M1YE 5TVKA 1A82A 5HKKD 2IYQA 2YOFA 3CB4A 1TQ4A 1ZD8A 3WXMA 5KTYA 3THWA 3DOFA 4B3FX 4RZ3A 1KI6B 1AKYA 1UJ2A 1OB5A 1JEEA 1OSNA 3PIRA 4PO1A 1YR8A 4U00A 1Z3IX 4QM6A 3J81k 2YWFA 3BC1A 3IGFA 3W5JA 1T5IA 4C0LA 1AJEA 2FFAA 1Q1EA 3PEWA 1KI6A 3ADCA 4C0BA 1GP2A 3OEED 4OJKA 4TT3A 2ANBA 3AVTA 3THOA 2B8WA 2GKSA 2X77A 1Z6GA 2W6JA 5D3QA 3PEUA 4FCTA 3R9WA 4UNRA 2BBWA 2VQSA 1LF5A 3DMDA 2VSFA 5FTNA 5EE0A 2ZQ5A 1QRAA 4CEJB 2C2HA 4BECA 2HT6A 3FHOA 4Z1MA 4O25A 1Z2AA 1LY1A 2ATXA 3Q8XB 4HLDA 5KO2A 4KVAA 4URZR 4QJ3A 4MUAA 2EFHB 3W90A 4CEJA 1NVXQ 4DLRA 3U7HB 2ZANA 1SXJB 4ZDWA 3PENA 2QNRA 3GLHE 1WB9A 2CVHA 3CKLA 4PO9A 4Q5IA 5JEEA 2KE5A 2JLYA 2JCSA 2OCYC 3UG7A 1X8KA 1SXJA 2BOVA 4MRSA 3WP0A 1G21E 1KGDA 3VNUA 3IO3A 3GJ0A 4X8LA 2QP4A 1BH2A 1HQYE 2W2XA 4A1FA 1L8QA 4DZZA 2MSEB 1RYFA 1G19A 1FUUA 2FGJA 2FNAA 2QGNA 3BD9A 1TQ6A 5FL7A 3SJBA 1EXMA 2ODEA 3KKOA 3OAAA 4GBMA 4Q18A 1NVVR 2D06A 3TK1A 4AI6A 1XTKA 3NBFA 4JJKA 2OE2A 2VP4A 5IF9A 2N1BA 3IBGA 5GJWC 2XB2A 4G5OA 2ZU6A 1E32A 2VHUA 2YWEA 3QVUA 1RFLA 4QRHA 1XMSA 3V00A 2QG6A 1U2RA 1ZUHA 4MYUA 2O0KA 2O8EB 2DPXA 1WCV1 1I2MA 3QOFA 3QSYA 3TE6A 2QL6A 3K70D 1RVDA 3R7WB 5FPKA 1Q1QA 5A4JA 4PAQA 4TZ6A 5FPYA 3GQBA 1A5TA 1Z6XA 2RAPA 1W0JA 2RCNA 2CLDX 5LB4A 1XPUA 2O8EA 1H8HD 1PUIA 3K0EA 1AIPA 3CWQA 2ZI9A 3R7WA 2Y8EA 3AVOA 4Q21A 2OEPA 4L9SA 4FCWA 4Q9IA 1SVOA 5KDOA 2ZI4A 1TQ2A 2R44A 1DVRA 5BYJA 3NXSA 3RS7A 2VHJA 2ZS7A 4JVLA 1KYIA 3HU3A 3JZMA 2G9NA 3G0HA 1YZUA 1UEJA 1EK0A 1X1RA 1MV5A 2QM7A 4KAXA 5L3VA 4Q4LA 1CF4A 1Q3HA 2VHQA 3KTAA 4BZPA 4IFEA 2W2TA 1TAGA 1T3LA 3L82B 1U0LA 4BFXA 1PVOA 1II0A 2PMKA 2BJWA 5CLQA 1GIAA 5IHPA 2FWRA 1QVAA 2OO7A 3DO6A 5EUQB 4PX9A 4PR0A 2YINC 1RJ9A 1UBCA 3LDAA 1Q44A 3EW9A 3DPUA 4GOXA 1YVDA 5J47A 4QHYA 2IS4A 5EXPA 4Y0VA 2CK3A 2GTPA 4DT1B 3FKSD 1KI4A 3VR2A 5JHGB 5F98A 3QEOA 5AWFC 4D6PA 2A3RA 4EPXA 5CJPA 2VF7A 2GEVA 4WXRA 4I1OA 3QQ5A 4EPTA 1EG7A 4DT1A 2ZJ8A 3Q72A 3GLGE 4M53A 1RRCA 3BFVA 3NEJA 5CM9C 3CWZA 1KKLA 2QORA 1Z0FA 3GFTA 5G40A 1TX4B 3BGWA 2GCNA 621PA 5HE9A 1T3HA 4AG6A 4ESVA 1XD9A 1TF7A 1KMHA 2Q3HA 4JYCA 4KFRA 1SKYB 5JWHA 4ZPXA 3HDTA 5JEDA 3TW4A 4LSGA 3RSOA 2CXXA 2JDIA 3TVTA 2J0UA 3PCRB 3RYTC 4DDUA 4F92B 4G0NA 4QGFA 4LYFA 3A4LA 5M04A 3K0FB 1HA3A 4HAZA 3HU1A 4DCVA 1GRNA 3QBVA 3B82A 2NPFA 4C2TA 2GHIA 3U6BA 2RGAA 4JBXA 1CJTC 1IN8A 2H16A 1OIWA 3D3QA 3L0SA 3VHLB 2OXRA 2WV9A 4OK3A 4TTPA 1SGWA 1N5LA 4LHWA 5FPHA 2FEMA 1ZD9A 5E95A 1S1CA 1E94E 4BFTA 2GJSA 3EZ9A 2BMFA 3KDSE 4XVRA 2XJ9A 5ANRB 3TR0A 4QGAA 3B1WA 2JLSA 2DWOA 4RZXA 1KI1A 3IDQA 4BGDA 5CDFA 1ZNXA 3M1IA 1OH6A 1GFIA 2BJVA 4MITA 2ZUBA 4A6XA 4FMCF 4Q4JB 4LC0A 4OQNA 4QKQA 121PA 3KUCA 3JZAA 1COWD 1ZJ6A 