2CXXA

Crystal structure of a probable gtp-binding protein engb
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
184
structure length
184
Chain Sequence
b'ATIIFAGRSNVGKSTLIYRLTGKKVRRGKRPGVTRKIIEIEWKNHKIIDMPGFGFMMGLPKEVQERIKDEIVHFIEDNAKNIDVAVLVVDGKAAPEIIKRWEKRGEIPIDVEFYQFLRELDIPTIVAVNKLDKIKNVQEVINFLAEKFEVPLSEIDKVFIPISAKFGDNIERLKNRIFEVIRER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable GTP-binding protein engB
molecule tags Cell cycle
source organism Pyrococcus horikoshii
publication title Crystal structure of a probable GTP-binding protein engB
rcsb
total genus 65
structure length 184
sequence length 184
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2cxxA00
2QZ4A 1YR6A 3N2IA 2BV3A 1RZ3A 3UWKA 2GJKA 3QIAA 3DVLA 1MRNA 3K0SA 1N0UA 3PUVA 2ZSAA 4CEHB 1J8YF 1MV5A 5KTYA 1NVVR 3RRZA 3TLXA 1TX4B 4PZZA 3PQCA 4LJ8A 1CRQA 1JPJA 2ZR7A 2PMDA 1TU3A 2ORVA 4HLUC 3KJEA 1GVNB 4KODA 4KYUA 1YKSA 2HYDA 3UMRA 2WWFA 1PUIA 3S1AA 1IQPA 2WJHA 3NEJA 4A4DA 4F38A 1NRJB 4PPQA 2WJJA 4OHVA 4B2LA 1GWNA 2ZXUA 1YZTA 1E9DA 3AF0A 2BBOA 2CJWA 4TMVA 4JLDA 2OFXA 1RYFA 2QRZA 2R6GA 3NXSA 4TTQA 3MWKA 2HT1A 2AK3A 1HV8A 1YZUA 1WP9A 5FH9A 5FPYA 2OCAA 5IDVA 2XZPA 1A7JA 4G5GA 4XVQA 4JSTA 4NYJR 5BN3A 3OAAD 1NBME 4ACBA 5JEDA 2QE7D 2UVQA 1YHNA 2ZU6A 1GILA 2AFHE 2WKPA 3GCGA 3VR4A 3QPUA 3MAAC 5GJVC 4A8JA 4M1YA 4LHXA 2CXXA 4QHYA 4B3DA 3GJ7A 2QTHA 3PUWA 3EW9A 1XCMA 3VTKA 2VHQA 1T6NA 5KOYA 1CXZA 4OJQA 3OESA 1GNPA 1RRFA 1UDXA 3FHOA 4I1VA 1AM4D 4L9SA 1E4YA 1Q1EA 3PIRA 4TSFA 621PA 4C0QC 4AYXA 2FGKA 1E79D 1U8AA 4Q7KA 1XD9A 4D25A 4G3XA 4DBLC 5EXPA 4WXPA 2XJ9A 3K09C 4PAQA 4X8HA 5FBRB 2IXFA 2IW3A 1G3RA 1KNQA 1DVRA 1T9HA 3KKOA 4KFUA 1XJQA 1XXHB 4GZLA 4RZ3A 5GVSA 3GLGA 2CEAA 3EASA 4M2LA 1FX0B 3AEZA 3BK7A 4RCYA 4C0SA 4XVRA 3H0KA 2CLCX 3WXMA 2EWVA 3AVOA 1WMSA 5JJKA 3RRMA 4ON9A 2OLJA 4XSHA 1LB1B 3FKSA 4HDOB 3E70C 1GDDA 2JLWA 4Q9HA 1NMYA 2IHYA 2O8BA 3KDSE 3REGA 4BUJA 4BWYA 1U0LA 4JL6A 4A1FA 4BRWA 2XITA 4NCHA 2LWIA 3BC1A 1G64A 1ZBDA 5CYOA 4YMVA 1COWD 1TPZA 3W3AA 4BZPA 5KO2A 1EFUA 1OFHA 4IXNA 4XWAA 3BB3A 1PV4A 5CM8B 4QM7A 4EQ6B 5KPDA 2WKQA 3P4YA 4QHSA 5EZ6B 5TARA 1W0KD 3U6KA 3THWA 3SFVA 2G0NA 3FDIA 1P73A 3DOEA 2FV8A 3SEAA 2GXSA 4NPHA 5HR5A 3DM5A 1R6BX 2IYYA 5L8VA 3O8BA 3WRXC 1WA5A 4Y0VA 1BO6A 1X86B 3KQLA 2B7CA 1CULC 3KXKA 3PVSA 5EXXA 4NCJA 4YQFA 5DHFA 3QXJA 4OJKA 1P60A 1E0SA 1T0HB 5FOSA 2QROA 4WBSA 3VFDA 1KO5A 1G7CA 1GNRA 2GXQA 4QRHA 1BMFD 1H8EA 3OEHD 3QF7A 1ZM4A 4QFMA 1JR6A 1KJWA 2RGNA 4JVMA 2B7BA 2WZQA 3A4NA 4A15A 3A1TA 4EIWA 1VYUA 3OIVA 4YC7A 4LJ5A 3VU9A 2ZUBA 2XSZA 1EWQA 2GAOA 3RYTC 2XTMA 1MO4A 2RHMA 2CL0X 4GZMA 3NBFA 1WQ1R 1Z28A 2JJ8A 4FCWA 4JL5A 5AJXA 4M1MA 3LLMA 3C7KA 2V3CC 4JBYA 2O8EA 1ZP6A 3TUZC 1ZNYA 1N6HA 1XMJA 4P4TA 5K8TA 2ZJ5A 2GZHA 2PJRA 4PR0A 1R5NA 3K0AB 5CDFE 2LKDA 3UK6A 1D9ZA 1KI1A 3FMIA 4RJLA 1CR0A 4I99A 2JLXA 1N6LA 3THYA 2GK6A 1G3QA 5KNCA 3T1QA 2WPDD 2IWHA 4Q02A 3W9YA 3IIKA 4UXHA 3I1FA 2XZOA 1BS1A 1LFDB 4QXAA 3OIWA 1LS1A 4URYR 1GL6A 2A78A 4UQOA 5H8WA 4C0JA 3WP1B 2FE4A 1Z6XA 3RWOA 2QENA 1EFTA 2QMEA 1KSHA 4JJZA 2PCJA 4FMCB 2D7DA 4KLNA 3LWNA 1E9SA 2WWIA 2WJYA 3UATA 2DWQA 1MKYA 1KJZA 2YNMA 2GXAA 1W0JD 1G16A 1SHZA 4M21A 4AG5A 1VIAA 1PUJA 5AWFC 1FNNA 3PEUA 5FUYA 3RAPR 4WA7A 4DLTA 5E4FA 2AD5A 2IXEA 3B1YA 3WNDA 3GJ3A 4GMXA 4G5OA 3Q72A 4HAYA 1NF3A 1XZPA 1N6PA 2O8FB 2JJ2D 1CTQA 3EARA 2FU5C 4UXJA 2OV2A 4BFTA 2REBA 4KLZA 1MRSA 1M6NA 1R0YA 2XNDD 4QBHA 3DM9B 4ITRC 4DDTA 3P4XA 5L3VA 1YZGA 1NLZA 4G0NA 2FPMA 2XXAA 3FYHA 1G5PA 1L4YA 4NDZA 1I2MA 1GM5A 4K46A 1EESA 2ERXA 2YV5A 3EA0A 5K8LA 1DTSA 3BD9A 3W8NA 3ZIAA 1VYTA 1E2MA 1LY1A 2X2EA 3QXXA 1LNZA 4DEYA 5JHGB 4YXWD 4W9MC 3UPUA 4PPGA 3UMFA 1SKYE 4NYMR 4OBEA 1OXTA 4EUNA 4C0LA 3EC1A 4US0R 1TEVA 4LYJA 3TUIC 2IA5A 2QL6A 2PCLA 1KIMA 2ZI9A 3FWYA 2EYUA 1R0ZA 1XXHA 2C95A 3GFPA 3LBHA 3ZVLA 1F2TA 4D80A 5AUNB 2PLFA 5C4GB 5CIQA 2H18A 2VP9A 4PSVA 1TL7C 1CP2A 4UNQA 2DB3A 2F7SA 4GFDA 4BLTA 2F6RA 3VMFA 1KDRA 2K5UA 4P32A 4C4PA 1GRQA 1ZNZA 2W6JA 3FTQA 4DXAA 1Z07A 4TT3A 2QBYA 4L4UA 2EU8A 3TGPA 2FGJA 2BBTA 2WSSD 3TSZA 3HYTA 1A4RA 3KJHA 4R71A 1YZLA 5B64A 1R4AA 2BMFA 2OM2A 1YRAA 5F3WB 1M8PA 1R8SA 2HUPA 4JLPA 4QL3A 4IXMA 4RD0A 2F1HA 1FFHA 4HAZA 4Q7MB 2OHFA 5GVRA 4MRRA 2CCGA 2XB2A 1W36B 3KB2A 1XZQA 1OH5A 2ZYWX 3B5JA 4XVUA 5TY0A 5KSYA 4GOJA 2YWEA 1TMKA 1YU9A 4WVFA 2RGBA 3A58B 4C0AC 3IQWA 4CEIB 4TLBA 2R44A 1R0XA 1ZIPA 5CIWA 5JJLA 2ZPTX 4NYIR 5G3YA 1Z83A 4LV6A 4TL8A 4RD6A 4PQFA 2NO7A 4JBWA 4ARZB 4PO8A 5HTKA 3X1ZA 5FR2A 2FFHA 5G40A 4EPYA 4HB0A 1IOZA 3G5UA 4CEIA 2H1LA 4W7SA 3QKRB 3IDQA 2Y8EA 5JJIA 3EIQA 2CLDX 1KY3A 2ZROA 4KBGA 4B3CA 1CBUA 2VF8A 1NSTA 1J99A 4HSEA 1D6JA 2QAGC 4LYFA 1QZXA 1E2HA 1N5LA 4FMCF 4U00A 3TRFA 5BN5A 1PZNA 5DHAA 4Q4AB 3WMFA 5EUQB 3BFKA 4AKEA 1JR3A 1D2NA 4XWOA 3EWAA 1NVXQ 4LBWA 1WE2A 5J5CA 1W48A 1NVVQ 2FSGA 2IL1A 2UZIR 2G0TA 1OPXA 4HAWA 4E22A 2CHGA 3K9LA 4TTPA 2XTZA 5TDHA 1HT1E 3R8CA 2O8EB 3LD9A 1EG7A 4BLQA 5JWRA 3A6PC 4DT1A 5KDDA 2VHCA 3V4FA 5LD2B 5DSZA 4CT5A 1F6BA 2RGNC 1KYIA 4MKGA 2JATA 3K9GA 1SVOA 1HH4A 1QHSA 1PJRA 5G53C 2QE7A 4CDGA 2WPDA 1NY5A 2O8CB 1H8HD 