2CZ0B

Photo-activation state of fe-type nhase in aerobic condition
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title photo-activation state of Fe-type NHase in aerobic condition
rcsb
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 56
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2cz0B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cz0B02
1AHJB 4RKUE 2DD4B 1GXIE 2ZPEB 2PU9B 4OB1B 1PSEA 1UGQB 3HHTB 2ZZDA 3A8GB 4ZGJB 2DD4A 3QZ5B 3VYGB 4OB3B 2DD5B 1QP3A 4KT0E 3X28B 4XK8E 3WVDB 2ZPHB 2DXBB 3A8MB 3A8OB 2PVOB 4OB2B 3QXEB 1UGSB 2PUOB 2WSFE 3X24B 2CZ1B 1PSFA 4ZGEB 3X26B 2AHJB 3VYGA 2DXCA 2ZCFB 3X20B 3QYGB 2ZPFB 1QP2A 2DXCB 2QDYB 1DJ7B 2ZPGB 1UGPB 2D0QB 2PVDB 4FM4B 4OB0B 3WVEB 2WSEE 3VYHB 2ZPIB 1V29B 2DXBA 2DPPB 2WSCE 4L6V5 3X25B 5L8RE 1IREB 4Y28E 3QZ9B 2CZ6B 3QYHB 2O01E 2CZ0B 2ZZDB 2CYZB 1JB0E 2PVGB 4ZGDB 2CZ7B 2PUKB 3A8HB 2DD5A 2ZPBB 1UGRB 3LW5E 3A8LB
chains in the Genus database with same CATH superfamily
1K8AR 2GF7A 2X51A 2LT4A 4BDYA 2YDLA 2CT3A 5FU7C 4E6RA 3CMAQ 2VV5A 1X75C 4RTWA 2QQBA 2LQNA 5KCOA 4PFOA 3EFOA 4VUBA 4JJBA 3JB9H 2K5IA 1MMGA 5GJVB 3NTIA 1IRXA 1D0YA 3CEYA 4LN2A 3QYEA 1M8MA 1YJWT 4HVUA 4OB2B 1YHQT 2PUOB 1E9HB 2RQTA 2XD0A 5HK3A 4PFPA 1D0ZA 1QLYA 2COWA 1UG1A 4X1VA 2Y4XA 1PKTA 5CKDA 1VQLT 2G9XB 2UZBB 3X20B 1SPKA 2IPOB 2JTFA 3MHXA 3CCJQ 2C06A 2E6ZA 2XMFA 4A4EA 1YJNA 1XJWB 1WHHA 2XDBA 2ZPGB 4CFNB 2FZCB 1VQKT 2DYBA 4CFUB 1I81A 3RBBB 2DZ9A 2ZAEA 2R57A 1SG5A 4M78B 1JBMA 3JSCA 2QA4T 1KC8U 3PIPA 1Q81U 4GLMA 1GUXA 4F7UA 4M7DD 4IUQA 1G3SA 2DTHA 3G71T 2C5NB 1WPYA 1H3HA 4XTUA 4J83A 4PFZA 3CCST 1GCQC 2YT6A 3A8HB 2W10A 2ZPBB 4BDZA 1GRIA 1M1KR 2O2OA 3FLGA 2J05A 3A1PA 1BU2A 4L5GA 4F17A 3EG0A 2O9SA 2JN0A 2HQEA 2KRNA 3OYHA 2E3HA 3C95A 2EBPA 5CAIA 1FINB 4OB1B 2KR3A 5I11A 4YOSA 1WXTA 2V8JA 1AD5A 2R5MA 3JB9J 1H641 5IHYA 4BXXX 3SHWA 3G71A 4RTZA 3EHRA 5EC7A 5FLXE 4OMOA 4J9IA 1QP3A 5GANf 4ZN1A 3JCMc 3ZEHA 2EAYA 2G77A 2M1HA 2NUTA 1Q82U 5ECAA 4M4ZA 1WHLA 4X9CA 2L5QA 1EFNA 4C8QE 2MWPA 3A8OB 2CDTA 3EGUA 1KIKA 2ECZA 5GAN8 5FGKB 2RF0A 4N0AA 1JSTB 4NOYA 1O9KA 1X2QA 2CZ1B 3DL1A 4QKUA 2W2HA 2WJ9A 1M4ZA 1VQ9A 4Q5WA 5KH6A 2RMOA 2FO0A 2KT1A 3V7RA 1YHQQ 3M0QA 3CCRQ 1UHFA 2OTJT 1VQ6A 1IXDA 2IW9B 1VQOA 3QG1A 3PVQA 2L89A 1AOJA 4OMNA 4A4KA 5LL6S 2WFYB 3VUBA 5KYYA 1Q95G 4M7AD 3IQLA 3V7SA 3CD6Q 4F7UF 3QWXX 2HKQB 2VXFA 4A4FA 2DVEA 1VQOT 3VKGA 3CBOA 3OS5A 1QVGS 3LWHA 3L2UA 5LJ5g 2DERA 4DEXA 2QTXA 5LJ3d 1K4US 4PJJA 3R6NA 1YBYA 2DJQA 3CCET 1PKSA 1NYFA 2X4YA 1G3TA 3L2WA 4HCZA 2YUQA 1R77A 1K73R 2VXEA 4DBQA 4JX6A 2QXFA 1LCKA 2V26A 4D6WA 1ZUYA 2KMGA 3CC7T 4ROEA 3CCUT 2GQIA 1YNZA 3CXCA 1W2BS 3OYMA 1OULA 3D7SB 3TW6A 2JM8A 1PKDB 2CP5A 1BI1A 2KSSA 2EW3A 1W98B 1PC0A 3HZJA 2PJQA 2RN8A 2DTOA 4M77C 2QK0A 1BCMA 2SEMA 1KC8C 4PL6A 1UTIA 4O6JA 4ZGJB 2E41A 3H9NA 1VQ9T 4M7AF 1T0JA 5A0DA 1Q7YR 1CKBA 2QQRA 3G7ZA 2D8HA 1GFCA 5EFQB 3M0RA 5GAOr 1G3YA 4KT0E 3CPWP 1VQ5A 3X28B 3F5XB 4BCGB 2EYZA 1ZLMA 2D8JA 1KJWA 3MKDA 3HRSA 4EMKB 4Y92A 4IURA 4EOSB 2GGRA 2VVKA 2KXDA 3TREA 2DVJA 1TD6A 3EH2A 2EJFA 4E7LA 3JB9F 2LJ1A 1NG2A 3QHSA 3CCQT 3RIRA 4YTLA 3M4YA 1OIUB 2EYWA 3G6EQ 3TN8B 5FU6B 4M77A 1VYUA 5KE3A 1KQ2A 4C92A 3B57A 1C0MA 4DOWA 3JCMW 2ED0A 3CCMQ 4CFXB 4FCYA 4XTWA 2WHBB 1AWXA 2DLPA 4PJNA 4LE9A 3G6EA 1N8RR 1B07A 3SWNC 1WHJA 1FKMA 1TU0B 2HAXA 3KXTA 4PJOE 1VQ6Q 2YUOA 3L2QA 2CP6A 1ZUUA 4IUTA 2EGAA 4AFUC 2FG0A 4M7DE 3VS2A 3M0UA 3RNJA 2X35A 4XQ3A 1BI2A 1VQLQ 4M7DB 1JEGA 2VC8A 2XDDA 1NEGA 2J6KA 4BCND 1XO2A 5DLOA 2KT8A 1V76A 4XTVA 4LDYA 5GAMe 4BY6C 4P5NA 3CCLA 3OYLA 1I4K1 2DD4B 4QT7A 5FROA 1WGSA 1KHIA 1UJ0A 4M75C 2Z0WA 3I9QA 4QVZA 4DOVA 1KQSA 1OPLA 5IAYA 4LD9K 5GAN2 1YJ9A 1VQ8T 3VKIA 3BG9A 2BPMB 1MMAA 2LTOA 2JVVA 3R6OA 3CCLQ 2E10A 2HNIA 3WVDB 4PJOD 3UDCA 1VQ4T 1O9SA 4A54A 2LQWA 4J9BA 2YLBA 4C92C 3OA6A 4AKIA 2RM4A 1R0CB 3UA6A 1UEBA 4BBSM 4CI0C 2RJFA 5DY9A 1NE8A 2LX7A 3PMTA 1OL2B 2QQAA 2IW8B 5DM7R 1WLPB 3VS6A 2RQWA 2COZA 3I55Q 5GAOq 1RUWA 2F2VA 2KY9A 5CIUA 5GAMh 3PT9A 2KAFA 2RQVA 4RTVA 5IH2A 3C94A 2A37A 1JU5C 1WNLA 3CPWA 2YWWA 3J80E 4EDUA 3I56A 1NZ9A 4M6VA 4IUPA 2WSEE 4M7AE 3CXCP 2BS4A 3VRZA 4F6UB 1MMNA 2X3WD 1FWZA 4O5VA 3FDRA 2FYKA 2JUFA 3OYNA 2LCLA 3EG1A 3L2ZA 1K0XA 3NTHA 4E7HA 2HQHA 4E7ZA 1JXMA 1GCQA 2O9VA 4F7SB 3BFMA 5FWCA 2ABLA 1OOTA 2P0PA 2YSQA 2WPAB 3JCMe 1ACMB 1FMVA 2EWNA 4EMKA 1M2OA 2XDPA 2BTTA 4RTXA 2E12A 2FPFA 1QMZB 3CC7A 1VOMA 3A8LB 2BIVA 4BBRM 4QQGA 4QVDA 2DEQA 1GFDA 2G3RA 4BE2A 1QVPA 2JM9A 3O8VA 1KG1A 2QG9B 2X3XD 3OYEA 1S1NA 2YLCA 3JCMP 4FYVB 4K11A 4MZPA 2IW6B 4JZ4A 1D1BA 2CJMB 4EONB 5LJ3h 4F7NB 3OS2A 2K5FA 3H41A 4OB3B 2I40B 2M0OA 1KD1C 1QVFP 1JJ2S 2BE7D 5CCAA 1YJ9T 4JX5A 4BCIB 2NWMA 2YRVA 2XIDA 2SRCA 3QDFA 4UN0A 5IHKA 3C4SA 3I56T 3NMZC 1UGSB 3CCUQ 4KULA 2XICA 3CCVT 3OYFA 3HP9A 1K9MC 4XU0A 1QVFS 3PFSA 3TU4K 4M77F 4HCKA 3VJPA 3SD4A 2BZXA 2DXCA 1AD6A 5GAOm 4PJOC 2CP7A 4B9XA 2DA9A 4LXCA 3QWLA 1BI0A 3GBQA 4TTHA 5KCHA 1VQNT 4M7DC 1OI9B 1M3AA 3OB9A 1KQSP 1KFZA 4BCPB 3BW1A 3LWIA 5C6SA 1SRMA 2PQWA 3OYGA 1FMWA 1QWEA 4C8QB 1I8FA 2F5TX 1M9SA 3I35A 1EX4A 3QJ6A 1RAGB 4TVRA 2DL7A 1TOVA 4BY7X 5GAMg 3EFOB 1QKWA 2OTLQ 2YXYA 1M3BA 2L8DA 1C1AA 4A53A 5GAMf 1OKWB 2UUEB 4CFWB 4EC9B 2O31A 3OS0A 3CC4T 2PUKB 2MK5A 2HCKA 4FL6A 2LMJA 3CMAT 3V7CA 4LOCA 2RHYA 2W96A 3H6ZA 4C5GA 4EOOB 4MFEA 3TW7A 1QVFA 2HBWA 2DXUA 5D6WA 1PSEA 1UGQB 3PNWC 2D6FA 1OL1B 5CK9A 1SRLA 2I0NA 3EGDB 4F6SB 4ELLA 1QQJA 1FXXA 2ZZDA 3A8GB 2KR6A 5DQWA 4OF1A 1VQ6T 5IHIA 1FVVB 2HDAA 1K76A 4FU6A 2DD5B 4E7KA 1W6XA 1N5ZA 3HL8A 3RERA 4NL2A 4KRCB 1VQKA 3A8MB 2PVOB 1Y96B 4Z89A 1JJ2P 2E64A 4IUVA 4ZTJA 1Q86C 2DYIA 3OYJA 3JCMV 1PSFA 2DAQA 5GAOp 5LJ5j 3CCEQ 2C4GB 2ZPFB 2MAMA 4ZN3A 2C5XB 5HNBB 1NBEB 4OMFB 4AMCA 2VASA 5KYUB 3BHVB 2PNIA 4Y91A 3FRNA 2PHGA 1CSKA 4NL3A 1PD1A 4HT9A 2A7YA 1Y96A 4PLLA 5D7UA 2DIQA 2CP0A 1F5QB 2DXBA 3CC2A 5CO7A 5J3BA 3OY9A 2LX9A 1QVGP 2DF6A 5L8RE 5FU6C 2EQMA 1UHCA 1M90U 2LDMA 4FIBA 4D8DA 2CZ0B 2H3JA 1OU8A 5CYIB 3TNHB 5HY6A 2EKHA 3JB9I 1W4SA 4EIKA 1WDXA 3GPLA 5FRMA 2A0FB 2NUTB 2KQWA 1GH6B 2DRMA 2HSPA 3SWNA 1VQPA 2CH4W 1Q7YU 1E6GA 1OQKA 2NUZA 4FW1A 2QTVA 2CSQA 2DIGA 3S3OA 4M7AA 1Z9QA 2F5KA 2EIFA 3G1JA 2KROA 4HNTA 4Z8AA 2LT1A 2LVMA 1G2BA 2NYSA 3PE0A 5I22A 2DTIA 2KEAA 4M75D 1VA7A 2P4RA 1Q82C 2WACA 4LUDA 1OIYB 4RODA 2C0OA 3LGLA 4OVAA 4E2FB 1K8AU 4JJDA 4BY6B 2DRKA 1TUDA 1HJDA 1Q86R 3TQ7P 4Z88A 8AT1B 2MOXA 3OS1A 1WJQA 3UATA 3OYCA 4BCHB 1LPLA 5LJ3g 1RAEB 4XAXB 1TWBA 7AT1B 2E6NA 2AKLA 2W0ZA 4PJOA 1YJWA 4WCIA 3H0IA 4N0AC 1M8VA 1ABOA 1ENWA 2VGNA 3JB9D 1RACB 2AHJB 2YRCA 2NLUA 1VUBA 2GTOA 2K5LA 4JRKA 3UPUA 2GFAA 2VWFA 1TFBA 1UDLA 2RHXA 1K9AA 3CC2Q 3GF5A 1ZSZC 1VQ9Q 1HK9A 2C6TB 2FZKB 3F70A 3DB4A 3OSSC 1KK7A 3E2UA 4EOJB 1Y07A 4HCCA 2JMAA 1KD1U 1M30A 2K79A 5M9OA 3P8BB 5LJ5h 2DK3A 4KBMB 1U1SA 3PVLA 1YITT 5LQFB 1Q7YC 2LJ0A 2JJ9A 4L6V5 4BE0A 1OV3A 2ROLA 3OQ5A 2KNBB 2LCSA 2E5QA 3EJ1B 1UECA 2EVRA 4Z6YA 3CCQQ 1PRLC 3VUZA 4YC3B 4C0ZA 2HMAA 2IG0A 1MV0B 5D6YA 5IXBA 1F1BB 4J9GA 3CCSA 1NYGA 1VOLA 3QO3A 4BCMD 4M7AB 2QGGA 2EJGA 