2CXXA

Crystal structure of a probable gtp-binding protein engb
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
184
structure length
184
Chain Sequence
ATIIFAGRSNVGKSTLIYRLTGKKVRRGKRPGVTRKIIEIEWKNHKIIDMPGFGFMMGLPKEVQERIKDEIVHFIEDNAKNIDVAVLVVDGKAAPEIIKRWEKRGEIPIDVEFYQFLRELDIPTIVAVNKLDKIKNVQEVINFLAEKFEVPLSEIDKVFIPISAKFGDNIERLKNRIFEVIRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a probable GTP-binding protein engB
rcsb
source organism Pyrococcus horikoshii
molecule tags Cell cycle
molecule keywords Probable GTP-binding protein engB
total genus 65
structure length 184
sequence length 184
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2cxxA00
1E9BA 2W2XA 1E2IA 1P2TA 4HZUA 1XD9A 1ZCBA 1U0HC 4M1MA 2O8BB 1RFLA 3FE2A 4DDVA 3V9PA 4XWOA 1QVRA 4D0NA 4B34A 3SOPA 4GDFA 1OE0A 1G8PA 2R8RA 4LJAA 3I32A 2JLRA 2ZJBA 3T1VA 1DAMA 4M1KA 2W2VA 4Z1MD 1TQ2A 4FCTA 2IK8A 2ZRJA 1SKQA 5IK2D 1GWNA 1W0JD 1PUJA 2ZITA 4Z8XA 1NF3A 4EQ6A 2W0SA 3PQCA 4DBLC 3RDPA 1W0KA 3Q8XB 5LD2B 1E2MA 3PUYA 1T8UA 1ZCAA 3BERA 3OEED 4QM6A 3MMPA 4JBYA 1Z08A 2RGGA 1OHHA 4TZ6A 3FFAA 1US8B 4TLBA 4BFSA 2QMHA 4GRAA 2G0TA 2OXCA 4BLOA 4URYR 4C3ZA 1P2UA 1U99A 3OE7D 1N5KA 2C03A 3EC2A 2VHJA 2QORA 5H70A 1Q57A 2XZPA 4HUQB 2QGZA 1ESNA 4BFTA 1BMFA 4R7ZA 2W6JA 1W1WA 2R62A 2WJIA 4H9GA 2DBYA 5JHHB 2B21A 5SZJA 4OJQA 2QA5A 1KYIA 1SXJE 4JLDA 1OXVA 1KK2A 1YRBA 3AGQA 3Q5EA 1SQ5A 5KSOA 1YKSA 3KL4A 4CEJB 1SKYB 2ZI4A 2WWHA 1Z63A 1OJLA 3ETLA 1YR8A 2Q9BA 4UKDA 4A2PA 1NN1A 2J0UA 4BE7B 5JSZA 5C4GB 5BYKA 2YC4C 1XTQA 3L8ZA 1Z6TA 4X8LA 4XD7A 3WBKA 3WHKA 3I72A 1A4RA 1EFTA 4LC1A 4Q9LA 4QJ5A 4RZXA 4EUNA 3B1YA 5FFMA 3ZIAA 4PX9A 2B6HA 4PC6A 1AN0A 2I3BA 3R9IA 2HJVA 5FBWB 2FA9A 4V0LA 3EZ6A 3KXLA 4JLOA 4NU0A 1SVOA 4PO9A 1EFUA 1QDEA 2F43A 2QTHA 1FMLA 3I92A 3PFIA 4GPTA 4Q4HA 4XSGA 4ILEA 1NNEA 2PLRA 5EP4A 2QEQA 3PIRA 4PO1A 5FL7A 1G64A 2CE7A 1G5RA 1S2MA 5F9FA 2EQBA 2V6IA 1QF9A 5LD2C 2UZIR 2G88A 4O3MA 2XZLA 5HR5A 1YU9A 2VA8A 1NSTA 5G3ZA 4A0FA 1RKBA 2ZR9A 2ZS9A 4BECA 4IFEA 4NMMA 5FTLA 4DT1A 3DKVA 1ZRHA 5IF9A 2NIPA 3MWYW 2P0EA 4HEJA 4Q48A 1M7GA 2CDNA 4DHEA 4I1SA 2WTUA 4PSAA 4WXRA 2ZI7A 1VYVA 2QP3A 4TL8A 1KK3A 5J47A 2JAQA 1XPOA 3IHWA 4G5OA 1ZC4A 3SJAA 1VMAA 5FOSA 4OI2A 2IF0A 5EUMA 2JLYA 1U9IA 4G01B 2J0VA 2HXSA 4HAXA 5IK2A 2XNDA 2HLDA 3KJEA 1P75A 4A6XA 1GVNB 1NIJA 1RZ3A 2GWHA 2EFHB 1E2HA 4DC9A 4Q1AA 4TN1A 3KQHA 1Z2AA 3H86A 1E2DA 1N0VC 1KI3A 5E7JA 3JZAA 3TGPA 1IY2A 1G3RA 2G3YA 2YKGA 3AVYA 5KYKA 4RZ2A 1EFHA 3MWKA 3W9YA 3GLIB 2GZAA 3BAFA 5DI9A 4HZIA 3VNVA 3OE7A 1XTJA 5JEDA 4IKEA 2OBNA 3ZVRA 4AG5A 3TIFA 2FOLA 2CK3A 4NYIQ 3CX8A 1XZPA 3BXZA 3UG7A 3EXAA 3FWYA 4JBWA 2OUKA 2QENA 4C0HA 2FX3A 2ZU0C 2RGCA 5AUQA 2QZ4A 3O8BA 3CPJB 3OEHA 1FFHA 1S1MA 2XJ4A 2ZPTX 2FFQA 5CM9C 1X86B 3THWB 5EE9A 3HP1A 5HE9A 4Q1BA 1BIFA 2F9LA 2YHSA 2VQSA 4TT3A 1XCGB 4NL4H 4CT5A 3AQ4A 4M1SA 2GCOA 4Z8YA 2Z43A 4XD7D 3BD9A 1MOZA 1AJEA 1A2KC 1LB1B 3REFA 2ZUBA 4CW7A 5KNBA 1GP2A 1ZM9A 1TF7A 2QPTA 4FXPA 1EX6A 3C41J 4XTCS 3KKNA 4HB0A 3U3MA 4W9MC 3RYTC 2GXSA 2FPKA 4FMCB 3T12A 4Q4JB 1Q12A 3VR3A 2BJVA 4S35A 1Z0KA 2J3EA 4CEIB 1GILA 2BM1A 4DCVA 3ADBA 3TRFA 2C95A 3TQFA 1G7RA 4FMDF 3FVQA 5FL7D 1U94A 4HB2A 4HSEA 3IHLA 2XZOA 1WB9A 4TYQA 4HDQB 1JAHA 1ZW6A 2C8VA 1E2QA 4QNMA 3LLUA 4KFTA 1G3QA 1QHHB 3V00A 4C2UA 1KZGB 2P6UA 5CLLA 4YMVA 3EZ2A 3HR8A 2W6ID 3OIYA 1CRPA 3VNUA 2IA5A 1DAHA 2V9PA 1OFIA 4F7WA 4DVGA 1Q1EA 4CIDA 2X77A 4P4UA 3QENA 3LVRE 2BMJA 2BKEA 1OIXA 4OQFA 2NO7A 5DIFA 3JZMA 2VHQA 4V0OA 1CBUA 1TF5A 1B0UA 2QM8A 1II0A 1P5ZB 1U8AA 3CB4A 4LJYA 3QPUA 2GZDA 2ZANA 1G6HA 3BFXA 4HLCA 4AIIA 4RD4A 1BYIA 2C96A 3K9HA 1GOTA 1OIVA 1KSJA 3MLEA 1T6NA 1L4YA 4K81B 2OG2A 1EG7A 2G1KA 3BFVA 4G3XA 5UKDA 1HURA 1J7KA 3BIFA 4AI6A 2ZUCA 1P2VA 5L3QB 1XEXA 1UBEA 4U00A 3GFPA 3AF3A 2BC9A 3H0KA 2LKCA 3FHTA 1ZUNB 1BOFA 3IIMA 1OV4A 1V43A 2QL6A 1DBSA 4JSYA 2ONJA 5KUTA 3PV0A 4X8HA 1WDTA 1AGPA 2I4IA 2A78A 3QXHA 1I4DD 2X2FA 2ZM5A 2PX0A 5FUWA 1NIPA 2GZHA 4KVGA 3MSXA 1TMKA 3RABA 1MO4A 2ORVA 4GI7A 4BLPA 2J7PA 3RRYA 3G82C 3ICEA 1KKMA 3GD7A 3TUJC 1KNQA 2VEDA 3B8HA 5BQ5A 3AV0B 2OT3B 1Y63A 3QKTA 2Z5FA 4YXWA 2E87A 4M9QA 1EFRD 4M1OA 4M22A 5AR1A 1RE0A 4BRUA 1UBFA 3CRQA 3U5ZB 4ZPXA 4NKRA 5KNCA 2WBLC 1CR4A 3SJBA 3X1YA 5DI3B 3PVSA 1IY1A 1ODFA 1NN5A 2IX3A 1M34E 5KNDA 4JVLA 2OESA 1L8QA 3C7KA 2EFDB 3DVLA 2BCJQ 2ZJ2A 4BLTA 1Z0JA 5FOXA 5FI1B 4O25A 5DGXA 1COWD 2RGNC 1EXMA 2H7VA 3CWZA 4ZIRA 1GAJA 5L3SA 1JALA 1HY3A 3EARA 3U2QA 4AYTA 1U90A 3QXSA 2Z4SA 3UWKA 1GRRA 1IXZA 3GLHA 1N6KA 2VBCA 4PQYA 3RRNA 1OIWA 5J40A 4OL0A 2PZGA 3GJ6A 4FMBB 5LDDC 2QAGB 221PA 4CGZA 1FQKA 1H8EA 2Q3FA 2RHMA 5C4MA 1OKKD 1HYQA 1T0JB 2FZLA 4CEHB 3IEUA 3M4YA 3QE0A 3ONWA 1FL9A 1XU4A 4U5XA 4DSOA 2F1HA 4BEBA 1K5GA 5GJCA 2NZ8A 4H1VA 1VIAA 2NO9A 1RYHA 2WOJA 3SYKA 3ZH9B 5J4LA 1S96A 3EIQA 5E3HA 3RANA 3NEJA 1F6BA 3CWQA 4LHVA 3A37A 2H1LA 1NMXA 2VLIA 4HI0E 2CCGA 5EUQB 3BB4A 1KJWA 1XB2A 2ZVQX 3T61A 4Q7JB 2R44A 2WWXA 5BW8A 5CB6A 2OLJA 3B1WA 5C1BA 4M21A 2WSMA 5DHAA 1U0LA 4TL9A 1IQPA 5TMPA 3ND8A 4FCWA 2OBMA 1RIFA 4LYJA 2ZS7A 4WOPA 5SZHB 3L8YA 5HKKD 4MYCA 2IHYA 4C2TA 4M0LA 5FPYA 1Q1QA 