2W00A 3BFVA 2ONJA 4BECA 1G4UR 3NIBA 1Q12A 2ZYVX 4TQ9A 3CPEA 3ND8A 2QP9X 1KNXA 3NC1C 3FPAA 2Q9BA 4UKDA 2DYKA 4AYWA 4YDHB 4G5RA 3AKCA 4UJ3A 3IUYA 4F4JA 4AKGA 1UEIA 3REFA 4P4UA 2O8CA 3TSWA 5IF9A 1QVAA 5BYKA 3TKLA 3ADKA 1MABB 3BFXA 3D31A 2FSHA 2IS1A 4EQ6A 1P4SA 3AGQA 1YRBA 4PC1A 3RVBA 3AVUA 4XSGA 3W6OA 2XZLA 3U60B 2V7QA 4GOXA 4D82A 1L4UA 3TH5A 4FW9A 3T5GA 3CRMA 5JI3E 4NYJQ 4TL6A 4G01B 3WNCA 4Y0AA 1G6OA 1NN1A 4O2LA 4X8LA 4A92A 3KQHA 4GRAA 5FTLA 3FOZA 4JIMA 2QQEA 5JSZB 4PFSA 1MOZA 1F2UB 1Z2AA 1XCPA 1JALA 1ZJ6A 1NL3A 3QG5A 1E2JA 2A30A 1GKUB 1GSIA 2L0XA 2ZR9A 4TL7A 4URWR 4A2PA 4IDNA 1II8A 2OEPA 2IS6A 2XB4A 1D5CA 1XPRA 2NMVA 3WRYC 2OXCA 1LS6A 4QHTA 4BEBA 3HPRA 2VHTA 2VF7A 1E98A 1ZD1A 1OXXK 1JXOA 4GL2A 2P0EA 5JFGA 5EP2A 1E9AA 2Z5FA 4LSGA 2WSMA 3CO5A 2ZRJA 4Q9IA 2VP2A 4B32A 3IO5A 4Z1MA 5B30A 4IOKA 3OZXA 2P5SA 4LYHA 1J70A 1G7SA 1AZTA 1LW7A 4GSYA 2CVHA 3MRSA 4DB4A 1EXMA 3RS5A 3H84A 2ZJZA 4OI4A 2V6JA 1X8JA 5IK2A 3N2EA 2OT3B 3E2IA 3Q7QA 3L2OB 3MCAA 4DLXA 4Z1MD 2IHBA 3SE0A 1A5TA 1KI9A 3U6BA 2KE5A 5JEEA 3F3YA 1G1MA 2F9LA 2WWXA 1Z0AA 1UJ2A 4NH0A 1RW4A 1EWRA 2D74A 4EDHA 3DZ8A 4DT1B 1IM2A 1CJVC 2BJVA 2O8DA 2ZANA 2J0UB 3BWDD 2PZFA 1EX7A 1A2KC 1S0UA 2G77B 3DL0A 1A1VA 1CJUC 4Q01A 2NZ8A 2PH1A 5EP1A 3D8BA 4MKHA 1FP7A 1AS0A 3KKNA 3K8YA 1KK0A 2ZRAA 1P2TA 5G3ZA 2O8DB 3VX4A 5A4JA 1OV4A 4LJ6A 1RYHA 4DC9A 5K8IA 2FFBA 2DCUA 1IJEA 1EFHA 1R0WA 5EE9A 4BFUA 2KB0A 1E1RD 3NKVA 2QP3A 3OIUA 5FR1A 2X77A 4Q1EA 1OB2A 4K8OA 3PV0A 1DO2A 4QBGB 1DG3A 1BIFA 1X1RA 1XDBA 4QBFA 5G41A 1W4AA 1U98A 2ZE7A 1CU1A 1TUEA 3LH5A 2NO0A 2WMOB 4GP7A 3FMOB 3THXB 4M8NE 2JGNA 3B60A 1G8HA 3BB4A 1X6VA 1BOFA 3PXGA 4MGKR 1M1YE 1OHHD 1J7KA 3NBXX 5F9FA 3W8RA 2ONKA 3EZ6A 3WY9A 5EJEA 4M22A 1P9RA 1E0KA 4TLDA 2ZS9A 2VTKA 4BLOA 4QGGA 3JVUA 4PHFA 3SZRA 1TUIA 5BW8A 4DLZA 2FG5A 4U5XA 2C9YA 2W83A 2N46A 3PUYA 3DMNA 4TYWA 1CR4A 1E2QA 1M7HA 3CBQA 5FOVA 5FBLB 2JA1A 3FMFA 3CZPA 3F8TA 3AV0B 2F1JA 3HU2A 5CK5A 1GNQA 1HQYE 3BORA 2C04A 3FVQA 1KK1A 4Q47A 3QKSA 4HDQB 2DR3A 2PT7A 2BVNA 1BYIA 2O5VA 1QG4A 3R9IA 3FHTA 3B82A 2AXNA 4DIEA 2EW1A 4OYHA 5EXTA 3TBKA 1EGAA 4RFVA 3AGPA 3U7EB 4C7OB 1A82A 5FL7D 3NH6A 4Q1CA 2X19A 2HEIA 4Q4HB 3A8TA 1I4DD 2H57A 1Q21A 3LNCA 5DH9A 1UBFA 2X8AA 1NP6A 2CK3D 2ERYA 2GJAA 2OXRA 2ZS7A 2ZJ2A 2FEOA 3OEHA 1KO4A 5FBVB 2V7QD 1KI4A 1YR8A 2JLQA 4AKIA 3OF5A 3JZMA 4RD1A 3QUSA 1G21E 1XTSA 1LTQA 4CGZA 4ZDJA 3VQTA 3ZYCA 2PJZA 5AJWA 3MJHA 4BPBA 1H65A 2OSBA 4PSKA 1XJCA 5KSPA 1T5IA 4HDCA 2VO1A 4I1UA 4KAXA 5FPKA 3THWB 2HJVA 2WJGA 4OI0A 4HAXA 4KCGA 1NY6A 3CIOA 4Z8YA 1ZNXA 3LAWA 5SZJA 3X2SA 4B6FA 2IS2A 3QNUA 3U7GA 1XJ0A 5HZKA 2WJIA 3QSYA 4B35A 4JL8A 2GKSA 1TEXA 4OK3A 1RJ9B 2J41A 1UFQA 4EPXA 1FNMA 4IJMA 1SVWA 1KI6A 4ZDIA 2F1IA 1TQDA 2J1LA 1UF9A 3C15C 4DLUA 1R2QA 2G1JA 3RS0A 4PQYA 4BQSA 4LJ7A 3VHXA 1HYQA 4WZBE 2OCYC 3EZ2A 4TT3D 3EZ9A 3AF4A 3BRWD 3PEVA 4IVQA 5FI0B 3TMKA 3DMDA 1S1MA 5AK0A 1XX6A 3LVQE 5KU1A 4YMTA 3QI2A 2Z6VA 2GVDC 2CNWA 1HQCA 3PEYA 2O0KA 3HU3A 1GRRA 4U02A 1TTTA 2FA9A 3LBIA 4X8OA 2BC9A 1UADA 1W4RA 3KTAB 4QJ5A 3K53A 5HE8A 4TLAA 1M7GA 1P61B 2REOA 4KJZA 4TYPA 5A5GA 2FNAA 2J3EA 2P67A 2B6HA 3CF2A 3VR5A 3CF6R 3QPVA 3ASZA 3LY5A 5KNBA 5L3QB 4YXWA 1NLFA 3R8FA 1Z0JA 2A9KA 4RD2A 1VHTA 4DDWA 1FP6A 1FTSA 3P26A 2B92A 1KMHA 2J9RA 4ZCMA 4ZCLA 5HZHA 1P75A 2QMUA 2FJUA 1CRPA 2I3BA 2V1XA 2NPFA 3VHLB 1BMFA 4A2WA 4FI3C 2J0VA 3SJBA 5H1YA 2YZ2A 4CEJA 4TLEA 1E1RA 1SXJC 2OILA 4OL0A 4WAUA 3A37A 1ZVQA 3U3KA 1P2VA 4HYYA 3QEJA 2WAXA 3NTUA 2VIIA 1E94E 1ESMA 4O3MA 2VP4A 4LHWA 1CJKC 2F43B 3WBJA 4D4LA 4AY2A 1S4QA 4R9UC 3RS7A 2UKDA 1OIVA 1KAOA 4FD2A 4E07A 4C0BA 3RANA 3W3ZB 2AD1A 4US2R 3DKVA 1RRPA 2P65A 4Q00A 3CX7A 2ZYTX 3RS3A 4EFNA 2W2TA 2GNOA 2W6JD 5IT5A 5P21A 4MYHA 4URXR 3BB1A 4JLAA 1G19A 5DN6A 4HEJA 3FFAA 3GMTA 1XCGB 2E87A 2GJ8A 2P5TB 3KKPA 1WBDA 1SULA 2MSCB 1PLKA 3AP3A 2R2AA 4ZPXA 3UG6A 1CR1A 3TAUA 4QKQA 2B8TA 1YZNA 4V0ME 2J5XA 2ZSDA 2O0JA 1Z5ZA 2BWJA 1UDWA 1G18A 2ZTSA 3U44A 4R98A 3IHLA 3LA6A 3WYGA 3GJ8A 1SVLA 2N1BA 3M6AA 4BLRA 4ERNA 4EFLA 2DFNA 4LBVA 4AKHA 4RKEA 2D62A 3EZFA 1W5TA 4GNKA 4F91B 2RGDA 1Z8FA 4B6EA 1NJFA 1E2NA 1EK0A 1OKKA 2GZAA 1SVMA 3WHKA 2IYQA 2OE2A 4LPKA 3AVXA 5LB4A 4BZQA 2DFLA 3ZD7A 2C96A 1IN5A 3I4LA 2KJQA 2QPTA 1HUQA 2V55B 4D0NA 2AKAB 2OCBA 3QKSB 2C98A 4H9GA 4W5HA 2GILA 2XJ4A 4M9QA 1MH1A 5BXQC 3NBZC 3QOFA 1XPOA 1MO5A 3QKTA 5JS8A 4URUR 821PA 5KHOC 3B78A 3QF4A 2XTNA 5AUOB 4D2IA 4KV9A 3VR2A 3IHWA 2DWOA 5HPYB 1X3SA 3G0HA 4HB4A 2CNWD 1VTKA 3ECCA 1G6HA 1U2RA 3AUYA 3WMGA 5C2JB 4P31A 3PITA 4XWKA 1U94A 4JLJA 2V9PA 5IHPA 1JAIA 1NVUQ 3THYB 1P5ZB 4E5UA 2FWRA 1QG2A 4AYTA 3CX6A 2EFCB 1CS4C 1KI7A 1KK3A 3P32A 4DDVA 3AVVA 2IS4A 1J2JA 1O87A 3OEED 3ZZ0A 1DEKA 3K0CA 4F7WA 5HKKD 4QGHA 3CB4A 4Q7JB 4S35A 1QVRA 2OZEA 3HWSA 1T3LA 1YJ5A 3ZVNA 1AN0A 4QOSA 3ZVMA 2J0SA 3WYFA 2R6AA 4Q7LA 2HXYA 3KXIA 5DO9A 2ECKA 2IT1A 3V00A 2YWGA 3LBNA 3GLFB 2Q6TA 4Q9JA 1CIPA 4EPWA 2PZGA 4QBIA 2AFIE 1QHHB 2QEQA 3WBKA 1G8FA 1UBGA 2CL7X 1FQKA 2VPPA 3DDCA 3I32A 4MDFA 3K0FB 2R6FA 2AL7A 2AWNA 3B7GA 4IEEA 1Q1QA 3F0TA 5CLQA 1IXSB 1Q22A 2AR7A 2GBLC 1E2IA 2IUUA 3MWJA 4ILEA 2BCJQ 5A0FA 1Q3TA 