2PK2A 3C12A 3CMAA 4M7DG 2B9RA 5IDNB 1ZHIA 2ENMA 3CBPA 2DJZA 1IO6A 5C0MA 3SFMA 2LW4A 1GCPA 3BY7A 1Y7XA 3UT1A 3E9GA 5EJCA 2CKKA 3EFRA 3FB9A 1D3BB 2DETA 4M77D 3H4CA 2VKNA 6AT1B 1IHVA 3AHUA 3VYGB 2M9UA 1QW1A 2CSIA 5LJ5e 1YITA 3HFNA 2JMCA 1NLOC 4ELYC 2FPEA 2F2WA 5GANg 1YP5A 3CPWS 4E7SA 2DXBB 2K57A 2JZ2A 4LNPA 4EOMB 3QIIA 1VQ8A 1IGQA 2HBPA 1G3NC 4C5HA 2J06A 3RKYA 3BG3A 2FVUA 3X24B 3CBMA 1G83A 4OMQA 1N9SA 1O75A 4KRDB 4CC4B 1N6AA 1YJNT 4C92F 2LRQA 1G5VA 4QSHA 5L2WB 4EOLB 4PLIA 1XTDA 2CUDA 4JS4A 2QQSA 4JZ3A 1BIBA 1BI3A 2LJ3A 4ROCA 3SB2A 1BK2A 2HEQA 1HXDA 3ER0A 3OMCA 5J26A 2D0QB 4J7FA 5A2QE 3U23A 5FW9A 4D8KA 3CCEA 1AT1B 2V1RA 1YHQA 2DNUA 1BU1A 3EGXB 1QCOA 2DL3A 1V29B 2B86A 3BDUA 2ED1A 1VQNQ 3CC2T 2EYXA 4XTYA 2WSCE 5DQVA 3BE3A 3RMSA 3VKHA 3QZ9B 4EOPB 3OYAA 2EUFA 1BKBA 1OYXA 4DBHA 2D1XA 5FWBA 3QYHB 1BBZA 2OTJA 4M7AG 4F16A 3META 5A0GA 2BKZB 3NHNA 1QCNA 4FSSA 4KUIA 5FU7B 1LVKA 1D1CA 3REBB 1U3OA 3CCVQ 1UGVA 4PJOB 1N8RC 4C0GA 2EGCA 4ESRA 1YCSB 3TSWA 3M0PA 2V8KA 1AZGB 4RTUA 1S72T 3EIDB 5GAN4 4A4HA 2K9GA 4NC6A 3CMEQ 2D9TA 4KUDK 1I1JA 4C0DC 3MP8A 1VQ4Q 2V8IA 1VYVA 3QZ5B 4C92E 4EPCA 2KGTA 4XTXA 2O4XB 2JS0A 1JOWA 2J6OA 4J9FA 4PJOF 2F2CA 1JO8A 1TH7A 1YN8A 2ZPHB 1T0HA 1OX9A 4XU2A 1B3QA 2L3RA 2HL5C 4KGZB 2WIHB 4YOOA 3OBWA 1H1SB 2X4WA 3X26B 3M4GA 2RA2A 3VYGA 4GY5A 3K7AM 3A5ZB 3CC4Q 1D3BA 4EORB 2LNVA 4M75A 1LNXA 3M03A 2DXCB 2QDYB 4F7JB 3MI9B 2BE9B 4AFSC 1X27A 3LQ5B 5HVYB 2QA4A 2DZCA 3FJ5A 4BCJB 2ROTA 4QVCA 1I5OB 4HXJA 3JV3A 3HSBA 3VYHB 1W70A 2C5VB 3A98A 1NJIR 2KYMA 3N5BB 4C92D 1G3WA 2GQVA 4XU1A 2EGEA 3URGA 4BCKB 4RCCA 2BZ8A 2M0YA 4FW2A 5CKHA 4JRPA 8ATCB 4F6WB 4BCFB 4BE1A 3OMGA 1TUCA 1I5LA 4CC2A 1OZ3A 4DEYA 1HYOA 1WYXA 3PGGA 5GMKi 4OMMA 2JS2A 2JNGA 4F7UE 4BB7A 3G4ST 3DTOA 4BACA 2ZGWA 2DL8A 4KGXB 4RTYA 5LMKB 2Y90A 2VGMA 2YUPA 1E7OA 4CRLB 2P4TA 4DQ2A 1MNEA 1WZOA 2JT4A 2BS3A 4FYWB 1VQLA 4JJCA 2EYYA 4M7DF 1NLPC 2IIMA 3SWNB 1H27B 5I2MA 1UNGD 1WXUA 3J81E 3DOGB 4II5B 5GAN5 3QDRB 2BS2A 1I0CA 1PG5B 1UNLD 5I21A 1G8XA 3OYBA 3RKWA 3M0SA 2QGSA 1RAIB 2DD4A 1FMKA 1U06A 3I5SA 4MDWA 3JRZA 4F7LB 1MMDA 3L2RA 1S72Q 1UNHD 3CCVA 1MV3A 3QUIA 1AEYA 1D3UB 3E1SA 4QQ6A 2XG8D 3S6WA 5ACBA 3G6ET 2MPXC 3QKJA 1BIAA 4MMLA 3FIFA 4BY1X 4IUUA 1AWWA 4YOZA 3MJXA 3NTKA 3BLQB 1NEBA 2AZVA 3M9QA 3S3MA 5I2SA 1K8AC 4F70B 2EQJA 4C92G 3QYGB 1QP2A 4FX3B 4CC3A 2KYBA 3QHWB 1DJ7B 3GNGA 2QAZA 1VQMA 1X6BA 4GBQA 5GANd 1URCB 4LD6A 4DBFA 3TNWB 1YIJQ 3WVEB 4JLIA 5LJ3e 5AT1B 2E4HA 4BCMB 3Q1JA 3PIOA 1H24B 4AG2C 4JPBW 2RO0A 4C92B 4EMGA 3M57A 2OI3A 1M90C 2EQKA 5IT9E 4IIMA 2JOYA 4JJNK 2QDLA 1W2BP 1OGUB 3TNIB 1VQ5T 4BCQD 3JCMJ 4HNUA 2DL4A 4RUGA 2PMIB 3CQTA 4BCNB 2MMPA 2CZ7B 3OYIA 1MGQA 2KK4A 1I07A 2QDJA 4RCBA 1MUZA 5HBJB 5GAN3 5GMKl 1UUEA 2B8AA 3S3NA 1NJIC 3EFSA 2K6DA 5CQYA 5CVIA 3EAEA 5FRNA 3ZBDA 2MWOA 1QMCA 1VQMT 1GXIE 1D09B 2ZPEB 3FJPA 2IN3A 2FPDA 1X69A 3CCUA 1TG0A 3V8KA 1QVGA 1WHGA 1N9RA 5GAN7 5CEIB 1XNIA 2VB6A 2ATCB 1HD3A 1VQ4A 2XHCA 4MIMA 3KHIA 4IIOA 3LGFA 1R8OB 3I55A 4B9WA 3VS4A 3QWYA 1IHWA 2RHUA 3OBYA 1NPRA 2YRDA 3OYKA 2DX1A 1P92A 4RTTA 3OYDA 1BYMA 3TSZA 1K0SA 1N8RU 1H1PB 4M7AC 3THKA 5HBEB 2FHDA 1UGPB 5HK0A 2OTLA 1W1FA 4QQDA 4C8QD 5GAMd 4C8QF 5KYYB 2KXCA 5KYWB 2KRSA 5HQ0B 4OP0A 3OW2S 1A0NB 3VRYA 4V2SA 2P0KA 2QASA 1FYNA 2EFIA 2CP3A 3EG9A 4ORZA 3DLLA 1MNDA 2RJEA 3DDPB 1TXQA 5CQXA 1Q81R 1OEBA 4OGCA 1PWTA 4HT8A 3LYIA 1ZBJA 1NJIU 3VU3C 3X25B 2NUPB 2QYZA 1IREB 4JUVA 3RKXA 4M77G 4EMKC 4E47A 3E19A 1VQPQ 2O01E 3CD6T 2RH2A 2DEUA 4KH1B 4M7DA 3KFVA 4FYXB 4N4HA 2DL5A 4CFMB 2EQUA 3PTAA 1V1CA 1ZQ1A 2L0AA 2CH4A 4ME7A 1VQNA 2W99A 2MCNA 1QWFA 1H1QB 4MZTA 3LW5E 2QGFB 3O0GD 1BCOA 2CP2A 4AFZC 3MY1B 3RUXA 1WQWA 4WTOB 2A3LA 4G6LB 1AWOA 1YITQ 4FYYB 1PNJA 2FEIA 4LDWA 1KXUA 3BDLA 1XOVA 2L3QA 2LQ8A 2RI3A 2M16A 3L42A 3JCMf 5GAMj 1VQ7A 2QEXT 4FT4A 2W9FA 4PJLA 1WXBA 4M75B 2JTEA 4KH0B 2RJDA 1Q86U 5CKFA 5GANe 3CCRA 1AWJA 1JJ2A 1QCFA 3QJYA 4F7UG 2HD0A 1RLPC 4HVVA 1H92A 1YI2T 2K2MA 2HKNA 2CCIB 1JXOA 1YWPA 2XK0A 4C0DB 2RK2A 3MP1A 2X4JA 3QYBA 1KQ1A 1VQ7Q 4J7IA 4WF2A 4F7UB 3FC3A 2ZCFB 4EOQB 3BLRB 1C6VX 2J6FA 4M78A 4HLQA 1JRIA 4XU3A 5KYXB 3LH5A 4N4GA 2CGHA 5J39A 4LDVA 1GL5A 4M75G 4ELZC 1O9KB 1K1ZA 2L3PA 3TCJA 3MEWA 1UJYA 2NUPA 3WXMB 2EJ9A 2I53A 3CCJA 1JKWA 4XTZA 1EIFA 1ZX6A 1U1TA 2K3BA 2LZ6B 4GLKA 2EPDA 3GOXA 1OU9A 2MI6A 4RMOA 2L2PA 5GMKh 1HSQA 1WX6A 3NDQA 4Y28E 4R0KA 3M56A 4JDSA 1KQSS 4OR5B 3G4SA 2CCHB 2RNAA 1OX8A 4BI3A 5GANh 4KGVB 4M77B 3V8LA 2GTJA 2D0NA 2VYTA 3DB3A 3JCMb 2K2VA 3CD6A 3EH1A 2RK1A 3MEUA 2DD5A 2LQKA 1UB4A 3P8HA 4BCOB 3RGFB 1SHGA 5EG2A 1M3CA 1UGRB 4B6MA 1IZ6A 4J6YA 4ELJA 3HKSA 3OYYA 3TVTA 1AHJB 3G4SQ 1ARKA 3CCSQ 2GBQA 2DMEA 1R0BG 2RI5A 5KYUA 1XQHA 2PU9B 2OX7A 3KUFA 3EHQA 4ANJA 1ZBXA 3CCJT 1LOJA 1D1AA 3HHTB 1H4LD 5CKEA 4PNOA 2VUBA 3QSUA 2QI2A 2DBKA 2KI7A 9ATCB 4C8QC 2RQUA 2C0IA 4AG1C 4R56A 3M0TA 3KBGA 1YCYA 1YJNQ 5GMKe 2IVWA 2K4YA 2DKGA 2COYA 3QXEB 3MO8A 1SSHA 3GIBA 3MEAA 3ZFJA 3CCLT 3H8ZA 1ZP2A 2HL3A 4HKEA 2M51A 1M1FA 1PCXA 4C8QA 5GMKm 2I2LA 3CMET 2GNCA 1VYWB 1SSFA 4Y72B 1OZ2A 4J6XA 4KRTA 2JXBA 2G6FX 1VIEA 2KE9A 2PVDB 4R55A 1VQ7T 2X4XA 4MMKA 1K73C 3MCAB 4LUEA 4BI8B 3JCMd 4QW2A 4OGEA 1J3TA 1MHNA 3LH0A 4JRIA 3CCRT 2OTJQ 1T3SA 5GAOn 1M27C 3M55A 4OMLA 3CPFA 1KD1R 5IXFA 1YIJT 1PRMC 1BB9A 3I5RA 5LJ5f 2RPNA 1M2VA 1RL2A 3NGPA 3TEEA 5I5ZB 2HQXA 5IN1A 3O5ZA 4AKHA 2H3EB 2CS7A 1SHFA 4M75E 2DE0X 1Y57A 5HBHB 2RHIA 3M59A 1RAHB 3VS7A 3FEOA 2L3SA 2DXTA 3POMA 2PTKA 2A08A 1GUXB 3CMEA 2E1HA 1H26B 5KYWA 2F1LA 2EYQA 2Y4YA 4RKUE 4J8OA 2YUNA 3DLMA 4FT2A 4MZMA 4AI6A 3HRUA 3L1AA 2R7GA 5DLQE 3H0HA 2WEVB 1M1KC 3OSVA 1WFWA 4J9EA 3DDQB 1LJOA 1RI0A 1B34B 1NPPA 2RB6A 1VQPT 1M1GA 2KBTA 1X6GA 1NM7A 2RQRA 3VV0A 1OI1A 3GLXA 2PK9B 1WIEA 1PM3A 1VQOQ 1JSUB 3CC4A 3AT1B 3BLHB 4ZNXA 4BI4A 3BG5A 2WSFE 4M78F 1PHTA 3NPFA 1D0XA 5HKCA 2A28A 1YJ9Q 1E6HA 1IGUA 2MIOA 2X1NB 4I3ZB 1VQ5Q 3H0FA 1VQKQ 2LCCA 2P0QA 4EOIB 4C8QG 2LP5A 4ATOA 3I56Q 1EZZB 2O4XA 5LJ5d 5GAN6 1H1RB 3NFCA 5HCKA 1Z9ZA 1VQ8Q 3M58A 4EOKB 3EOCB 2R5AA 3BHUB 2UZLB 2C0TA 1SKUB 1X01A 5KYXA 4M75F 3MEVA 5AYFA 2KMTA 1RAAB 2GCXA 5ICPB 3JB9G 1RI9A 3RESA 2ZPIB 4ZTFA 1H28B 2OAUA 3C0CA 3HRTA 4CXAB 3M53A 1TS9A 2DPPB 1SF9A 2EQIA 2LNHB 1VIFA 3VS5A 1X6OA 2J7IA 1GY3B 3VS1A 3CCMT 4RG2A 3UA7A 4E7JA 4FSXA 4NSTB 2BUDA 1WHKA 5LJ3j 2QQ8A 1H25B 3VS0A 5KE2A 2CYZB 2PZ1A 3ZL7C 1WQ7A 1JB0E 3I55T 4LDXA 1VYTA 2KDSA 2DBMA 1RAFB 4Z02A 1YFNA 2RI2A 4HCBA 2E3IA 3OW2P 1X2KA 2RHZA 2RD1A 1UFFA 1E7PA 2HZYA 2KVQG 3REAB 4X9DA 3CCQA 4CFVB 4L59A 4M78G 3BHTB 3QHRB 2K3YA 4MDXA 2QEXA 3E9FA 5A0LA 4EMHA 2DFUA 2GFUA 5KYNA 1TTHB 3G33B 1QKXA 3ASKA 2A36A 1ZA2B 1YWOA 1K73U 1Y0MA 1ABQA 4N4IA 2O88A 4II1A 2DM1A 2QQ9A 3MP6A 5GAOl 2QF7A 2QA4Q 1B7TA 1ZSGA 3L2VA 3M5AA 2QEXQ 5CR2A 4E7IA 1WA7A 2BKDN 3JCMh 3G71Q 3DKMA 2ESWA 2AZSA 5CKBA 4A4GA 4PJMA 1UE9A 2MYSA 2K7AA 1B34A 4J6WA 2WMBB 1TUGB 2FB7A 4PJOG 3HBLA 1KSWA 4OMPA 3JCMg 3EGDA 4M78E 2HSEB 2OAWA 4IKFA 3GTMS 2CT4A 1ZSZB 1Q81C 2E70A 4BCQB 2CREA 2DILA 3HFOA 3QBYA 2M02A 4J9DA 4MFDA 3EG3A 3CC7Q 5GANj 4RG8A 4AT1B 