5H68A 1KK1A 3BK7A 2BMJA 2VO1A 5GVSA 1KO8A 1W1WA 5B30A 1FNNA 5DHAA 3I61A 4Q4JA 2HT1A 1G5TA 3ZQJA 5E7JA 1JXOA 1ZC3A 5FBWB 4LBZA 4ZO4A 3ZVNA 3EIQA 4AC9A 1E9DA 4JBYA 4Q7LA 2RKOA 3K09C 4DCNA 4EJSB 4EDHA 3EASA 3H86A 2F43B 3ZZ0A 3RABA 2WM9B 2VP2A 3MWLA 2GK7A 4BFZA 4CF7A 4O0MA 2FE4A 4PZYA 3F5FA 4XVUA 2R62A 4EJSA 4TQ9A 3W8RA 3DDCA 4GT1A 5CB8A 3R8FA 1E2LA 2F43A 1XEWY 2FFBA 1GL9B 4DDVA 2IUSA 4LJ7A 4NYJQ 1E2EA 3TAHA 4CT4B 4LOAA 2G1KA 3MD0A 4DIEA 4YDHB 3FE2A 4QM7A 4ZKEA 2A5DA 2QGZA 1P9WA 2HLDA 5C4MA 1XMIA 5E3HA 4DXAA 2W2VA 3IO5A 1R10A 2B21A 5IT5A 1R5NA 4HAWA 2A5YB 3QKTA 4TLDA 4KXFB 1SHZA 1KKMA 4B3BA 1DOAA 2HDNB 3ECCA 1MOZA 3I8SA 1FMJA 4JMPA 3K70B 3EA0A 2REBA 4EKDA 4ACAA 4ERNA 4US2R 5J4VA 1D8TA
chains in the Genus database with same CATH superfamily
1G291 3FY4A 1LWOA 3DF9A 4BO8A 1A50B 1U2ZA 1NBME 3KYJB 3D1LA 3SMQA 1LBTA 5IXJA 2QTZA 5KQMA 4Y0AA 4IHAA 3BCHA 3PD1A 5FBHA 1QOPB 1JIJA 1NXSA 2WEKA 2WSSD 3AUJB 3NS7A 5ALXA 3TIIA 6YASA 4UEQA 1J2YA 4W1RA 2VHYA 3DWEX 3L40A 4RJKA 3S4YA 3T8YA 4IICA 3F1LA 1XU9A 4B73A 4DYVA 3KO8A 4HQ6A 4ARSA 4B45A 3TVYA 4AWAA 4EGFA 4FE7A 5EKSA 2PX4A 2PRKA 2QM8A 4UTRA 2IZ1A 1C4KA 2WF8A 1WL8A 5C4GB 3DZFA 2J9FA 5K20A 3TO5A 1SD2A 3HMKA 4E1AA 2CJWA 1I1QB 3DDWA 1T6XA 4MUMA 3D8BA 4R2KA 1BN6A 2MDTA 3DMGA 5BN5A 3RS8A 3D4BA 5AW0A 1VPEA 4IIJF 4RUKA 1EVQA 3S2YA 5LSAA 5KX5A 1PW7A 4B7ZA 4C29A 1KQFA 3JTEA 1PNQA 2QRUA 3CNBA 3LCUA 4KW7A 2JFFA 3JAKB 3O91A 4QPZA 2AFHB 3KKMA 1JG3A 2FOLA 1F51E 1ZQ1A 4LXQA 3VVCA 4D8TA 3ZVMA 1G21A 3QUTA 5FA5A 2G70A 4YCLA 4TROA 1I3LA 1G6KA 1BQ4A 1JZTA 5BRJA 1AK2A 3GEHA 1SA0A 3HCAA 4QSHA 3MUNA 3UMMA 1I3OA 4YCJA 2RBGA 2FMKA 3R3WA 3K1YA 4BMXA 3RFTA 5C2JB 2XQKA 1YNOA 5JDCC 3ADBA 4PAGA 3RADC 4Q47A 3VOSA 2ECPA 2XDQA 2JK0A 3AILA 1DADA 1F0NA 2VDNB 2FMFA 1JHZA 1NFFA 2BMWA 1M2JA 1UDXA 4HMOA 4QGSA 3RWBA 2Q3DA 1J9EA 1GPYA 1YZFA 2R3SA 3LOQA 1WDLA 2JLQA 3KYCA 1G20E 4IZIA 2YNMA 1K06A 3QJGA 1XHFA 4AUNA 1YZYA 5A0FA 1G2IA 3ZK7A 2A92A 2BR4A 1G4UR 1SU8A 3BGOS 3B9RA 3OLZA 4ZQBA 1O5OA 3UEOA 3HR7A 1PZMA 3M5DA 3ZU5A 1TPYA 3W5HA 1G41A 1PQWA 1NSTA 3G2IA 4WXPA 4CQNA 1EP3B 4LNAA 1SPXA 4ESHA 2LPMA 4J6FA 4A0FA 2I2DA 2O2CA 4TZTA 3OIGA 4MRNA 4L78A 4FW9A 1N2JA 3FPJA 1DKLA 3HSSA 3SWWA 4OPMA 3PX7A 4EP1A 5JCJD 1SIWA 4ZVRA 4FWTA 2OBNA 3MVEA 3OFNA 3QTBA 3H1FA 2H7YA 3ZV7A 1UT5A 1SG9A 3IUPA 4IJQA 5BVGA 5BT9A 3O73A 3E9RA 3A04A 1OKKD 3SZRA 1UJCA 1L5QA 2ADFA 4QOGA 5J4YA 2GJ4A 3A9WA 3ASZA 3OPYA 3B7PA 1PP4A 2X0KA 2GDJA 3A6EA 4XM0A 3AUSA 1SUSA 5K6AA 1R0WA 4Q37A 2GA8A 1KVTA 3B48A 3FGNA 4OQLA 5DK4A 3UAYA 1JWBB 1Y9JA 1T43A 1U9IA 2ZB7A 3JQRA 1TGYA 2H7XA 1W2HA 4RH3A 4EABA 2HWKA 5LJLA 3L6UA 2H2HA 4RKWA 5DKFA 