4URZR 5J4YA 4PHHA 1AK2A 3SS8A 1T0JB 4JJKA 3MGCA 4ARZA 4N3NA 4HLDA 4OK5A 1VPLA 1W46A 1VIYA 2EVWX 3KKQA 2ZRCA 4NE2A 2JJ1D 5TB5A 3BBPA 2GESA 1DAIA 4M1TA 3NVAA 2HYIC 3K70B 4LRWA 1RFLA 2ZAOA 2CDNA 5BYJA 3AVQA 1KI3A 4B34A 2VLIA 3JZAA 3U7HB 2VYFA 3C16C 2AKYA 5SZKB 1P9WA 1U8YA 3X1WA 3UIEA 2CCJA 5EE3A 1TF7A 3TW4A 1G3MA 4PQRA 3RSOA 3I92A 5CYPA 3TR0A 3R20A 1E2LA 2ZJOA 3GJ6A 2NGRA 1T3HA 2NO9A 2NQ2C 4FCTA 4M1SA 4RCZA 1KDOA 3E1SA 3CRW1 4KSBA 3B1XA 3I62A 1XEXA 4NCNA 3TSOA 4S2EA 4UJ5A 4AIIA 2B8WA 4FMDB 4MRPA 1KSGA 3TNFA 5C1BA 2RHDA 4JYBA 2Q3MA 3RC3A 2CE2X 4B44A 4BFYA 3GLHE 3U3JA 4TN1A 3LV8A 3FB4A 4DKXA 1ZU5A 5JWHA 2W58A 3BS4A 3CUEF 2GCOA 4RD3A 4A0GA 3A1VA 2WAYA 5JRJA 2N42A 4B71A 1UM8A 4FXPA 1ZYUA 2YC4C 2H8KA 2ZI6A 5FFMA 2J7PD 1WRBA 5JHHB 1US8B 5HCIA 2OBLA 1XPUA 5FOTA 5DI3A 2D2FA 1D2MA 1E32A 1U9IA 5AJVB 3CM0A 3K70C 1N0VC 4NU0A 1S9DA 5IRCD 3K09A 1MR3F 1NJGA 3CWQA 2F3TA 2A5DA 1Q20A 4A0HA 3I5YA 3AVTA 3KQUA 2JJ1A 4CIDA 2EFDB 4KVGA 3CPHA 2VL7A 2VP6A 5J4HA 3U5ZB 3IEUA 4PO1A 1E79A 2CBZA 1TQ2A 2F9MA 1AS2A 2G6BA 2ZJYA 2GCNA 1NBMA 3K1JA 1OKKD 4V02A 3VR6A 1AKEA 1BYUA 2NO6A 1Z0DA 2NOAA 2ZJAA 2ZRLA 2NPIA 1ZM2A 4IOLA 4DSUA 1SVSA 5JMTA 4DB2A 1KTVA 5TV2A 3I5XA 3BXZA 4R7ZA 2DFKB 1W2GA 1P7CA 1SKQA 3R9WA 4LBYA 3OFND 1D8TA 2YHSA 1RE0A 1G17A 4JKIA 4Z54A 3QPWA 2PL3A 2ORIA 2IYWA 2ZI4A 3EPKA 3T61A 3GPLA 2NTYC 2ANCA 5DYIA 4P0TA 4YDSA 4POAA 5EP3A 3QY0A 3HJNA 4BFSA 3PCRB 1C4OA 1IN6A 1W49A 2DWPA 1U0HC 2O0HA 3ZQ6A 2WICA 1P62B 4B2PA 4P33A 3LFUA 4LDJA 121PA 4D4MA 1CJTC 1D9XA 1F2TB 1G291 2A7QA 2ZRFA 3I72A 3QJYA 1DAFA 2WVJA 1TF5A 3RSLA 2QAJA 4AK9A 4ESVA 1WXQA 3CNNA 2IYTA 1N2CE 5GJWC 2QMHA 3SI7A 2ZYUX 4C2TA 4RZ2A 2ZQ5A 1NIJA 1U99A 1QDEA 3K9NA 4FMBB 4HB2A 4D0LB 3H2YA 1ZW6A 3NHBA 3B1ZA 2YYZA 5M04A 4I4LA 5SZHB 3RHFA 1T8TA 5L3SA 2C9OA 3X1DA 3QG1A 3TQCA 5JSZA 3NBYC 4URVR 4B43A 1E9CA 3VR1A 3UKDA 5LBIA 3UXMA 3CONA 1ZD8A 1P3JA 2F55A 4TL9A 4M9ZA 3BGWA 1N25A 2HDNB 2ZSBA 1W36C 1OIWA 5AJYA 4MRSA 1IN7A 1FW6A 3GLFA 3EX7C 5LB2A 4DSOA 1R8QA 1R5BA 3NHAA 1KKMA 3P27A 4C0KA 2QAGA 1G20E 1Y63A 3EPJA 4ACAA 4MYCA 2WSSA 4DJTA 1E2GA 1JQLB 1Z6YA 5CM9C 1TAGA 3A1WA 2XAUA 3D6TB 1QHXA 5C4MA 4OHXA 1GAJA 2R62A 3I8XA 4IDQA 4TMXA 5E95A 2JLSA 5CLLA 1IJFA 1KMQA 3KTAA 2R6CA 2XXAB 4D4JA 2VHUA 4AD8A 1P2UA 2FFQA 4Q21A 3BH6A 1UEJA 8OHMA 1DELA 3QQ5A 1S1CA 2BMDA 5LPNA 3U3OA 2ORWA 1SXJA 4CW7A 2GTPA 3QVVA 4B76A 4I81A 1ZUHA 3F5FA 3LW8A 5KDOA 1N6NA 1VKJA 1RC8A 1E4VA 4BLSA 2GVZC 1BKDR 3KJGA 1XU4A 4L15A 4LJ4A 4YMSA 1DO0A 2DBYA 2NO1A 3U4QB 3W6NA 4WW0A 3ZZTA 4QJ3A 1SXJB 1XTRA 4LCBA 1O3YA 4CEHA 2GA8A 3R9XA 1OYYA 1JR3D 1DAKA 2ODWA 3UMSA 1IXRC 1ZC3A 1AQUA 4B74A 1UBEA 4TQAA 4WIAA 2OUKA 1QHIA 5LD2C 5FOWA 3S1AB 1VMAA 2ZRKA 1N5JA 2BEJA 3AF3A 4NHOA 4V0NA 1COWA 4EFMA 3WNBA 4B3BA 4BFWA 1OFTA 2A5JA 4L9WA 2QUZA 3LO5A 1Z06A 2LKCA 1F48A 1EFCA 4LHVA 1OW3B 1UKVY 2QP4A 3SYNA 3KL4A 2YOFA 4RD4A 1XFAA 4QJ4A 1KO8A 2BM1A 3TVTA 1JQJC 4OHWA 1XD2A 3W5IA 2CK3A 2RGCA 3SYLA 3GJ4A 3VAAA 1QHNA 1H8HA 1K6MA 2D2EA 4M1WA 4YONB 4L8GA 2XNSA 3A4LA 3C14C 1QHGA 5UKDA 4GDFA 2IC5A 2HLDD 4A8JB 1YQTA 2J59A 2JAQA 4RKFA 1X1SA 4Q1DA 4YMWA 2WWGA 3C8UA 5EE0A 5JECA 1S2MA 4JVNA 2QGZA 2E1RA 1G9XA 5EUMA 4II7A 2HF8A 4PO9A 1X8KA 4KO8A 3TVDA 1ZUIA 221PA 1UKZA 2C2HA 3B1VA 3GD7A 2WHXA 2WOJA 4C2UA 2HV8A 1Z08A 3RS4A 2NZJA 1PLLA 1SHKA 3TJZA 1IN8A 4UNSA 2OO7A 2JLVA 3W90A 2QSYA 1NN0A 4PSAA 2JIZA 4CYMA 3EG5A 1W4CA 1G5TA 2VP5A 2ZRIA 4MUBA 4QNMA 2AK2A 5FBWB 2RAPA 5FPTA 4FIDA 2OCPA 2H7VA 2PX0A 3CX8A 4C0HA 1HTWA 4ZCIA 2A5YB 1ZUNB 1W2HA 2XGJA 2XNDA 3OAAA 3K70D 3IBYA 1T8UA 3VR3A 1ZRHA 3SN6A 1CKEA 4R2IA 1OJLA 1DOAA 1Z6TA 5DIFA 3LQRA 2EFEB 2MMCA 4LHZA 3E5HA 4LV8B 4MKFA 3X1XA 2KI5A 3AH8A 4G5QA 1XMSA 3L82B 5CK4A 1G8PA 5DE3A 1E6CA 2GK7A 2UZ3A 3A1UA 3GEHA 4ZO4A 2MSEB 4DUGD 4BE7B 3ZJYA 2GDJA 3BOSA 3CW2A 4Q4LA 5DN6D 2GEDA 3BH7A 4DCVA 2GETA 2QTVB 3LW7A 4YLGA 2PZEA 4XH9B 2ZI7A 4Q4JA 5BN4A 4JLKA 2P3SA 1ZC4A 3AKEA 2IYXA 4JLOA 1DS6A 1Z3IX 1VCNA 3A1SA 4WXRA 5FBQB 2HT6A 3SFZA 4CEJB 2REXB 2W2XA 4LJYA 4IOMA 1NSFA 1YR7A 3EAQA 3U2QA 3BERA 4CF7A 4ZIRA 3PJRA 2W0MA 1XTJA 5ANRB 1II0A 4NTZA 4Q4JB 4KHZA 4TMKA 1B0UA 2WWYA 1Q3HA 3UANA 4GT1A 2G83A 1X8LA 3PENA 4Q9LA 1E2KA 1MO6A 1M7BA 2A5FA 2IYUA 3EWSA 2O52A 5JS7A 2PBRA 1QHHA 3NC0C 4N1AA 4JMPA 5TVKA 2ZR0A 3DO6A 1Q44A 3GFTA 1UPTA 1P2SA 1RPZA 2CHVA 1GRNA 1GL9B 3K0FA 3AM1A 1MT0A 1G8GA 3TR5A 3BAFA 3L0IB 1YZKA 1TQ6A 2GF0A 4A6XA 2G88A 5F9HA 4QC2A 1L2TA 1ETUA 4ASUD 5FL7A 5C18A 2HLDA 2G3YA 1Z6GA 3L8YA 4KBFA 1KOFA 3WHLA 1TQ4A 5JCPA 4LJ9A 1UKYA 4JLVA 1TU4A 4MYTA 4D81A 3U7FB 4PHGA 2IBMA 3Q5DA 1HEIA 3J81k 3ZIAD 3IIJA 3OEEA 4MRVA 4HAUA 4MA4A 1SKYB 4A6PA 4TSFD 1F5NA 4RFSB 2ZIAA 3MMPA 3SJZA 4PC6A 1EX6A 1GKYA 4I1SA 1S3GA 4QNRA 4IVRA 2ZE5A 5EE5B 2FDCA 1JAHA 1OE0A 5J4KA 3T06B 3K0AA 1SZPA 2F1RA 4EPRA 2YWHA 3AF2A 4IDHA 1ZM7A 3AP2A 2QI9C 5AUQA 3I73A 4CRWB 4XD7A 3QXHA 4JKYA 2ZJBA 3CPJB 3L0OA 4M9SA 1Z0IA 4TQUS 1E9FA 1OH8A 3KKMA 2C8VA 2HCJB 4HAVA 3ZDQA 2ATVA 1IXZA 1V5WA 3FMPB 2AXPA 2C99A 3EA5A 3NEYA 1DAGA 3MSXA 4DSNA 1KMHB 4XD7D 1KK2A 1KJYA 3ZD6A 3GLGE 2WIBA 1W0KA 2OLKA 2FPLA 3B85A 2QM8A 3TUJC 4MH0R 2IYSA 2WM9B 4G1UC 