2GBLC 4I1OA 1KI1A 1XBTA 3CPEA 4DLTA 2O8DA 1U98A 2FMXA 3CZQA 1IONA 2FSFA 4FWTA 2FZ4A 1NLYA 4HLDA 5FPHA 4NYMQ 1Z07A 1EESA 3LXXA 4XWKA 3K0FB 4QJ4A 1VTKA 1HUQA 4AWXA 1FUKA 2OV2A 1FNNA 2AX4A 1TX4B 4Q19A 1A2BA 3RS4A 1TQDA 1CIPA 1E2PA 1U0JA 1ZUIA 4EAQA 4NCHA 3CR8A 1JR3E 1X8JA 4P3YA 3ZD7A 4D25A 1GKYA 2JJ1A 3N70A 1FQJA 3KB2A 1R10A 2GJSA 3KXKA 3GP8A 5FTKA 3K9GA 3T06B 3LBIA 2J9RA 1W36D 1XEWX 1H8HD 3DPUA 1TQ4A 1UFQA 1UBGA 2JGNA 1KDPA 5A5GA 4M1WA 4JZKA 1G7CA 2QMEA 3HU3A 2G77B 3KQNA 5EE3A 1Z2CA 3NXSA 3UKDA 8OHMA 4AKHA 4V0NA 2P6NA 3E70C 1VCIA 2KSQA 4D80A 2XGJA 2QRNA 4URUR 4PPFA 1RC8A 3EPKA 3QBVA 3KFXA 3LQRA 4B43A 1IAQA 2D7DA 1YZGA 4M9ZA 3AKEA 3SYNA 4DIEA 4OJKA 1DTSA 4KAXA 2FEOA 4RVCA 1T8TA 1TU4A 2G6BA 4BFYA 1E9CA 1N5IA 3K1JA 2IYXA 3QF4B 4N0DA 5CLQA 2AWOA 1N0WA 3CF2A 1ZM7A 2A5DA 4M4SA 3GLFB 1OW3B 3LAWA 3M0EA 4P4SA 4MGZR 5JWHA 4JT2A 5J4KA 3RSOA 4A1FA 1QVAA 1PLJA 4OQNA 1P60A 1EGAA 3W34A 2WM9B 2HYDA 4I4LA 4WXPA 4ZCIA 1KO8A 2IC5A 2AFHE 3A4LA 3RLFA 5BXQC 5KPDA 1W36B 1CLUA 3AGPA 3PENA 3PG5A 4JKYA 4L15A 2C98A 4EJSA 2HYIC 1D5CA 2IXGA 1VYTA 1Q3HA 5K8IA 3NHAA 1E2LA 3AP3A 1E94E 4C4PA 3DMDA 3U3RA 2MSCB 2Z6VA 3SFVA 2QE7A 2BV3A 3SHWA 4EIWA 1JEEA 1V5WA 3W5IA 3NG1A 1FTSA 1GL9B 2ZYUX 4DLZA 1VG0B 3FMOB 1PUIA 1UEJA 2MSDB 3ASZA 3B9PA 4HYYA 1WA5A 2AN9A 2IYYA 3EW9A 3IIJA 3WY9A 5CYPA 3N5CA 4ZCLA 4P31A 1P9NA 4Z51A 5CK5A 1EWQA 1NKTA 3NTUA 2UZ3A 4GP7A 4TTQA 4WA7A 1CULC 3HWSA 4MRVA 3SHFA 4DT1B 2JLZA 2IHBA 2GA8A 4KHZA 4NE2A 1D6JA 4PSVA 2W6JD 4URXR 1G8YA 4B71A 1IN6A 3AB3A 5ELXA 4GL2A 1IOZA 4CZ2A 1WBDA 4CEIA 4WIAA 4IDNA 2VSOA 3JVUA 3GJ7A 1XMIA 1AKYA 1B23P 1GNRA 4Q7LA 3PUVA 3RWMB 4P33A 4A92A 4CRWB 3GFTA 3QJYA 4DUGD 1ESMA 4US0R 5KSYA 1RRFA 2ZQ5A 4UNRA 1N6NA 5L3RA 2OILA 3VR4A 2LKDA 2WMOB 1IM2A 3TAUA 3VR1A 1AS0A 1D2NA 4C9BA 3N2IA 3UATA 5CK4A 4YQFA 1G18A 2EVWX 2A5YB 2CK3D 3W3AA 5C2JB 3B85A 3HPRA 4PAOA 3U7HB 2XOKD 4S2EA 2IL1A 3CUEF 3GLFE 2DHRA 4Q03A 1AM4D 1AK2A 1D9XA 4ESVA 3MGCA 2CL6X 1XMJA 2ZJOA 4M9SA 1EFRA 2DY1A 1OXXK 3LQQA 2TMKA 1XZQA 1TAGA 4WZAE 1TUEA 5AJYA 1LS1A 3L43A 6Q21A 3BJIC 4V0KA 1E9RA 2BVNA 4DEXA 4MQBA 4KLZA 1E0KA 2X2EA 2ZRBA 4AURA 2R9VA 1KTVA 2BCGY 1JNYA 3VAAA 2WAYA 4LZZA 4JLPA 1ZNYA 4J0QA 1VCNA 3A1TA 4M1YA 5C46F 4NH0A 2I1QA 4B3GA 3Q3JB 2V7QA 1E79D 1XNJA 2PCLA 1K6MA 5B2ZA 3K53A 3BH7A 2FG5A 1I4LD 2FGJA 2WAXA 2JLVA 3FMPB 4NYJR 4OK5A 3L82B 1KO5A 2CHQA 2ZIAA 1L7VC 4LK2A 3MG9A 4UNNA 4LJ9A 1ZBDA 3PXGA 1BO6A 5CM8B 4IOKA 3QKUA 4MUBA 5G41A 5AWFC 4BPBA 3CX6A 4KLNA 4V0MA 1VG8A 4NTZA 2ZROA 1N0UA 2KE5A 4HATA 4UJ3A 2GHIA 2AR7A 2NO0A 2G83A 2AHOA 4KVAA 1SXJA 4LBWA 1HE1C 521PA 1YE8A 5TXGA 4B2PA 1CKEA 2JA1A 4BGDA 2ZXUA 2FE4A 4K46A 5AJVB 1KSGA 1Q3TA 3CH5A 5JWRA 2ZETA 4MRSA 4B33A 3ZLJA 2GTPA 4JLVA 3KFVA 4XVRA 4ESHA 4DLVA 3V4FA 3A58B 3WBJA 4FIDA 4A0RA 4E09A 2V6JA 4JL5A 1IXRC 4JLNA 4KFUA 1LVGA 5FPSA 1ZNWA 4Q9JA 2FFAA 1Z6AA 4V0ME 2CNWA 2HT1A 1F48A 2BEJA 1F2UA 2GCPA 4D0GA 4Q4AA 4D4KA 2BMEA 2F1RA 3K70B 2AFIE 2HXYA 4OKSA 5FOVA 1UKYA 1ZNXA 4TT3D 3CNNA 5HKKA 3I8SA 2D74A 2ATVA 3DKPA 2CHVA 3K0AA 1KDTA 4E22A 5L8VA 4PAQA 5K8LA 1E2JA 5L3VA 3GEHA 1PLLA 1TADA 1YVDA 1Z8FA 2ZJ8A 3LW7A 1GM5A 1NP6A 4DLWA 3EPLA 1JXOA 2AL7A 2H57A 1ZMXA 1Z3IX 4N1AA 2OXRA 5L3QA 1E2KA 4NPHA 1LY1A 2VIIA 4HUQA 2YC2C 5FBVB 1G8HA 4HDOB 1KI4A 1E0SA 3TVDA 1U2RA 3KQLA 2YOFA 4LHWA 3CR7A 1JQLB 2GCNA 2JJ1D 2PEZA 3RS2A 1IJEA 3MD0A 4LDJA 1OXSC 2EWVA 2SHKA 1W0JA 4B3XA 4RD2A 4NONA 3A1SA 1SVIA 4FI3C 4N3NA 3B5JA 2JJ2A 4CVNA 4LRWA 4MGIR 3DM9B 3KKPA 4Q5IA 5FPKA 3IO3A 1N2CE 2FEMA 4TYNA 2IWRA 1ETUA 4B44A 1VHLA 2EW1A 1E6CA 5IDVA 3VTKA 5DYGA 2IXEA 1GRQA 3WYAA 1IN7A 2IYRA 2F6RA 3K09C 2DFTA 5E7MA 2W00A 4A82A 3CONA 3FTQA 1WQ1R 3E1SA 4JIMA 4QOSA 2QNRA 5DN6A 3L2OB 1KMHA 5GVSA 3IBYA 3K0FA 1R7RA 3KB1A 3RWOA 4M9XA 1FOEB 1DAIA 3TSZA 4ASUA 1HH4A 2ZRDA 4HAZA 2EFGA 3ZVLA 4D81A 3F0TA 4NYJQ 3BS4A 5HCIA 1S9HA 4YMSA 4UXIA 1Z0IA 3K70C 4TQ9A 2NPFA 1X1RA 3EPHA 1AS3A 3KJHA 5JS7A 3TW8B 4C0LA 3AVTA 2H17A 2A7QA 3CRW1 1JR3A 4HAVA 2PCJA 1SXJD 5TVKA 2GK7A 4CF7A 4YMUA 1Q0UA 2ZTSA 4MYTA 4PXAA 4Q7MB 1ZYUA 5DLQC 4RD1A 1M74A 3IQXA 2BBOA 4US2R 5ANRB 2ANCA 3E2IA 3MUFA 4Q02A 1R6BX 2ODNA 3ZIAD 4B47A 4DB4A 3THXB 1KJYA 1J2JA 2G9NA 4Q9HA 1DO2A 2JCSA 2J7PD 2OHFA 3LLMA 4KITB 1E4VA 1XD8A 2NTYC 2QAGC 3DZDA 4E5UA 5H1YA 3A6PC 1OB2A 3MAAC 1R0XA 2AD5A 3R9XA 2YV5A 3TBKA 2A9KA 3TNFA 3SDZA 4W5WA 1ZVQA 1Z6YA 1OXTA 2GCOB 4Q4AB 1XXHB 4II7A 4F4IA 1GNPA 4R2HA 4X8OA 5B30A 1ZU5A 1ZD8A 4TL6A 2RMKA 2ZS8A 5KDDA 1E2EA 1YR7A 3BB1A 3BORA 5EE0A 4D2IA 4PZZA 3UG6A 2XX3A 1E32A 4Q21A 4QGAA 5FPTA 5TB5A 5EJEA 1SVSA 4U02A 4PPGA 2OM2A 1QHIA 4TLAA 4HLQB 4QGGA 4CDGA 1CR2A 1ZU4A 4EFNA 5AJXA 1T3HA 4OQMA 1OYWA 4DCSA 2V55B 5FR1A 4XSHA 3BB3A 5B64A 4KV9A 2AKYA 3AH8A 3H1TA 4MKHA 3GQBA 1ZC3A 1ZD9A 3MJRA 1KK1A 2QI9C 5LBIA 2WZQA 2O0HA 1HE8B 1MH1A 2HCJB 1NY6A 2IW3A 3QEOA 1P3JA 2XJ9A 1VECA 3AP1A 5TY0A 2CJWA 1UKEA 2XOKA 4PHTA 3ZJYA 1I2MA 4FW9A 3O8CA 3GJ0A 2YZ2A 3Q9LA 1XTIA 4QG7A 4KI0A 4PPQA 4I1UA 2D62A 2ZSEA 5AJWA 3FKSD 1JQJC 2PEYA 3SI7A 4MDFA 2O52A 2NO6A 2VF7A 2J45A 4LJ8A 4PC1A 5DYIA 3QXCA 4TWZA 4KFSA 1U8YA 3T1TA 1VCOA 4WW0A 5FOUA 4RCYA 3KQUA 1KJZA 