2CUBA 1N4MA 4ZGDB 3J7AF 2F2XA 3PO3S 3DJBA 3PMIA 1H3ZA 4J5YA 5GMKj 2KRMA 4CC7A 3V8JA 2JTMA 4EC8B 2W9ZA 4M77E 1M2VB 2JW4A 1GBQA 3EG9B 2LC4A 4BD3A 1WHMA 2F69A 3HO8A 2UZDB 2FRWA 3M54A 2AK5A 3EG2A 1AZEA 4A63B 1FX7A 1ZSZA 2V1QA 1RABB 4HA8A 3SDZA 4C0FA 4HL4A 3ME9A 2WXVB 4F04B 1IB8A 1K9MU 4BUGA 2AIRB 4JLGA 1AVZC 3LLRA 2XKOC 4DBRA 1YJWQ 1ZA1B 1U5SA 2WMAB 1RLQC 4AKGA 2AT1B 2WIPB 3HTRA 4M78D 2BZYA 4JS5A 2XI9A 4OGRB 1M5Q1 3JCMX 4PKCC 2X9HA 2OJ2A 3HB9A 5LJ3f 4HVWA 2MF2A 2H8HA 5IF1B 4X34A 1OKVB 4CFUD 4XK8E 4JRQA 3LX7A 2R58A 3HPWA 3MPUB 3UWNA 1WI7A 4J9CA 1YIJA 2UZEB 1S72A 4M78C 1WJSA 1AISB 3T9NA 3SEMA 4UC4A 3CCMA 2YHTA 3JAME 3GP8A 4ZGEB 1H8KA 2DMOA 1P5EB 4HNVA 3OW2A 3VS3A 2AKKA 2EKOA 1K9MR 2DO3A 1YI2A 1M1KU 2IVXA 2P84A 3GNFB 4LDUA 1U8RA 2FRYA 1KC8R 4IMYB 1JQQA 4FM4B 1C9BA 5L23A 1OPKA 3RMQA 4JX4A 4OB0B 1Y71A 2FL7A 3RR6A 2XU8A 4CRIA 4J9HA 1WJRA 1QLBA 5IHNA 2E5KA 1VQMQ 1M90R 1CKAA 5D6XA 2K3XA 2C5OB 4F14A 1GBRA 4NS5A 1PD0A 1YI2Q 3P8DA 5BNJB 1SEMA 3ULRB 1N27A 3QPHA 3UF4A 5GJWB 2CZ6B 3JCMQ 4AFQC 2FZGB 1Q82R 3MIAB 2RJCA 1KHCA 4PK4A 3CXCS 1W2BA 2ZZDB 1T3LA 2E65A 4DA4A 3INZA 3RDVA 1TSFA 2PVGB 2QFZA 1ZUKA 1VINA 3MY5B 4C5IA 1RADB 1X43A 5IDPB 2OTLT 3EGXA 2JGZB 2V22B 4C5EA
chains in the Genus database with same CATH topology
4BBRM 4QQGA 1N8RC 4QVDA 1AHJB 4C0GA 2DEQA 2G3RA 4BE2A 1QVPA 3O8VA 2GF7A 1KG1A 2V8KA 2LT4A 3OYEA 4BDYA 1S72T 2YLCA 2RI5A 1XQHA 2PU9B 5GAN4 5FU7C 3KUFA 4A4HA 1ZBXA 3JCMP 4NC6A 4PJOD 2D9TA 2VV5A 4MZPA 4KUDK 3CCJT 1LOJA 3HHTB 4C0DC 1X75C 3MP8A 5LJ3h 5CKEA 2QQBA 2V8IA 4PNOA 2VUBA 5KCOA 3OS2A 3QSUA 3QZ5B 4C92E 4EPCA 2QI2A 4XTXA 2K5FA 4VUBA 4OB3B 2M0OA 2O4XB 1KD1C 4C8QC 3JB9H 1JJ2S 2K5IA 5CCAA 1YJ9T 3NTIA 4JX5A 4R56A 4PJOF 2YRVA 2XIDA 3KBGA 1YCYA 5GMKe 1TH7A 2IVWA 2K4YA 2ZPHB 2DKGA 3C4SA 3CEYA 3QYEA 1YJWT 4XU2A 4OB2B 3I56T 1YHQT 3QXEB 3MO8A 1UGSB 2L3RA 2PUOB 4KULA 4C92D 2XICA 3CCVT 3OYFA 2XD0A 5HK3A 3HP9A 1K9MC 3OBWA 4XU0A 3GIBA 1QVFS 3PFSA 2X4WA 3TU4K 4M77F 3X26B 3M4GA 3MEAA 3ZFJA 3CCLT 2RA2A 3H8ZA 3VYGA 4HKEA 3VJPA 3SD4A 4GY5A 2DXCA 1M1FA 2Y4XA 5GAOm 5CKDA 1VQLT 4PJOC 4C8QA 3X20B 3A5ZB 4B9XA 1D3BA 2I2LA 4C5EA 5GMKm 3OA6A 3CMET 2LNVA 2JTFA 3MHXA 4M75A 2C06A 2E6ZA 3QWLA 1LNXA 1SSFA 2DXCB 2QDYB 1BI0A 4A4EA 1OZ2A 4J6XA 5KCHA 1VQNT 2XDBA 4M7DC 2ZPGB 1VIEA 2PVDB 4R55A 3OB9A 1VQ7T 2X4XA 3BW1A 4MMKA 2QA4A 2DZCA 1K73C 1VQKT 3LWIA 3MCAB 4BI8B 5C6SA 1I81A 2PQWA 4QVCA 3OYGA 3JCMd 3VYHB 4QW2A 4OGEA 2DZ9A 3HSBA 4C8QB 1I8FA 2F5TX 1M9SA 1MHNA 3LH0A 4JRIA 3CCRT 5GAOn 2R57A 3M55A 3CPFA 3N5BB 1G3WA 2GQVA 4XU1A 3QJ6A 4M78B 1JBMA 3URGA 4RCCA 4TVRA 1YIJT 3JSCA 5CKHA 2QA4T 3PIPA 4JRPA 1KC8U 1Q81U 5GAMg 4BE1A 3OMGA 4F7UA 5LJ5f 4M7DD 2L8DA 4IUQA 1G3SA 2DTHA 1I5LA 1RL2A 3G71T 3TEEA 1OZ3A 4A53A 5GAMf 2HQXA 3PGGA 5IN1A 1WPYA 5GMKi 3OS0A 2JNGA 4J83A 4XTUA 4F7UE 4BB7A 3G4ST 3CC4T 4AKHA 3CCST 4BACA 2CS7A 2ZGWA 2PUKB 4M75E 3A8HB 2Y90A 4FL6A 2ZPBB 2VGMA 2RHIA 2P4TA 3M59A 4DQ2A 4BDZA 3CMAT 3V7CA 3FEOA 2DXTA 3CMEA 3FLGA 2E1HA 2BS3A 1VQLA 4LOCA 2EYQA 2RHYA 4L5GA 4M7DF 2JN0A 2HQEA 2Y4YA 3H6ZA 4RKUE 5I2MA 3SWNB 4C5GA 4J8OA 3OYHA 3DLMA 3C95A 4FT2A 4MZMA 4MFEA 3TW7A 5CAIA 3J81E 1QVFA 4AI6A 2DXUA 4OB1B 5D6WA 1PSEA 1UGQB 3PNWC 3QDRB 5GAN5 3HRUA 2D6FA 5CK9A 2BS2A 3L1AA 5DLQE 2V8JA 5I21A 1FXXA 3OYBA 3RKWA 2ZZDA 3A8GB 1M1KC 2KR6A 3OSVA 2R5MA 4OF1A 1VQ6T 2DD4A 1H641 4MDWA 1LJOA 3JB9J 1RI0A 3JRZA 1B34B 1NPPA 2RB6A 3G71A 1M1GA 1VQPT 3L2RA 4FU6A 2DD5B 5FLXE 3CCVA 3QUIA 4E7KA 3VV0A 1QP3A 5GANf 3E1SA 4ZN1A 3JCMc 3ZEHA 2EAYA 2G77A 2M1HA 3HL8A 1Q82U 1OI1A 3RERA 4NL2A 4X9CA 4QQ6A 2XG8D 3GLXA 2L5QA 3S6WA 1VQKA 4C8QE 3G6ET 2MWPA 3A8MB 3A8OB 2PVOB 1Y96B 3CC4A 3QKJA 5GAN8 1BIAA 4MMLA 4BI4A 2E64A 3FIFA 3BG5A 2WSFE 4M78F 4N0AA 4IUVA 5HKCA 4ZTJA 4NOYA 1Q86C 3OYJA 2CZ1B 3DL1A 3JCMV 1PSFA 4IUUA 1M4ZA 2WJ9A 1VQ9A 2DAQA 3NTKA 4Q5WA 5KH6A 5GAOp 3M9QA 3S3MA 5I2SA 1K8AC 5LJ5j 2LCCA 3V7RA 2P0QA 4C8QG 2EQJA 4C92G 4ATOA 3QYGB 2ZPFB 1QP2A 2MAMA 4ZN3A 2OTJT 1DJ7B 3GNGA 2O4XA 4OMFB 5LJ5d 1VQMA 1VQ6A 5GAN6 3NFCA 1VQOA 5GANd 3QG1A 3M58A 4LD6A 2BIVA 2L89A 3A8LB 4Y91A 1YJNA 3FRNA 2R5AA 3WVEB 4JLIA 5LJ3e 4A4KA 5LL6S 3VUBA 1X01A 3Q1JA 4M75F 3MEVA 3PIOA 4M7AD 4NL3A 5AYFA 2RO0A 2KMTA 3V7SA 4C92B 4HT9A 2GCXA 2A7YA 4F7UF 1Y96A 4PLLA 3RESA 2ZPIB 3M57A 4EMGA 2DIQA 4ZTFA 2OAUA 2DXBA 3CC2A 2VXFA 4A4FA 3HRTA 3M53A 5CO7A 2DVEA 1VQOT 5J3BA 3VKGA 2EQKA 3CBOA 3OS5A 3OY9A 5IT9E 3LWHA 2DPPB 2LX9A 1QVGS 1VIFA 3L2UA 5LJ5g 2JOYA 5L8RE 5FU6C 2EQMA 1X6OA 1M90U 2LDMA 4JJNK 3CCMT 4RG2A 4E7JA 2QTXA 4FIBA 5LJ3d 4FSXA 2BUDA 1VQ5T 5LJ3j 2CZ0B 2QQ8A 4HNUA 2H3JA 3JCMJ 5KE2A 1YBYA 5HY6A 3JB9I 1W4SA 2CYZB 3CCET 1WQ7A 3GPLA 1JB0E 5FRMA 3I55T 2X4YA 4LDXA 2MMPA 1G3TA 2CZ7B 3OYIA 1MGQA 2KK4A 4HCZA 3L2WA 2KQWA 2KDSA 2QDJA 4RCBA 2VXEA 4JX6A 2QXFA 4Z02A 2RI2A 5GAN3 4D6WA 5GMKl 3SWNA 1VQPA 2KMGA 2B8AA 3S3NA 1Q7YU 3CCUT 1NJIC 3CC7T 4HCBA 3CXCA 1W2BS 3EFSA 2RHZA 2DIGA 2RD1A 3OYMA 5CQYA 5CVIA 3EAEA 1E7PA 5FRNA 3TW6A 3ZBDA 3S3OA 2MWOA 4M7AA 2F5KA 1VQMT 2EIFA 2KVQG 1GXIE 1BI1A 4X9DA 2ZPEB 2KSSA 3CCQA 4HNTA 2LT1A 2LVMA 3FJPA 3HZJA 4L59A 4M78G 2DTOA 3CCUA 4M77C 2K3YA 4MDXA 2QEXA 1KC8C 4PL6A 2DTIA 4O6JA 3E9FA 4ZGJB 2E41A 4M75D 1VQ9T 4M7AF 5A0LA 3V8KA 4EMHA 1QVGA 2GFUA 1N9RA 1Q82C 3ASKA 2WACA 5A0DA 3LGLA 4OVAA 5GAN7 1K8AU 4PJOB 1XNIA 2QQRA 3G7ZA 4BY6B 5GAOr 1G3YA 4KT0E 1VQ5A 3X28B 1VQ4A 1K73U 4N4IA 4II1A 3OS1A 1WJQA 3OYCA 2XHCA 4MIMA 3HRSA 4EMKB 2QQ9A 3MP6A 3KHIA 5LJ3g 3LGFA 1R8OB 4XAXB 4B9WA 5GAOl 3I55A 4IURA 1M90C 2QF7A 2E6NA 3TREA 2RHUA 3L2VA 3OBYA 3M5AA 4E7IA 1NPRA 5CR2A 4PJOA 3OYKA 2BKDN 1YJWA 4N0AC 1M8VA 2EJFA 3JB9D 2VGNA 4E7LA 3JB9F 3JCMh 2AHJB 1P92A 3DKMA 3OYDA 1BYMA 3QHSA 3CCQT 5CKBA 2NLUA 1VUBA 4YTLA 3M4YA 3RIRA 4A4GA 1N8RU 4M7AC 2K5LA 4JRKA 3UPUA 2GFAA 5FU6B 2RHXA 4M77A 2FHDA 1UGPB 1B34A 3GF5A 4J6WA 5HK0A 2OTLA 5KE3A 1KQ2A 1HK9A 4C92A 3F70A 4QQDA 4C8QD 5GAMd 4C8QF 4DOWA 2FB7A 3DB4A 4PJOG 3JCMW 3OSSC 3HBLA 4OP0A 3JCMg 3OW2S 1Y07A 4XTWA 4M78E 4V2SA 2P0KA 4HCCA 2EFIA 1KD1U 3DLLA 4IKFA 5M9OA 2RJEA 3P8BB 5CQXA 5LJ5h 2DK3A 4KBMB 4OGCA 3G6EA 1U1SA 1YITT 1Q81C 4HT8A 2E70A 3LYIA 1Q7YC 3VU3C 1NJIU 4L6V5 3X25B 3SWNC 4BE0A 1IREB 3HFOA 3OQ5A 1FKMA 4JUVA 4M77G 3RKXA 4EMKC 3KXTA 2HAXA 3QBYA 4E47A 4PJOE 2E5QA 3L2QA 4IUTA 4MFDA 3E19A 2O01E 3CD6T 4M7DE 5GANj 4Z6YA 2RH2A 2X35A 4RG8A 4XQ3A 3VUZA 4C0ZA 1BI2A 2IG0A 5D6YA 4M7DB 4ZGDB 3J7AF 4M7DA 3PMIA 3CCSA 2VC8A 4J5YA 5GMKj 4N4HA 1H3ZA 3QO3A 3V8JA 2JTMA 2EQUA 4M77E 4ME7A 1ZQ1A 4M7AB 2XDDA 3PTAA 1VQNA 5DLOA 2LC4A 4BD3A 2EJGA 3C12A 3CMAA 2F69A 4M7DG 4MZTA 4XTVA 3LW5E 3HO8A 1ZHIA 4LDYA 5GAMe 3M54A 4BY6C 3CBPA 2DJZA 4P5NA 5C0MA 3CCLA 3OYLA 3SFMA 1FX7A 1I4K1 3BY7A 2DD4B 1Y7XA 4HA8A 3RUXA 3SDZA 4HL4A 1WQWA 3E9GA 3UT1A 3ME9A 5FROA 1WGSA 4C0FA 5EJCA 1K9MU 1KHIA 2A3LA 4BUGA 2CKKA 4M75C 3EFRA 3FB9A 4JLGA 4LDWA 3BDLA 1XOVA 1D3BB 4QVZA 4DOVA 1KQSA 3LLRA 5IAYA 2LQ8A 2XKOC 2RI3A 4M77D 3H4CA 2M16A 3L42A 3JCMf 5GAMj 5GAN2 1YJ9A 4LD9K 4AKGA 3AHUA 4M78D 3VYGB 1VQ8T 3VKIA 4JS5A 1VQ7A 2M9UA 2XI9A 3BG9A 1M5Q1 3JCMX 2QEXT 4FT4A 