1GZSA 1VG8A 3NWJA 2FMXA 1R7RA 2P2LA 2XX3A 1JJVA 2Z83A 1CEEA 2GJ9A 2WV9A 4V0LA 5JLJA 1FOEB 4TYYA 3VNVA 1II9A 1GFIA 2IF2A 2X2FA 2BDTA 3OIYA 3GEIA 4J0QA 2IYLD 1S3SA 1PVOA 3C5CA 4UXIA 1E9EA 4G5SA 1C1YA 1DAEA 3TIFA 2RGEA 2F43A 4JYCA 2GZDA 3CRVA 3MUFA 1JPNA 1Q0UA 1AS3A 4NL4H 4BGDA 4TZ6A 1AIPA 1N0WA 1OSNA 2O8FA 4KXFB 3GLIB 3IKJA 3TAHA 3U44B 1DAHA 1OXVA 1N3BA 2YINC 1E99A 4H1UA 1QHYA 3WP0A 5FUXA 3KFXA 3PR1A 1AKYA 1FUKA 4NCIA 3Q85A 1ZMXA 1JECA 1EFRA 2BMEA 4ZKEA 1C9KA 4O0MA 3LLUA 4PXAA 3Q7PA 1OF1A 4JLMA 5KUTA 4FCVA 4RFSA 4UNPA 1XTKA 6Q21A 4NP6A 3MJRA 1Z63A 4D0GA 1E9BA 3ZLJA 3ICEA 1JJ7A 4LWZA 3GJ0A 2I1VB 3B6EA 1IY2A 4TWZA 3CR7A 5FI1B 3B8HA 1JXMA 5FPHA 2XSZD 3KUDA 5CJPA 1JI0A 3GJ5A 2MMGA 3RS2A 1F3OA 2OBNA 2RH5A 3T1OA 4MKIA 2H92A 1NN3A 5EP4A 3AKYA 1CLUA 3ZH9B 1M74A 5H68A 5DLQC 5FUVA 2OESA 4ZI2A 4GI7A 5J4LA 2J0QA 3TE6A 3CKLA 1Z47A 1OHHA 1VDZA 4Q1AA 4B73A 2G9NA 4KITB 1VECA 1FTNA 1GUAA 3CR8A 5AR1A 5HCNA 2IWRA 3ETLA 1R10A 1FMJA 3FGNA 2YOHA 4KYIB 3KXLA 1VCMA 1JR3E 4DSTA 3RLFA 4KFTA 4KSCA 3P20A 2RMKA 4FINA 3VKGA 2GJSA 3X1YA 2VSFA 4QM6A 1DADA 1ESNA 4IW3B 2BEKA 1W5SA 2IX3A 4HUTA 5JCZA 2OAP1 1E3MA 3B9PA 5FPSA 3PUXA 3KB1A 1L8QA 3C4JA 2V4ZA 4B3GA 1OB5A 4HATA 3SHWA 3U61B 4LJAA 3TW8B 4KVAA 1NI3A 3CH5A 2D06A 2OFOA 2TMKA 5HKKA 4O2RA 4F4IA 1IBRA 1OT3A 1FMLA 2GF9A 1M34E 3FHCB 1AJEA 1KAGA 1KDPA 2RGGA 5FTJA 3RWMB 3UG7A 4UNRA 5D3MB 1TADA 3KQKA 2A5GA 2I4IA 4R2HA 1NMXA 1ONBA 4BEJA 3KQNA 2RKOA 1ZINA 1NBMD 2GEUA 3AKDA 2CLSA 1VG9B 2QSZA 3SBDA 1KI6B 2JLZA 3OE7D 2ZREA 1T5LA 1J8MF 1IAQA 4F4CA 2IYVA 2ZRPA 4H1VA 4C3ZA 4M1OA 3CZQA 2QORA 4HZUB 4AI6A 4LBZA 3CRRA 2C5LA 5E7MA 4Q19A 1AQYA 3CNLA 2SHKA 5JRZA 3QEOA 1G4AE 3SR0A 1K5DA 5TXGA 3RNLA 2QT1A 1NNEA 2AN9A 2YOGA 2H16A 3DKPA 4LK2A 3FKQA 4M9XA 5L3RA 4UNNA 1SVKA 4DHEA 4DUGA 1FZQA 1S9HA 2AWOA 1ZCAA 4DCNA 4QGFA 2J87A 3BJIC 5D3QA 4M53A 3K0CC 1MO3A 1ELOA 1Z2CA 5ELXA 3SJCA 2DPXA 3VU9B 4RY2A 1E1QD 5KSOA 2ODNA 2RB4A 1AGPA 2YWFA 4HI0E 4Q4AA 1Q1BA 2QTFA 4LYAA 2CHQA 2CCKA 2JEOA 3PG5A 3RRNA 4C9BA 1KY2A 1Z0FA 4JS0A 4QG7A 1UAAA 4P3YA 5DISB 4D4KA 1GKIA 3QBTA 3NG1A 1B23P 1D2EA 3QKUA 3VKWA 1N6OA 1S8FA 1E1QA 1FL9A 1G8YA 2OBMA 2ODEA 4RVCA 5CDFA 1NN5A 4B33A 4LX0A 2BBSA 1T3SA 2GBLA 3WMEA 3QVUA 4A0RA 4LC0A 3T15A 3TQFA 4WZ6A 3R7WA 2B21A 1US8A 2FEMA 3LXRA 1KGDA 4FN5A 2Z43A 3W34A 2FN4A 4A0FA 5CJ2A 1DBSA 3C5HA 2FSIA 2Q9CA 4MGZR 1U8ZA 1E69A 4Q4HA 3DEFA 3T34A 3THOA 2AHOA 3ONWA 4MQBA 3DPUA 3GEEA 4OHZA 3R7WB 3EPHA 1N5IA 4JBXA 1SXJE 1XD2B 4Q1FA 1DG1G 4RZUA 3GLFE 2CJWB 1XEWY 4C30A 2C78A 1F2UA 3ZS9A 4KFRA 3LX8A 5BQ5A 1YR9A 4OQMA 2R65A 4IFBA 1ZAKA 5J4VA 5B2ZA 3GQBA 4DLVA 3NDPA 1FUUA 2C03A 3SU8A 1SVIA 3FE2A 1RRGA 3MG9A 1G41A 4JVSB 1W36D 1KI2A 4ZDWA 2R6DA 1XMIA 1A2BA 5KSZA 1QF9A 3B1WA 1RKBA 1KKLA 2XOKD 4BLPA 3BH0A 3AB3A 3DHWC 1NKTA 3IO3A 2EFGA 3MD0A 4GPTA 2VRWA 3THXA 3H4MA 1HA3A 1F60A 1S96A 5AJZA 2GAAA 5EE1A 4BRUA 4LOAA 2ZETA 4DLSA 4FWTA 4JVLA 2ZM5A 4EJSB 4MRNA 3LXXA 1WDTA 2ZRNA 4TMWA 4Q18A 4EPTA 1LV7A 4DCUA 5JBQA 1NMZA 2IXGA 4GP6A 4Q03A 3ZS8A 1G7TA 2FZLA 4V0OA 2BBWA 4TTRA 2PLRA 4FWIB 4HB3A 4OQXA 2VHJA 2CVFA 1HT2E 1OFIA 3ZZUA 2FOLA 1JEEA 2ZAMA 1NIPA 5GJBA 3SQXA 5FTKA 1CJMA 1R5OA 3NDBB 2G1KA 2JDID 1KZ7B 4NMMA 3KFVA 2JASA 2KBFA 2ZI5A 3IPXA 2D4HA 3H1TA 2BHRA 4NYIQ 3U4QA 3O47A 4MGYR 4HUQA 2ZI3A 3C41J 5LDDC 3GLGB 4CT4B 3T35A 2Q0HA 2IEYA 4KU4A 1VG0B 4IDPA 2V1UA 2ZUDA 2C9CA 2ZJ8A 3LX5A 1DE0A 1GIAA 1OIXA 3AVYA 1HURA 1KO7A 3LQQA 3BE4A 3N70A 4CVNA 1NLYA 3T5DA 4PX9A 4N0EA 1U9IC 1EFRD 3EC2A 1MABA 1VG1A 4JT4A 4NZYA 1Q57A 3RC8A 1XB2A 4DZZA 4NYMQ 2V6IA 421PA 5DI3B 1JEDA 1RIFA 2JCSA 1LVGA 3HU1A 4EJSC 2QQ0A 1ZD9A 3FKSD 5DI9A 4ZKDA 2QRNA 2BKEA 4ZIRB 4DRZA 4PPFA 1XTIA 5KPJA 4Z51A 1GP2A 4MDEA 3DOFA 3ADDA 2H5EA 1OFUX 4IRUB 5FTNA 4OQNA 2ZRGA 4OKSA 5F98A 3SHFA 4D6PA 4ESHA 2OG2A 2QAGB 3GLHA 5CB8A 4LUCA 4B48A 4XTRA 2ZE6A 3VNUA 1AZSC 2JLRA 1OYWA 3FFBA 4F93B 4B75A 4PC3A 3M1IA 3KJIA 1I4TD 4L5BA 2QMOA 2GRJA 2CL6X 2ZU0C 2W2VA 4DIDA 2JDIA 3I61A 1T4GA 3B13B 3CRQA 4IEIA 3A36A 3TK1A 3ZVRA 2FZ4A 4GOKA 2WMNB 2XOKA 1W4BA 3L43A 5BWMA 1OXUA 2BMJA 4IOJA 1Z29A 1GOTA 2QA5A 1N6RA 2IEZA 5B57C 1CF4A 4M4SA 1AA9A 1NG1A 3BIFA 4PC2A 2PEZA 3A4MA 4DCTA 1OH6A 2CE7A 1XD8A 1SXJD 2ZE8A 4O25A 4ZDKA 1WBBA 1PLJA 5L3QA 1YVDA 2A3RA 4DWJA 2DHRA 5DNYB 4NONA 5J47A 2C77A 3T12A 4B3FX 2V8OA 5GJCA 2JLUA 2GHIA 2ODBA 1G7RA 2VH5R 2PT5A 3HP1A 3HYRA 1E0JA 3IPYA 3L8ZA 4A36A 1RVDA 2MSDB 1TF2A 2J0UA 4LI0A 1N6KA 2WOOA 4PPNA 2LCFA 4US1R 3VX3A 3B2EA 1KSFX 4AG6A 2XEXA 1ZM3A 2ZS8A 4AC9A 3LVRE 1GL7A 2ANBA 2ASEA 4V03A 4X8MA 4LGMA 4ASUA 3EZ7A 2QY9A 4L16A 4U7DA 4PZYA 1AGRA 4W5JA 2JIZD 2EQBA 1G5RA 2DFTA 5L3SB 1E2EA 2QBYB 2IYRA 2VQSA 3RDPA 1ZCBA 3ND9A 3PEWA 2ZRHA 2WJVA 3GP8A 2F3RA 3Q5EA 2QT0A 2R8RA 1IN4A 1UKEA 1ODFA 1W44A 3AQ4A 2BKUA 1ZIOA 4BFZA 4PANA 3IEVA 3I8SA 5JZVA 1XP8A 1XNJA 4KFSA 4B47A 2R9VA 1XMVA 5FOXA 3MWYW 5DYGA 5C46F 5IK2D 2PMKA 2W0SA 2KWIA 3OHMA 5EZ5A 3V9PA 2A2ZA 1N5KA 4LHYA 5FOUA 1XEFA 2OFWA 5E7IA 3D7MA 3N5CA 4I1OA 2QGNA 3EXAA 4NKRA 3WYAA 4OI1A 5KYKA 2YJTD 5EXSA 4XOIA 1L7VC 2IUSA 2RGXA 4JT2A 1E9RA 4ABYA 3SDZA 4A82A 2PX3A 4YMUA 1E2FA 2J45A 3DZDA 2ZVQX 3L0PA 