5DNEA 4EW2A 4TZKA 4FR2A 3ORFA 4X7BA 5AI4A 4D9GA 1IMJA 1LTKA 1P5JA 3LO5A 5K0NA 1D8AA 3GLVA 1UKBA 1JA1A 4MQBA 3ED5A 5IW8A 2XUHA 4K2AA 4DNQA 3ZQ6A 1BIFA 4CF5A 2GJKA 1H2RS 2VRBA 4MRAA 3WYCA 3F8TA 1EFVA 1MEOA 2AC4A 4AUMA 1SQ6A 3GPLA 3H5AA 1XIVA 4LQ4A 1CS0B 4RVOA 3S55A 5CCDA 3OHMA 4DQUA 4MIKA 5SY6A 1W0CA 3K9NA 2CHUA 3TINA 3W04A 5JD6A 3WAKA 3IQEA 3ONDA 4QD3A 4LE1A 5EJ2A 2B25A 1GRCA 2G40A 4F5EA 2XZPA 2W2LA 2A5JA 5KWEA 1J2JA 1U9ZA 4WNYA 1AS0A 1R4MA 2WJ6A 1JN0A 3OCYA 2FX3A 3R3JA 5LQDA 4NHOA 4C0QC 3I2KA 1P1BA 1GCIA 4ZU1X 1L4YA 1X7XA 2Z83A 4X8MA 5KOHA 1EDEA 2R1TA 4C43A 3NOXA 2VHCA 1WXDA 2FPSA 2J46A 2P11A 3MS4A 3QXJA 2E5FA 3AY6A 4FZRA 4GOND 1N3BA 2XA2A 4P4SA 1YBFA 3VDQA 4AYWA 3WNCA 4E2FA 5MN4A 3O92A 3QWHA 4EY3A 1ZW6A 2P2LA 2XEXA 1Z22A 4RTNA 2RK3A 4HK4A 4DDHA 5KQRA 4W63A 4XRRA 1U2DA 2GJ8A 1PIWA 1J97A 4N1AA 3QTTA 3FDXA 2Y1XA 3B38A 1QQ5A 1T4DA 2WG1A 1XELA 2P2SA 3CHYA 3EMKA 1SOVA 4GOKA 4B80A 3AB7A 4R1TA 2VUSA 3S40A 4E07A 1IUOA 3O8CA 2PO7A 4OJQA 4DJAA 1JFFA 3BXPA 1DFHA 1R00A 3ACBA 4FWIB 5F52A 1WM1A 2WAOA 2HMYB 4KQGA 4PXAA 4MUBA 4UUQA 3VC3A 3MS2A 4LJAA 1NUPA 3C6XA 3ENZA 2NQ2C 3AY0A 3CRNA 1JIVA 2C83A 4L1KA 5E0KB 5A03A 1FRNA 1NXOA 1FSSA 4ZA2A 1NJGA 3SOZA 2XDAA 3USZA 3RSSA 3UKJA 2A59A 3FDZA 5BMVF 1YT5A 2IOYA 1Y3AA 3EGXA 3K35A 3JALB 4KZKA 4UDYX 3VHXB 1R4NB 4LJ8A 4AJHA 5CA1B 2WOJA 4MDFA 2QJOA 1QHSA 1R88A 1RACA 1SUDA 1U4SA 5C1IA 3ROXA 1C1HA 2Q28A 1M6EX 2B1QA 3G13A 5BVHB 1TVKB 1XAJA 5J63A 1LDGA 1W5BA 1TTPB 1BCRB 1V0JA 1A9OA 3DCIA 2XVXA 2OECA 3BL6A 2R5NA 4KE8A 4QSMA 5B1HA 3N2GA 3NIWA 2AK2A 1L1EA 1TLTA 4UATA 3BWEA 5KQLA 2PA0A 1AHNA 2O1WA 3QEMB 3WL7A 4Y1GA 3TCKA 1TUIA 4YLYA 5LLSA 3UKOA 2C7QA 1E3MA 4FYJA 1AM4D 5F1YA 1W44A 4MYSA 1J8FA 3OA2A 3D1JA 2WBLC 4M9XA 1MAWA 3B5IA 3QI2A 5DX0A 1CLUA 4OQXA 4Y2RA 2WVJA 1SG0A 2JIBA 3AH8A 4QT4A 3ZVKA 3OZRA 3Q40A 1XN1A 3GAMA 3P4XA 2O7VA 3O7MA 4IMPA 1BQ3A 4M60A 2O3SA 4TUYA 3BA1A 1KJNA 3DEZA 1UMCB 5I4BA 3GAAA 3OZWA 4I9GA 2JVKA 3C3AA 3OP4A 2MYNA 2JIOA 2H1SA 3SICE 4S24A 1AGRA 3VSEA 1TE2A 3LAWA 2EL9A 1U8FO 1Z6QA 4UNQA 3TTTA 2J5RA 3HP1A 1HMYA 1YZLA 1ZKMA 2W2KB 3PFNA 3R77A 3QELB 5FPSA 3WA7A 4AZ3A 1IM2A 4OYYA 4PC3A 4D74A 4ND2A 4YRGA 4ZDKA 4ZK6A 2HF7A 2QG4A 4A27A 5JANA 2R7KA 4NY1A 4D82A 1TIBA 2EQAA 4BLWA 5TF4A 5ES4B 2JZNA 4RGBA 3U4AA 1R9NA 3IUEA 1OC4A 1M8KA 3MTEA 4K03A 4OMDA 4BYGA 2HMVA 4XSVA 4WRRA 2BHSA 3GDWA 4C07A 3GUYA 5BOVA 2OZEA 3GJXC 1E8NA 5E3JA 4YR9A 5IC4A 1XEXA 2GN8A 3OD5A 2WYIA 1EJBA 4IOMA 4LK3A 3VPAA 2BYTA 3L6BA 1SCAA 1OGYA 3CLTD 1FFDA 5NLLA 4DE5A 1OWPA 1P7WA 2WKPA 1S6YA 3LBFA 3QUSA 5B1DA 4B8ZA 5AVQA 5HA5A 3GMTA 5DISB 1LB1B 4PCLA 4AKIA 1PWYE 2ORYA 3TF5A 2G6BA 1G3MA 