2QBYB 5LB2A 2C77A 1YJ5A 4RFSB 4F92B 5KSPA 3UMFA 1CP2A 1XJCA 3FOZA 3WMGA 4YMTA 1XEXB 1N25A 1RPZA 2BJWA 3GJXC 4HDCA 4PSKA 2MMCA 2ZAMA 4OYHA 4DRZA 4TTPA 1MO3A 2IS1A 3IQWA 2A2ZA 2ERYA 2YWEA 3BGWA 4V02A 5AK0A 2PBRA 2F55A 1P4SA 3GLFA 4GMDA 4JVMA 2BBTA 2ZRCA 3A1WA 3TAHA 3THYB 2V3CC 2J46A 2BMFA 4AYWA 4P4TA 4AKGA 5AUNB 1AZTA 3RHFA 5JWOA 2WKPA 4TQUS 1N6LA 5CB8A 2ZI3A 3C4JA 1FNMA 4R9UC 3GEEA 3ECCA 1OHHD 1XPUA 1VDZA 5F2EA 3SS8A 4AKEA 3AUYA 4D0LB 4LX0A 5KTYA 3WMEA 1GG2A 2VO1A 4RFSA 3QVVA 1W5TA 1G291 3LBNA 3ZYCA 4WVFA 2CCJA 1AA9A 3IDQA 2FFHA 2FPLA 3QG5A 2CBZA 4GMXA 5DH9A 3VR5A 4C0QC 1OH5A 1RRPA 3AUXA 3MWJA 2VTKA 5CYOA 5FBQB 2AD1A 2IEZA 4UXHA 1Z06A 4PPNA 2GVZC 2GETA 1W36C 4ARZA 5JEEA 4RZUA 2N1BA 2ZUDA 3ZS8A 1Q20A 1M7BA 3IILA 4MGKR 2P5SA 1GIAA 3EWSA 2QG6A 3CM0A 1UDWA 4FN5A 4JLJA 4TYWA 2V54A 1DAKA 1M6NA 1S0UA 2B7BA 1FMJA 3ZQJA 2QAJA 3NH9A 1SXJC 2UKDA 5DISB 4LBZA 4JYBA 4IW3B 1O87A 4EFLA 3CX7A 2GXUA 1F3OA 4CEHA 1NLZA 1KMQA 2CVHA 1RJ9B 1IN8A 5FR2A 3G5UA 2G1JA 3QPVA 3HU2A 1Q1ZA 2QMOA 2FWRA 1DAEA 2WMNB 4BFVA 1Z0DA 3ZS9A 1EWRA 3AM1A 5G3YA 1SHKA 1S8FA 3CIOA 1W4BA 3AP2A 1ONBA 2F43B 2KBFA 4A0HA 4B3CA 1QHHA 2PT5A 4FCVA 1Q1BA 3VR6A 3OAAD 3RS3A 3LBHA 3T5DA 1GUAA 1TUIA 1CF4A 4EPYA 2EYQA 3PUWA 1ZIOA 3U6KA 3CNLA 3P1JA 3AKYA 4JT4A 1W2GA 3I5YA 4XJXA 5EXPA 4ZV4A 4EJSC 1QRAA 5HPYB 4KO8A 3GLGA 1XWIA 1PJRA 5JJIA 3DMNA 1HT2E 1WXQA 2ZJ5A 2VSFA 2IYLD 1W49A 5DHFA 5K8TA 2V7QD 5G53C 2IS6A 1FUUA 3FDIA 3HDTA 2DWQA 3MCAA 4KSCA 2Q21A 5CDFE 2XEXA 3A4NA 5KU1A 4D26A 2BHRA 1Z6GA 2ZSFA 3I61A 3THXA 1NI3A 3CRMA 4F4CA 4IEIA 5KDOA 5JFGA 2FSGA 3FYHA 2NOAA 3OFNA 1MO6A 4LBVA 1JR3D 1ZUHA 1KOFA 1W0KD 2RH5A 2VP6A 2YNMA 4EPWA 3AVQA 1FX0A 5EP1A 4Q00A 3WYGA 1YHNA 1OFUX 3EWAA 3VX4A 1JB1A 4TSFD 3I1FA 1J8YF 3D8BA 2PX3A 1R5NA 2E1RA 4Q4HB 1T5IA 4IDQA 3KQKA 3CBQA 4ZCMA 1OFHA 2NZJA 4KCGA 1UKZA 1HQYE 3FHCB 4B3BA 3U4QB 3SQWA 4A2WA 1E9AA 4C0JA 2HF8A 1Q21A 1IJFA 2R6CA 2RHDA 4PR0A 2ONKA 2GJKA 4LPSA 1N6OA 1SVKA 1KY3A 4XTRA 1CRQA 3A36A 3DZ8A 1G9XA 4B32A 4AY2A 1PV4A 1SULA 1JBKA 2HDNB 1NMYA 5JZVA 1Z5ZA 4BZQA 4MH0R 4KXFB 4ERNA 1XPRA 3HYTA 1R8SA 3K0EA 5HE8A 1HEIA 2GEDA 2IF2A 5E95A 3ZGXA 4TLDA 5KPJA 2XSZA 2EFCB 2BBSA 1VIYA 2VP5A 2P6RA 2ODEA 1UF9A 1OXUA 4CEJA 2ORIA 3RVBA 4NCKA 4BRWA 3VHXA 3RS5A 1F5NA 1G5PA 3KUCA 4OBEA 3ND9A 4MKFA 2XTZA 3L0IB 4G0NA 4TMWA 1IXSB 1AQYA 4OHYA 5A0FA 1ZP6A 1GNQA 2J1LA 2KBEA 2F7SA 3K8YA 5EXTA 1KO4A 2B92A 3OAAA 1SVMA 1QG4A 4FMDB 3DL0A 3LNCA 4QBFA 4OQXA 4YMWA 5TV2A 5JI2E 1G3IA 1E98A 1YZKA 1AQUA 3BH6A 2O8EA 3CZPA 3GLIE 3VHLB 4W7SA 3U6BA 3AKCA 3C8UA 3NWJA 3ICQB 2QTFA 1ZM4A 1TNDA 2CVFA 4D4LA 3SQXA 4M2LA 5E7IA 1WRBA 2ODWA 2FF7A 1N6RA 1TL7C 2EWWA 3O8DA 2JLWA 4A4DA 1TU3A 1COWA 2MMGA 3UMRA 3C5HA 2P3SA 4C30A 3CH4B 4ZO4A 1CXZA 1E1QA 3HJNA 5FBLB 1WF3A 1OSNA 1QHXA 3F3YA 3HR7A 2IS2A 3VFDA 2PJZA 2Z4RA 1PVOA 5KDLA 4PZYA 2VHTA 3SZRA 1AKEA 3UIEA 2F3RA 1E4YA 4UXJA 1XJ0A 4OHXA 2ZVPX 3LX5A 2YOHA 2J0QA 3WHLA 4HAUA 3PEWA 1OH7A 4JMPA 2WOOA 3MFYA 3WNBA 3MJHA 3W3ZB 1KNXA 2H5EA 3K0CC 5DO9A 3R7WA 1GDDA 1W4CA 4DCNA 3PUXA 2R6FA 3DHWC 1G7TA 3BOSA 4Q4JA 2LCFA 1R8QA 2V1UA 2WJVA 3CW2A 1II9A 3TUIC 4B2LA 2L0XA 3IGFA 4NYIR 1CR0A 3QKRB 3KJIA 4KODA 1EX7A 1T91A 1U81A 1XP8A 4MRNA 4GBMA 3X2SA 3OEHD 4ZI3A 1WCV1 1XDBA 4TMVA 2VH5R 2ANBA 5BYJA 1OFTA 2RB4A 2JIZD 4LYHA 1AGRA 4V03A 3AVWA 2GESA 2FU5C 4TMKA 3QSYA 1AS2A 2GK6A 4TQAA 1CJUC 2IUUA 3WP0A 2XSZD 4KSBA 4P0TA 3UWOA 4B75A 4LOAA 1F2UB 3WMFA 4NDZA 4D4JA 4Q4LA 2QPOA 1DVRA 3TQCA 1G4UR 3VKWA 3I5XA 3RS7A 1ZIPA 2O8FA 3ZZ0A 4IFBA 5FUYA 4WZ6A 4XOIA 2PZEA 4QHTA 4KFRA 4HB3A 4LBYA 2MSEB 3A4MA 1OB5A 1OH6A 2H16A 4UNSA 4R2IA 3D31A 1DAGA 4PAMA 4TMTA 3W90A 1A82A 2QBYA 3KXIA 3EX7C 1ANKA 2GJAA 2RAPA 1OKKA 1YZUA 3Q7QA 5EQTA 4LJ7A 4ASUD 2DWPA 3TR5A 4PO8A 1BS1A 3U3KA 3HU1A 1KY2A 2QGNA 1R5OA 3P26A 4LHXA 3AEZA 3M1IA 1E99A 1RJ9A 1CJKC 4I81A 4YONB 5JECA 2RCNA 1CU1A 5G40A 2O8EB 1TF2A 3WNCA 1YZTA 4PC7A 3TH5A 5J5CA 2DR3A 2HT6A 3X1WA 4BEJA 2BBWA 2F9MA 3FB4A 4MKIA 4GZLA 3AF1A 3TKLA 4LJ5A 5HCNA 3FGNA 3EG5A 5EP3A 3LDAA 1GKIA 5F3WB 2WICA 2DYKA 1VPLA 2DFKB 1BMFD 4L5BA 2J41A 3BH0A 2VP4A 3QIAA 3SC3A 2P5TB 3PEVA 3WXMA 3BK7A 3DDCA 1P2SA 2FPMA 5L3SB 1J70A 4MYHA 4A8JC 1XMSA 4ZKDA 1LS6A 1KIMA 1Z0FA 3NBZC 4AC9A 1YR9A 1NRJB 1N5JA 4IOLA 1XMVA 4DEYA 4DXAA 4O2LA 3OESA 4URVR 4BFUA 5KOYA 1YQTA 3Q72A 2ZI9A 2O5VA 4OQLA 3TUZC 5FI0B 3BE4A 3P20A 3LA6A 2BKUA 1UDXA 1GRNA 1JJ7A 3NHBA 4HAWA 2VL7A 4ZDWA 4ITRC 3VQTA 1E9EA 2ZRKA 1X1SA 1E9DA 3SEAA 1SVLA 3FHOA 2OCAA 5LPNA 3CKLA 2HV8A 3FMFA 2YYZA 1TTTA 2ZSAA 2WSSA 3BFKA 1SVWA 2A3RA 3OF5A 2B7CA 4RZ3A 4ZDKA 3GJ5A 1Z22A 4DLSA 3OIUA 3KKQA 1E2FA 3GLIA 2J0UB 4FMCF 5JSZB 4L8GA 4TYPA 4UNPA 3LVQE 3KTAA 4Q9KA 4XVUA 1N3BA 3AVXA 3R20A 3BWDD 2W6IA 3GLHE 1IN5A 3NBFA 2KI5A 1T3SA 2KWIA 4JL6A 1E69A 2ZU6A 2FGKA 2AKAB 4A36A 2XTMA 4LYFA 1T9HA 2QSZA 3CPHA 3ADCA 3QKRA 2GILA 1IY0A 2ZE8A 4TMZA 5DE3A 3WNDA 721PA 2R6AA 3QUSA 4DLYA 3RC8A 1W7AA 4QM7A 3NC1C 4HLUC 3EZFA 2WIBA 3U3JA 4LY6A 2IYWA 4EDHA 3C16C 4ZDIA 1QHSA 1JI0A 4BWYA 4DCUA 3GLGE 3ZVMA 4C7OA 2XTNA 4LSGA 4TYYA 2YWHA 2W2TA 3GMTA 4LGMA 1R5BA 1GFIA 2OO7A 5BN5A 1XX6A 3A1UA 2ODBA 3GJ4A 