2ZRDA 1E2DA 3GLIE 1QRAA 4E03A 1XRJA 2EYQA 721PA 4EAQA 2QPOA 4IDOA 1JBKA 2FSFA 2DY1A 1XF9A 3W6PA 3T1TA 1KI8A 4GBMA 3OFNA 1VHLA 2E9SA 2QM7A 2ZSEA 4HLUA 4CZ2A 4DDUA 5FTMA 4N0DA 4JSYA 4KI0A 3SYKA 2HCBA 5H70A 2VEDA 1P72A 2QG6A 3HR7A 3O8DA 4HZIA 1IY0A 2BCGY 2FH5B 3O8CA 4IKEA 4LY6A 1KDTA 2GCOB 1W1WA 3D3QA 1E0AA 3QBVA 5E3HA 2YKGA 4HUQB 4Q48A 4XIGS 3CWZA 3IIMA 2RGAA 1LF5A 4JLBA 2P6RA 2ZVPX 2BM0A 4V0KA 1XXHE 2D3WA 5JI2E 4P4SA 4Z8XA 2WWWA 1XEXB 3O8RA 3ADCA 4MITA 2CMKA 1Z0KA 1BH2A 2X1VA 521PA 3SBEA 1CR2A 2IK8A 1JNYA 4PAMA 3RABA 3T1VA 2ZRMA 4IVPA 3Q8XB 2Z0MA 1Z6AA 4DLWA 1W7AA 2JJ2A 4M1KA 4TZ0A 4EKDA 2P6UA 2RCNA 1GG2A 4HZUA 1QBKC 1IONA 5TMPA 1FPMA 2VP0A 3AP1A 4V0MA 2J7PA 4DLYA 4PZLA 2EWWA 3SQWA 3JVVA 4Q1BA 2Q3HA 1ZNWA 2FX3A 2ZRBA 2ZSFA 4XTCS 1E2PA 3SC3A 3ASYA 2D7CA 4IFEA 3L0SA 1VYVA 3ZQJA 3SJAA 2BIFA 1DARA 1U0JA 1U90A 4WZAE 1JB1A 2Q3FA 4MUAA 4TLCA 4AURA 3KZ1E 4Q66C 3HR8A 2AX4A 2OAQ1 4EJSA 3SOPA 5B58C 5CB6A 2WBLC 1GTVA 2GWHA 3U3RA 2FPKA 4LC1A 4M0LA 4TYNA 4RSGA 5GADl 3K0EA 3EIHA 3VKHA 2WWHA 4TMZA 1H8ED 4NBSA 1ANKA 1HE1C 3GJXC 3B9QA 4RZXA 3AF1A 2P6NA 1J90A 1N6IA 2QNRA 1OH7A 1IY1A 1SGWA 2IUTA 2FFAA 1SQ5A 2JLYA 3QE0A 1E96A 1WCV1 4C7OA 4MGIR 4LZZA 1VCIA 2EFHB 2BJWA 1K8RA 3QXCA 4Q5IA 3G82C 3CF0A 2H17A 1P6XA 1NKSA 2QN6A 3ADBA 4F92B 2VSXA 4BZXA 2HXSA 3EPLA 4DLRA 3AVWA 1U81A 4ZI3A 1Q1ZA 4AWXA 1DPFA 3P1JA 5FUWA 4WOPA 2IF0A 1KO1A 3IQXA 2QPAA 2HF9A 5E7JA 4DVGA 3GLIA 4XJXA 1FQJA 5D3MA 2VA8A 4ZV4A 2YC2C 3V4RA 1RRCA 2WKRA 1P9NA 1GITA 1ZM9A 3HPQA 1DAMA 2IYZA 5FL3A 3RRYA 4W5WA 4PHTA 3PFIA 4DEXA 4K81B 2ZITA 2Q9AA 3MLEA 1YZQA 1OLOA 2ATXA 4P4SB 3M0EA 3ZGXA 3QXSA 4PAOA 5DGXA 4A9AA 5EQTA 4HLQB 1NVWQ 1RJ9A 4NCKA 4TMTA 3QKRA 2GEVA 2Z4SA 4EPVA 1YE8A 1XTQA 3AUXA 3CH4B 2KBEA 5K8UA 4MYUA 4LV5B 3M4YA 4JLNA 2PEYA 1KSJA 1Y3AA 4JZKA 5J40A 2NIPA 3IBGA 4QGAA 2ZUCA 5KDLA 2Z4RA 5F2EA 3SNHA 1G3UA 4D26A 2QU8A 4BASA 5JWOA 5SZIA 3UWOA 3IGFA 4PC7A 3K9HA 1VCOA 3GLHB 3KX2A 1IHUA 2V54A 4BFVA 1G3IA 1K5GA 2HJGA 3AVPA 4DCSA 1KHTA 2KSQA 1W47A 3H86A 4FMDF 4OQLA 1XEWX 2FF7A 2W6ID 4OI2A 3PUZA 1OXSC 4A2QA 4PTLA 3NH9A 1M2OB 1LF0A 1Z22A 1KZGB 1WF3A 5CITA 2GXUA 4OQFA 2Q21A 4E09A 5HE9A 4HLCA 2VBCA 1II8B 1I2DA 2J7KA 3ICQB 1I4LD 1XBTA 1TNDA 1XWIA 2W6IA 1NG9A 4BFXA 1HY3A 1V43A 2WIAA 3Q3JB 3QENA 2VSOA 4Q9KA 3EIEA 4IHQA 4GMDA 3CLVA 4A8JC 3CNOA 4OHYA 3GFOA 1FX0A 1T91A 2I1QA 3I3SR 3LDAA 4B3XA 2YVUA 2BOVA 4TYQA 2J46A 3W5JA 5AUPB 4B2IA 2NG1A 3HDTA 3IILA 3LRPA 1ZU4A 4LPSA 3U3MA 2ZEJA 3MWLA 1UBCA 5KNDA 3MFYA 3OE7A 2GCPA 4OK6A 3QF4B 2O8BB 3Q9LA 1HE8B 3KUCA 1W0JA 1WB9A 2WTUA
chains in the Genus database with same CATH superfamily
2QZ4A 3EGCA 1A4UA 4WDQA 1RZ3A 5LOVA 2GJKA 1TQHA 3CU5A 3PUVA 2ZSAA 3JPYA 4MV4A 1K7SN 2HY7A 3PX3A 3GJYA 3PJDA 3PQCA 2JKZA 4PZZA 1JHXA 2ZR7A 4IAOA 1TU3A 3MMNA 4HLUC 5DT2A 4HTFB 2MU1A 1GVNB 3Q98A 4R8LA 4KUGA 4KYUA 3TF5A 4RZQA 1YACA 3LHIA 2WWFA 1PUIA 2YYAA 1IQPA 3GZTB 1RXCA 1NVFA 3QUBA 1FDTA 4HO1X 4OHVA 4JCCA 3L0DA 3JZIA 1O6GA 5JC1A 1UOEA 2E6KA 4R8RA 4X1YA 4MINA 3DLCA 1NVBA 1YRYE 2VTEA 1LWOA 4E1BA 1BDBA 1CQZA 4R40A 4C04A 2FWNA 4JLDA 2OFXA 2BPOA 3DBLB 4BMYA 1RYFA 3ZUGA 1G9TA 2MHCA 4MO2A 4HT3B 3MWKA 5L53A 1JDVA 3A2KA 3WKCA 3H1EA 5AXAA 1CV2A 5KQRA 1YZUA 3L1UA 4CQNA 2UYCA 2BEWA 4YRTA 5AFSA 2Z6QA 1ABFA 5JFOA 4IDEA 1YKFA 2BR5A 1O8CA 2NVOA 2Q3BA 4JSTA 2BHLA 2D1YA 4U2KA 4Y30A 3KE9A 4J2HA 3H2HA 1H6AA 1NBME 3OQ6A 1LC3A 1K7FB 1IOWA 5JEDA 3VVCA 2ZU6A 4B4VA 2FN7A 2PZAA 3GCGA 4L0MA 3TRJA 2CF6A 4RZHA 3H5RA 3ZLUA 3WGIA 2J48A 3PDUA 2PYIA 1VMDA 3EWNA 5E9JA 2FXIA 1GUDA 4LHXA 3CS3A 3VJLA 4QHYA 5BN5B 2Z2IA 3Q0IA 3EW9A 1XCMA 3VTKA 5MF6A 4YJ3A 1Y9DA 5KOYA 3HCOA 2Q2VA 3CLUD 2WU1A 1A5AB 3SY8A 2ET6A 5DDIP 4ZOQI 2UDPA 1Q1EA 1E7SA 1PR9A 2YW9A 3II6X 3PIRA 4TSFA 4RORA 4EJSC 621PA 4C0QC 3QWBA 5CW1A 4YAGA 1HZJA 1RD4A 1KF0A 3I45A 2AOTB 1E79D 1U8AA 4AYXA 2C9BA 1XD9A 3KB8A 4P80A 4N6OA 4BCBA 4X8HA 4FU0A 1JTEA 3VR5D 3MS2A 4Z99A 4DDMA 1DVRA 1T9HA 1PRYA 2DPMA 4KFUA 4R2KA 4M2LA 4KREA 3R9KA 4A1OA 3RG8A 4KPUB 3EPPA 3BK7A 2JNWA 4KDFA 3LUFA 1MFZA 2EL7A 3I6ZA 2GDZA 3GGSA 3WA6A 4EJ6A 2IEIA 4M0CA 3I1IA 1WMSA 3IDOA 3OHPA 4AO7A 3FWPA 5JJKA 5IVDA 1YUMA 1DEXA 3EXHC 4UCQA 5L40A 1L4NA 1LB1B 3FKSA 4PNZA 3WV5A 4CIAA 1C7RA 1UFKA 2W2KA 2JLWA 4Q9HA 3IAS6 1NMYA 2Q6OA 2IHYA 3IVGA 3REGA 1XTVA 3I04M 4BUJA 2XDQA 4NOMA 5HIIA 2Q4TA 2D8MA 2A7XA 3BD8A 4A1FA 4HYEA 3LO8A 3B6MA 2JHCA 4B81A 4HQNA 2EARA 1IWBB 3FPHA 1KDVA 2VFAA 1G64A 4NF2A 1ZD4A 1AUQA 3GJSA 4FLFA 1COWD 2XXJA 3O4FA 4LG1A 2H1FA 1LNSA 2BRUA 2IZ6A 2OORA 1EFUA 3W3AA 4A0SA 3C5WP 3BB3A 1KJJA 4C4YA 1PV4A 1NNSA 1NF9A 4EQ6B 4JI1B 1KQOA 2VDWB 2XGMA 4U7JA 4ESEA 1PD0A 2Z1DA 3P4YA 2K87A 1N9GB 2O1XA 4B4KA 1EUDB 5TARA 1W0KD 3W8FA 2QRHA 4QDKA 4X94A 2GCIA 1ADCA 1P73A 4BO9A 2FV8A 1C30A 3GIWA 4NPHA 4FN4A 3JATA 4RK0A 4DSZA 2UXDB 1Y4DE 5FFNA 2O5CA 3DM5A 1R6BX 2OOSA 2YZGA 1N92A 4X3CA 3TR6A 1X19A 3KALA 4BKMA 4DUYB 3O8BA 1E4EA 1QOPB 1WA5A 2IGTA 1CUCA 1H94A 2C4UA 2GRUA 4Y0VA 4PLTA 5ILQA 3D2CA 1S2LA 4UU0A 2B7CA 2AC4A 3PVSA 4YRPA 1DRWA 3G59A 3U9LA 3WFJA 1KZHA 4O6VA 4OJKA 1E0SA 5T4BA 1T0HB 1V8OA 2OV4A 3VFDA 2V96A 2V9CA 4PX5A 3DDNA 1FS5A 4HDMB 