4PKCC 1QW1A 3HB9A 5LJ5e 5LJ3f 1YITA 3HFNA 4M75B 2LTOA 2MF2A 2JVVA 2RJDA 3R6OA 4X34A 1Q86U 2E10A 5CKFA 4ELYC 5GANe 3CCRA 5GANg 1JJ2A 2HNIA 4XK8E 3WVDB 3LX7A 3UDCA 3CPWS 2K57A 2DXBB 4JRQA 1VQ4T 3QJYA 2JZ2A 2R58A 2HD0A 4F7UG 3HPWA 1O9SA 3UWNA 3QIIA 4A54A 1VQ8A 1YI2T 2HBPA 1YIJA 1S72A 4C5HA 2YLBA 4M78C 3RKYA 1WJSA 3BG3A 3T9NA 2FVUA 4C92C 2XK0A 3X24B 4AKIA 2YHTA 3CBMA 4UC4A 2RK2A 3MP1A 2RM4A 4C0DB 3CCMA 3JAME 1N9SA 2X4JA 3GP8A 4ZGEB 1UEBA 3QYBA 4BBSM 1KQ1A 1O75A 2RJFA 4J7IA 4CI0C 4WF2A 1NE8A 4HNVA 1N6AA 3PMTA 5DY9A 4F7UB 3FC3A 3OW2A 1YJNT 4C92F 2LRQA 2QQAA 2ZCFB 4QSHA 2EKOA 5DM7R 1G5VA 4PLIA 1XTDA 5GAOq 2DO3A 4M78A 1YI2A 4HLQA 1M1KU 1JRIA 4XU3A 4JS4A 2QQSA 2KY9A 1BIBA 1BI3A 2CGHA 4N4GA 5CIUA 3SB2A 3GNFB 4LDUA 1U8RA 5GAMh 1HXDA 3ER0A 3OMCA 3PT9A 2KAFA 5J26A 2D0QB 5J39A 4FM4B 4J7FA 4LDVA 4JX4A 3RMQA 5A2QE 4OB0B 1Y71A 2FL7A 3C94A 4M75G 1WNLA 2XU8A 4ELZC 3CCEA 3CPWA 3TCJA 4CRIA 3MEWA 3J80E 4EDUA 3I56A 1NZ9A 1YHQA 3WXMB 4M6VA 2EJ9A 1WJRA 4IUPA 2WSEE 3CCJA 1QLBA 4M7AE 2BS4A 4XTZA 1EIFA 1V29B 3BDUA 1U1TA 1FWZA 5D6XA 2K3XA 4O5VA 3FDRA 2FYKA 2JUFA 3CC2T 3OYNA 2LCLA 4GLKA 3JB9G 4XTYA 2MI6A 3L2ZA 4NS5A 2WSCE 4RMOA 3GOXA 3P8DA 3NTHA 4E7HA 5GMKh 3RMSA 3VKHA 1N27A 3QZ9B 3QPHA 2CZ6B 4Y28E 3OYAA 1OYXA 1BKBA 3M56A 4JDSA 3JCMQ 1KQSS 3G4SA 3QYHB 4BI3A 3BFMA 2OTJA 4M7AG 3META 5GANh 2P0PA 1KHCA 2RJCA 3CXCS 4M77B 2ZZDB 3V8LA 2E65A 1W2BA 4DA4A 2VYTA 3INZA 3DB3A 5A0GA 3JCMe 3JCMb 2PVGB 2K2VA 2EWNA 3CD6A 2QFZA 4EMKA 2RK1A 2XDPA 3MEUA 2DD5A 2LQKA 1UB4A 4C5IA 4KUIA 2E12A 3P8HA 5EG2A 5FU7B 3CC7A 1UGRB 2OTLT 1IZ6A 4J6YA 4ELJA 3HKSA 3OYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AHJ B;  4RKU E;  2DD4 B;  1GXI E;  2ZPE B;  2PU9 B;  4OB1 B;  1PSE A;  1UGQ B;  3HHT B;  2ZZD A;  3A8G B;  4ZGJ B;  2DD4 A;  3QZ5 B;  3VYG B;  4OB3 B;  2DD5 B;  1QP3 A;  4KT0 E;  3X28 B;  4XK8 E;  3WVD B;  2ZPH B;  2DXB B;  3A8M B;  3A8O B;  2PVO B;  4OB2 B;  3QXE B;  1UGS B;  2PUO B;  2WSF E;  3X24 B;  2CZ1 B;  1PSF A;  4ZGE B;  3X26 B;  2AHJ B;  3VYG A;  2DXC A;  2ZCF B;  3X20 B;  3QYG B;  2ZPF B;  1QP2 A;  2DXC B;  2QDY B;  1DJ7 B;  2ZPG B;  1UGP B;  2D0Q B;  2PVD B;  4FM4 B;  4OB0 B;  3WVE B;  2WSE E;  3VYH B;  2ZPI B;  1V29 B;  2DXB A;  2DPP B;  2WSC E;  4L6V 5;  3X25 B;  5L8R E;  1IRE B;  4Y28 E;  3QZ9 B;  2CZ6 B;  3QYH B;  2O01 E;  2CZ0 B;  2ZZD B;  2CYZ B;  1JB0 E;  2PVG B;  4ZGD B;  2CZ7 B;  2PUK B;  3A8H B;  2DD5 A;  2ZPB B;  1UGR B;  3LW5 E;  3A8L B; 
#chains in the Genus database with same CATH topology
 1K8A R;  2GF7 A;  2X51 A;  2LT4 A;  4BDY A;  2YDL A;  2CT3 A;  5FU7 C;  4E6R A;  3CMA Q;  2VV5 A;  1X75 C;  4RTW A;  2QQB A;  2LQN A;  5KCO A;  4PFO A;  3EFO A;  4VUB A;  4JJB A;  3JB9 H;  2K5I A;  1MMG A;  5GJV B;  3NTI A;  1IRX A;  1D0Y A;  3CEY A;  4LN2 A;  3QYE A;  1M8M A;  1YJW T;  4HVU A;  4OB2 B;  1YHQ T;  2PUO B;  1E9H B;  2RQT A;  2XD0 A;  5HK3 A;  4PFP A;  1D0Z A;  1QLY A;  2COW A;  1UG1 A;  4X1V A;  2Y4X A;  1PKT A;  5CKD A;  1VQL T;  2G9X B;  2UZB B;  3X20 B;  1SPK A;  2IPO B;  2JTF A;  3MHX A;  3CCJ Q;  2C06 A;  2E6Z A;  2XMF A;  4A4E A;  1YJN A;  1XJW B;  1WHH A;  2XDB A;  2ZPG B;  4CFN B;  2FZC B;  1VQK T;  2DYB A;  4CFU B;  1I81 A;  3RBB B;  2DZ9 A;  2ZAE A;  2R57 A;  1SG5 A;  4M78 B;  1JBM A;  3JSC A;  2QA4 T;  1KC8 U;  3PIP A;  1Q81 U;  4GLM A;  1GUX A;  4F7U A;  4M7D D;  4IUQ A;  1G3S A;  2DTH A;  3G71 T;  2C5N B;  1WPY A;  1H3H A;  4XTU A;  4J83 A;  4PFZ A;  3CCS T;  1GCQ C;  2YT6 A;  3A8H B;  2W10 A;  2ZPB B;  4BDZ A;  1GRI A;  1M1K R;  2O2O A;  3FLG A;  2J05 A;  3A1P A;  1BU2 A;  4L5G A;  4F17 A;  3EG0 A;  2O9S A;  2JN0 A;  2HQE A;  2KRN A;  3OYH A;  2E3H A;  3C95 A;  2EBP A;  5CAI A;  1FIN B;  4OB1 B;  2KR3 A;  5I11 A;  4YOS A;  1WXT A;  2V8J A;  1AD5 A;  2R5M A;  3JB9 J;  1H64 1;  5IHY A;  4BXX X;  3SHW A;  3G71 A;  4RTZ A;  3EHR A;  5EC7 A;  5FLX E;  4OMO A;  4J9I A;  1QP3 A;  5GAN f;  4ZN1 A;  3JCM c;  3ZEH A;  2EAY A;  2G77 A;  2M1H A;  2NUT A;  1Q82 U;  5ECA A;  4M4Z A;  1WHL A;  4X9C A;  2L5Q A;  1EFN A;  4C8Q E;  2MWP A;  3A8O B;  2CDT A;  3EGU A;  1KIK A;  2ECZ A;  5GAN 8;  5FGK B;  2RF0 A;  4N0A A;  1JST B;  4NOY A;  1O9K A;  1X2Q A;  2CZ1 B;  3DL1 A;  4QKU A;  2W2H A;  2WJ9 A;  1M4Z A;  1VQ9 A;  4Q5W A;  5KH6 A;  2RMO A;  2FO0 A;  2KT1 A;  3V7R A;  1YHQ Q;  3M0Q A;  3CCR Q;  1UHF A;  2OTJ T;  1VQ6 A;  1IXD A;  2IW9 B;  1VQO A;  3QG1 A;  3PVQ A;  2L89 A;  1AOJ A;  4OMN A;  4A4K A;  5LL6 S;  2WFY B;  3VUB A;  5KYY A;  1Q95 G;  4M7A D;  3IQL A;  3V7S A;  3CD6 Q;  4F7U F;  3QWX X;  2HKQ B;  2VXF A;  4A4F A;  2DVE A;  1VQO T;  3VKG A;  3CBO A;  3OS5 A;  1QVG S;  3LWH A;  3L2U A;  5LJ5 g;  2DER A;  4DEX A;  2QTX A;  5LJ3 d;  1K4U S;  4PJJ A;  3R6N A;  1YBY A;  2DJQ A;  3CCE T;  1PKS A;  1NYF A;  2X4Y A;  1G3T A;  3L2W A;  4HCZ A;  2YUQ A;  1R77 A;  1K73 R;  2VXE A;  4DBQ A;  4JX6 A;  2QXF A;  1LCK A;  2V26 A;  4D6W A;  1ZUY A;  2KMG A;  3CC7 T;  4ROE A;  3CCU T;  2GQI A;  1YNZ A;  3CXC A;  1W2B S;  3OYM A;  1OUL A;  3D7S B;  3TW6 A;  2JM8 A;  1PKD B;  2CP5 A;  1BI1 A;  2KSS A;  2EW3 A;  1W98 B;  1PC0 A;  3HZJ A;  2PJQ A;  2RN8 A;  2DTO A;  4M77 C;  2QK0 A;  1BCM A;  2SEM A;  1KC8 C;  4PL6 A;  1UTI A;  4O6J A;  4ZGJ B;  2E41 A;  3H9N A;  1VQ9 T;  4M7A F;  1T0J A;  5A0D A;  1Q7Y R;  1CKB A;  2QQR A;  3G7Z A;  2D8H A;  1GFC A;  5EFQ B;  3M0R A;  5GAO r;  1G3Y A;  4KT0 E;  3CPW P;  1VQ5 A;  3X28 B;  3F5X B;  4BCG B;  2EYZ A;  1ZLM A;  2D8J A;  1KJW A;  3MKD A;  3HRS A;  4EMK B;  4Y92 A;  4IUR A;  4EOS B;  2GGR A;  2VVK A;  2KXD A;  3TRE A;  2DVJ A;  1TD6 A;  3EH2 A;  2EJF A;  4E7L A;  3JB9 F;  2LJ1 A;  1NG2 A;  3QHS A;  3CCQ T;  3RIR A;  4YTL A;  3M4Y A;  1OIU B;  2EYW A;  3G6E Q;  3TN8 B;  5FU6 B;  4M77 A;  1VYU A;  5KE3 A;  1KQ2 A;  4C92 A;  3B57 A;  1C0M A;  4DOW A;  3JCM W;  2ED0 A;  3CCM Q;  4CFX B;  4FCY A;  4XTW A;  2WHB B;  1AWX A;  2DLP A;  4PJN A;  4LE9 A;  3G6E A;  1N8R R;  1B07 A;  3SWN C;  1WHJ A;  1FKM A;  1TU0 B;  2HAX A;  3KXT A;  4PJO E;  1VQ6 Q;  2YUO A;  3L2Q A;  2CP6 A;  1ZUU A;  4IUT A;  2EGA A;  4AFU C;  2FG0 A;  4M7D E;  3VS2 A;  3M0U A;  3RNJ A;  2X35 A;  4XQ3 A;  1BI2 A;  1VQL Q;  4M7D B;  1JEG A;  2VC8 A;  2XDD A;  1NEG A;  2J6K A;  4BCN D;  1XO2 A;  5DLO A;  2KT8 A;  1V76 A;  4XTV A;  4LDY A;  5GAM e;  4BY6 C;  4P5N A;  3CCL A;  3OYL A;  1I4K 1;  2DD4 B;  4QT7 A;  5FRO A;  1WGS A;  1KHI A;  1UJ0 A;  4M75 C;  2Z0W A;  3I9Q A;  4QVZ A;  4DOV A;  1KQS A;  1OPL A;  5IAY A;  4LD9 K;  5GAN 2;  1YJ9 A;  1VQ8 T;  3VKI A;  3BG9 A;  2BPM B;  1MMA A;  2LTO A;  2JVV A;  3R6O A;  3CCL Q;  2E10 A;  2HNI A;  3WVD B;  4PJO D;  3UDC A;  1VQ4 T;  1O9S A;  4A54 A;  2LQW A;  4J9B A;  2YLB A;  4C92 C;  3OA6 A;  4AKI A;  2RM4 A;  1R0C B;  3UA6 A;  1UEB A;  4BBS M;  4CI0 C;  2RJF A;  5DY9 A;  1NE8 A;  2LX7 A;  3PMT A;  1OL2 B;  2QQA A;  2IW8 B;  5DM7 R;  1WLP B;  3VS6 A;  2RQW A;  2COZ A;  3I55 Q;  5GAO q;  1RUW A;  2F2V