2QP9X 3ZVNA 1H8ED 4Q1CA 4NZYA 4EQ6B 4A6PA 2WWGA 5LB4A 4XWAA 1VCMA 1KI8A 3T15A 4PFSA 5FTNA 1J99A 3LD9A 1P72A 3R9WA 3IO5A 4HLUA 4DB2A 5FL3A 2W0MA 3I62A 3FMIA 1PZNA 1XD2A 2OE2A 2P67A 3AVOA 4E07A 1M1YE 2C9OA 3QPWA 1FX0B 3NIBA 1CTQA 5DI3A 3SN6A 2CMKA 3W6OA 1NBMA 2F3TA 4ABYA 1K8RA 4BASA 2GF9A 3D7MA 5AUPB 1TQ6A 1R0ZA 2Q3MA 1VG1A 5FOWA 2IWHA 5J4VA 4P32A 1C9KA 1SXJB 2B8TA 2WV9A 1T5LA 2ZE7A 3F5FA 4A0GA 4L9WA 2DWOA 2HF9A 1OLOA 3UANA 4AYXA 1OF1A 3HYRA 1G3MA 4QJ3A 1MKYA 1YRAA 2D2EA 2OCBA 3GJ3A 2JLSA 2VP2A 3IPYA 1E0JA 3WRXC 2DFNA 3UPUA 1VYUA 4CYMA 4DKXA 3DEFA 1II8A 1SKYE 1FPMA 1RW4A 2IYZA 3NH6A 3TSWA 4QGFA 3K0AB 3UXMA 621PA 4AD8A 3AVUA 2ZRAA 4LC0A 1NJFA 3U7FB 1WE2A 1H65A 4RSGA 3T35A 4US1R 121PA 4DCTA 1NL3A 2YJTD 4B73A 2QAGA 4U7DA 5EZ5A 5DN6D 1C4OA 3OEEA 2QP4A 5HTKA 1LF5A 1IHUA 4N0EA 1CJTC 1KAGA 1EK0A 1NJGA 2Z83A 2OFWA 1X8LA 2IUTA 5AJZA 821PA 1G7SA 2OZEA 1ZNZA 2ZE5A 1PLKA 3TK1A 1CEEA 2CE2X 3KTAB 4DLUA 3K0SA 4A2QA 4NCIA 5J4YA 1G41A 3HPQA 1G6OA 1JECA 1QBKC 1ZM3A 2ZRHA 2C04A 4BFZA 1Z6XA 4IVRA 1I2DA 2AK2A 1XXHA 3QF7A 2BEKA 3U7EB 4Q1FA 1UM8A 4QBIA 1D2EA 4ZIRB 3AF2A 1GSIA 4POAA 2JIZA 4UQOA 5FTMA 1TEVA 2GAAA 2EFEB 1DEKA 4ZKEA 1GITA 1MR3F 1KI6A 4RD6A 2J87A 1QG2A 1MO5A 4BLQA 1J90A 3K0CA 3B1VA 4IDOA 3PUZA 4PC3A 3ZQ6A 2WWYA 4E03A 3P4XA 1MT0A 4OI0A 4YDSA 1MABA 4Q18A 3ZZTA 1LFDB 4HZUB 3CNOA 2IYTA 1D8TA 1GL6A 4Q1DA 1XFAA 2BIFA 2YWGA 4BZXA 1XXHE 1KI2A 1HTWA 2GAOA 3U60B 4NYMR 4QGHA 4PQRA 5CDFA 4LI0A 1FP6A 3U61B 1DG1G 1XTRA 4OK6A 1MRSA 1Z0AA 4C7OB 2IYSA 4HAYA 2IXFA 5GADl 3LV8A 1VG9B 2WVJA 1Z28A 4DDTA 3OHMA 4GFDA 3QXJA 2E9SA 2X1VA 4G1UC 1W2HA 1JAIA 3D6TB 2VP9A 5BN3A 2ZRMA 5SZKB 2GBLA 2HCBA 2B8WA 3OFND 4LV8B 2CL7X 1G16A 1IBRA 4RKFA 3UMSA 2FSIA 5HZKA 4YXWD 3ADDA 1CJMA 1N6IA 2VF8A 2OFXA 4QBHA 4JSTA 1J8MF 5EXSA 1JJVA 2C9YA 4TSFA 1Y3AA 3W6NA 4GNKA 1XRJA 3GJ8A 1EFCA 1R4AA 3L0SA 3CF0A 4JLAA 4L9SA 2A5FA 2ECKA 4OHVA 4DWJA 3SE0A 3THWA 4G5SA 1RRCA 2GKSA 2XNDD 3H84A 3KDSE 5DNYB 2O8FB 5JJLA 3IEVA 1AIPA 3ZD6A 1P9RA 4Q66C 4A9AA 1L4UA 1SZPA 2BMDA 4RCZA 2D06A 4ZDJA 5EE1A 3WRYC 4M1TA 1FP7A 3BBPA 2A5GA 4RD0A 1KSHA 3AF0A 2BWJA 2O8BA 2XAUA 4MUAA 4KJZA 2VHCA 2NQ2C 3LXRA 1E1RA 1G8FA 3VMFA 2QMUA 2F1JA 1KHTA 1CR1A 2HUPA 3KKOA 1BKDR 1HV8A 4MA4A 1WBBA 2O0KA 3NDBB 1P9WA 3E5HA 4PHFA 4JJKA 3F8TA 1GL7A 2JDID 3JVVA 5EXXA 2Q9CA 3G0HA 2D4HA 3BRWD 3LWNA 1G8GA 1NSFA 2CEAA 2GXQA 1G19A 5FOTA 2OSBA 4GOXA 2ZRFA 1KGDA 2WSSD 3GFOA 5FBRB 4DLRA 2CJWB 3OZXA 2J7KA 2WJJA 4BLRA 4IOMA 3V4RA 3I8XA 4UNQA 1W4AA 2H92A 2FNAA 3W8RA 2QE7D 3UK6A 3QY0A 2PLFA 4HB4A 3VU9A 1XTSA 2HJGA 5D3QA 1NVWQ 2WWIA 1UEIA 5JJKA 1U8ZA 1KKLA 4RKEA 4LV5B 1A7JA 4Q7KA 4WBSA 4JVNA 1GKUB 4W5JA 5CJ2A 4B48A 1FW6A 2XNSA 4IRUB 1F60A 3TMKA 3H4MA 1SGWA 3EPJA 4MKGA 1X3SA 1DADA 2R65A 3U4QA 1XTKA 3OIWA 2QROA 3IBGA 3NDPA 3K9LA 5JHGB 1XEFA 2WKQA 4QRHA 1E3MA 1LNZA 2J59A 1JPNA 4JL8A 1NG9A 4C0AC 1HA3A 5F98A 3DOEA 2WPDD 1E1QD 3U44B 2QY9A 5P21A 1OH8A 2DB3A 4B74A 4B35A 3THYA 3KUDA 1M8PA 3EIEA 4TL7A 1S9DA 4B76A 1CS4C 2XXAB 2R2AA 2WIAA 3IIKA 2FFBA 3A8TA 1LF0A 3NKVA 4DUGA 5B57C 1NVVR 2GJ9A 4W5HA 1QZXA 1M2OB 1KAOA 5JRJA 2CLSA 5FUXA 2GEUA 4BZPA 4Y0AA 4QKQA 3ADKA 3Q7PA 5FH9A 2QTVB 4PZLA 4K8OA 4I1VA 4D4MA 4QC2A 2IBMA 2OCYC 1H8HA 5J4HA 1DARA 2I1VB 3S1AA 1MABB 2YOGA 3AVPA 4LWZA 1XJQA 2JLQA 3FFBA 2JJ8A 4OI4A 3PEUA 4GT1A 3QI2A 4LUCA 2YWFA 4QHSA 5JBQA 1Z47A 3QBTA 1P73A 3T1QA 1OYYA 2RKOA 1NVXQ 4Z54A 4GP6A 5AUOB 2Q3HA 2VRWA 3DO6A 3J81k 1JEDA 2WJYA 2ZEJA 2ZSBA 3SBDA 1O3YA 2P2LA 5A4JA 3SJZA 1YZLA 4F4JA 1DE0A 2PH1A 1ZD1A 3P4YA 4C0SA 1LW7A 4AK9A 2EU8A 3LY5A 2JLUA 1JR6A 1R2QA 1KMHB 2NPIA 2NMVA 1ZJ6A 1P7CA 4TLEA 4Y0VA 2GEVA 2V8OA 1E79A 1RYFA 1VHTA 1NG1A 5D3MB 2ZI6A 3TR0A 4DJTA 1XCPA 2C9CA 3T5GA 5EZ6B 1QHNA 2REBA 3B78A 3VR2A 5EE5B 3NEYA 5IHPA 2C99A 1K5DA 4EJSB 1E96A 4JLMA 3PJRA 2WJHA 4PANA 3SU8A 4PC2A 3U7GA 2CL0X 3U3OA 4A8JB 2FH5B 4IJMA 3VKGA 2QT1A 4BFWA 3AVVA 3C5CA 3PEYA 2ZRNA 1UJ2A 1G1MA 1G20E 2JEOA 3SFZA 3SBEA 3AKDA 4P4SB 5GJWC 4EPXA 1I4TD 5FTJA 2PJRA 2RGBA 2IYUA 2BDTA 2XB4A 2YVUA 3RAPR 1X8KA 3QF4A 2FDCA 2YINC 1KZ7B 4JKIA 3MRSA 3P27A 4IXMA 4JLBA 2FN4A 421PA 4FINA 3FKSA 4DZZA 1KO1A 3O8RA 5CIWA 3T34A 1Z29A 1S3SA 3GLGB 4G5RA 2HLDD 3K9NA 4DIDA 1SHZA 1KI7A 1P61B 2ZAOA 3L0OA 2GJ8A 3NBXX 5KO2A 2O8CA 3WP1B 3OIVA 1LV7A 1Q44A 2CNWD 2F1IA 2XITA 1AZSC 1NVUQ 2PMDA 3QG1A 1UAAA 2N42A 4DDWA 1N6PA 1P6XA 2ZE6A 2IT1A 2WWWA 4RFVA 2GRJA 1P62B 2IYVA 2PZFA 2R6GA 4IXNA 2VP0A 3WYFA 2PT7A 1A5TA 3KX2A 5BN4A 1QHGA 3KZ1E 3NVAA 1WP9A 1NVVQ 4KU4A 2GVDC 4PTLA 3RSLA 4URZR 2J0SA 4TMXA 2LWIA 4L4UA 3BC1A 3SNHA 4OI1A 1FTNA 3U44A 3K09A 1C1YA 3GLHB 5TARA 2CXXA 3VX3A 4GZMA 3IPXA 4TZ0A 4XVQA 2C78A 1BYUA 2AK3A 4EKDA 3IKJA 1R0YA 4JBXA 4NBSA 3THOA 1UBCA 4F93B 3MWLA 3SYLA 1JPJA 2K5UA 2RGAA 3N2EA 5JMTA 4LJ4A 2JJ2D 4Q01A 4MRRA 4XIGS 1L2TA 4Q47A 2BM0A 2O0JA 2ATXA 2ZR7A 3B6EA 4BFXA 2PMKA 2BOVA 4FWIB 1TPZA 4F91B 4GOJA 3O47A 1IN4A 3Q85A 1NBME 2A30A 4DLXA 4LHZA 1UPTA 2DPXA 4CT4B 4RD3A 4B6EA 2H18A 4Q1EA 4EFMA 3QKSA 1KSFX 5E4FA 3RNLA 3R7WB 4D82A 2DCUA 2JATA 3PITA 1W5SA 2ORWA 4G5QA 1W4RA 3SR0A 4A15A 2Y8EA 4Q9IA 5TDHA 4TLCA 3LO5A 1DAFA 4C0BA 2AXPA 