3KSBC 1JQ3A 1NVKA 2O2YA 3RHTA 3QSGA 4C6RA 3ZCVA 1GY8A 3B6KA 4MS4A 2OCGA 3NTXA 3UJHA 4QDOA 2IDKA 2WZQA 3EEYA 1RWXA 5FIUA 3A1TA 3LGAA 1ORHA 3OIVA 3F6EX 3IA2A 3LDUA 3OU7A 1PWXA 2VCHA 4LJ5A 4CHGA 1Z4KA 1K2WA 1N1EA 2IUFA 2XSZA 1O5OA 4JP5A 4KP7A 4BGVA 5JXJA 1PZXA 3ZCTA 1O77A 2EXXA 1GFWA 4GZMA 4MS4B 1WQ1R 1Z6ZA 2VF2A 4LXGA 3HB1A 4LNUA 4P7FA 4B82A 4MS3A 1GPH1 4ZAGA 1MC1A 4M8LA 3C7KA 3CLSD 5BOSA 2VJNA 2I6GA 2Y67A 1ZP6A 3ETDA 3LT0A 4HN2A 4P4TA 1EHCA 3MJDA 4X3PA 2ZSJA 1XLWA 1THGA 2PK3A 4YCSA 3PHHA 1MEEA 1CB7A 1FP1D 3NORA 1I6MA 1TE2A 3F4KA 4IO1A 3K0AB 2F64A 4YJDA 5CDFE 2BFPA 2BDEA 2W2LD 4ZVUA 3IQHX 3E22B 2JRLA 3UK6A 1D9ZA 1KI1A 3P9KA 3R5JA 4P7BA 3OIDA 4RJLA 5DIZA 1CR0A 3GHHA 3SBOA 4BEWA 3THYA 2X8WA 3I58A 4FFMA 2GK6A 4LYEA 1ULBA 3D0QA 2XBMA 1M83A 1G3QA 4HDNA 1OTHA 2PD3A 3HE3A 3T1QA 2E5LB 3I09A 2WPDD 2AVDA 1N4AA 3N2ZB 1QPZA 5IM4A 3IIKA 4WFQA 4CKXA 2XZOA 1BS1A 3E22A 4O5OA 5CP8A 3U7QB 5B7NA 2UXCB 1L1QA 1M0SA 2JFHA 2Z95A 3M5WA 1LS1A 3OIWA 4WLOA 3TPFA 4URYR 4JI2B 5J2TF 4QICA 1GTRA 1QQTA 1YFKA 3K1AA 1FVOA 4KX5A 4Z4CA 2QMEA 1CEQA 4FI3F 4JJZA 5HIJA 4PYQA 1SIWA 2D7DA 1JDTA 3GUVA 1I51A 3JQEA 1ES9A 1PWZA 2H1WA 3OX3A 4AJEA 1J8FA 3A25A 5AVTA 4HJRA 1EUCB 1ARZA 2ODQA 1GTL1 3R74A 3K5PA 5BNIA 4IJ6A 3GU3A 1K7EB 2O2ZA 3KQSA 4N65A 4NNOA 1NT2A 4R1UA 3RHZA 1GADO 4M21A 4AG5A 5C7LO 4JSRA 3HY4A 2Q5HA 1F0KA 1YFJA 2PT9A 5TJHA 1DC8A 3D3EA 3FA2A 5F7JA 1PTKA 3B1YA 1GTSA 3GJ3A 4GMXA 5ALVA 3TNDA 4ETMA 1XWFA 5CFMA 1N6PA 4G85A 2OD9A 4D9IA 3EARA 4MVJD 4CV1A 2OV2A 5K3FB 3LY9A 1M6NA 5AIBA 2R1UA 1V1MB 3L1HA 1J06A 1DKQA 3F5MA 2VF4X 2VHWA 1QVWA 4J3FA 3W6ZA 2I9PA 5L7WA 1F12A 3JQ6A 5JAUA 1QCZA 4PV7A 4BV2A 4AUKA 3W8DA 3K1TA 4K46A 2MJLA 4YJKA 4PY2A 1JHDA 4LE0A 5K8LA 3OQNA 1DTSA 1FIUA 3AONB 2H3HA 4MPJA 3ORQA 4QDJA 1NJ5A 4YJ3B 2C2WA 2C1EA 3QXXA 1LNZA 3CRZA 5B58T 4PR3A 1K5PA 3L5OA 2IXAA 4PWYA 1MDBA 1SKYE 4QYTA 4BNNA 4DCCA 5GQSA 5LQNA 1KERA 4BLWA 3GAZA 4EUNA 8MHTA 3JQ9A 1SRRA 4C0LA 3EC1A 4US0R 1FSPA 4LYJA 1YUNA 3INYA 1PNTA 4FYMA 4L3VA 1C1DA 4P54A 4XUEA 3RU3A 3TIXB 2PCLA 2ZI9A 3SSAA 5ITZB 1GPKA 4ARIA 2EYUA 4J0HA 2AF4C 3GFPA 2QLLA 4XB6B 2F00A 2VT7A 4D80A 1LFAA 1PWHA 3QJGA 3KWMA 4L22A 5CIQA 4G8JA 4LA4A 1C9EA 4YJGA 1CP2A 2COKA 4UNQA 1UJBA 2F7SA 2DB3A 3DDUA 1S89A 5H3HA 4BLTA 4G1FA 1QE5A 4J16C 4GKVA 1C2YA 1KH3A 4EM6A 2X86A 3H6GA 2QBYA 2EU8A 4RETA 4DC0A 2FGJA 2BBTA 2W2KB 4RK1A 3TSZA 2PKCA 4W7IA 2V4UA 1A4RA 5T7BA 4GSLA 4OHPA 2ECOA 1K98A 4GKAA 4H31A 1EB8A 4R71A 2H7CA 4UFNA 4M7RA 3WLSA 4DARA 3HM9A 3AEUA 4GIBA 1R8SA 3IIIA 1ENPA 4IKPA 4JLPA 1VKHA 4NICA 2WVGA 2QRLA 4IXMA 4QL3A 1U1IA 2F1HA 7AT1A 2C1ZA 3K2QA 1ZZEA 4O2AA 3D3NA 1BWPA 5GVRA 4MRRA 5LUAA 3UB3A 2JCBA 2XB2A 1TO1E 1V45E 3EOAI 4I5DA 3IYLW 3B5JA 1VSTA 5TY0A 1TUBB 3C39A 1PO7A 5IJ0A 5KSYA 5HG0A 1TMKA 4WVFA 3D7NA 4C0AC 4CEIB 4N3BA 2QS9A 4QIHA 3ERCA 3KLMX 1PGPA 3DZHA 1Y4ZA 2DH5A 5F35A 1Z83A 5G3YA 1NI4A 1U04A 5D87A 4UHHA 3W3AH 2JIDA 4JBWA 4O1HA 3ETNA 5ISMA 2JAUA 1L8OA 3S8EA 3U7RA 1IOZA 2VTDA 3EVCA 4KK4A 4QYIB 5SYAA 3I0NA 1MZVA 1B8VA 1UXKA 2WTBA 3KT3A 3QKRB 4FGUA 4W7SA 5CGZA 2JIMA 4CFZA 3AJAA 4TM7A 3RIMA 3T4UA 2UVDA 2H29A 2WYUA 4JAVC 2F2TA 4B3CA 3PD1A 2MSLA 2NUAB 1W29A 3D8SA 2IOFA 3JU3A 3HB9A 3JZDA 4RL4A 3TLGB 3NVDA 4BNXA 3IEXA 3BMOA 4F12A 1PZNA 2RKWA 3O7WA 4XDHA 3WMFA 2VNKA 2YQ4A 5EUQB 4EB8A 3DQPA 4AN4A 2HA6A 4J03A 3NX4A 3TOZA 5FXMA 3IAM6 1BWRA 1UKBA 5DN9A 5FA6A 2D2IA 3N0WA 2WHRA 1NVXQ 3TLGA 2CY0A 1GYPA 3L6EA 1RWVA 4L5AA 5FI5A 1OFVA 1JQBA 2UZIR 2PRSA 4E22A 4ALJA 3R0JA 4OEHA 4WLEA 3P7MA 4F2WA 3EDQA 4NPCA 3W9BA 4TTPA 5HP4A 3E5MA 2BUBA 5TQJA 6ABPA 1DFGA 4TWAA 1YIDA 4QARA 3SXJA 3WB2A 4NU8X 2QZ9A 1PNOA 2YCLA 1OYOA 1NXXA 1K27A 2EFJA 3GOQA 4CKCA 3GRYA 3V4FA 4CT5A 1HETA 5BVGB 1KYIA 1SN7A 3MINB 4H4CA 3K9GA 1U8FO 4KUEA 2Q2OA 1TVEA 1HH4A 3G88A 1EUYA 4BX0A 6AT1A 1G8JA 4BOYA 2ISCA 4R1SA 3T7CA 4CDGA 2WPDA 5F5LA 2W00A 2ESRA 2ONJA 4BJ6A 4WY8A 2VHVA 5ER9A 4TQ9A 5HSGA 2PZLA 4V3CA 1AOXA 1F0YA 3FPAA 2QPLA 2ZWMA 3KB6A 2RIPA 3FW1A 4IMJB 1R66A 2XH8A 1I2CA 2X2OA 4G5RA 5DVZA 5E8JA 2Z3WA 3HXQA 2WUEA 4D1YA 3REFA 1LQTA 4OXRA 3RJ5A 1A69A 1ZVKA 3UMYA 2O8CA 1WNTA 3L7KA 3L9WA 4JQYA 1YIOA 1DIHA 1MAWA 2B94A 1QO7A 2FSHA 1EX1A 1B0ZA 3E53A 3ZY6A 4L5IA 1P4SA 5ALKA 1NRIA 4MULA 4PC1A 3VAYA 4C5BA 3D3WA 5GAJA 1T5BA 3R0VA 3AVUA 4QOEA 1BRTA 1XLTA 4KO2S 5HKAA 1BU8A 3MMXA 2VC2B 2A9JA 3T5GA 1LSJA 3HKEB 3CRMA 3L7DA 1AB5A 3P9CA 2ZKLA 5TEWA 4O4LF 2UYYA 2QX8A 3EEBA 3U3DA 1FTYA 1EP2B 1GT91 4DA7A 5K1ZA 1BZYA 2XMRA 5BR4A 5BSWA 4O2LA 3D6MA 3KQHA 1BGVA 4G5HA 3CVUA 3H19A 3R5XA 2HJRA 1O4WA 4PFSA 4I4TA 4ZT3A 4ETIA 1F2UB 3DTYA 1JALA 1ZJ6A 2JJQA 2VR1A 3U40A 3AW8A 2FR1A 4LTMA 1E2JA 2WV7A 1X1TA 1NOIA 1VB5A 3MTDA 1NUAA 3U37A 4Z1OA 3AG6A 3I28A 3SICE 4A2PA 4YWJA 2HSDA 1TZBA 3SX4A 2IS6A 1X80B 2C92A 3EXEB 1D5CA 3WGKA 2NMVA 1BROA 1M1YA 2YV4A 3WRYC 3AF6A 2OXCA 1LS6A 3GGGA 3PNQA 4QDTA 5AKJA 1YCHA 4QHTA 5DHSA 5IDXA 4BP1A 2VF7A 1ZD1A 1DQSA 3CGWA 1RJDA 2B9VA 1JXOA 1A5BB 3B3FA 1AXGA 3KT0A 4GWLA 4YEDA 3EWIA 1Y81A 1E9AA 5EP2A 4CL3A 2O2EA 3J80A 2ZRJA 1UANA 4F1JA 4L8FA 3ESQA 3ZE1B 3IVAA 2AXEA 4IOKA 3HL4A 3OZXA 4GOMD 3RVOA 1KRHA 3STHA 2P5SA 3D2LA 