A;  2KY9 A;  5CIU A;  5GAM h;  3PT9 A;  2KAF A;  2RQV A;  4RTV A;  5IH2 A;  3C94 A;  2A37 A;  1JU5 C;  1WNL A;  3CPW A;  2YWW A;  3J80 E;  4EDU A;  3I56 A;  1NZ9 A;  4M6V A;  4IUP A;  2WSE E;  4M7A E;  3CXC P;  2BS4 A;  3VRZ A;  4F6U B;  1MMN A;  2X3W D;  1FWZ A;  4O5V A;  3FDR A;  2FYK A;  2JUF A;  3OYN A;  2LCL A;  3EG1 A;  3L2Z A;  1K0X A;  3NTH A;  4E7H A;  2HQH A;  4E7Z A;  1JXM A;  1GCQ A;  2O9V A;  4F7S B;  3BFM A;  5FWC A;  2ABL A;  1OOT A;  2P0P A;  2YSQ A;  2WPA B;  3JCM e;  1ACM B;  1FMV A;  2EWN A;  4EMK A;  1M2O A;  2XDP A;  2BTT A;  4RTX A;  2E12 A;  2FPF A;  1QMZ B;  3CC7 A;  1VOM A;  3A8L B;  2BIV A;  4BBR M;  4QQG A;  4QVD A;  2DEQ A;  1GFD A;  2G3R A;  4BE2 A;  1QVP A;  2JM9 A;  3O8V A;  1KG1 A;  2QG9 B;  2X3X D;  3OYE A;  1S1N A;  2YLC A;  3JCM P;  4FYV B;  4K11 A;  4MZP A;  2IW6 B;  4JZ4 A;  1D1B A;  2CJM B;  4EON B;  5LJ3 h;  4F7N B;  3OS2 A;  2K5F A;  3H41 A;  4OB3 B;  2I40 B;  2M0O A;  1KD1 C;  1QVF P;  1JJ2 S;  2BE7 D;  5CCA A;  1YJ9 T;  4JX5 A;  4BCI B;  2NWM A;  2YRV A;  2XID A;  2SRC A;  3QDF A;  4UN0 A;  5IHK A;  3C4S A;  3I56 T;  3NMZ C;  1UGS B;  3CCU Q;  4KUL A;  2XIC A;  3CCV T;  3OYF A;  3HP9 A;  1K9M C;  4XU0 A;  1QVF S;  3PFS A;  3TU4 K;  4M77 F;  4HCK A;  3VJP A;  3SD4 A;  2BZX A;  2DXC A;  1AD6 A;  5GAO m;  4PJO C;  2CP7 A;  4B9X A;  2DA9 A;  4LXC A;  3QWL A;  1BI0 A;  3GBQ A;  4TTH A;  5KCH A;  1VQN T;  4M7D C;  1OI9 B;  1M3A A;  3OB9 A;  1KQS P;  1KFZ A;  4BCP B;  3BW1 A;  3LWI A;  5C6S A;  1SRM A;  2PQW A;  3OYG A;  1FMW A;  1QWE A;  4C8Q B;  1I8F A;  2F5T X;  1M9S A;  3I35 A;  1EX4 A;  3QJ6 A;  1RAG B;  4TVR A;  2DL7 A;  1TOV A;  4BY7 X;  5GAM g;  3EFO B;  1QKW A;  2OTL Q;  2YXY A;  1M3B A;  2L8D A;  1C1A A;  4A53 A;  5GAM f;  1OKW B;  2UUE B;  4CFW B;  4EC9 B;  2O31 A;  3OS0 A;  3CC4 T;  2PUK B;  2MK5 A;  2HCK A;  4FL6 A;  2LMJ A;  3CMA T;  3V7C A;  4LOC A;  2RHY A;  2W96 A;  3H6Z A;  4C5G A;  4EOO B;  4MFE A;  3TW7 A;  1QVF A;  2HBW A;  2DXU A;  5D6W A;  1PSE A;  1UGQ B;  3PNW C;  2D6F A;  1OL1 B;  5CK9 A;  1SRL A;  2I0N A;  3EGD B;  4F6S B;  4ELL A;  1QQJ A;  1FXX A;  2ZZD A;  3A8G B;  2KR6 A;  5DQW A;  4OF1 A;  1VQ6 T;  5IHI A;  1FVV B;  2HDA A;  1K76 A;  4FU6 A;  2DD5 B;  4E7K A;  1W6X A;  1N5Z A;  3HL8 A;  3RER A;  4NL2 A;  4KRC B;  1VQK A;  3A8M B;  2PVO B;  1Y96 B;  4Z89 A;  1JJ2 P;  2E64 A;  4IUV A;  4ZTJ A;  1Q86 C;  2DYI A;  3OYJ A;  3JCM V;  1PSF A;  2DAQ A;  5GAO p;  5LJ5 j;  3CCE Q;  2C4G B;  2ZPF B;  2MAM A;  4ZN3 A;  2C5X B;  5HNB B;  1NBE B;  4OMF B;  4AMC A;  2VAS A;  5KYU B;  3BHV B;  2PNI A;  4Y91 A;  3FRN A;  2PHG A;  1CSK A;  4NL3 A;  1PD1 A;  4HT9 A;  2A7Y A;  1Y96 A;  4PLL A;  5D7U A;  2DIQ A;  2CP0 A;  1F5Q B;  2DXB A;  3CC2 A;  5CO7 A;  5J3B A;  3OY9 A;  2LX9 A;  1QVG P;  2DF6 A;  5L8R E;  5FU6 C;  2EQM A;  1UHC A;  1M90 U;  2LDM A;  4FIB A;  4D8D A;  2CZ0 B;  2H3J A;  1OU8 A;  5CYI B;  3TNH B;  5HY6 A;  2EKH A;  3JB9 I;  1W4S A;  4EIK A;  1WDX A;  3GPL A;  5FRM A;  2A0F B;  2NUT B;  2KQW A;  1GH6 B;  2DRM A;  2HSP A;  3SWN A;  1VQP A;  2CH4 W;  1Q7Y U;  1E6G A;  1OQK A;  2NUZ A;  4FW1 A;  2QTV A;  2CSQ A;  2DIG A;  3S3O A;  4M7A A;  1Z9Q A;  2F5K A;  2EIF A;  3G1J A;  2KRO A;  4HNT A;  4Z8A A;  2LT1 A;  2LVM A;  1G2B A;  2NYS A;  3PE0 A;  5I22 A;  2DTI A;  2KEA A;  4M75 D;  1VA7 A;  2P4R A;  1Q82 C;  2WAC A;  4LUD A;  1OIY B;  4ROD A;  2C0O A;  3LGL A;  4OVA A;  4E2F B;  1K8A U;  4JJD A;  4BY6 B;  2DRK A;  1TUD A;  1HJD A;  1Q86 R;  3TQ7 P;  4Z88 A;  8AT1 B;  2MOX A;  3OS1 A;  1WJQ A;  3UAT A;  3OYC A;  4BCH B;  1LPL A;  5LJ3 g;  1RAE B;  4XAX B;  1TWB A;  7AT1 B;  2E6N A;  2AKL A;  2W0Z A;  4PJO A;  1YJW A;  4WCI A;  3H0I A;  4N0A C;  1M8V A;  1ABO A;  1ENW A;  2VGN A;  3JB9 D;  1RAC B;  2AHJ B;  2YRC A;  2NLU A;  1VUB A;  2GTO A;  2K5L A;  4JRK A;  3UPU A;  2GFA A;  2VWF A;  1TFB A;  1UDL A;  2RHX A;  1K9A A;  3CC2 Q;  3GF5 A;  1ZSZ C;  1VQ9 Q;  1HK9 A;  2C6T B;  2FZK B;  3F70 A;  3DB4 A;  3OSS C;  1KK7 A;  3E2U A;  4EOJ B;  1Y07 A;  4HCC A;  2JMA A;  1KD1 U;  1M30 A;  2K79 A;  5M9O A;  3P8B B;  5LJ5 h;  2DK3 A;  4KBM B;  1U1S A;  3PVL A;  1YIT T;  5LQF B;  1Q7Y C;  2LJ0 A;  2JJ9 A;  4L6V 5;  4BE0 A;  1OV3 A;  2ROL A;  3OQ5 A;  2KNB B;  2LCS A;  2E5Q A;  3EJ1 B;  1UEC A;  2EVR A;  4Z6Y A;  3CCQ Q;  1PRL C;  3VUZ A;  4YC3 B;  4C0Z A;  2HMA A;  2IG0 A;  1MV0 B;  5D6Y A;  5IXB A;  1F1B B;  4J9G A;  3CCS A;  1NYG A;  1VOL A;  3QO3 A;  4BCM D;  4M7A B;  2QGG A;  2EJG A;  2PK2 A;  3C12 A;  3CMA A;  4M7D G;  2B9R A;  5IDN B;  1ZHI A;  2ENM A;  3CBP A;  2DJZ A;  1IO6 A;  5C0M A;  3SFM A;  2LW4 A;  1GCP A;  3BY7 A;  1Y7X A;  3UT1 A;  3E9G A;  5EJC A;  2CKK A;  3EFR A;  3FB9 A;  1D3B B;  2DET A;  4M77 D;  3H4C A;  2VKN A;  6AT1 B;  1IHV A;  3AHU A;  3VYG B;  2M9U A;  1QW1 A;  2CSI A;  5LJ5 e;  1YIT A;  3HFN A;  2JMC A;  1NLO C;  4ELY C;  2FPE A;  2F2W A;  5GAN g;  1YP5 A;  3CPW S;  4E7S A;  2DXB B;  2K57 A;  2JZ2 A;  4LNP A;  4EOM B;  3QII A;  1VQ8 A;  1IGQ A;  2HBP A;  1G3N C;  4C5H A;  2J06 A;  3RKY A;  3BG3 A;  2FVU A;  3X24 B;  3CBM A;  1G83 A;  4OMQ A;  1N9S A;  1O75 A;  4KRD B;  4CC4 B;  1N6A A;  1YJN T;  4C92 F;  2LRQ A;  1G5V A;  4QSH A;  5L2W B;  4EOL B;  4PLI A;  1XTD A;  2CUD A;  4JS4 A;  2QQS A;  4JZ3 A;  1BIB A;  1BI3 A;  2LJ3 A;  4ROC A;  3SB2 A;  1BK2 A;  2HEQ A;  1HXD A;  3ER0 A;  3OMC A;  5J26 A;  2D0Q B;  4J7F A;  5A2Q E;  3U23 A;  5FW9 A;  4D8K A;  3CCE A;  1AT1 B;  2V1R A;  1YHQ A;  2DNU A;  1BU1 A;  3EGX B;  1QCO A;  2DL3 A;  1V29 B;  2B86 A;  3BDU A;  2ED1 A;  1VQN Q;  3CC2 T;  2EYX A;  4XTY A;  2WSC E;  5DQV A;  3BE3 A;  3RMS A;  3VKH A;  3QZ9 B;  4EOP B;  3OYA A;  2EUF A;  1BKB A;  1OYX A;  4DBH A;  2D1X A;  5FWB A;  3QYH B;  1BBZ A;  2OTJ A;  4M7A G;  4F16 A;  3MET A;  5A0G A;  2BKZ B;  3NHN A;  1QCN A;  4FSS A;  4KUI A;  5FU7 B;  1LVK A;  1D1C A;  3REB B;  1U3O A;  3CCV Q;  1UGV A;  4PJO B;  1N8R C;  4C0G A;  2EGC A;  4ESR A;  1YCS B;  3TSW A;  3M0P A;  2V8K A;  1AZG B;  4RTU A;  1S72 T;  3EID B;  5GAN 4;  4A4H A;  2K9G A;  4NC6 A;  3CME Q;  2D9T A;  4KUD K;  1I1J A;  4C0D C;  3MP8 A;  1VQ4 Q;  2V8I A;  1VYV A;  3QZ5 B;  4C92 E;  4EPC A;  2KGT A;  4XTX A;  2O4X B;  2JS0 A;  1JOW A;  2J6O A;  4J9F A;  4PJO F;  2F2C A;  1JO8 A;  1TH7 A;  1YN8 A;  2ZPH B;  1T0H A;  1OX9 A;  4XU2 A;  1B3Q A;  2L3R A;  2HL5 C;  4KGZ B;  2WIH B;  4YOO A;  3OBW A;  1H1S B;  2X4W A;  3X26 B;  3M4G A;  2RA2 A;  3VYG A;  4GY5 A;  3K7A M;  3A5Z B;  3CC4 Q;  1D3B A;  4EOR B;  2LNV A;  4M75 A;  1LNX A;  3M03 A;  2DXC B;  2QDY B;  4F7J B;  3MI9 B;  2BE9 B;  4AFS C;  1X27 A;  3LQ5 B;  5HVY B;  2QA4 A;  2DZC A;  3FJ5 A;  4BCJ B;  2ROT A;  4QVC A;  1I5O B;  4HXJ A;  3JV3 A;  3HSB A;  3VYH B;  1W70 A;  2C5V B;  3A98 A;  1NJI R;  2KYM A;  3N5B B;  4C92 D;  1G3W A;  2GQV A;  4XU1 A;  2EGE A;  3URG A;  4BCK B;  4RCC A;  2BZ8 A;  2M0Y A;  4FW2 A;  5CKH A;  4JRP A;  