2CZ0B

Photo-activation state of fe-type nhase in aerobic condition
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
211
structure length
211
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
molecule tags Lyase
publication title photo-activation state of Fe-type NHase in aerobic condition
rcsb
total genus 56
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2cz0B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cz0B02
2DD4A 4OB1B 2CYZB 1GXIE 2PUOB 2WSCE 1DJ7B 2DXBA 3WVEB 1UGPB 3QYHB 3HHTB 4ZGDB 4RKUE 2ZZDB 4OB0B 3A8LB 2PU9B 3QYGB 1V29B 2ZPIB 3X20B 3LW5E 2ZCFB 3X25B 2PUKB 4OB2B 2QDYB 3QZ5B 3A8OB 3QXEB 2PVDB 4L6V5 4FM4B 2WSFE 2ZPHB 3X28B 2ZZDA 2DXCA 1QP3A 4XK8E 1PSEA 2CZ7B 4ZGJB 2CZ0B 2DPPB 2D0QB 1UGSB 2PVOB 2DXCB 2ZPEB 3VYHB 2ZPBB 2AHJB 4ZGEB 2WSEE 3QZ9B 2O01E 1UGRB 4OB3B 2DXBB 4Y28E 5L8RE 2PVGB 2CZ6B 3X26B 2ZPFB 1UGQB 4KT0E 3A8MB 1AHJB 1PSFA 3VYGA 2DD5B 1JB0E 2DD5A 2CZ1B 3WVDB 3VYGB 1QP2A 3A8HB 3X24B 1IREB 3A8GB 2DD4B 2ZPGB
chains in the Genus database with same CATH superfamily
1GCQC 2VKNA 1Q86R 2RD1A 5GAOl 1D0YA 1R77A 2AIRB 5HBEB 1Q86C 2JTMA 3NDQA 2DBMA 2GFAA 1ENWA 1S1NA 2CP3A 2P0KA 4BI4A 1UGPB 1Q7YU 4BCHB 2K2VA 1M90R 1Z9ZA 2JTEA 5CCAA 3CCLA 1VQLA 1VYUA 2ZZDB 4PJLA 2EQIA 2G6FX 2C4GB 1X6GA 3A8LB 2FRYA 1VQ9A 1ZSZA 2EYYA 1LCKA 1B7TA 4AI6A 3MKDA 3M55A 2K7AA 2RQVA 3OYYA 3G4SQ 4AKGA 4XTXA 4I3ZB 1Q82C 3GOXA 1GFDA 4CFWB 3EGDA 2YRVA 2PVDB 1RL2A 5GANd 2HQXA 1YI2Q 4FSXA 2V26A 4RODA 2DXCA 2JMCA 2LP5A 4OMLA 4M78C 2QQRA 4ZGJB 2GNCA 2CUBA 3HP9A 4WCIA 2G77A 2MIOA 4Q5WA 4J7IA 3PNWC 3VS7A 3CCLQ 1W4SA 3UT1A 1RADB 3THKA 1F5QB 4CC3A 2QAZA 1PM3A 3RKYA 5I11A 3I55T 3U23A 5HKCA 4OR5B 2L3RA 3NPFA 1PRLC 3OSVA 5LJ5f 3L2UA 4LXCA 4YTLA 1WGSA 1T0JA 1RLPC 5GANg 2FZKB 1KD1R 1XTDA 1M5Q1 5LJ3e 2DTHA 5LJ3j 1AHJB 2K5FA 2LCLA 4EDUA 2WIHB 1X43A 4DBQA 2MK5A 3CCRA 4MMLA 1NYGA 3X24B 4MZMA 1E6HA 2QI2A 2EQMA 3H0FA 1VQ9Q 2YRCA 2RJEA 3G7ZA 4IUVA 