3EXIA 5G2OA 2P1ZA 5EPEA 4CXMA 4DB4A 1C7ZA 3FPJA 5E6RB 2QSUA 4J1SA 4UEWA 2OM6A 4PLWA 3L4BC 3PFWO 1X8JA 1LPPA 4W99A 5IK2A 1QCYA 4ALIA 5IX8A 2YJGA 1XTPA 2YWJA 3BE6A 3MCAA 3SE0A 5GINE 2KE5A 2ZOSA 1VXOA 3F8SA 4DCOA 5JEEA 1FDRA 2CFTA 4K9DA 1XN1A 4LXUA 5LXTA 4PZDA 3NTQA 4W8GA 4Y9RA 4R1OA 5FAKA 1AT1A 2JW5A 3DZ8A 4DT1B 4YCJA 3D81A 4PRZA 1W9MA 2J0UB 2BLLA 2O7NA 4D97A 1DMSA 3BWDD 4XR9A 2TSYB 3L6DA 1QYXA 3G2OA 3I2HA 4AT1A 4Q01A 1Z74A 2NZ8A 2LR0A 2PH1A 2PU7A 3S0JA 4J0FA 4OU5A 3HP4A 4PSUA 2NZXA 3HGMA 3O2NA 4M37A 4MKHA 1ORWA 2C9MA 5DTMA 3KKNA 3L18A 2ZRAA 4L75A 3ZBUA 3LCRA 3JD4A 1PF7E 3VX4A 2O8DB 3DBLA 4HDAA 3EDMA 2CUZA 1WCIB 1UMBB 1ZWKA 2XCLA 2ZYHA 3LQ1A 4TXNA 3HA3A 4AJKA 2FFBA 3OZIA 4KEAA 1Y3BE 5I7OA 2QN8A 4EYKA 4I8IA 2YH2A 2XYGA 2O7RA 4YHBA 1GEEA 1XU9A 4L6IA 4ALKA 1DO2A 1DG3A 4CLOB 1YDHA 3K8OE 1M75A 2Y0CA 3TKAA 3G3EA 5C8YA 1XDBA 1WCIA 2GAJA 2BZ0A 4QBFA 5C5IA 1U98A 4NV0A 3WLIA 1CU1A 4FHZA 4GP7A 3P9IA 4WD3A 5DCLA 3THXB 3LOPA 3CG0A 1X1BA 2YZ7A 1DJLA 1BOFA 4MGKR 4DHWA 1SKAA 1M1YE 1OHHD 5A7GA 4C4ZA 2G9ZA 3JXEA 4OTZA 4QJIA 3IOMA 4I5EA 3X2EA 3UWMA 3UFBA 3W5UA 4AMZA 3PQ2A 5JSQA 5F9FA 4OHOA 1PQWA 3HHPA 3K4PA 5EJEA 4NBUA 4HVAA 4C4RA 4ZT6A 4B17A 1Q0RA 4BLOA 3JVUA 4PHFA 4ZQGA 1TO2E 3K4HA 2XCQA 4OMUA 3SXPA 4KR6A 2X7XA 4LYDA 3WWEA 1BXZA 1CC1S 1K66A 1XDSA 1NU6A 2OVFA 3CUSA 3LBYA 3PUYA 3UYLA 3KSAC 2HR1A 4EJ2A 2FPXA 3EDRA 1SZDA 2JA1A 2YXNA 3DWFA 3FMFA 4M6WB 3CE6A 5IJWA 3AV0B 2F1JA 2VTVA 3TQTA 1OY1A 1M33A 2C04A 2FVXA 1KK1A 3BORA 3FVQA 3GVIA 3MLAA 3QKSA 4Q47A 2PT7A 3PCXA 1HPLA 2AOVA 2O5VA 3RTDA 3V7WA 1JAZA 1CIVA 3PC2A 4U7TB 3ZE7A 4AF6A 2JFVA 3QELA 4MVWA 3MTQA 4OYHA 4LV5B 5EXTA 2PS9A 2A58A 1DX4A 5AVSA 5J2UA 1N57A 2RJNA 4WVLA 4ABTA 2WDZA 5KC9A 2QD5A 2HEIA 2X19A 4BUZA 3FG9A 2F1KA 4JEHA 3VDXA 1A8UA 1Q21A 2CDBA 3LQ4A 4IS2A 5BVGA 2CK3D 4FIZA 1IZ9A 2AOUB 3DG9A 2AFRA 1IPEA 4XLZA 3ZNOA 4OXNA 3JQDA 4KPYA 1ENZA 1U8XX 1KEVA 1TYDE 3QHQA 4G5YA 3JZMA 4E2ZA 3G9QA 1H0HA 5FPQA 4YT8A 1DWQA 2PJZA 4C22A 4CWAA 4BPBA 5KSPA 1GG8A 5DB4A 5DF1A 1X15A 2GASA 3QVLA 4U7FA 4CKWA 3THWB 2FW1A 4RDCA 5JAMA 5AHOA 5IVPA 4OI0A 3VRHA 2R97A 4LHEA 4Z8YA 3RKSA 2IH5A 1DJMA 2WSLA 3JQ8B 3K92A 2O0LA 2SECE 2VRNA 3P19A 4XQCA 2C31A 1K68A 1JFSA 2GVNA 4JL8A 4CPDA 4I55A 5FI3A 1APBA 3RARA 4QOHA 3FNGA 1P2DA 4OK3A 4L08A 2XVZA 4MWCA 4MRAA 1MAAA 1IL0A 1D0IA 4OH7A 3LHKA 4QEKA 2RB5A 3B20A 1T1JA 3DDZX 5DJ5A 2AZTA 4BVBA 4C4SA 2DETA 2J1LA 4IMPA 3UJPA 2GM5A 1UXHA 2VG8A 5GZ1A 3AM4A 4JXZA 2Q9UA 3SJ7A 2QYHA 2G1JA 3HYCA 3ETHA 3OIFA 4ZEOA 2IOFK 3UKOA 2I3DA 5KVAA 2D5AA 1PT8A 4YWHA 1MX9A 3EZ2A 4FUQA 2QVCA 4LY3A 3UH1A 4ZYZA 4TT3D 1SC3A 2HBQA 4CM4A 5FI0B 3ROXA 1GTJ1 4ER6A 4RY9A 5IJ9A 3N9IA 1S1MA 5AK0A 3LVQE 3T52A 4F71A 1IXKA 3CX3A 3ENWA 1G5HA 4QXPA 4HR7A 4YO7A 4HN9A 1QS0A 2Z6VA 4RTLA 1HQCA 4XGKA 4D9KA 3FZNA 1QIEA 4II3A 4LNUB 1GLGA 4REOA 4ZWNA 4U02A 4EUSA 3MCTA 1I2AA 3LBIA 2P79A 3O03A 4QJ5A 5HQTA 1CQJA 1QORA 2PZJA 3SR3A 1Y1PA 2X0JA 1TIPA 2CZGA 2REOA 2YIJA 3LCUA 4KJZA 1MU0A 3MJFA 1F6WA 1FB5A 2FNAA 4JUAA 2FPRA 5HQJA 1M2NA 1BG6A 5LZ9A 2B6HA 2Y1DA 2A92A 5GONA 3VR5A 5K3BA 1QKJA 1NQTA 3ZV6A 3R8FA 1UOOA 1E3IA 3ADOA 4RD2A 2QUJA 3AEYA 4DCMA 2G04A 3SQDA 4DDWA 1DKNA 5A3QA 2VJMA 5HM8A 2B92A 1JG2A 3ER6A 4QWWA 5ALZA 4OQYA 1WZ2A 5HZHA 1P75A 4UD6A 3VVMA 4F9TA 4NXNB 1U0NA 2XDYA 2V1XA 1YJAA 3HVIA 4CQMD 1LWNA 4CEJA 4L57A 1SXJC 2PYZA 4WAUA 1LK7A 2ECQA 4BIIA 2XB8A 3UC9A 2MOKA 2WYIA 2MSWA 1I5OA 2VSYA 3GLVA 4FYVA 3CW8X 5LIRA 1E6UA 1VJTA 3S29A 3CVJA 4E2YA 1U9YA 2RC6A 2I22A 2VP4A 4LHWA 2F43B 1ESEA 2HI0A 5D5HA 4AM8A 5KOIA 5CEJA 5DRYA 1TCUA 1VJRA 4F46A 5HIKA 2FW6A 3PF9A 4O4IF 1ODSA 4AS2A 4AWBA 4BNTA 4C0BA 2FPOA 1D2RA 3CC8A 4YJGB 2AD1A 1PR5A 1BRMA 2QXUA 2RGWA 3DBRB 1NXSA 3DKVA 3NHJA 5F3RA 1RRPA 2IU0A 2P65A 3EH1A 4FD3A 2PSHA 2WUFA 5C31A 1VSVA 3A3KA 4MDYA 3TTUA 3HVRA 2JZNA 3WGUA 2GNOA 4XEUA 1A98A 5IT5A 3BHJA 3F2VA 1EEHA 4EUFA 5J5AA 5DN6A 4HEJA 3FFAA 4AX4A 1XE3A 2WD7A 1XCGB 2WYVA 4E5DA 2UYHA 4FHEA 1WBDA 1Z5NA 2LIPA 1WV0A 5JUWA 3TQSA 3IUQA 5AJHA 1UAYA 2R2AA 1PEKE 3AHJA 2RC5A 1J9EA 1QH1A 1CR1A 2OCIA 2Q3DA 1TPYA 4NBWA 3FSJX 4ZPXA 1OI3A 1CY1A 3TAUA 4ALLA 1SD1A 1PFWA 5WRFA 4F45A 2XEDA 4G2TA 3UQYS 4F60A 3H42B 2BWJA 1VRVA 5EJ4A 4XM1A 2ZTSA 5IJAA 5IAKA 3WYGA 2N1BA 3M6AA 5J63A 4JXXA 2NACA 3NT5A 1ZK1A 2O07A 5I7VA 2Y1CA 1CDZA 3UV3A 1H1LA 1W5TA 2J9XB 2JBAA 1KC1A 1HG1A 2JFGA 1NBAA 3MSCA 3OVMA 4TV9B 3RTAA 3RSZA 2DUWA 1CZRA 1NJFA 4XWGA 3QV1A 3ZWYA 2EIHA 3UPDA 3AVXA 2B3TA 1AHPA 3QX7A 2C96A 2VNHA 1IN5A 6GPBA 3FFTA 3KFLA 3K9FC 4RHYA 5AM2A 3EF1A 5BWNA 4H9GA 3ZI0A 1FFCA 1YQQA 2BP7B 4W5HA 2P69A 1SCKA 2JGLA 2I03A 3HCWA 4ZHSA 5BXQC 2G36A 1XPOA 3VPBA 4LJRA 5CT8A 2I6SA 3SZLA 5JASA 1JSRA 3ZN2A 4CR8A 3R7DA 3Q40A 3QF4A 5DGHA 1XKQA 3H05A 2DWOA 4MLPA 3VKVA 1REQA 4B4WA 2PGNA 2J3MA 3FPKA 1XWWA 4OHFA 1A1SA 4ESOA 4HY3A 2I8LA 4LXYA 1G6HA 1PU2A 2ASVA 4ZI7B 4UHFA 1JI3A 2PQ2A 4R1TA 5A3SA 1EGHA 1JFLA 4OREX 4XWKA 1SKUA 2VPQA 5IHPA 2PA3A 1JAIA 3THYB 4CNBA 4E5UA 3QFTA 1T0IA 5B2EA 4ZMBA 2E5FA 1XQ9A 4YMIA 3UK0A 2Y3IA 2UVPB 3KLNA 2XE4A 1O87A 4OUKX 3ZZ0A 1NC1A 3K0CA 3NWPA 5HKKD 3RFTA 4QGHA 4FDTA 2IU6A 3WKDA 3NONA 3BK1A 4LVCA 