8ATC B;  4F6W B;  4BCF B;  4BE1 A;  3OMG A;  1TUC A;  1I5L A;  4CC2 A;  1OZ3 A;  4DEY A;  1HYO A;  1WYX A;  3PGG A;  5GMK i;  4OMM A;  2JS2 A;  2JNG A;  4F7U E;  4BB7 A;  3G4S T;  3DTO A;  4BAC A;  2ZGW A;  2DL8 A;  4KGX B;  4RTY A;  5LMK B;  2Y90 A;  2VGM A;  2YUP A;  1E7O A;  4CRL B;  2P4T A;  4DQ2 A;  1MNE A;  1WZO A;  2JT4 A;  2BS3 A;  4FYW B;  1VQL A;  4JJC A;  2EYY A;  4M7D F;  1NLP C;  2IIM A;  3SWN B;  1H27 B;  5I2M A;  1UNG D;  1WXU A;  3J81 E;  3DOG B;  4II5 B;  5GAN 5;  3QDR B;  2BS2 A;  1I0C A;  1PG5 B;  1UNL D;  5I21 A;  1G8X A;  3OYB A;  3RKW A;  3M0S A;  2QGS A;  1RAI B;  2DD4 A;  1FMK A;  1U06 A;  3I5S A;  4MDW A;  3JRZ A;  4F7L B;  1MMD A;  3L2R A;  1S72 Q;  1UNH D;  3CCV A;  1MV3 A;  3QUI A;  1AEY A;  1D3U B;  3E1S A;  4QQ6 A;  2XG8 D;  3S6W A;  5ACB A;  3G6E T;  2MPX C;  3QKJ A;  1BIA A;  4MML A;  3FIF A;  4BY1 X;  4IUU A;  1AWW A;  4YOZ A;  3MJX A;  3NTK A;  3BLQ B;  1NEB A;  2AZV A;  3M9Q A;  3S3M A;  5I2S A;  1K8A C;  4F70 B;  2EQJ A;  4C92 G;  3QYG B;  1QP2 A;  4FX3 B;  4CC3 A;  2KYB A;  3QHW B;  1DJ7 B;  3GNG A;  2QAZ A;  1VQM A;  1X6B A;  4GBQ A;  5GAN d;  1URC B;  4LD6 A;  4DBF A;  3TNW B;  1YIJ Q;  3WVE B;  4JLI A;  5LJ3 e;  5AT1 B;  2E4H A;  4BCM B;  3Q1J A;  3PIO A;  1H24 B;  4AG2 C;  4JPB W;  2RO0 A;  4C92 B;  4EMG A;  3M57 A;  2OI3 A;  1M90 C;  2EQK A;  5IT9 E;  4IIM A;  2JOY A;  4JJN K;  2QDL A;  1W2B P;  1OGU B;  3TNI B;  1VQ5 T;  4BCQ D;  3JCM J;  4HNU A;  2DL4 A;  4RUG A;  2PMI B;  3CQT A;  4BCN B;  2MMP A;  2CZ7 B;  3OYI A;  1MGQ A;  2KK4 A;  1I07 A;  2QDJ A;  4RCB A;  1MUZ A;  5HBJ B;  5GAN 3;  5GMK l;  1UUE A;  2B8A A;  3S3N A;  1NJI C;  3EFS A;  2K6D A;  5CQY A;  5CVI A;  3EAE A;  5FRN A;  3ZBD A;  2MWO A;  1QMC A;  1VQM T;  1GXI E;  1D09 B;  2ZPE B;  3FJP A;  2IN3 A;  2FPD A;  1X69 A;  3CCU A;  1TG0 A;  3V8K A;  1QVG A;  1WHG A;  1N9R A;  5GAN 7;  5CEI B;  1XNI A;  2VB6 A;  2ATC B;  1HD3 A;  1VQ4 A;  2XHC A;  4MIM A;  3KHI A;  4IIO A;  3LGF A;  1R8O B;  3I55 A;  4B9W A;  3VS4 A;  3QWY A;  1IHW A;  2RHU A;  3OBY A;  1NPR A;  2YRD A;  3OYK A;  2DX1 A;  1P92 A;  4RTT A;  3OYD A;  1BYM A;  3TSZ A;  1K0S A;  1N8R U;  1H1P B;  4M7A C;  3THK A;  5HBE B;  2FHD A;  1UGP B;  5HK0 A;  2OTL A;  1W1F A;  4QQD A;  4C8Q D;  5GAM d;  4C8Q F;  5KYY B;  2KXC A;  5KYW B;  2KRS A;  5HQ0 B;  4OP0 A;  3OW2 S;  1A0N B;  3VRY A;  4V2S A;  2P0K A;  2QAS A;  1FYN A;  2EFI A;  2CP3 A;  3EG9 A;  4ORZ A;  3DLL A;  1MND A;  2RJE A;  3DDP B;  1TXQ A;  5CQX A;  1Q81 R;  1OEB A;  4OGC A;  1PWT A;  4HT8 A;  3LYI A;  1ZBJ A;  1NJI U;  3VU3 C;  3X25 B;  2NUP B;  2QYZ A;  1IRE B;  4JUV A;  3RKX A;  4M77 G;  4EMK C;  4E47 A;  3E19 A;  1VQP Q;  2O01 E;  3CD6 T;  2RH2 A;  2DEU A;  4KH1 B;  4M7D A;  3KFV A;  4FYX B;  4N4H A;  2DL5 A;  4CFM B;  2EQU A;  3PTA A;  1V1C A;  1ZQ1 A;  2L0A A;  2CH4 A;  4ME7 A;  1VQN A;  2W99 A;  2MCN A;  1QWF A;  1H1Q B;  4MZT A;  3LW5 E;  2QGF B;  3O0G D;  1BCO A;  2CP2 A;  4AFZ C;  3MY1 B;  3RUX A;  1WQW A;  4WTO B;  2A3L A;  4G6L B;  1AWO A;  1YIT Q;  4FYY B;  1PNJ A;  2FEI A;  4LDW A;  1KXU A;  3BDL A;  1XOV A;  2L3Q A;  2LQ8 A;  2RI3 A;  2M16 A;  3L42 A;  3JCM f;  5GAM j;  1VQ7 A;  2QEX T;  4FT4 A;  2W9F A;  4PJL A;  1WXB A;  4M75 B;  2JTE A;  4KH0 B;  2RJD A;  1Q86 U;  5CKF A;  5GAN e;  3CCR A;  1AWJ A;  1JJ2 A;  1QCF A;  3QJY A;  4F7U G;  2HD0 A;  1RLP C;  4HVV A;  1H92 A;  1YI2 T;  2K2M A;  2HKN A;  2CCI B;  1JXO A;  1YWP A;  2XK0 A;  4C0D B;  2RK2 A;  3MP1 A;  2X4J A;  3QYB A;  1KQ1 A;  1VQ7 Q;  4J7I A;  4WF2 A;  4F7U B;  3FC3 A;  2ZCF B;  4EOQ B;  3BLR B;  1C6V X;  2J6F A;  4M78 A;  4HLQ A;  1JRI A;  4XU3 A;  5KYX B;  3LH5 A;  4N4G A;  2CGH A;  5J39 A;  4LDV A;  1GL5 A;  4M75 G;  4ELZ C;  1O9K B;  1K1Z A;  2L3P A;  3TCJ A;  3MEW A;  1UJY A;  2NUP A;  3WXM B;  2EJ9 A;  2I53 A;  3CCJ A;  1JKW A;  4XTZ A;  1EIF A;  1ZX6 A;  1U1T A;  2K3B A;  2LZ6 B;  4GLK A;  2EPD A;  3GOX A;  1OU9 A;  2MI6 A;  4RMO A;  2L2P A;  5GMK h;  1HSQ A;  1WX6 A;  3NDQ A;  4Y28 E;  4R0K A;  3M56 A;  4JDS A;  1KQS S;  4OR5 B;  3G4S A;  2CCH B;  2RNA A;  1OX8 A;  4BI3 A;  5GAN h;  4KGV B;  4M77 B;  3V8L A;  2GTJ A;  2D0N A;  2VYT A;  3DB3 A;  3JCM b;  2K2V A;  3CD6 A;  3EH1 A;  2RK1 A;  3MEU A;  2DD5 A;  2LQK A;  1UB4 A;  3P8H A;  4BCO B;  3RGF B;  1SHG A;  5EG2 A;  1M3C A;  1UGR B;  4B6M A;  1IZ6 A;  4J6Y A;  4ELJ A;  3HKS A;  3OYY A;  3TVT A;  1AHJ B;  3G4S Q;  1ARK A;  3CCS Q;  2GBQ A;  2DME A;  1R0B G;  2RI5 A;  5KYU A;  1XQH A;  2PU9 B;  2OX7 A;  3KUF A;  3EHQ A;  4ANJ A;  1ZBX A;  3CCJ T;  1LOJ A;  1D1A A;  3HHT B;  1H4L D;  5CKE A;  4PNO A;  2VUB A;  3QSU A;  2QI2 A;  2DBK A;  2KI7 A;  9ATC B;  4C8Q C;  2RQU A;  2C0I A;  4AG1 C;  4R56 A;  3M0T A;  3KBG A;  1YCY A;  1YJN Q;  5GMK e;  2IVW A;  2K4Y A;  2DKG A;  2COY A;  3QXE B;  3MO8 A;  1SSH A;  3GIB A;  3MEA A;  3ZFJ A;  3CCL T;  3H8Z A;  1ZP2 A;  2HL3 A;  4HKE A;  2M51 A;  1M1F A;  1PCX A;  4C8Q A;  5GMK m;  2I2L A;  3CME T;  2GNC A;  1VYW B;  1SSF A;  4Y72 B;  1OZ2 A;  4J6X A;  4KRT A;  2JXB A;  2G6F X;  1VIE A;  2KE9 A;  2PVD B;  4R55 A;  1VQ7 T;  2X4X A;  4MMK A;  1K73 C;  3MCA B;  4LUE A;  4BI8 B;  3JCM d;  4QW2 A;  4OGE A;  1J3T A;  1MHN A;  3LH0 A;  4JRI A;  3CCR T;  2OTJ Q;  1T3S A;  5GAO n;  1M27 C;  3M55 A;  4OML A;  3CPF A;  1KD1 R;  5IXF A;  1YIJ T;  1PRM C;  1BB9 A;  3I5R A;  5LJ5 f;  2RPN A;  1M2V A;  1RL2 A;  3NGP A;  3TEE A;  5I5Z B;  2HQX A;  5IN1 A;  3O5Z A;  4AKH A;  2H3E B;  2CS7 A;  1SHF A;  4M75 E;  2DE0 X;  1Y57 A;  5HBH B;  2RHI A;  3M59 A;  1RAH B;  3VS7 A;  3FEO A;  2L3S A;  2DXT A;  3POM A;  2PTK A;  2A08 A;  1GUX B;  3CME A;  2E1H A;  1H26 B;  5KYW A;  2F1L A;  2EYQ A;  2Y4Y A;  4RKU E;  4J8O A;  2YUN A;  3DLM A;  4FT2 A;  4MZM A;  4AI6 A;  3HRU A;  3L1A A;  2R7G A;  5DLQ E;  3H0H A;  2WEV B;  1M1K C;  3OSV A;  1WFW A;  4J9E A;  3DDQ B;  1LJO A;  1RI0 A;  1B34 B;  1NPP A;  2RB6 A;  1VQP T;  1M1G A;  2KBT A;  1X6G A;  1NM7 A;  2RQR A;  3VV0 A;  1OI1 A;  3GLX A;  2PK9 B;  1WIE A;  1PM3 A;  1VQO Q;  1JSU B;  3CC4 A;  3AT1 B;  3BLH B;  4ZNX A;  4BI4 A;  3BG5 A;  2WSF E;  4M78 F;  1PHT A;  3NPF A;  1D0X A;  5HKC A;  2A28 A;  1YJ9 Q;  1E6H A;  1IGU A;  2MIO A;  2X1N B;  4I3Z B;  1VQ5 Q;  3H0F A;  1VQK Q;  2LCC A;  2P0Q A;  4EOI B;  4C8Q G;  2LP5 A;  4ATO A;  3I56 Q;  1EZZ B;  2O4X A;  5LJ5 d;  5GAN 6;  1H1R B;  3NFC A;  5HCK A;  1Z9Z A;  1VQ8 Q;  3M58 A;  4EOK B;  3EOC B;  2R5A A;  3BHU B;  2UZL B;  2C0T A;  1SKU B;  1X01 A;  5KYX A;  4M75 F;  3MEV A;  5AYF A;  2KMT A;  1RAA B;  2GCX A;  5ICP B;  3JB9 G;  1RI9 A;  3RES A;  2ZPI B;  4ZTF A;  1H28 B;  2OAU A;  3C0C A;  3HRT A;  4CXA B;  3M53 A;  1TS9 A;  2DPP B;  1SF9 A;  2EQI A;  2LNH B;  1VIF A;  3VS5 A;  1X6O A;  2J7I A;  1GY3 B;  3VS1 A;  3CCM T;  4RG2 A;  3UA7 A;  4E7J A;  4FSX A;  4NST B;  2BUD A;  1WHK A;  5LJ3 j;  2QQ8 A;  1H25 B;  3VS0 A;  5KE2 A;  2CYZ B;  2PZ1 A;  