2OTLT 1MMAA 2EBPA 2WHBB 4F7UA 1VQ9T 1VQKQ 1M1FA 1BIBA 1BI3A 4M7AE 3CBPA 1H3HA 1TTHB 2L0AA 2IVWA 4M77G 2P84A 2I0NA 4AMCA 2HCKA 4FCYA 1UJYA 4GLMA 3QYHB 4TVRA 3DDPB 2DRMA 2LVMA 3QWLA 4M7DE 1ZBXA 1QCNA 1KJWA 2RH2A 5FWCA 4FIBA 1U5SA 1BK2A 2CT4A 4BCND 1K1ZA 2EIFA 2EYZA 3X25B 1WJQA 2KYMA 4B9WA 1ZHIA 4PK4A 3G4SA 3SWNA 1I5OB 5GAMe 4D8DA 4HL4A 1BB9A 5GJWB 4FL6A 1KXUA 2ED1A 3BHUB 1BI0A 2UZDB 1QQJA 2X9HA 8ATCB 3PGGA 1RAEB 1WNLA 1UGSB 4C92A 4QSHA 3ME9A 4II5B 2ZPEB 3OYIA 2R7GA 1U8RA 2JNGA 2AHJB 4BCOB 4K11A 4MFDA 4EOIB 5GAN6 1KC8C 2QQ8A 2DXTA 2YRDA 4OMNA 1VQ6Q 3DLMA 1NLOC 2WMBB 2FZCB 4RTWA 1TS9A 4XTWA 3NMZC 1NM7A 4C92G 3G4ST 1TG0A 5HCKA 3VS2A 2HBPA 2H3EB 4JS5A 1YITQ 1UTIA 1QCOA 1QVFA 4DA4A 4BCNB 5CQXA 5A0DA 4OGCA 4F7UF 4MIMA 3CC7A 4P5NA 1FMKA 1N27A 5I5ZB 1W70A 3HBLA 3P8DA 4NS5A 1JEGA 1VYWB 2RF0A 2C0OA 2DTIA 3EG1A 2OTJT 2DBKA 1RAGB 4M4ZA 1OPLA 1IRXA 1AVZC 2FZGB 3JCMX 2LW4A 3A1PA 5I22A 4XTUA 1MHNA 2XDDA 2DXBA 5ECAA 2COZA 1YFNA 2CKKA 3BDUA 4KGVB 4ZTJA 4FYWB 2B9RA 5KYXB 2EYWA 2SEMA 1UHFA 4PJNA 4EONB 4OB0B 1K8AR 1WFWA 1UE9A 1YWPA 2GTOA 1H26B 2RPNA 1YJWA 1G3NC 1K9MC 4X9DA 5I21A 1W98B 1FVVB 5C0MA 1GUXA 1D1AA 5KYWB 1VQ8T 4JRPA 1D1BA 4PFOA 4BE1A 3QO3A 4IMYB 4E7SA 2QDYB 2D8JA 3QYEA 2BS2A 3PIPA 4EIKA 4CFXB 4L6V5 2R58A 3MP8A 1NJIR 3VV0A 3M56A 4R56A 1UNHD 2L3SA 4Z89A 3VU3C 5GAN8 5KE3A 2DPPB 2D0QB 2XIDA 5L2WB 2BS4A 4G6LB 5CK9A 4EPCA 1M3AA 1I07A 3UATA 2QQAA 1D3BA 1X69A 2WSEE 1UDLA 4EC8B 2IW8B 3M58A 3PVQA 5DQVA 5ICPB 1M1KR 1VYTA 3V7RA 1VQMA 2GBQA 5GAN5 3CCQT 2VGMA 2JN0A 3R6OA 3URGA 1M90U 3JCMh 2KROA 4C5HA 3AT1B 1RABB 2X1NB 2CZ6B 5CKHA 5GMKe 2R5MA 2DEQA 2D8HA 1ZLMA 2LC4A 2O88A 4ELYC 2XDBA 4LD6A 2O4XB 3NFCA 3M54A 3M0RA 3VYGB 4A4FA 1E7OA 1K76A 2RI2A 3V8JA 1B34B 4XU3A 3BDLA 4FYYB 4UC4A 4FSSA 4DBHA 3G71A 4M75G 3Q1JA 4LUDA 2VGNA 5CEIB 1DJ7B 3MP1A 1OPKA 3CPWP 2X4JA 1GUXB 3JCMQ 1U1TA 4JZ4A 3OYDA 5CKDA 3GBQA 3FJ5A 3LLRA 2P4TA 1AOJA 2LJ3A 3TW7A 1VQOT 5CO7A 2QGGA 