1YJ5A 3R0XA 3ZVNA 2Z8XA 3TZBA 1CY2A 1DBIA 3ZVMA 1L7DA 2ZYRA 3WYFA 4OGKA 5GZ3A 2HXYA 3CVOA 4MV8A 3P0JA 3D6FA 2DT8A 3RREA 4DPMA 1WABA 5IT9A 3SBXA 1L5SA 4GPEA 4I3FA 4IWNA 4O2AB 4EPWA 4IFIA 3WBKA 2HMTA 2N75A 2A1UA 1G8FA 3RRJA 2ILTA 3TSYA 3BMNA 3O8OA 4RS3A 1QGZA 3PDHA 4GE0A 5JR3A 1P3Y1 2GMWA 4YV1A 1Q1QA 1RAFA 5CLQA 4AIRA 4UE2A 3QFSA 3AR4A 3UUEA 4ILEA 2SNIE 2BCJQ 1IG0A 1NUUA 1SRQA 1T8WA 1IPHA 1GNTA 4PHHA 4URZR 5A0FA 5IJXA 1T0JB 4ZPJA 2PQMA 3DR5A 4CIVA 2E4YA 4PLFA 1YB4A 1ZHFA 4HGOA 4OK5A 4IJKA 4TGLA 3GFVA 4ARBA 4EG4A 3P2MA 4DTCA 3UWSA 4WBNB 2JJ1D 1TD9A 4H3HB 5E4YA 5C8VA 2GESA 3EDYA 4NBTA 1ZITA 1YTLA 3QEAZ 2BEUA 2X7JA 3NVAA 3TTXA 4W1SA 4BYMA 1N4DA 2OSVA 5KYUB 3DZCA 3AVQA 2G0AA 4B34A 5KYVA 1WZCA 5BWBA 1HNZB 5FO0A 3BJRA 2AKYA 4RMJA 5SZKB 3IAAA 1U8YA 3EGEA 3H11B 3OM1A 4GYKA 3SHOA 4IDGA 5EQFA 3UIEA 3W4KA 4KQ2A 4PZUA 4JYMA 3OY2A 1JVSA 2BISA 4JUCA 1JILA 4PQRA 4Q24A 2H4ZA 3I92A 5IDYA 3NHFA 1QE3A 4NBNA 2YBDA 3R20A 1E2LA 4XM0A 5DEIA 2GYVA 3JQBC 5FWYA 2CDAA 3SM9A 3DT9A 3NYWA 4UE3S 5TX7A 1OX4A 3BL6A 1JTFA 5A2GA 5CLFA 3I62A 3NDRA 1UPAA 2SKCA 3O95A 4NCNA 9LDTA 4BE9A 4LF5B 1NI5A 4FMDB 4XGQA 3TNFA 3UEOA 1BFKA 1V8DA 2V98A 3DEHA 5C1BA 3LQKA 2RHDA 4ZVMA 1PNVA 4MAMA 2JI8A 4B44A 5KIAA 2ADFA 3GLHE 3JTEA 4C05A 4N48A 2I2AA 4NMXB 2PUGA 3FLMA 4QAJA 5IJ0B 3CUEF 2GCOA 4QPJC 4CCYA 3L77A 1UBTS 2EQ5A 3AEQB 4L8WB 1NRWA 1T8PA 1QYCA 2FW7A 2WP8J 4EG1A 2CZQA 3CZRA 4FXPA 4CODB 4Y6QA 1U4SA 4UMFA 2J7PD 3UCXA 2ZYIA 3BCRA 2J0EA 3D1JA 1LBSA 3IFSA 4IDAA 4EFKA 4ZHQB 1Z5VA 2Q6IA 1X1QA 4UZSA 1P2GA 1XPUA 1X3LA 5DI3A 4QTXA 4TMYA 3UOWA 3N8DA 2AC7A 3H8SA 4S1OA 3RAEC 1D2MA 1U9IA 1CUEA 1KYTA 2UZ1A 3W2FA 1BXGB 3CM0A 4E5KA 5JZMA 5IRCD 3K09A 1Q7RA 3H8JA 3FPGA 1BE8A 2X4GA 3EEQA 2R8OA 1LK5A 3CWQA 4YAKA 3PNKA 5LKRA 3I5YA 4B7XA 1E7WA 3H8WA 2RI6A 3OMLA 1X7GA 3AVTA 2JJ1A 4M8IA 4AJIA 3FUCA 2BEUB 4UMVA 3C6BA 4TROA 4BVHA 4NX2A 3WQBA 1BXGA 1MG5A 1PZMA 1R5JA 5HGXA 4E4RA 4PO1A 3O38A 2WHYA 1MIOA 3L0CA 1R9MA 3JQQA 2F9MA 1N5DA 1ZRNA 2G6BA 2H2FA 2ISQA 2ZJYA 3MBIA 1JTVA 1GQ2A 1NBMA 5T57A 2QQGA 1QIJA 4XPZA 5A06A 3F6BX 1QCCA 1NW7A 3VR6A 1USKA 5AVKA 1AKEA 2NOAA 4GO1A 4HWSA 4DSUA 3B12A 5HF5A 1SELA 1SVSA 1SZCA 4EA8A 4DB2A 3I5XA 3A6HA 4YECA 3RBXA 1RWMA 2I6XA 2ZG6A 1SKQA 3E5RA 1QGOA 3OFND 1LH0A 1EDZA 1OJ7A 3ZI4A 2V3VA 1D8TA 2IHTA 3B38A 3BMXA 1G17A 2Y1LA 3G68A 4IIBA 4KQWA 4R5MA 4DWWA 3U09A 4OA5A 3GT7A 4B31A 2JHPA 4XIYA 1J97A 1WY5A 2B69A 2DWPA 2VK2A 2AOUA 1VLVA 2B4QA 4Q6BA 121PA 4D4MA 2A7QA 1G291 5DNUA 1D4OA 1PVDA 2VDLB 4RSMA 1E6LA 4HXGA 3WLOA 3FLBA 2XE6A 4RHEA 2NW6A 3JD3A 1CF2O 5ERYA 3TKYA 1Q6ZA 2BSXA 5GJWC 1J0BA 4NMLA 1LI7A 3E3AA 4JCOA 3GNTA 2AQKA 3TFQA 1PJ4A 5A9SA 1RM3A 4WCFB 3RVMA 4CI0B 1P7PA 1NIJA 2HMAA 2HO4A 4BMCA 5FA5A 3UFXB 4R6WA 1UMDB 1KH1A 2I9KA 5E38A 2YYZA 3C3YA 3PGMA 1MJGM 5E3IA 1ZMOA 5SZHB 1M2VA 1T8TA 3OCXA 5L3SA 1ISJA 3QG1A 4L73A 3TQCA 1AB6A 2P91A 1WXWA 4URVR 2R84A 3UKDA 1S3IA 1BJKA 1JVNA 3JATB 3MT8A 2AR0A 3D8NA 1XMOB 4ZN6A 1DJPA 1P3JA 3LUCA 2OZKA 3H9QA 5KTOA 3BGWA 1OI7A 1DT3A 1P29A 2HDNB 1M3SA 2XDWA 3Q5GA 3LCJA 3Q3IA 4I3GA 4UEOA 3SLGA 4EBFA 1W36C 1V2GA 1VKOA 1VHDA 2HC9A 1VI5A 3PR3A 3C3BA 5ENVA 1XKXA 1XJ5A 3CEHA 5CYFA 4DIFA 1R8QA 1H4TA 4CMCA 4XKJA 1KKMA 1W2WB 1NWHA 3GFFA 5DP1A 4JC5A 5FBZA 3GXOA 4W9MC 3TIVA 4ZZ2A 3EPJA 1E2GA 2Q3EA 3OQJA 2AFHB 3WE7A 3TLXA 2EGHA 3LHFA 1LPNA 1RMTA 1SC1A 2IEAA 4XB1A 3RKRA 3ZCXA 5GOZA 3RCBA 1QHXA 1SCUA 1UMCA 3I8XA 4OHXA 5C4MA 1RXWA 5E95A 4JJFA 2F8TA 3VR3D 3R7LA 1VKRA 4P98A 4BO3A 1M34A 1OLSA 4Y2YA 1CE8B 3HBNA 3C8ZA 5DHUA 4A3SA 1Y8QB 4C76A 1CZHA 4ZYWA 1JQ5A 1RYYA 5BNTA 3ELWA 1OA1A 4DQUA 1SNYA 3COYA 4RPGA 4E70A 4EENA 4EITA 2QLNA 1QNFA 4K8RB 5B3AA 1ACMA 3RO7A 3V3KA 5LYJF 5EXDA 5HNKA 2W4IA 2HMVA 4J90A 1MC8A 4CG0A 4CW7A 1MJHA 2L2QA 4FZVA 4D8UA 2GBIA 1XNGA 3LW8A 1N6NA 3DH0A 1GO2A 1NV9A 1R3DA 3WLPA 5KDOA 3E9MA 3FKJA 3KE8A 2GD6A 1ECPA 4JN6B 2VJOA 3CKMA 1I9GA 4MPDA 4BLSA 1K86A 4HDMA 2CUKA 1JDJA 4YMSA 3HY3A 3FCUB 4YP0A 2NADA 4D3ZA 5THXA 3A4TA 1PFGA 1JA0A 4WESA 5T8KC 2G7ZA 3EGIA 4Y2PA 3W6NA 1SXJB 2NTNA 2R6JA 1EUZA 2B8EA 2H9YA 2KW5A 5CA0A 2NM0A 4KH1A 4X85A 5AVZA 2PDAA 2ZIUB 3N87A 2QL9A 1XA3A 2AGVA 2REQA 2B0CA 4B74A 2QAIA 3F46A 1Q6YA 1V7CA 5LD2C 1LLQA 3EHEA 3PI6A 5FOWA 3OJ0A 1VMAA 4DR4B 2HRDA 1FYVA 4XD2A 2VDQB 2PQ0A 1N5JA 4KOAA 2BEJA 4UDOA 4ZALA 3T9EA 4EFMA 2B2CA 1RLIA 2A5JA 6ADHA 1DAOA 5AW1A 5ADVA 2QUZA 3OQPA 1NYRA 5BSUA 5BUSA 2Z04A 1XT6A 1F48A 4G09A 1POXA 2YUIA 5JMPA 1RWWA 1IUNA 4XDYA 4Y18A 5I4BA 1EKXA 5L6MB 3ZHVA 4QJ4A 5J59A 1P5RA 4AJHA 3MS7A 4OAQA 1KO8A 4X90A 1SU6A 4IHAA 1Y1LA 5AOAA 5JSYA 4BKUA 1VI2A 1G5IA 3BWEA 3GJ4A 1QCDA 4QRIA 1L9KA 4QWMA 2K4MA 4X1IB 3ZGNA 1D4FA 2PFGA 3HKEA 4YONB 1M54A 1XA0A 1RI1A 4L8GA 4BKQA 3I5UA 1L3CA 1YL5A 3A4LA 5UKDA 1EMDA 2X5KO 1T34A 1TKRA 2J59A 4RKFA 1Y3FE 2OENG 2VJDA 1X1SA 4Q1DA 5H3LA 1ZQ9A 3E1GA 4C4TA 3SZOA 3AM5A 2A9PA 2JGDB 1XZLA 1CW2B 4H15A 4JVNA 4PAGA 1G9XA 1OBVA 1SHLA 2OCKA 1OGIA 2HF8A 3OSZA 4II7A 1Y4SA 4PO9A 5DWQA 3TI9A 3TVDA 1DDGA 221PA 3QLEA 4KQ9A 3W2EA 4I50F 1UKZA 1Z7WA 3B1VA 3OTWA 4WNAA 3C97A 2HV8A 2BLNA 1Z08A 1AUVA 2GEBA 3KEFA 4UNSA 5E1DA 4EZEA 1JG1A 1T6XA 3V5NA 1GGEA