3ZL7 C;  1WQ7 A;  1JB0 E;  3I55 T;  4LDX A;  1VYT A;  2KDS A;  2DBM A;  1RAF B;  4Z02 A;  1YFN A;  2RI2 A;  4HCB A;  2E3I A;  3OW2 P;  1X2K A;  2RHZ A;  2RD1 A;  1UFF A;  1E7P A;  2HZY A;  2KVQ G;  3REA B;  4X9D A;  3CCQ A;  4CFV B;  4L59 A;  4M78 G;  3BHT B;  3QHR B;  2K3Y A;  4MDX A;  2QEX A;  3E9F A;  5A0L A;  4EMH A;  2DFU A;  2GFU A;  5KYN A;  1TTH B;  3G33 B;  1QKX A;  3ASK A;  2A36 A;  1ZA2 B;  1YWO A;  1K73 U;  1Y0M A;  1ABQ A;  4N4I A;  2O88 A;  4II1 A;  2DM1 A;  2QQ9 A;  3MP6 A;  5GAO l;  2QF7 A;  2QA4 Q;  1B7T A;  1ZSG A;  3L2V A;  3M5A A;  2QEX Q;  5CR2 A;  4E7I A;  1WA7 A;  2BKD N;  3JCM h;  3G71 Q;  3DKM A;  2ESW A;  2AZS A;  5CKB A;  4A4G A;  4PJM A;  1UE9 A;  2MYS A;  2K7A A;  1B34 A;  4J6W A;  2WMB B;  1TUG B;  2FB7 A;  4PJO G;  3HBL A;  1KSW A;  4OMP A;  3JCM g;  3EGD A;  4M78 E;  2HSE B;  2OAW A;  4IKF A;  3GTM S;  2CT4 A;  1ZSZ B;  1Q81 C;  2E70 A;  4BCQ B;  2CRE A;  2DIL A;  3HFO A;  3QBY A;  2M02 A;  4J9D A;  4MFD A;  3EG3 A;  3CC7 Q;  5GAN j;  4RG8 A;  4AT1 B;  2CUB A;  1N4M A;  4ZGD B;  3J7A F;  2F2X A;  3PO3 S;  3DJB A;  3PMI A;  1H3Z A;  4J5Y A;  5GMK j;  2KRM A;  4CC7 A;  3V8J A;  2JTM A;  4EC8 B;  2W9Z A;  4M77 E;  1M2V B;  2JW4 A;  1GBQ A;  3EG9 B;  2LC4 A;  4BD3 A;  1WHM A;  2F69 A;  3HO8 A;  2UZD B;  2FRW A;  3M54 A;  2AK5 A;  3EG2 A;  1AZE A;  4A63 B;  1FX7 A;  1ZSZ A;  2V1Q A;  1RAB B;  4HA8 A;  3SDZ A;  4C0F A;  4HL4 A;  3ME9 A;  2WXV B;  4F04 B;  1IB8 A;  1K9M U;  4BUG A;  2AIR B;  4JLG A;  1AVZ C;  3LLR A;  2XKO C;  4DBR A;  1YJW Q;  1ZA1 B;  1U5S A;  2WMA B;  1RLQ C;  4AKG A;  2AT1 B;  2WIP B;  3HTR A;  4M78 D;  2BZY A;  4JS5 A;  2XI9 A;  4OGR B;  1M5Q 1;  3JCM X;  4PKC C;  2X9H A;  2OJ2 A;  3HB9 A;  5LJ3 f;  4HVW A;  2MF2 A;  2H8H A;  5IF1 B;  4X34 A;  1OKV B;  4CFU D;  4XK8 E;  4JRQ A;  3LX7 A;  2R58 A;  3HPW A;  3MPU B;  3UWN A;  1WI7 A;  4J9C A;  1YIJ A;  2UZE B;  1S72 A;  4M78 C;  1WJS A;  1AIS B;  3T9N A;  3SEM A;  4UC4 A;  3CCM A;  2YHT A;  3JAM E;  3GP8 A;  4ZGE B;  1H8K A;  2DMO A;  1P5E B;  4HNV A;  3OW2 A;  3VS3 A;  2AKK A;  2EKO A;  1K9M R;  2DO3 A;  1YI2 A;  1M1K U;  2IVX A;  2P84 A;  3GNF B;  4LDU A;  1U8R A;  2FRY A;  1KC8 R;  4IMY B;  1JQQ A;  4FM4 B;  1C9B A;  5L23 A;  1OPK A;  3RMQ A;  4JX4 A;  4OB0 B;  1Y71 A;  2FL7 A;  3RR6 A;  2XU8 A;  4CRI A;  4J9H A;  1WJR A;  1QLB A;  5IHN A;  2E5K A;  1VQM Q;  1M90 R;  1CKA A;  5D6X A;  2K3X A;  2C5O B;  4F14 A;  1GBR A;  4NS5 A;  1PD0 A;  1YI2 Q;  3P8D A;  5BNJ B;  1SEM A;  3ULR B;  1N27 A;  3QPH A;  3UF4 A;  5GJW B;  2CZ6 B;  3JCM Q;  4AFQ C;  2FZG B;  1Q82 R;  3MIA B;  2RJC A;  1KHC A;  4PK4 A;  3CXC S;  1W2B A;  2ZZD B;  1T3L A;  2E65 A;  4DA4 A;  3INZ A;  3RDV A;  1TSF A;  2PVG B;  2QFZ A;  1ZUK A;  1VIN A;  3MY5 B;  4C5I A;  1RAD B;  1X43 A;  5IDP B;  2OTL T;  3EGX A;  2JGZ B;  2V22 B;  4C5E A; 
#chains in the Genus database with same CATH homology
 4BBR M;  4QQG A;  1N8R C;  4QVD A;  1AHJ B;  4C0G A;  2DEQ A;  2G3R A;  4BE2 A;  1QVP A;  3O8V A;  2GF7 A;  1KG1 A;  2V8K A;  2LT4 A;  3OYE A;  4BDY A;  1S72 T;  2YLC A;  2RI5 A;  1XQH A;  2PU9 B;  5GAN 4;  5FU7 C;  3KUF A;  4A4H A;  1ZBX A;  3JCM P;  4NC6 A;  4PJO D;  2D9T A;  2VV5 A;  4MZP A;  4KUD K;  3CCJ T;  1LOJ A;  3HHT B;  4C0D C;  1X75 C;  3MP8 A;  5LJ3 h;  5CKE A;  2QQB A;  2V8I A;  4PNO A;  2VUB A;  5KCO A;  3OS2 A;  3QSU A;  3QZ5 B;  4C92 E;  4EPC A;  2QI2 A;  4XTX A;  2K5F A;  4VUB A;  4OB3 B;  2M0O A;  2O4X B;  1KD1 C;  4C8Q C;  3JB9 H;  1JJ2 S;  2K5I A;  5CCA A;  1YJ9 T;  3NTI A;  4JX5 A;  4R56 A;  4PJO F;  2YRV A;  2XID A;  3KBG A;  1YCY A;  5GMK e;  1TH7 A;  2IVW A;  2K4Y A;  2ZPH B;  2DKG A;  3C4S A;  3CEY A;  3QYE A;  1YJW T;  4XU2 A;  4OB2 B;  3I56 T;  1YHQ T;  3QXE B;  3MO8 A;  1UGS B;  2L3R A;  2PUO B;  4KUL A;  4C92 D;  2XIC A;  3CCV T;  3OYF A;  2XD0 A;  5HK3 A;  3HP9 A;  1K9M C;  3OBW A;  4XU0 A;  3GIB A;  1QVF S;  3PFS A;  2X4W A;  3TU4 K;  4M77 F;  3X26 B;  3M4G A;  3MEA A;  3ZFJ A;  3CCL T;  2RA2 A;  3H8Z A;  3VYG A;  4HKE A;  3VJP A;  3SD4 A;  4GY5 A;  2DXC A;  1M1F A;  2Y4X A;  5GAO m;  5CKD A;  1VQL T;  4PJO C;  4C8Q A;  3X20 B;  3A5Z B;  4B9X A;  1D3B A;  2I2L A;  4C5E A;  5GMK m;  3OA6 A;  3CME T;  2LNV A;  2JTF A;  3MHX A;  4M75 A;  2C06 A;  2E6Z A;  3QWL A;  1LNX A;  1SSF A;  2DXC B;  2QDY B;  1BI0 A;  4A4E A;  1OZ2 A;  4J6X A;  5KCH A;  1VQN T;  2XDB A;  4M7D C;  2ZPG B;  1VIE A;  2PVD B;  4R55 A;  3OB9 A;  1VQ7 T;  2X4X A;  3BW1 A;  4MMK A;  2QA4 A;  2DZC A;  1K73 C;  1VQK T;  3LWI A;  3MCA B;  4BI8 B;  5C6S A;  1I81 A;  2PQW A;  4QVC A;  3OYG A;  3JCM d;  3VYH B;  4QW2 A;  4OGE A;  2DZ9 A;  3HSB A;  4C8Q B;  1I8F A;  2F5T X;  1M9S A;  1MHN A;  3LH0 A;  4JRI A;  3CCR T;  5GAO n;  2R57 A;  3M55 A;  3CPF A;  3N5B B;  1G3W A;  2GQV A;  4XU1 A;  3QJ6 A;  4M78 B;  1JBM A;  3URG A;  4RCC A;  4TVR A;  1YIJ T;  3JSC A;  5CKH A;  2QA4 T;  3PIP A;  4JRP A;  1KC8 U;  1Q81 U;  5GAM g;  4BE1 A;  3OMG A;  4F7U A;  5LJ5 f;  4M7D D;  2L8D A;  4IUQ A;  1G3S A;  2DTH A;  1I5L A;  1RL2 A;  3G71 T;  3TEE A;  1OZ3 A;  4A53 A;  5GAM f;  2HQX A;  3PGG A;  5IN1 A;  1WPY A;  5GMK i;  3OS0 A;  2JNG A;  4J83 A;  4XTU A;  4F7U E;  4BB7 A;  3G4S T;  3CC4 T;  4AKH A;  3CCS T;  4BAC A;  2CS7 A;  2ZGW A;  2PUK B;  4M75 E;  3A8H B;  2Y90 A;  4FL6 A;  2ZPB B;  2VGM A;  2RHI A;  2P4T A;  3M59 A;  4DQ2 A;  4BDZ A;  3CMA T;  3V7C A;  3FEO A;  2DXT A;  3CME A;  3FLG A;  2E1H A;  2BS3 A;  1VQL A;  4LOC A;  2EYQ A;  2RHY A;  4L5G A;  4M7D F;  2JN0 A;  2HQE A;  2Y4Y A;  3H6Z A;  4RKU E;  5I2M A;  3SWN B;  4C5G A;  4J8O A;  3OYH A;  3DLM A;  3C95 A;  4FT2 A;  4MZM A;  4MFE A;  3TW7 A;  5CAI A;  3J81 E;  1QVF A;  4AI6 A;  2DXU A;  4OB1 B;  5D6W A;  1PSE A;  1UGQ B;  3PNW C;  3QDR B;  5GAN 5;  3HRU A;  2D6F A;  5CK9 A;  2BS2 A;  3L1A A;  5DLQ E;  2V8J A;  5I21 A;  1FXX A;  3OYB A;  3RKW A;  2ZZD A;  3A8G B;  1M1K C;  2KR6 A;  3OSV A;  2R5M A;  4OF1 A;  1VQ6 T;  2DD4 A;  1H64 1;  4MDW A;  1LJO A;  3JB9 J;  1RI0 A;  3JRZ A;  1B34 B;  1NPP A;  2RB6 A;  3G71 A;  1M1G A;  1VQP T;  3L2R A;  4FU6 A;  2DD5 B;  5FLX E;  3CCV A;  3QUI A;  4E7K A;  3VV0 A;  1QP3 A;  5GAN f;  3E1S A;  4ZN1 A;  3JCM c;  3ZEH A;  2EAY A;  2G77 A;  2M1H A;  3HL8 A;  1Q82 U;  1OI1 A;  3RER A;  4NL2 A;  4X9C A;  4QQ6 A;  2XG8 D;  3GLX A;  2L5Q A;  3S6W A;  1VQK A;  4C8Q E;  3G6E T;  2MWP A;  3A8M B;  3A8O B;  2PVO B;  1Y96 B;  3CC4 A;  3QKJ A;  5GAN 8;  1BIA A;  4MML A;  4BI4 A;  2E64 A;  3FIF A;  3BG5 A;  2WSF E;  4M78 F;  4N0A A;  4IUV A;  5HKC A;  4ZTJ A;  4NOY A;  1Q86 C;  3OYJ A;  2CZ1 B;  3DL1 A;  3JCM V;  1PSF A;  4IUU A;  1M4Z A;  2WJ9 A;  1VQ9 A;  2DAQ A;  3NTK A;  4Q5W A;  5KH6 A;  5GAO p;  3M9Q A;  3S3M A;  5I2S A;  1K8A C;  5LJ5 j;  2LCC A;  3V7R A;  2P0Q A;  4C8Q G;  2EQJ A;  4C92 G;  4ATO A;  3QYG B;  2ZPF B;  1QP2 A;  2MAM A;  4ZN3 A;  2OTJ T;  1DJ7 B;  3GNG A;  2O4X A;  4OMF B;  5LJ5 d;  1VQM