2ZRIA 2FJUA 2Q9AA 5FUVA 5H68A 2EYUA 3T1OA 1KI6B 1M7HA 1YR6A 3RRMA 3PCRB 1G4AE 4URWR 4DSTA 5IRCD 1E2NA 4PHGA 4B3FX 5BWMA 2IUSA 3C15C 2QUZA 1F2TB 4A8JA 3DM5A 1G21E 3LW8A 5D3MA 4AG6A 2P65A 1DELA 4QL3A 1UKVY 5CIQA 3CRVA 1E9FA 3QQ5A 5CITA 2FSHA 4KBGA 4QNRA 3RS0A 1NY5A 4RY2A 2XB2A 1KDOA 1S1CA 1HQCA 4EPTA 4LCBA 2OEPA 5K8UA 2Z0MA 3NBYC 4L16A 4O2RA 4NP6A 1UADA 1S3GA 1ZM2A 3KKMA 1T0HB 2IEYA 5GJVC 4DDUA 2ZI5A 3EASA 3GCGA 4B3DA 5JRZA 1NN3A 2ZYWX 1OPXA 2CCKA 3RRZA 3QEJA 4ARZB 2QQEA 4JVSB 2ZRGA 3Q5DA 5HZHA 1DS6A 1KO7A 4JJZA 4QFMA 1ELOA 1NLFA 3AF4A 3CF6R 4LYAA 4MGYR 4QBGB 4JYCA 1Q22A 3B82A 1RVDA 4IVQA 3TJZA 1KI9A 3W6PA 4QHYA 3ZZUA 4WAUA 2O8CB 2X8AA 2ZYVX 2D2FA 4D6PA 2OBLA 1WMSA 2DFLA 3S1AB 5KSZA 3B9QA 1MRNA 4ACBA 3M6AA 2G0NA 4KYIB 3PR1A 4IEEA 3FPAA 1D2MA 3EC1A 4NCNA 3B13B 3I3SR 2N46A 2RGNA 3TW4A 4MDEA 4B6FA 1W46A 3B1ZA 4R98A 2A5JA 1N6HA 2QPAA 1E2GA 3ASYA 2UVQA 3EZ9A 4LV6A 2C5LA 2ZSDA 4M8NE 4PHHA 3FKQA 4ON9A 4B2IA 2X19A 2ASEA 1NN0A 5KHOC 4G5GA 4KYUA 4O0MA 3ZDQA 4EPRA 1E0AA 2GF0A 2AWNA 1CJVC 3GEIA 5JI3E 3SJCA 4IDHA 2HEIA 1DO0A 2NGRA 1Z83A 4NCJA 2WWFA 5B58C 1XCMA 3B60A 2OAQ1 2C2HA 2W83A 1W44A 4DSUA 2ZJYA 4MRPA 4BQSA 3EA5A 1T4GA 2OCPA 4BUJA 3X1ZA 2OFOA 2ZREA 2KB0A 4IHQA 2NG1A 1XEWY 4X8MA 2VPPA 1YZNA 3X1DA 1II8B 2OLKA 2CLCX 2D3WA 4GOKA 4YDHB 1G5TA 3RC3A 2V4ZA 3EAQA 5EP2A 1W48A 2IYQA 2JDIA 2KJQA 1MV5A 1W47A 1XF9A 3A1VA 3R8FA 3QVUA 4YLGA 5SZIA 1T3LA 2RGXA 2Q6TA 1HT1E 1X6VA 4M53A 3QNUA 2ZRPA 1R0WA 4I99A 5GJBA 4IOJA 4Z1MA 3B7GA 4JS0A 4ZI2A 4NHOA 4OHZA 2QRZA 2ZYTX 5JCPA 3QKSB 3TE6A 2CLDX 3CRRA 2ZJZA 1FZQA 2NO1A 1JXMA 1A1VA 1BH2A 4LPKA 2REOA 4AKIA 4DSNA 3EA0A 3H2YA 3W8NA 1OT3A 1DOAA 2QT0A 3W5JA 3K70D 2GXAA 2XXAA 1ZAKA 1N5LA 3QOFA 3TLXA 1GZSA 1LTQA 4BLSA 2GNOA 3D3QA 1QHYA 3GPLA 4KBFA 1KDRA 4UJ5A 5GVRA 4MITA 1G3UA 5JS8A 2H8KA 4XH9B 2QN6A 1F2TA 3LX8A 4FD2A 3L0PA 2O8DB 2IS4A 1GTVA 2RGEA 4TTRA 5JLJA 1XD2B 3VKHA 1E9SA 4ACAA 2ZR0A 2WPDA 2QSYA 5C18A 2VYFA 2OAP1 1DPFA 2R6DA 3TSOA 5H8WA 3LRPA 1TEXA 5F9HA 4LJ6A 3QXXA 2VSXA 2QQ0A 4QXAA 5CJPA 2JASA 5DSZA 3I4LA 4OK3A 1E1RD 2REXB 5IT5A 1DG3A 2D7CA 4YC7A 2ERXA 3TVTA 2FV8A 2RGDA 2W58A 2ZRLA 2JLXA 2WHXA 3LH5A 3VU9B 3REGA 5JCZA 4HUTA 2GDJA 2WKRA 1S4QA 2QM7A 2J5XA 4IDPA 3C14C 4GSYA 2Q0HA 4R71A 1VKJA 4WZBE 1U9IC 4C0KA 3P32A 2ZJAA 4IVPA 3CLVA 3I73A 3CO5A 1D9ZA 1G17A 3B2EA 2PL3A 2VHUA 1NMZA 2WJGA 4LHYA 4PQFA 3EZ7A 4H1UA 3DOFA 5M04A 1ZINA 4RJLA 2QU8A 3KJGA 1KK0A 3EIHA 2CHGA 1YZQA 3IUYA 1NKSA 1US8A 1NBMD 3LFUA 3NC0C 4OHWA 1RRGA 4F38A 2AXNA 4EPVA 3B1XA 4MYUA 4JLKA 3R8CA 2V1XA 3X1XA
chains in the Genus database with same CATH superfamily
1E2IA 4KE9A 3BMNA 1TYBE 4X41A 1ZCBA 1GZ7A 5F64A 3G59A 4TTJA 3ESAA 4RPHA 3Q8LA 1QYDA 2AC2A 1QRDA 4XIJA 3BXEA 2AMVA 1QVRA 2C0QA 3HA3A 1K4MA 2APJA 3AEQA 4CT0A 4GDFA 1FIUA 2ZIXA 4J0CA 2R8RA 4QO8A 4ALJA 4LXQA 4Z6KA 2JGDA 2W90A 4ZJUA 3T1VA 3AJ9A 3ZOZA 4KIJA 2Q5QA 4M1KA 2W2VA 4Z1MD 3DHEA 3FBTA 1L7PA 1CT9A 1H4SA 3N07A 3LVBA 4JYPA 4RQAA 4FM9A 2W0SA 2W9XA 5C8XA 1T2NA 4C20A 4RH0A 1KBOA 5LD2B 3PUYA 3OEED 1YZHA 5DHRA 1QRRA 3MMPA 1RWQA 4X61A 2I34A 1NJ5A 2QMHA 3UA3A 3BCUA 5M29A 1UP6A 5BV0A 2Z9DA 4CKBB 4CIWA 1PJAA 3FI0A 1OPRA 3DVAB 4URYR 3LCUA 4ZHQF 1I51A 1L5NA 1N5KA 2C03A 4Q6BA 1U9JA 3D4LA 3AIKA 3LKVA 5DNDA 2QORA 5U9CA 4KOEC 2Y77A 1ULZA 2CVQA 1ESNA 1LPNA 1BMFA 2DHQA 1ORTA 2QGZA 2E4AA 3JQ9C 1KEWA 4ND8B 4OPMA 1W1WA 2WJIA 3ESZA 4KUEA 2Q5OA 4JLDA 1OXVA 3UICA 3AGQA 3ROKA 1ONNA 3E9QA 3Q5EA 4FSXA 4HXEB 3ZNOA 5KSOA 4J94A 4BO2A 1PWEA 2C84A 3KL4A 2YV1A 2WHYA 3IVCA 1JX6A 3GCDA 1Z63A 5CTAA 3R7LA 3ACDA 2R7MA 5D6NA 4UKDA 1WOMA 1D6NA 1LWOA 1TRHA 2ACWA 3MBOA 4AX4A 2J0UA 3AOGA 5E4YA 5C4GB 1MNAA 1VRCA 3RS8A 1TT7A 5L4NA 3W9SA 4YT2A 2XQFA 1XTQA 3NC0C 3AO0B 3I0MA 4X8LA 2RK6A 3EVDA 3WBKA 3R3WA 5EJ5A 2VBGA 3M6XA 2HO4A 3I72A 3JWEA 4DARA 1A4RA 3K2QA 2P5UA 4QJIA 4EUNA 4RDXA 1Y7PA 3OFVA 3ZIAA 4EB8A 2YYAA 4PC6A 1AN0A 1NF2A 1QONA 4C5BA 1Y8QA 3K2BA 5FBWB 2EFJA 3AZOA 1J49A 1E59A 1R6AA 2CXSA 4V0LA 2ZUTA 4F0JA 2X0RA 4NOLA 2PUDA 1NBOA 3PFIA 4OFZA 2F43A 2QTHA 1WMEA 4KQ1A 3ZDXB 1NI4A 1T2UA 5AVQA 1L4EA 1QGUB 3KZMA 4ILEA 4MSUA 1SO8A 4XSGA 1I8TA 4O4LA 4PO1A 4UAJA 2JARA 5A2GA 3TQSA 3TQHA 1NBEA 1G5RA 2ZWAA 4QUKA 2JLZA 1UINA 4HYEA 1I2ZA 1M1NB 2V6IA 5U4QA 2UZIR 2G88A 5LD2C 1ZISA 3MRVA 2JS7A 3FAKA 3FNFA 4MV1A 2VA8A 4DPLA 1MA0A 3KJNA 3ONEA 2ZR9A 1ZHHA 3FNRA 4IFEA 3DBRA 3DKVA 1ZRHA 2WY2D 3O83A 4HEJA 2VP3A 5BSFA 4W82A 3T5PA 2V0GA 1HLFA 2Q8PA 4I1SA 4TL8A 1CRWG 1VYVA 2ZKLA 1KK3A 5ESWA 2JAQA 1IZ8A 1C8KA 2VUHB 3GFFA 4IDFA 1XVUA 4IX1A 2VQ3A 3QP9A 1GY8A 4OI2A 4M54A 5EUMA 1DNPA 4HEQA 1YJ8A 5HJ7A 1K66A 1V11A 5AM4A 4RKQA 1GZDA 3WK4A 1C14A 3N74A 3A1CA 5JATA 5LZ9A 1TT5B 3KJEA 1P75A 3FZYA 1PL8A 4UAUA 1PBNA 1RZ3A 2GWHA 5AM2A 1JYFA 3T5MA 3TPCA 1OTXA 2VPIA 3VPHA 1Z2AA 1QH0A 3KQHA 2UVPA 1N0VC 4TMYA 2W42A 3TZLA 1HDEA 1KZHA 6ABPA 2UUAB 3JWPA 4CI0B 3N8NA 1KYWA 5JCOA 2YKGA 3MIZA 4JWKA 2D1RA 4RZ2A 2WSLA 1KU0A 3IDOA 3GZTB 2GZAA 3V6LA 1DT5A 1AXGA 2RH9B 3HCDA 5JLAA 3OE7A 5DHQA 4YREA 4FZVA 4IMPA 5BURA 4KQ6A 3QELB 1P1BA 1Q7CA 2CK3A 2IUYA 4OYLA 3LP5A 3K5IA 1WETA 3TN7A 2JVKA 2FHSA 2IU6A 3A1DA 4GE3A 