1UMBB 2CUZA 3ITNA 2GZ2A 3IPYA 4CIYA 1F0PA 4GM0A 4TZ0A 1FFHA 2A9JA 4M1SA 3ZQKA 4F4CA 3T34A 1TAHA 1NI4B 3ND6A 4X7RA 4OUKX 4OUDB 3ET5A 1OPXA 2PSDA 4C7MA 1J24A 3BJZA 4JIGA 1F8XA 2GXQA 3V48A 2EBFX 1IBSA 1DJLA 3DNFA 1TVMA 2WUDA 4A2PA 1GU7A 2TMYA 1E99A 3ZWOA 3W2GA 1VL1A 2FX5A 2GLUA 3LF1A 1N6NA 1NUTA 4FNAA 1WLYA 2CL6X 3A1FA 4WJLA 1T8TA 3BH6A 4G4IA 1D2HA 1S9HA 1UBNA 2BCJQ 3ZE2B 3HP7A 4AYXA 2VQ3A 4EARA 3JZFA 3IT3A 3PDIA 1JAHA 4CL0A 4OIFA 1PR0A 1TZ2A 2AQ8A 3PR2B 2O59A 3T52A 4MUGA 2WWRA 4B4KA 1ONSA 1KAQA 4DBLE 5JZ9A 1PT7A 4CGZA 2VHWA 1QHFA 4FM9A 2HNBA 4TRMA 4A82A 2YWCA 2WICA 3JWPA 1L3BA 1EFTA 1ZHFA 3OOYA 4A8HA 4ZHSA 4OLBA 3P4YA 1W8IA 3TQFA 3K0KA 1FUEA 2PKQP 2O3TA 3K31A 4KI7A 1TW3A 1XMVA 3A05A 4GQIA 3W2HA 1MIOA 2C2YA 2Z4RA 4MWEA 1DFIA 2V7GA 3VSAA 1LDNA 3HKDA 1IE3A 2C2GA 3K0CC 2I4TA 3A9TA 1B15A 4MEAA 2ZSJA 1MUUA 2EJUA 4Q19A 5JIBA 3NONA 4Q9LA 1PJBA 4YHBA 3PB3A 3ZCTA 1K92A 4UNIA 3V2GA 4EGJA 1CDEA 4BUCA 1AZTA 2DE0X 4HMPA 2FZCA 1Z4MA 3C70A 3JATA 3L0CA 1KOJA 4UD2A 2XW6A 2ABWA 5LA6F 3ORYA 2XTNA 1E96A 3LBYA 3AESA 3IOYA 1AKWA 3H6HA 3HNRA 2OHJA 2IFTA 3L43A 4TRRA 1M66A 4DMHA 1Y34E 4LY9A 4UHCA 4PLYA 5A5FA 1K9SA 3T0GA 4OXKA 1Q0UA 3BDVA 4DLNA 3ACDA 1B2LA 3F8WA 4KMSA 2ZYDA 4Q3LA 3AJDA 3CX7A 1R5JA 4NJEA 4UHJA 5EZYF 4ZHQA 5L8VA 3FPEA 5BV8A 3BJMA 3IX7A 5IJWA 3K0SA 3VU0A 1KEPA 2GXUA 2BPOA 4HXFB 3TNYA 1ZD1A 3BHMA 4NZYA 3BD7A 2IHYA 3UATA 1QFSA 3T41A 3SJUA 2WIAA 3KEGA 1QGUA 1L7MA 3TW8B 5CVCA 1K2VN 3WLNA 3KRTA 3RRBA 3SVLA 1Y6GA 3KKEA 5JPCA 4I9HA 1E2IA 2ZXFA 2BTOA 1XF9A 4RTJA 1YOVB 3MRVA 4D3YA 3B2NA 5LOVF 4P82A 2DETA 2DQZA 4HI0E 1JBQA 5FFMA 2FRXA 2E82A 3HCFA 3HJUA 3X1MA 1GLNA 4A6PA 2XMGA 3NQ41 3UOWA 3HYTA 1YV9A 4DIKA 1LNZA 1F1JA 4L4ZA 4MLCA 4M49A 5CK5A 1VLZA 3DMTA 3IAFA 4OSPA 5EWMA 5JSQA 3FDJA 2MHCA 4YJ2F 1Z82A 5FQNA 1H69A 1M2WA 1LC3A 8MHTA 3H11A 4KWEA 4LFCB 4INPA 4CDMA 3HKCB 4MWTA 3VMFA 1TD9A 1YRBA 4MS1A 1BKSB 3MWEA 4KV9A 5DLQC 4NU5A 2ONCA 4QREA 4XWYA 2RGDA 2Q1XA 3D4OA 1EUDB 1SZPA 5EPOA 1ECJA 1U8CB 5B58T 2WTBA 1NN5A 3KQLA 4ZCMA 2VTBB 4ONEA 3GLTA 1RABA 1GRRA 4TSFD 3WMFA 2CLEB 3V4PB 3DE6X 3PR3A 3ZN2A 2ORWA 5CG2A 3QWFA 3JQ9A 3WI7A 5CXQA 5DM2A 1YR3A 3RVMA 1LFDB 4BBJA 4IUBS 2X22A 3RJTA 1MJNA 2JGDA 2PRYA 1TQ8A 3HY6A 2AJ8A 3I1YA 1KP2A 2R8BA 1ISFA 2PGNA 5CUQA 1QAOA 5B2ZA 1UT6A 1PEDA 2G28A 4Q7QA 4RULA 2INGX 1EZZA 4CEIA 3F67A 5HDBB 3EDMA 3OU7A 1FP7A 2YCLA 4J4TA 5DWQA 2C9YA 1O0BA 1PJ2A 3SS8A 4CTMA 2RIPA 4MIEA 3MT0A 5JYEA 2Z1DA 4FHZA 5F77A 3H5WA 3I34X 3BHJA 2H57A 1RM4A 3B9QA 4Y2PA 5BT8A 2GHTA 2KJQA 2ZRMA 2Y9MB 1KFCB 1T24A 2GLXA 2ON6A 3B5EA 5CVTA 3GCDA 1THTA 2JKVA 1Z75A 3EFEA 2Z0MA 4J49A 3NM5A 4JXKA 1IY1A 2SCUA 4PZZA 