3L2RA 2DO3A 3BLRB 2X4WA 2C5VB 2JM8A 2B8AA 4N0AA 3BHTB 4EMKB 2EQKA 2ZPIB 4C92E 3K7AM 5L23A 2PUKB 3HPWA 4N4GA 1VQ7Q 3A8OB 4HVWA 4CXAB 1WHGA 1RUWA 3VUBA 1NJIU 3X28B 2L8DA 3R6NA 1Y7XA 4PJOF 4EOMB 4BY7X 4XK8E 3ULRB 2DA9A 2WIPB 2PVOB 3FC3A 3QHRB 2YUQA 2QA4Q 4E47A 2KI7A 3QYBA 1VYVA 3CMAA 1TUDA 3UA7A 3VS0A 1K9MR 3CD6T 4D6WA 5IAYA 1GH6B 1TOVA 5GAMh 3JCMP 4DOWA 1OX9A 4EORB 3J81E 4A54A 1N5ZA 4XAXB 3DJBA 2GCXA 2J06A 3HFNA 1S72T 1QKWA 3JRZA 1UUEA 3KHIA 3E9FA 5GAOp 3JCMW 2W2HA 1OL2B 4AKHA 1MMNA 3VRZA 1WJSA 3G71T 3BG3A 4M7DG 1AZEA 3S3MA 3OMCA 2QGFB 3VYGA 2AZVA 4E7ZA 1Z9QA 1GL5A 1D0ZA 2E6NA 4HKEA 3HRTA 1QP2A 3ZEHA 3BFMA 4BE2A 2CP7A 2M16A 4LDUA 2DYIA 2D6FA 2DTOA 3CCVT 4YC3B 4M7DA 5EJCA 1BU2A 3QKJA 2BKDN 3MY1B 1R0CB 3A98A 3NGPA 2LRQA 3MEWA 1G3SA 2CH4A 4TTHA 3OYGA 2VYTA 3CC2T 2K2MA 4XU0A 1GFCA 4BUGA 2YUOA 5CKFA 4OMOA 4JPBW 1XQHA 3CCJQ 1MV0B 4KUDK 2V8IA 5C6SA 4E7LA 1YIJT 1W2BS 2DJZA 3JCMV 1C6VX 2YDLA 1HYOA 2K4YA 3JB9I 4RCCA 3BLHB 2RJFA 3QJYA 1ZP2A 5IDPB 4C0DC 3LW5E 4PNOA 1VQPA 2ZCFB 4KGZB 4OB2B 2NUTA 2BKZB 1ZSZB 3CBOA 1QWFA 3EG0A 4HCKA 4XTYA 3OYJA 2PQWA 3E19A 2K3XA 1PD0A 4ME7A 4ZNXA 3HKSA 1OYXA 4J9EA 3BHVB 4KUIA 3REAB 4IUTA 4M75C 2EFIA 1BBZA 3JB9J 5GMKj 5KYXA 4AFUC 4ZTFA 3EFOB 1YITA 4Z8AA 1ACMB 4Z6YA 2F2XA 5CAIA 2MMPA 1GRIA 3H6ZA 1H1PB 3CD6Q 4C5GA 1IO6A 4Z88A 2A0FB 9ATCB 3PE0A 1KG1A 5AYFA 5CYIB 5D6WA 3C4SA 2A36A 2JM9A 2A37A 2J05A 3EHRA 3FB9A 3QG1A 1KD1U 1PSFA 3M9QA 2DILA 1OKVB 2IVXA 1PNJA 4FYVB 4CFNB 1Q81C 3OS0A 1Q81R 2EPDA 5GMKm 3OYNA 2QASA 4M7AD 5CIUA 5FU7B 3EFRA 2MOXA 1VQNT 1JJ2S 1LPLA 3L42A 3HSBA 2WMAB 4GY5A 1CSKA 5DLOA 4PJOC 3EG2A 1X6OA 3SEMA 1KQ2A 4NC6A 1RAHB 2W96A 2JZ2A 3VJPA 4BE0A 3JCMJ 1WQ7A 3CPWS 2K5IA 1RAAB 1KSWA 4N4IA 2H3JA 2RK2A 2EWNA 4CRLB 4J5YA 1WHLA 1UJ0A 3FDRA 2CUDA 2EKHA 1SRLA 1V29B 3I9QA 1H28B 1YP5A 3L2VA 4OMQA 4M75A 2O2OA 4J9HA 3C94A 1H641 4X1VA 5ACBA 1SSHA 4DBRA 3H41A 1WA7A 1K9AA 2YUPA 4Z02A 1QVGA 4Y91A 2DYBA 3M59A 