2QY6A 1JVSA 1MG0A 4M36A 3DJYA 4JBWA 4IGIA 2OV6A 4C0HA 1PL0A 1XTPA 2ZU0C 4YRGA 4LRXA 4D7AA 3O8BA 3K0HA 3OEHA 2ACEA 3UT5B 4CQNA 2ZPTX 4OHCA 5B7NA 1IRIA 1X86B 4FFLA 2BFNA 3THWB 3DWGA 1E6WA 5EE9A 5G4KA 5PGMA 5L7WA 4HQFA 1KMCA 1KFBB 4Q1BA 1THGA 2WG1A 4WTOA 1E5VA 3V3KA 4ETIA 2F9LA 4TT3A 1ZKDA 1XCGB 4KQ2A 2V0CA 1JZSA 1JVNA 4NL4H 4M1SA 4LJRA 2OYSA 1JLMA 1VJ5A 1W96A 1WMAA 1CIJA 4EATA 1WLYA 1Z2DA 4GDMA 5FTWA 3EEOA 1XRNA 4RJJA 1A2KC 1TT5A 1XNHA 5KNCD 2JIPA 5LYJB 1EX6A 3AM5A 4J1QA 4XTCS 3KKNA 4HB0A 4W9MC 4TWRA 4YRRA 1E4EA 2D1SA 3NHJA 2FPKA 3IVXA 4NDNE 4WA8A 3T12A 3TL2A 5BVGB 1LA2A 3CEAA 1Q12A 3VR3A 2BJVA 1CSEE 1C9JA 4YAIA 2VJKA 3V7NA 2BSAA 2J3EA 1U28C 5IJXA 1ISSA 1WXHA 3PPIA 3DCNA 4I66A 3ZCQA 4DJ5X 1WDWB 5BV1A 5LQMA 3ADBA 3I9NA 2VRCD 1RZVA 1G7RA 1XVIA 3I9V6 3FVQA 4RHEA 5FL7D 1U0GA 4MTLA 3IR7A 4H77A 3WL7A 4CCSA 5BSHA 1I0LA 4HBZA 1Z73A 4HDQB 1CHDA 4LX8A 5EJMA 4DXHA 1F9AA 2L18A 5HILA 5GZ1A 2WU0A 1G3QA 1QHHB 1GCOA 5ERYA 3FGOA 4FB5A 1C1DB 3WB0A 4YMVA 4TXJA 3EZ2A 3HR8A 4NXNB 4UPEA 2P75A 4XR4A 3DEIA 2I2WA 1DAHA 1L4GA 5HCUA 1AVTA 3VYTB 1GQRA 3NZEA 5DIFA 2QJOA 4QZVA 3GAFA 4RA6B 1Z4QA 1Y6ZA 2ABWA 1OUMA 2FXIA 3ONDA 2YICA 1TF5A 3RVMA 4CXMA 3MA0A 2QM8A 4D8WA 1DTWA 1II0A 3OLXA 2CT8A 3S2ZA 3H17A 5IAGA 3H5RA 4AIIA 1UJ5A 2F62A 1FX1A 1N9GB 2CLKB 4HWGA 3FDZA 4Z2AA 3QE9Y 3O8OB 2POCA 2YZMA 1H4VB 3C5VA 5KWVA 1OI4A 1UBTS 4ZAWA 5B53A 1EG7A 2GZSA 3CJQA 4OEHA 5KYNA 2BE9A 1TQ8A 4I5EA 4V2IA 4FNOA 1KRWA 3BIFA 2ZSHA 1JE1A 3QZUA 4L2IA 2ZUCA 2ZM6B 4GQBA 3TG2A 1UBEA 4H3VA 3TE7A 4HQ6A 3LTNC 5CLJA 3DO5A 2E4XA 3T99A 4DA9A 5EIEA 2RHTA 5HWSA 1ND6A 1DBWA 3H0KA 1OA1A 1O96B 2LKCA 3Q11A 4ALKA 5HXAA 3FHTA 3IJRA 3IIMA 1BOFA 1KEPA 1J0BA 4IS2A 1OV4A 4RGBA 4CCWA 1HSOA 2EBUA 1OA0A 4P80A 2IU4A 5ILOA 3VO1A 2OD2A 5KTTA 2ZIVB 3ELUA 1S2IA 2I4IA 5LQSA 2VDKB 5AVTA 2LZ0A 2P4HX 4RZIA 2GZHA 4JYAB 4JK3A 1OFUA 3MSXA 1JS1X 1MO4A 4GI7A 5M7EA 1JHOA 1QPZA 1CRPA 5DX0A 2VEDA 4NF2A 5F51A 5BQ5A 1L9KA 4YDQA 2Z5FA 5KVQA 5C3UA 1J2TA 3WGUA 4D9JA 2R96A 4XGRA 4JI1B 1Y5MA 1ZRMA 4XE5A 3E9YA 3UMJA 4W5RA 3MLAA 2P4EA 4QRDA 4C3OB 1AMOA 3HG7A 1AURA 3A6DA 4H6WA 1ICEA 2G04A 1A7UA 3MMNA 4PSDA 3QOWA 4UASA 3WGNA 3X1YA 2SBTA 3FCAA 2V6BA 3H2JA 5T5QA 1ZR4A 3KB8A 4YN3A 1AC5A 1YA6A 3C7KA 5NLLA 2WUDA 3RV3A 2CFCA 2I9PA 5HM6A 3ZTYA 4MZXA 3H05A 3MAJA 5FOXA 5H3CA 1TAQA 3FLMA 2HSJA 4KXVA 3KSZO 3LCRA 3I30X 1EXMA 4IXTA 1ZICA 1VIMA 2AH5A 3PJEA 4MI3A 3ZHQA 4DZRA 4I4TA 1HY3A 1U7UA 2GLXA 2SNIE 3GPDG 3U2QA 1JG7A 1U90A 4ZO9A 3RR2A 1XU7A 3GGPA 1GRRA 2QN2A 3U7IA 3D0KA 4BEVA 1EP9A 3R3JA 5LOVF 3BWYA 4PQYA 3L4EA 5AD1A 1G66A 4FKZA 3VUFA 4DGSA 2QAGB 4JC4A 4U2CA 4U5QA 5TPWB 3DULA 2Q3FA 3NTLA 2GO1A 2OKGA 4KLAA 2FZLA 1T0JB 2FQXA 4PBTA 1XK7A 3T3DA 3P9SA 4LEIA 1X38A 4ODIA 1VKHA 3UWMA 4U5XA 4N3AA 1QLHA 3UPDA 1QV6A 4QD3A 4JLWA 4NJEB 1Y4AE 3ICPA 5HOEA 3JR7A 3PSAA 4HEA6 4OMCA 4YJFA 1RBYA 1VIAA 1RYHA 2WOJA 5HFNA 1H9BA 5ETJA 2O3JA 1UZNA 1HT0A 4QICA 3EIQA 3T9AA 4OAQA 3SCZA 2HHHB 1YMUA 3RANA 5IN4A 4A0QA 1F6BA 4ALNA 1BJKA 2NUBA 4XUGB 4LHVA 2NSHA 3U56A 4DCMA 1DTEA 2XH8A 3HSYA 4U7FA 4TGLA 5EUQB 3KQMA 2ZVQX 3T0IA 3RK0A 4S24A 2PSEA 3NGMA 5BW8A 5C1BA 5CB6A 4PLWA 4B8YA 4G0UA 2BKAA 2VAWA 2FUEA 5K0JA 4PF1A 3ECSA 3ND8A 2V7PA 2ZS7A 5SZHB 1RMYA 1CZLA 2QAIA 3CLUD 5HKKD 4MYCA 1L5QA 1JFFA 4RWZA 4C2TA 1P4RA 4PS1A 3ML1A 3I01A 1WHSA 2O8DA 1U3WA 1XOIA 4FBMA 3DNPA 4QASA 3HR4A 4Y6RA 2GERA 1O5TA 2FP4B 4KL8S 4AKTA 4HLDA 1HBJA 2IYNA 2J33A 1D0SA 4YAFA 2WWVD 4R1MA 4ZARA 3VKVA 1JYSA 3PKIA 2OV3A 5P8WA 2R4QA 1HUQA 5F12A 4DM3A 3QU5A 2GYYA 1FNNA 2IOYA 3DGEC 4A2CA 1OYOA 1A2BA 5K0FA 1QPGA 1TXGA 1U0JA 3PI7A 1Z82A 1DFHA 3KR2A 1JDNA 3O9VA 1JHRA 3WGHA 1XV5A 2HHLA 4QELA 4RE5A 3N70A 1FQJA 2WFLA 1R10A 2CJYA 2DMRA 2BI8A 3DV0A 3NCHA 3GMDA 3GP8A 1PEDA 1BJRE 4UUMA 2QZZA 4WJZA 4WXYB 4WNAB 2J9RA 3WJ1A 2WTNA 4K9PA 5DF1A 3OZUA 1B8OA 1WUKS 5IXYA 2AOUB 1H8HD 1J5EB 2Z04A 1V45E 1XELA 3N0RA 2FMUA 3DE1X 1KDPA 4O2BB 5KWJA 5K5EA 3UUWA 3FGPA 3Q5GA 3W3AH 3KQNA 3QWFA 2HC9A 4RLQA 4XX1A 4QARA 3I6ZA 2P6NA 2ZPAA 1BAPA 1VCIA 2KSQA 3KOXA 4EA8A 2XWQA 1T1SA 3DCIA 1HZZC 1ULBA 2QRNA 4PSUA 3TYXA 4URUR 3I23A 1J0XO 3QBVA 2RJNA 3KFXA 1VB3A 3FM9A 1A7AA 2QYSA 1VLJA 1ORDA 2MWMA 2E4ZA 3MQ4A 3SYNA 5IT4A 4OJKA 5AM0A 1T8TA 4IMJB 3TAXA 1GNSA 3KQTA 3L1KA 4UVEA 1E9CA 4N0DA 1NXWA 2IYXA 4TSRA 5IDXA 4GPAA 4PFQA 1N0WA 3UHJA 1XT6A 3X1MA 2GBPA 1A9SA 1Q17A 4ZU6X 3M0EA 2NU8B 3RKSA 5JWHA 1H2HA 2QB5A 2C82A 4GH5A 1YS7A 4C6RA 5J4KA 4A1FA 5JY6A 4WD3A 1QVAA 2UZ1A 3LX4A 3NWOA 2PD4A 4OQNA 5CVDA 3I9JA 3QVSA 5KI6A 1SBIA 3CKKA 4MP6A 4QQKA 4RMGA 2QZSA 1W36B 1P4AA 5BSGA 3MTGA 4ZCPA 9MHTA 2J3DA 3L9XA 3PG5A 4PU0A 3KJXA 2HSGA 5C5DA 1V6CA 2YWCA 3EUAA 5IBPA 4C6TA 1KIAA 4MR8A 3VVMA 1THMA 5HDBB 4MRMA 3STVA 2Z6VA 1P6QA 2QE7A 1V48A 3SHWA 4H27A 1HM5A 3AFOA 3W5IA 1EA7A 1FTSA 5IASA 4DUYB 1N2ZA 2JANA 2Z2YA 3T5CA 3DD1A 4QTZA 3VC2A 3OCCA 3HN2A 3B9PA 3MPUA 1FSPA 4HYYA 2DRIA 1JAYA 1NRXA 2GEKA 3SD7A 4HZGA 3DBHB 2OR3A 3WY9A 3N5CA 3EMBA 4GOOD 4IIJF 5KMGA 4RM3A 3NJRA 4OB7A 5I7EA 2YHBA 4YP0A 2DSNA 1DJLA 4MRVA 3SHFA 3VVCA 2ZBDA 3NP9A 4CG3A 3BGDA 4DT1B 2IHBA 1BVHA 4G36A 1DC3A 5T57A 1E5XA 2RJ3A 4A91A 3E18A 