5ILGA 3FOZA 1RS0A 2G67A 2KM1A 2OMEA 1Q74A 4HUJA 2X86A 5IZCA 1DJPA 3MYRA 1SUBA 1YJBA 3G5LA 3EARA 1CERA 1Q0SA 1ZUNA 3IKLA 2A1IA 4EB6B 4DUZB 3GAZA 3ER9A 3NP7A 4I50B 1E5QA 3O1JC 2I7DA 4JLNA 1QKKA 1T10A 4MROA 4U2FA 3IURA 5E9AA 1LTQA 1M7HA 2C9OA 2ZWAA 4DNFA 4DZRA 4JP5A 5IJ9B 3VZPA 2WAAA 1NVVQ 3KE8A 3FVQA 4H9GA 1ZH8A 2BM8A 2G04A 2JFNA 4ZVTA 5CBKA 1Q92A 1M5TA 2GN9A 4MVJE 1Z29A 1NXXA 4GSKA 5T4FA 3ZVRA 3EPHA 3R7FA 1N36B 2FDCA 1XNQB 4QQNA 4PY2A 5ECDA 3RFXA 3K0AA 1G55A 3F71A 4YRMA 1U28A 4N5HX 5ESWA 1KRXA 1AF4A 3RS3A 5HR5A 3KSZO 4DLWA 4L0CA 2HM7A 1WDMA 4MQUA 5K8IA 1UAGA 1GNVA 1UJNA 1J21A 3C16C 4I4TB 4W1QA 5EZ6B 1EP2B 1H3NA 1DZIA 1O5IA 1C8VB 1FX0B 1E1LA 2Q2NA 2OZKA 4HS4A 3FFXA 3P9XA 3W5CA 1U8ZA 2QPOA 3ICOA 1Q16A 2O54A 1Q22A 4DIMA 3DUWA 2CLKB 4Z4FA 3ZDXB 3KTOA 4PM4A 1CY4A 3CA8A 1XEWX 4DMLA 2QP3A 3IOBA 5A9TA 3RSLA 3EVNA 2QI9C 1P29A 4IH9A 5GJCA 5F3DA 5FI0B 2HSEA 4F5YA 1U2SA 5DOVA 3V1LA 4W5HA 4DV3B 4G0ZA 4URUR 1UP7A 2JNWA 4QARA 3JQCA 4ZVMA 4LMAA 3W6ZA 5A4IS 3SQDA 4EKYA 1V5IA 4FZ3A 4URXR 4M0MA 2ZE6A 3UFBA 3OQIB 5KKCA 3SBOA 1SXPA 3PCTA 4XCVA 5CXSA 2YNMD 2X0DA 3TTSA 4M9QA 4A8JC 4F5ZA 5C4IA 5JI2E 5JNSA 5JSZA 5MFPA 3M8KA 4N54A 3FTPA 3IIEA 2W93A 2NO9A 3P9RA 2OD7A 3KUKA 3RW9A 1FU7A 2WIDA 3TL3A 4TQGA 3QA3E 4EX7A 4Y0NA 2A57A 4OXXA 1TM3E 1NWHA 1AHPA 5F3RA 1GKUB 1N2CA 1DWPA 2OWEA 2O20A 3NWPA 4EX6A 1UDRA 2EJVA 2REQB 3ANMA 4YI3A 4D7AA 4HV4A 5B37A 4YT2A 3ZDFA 4LZWA 1W4ZA 1HDCA 2YZMA 4FEEA 4EG4A 3LV8A 3N3BC 2HCJB 1NOKA 1ESMA 2OGTA 4HDNA 4LHEA 5IEBA 3CUKA 3BIXA 1YFZA 2UZ4A 1BHSA 1YFJA 1KY2A 1VJCA 1TXGA 2LGJA 1EBFA 2QUZA 3BULA 3G2OA 3G59A 3LSYA 1SCDA 5C34B 3TIGA 2CT8A 3AHFA 4LXXA 5EYPA 3L02A 1QFMA 3QI7A 1QH8A 4ZARA 3VKWA 5DN6D 2P2NA 2RHLA 3NPMA 2LE0A 2PFKA 2BY4A 4ROTA 3H16A 4NPCA 1HZZC 1T4CB 3D7MA 3JYPA 3UICA 1OWMA 1IY0A 1SBZA 3IVRA 4RTMA 1M7GA 1DWUA 2NTVA 2QXTA 1KQ3A 3WYBA 3MIZA 3LXUX 5AOCA 4KR6A 4DMFA 4FONA 1QO7A 3C6YA 3MM4A 2D1YA 4BP1A 3ZG6A 4ON9A 3JZDA 1FNMA 1P7YA 3BVPA 4HH1A 2Z6AA 2RFLA 2VHXA 4KO1S 1U7DA 3DQQA 2OGWA 5F2KA 4A36A 1SKMA 1QE5A 3JVEA 5LA6A 5FL3A 3EPPA 3IEUA 1PTJA 1KOFA 4DSOA 2XZLA 1OH5A 5CYFA 2ID8A 1XZGA 2QN9A 2NO4A 4AWXA 5CXUA 3ZWAA 1OH7A 1WKCA 1YL6A 3C3XA 5JMOA 4K9SA 3O90A 3D8TA 4IMJB 4GR5A 4GKJB 1QGYA 3U3OA 5GIOE 4DR6B 1CJCA 4I5DA 3HKEA 1PYDA 1XEFA 4KE7A 5JD3A 2Z57A 2I3BA 3PEFA 1XT6A 4QTZA 4EITA 1OU0A 3QUCA 2F00A 2JASA 1O95A 3RVRA 4MB6A 4HXEB 4QDJA 1F2UB 1AXRA 3ZDCA 2VYVD 4I1UA 3UHJA 2VAPA 1BS9A 3RQIA 2Z1MA 3N86A 1VMDA 1DQNA 2W2LD 3GO4A 1XJ5A 2B0JA 4MVWA 2ZIGA 1Y5NA 4LJ5A 1W35A 3G0CA 4M8SA 1X8XA 2FX2A 1GZVA 2YV3A 4ZCSA 5TQ0A 4X8OA 4D81A 4Q3OA 5EHNA 2VCEA 4U2DA 3OZBA 1NY6A 5LOVA 3LXMA 