1TUCA 3CMET 4XU1A 2CZ0B 5LJ3f 4A4KA 3PVLA 4XTVA 5KH6A 2EJFA 5LMKB 2DX1A 4ZGEB 4C8QB 2LJ0A 4MDXA 3QDRB 5IXBA 2OTLQ 2NUTB 3G6EA 2JJ9A 3G33B 4M77D 4Y28E 4CI0C 1X01A 4PL6A 1ZUUA 3CCEQ 1WPYA 5GAMj 3I56T 1X27A 1ZSGA 5IHNA 2A08A 3CC2Q 2ROTA 1BU1A 4XTZA 3OB9A 3RIRA 2IW6B 3CC7T 4M78E 3NTKA 2FPDA 1PWTA 4F7UE 1TXQA 3QHWB 4CFUB 5DY9A 2HDAA 3EGXA 4C8QG 1VQLQ 1P92A 1M2VB 4C5IA 2V1RA 1S72A 3NTIA 3I5RA 2DL5A 1PHTA 2QQBA 4CC2A 3OSSC 2DD4B 1I1JA 2RJDA 1M4ZA 1VQ7T 5GAN7 2BZXA 3LWHA 3GLXA 4PLLA 4JRIA 4L5GA 4HLQA 4WF2A 1M1KC 3M0UA 4AG2C 4LOCA 2PMIB 4A4GA 1JKWA 1NG2A 3TSZA 4J9CA 2A28A 1K9MU 2DJQA 3GNFB 1VQKA 1K4US 1D09B 3LYIA 4F7JB 5IH2A 4OF1A 2L3PA 2KT8A 5GAMg 4CFUD 2IIMA 2V8KA 1NJIC 4BCQB 4A63B 4BCMB 2KDSA 4PJOG 5GAOm 1FXXA 1SHGA 3BG9A 2M9UA 2HQHA 4HNVA 3H0HA 4C92C 2X35A 5D6XA 1OIUB 1X75C 2RJCA 2OTJQ 2WSFE 2ZPHB 3JCMc 1AD5A 3L1AA 3CCLT 4RTUA 4F14A 5IXFA 1VQ6T 1BCMA 4PJOA 1NPPA 4JX6A 1RI9A 1U1SA 2MPXC 4C8QF 1G5VA 1H3ZA 4J7FA 2M0OA 2VWFA 5KCOA 1H8KA 4MZPA 1SSFA 2DVJA 2FG0A 4LDXA 3MIAB 1UNGD 3M03A 4IIOA 5LJ3d 3FJPA 1Y57A 1KIKA 2QXFA 3EFSA 2E5KA 1VQOQ 4LDWA 2QYZA 1H4LD 2CP6A 3G6EQ 1OU9A 2PJQA 1JQQA 3NHNA 4IURA 3GIBA 3O8VA 3ASKA 2VUBA 3UPUA 2E1HA 4C5EA 1YWOA 4HXJA 3OYKA 2O9SA 2KRNA 1NEGA 3S3OA 3MJXA 4OVAA 1QVFS 1OU8A 4JRKA 2VXFA 1OKWB 1TUGB 5IHKA 4PLIA 3L2ZA 1SPKA 2DD5B 1WHJA 2QDJA 4FW1A 2HBWA 2CZ1B 2GGRA 4D8KA 2DZCA 4ZN1A 2X3XD 3M53A 4FW2A 2DNUA 2ECZA 1YJ9T 3CD6A 1XO2A 3RDVA 2D9TA 1YHQT 4J9FA 1Y96B 3JB9H 1I8FA 1PKSA 1VQ5T 2ZPGB 1YJNT 1QVGS 2RN8A 2BIVA 2GFUA 1YI2A 1YJWT 2FRWA 1QKXA 1VA7A 2DAQA 4PKCC 4E2FB 5HBHB 1LNXA 1VQLT 1QMCA 4C0ZA 3S3NA 1P5EB 1RAIB 1QMZB 1B3QA 3PFSA 3N5BB 4CFVB 1FKMA 4MMKA 5KYYA 1YCYA 2RA2A 2DZ9A 2KT1A 3L2WA 4J8OA 3I55Q 1FMWA 2PK9B 2KMTA 2PHGA 3SHWA 4CC7A 3CMEA 4HT9A 1ZUYA 4J9BA 4BCJB 2I40B 4LE9A 4ESRA 3X20B 1BCOA 3G1JA 1Y0MA 2EGCA 3CCSQ 4QQDA 1D1CA 1PC0A 1AWJA 1HXDA 2EYQA 2LT4A 3VUZA 1VQ6A 3CCST 3KUFA 1Q7YR 1PD1A 2RK1A 4BCQD 