2YS6A 1V1RB 4MMYB 3PFGA 4URXR 1PRYA 1ZJZA 4Z9AA 3PZRA 3UJ9A 3PPVA 3KETA 1WBDA 4CEIA 4WIAA 4JGBA 4ZTUB 3GJ7A 1B23P 1JHVA 1ZL2A 1DWPA 3RTBA 1GNRA 2OBBA 4Q7LA 3D5QA 1L3CA 4XSVA 1JSCA 1BVUA 3H97A 3IOCA 4GU5A 4I8XA 4P33A 4KO3S 5JE8A 3RWMB 4A92A 5K0GA 2PXHA 2G9RA 4LVOA 3T7KA 4FNGA 1OFVA 4US0R 5EMLA 4B82A 4UNRA 5HNKA 2AJBA 1FVXA 4G09A 4I2NA 1OAOC 2KQUA 2OILA 3VR4A 3E35A 2GHTA 4WXMA 1AS0A 2W8ZA 1A98A 3VYSB 3O3CA 5A05A 2EZUA 4F45A 1V4VA 4MRMB 4AM8A 3LTEA 4BIIA 4JYZA 2Q3LA 5C2JB 3JQQA 2IOFA 4PAOA 3A3KA 1R64A 1PUXA 1IEVA 1EB8A 1X7XB 2I3DA 3HLYA 5SYAA 5KYXB 2O59A 2IHZA 3N7TA 3OPMA 4XJTA 2GYVA 2JGRA 2DHRA 3I4CA 3VMMA 5BR1A 4TZKA 3UWPA 1KP3A 2BF7A 4QU0A 1E1YA 5BWBA 2CL6X 2RKBA 2H1VA 2PANA 4M9SA 5KBYA 4KGVA 2OK8A 1EJ6A 4O02B 3ETCA 4A7PA 3EXHA 4KAJA 3HJBA 4JROA 4UMVA 5AJYA 1PWYE 3W9UA 6Q21A 1RADA 1A9OA 4NV0A 3CUTA 5AW0A 3W05A 2BVNA 4DEXA 4DMCA 2X2EA 4MVYA 4F46A 1FDWA 1I6KA 1WB6A 1A9RA 2R9VA 3M83A 4CMAA 1FS4A 3VAAA 5ALPA 3NP7A 1WUJS 1ZZEA 4BB5A 4J0QA 3B3JA 2XE4A 1GA1A 2XRMA 3HFSA 1WVGA 4IDGA 4GOLD 1IHOA 4UOEA 1JQEA 4O6VA 4B3GA 1Q74A 2V7QA 4OFXA 1E79D 3WLQA 1K6MA 3MRTA 1Q16A 3V32A 3K53A 1EG2A 4JB3A 2VBIA 4A8PA 2RHOA 5KWEA 2VQEB 5ED4A 2WAXA 2ZYDA 4M1QA 1ZL0A 1KO5A 1C41A 3BWXA 4QXRA 4WEQA 3L4BC 1KY5A 2HJ9A 2H9YA 3OEWA 3E7DA 2Q5CA 3QKUA 3FOAA 4PN3A 2G9VA 4LSZA 5G41A 1QLWA 2EGUA 3OPYB 5AWFC 4EA7A 1U7ZA 1BCRA 1WZNA 4M0UA 2FUG6 2CNOA 3B1JA 4RACA 4PYKA 4UJ3A 2Z57A 2R8BA 4L5CA 4RSHA 1ZR2A 3SLRA 5FAKA 1XZNA 1SXJA 4LBWA 521PA 1LVHA 4DWOA 5JMOA 5AJVB 3JQPA 4C06A 4X6XA 1K7YA 4LNAA 1CUJA 2ATCA 1MFPA 2VJNA 2ZETA 3SZMA 2DQ4A 3NONA 1ZY2A 4ESHA 2HU8A 2FP4A 3WBJA 1GV0A 1PR2A 3U4CA 1XN4A 4LMBA 3LG2A 4KFUA 1NYQA 3FROA 1C1DA 2P69A 3UJPA 1W2WB 4BNKA 2WDZA 1QMGA 1Z6AA 4V0ME 5TF0A 1A5BB 1F48A 2HT1A 4G0PA 4LC9A 3PJGA 4CBVA 5BPHA 1GYQA 2EJVA 1AX9A 2HBRA 2F1RA 3FVVA 2AFIE 5EJ6A 1BU5A 5FOVA 3II6X 3LL4A 2C7RA 1UKYA 1Z4KA 1ZNXA 3BQNB 4MEJA 3T7DA 3LUFA 3MGAA 3VR4D 1HNNA 2M32A 3HZZA 1KDTA 5L8VA 1YZVA 4WLVA 2EGGA 4ZZ3A 1ACMA 2Z1DA 5L3VA 1GM5A 2XYGA 1TADA 2F3PA 1T5OA 2ZJ8A 2G6TA 4E4YA 2PZAA 3CY6A 5IZCC 4UHKA 2AL7A 1LJ8A 3QVGA 3ESDA 3GRFA 4MQFA 4R1UA 1VXOA 1T1IA 2H57A 3G5MA 1P2BA 4CCAA 4TKVA 5LOVA 2CFOA 3LHIA 2HK7A 2OVBA 1XQ9A 4DJDC 2EBWA 2YC2C 5FBVB 1G8HA 4HDOB 4LXXA 1I7DA 2C88A 4CF5A 2B0CA 3FCUB 5JCJA 3SC2A 1AN9A 3UOGA 5IM4F 3RS2A 2Z56A 2PEZA 4KQKA 4O33A 1ICIA 1IJEA 3MD0A 3QWHA 4FOTA 4PFJA 1YSCA 3DTYA 1OXSC 2SHKA 3JWHA 4OO3A 2QXUA 4RD2A 2C2WA 4YY3B 4NCAA 1DV2A 1SVIA 3AQIA 3B5JA 3FSGA 4RLSA 4M0EA 3W0LB 3ZWKA 2JJ2A 2VDNB 1UZMA 3EPPA 4RJKA 3U4AA 4BPRA 3ADPA 2PH7A 4MGIR 3DTVB 4KE7A 2ZYSA 4R54A 1EVKA 2VQ6A 1AK1A 2MYPA 3O84A 1ZX1A 2LDBA 1YRQA 3PQFA 4FDUA 5FXMA 5A5DA 1F8XA 1N2CE 1R3DA 5K0BA 4MW0A 4DPKA 4IHJB 3HJCA 3CW9A 3USES 1BOOA 4B44A 2HU2A 5KVCA 4HGYA 5ECYA 4QUEA 3JQEA 2IXEA 3WYAA 3M4JA 3PQ3A 3VTZA 3K09C 3R3XA 1UKBA 2HSWA 3H3JA 1K92A 2X6RA 2YW2A 4JOCA 4XYBA 4DIKA 5DN6A 4QOSA 4H16A 5CXXA 1A9PA 4IDCA 4LMRA 3WZMA 4MKZA 2VH2A 1CLEA 1ZUWA 1FOEB 3QLEA 3JQFA 4ASUA 2ZRDA 1OWNA 3HABA 2CNDA 4G6ZA 1JIUA 4NE9A 3LDHA 1JU9A 4R31A 5AOCA 2NPFA 3FOEC 1PK9A 4IG9A 1AS3A 5JS7A 3ZJTA 4K05A 1U31A 3O4IA 2RGWA 1VA4A 4N5MA 1UK6A 4EJ2A 2WMYA 2A88A 2R1TA 4P86A 5T41A 3HJFA 1SXJD 5TVKA 3LBAA 4UU7A 4Q4CA 5KHLB 4YMUA 1Q0UA 4MULA 2GA9A 3LT2A 1EDOA 2PAFA 2PRZA 3D2AA 4MYTA 3EW7A 1FS5A 3DBHA 1ZYUA 4PXAA 5DLQC 5TGDA 1M74A 2CF6A 5TS3A 3ANXA 3IQXA 1VM6A 3VOBA 4AJ4A 4PGMA 4ID9A 3VZRA 2XMPA 4JI3B 5ANRB 4US2R 4HDMB 3BL8A 2ANCA 1CYDA 2OHVA 3OY7A 5BMOA 4FOPA 2AF4C 3H19A 2ODNA 5IH3A 1NUTA 2H6EA 4KXYA 4N0QA 2QWXA 5AI8A 4B47A 1KJYA 5CFQA 2R8EA 4FFBA 2G9NA 4DB4A 4CFZA 1H94A 1RQXA 3DR5A 5F1OA 3AESB 3PGA1 1Y6QA 1DO2A 1V5IA 4TM8A 3DMRA 3U3ZA 4HQOA 2XW6A 1NJ8A 3LLMA 3MPOA 5D8DA 3V8NA 1XD8A 4KITB 2IP1A 3DZDA 1IEQA 3DFFA 2PVSA 1P0IA 2QM3A 5JY1A 1O94A 2C5FA 1OB2A 5BMVF 3MAAC 3EXG1 5F77A 3R9XA 4J0HA 2A9KA 2ZSJA 3OUTA 1U1DA 1PN3A 2GX6A 4W5WA 1Z6YA 2CDAA 2AOTB 1EFDN 3O8OA 3N9IA 1XXHB 3P7MA 5FLKA 1P1JA 1R6DA 4X7PA 1LBIA 5TMDA 1FUEA 4TL6A 3E9DA 3F3SA 2QYOA 2CUNA 3FDXA 1CUDA 1YVUA 4BX0A 3U6BA 2GF2A 1Q0PA 1ZGGA 3BB1A 4L8VA 2LV8A 3ZCSA 4JGIA 1T9KA 5F2KA 4F5DA 5EJEA 1E32A 4HFRA 3BGVA 4L6AA 4G0OA 4PPGA 1Z35A 1QHIA 3Q7SA 4YJ3F 4QGGA 3SF0A 1CR2A 4GRDA 5C5IA 5EJAA 1CJCA 2VFAA 3ZD9A 1T3HA 2HK6A 5H16A 4A03A 3EFOA 1GUBA 2V55B 5E1MA 4XSHA 4O2AF 2YFHA 3IS3A 4ZCRA 2Q1XA 2QZPA 3FBWA 4OTZA 4PEVA 5ILQA 5LKAA 3DBVO 1JVBA 2XUKA 3QUAA 3MJSA 1CZUA 1NVMB 4NG5A 1JJIA 3O0DA 1EGVB 3S2GA 5A3SA 1BG6A 2XRFA 4ZT5A 2GRUA 2QI9C 1ZH6A 2WZQA 3BE8A 3N7AA 3OUUA 3WK6A 4S05A 1H3NA 2HCJB 2HMAA 1B2RA 1W5FA 2A1UA 2R4UA 1P3JA 4WUTA 3K1TA 3LUDA 4HDAA 3IEPA 4L3OA 3T4UA 3E23A 2CJWA 4DV4B 4IV0A 1T3ZA 1O9GA 1REQA 1DJQA 1TFUA 1U5BB 3HI6A 3P9IA 2DFPA 4GC5A 4WVLA 3ZJYA 2FAXA 1I2MA 1W8IA 3KJFA 4MWDA 3GJ0A 4AJHA 3JRXA 3RRBA 1VCHA 5IDQA 2HM7A 3PDIB 4DGQA 1TYDE 1PNQA 4D57A 3OIDA 2ROQA 5AJWA 3FKSD 2ZUVA 2O52A 2VF7A 3NAGA 1TZ2A 5D3ZA 2O5RA 4QU9A 5J2TF 4I1YA 4FB4A 3QXCA 1NXXA 4KFSA 2FR8C 4DA0A 3GPCA 5BNFA 3W4JA 1U8YA 4N0PA 4WW0A 4F92B 4FHGA 1AKUA 2X13A 4MUKA 4U3JA 1YONA 4QNNA 1XJCA 5B1YA 4U7TB 4AN4A 1Q7TA 2VZEA 