A;  1VQ6 A;  5GAN 6;  3NFC A;  1VQO A;  5GAN d;  3QG1 A;  3M58 A;  4LD6 A;  2BIV A;  2L89 A;  3A8L B;  4Y91 A;  1YJN A;  3FRN A;  2R5A A;  3WVE B;  4JLI A;  5LJ3 e;  4A4K A;  5LL6 S;  3VUB A;  1X01 A;  3Q1J A;  4M75 F;  3MEV A;  3PIO A;  4M7A D;  4NL3 A;  5AYF A;  2RO0 A;  2KMT A;  3V7S A;  4C92 B;  4HT9 A;  2GCX A;  2A7Y A;  4F7U F;  1Y96 A;  4PLL A;  3RES A;  2ZPI B;  3M57 A;  4EMG A;  2DIQ A;  4ZTF A;  2OAU A;  2DXB A;  3CC2 A;  2VXF A;  4A4F A;  3HRT A;  3M53 A;  5CO7 A;  2DVE A;  1VQO T;  5J3B A;  3VKG A;  2EQK A;  3CBO A;  3OS5 A;  3OY9 A;  5IT9 E;  3LWH A;  2DPP B;  2LX9 A;  1QVG S;  1VIF A;  3L2U A;  5LJ5 g;  2JOY A;  5L8R E;  5FU6 C;  2EQM A;  1X6O A;  1M90 U;  2LDM A;  4JJN K;  3CCM T;  4RG2 A;  4E7J A;  2QTX A;  4FIB A;  5LJ3 d;  4FSX A;  2BUD A;  1VQ5 T;  5LJ3 j;  2CZ0 B;  2QQ8 A;  4HNU A;  2H3J A;  3JCM J;  5KE2 A;  1YBY A;  5HY6 A;  3JB9 I;  1W4S A;  2CYZ B;  3CCE T;  1WQ7 A;  3GPL A;  1JB0 E;  5FRM A;  3I55 T;  2X4Y A;  4LDX A;  2MMP A;  1G3T A;  2CZ7 B;  3OYI A;  1MGQ A;  2KK4 A;  4HCZ A;  3L2W A;  2KQW A;  2KDS A;  2QDJ A;  4RCB A;  2VXE A;  4JX6 A;  2QXF A;  4Z02 A;  2RI2 A;  5GAN 3;  4D6W A;  5GMK l;  3SWN A;  1VQP A;  2KMG A;  2B8A A;  3S3N A;  1Q7Y U;  3CCU T;  1NJI C;  3CC7 T;  4HCB A;  3CXC A;  1W2B S;  3EFS A;  2RHZ A;  2DIG A;  2RD1 A;  3OYM A;  5CQY A;  5CVI A;  3EAE A;  1E7P A;  5FRN A;  3TW6 A;  3ZBD A;  3S3O A;  2MWO A;  4M7A A;  2F5K A;  1VQM T;  2EIF A;  2KVQ G;  1GXI E;  1BI1 A;  4X9D A;  2ZPE B;  2KSS A;  3CCQ A;  4HNT A;  2LT1 A;  2LVM A;  3FJP A;  3HZJ A;  4L59 A;  4M78 G;  2DTO A;  3CCU A;  4M77 C;  2K3Y A;  4MDX A;  2QEX A;  1KC8 C;  4PL6 A;  2DTI A;  4O6J A;  3E9F A;  4ZGJ B;  2E41 A;  4M75 D;  1VQ9 T;  4M7A F;  5A0L A;  3V8K A;  4EMH A;  1QVG A;  2GFU A;  1N9R A;  1Q82 C;  3ASK A;  2WAC A;  5A0D A;  3LGL A;  4OVA A;  5GAN 7;  1K8A U;  4PJO B;  1XNI A;  2QQR A;  3G7Z A;  4BY6 B;  5GAO r;  1G3Y A;  4KT0 E;  1VQ5 A;  3X28 B;  1VQ4 A;  1K73 U;  4N4I A;  4II1 A;  3OS1 A;  1WJQ A;  3OYC A;  2XHC A;  4MIM A;  3HRS A;  4EMK B;  2QQ9 A;  3MP6 A;  3KHI A;  5LJ3 g;  3LGF A;  1R8O B;  4XAX B;  4B9W A;  5GAO l;  3I55 A;  4IUR A;  1M90 C;  2QF7 A;  2E6N A;  3TRE A;  2RHU A;  3L2V A;  3OBY A;  3M5A A;  4E7I A;  1NPR A;  5CR2 A;  4PJO A;  3OYK A;  2BKD N;  1YJW A;  4N0A C;  1M8V A;  2EJF A;  3JB9 D;  2VGN A;  4E7L A;  3JB9 F;  3JCM h;  2AHJ B;  1P92 A;  3DKM A;  3OYD A;  1BYM A;  3QHS A;  3CCQ T;  5CKB A;  2NLU A;  1VUB A;  4YTL A;  3M4Y A;  3RIR A;  4A4G A;  1N8R U;  4M7A C;  2K5L A;  4JRK A;  3UPU A;  2GFA A;  5FU6 B;  2RHX A;  4M77 A;  2FHD A;  1UGP B;  1B34 A;  3GF5 A;  4J6W A;  5HK0 A;  2OTL A;  5KE3 A;  1KQ2 A;  1HK9 A;  4C92 A;  3F70 A;  4QQD A;  4C8Q D;  5GAM d;  4C8Q F;  4DOW A;  2FB7 A;  3DB4 A;  4PJO G;  3JCM W;  3OSS C;  3HBL A;  4OP0 A;  3JCM g;  3OW2 S;  1Y07 A;  4XTW A;  4M78 E;  4V2S A;  2P0K A;  4HCC A;  2EFI A;  1KD1 U;  3DLL A;  4IKF A;  5M9O A;  2RJE A;  3P8B B;  5CQX A;  5LJ5 h;  2DK3 A;  4KBM B;  4OGC A;  3G6E A;  1U1S A;  1YIT T;  1Q81 C;  4HT8 A;  2E70 A;  3LYI A;  1Q7Y C;  3VU3 C;  1NJI U;  4L6V 5;  3X25 B;  3SWN C;  4BE0 A;  1IRE B;  3HFO A;  3OQ5 A;  1FKM A;  4JUV A;  4M77 G;  3RKX A;  4EMK C;  3KXT A;  2HAX A;  3QBY A;  4E47 A;  4PJO E;  2E5Q A;  3L2Q A;  4IUT A;  4MFD A;  3E19 A;  2O01 E;  3CD6 T;  4M7D E;  5GAN j;  4Z6Y A;  2RH2 A;  2X35 A;  4RG8 A;  4XQ3 A;  3VUZ A;  4C0Z A;  1BI2 A;  2IG0 A;  5D6Y A;  4M7D B;  4ZGD B;  3J7A F;  4M7D A;  3PMI A;  3CCS A;  2VC8 A;  4J5Y A;  5GMK j;  4N4H A;  1H3Z A;  3QO3 A;  3V8J A;  2JTM A;  2EQU A;  4M77 E;  4ME7 A;  1ZQ1 A;  4M7A B;  2XDD A;  3PTA A;  1VQN A;  5DLO A;  2LC4 A;  4BD3 A;  2EJG A;  3C12 A;  3CMA A;  2F69 A;  4M7D G;  4MZT A;  4XTV A;  3LW5 E;  3HO8 A;  1ZHI A;  4LDY A;  5GAM e;  3M54 A;  4BY6 C;  3CBP A;  2DJZ A;  4P5N A;  5C0M A;  3CCL A;  3OYL A;  3SFM A;  1FX7 A;  1I4K 1;  3BY7 A;  2DD4 B;  1Y7X A;  4HA8 A;  3RUX A;  3SDZ A;  4HL4 A;  1WQW A;  3E9G A;  3UT1 A;  3ME9 A;  5FRO A;  1WGS A;  4C0F A;  5EJC A;  1K9M U;  1KHI A;  2A3L A;  4BUG A;  2CKK A;  4M75 C;  3EFR A;  3FB9 A;  4JLG A;  4LDW A;  3BDL A;  1XOV A;  1D3B B;  4QVZ A;  4DOV A;  1KQS A;  3LLR A;  5IAY A;  2LQ8 A;  2XKO C;  2RI3 A;  4M77 D;  3H4C A;  2M16 A;  3L42 A;  3JCM f;  5GAM j;  5GAN 2;  1YJ9 A;  4LD9 K;  4AKG A;  3AHU A;  4M78 D;  3VYG B;  1VQ8 T;  3VKI A;  4JS5 A;  1VQ7 A;  2M9U A;  2XI9 A;  3BG9 A;  1M5Q 1;  3JCM X;  2QEX T;  4FT4 A;  4PKC C;  1QW1 A;  3HB9 A;  5LJ5 e;  5LJ3 f;  1YIT A;  3HFN A;  4M75 B;  2LTO A;  2MF2 A;  2JVV A;  2RJD A;  3R6O A;  4X34 A;  1Q86 U;  2E10 A;  5CKF A;  4ELY C;  5GAN e;  3CCR A;  5GAN g;  1JJ2 A;  2HNI A;  4XK8 E;  3WVD B;  3LX7 A;  3UDC A;  3CPW S;  2K57 A;  2DXB B;  4JRQ A;  1VQ4 T;  3QJY A;  2JZ2 A;  2R58 A;  2HD0 A;  4F7U G;  3HPW A;  1O9S A;  3UWN A;  3QII A;  4A54 A;  1VQ8 A;  1YI2 T;  2HBP A;  1YIJ A;  1S72 A;  4C5H A;  2YLB A;  4M78 C;  3RKY A;  1WJS A;  3BG3 A;  3T9N A;  2FVU A;  4C92 C;  2XK0 A;  3X24 B;  4AKI A;  2YHT A;  3CBM A;  4UC4 A;  2RK2 A;  3MP1 A;  2RM4 A;  4C0D B;  3CCM A;  3JAM E;  1N9S A;  2X4J A;  3GP8 A;  4ZGE B;  1UEB A;  3QYB A;  4BBS M;  1KQ1 A;  1O75 A;  2RJF A;  4J7I A;  4CI0 C;  4WF2 A;  1NE8 A;  4HNV A;  1N6A A;  3PMT A;  5DY9 A;  4F7U B;  3FC3 A;  3OW2 A;  1YJN T;  4C92 F;  2LRQ A;  2QQA A;  2ZCF B;  4QSH A;  2EKO A;  5DM7 R;  1G5V A;  4PLI A;  1XTD A;  5GAO q;  2DO3 A;  4M78 A;  1YI2 A;  4HLQ A;  1M1K U;  1JRI A;  4XU3 A;  4JS4 A;  2QQS A;  2KY9 A;  1BIB A;  1BI3 A;  2CGH A;  4N4G A;  5CIU A;  3SB2 A;  3GNF B;  4LDU A;  1U8R A;  5GAM h;  1HXD A;  3ER0 A;  3OMC A;  3PT9 A;  2KAF A;  5J26 A;  2D0Q B;  5J39 A;  4FM4 B;  4J7F A;  4LDV A;  4JX4 A;  3RMQ A;  5A2Q E;  4OB0 B;  1Y71 A;  2FL7 A;  3C94 A;  4M75 G;  1WNL A;  2XU8 A;  4ELZ C;  3CCE A;  3CPW A;  3TCJ A;  4CRI A;  3MEW A;  3J80 E;  4EDU A;  3I56 A;  1NZ9 A;  1YHQ A;  3WXM B;  4M6V A;  2EJ9 A;  1WJR A;  4IUP A;  2WSE E;  3CCJ A;  1QLB A;  4M7A E;  2BS4 A;  4XTZ A;  1EIF A;  1V29 B;  3BDU A;  1U1T A;  1FWZ A;  5D6X A;  2K3X A;  4O5V A;  3FDR A;  2FYK A;  2JUF A;  3CC2 T;  3OYN A;  2LCL A;  4GLK A;  3JB9 G;  4XTY A;  2MI6 A;  3L2Z A;  4NS5 A;  2WSC E;  4RMO A;  3GOX A;  3P8D A;  3NTH A;  4E7H A;  5GMK h;  3RMS A;  3VKH A;  1N27 A;  3QZ9 B;  3QPH A;  2CZ6 B;  4Y28 E;  3OYA A;  1OYX A;  1BKB A;  3M56 A;  4JDS A;  3JCM Q;  1KQS S;  3G4S A;  3QYH B;  4BI3 A;  3BFM A;  2OTJ A;  4M7A G;  3MET A;  5GAN h;  2P0P A;  1KHC A;  2RJC A;  3CXC S;  4M77 B;  2ZZD B;  3V8L A;  2E65 A;  1W2B A;  4DA4 A;  2VYT A;  3INZ A;  3DB3 A;  5A0G A;  3JCM e;  3JCM b;  2PVG B;  2K2V A;  2EWN A;  3CD6 A;  2QFZ A;  4EMK A;  2RK1 A;  2XDP A;  3MEU A;  2DD5 A;  2LQK A;  1UB4 A;  4C5I A;  4KUI A;  2E12 A;  3P8H A;  5EG2 A;  5FU7 B;  3CC7 A;  1UGR B;  2OTL T;  1IZ6 A;  4J6Y A;  4ELJ A;  3HKS A;  3OYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...