5C8YA 3GFVA 1DTSA 3T9CA 1V95A 3EG5A 3H42B 2DWUA 4E03A 2DFTA 4OBWA 4TS3A 3WK7A 4OFBA 1O6BA 2BGLA 4JHXA 1FMLA 2J33A 2HMUA 3AW8A 3TUZC 3I76A 3DEJA 3H83A 3V9PA 3I32A 1TOAA 4DV4B 3PQEA 3UJAA 3KQKA 2RGCA 4D3XA 1EK1A 5JROA 1HWYA 3NEYA 4YJ2A 3AK4A 3BK1A 1XVIA 4OLHA 3KJFA 1UBKS 4QEKA 1G8YA 3EVGA 3FUXA 4TV8F 1MA0A 3PNSA 4JYPA 3CW9A 4CKCA 5A4KA 3ZLUA 1IY8A 2WMNB 3AONB 1CUZA 4NECA 5CT4A 3RBZA 5F4ZA 3SHFA 4G1EB 2OKGA 4IXDA 5FFFA 2P3QA 2FSGA 3N2KB 3PHCA 4MV5A 2IGBA 5C52B 3IPXA 4L76A 1F5NA 2PT6A 3AI3A 1D2NA 2VJCA 4GS5A 2BI8A 1AA9A 1H23A 2PSJA 1YC5A 2DUWA 5C3MA 3C1OA 5DLDA 1U65A 2F3TA 5EIAA 5E7MA 3W5VA 3CUSA 3AF4A 4K8OA 3E2IA 4QQKA 3UW3A 2ZRAA 3IQGX 1A7JA 2HAEA 1WQ4A 3EWAA 2FSSA 3QV2A 3TJZA 4E5DA 1ZP6A 2NZ8A 1CW2B 4YRCA 3EIWA 4O4LB 3OWHA 3IOCA 2R6R1 2PS0A 5L9AA 2XRZA 1DMRA 1K6EA 4MV3A 1RYHA 5L4NA 2FPUA 2HYDA 2B5OA 4MW1A 1G2PA 2RHHA 4F46A 1SEVA 4J2OA 3OZIA 4FC6A 5AM4A 1ZJ5A 4TKMA 2AD5A 2ZCUA 2PX5A 1XTPA 1RWKA 3C4VA 1E3WA 1E9SA 3BTVA 4U0JA 4PYJA 1XYYA 1PL6A 2EATA 2HRDA 1JW9B 2XTJA 2NUAB 2IPXA 5EXSA 4D0RA 2H31A 2PH7A 1ZN8A 3GN2A 3RU3A 3S99A 3WS7A 4OD0A 2ZWVA 2Y4NA 5AKKA 1UBEA 1UJ6A 1FF9A 2EV9A 4Q9JA 1CUEA 4NS4A 3DXFA 3UQZA 4D9FA 1UT8A 2HDWA 3LVRE 2FPIA 4HNVA 1WO8A 3QGMA 1RPZA 5AK6A 4LXTA 3AC0A 4POAA 3D1VA 1MENA 2FDXA 4WOKA 2ZYGA 2RB4A 3WLJA 3SC4A 4LYJA 3VPCA 1OZAA 4P7BA 5JDIA 5LPNA 3A1WA 5CYGA 3TEJA 3HXMA 4YRTA 5H80A 4PPFA 5KC9A 5TPZD 2O0HA 3PZRA 3HJFA 1SQSA 1QQ6A 5CDSA 3DL4A 1M6NA 5IKMA 3VH4A 1BJKA 5GZ3A 2IDMA 4TYNA 3ESXA 3PNYA 4N41A 1OTXA 4E09A 2Q45A 2D1RA 1XVTA 4GSLA 2J07A 2ZE5A 3A6LA 1QZXA 1W30A 4Q3NA 3WLQA 4R8RA 1CR4A 4EPYA 2QD5A 1UWLA 2WJIA 4PLFA 2G82A 2C3OA 1QONA 2I54A 3UT0A 2XV1A 1IBMB 3WB1A 1DT5A 2BF4A 3GUCA 1D3AA 4K6OA 4KJZA 4PX3A 4MI6A 4ZVSA 1H2XA 2P5TB 2Q0XA 4Q4AB 4AYTA 2ZI6A 4NH4A 3Q5GA 3AEYA 2QR3A 3H97A 2HCBA 4FMBB 4MR8B 1QF7A 4TRJA 1Z28A 2BFDA 3AB8A 1WXIA 3H5LA 4OQYA 2EKLA 2WKRA 2QRNA 4OP1A 3L8MA 3TQCA 5I7WA 4A0HA 1JAIA 2WIFA 2KB0A 2EWWA 2SECE 2R7AA 3NHWA 3OM9A 4FFVA 2OR3A 4JT4A 1L4LA 2ICAA 4M8NE 4O0LA 1MJ5A 5CX1B 1ZJWA 3O0DA 1LLFA 4K6MA 3UBTA 5F64A 5JR3A 4QLBA 1R0ZA 2IHZA 1REQB 5SICE 4IXNA 4HN2A 5FTWA 1TGVA 4BPBA 1CY6A 3BWYA 2BF7A 3T1VA 1VGRA 4DL9A 5KYKA 1C8KA 1PT5A 2ZTUA 2I87A 5JAOA 4Q9HA 3M9LA 3OPVA 3IESA 1JHAA 2HLPA 2I91A 3R3UA 5JCZA 4OMUA 2O4UX 4V39A 4DRZA 5T8KA 5JQGB 2HU7A 3LE8A 2ZWMA 3PUIA 4YAJA 4BEBA 4KUHA 1JDBC 2A1TR 4URVR 2QBYB 2PZBA 4PYIA 3UGJA 5E6RA 1VE7A 1MO6A 1QHNA 1V47A 3E9YA 4QNRA 5AVWA 2FP4A 4CKWB 1GXSB 1V7QA 2RGNC 3FDIA 4Q9NA 4MW4A 1GA4A 1M74A 2C5EA 2J0SA 3AR8A 3WGKA 1SCNE 1T5LA 2YWXA 3IODA 3R6WA 4H3VA 5F1PA 3WJ1A 3SSNA 3LUFA 2Q4RA 4F45A 4MJ3A 5G4LA 4ARCA 1HE5A 