4H0FA 1PAUA 4O8CA 1CQZA 3GJXC 1WP4A 3MTEA 3WE7A 1RPZA 4HDCA 1D2GA 4PSKA 1RWMA 2Z3WA 3VO9A 5L6LB 2BGWA 4D6XA 2EHDA 4DRZA 4DRYA 3TF5A 2WSIA 2CJXA 3IT2A 2YWEA 3BGWA 2QRLA 2JFWA 3TIVA 1HGXA 4JVMA 2DU8A 4C21A 2ZRCA 3GLTA 3BZBA 2X0EA 4ND2A 4YRPA 3ULKA 3DEAA 2FVYA 5K0EA 3OOYA 2XZTA 1E8DA 3WYCA 1Q0SA 2R4TA 3RHFA 4CQMA 4INPA 2HV9A 2WKPA 3HBJA 1V3UA 1FXWF 5AKGA 5B4VA 1U7XA 1ML4A 1FNMA 4R9UC 4Q37A 3ECCA 3IEIA 4OOEA 5COBA 1XPUA 4D6YA 4AKEA 4F06A 4RO0A 4UM5A 3RLIA 1QAOA 5KTYA 1GAWA 2W70A 1MV8A 4ZRNA 3AUUA 3F96A 2Q6IA 4RFSA 3W5DA 4PCUA 1P91A 1YL6A 4MB6A 1P2GA 4HOYA 4Y7DA 2CCJA 3EMVA 2QRHA 1BH6A 2B1IA 3Q3HA 4ZJZA 3QG5A 2FN7A 2W71A 3EQZA 3MWJA 5EHXA 3I05A 4RNDB 2R8PA 3H4VA 9LDTA 4PPNA 4J03A 4YV1A 2GETA 4JQZA 3IXMA 4QQFA 4ZEVA 4ARZA 1M1YB 3VPBA 5JEEA 4RZUA 4NSNA 5FPPA 1PD1A 2C7BA 1JEQB 1UOPA 3ZS8A 2PSDA 1OWPA 4WWHA 1AA6A 4LZLA 4ZEWA 1A5AB 3IILA 4NZPA 3WKBA 1ZBQA 2WVHA 3PS9A 2Z2KA 4EY6A 1GIAA 4REMA 3FETA 2QG6A 3IQEA 6NULA 2JAXA 2FW6A 1YJQA 2WF5A 4MROA 3JZIA 2B7BA 3Q1KA 4PZUA 4QOJA 1L4NA 2FLWA 2QD3A 1QWOA 4OH1A 3RJTA 1CDZA 3KAQA 3MELA 3WNZA 4BZWA 4ZOCA 1M1NA 4UMFA 1C8LA 2PHZA 3SX0A 4EKGA 3E7WA 3UB4A 5IPFA 1F3OA 1YMVA 2O0LA 2Y9PB 1AB5A 2XWBF 1FDVA 1M2HA 3P9ZA 2DTDA 1TI7A 2AOVA 2XA9A 3FR8A 4OIMA 3HU2A 4B3SB 4HYQA 4OJMX 3S0JA 4HR7A 2A35A 1N3IA 3AM1A 5DW3A 2AN5A 1EEXB 1S8FA 3AR5A 4FHEA 3T6KA 4HDRB 2B9EA 5FOQA 2YMQA 2DZDA 1IY9A 1JWBB 4TXHA 2DERA 2IVFA 3COYA 4X71A 4A0HA 1C9NA 1QHHA 1A5SB 1VL0A 2XY4A 4FCVA 4ECEA 1VE3A 3HY4A 4UOQA 5EXDA 1RLOA 1UH5A 3QWIA 4DYHA 1DX9A 4Q24A 1CF4A 4K3UA 4C22A 2F1OA 2WHQA 4G65A 4Q9DA 2YZGA 5CFPA 3CNLA 3OTOB 5JDCA 4BP1A 2AR9A 1LLUA 1PWHA 5IC4A 3UW1A 1SQGA 1W2GA 4DJEC 4YHHB 2VAXA 1WBJB 4G37A 3PI6A 3MCZA 4I55A 3C48A 5EXPA 1VXRA 1BN6A 1PS8A 2Q5JA 3FLBA 5TPZD 3PDWA 4FEAA 3GLGA 1IB6A 1PJRA 3FSRA 5JJIA 2XEDA 1HT2E 2IYLD 4CMIA 4E31A 3IPCA 3IRVA 4JCCA 2F8TA 2Y27A 5JXHA 1FUUA 2W8BB 4YV0A 2PS9A 3GNTA 2DWQA 2IDMA 1M2WA 3R4VA 2ZSFA 3QU4A 4GF5A 5G2OA 2NSDA 3K9BA 3CRMA 2AG1A 1QYRA 3TOCA 1DQPA 2FSGA 2WPNA 1MGOA 2NOAA 3PT9A 4OGWA 1E62A 4J0IA 4LBVA 1JR3D 1POWA 3RU3A 1W0KD 3BGSA 4RQBA 1PT7A 4XGKA 4Q00A 4CV0A 2BEVB 2WV7A 5B2FA 2XODA 4B31A 3DFIA 1XK6A 3IR5A 2CSUA 3HBLA 3RRFA 1JB1A 2AN3A 2BGJA 3D8BA 4IDAA 3PICA 4NNPA 4HRXA 1XZLA 1R5NA 2E1RA 1S7GA 4Q4HB 1T5IA 1VZ3A 3OVMA 4HS4A 4IDQA 5AM3A 1JFTA 1F8YA 4AROA 1ODCA 2VJMA 4ZCMA 4OX9Y 4KCGA 3GT0A 1VHJA 1UKZA 3AOEA 4NNJA 1DIAA 1HQYE 2JLCA 1RI5A 4CLDA 3F8WA 5DYYA 1AO3A 2JD0A 4FBGA 5ULLA 4C0JA 2PGXA 1NI4B 3F49S 3NWBA 5DYNA 3FNEA 3WTCA 2ZB3A 1R4ZA 1N9ZA 3LUBA 1LJLA 3P2MA 1N6OA 2A9RA 1NE7A 1O9HA 3LBFA 1EE1A 2FUCA 4H60A 2IYAA 1WQ4A 3OURA 3OX2A 4XTRA 1CRQA 4GZ3A 3RD5A 2OZLB 3IV9A 4YV7A 3KDPA 1PV4A 3INNA 2PUWA 3ENNA 4ZRDA 2H8GA 3BIWA 3ZCTA 4BAZA 4PW0A 1VSVA 2JGMA 4LOJA 3OFKA 4QPJC 5KWIA 2Q4EA 4KXFB 4NU6A 4BV3A 4EUFA 5KS2A 1R8SA 1DCMA 4ZQHA 4HHEA 2DBZA 3I6QA 2R5WA 3UW3A 2XSZA 4ML3A 1VIYA 2VP5A 1D2AA 3WL3A 2ODEA 2P6RA 1N5DA 4NCKA 2B8NA 3F74A 3T7EA 3WGLA 1V9SA 4Y2VA 1RFGE 1REQB 2HRZA 2JCGA 3NJ4A 2NP6A 2SCUA 2WF8A 1P1FA 1MC1A 4FP9A 1IXSB 3EGXA 1AQYA 1TJ5A 4OHYA 5A0FA 1Y0BA 4D8UA 1H5NA 1ZP6A 1B0PA 2F7SA 2OZVA 1KO4A 2B92A 3FCXA 4YRIA 5J2UF 2A9FA 1QG4A 5HEKA 2BZSA 2G8NA 3T0GA 1JG6A 2P27A 4QVKA 2J85A 4J8PA 3A10A 4JT9A 4MVJA 2IH5A 2NSYA 1CB0A 1N2SA 2BEUA 1G3IA 4AN1A 4CDNA 1AQUA 3TMAA 1Y5NA 3GLIE 3KVYA 4W7SA 3MCTA 4NEQA 3AKCA 4DM7A 2RE8A 3ICQB 3S4YA 2GN8A 5ALFA 4DBVO 4DLKA 5E7IA 2EG9A 3CINA 1WRBA 4BB6A 4B83A 2Z6QA 1EYZA 2HHJA 2AXEA 2ODWA 2G1UA 2HRDA 2EWWA 1OGYA 2IW1A 3M6WA 1J9GA 3CUKA 1TRKA 4UC0A 1RQNA 2C4UA 3UMRA 1A8PA 3C8DA 4EHNA 4EKEA 1JIIA 5CFZA 2J67A 1NV9A 2P3SA 3I6MA 2BFDB 3PUKA 3ROTA 3F8SA 3KLNA 5LR6A 3J81A 3C6BA 3R0VA 4ZO4A 3GEBA 1CFZA 5IKXA 3ET4A 4QVIA 1UDBA 2C4TA 3U19A 1IBMB 3L6UA 1DIHA 3HR7A 4UVDA 4OJTA 3VFDA 1A9ZA 2PJZA 3D8UA 2Z4RA 1L7DA 3V1TC 2EL7A 4BVAA 2VNJA 2X7HA 1NUPA 1FU4A 2ZIXB 3OZIA 2BF4A 4X1YB 5CW1A 5EESA 2F3RA 2DBRA 4RDHA 3AM4A 2VXBA 1XJ0A 3MCUA 5BPFA 3LC7O 5DCYA 3S55A 2ZVPX 5J43A 2DTXA 3LX5A 3EGXB 1UT5A 3WHLA 3CLRD 3ZI7A 4EARA 4B7ZA 3K0CC 5DO9A 4XYGA 1GDDA 1A72A 2RCYA 4GIBA 2R6FA 2ZWPA 1YACA 3QYJA 1J9ZA 1QIMA 3MJFA 3P2KA 3DHWC 3BOSA 5BVGA 1JIJA 1SRRA 2I4RA 3G8BA 4JHXA 1N8NA 4LVCA 1K97A 1KY4A 2H4WA 5FNVA 1JDBB 1SNYA 2YCLA 4B2LA 5C9ZA 4DDHA 4CHGA 1B74A 2IEGA 3M3HA 1EX7A 4BU0A 4DXDA 4ARIA 4V39A 1RHMA 5BN1A 1WCV1 2J4DA 4LWPA 1ARZA 4MV5A 2E82A 3S81A 1OFTA 1YWGO 2ADMA 1T1JA 1MIOA 2EJTA 3FDZB 5IZCA 3I3OA 3AR8A 3EBOA 3FNHA 4U7GA 2DG2A 3AVWA 4O1HA 2FU5C 2P9FA 3G13A 3SSAA 2PO7A 4CKZA 3QSYA 4Z2YA 3WP0A 4R7GA 5NULA 3UWOA 3E1KA 3G2HA 4LOAA 3PTAA 2CDRA 3UT5A 4D4JA 2WU1A 1X39A 3GAZA 4Q4LA 3TQCA 6YASA 1G4UR 1KFJB 5AW8A 4KTTE 4UD2A 3E3NA 3ZN2A 1MLDA 3PQ5A 4CHTA 5IXSA 4IFBA 5FUYA 3LPCA 4CDRA 1Q19A 1NU8A 5AKXA 4CM8A 2GFQA 2VDVE 4GZ5A 1B42A 4E88A 1CY1A 2H16A 1KE2A 3T3GA 1Z8NA 3QUTA 2V97A 4E5PA 1C4WA 3HDVA 2FG6C 5JADA 2RAPA 1YZUA 5EQTA 2V6GA 3V8MA 4ASUD 5AVSA 3TR5A 1FVOA 1O6ZA 4B4VA 4RS3A 4WECA 1QUFA 3U3KA 4KZKA 1B0AA 3P26A 4LHXA 4GEGA 1TJ3A 2WJ6A 3BILA 1M6WA 1CJKC 1GYPA 1RJ9A 2XT0A 3F7NA 3MNFA 1H1LB 2OGSA 4WOBA 5G40A 4U2EA 1QGED 2J0EA