4IV8A 2EKDA 2O8FA 2HK7A 2G9ZA 3FOCA 2P6OA 1ARZA 1HLGA 2X1MA 2CSUA 2W00A 5GINE 5BV0A 2EEPA 2PHZA 5ADVA 2QDKA 4MS1B 4EY6A 4D80A 3BXFA 2WMDA 2EHDA 1NUSA 3T4PA 3ESYA 3WICA 4JI8B 1IEVA 5C8ZA 3CEAA 3VISA 3W6NA 2OPBA 1YI0A 5HKKA 4BEWA 2DLNA 1MAVA 4I4IA 3SIPA 5KS2A 2B34A 1UFKA 2FOIA 1NKSA 2Q3BA 4Q1AA 1MRZA 3WK4A 1SCUA 4TYMA 4XPIA 4FFSA 3WGHA 3D6UA 5CCXA 3MWJA 1Y6QA 1JIXA 3JQBA 2GCGA 4NCIA 2GO1A 1NV8A 1ZW1A 2F8LA 1XLUA 2OPHA 1M8PA 4WGFA 1J8VA 5AKEA 2OQRA 3W5DA 2VZ0A 3O2SB 3QW2A 4IOKA 5EKDA 3Q9NA 4AF6A 4IXTA 1KAOA 4MYTA 2WE8A 4GR9A 1SRQA 5KJFA 2C03A 3T3GA 4Z1MD 4KQHA 1ODLA 4IINA 4YXFA 2OUIA 1E2NA 1J9GA 3FCCA 3DNMA 4HPXB 3SM3A 1YDGA 5IJZA 4DV2B 4KQEA 2GCOA 2UVPB 3G6KA 3IEKA 1K0FA 2YQ4A 2FKNA 4NJOA 1KBQA 2RHWA 3FFBA 5T6BA 4FMDB 3H3XA 4J1QA 2OYSA 4TLBA 3T3DA 1J0CA 1P0PA 3WLOA 2FH5B 5KVVA 1WSAA 1CWUA 2GD2A 3MINA 1RAAA 2OCKA 4XDZA 4CM1A 2JAOA 1ZM2A 1D1QA 5ABPA 3ETLA 5JWRA 1L5FA 3O74A 3AHDA 4GQAA 3MIIA 4KLRA 1W73A 3DCNA 4J75A 3EJWA 3TLXA 3VC2A 5L3SB 1GR0A 2W6ZA 3P0EA 5JXHA 3ZVLA 4MJLA 3CRW1 1NOIA 3L4JA 3D59A 1IUNA 1X1EA 1SXJD 1X7WB 3IJPA 3PTZA 4UDXX 2HIAA 4DG9A 1PFYA 2ZVJA 4MKHA 3O3MB 1UDCA 1O8BA 4NFLA 3HDVA 3CLUC 3BMNA 1CDZA 2IYYA 2GM5A 3ZE6A 3EVTA 2GJ9A 3B85A 4F8EA 4LE2A 2O7RA 1TCCA 3ELDA 4R3WA 4UU1A 3UMYA 1WNTA 1RHMA 1Z34A 5EP1A 1AKNA 3RFFA 5B3KA 4TV8A 1T36A 4H1VA 2AXQA 1CZUA 1Q1AA 1VECA 3I09A 2C8KA 4FYHA 5SYAA 4ZAWA 5K6TA 2FJPA 1PDOA 1HQKA 1U7ZA 1ND6A 3LX4A 4M3NA 5A3VA 1Y7IA 3DE0X 4AZ0B 2PYDA 2OXFA 2V5UA 5DRYA 4R98A 1B23P 3PHLA 2Z8YM 4FOOA 2BGTA 2IYWA 2JFXA 2ZREA 4BGEA 4DUYB 3KU4A 2BMAA 2X14A 2WJPA 1KQGA 2M98A 3CN7A 2JAHA 2XB9A 2ZIWB 1M2OB 5JFGA 4MNTA 4RTPA 2DWCA 1JG6A 1G6Q1 3R7BA 2PZLA 1LW7A 4C2UA 1DUSA 3LSTA 3NAGA 1P73A 1PCXA 2C7VA 2WJAA 1RYDA 1VPTA 3OIYA 4WFQA 2ETVA 3U9LA 1JBEA 4QBKA 4A6DA 5IZ4A 3LOUA 2ZR7A 4M86A 5I4IA 1CR1A 2H1CA 5IAOA 3HI6A 1UXGA 8GPBA 1FPMA 5B3JC 3I42A 1SC3A 4L22A 4PG5A 3F49S 2R8YA 4HQOA 4WVFA 4URYR 4MVJH 5IH3A 4ZWNA 4K6HA 2FPMA 4ZU6X 4K6FA 1M5RA 4B2LA 3FOAA 4C4TA 4CTKA 1ILEA 5K4HA 1QP7A 1DXHA 5JMTA 1PZXA 3UMGA 1NF3A 2DH5A 1GA1A 4LZOA 3UJCA 2OAEA 1P81A 4GX1A 4UXJA 7REQB 4QXOA 1RM5A 4ML3A 2XRYA 4F4IA 3MRXA 1IHYA 1NQXA 1YB7A 2CXOA 1WMEA 2TS1A 4RYLA 1TT5B 3NB0A 3V8MA 4ICIA 2DGDA 4EEZA 1TK9A 1Z68A 1SU6A 4V02A 1RQRA 1B0ZA 4EHLA 4O3MA 4YQYA 4D99A 1XBTA 2P0YA 4MLDA 2V54A 1ZDMA 4F5WA 4B2PA 3Q3GE 1DQYA 3R20A 1O77A 3RREA 4A2QA 5C1PA 2GR9A 5CEFA 1L7RA 1MO3A 2NZJA 2Z5VA 4KV7A 4AX4A 5LQUA 2ENWA 2WG2A 3D4NA 4JASB 4PS1A 2PX2A 3ZDEA 5B5SA 2XYPA 5C5DA 4A91A 2OC9A 2VJLA 3G2NA 4M83A 1OOEA 4O5AA 3A25A 1SWWA 3TZEA 1GZ6A 3L7MA 3KXIA 5HKBA 3MSCA 4D02A 3WDMA 3TR6A 3IAXA 3M5WA 2IS6A 3H6GA 3MBIA 1GZ4A 4HDMB 4NMHA 5LNK6 3VJRA 1E69A 4GX0A 1DOZA 3UHOA 4XZ3A 1LU9A 3AHGA 3D3JA 1LBIA 5D3MB 3SXJA 3LQ4A 4BBPA 4KSCA 1D6JA 2PRIA 4AZVA 4XGIA 3Q2OA 5K45A 4I99A 3LBHA 3E8SA 5K8TA 2GMWA 2NU6B 3WZ2A 1KO7A 3GZNB 3WJAA 3EXHC 2BW0A 3LCMA 2UZ0A 1KJIA 1WMBA 2IC5A 3OF3A 3T5AA 3U44B 4N49A 2WYWA 4OCZA 1RDFA 1SB8A 3GA5A 2I34A 1DUIA 4OI1A 3DAFA 3ZBUA 4BVGA 3ZCPA 1B0UA 4YACA 2ZVQX 2ZRHA 2H5JA 3OZDA 5FWAA 1MZVA 2AH5A 3NMUF 1O94C 4ODIA 4X6XA 5E1DA 4IWYA 3DEYX 3GY0A 3OJWA 1JPUA 1KSGA 4D4HA 3CRMA 2ZRQA 2JDID 4LPKA 1JAYA 2C3PA 1AKMA 4JI0B 4Q93A 4IXMA 2AN9A 2XE8A 4LV5B 1Z8DA 1VBFA 4CTOA 3HCBA 1KY3A 1TC2A 4QDZA 2X4IA 2X8BA 2WD7A 2XOKA 5D51S 3ZGOA 1M9NA 1E6EA 1RJFA 5KPDA 1SQ0A 3GJ5A 4ILKA 4E3ZA 2AHRA 3BFPA 3OZ7A 1W1UA 1CUVA 1HPLA 2I6GA 1P7CA 2GD6A 4I4LA 4ND7A 3EPRA 3RGGA 2L69A 4EG7A 7ADHA 3SE0A 4QHSA 5K8LA 2Q46A 2P2ZA 3KQHA 1EFHA 4C2AA 4KN9S 1U3GA 4FS3A 4L5AA 4WCFC 5I8WA 1HY3A 4DDTA 4OQEA 4YBRA 3NH9A 1QP0A 2NO0A 1CY7A 4DN6A 4WPGA 4WEOA 1DQSA 4MV8A 5IU6A 2YJ5A 4JOQA 3IHKA 1EBBA 4OHRA 5FOVA 5BQXA 1TLLA 3TQIA 1CDOA 1P91A 2E1RA 4BZZA 2J4CA 3RAJA 5FQOA 4IM7A 4BZWA 1R0XA 1C8LA 2DWPA 1LLDA 2PLAA 1SPBS 2Y1KA 5TRTA 2C4HA 2YWDA 2H0QA 4LRQA 1WBDA 4JMLA 2O8DA 2GBIA 4XJXA 3AYZB 2X3UA 1RE1A 4Z9AA 3K9HA 1VIDA 2OORC 1V8DA 4YB8A 1JZQA 3IKVA 4XD2A 1N2SA 3URMA 4D9MA 1CUUA 3S2FA 1J42A 2Z58A 2WU1A 3R5JA 3SQXA 1EQ2A 2FWIA 2VAWA 1T9BA 1GPNA 2WTAA 5DASA 1ZLYA 2D8MA 1X19A 4FN4A 2EKQA 2PLNA 4Q7EA 2FSHA 2NZUG 4QHTA 3ELWA 4COKA 2ATIA 3ND9A 5FCDA 2XH8A 1F14A 2C2BA 4PPYA 4E32A 4RAQA 1T2DA 1H0SA 5I7EA 2K7ZA 2P67A 4CHGA 1EFAA 3HBJA 5KINB 4M1TA 5KSZA 4G1FA 4DLAA 2XF8A 1Z5UA 2HMSA 2XQGA 3DOHA 3CNLA 3AUFA 2II6A 3QUQA 1FXWF 4FNMA 5LQNA 1XOIA 3PGJA 3Q9LA 4O4IF 5BOSA 1P0CA 5J43A 5J58A 2I2XB 1QIHA 4GPBA 3PUWA 2ZJYA 4UPVA 1OIVA 1YCFA 2A5GA 3W06A 2F3SA 2VJOA 2E87A 2A7XA 2ZVPX 4WOPA 1WBBA 4LF8B 5DLYA 1VRCA 1C7ZA 2ZE8A 2ZETA 1YS1X 4JA0A 4N6NA 1U6IA 3BF8A 4OBXA 4DCGA 2XKKA 2F48A 1C8BA 3IPRA 4MWSA 4CM7A 3ID6C 3MUEA 4NATA 2AJDA 2DWQA 5EJIA 1H6AA 3LQ1A 4WHMA 2DHEA 2WD8A 3EPJA 1F12A 2XYHA 3PCXA 4KXXA 4G5YA 2FG5A 4H6XA 1IN5A 2QLBA 4GO1A 4MI9A 1KK0A 4KIWA 4PC6A 2B4KA 4CQJA 5AOVA 1JQDA 3W77A 2APJA 1I2ZA 3QKRA 1UJ5A 1RT9A 5LKAA 5JDCA 2Q6KA 2HA2A 5FUWA 3ICVA 1QHYA 1ZM3A 5ALOA 5ULLA 2HRCA 4YCMA 3MJCA 4UTNA 1NIJA 3BMCA 3SHVA 1IBLB 4WNIA 2WINI 4DKJA 1RMTA 1Z8HA 1LSSA 4WN9B 3RIHA 3K5WA 3SR4A 1OBVA 3G7UA 4J3JA 4C21A 4CL8A 2PT5A 3QG1A 1E79A 5E7IA 2Z43A 2BGUA 2Y0PA 3NNNA 4OFWA 1F8YA 1MJFA 2ZB2A 3N6XA 3PWZA 3EIOA 3S2IA 5CB4F 2X2EA 4L8LA 4ALIA 1Z4LA 1NZDA 3CLSD 1Z4IA 3CNNA 1AZLA 1XMJA 3L0BA 3AWIA 4KMMA 3KIPA 3ZH9B 3KTAB 1O9HA 4YUVA 3X43A 5CITA