4RTXA 2NUPA 4GLKA 5FW9A 3HL8A 3DDQB 4E7KA 1KC8U 4M7DC 1ABQA 3UWNA 1JO8A 2CGHA 3TNHB 1URCB 2EJGA 1YJ9Q 2LNVA 4ZN3A 4ORZA 4RG8A 1N8RC 3PT9A 2VASA 4NSTB 1SKUB 1M3BA 1WXUA 2IPOB 3D7SB 3CXCP 1JXOA 4PJMA 2ZGWA 5EC7A 1M3CA 3GTMS 1YN8A 4WTOB 2E5QA 4PFPA 3E1SA 3TREA 4EC9B 3DLLA 2ZPFB 1K73R 1AZGB 1BIAA 4JJBA 4M78F 2PK2A 3OYFA 1Y07A 1X2QA 1NEBA 2E65A 1NLPC 3J80E 3OYLA 1ZA2B 1O75A 2VC8A 1NE8A 4JJNK 2GF7A 1MUZA 2OJ2A 4MFEA 1FX7A 4HVVA 4BBRM 1HSQA 1UFFA 3CCMT 2K57A 2X51A 1VQOA 3LWIA 4FX3B 4AG1C 3CCUA 2YHTA 3G6ET 2DIQA 4KGXB 2E10A 1XNIA 4KH0B 2F1LA 2EYXA 1IXDA 3QSUA 3CCRQ 4QVCA 2RMOA 4A53A 1M27C 4N0AC 2K3YA 4M75D 1JJ2A 4OGRB 3T9NA 2NWMA 2DL4A 3BG5A 2QEXA 1YJ9A 1WLPB 1KQSS 2FYKA 2DETA 2M1HA 4F04B 3RERA 2BUDA 5LJ5e 4A4HA 3CC4A 2DERA 1OOTA 4EMHA 1LJOA 4FM4B 4JLIA 1H1SB 4QKUA 3RESA 2BPMB 2E12A 4R55A 1N9SA 5HNBB 4RCBA 3QPHA 1GBQA 3SWNC 1WHKA 3V8LA 2EJ9A 3CBMA 4C92F 2AKLA 1YIJA 1EX4A 3SB2A 3HB9A 4J6WA 1CKAA 1NPRA 5GAN3 2QTVA 3E9GA 4J6XA 4M75F 3CCMQ 5GANj 2QK0A 4EOJB 5DLQE 2G9XB 3RKXA 1BI1A 1PRMC 4C8QC 2HNIA 1K0XA 3CCSA 1VQMT 2SRCA 4MZTA 1D3BB 3OBWA 3OW2P 2UZBB 1OULA 2O9VA 3CEYA 5AT1B 1VIFA 2K6DA 4DQ2A 5GAOr 3MP6A 2RQWA 3VS1A 3S6WA 1Q81U 4F7SB 3MO8A 2OAUA 5J26A 4NL3A 3CCJA 1M8MA 1VQ4Q 2XG8D 5FU6B 1OI1A 2G3RA 3GP8A 4M6VA 3PMIA 5A2QE 2EKOA 4M78D 4LNPA 4NL2A 3P8HA 2F5KA 2HMAA 1GXIE 2NLUA 3OA6A 1UG1A 2EQJA 4BB7A 1NBEB 2ROLA 3KBGA 2KR3A 1KQ1A 4OP0A 2IN3A 2XKOC 1QCFA 2GQVA 1RAFB 2QQSA 4EMGA 5KYWA 1H25B 3TCJA 5CVIA 1N8RR 3TEEA 3OYAA 1HK9A 1R8OB 3DOGB 5KE2A 5IN1A 5IHYA 1I5LA 2RHZA 3C0CA 3TW6A 3LGFA 3M5AA 2EAYA 2HEQA 1AWXA 4QQGA 7AT1B 2WACA 1V76A 5EFQB 1IHVA 1TSFA 2NUPB 4BDZA 4DEYA 4JUVA 4M78B 2DLPA 4PJOD 4CRIA 3ER0A 3GF5A 3CCVA 4F7NB 3CC4Q 4KRTA 4Y92A 5I2SA 4ROCA 2EVRA 2KY9A 4EOQB 3HRSA 3AHUA 1MV3A 3MEAA 5GJVB 2DXCB 1E9HB 4AT1B 2E3HA 1VQNA 1OV3A 2LQ8A 4X34A 1G3YA 3M4YA 1VQ5Q 4IUUA 3SDZA 3VKGA 1H24B 2P0QA 2W0ZA 2QDLA 2E6ZA 4HCBA 4BCMD 2BE7D 2KRSA 1UHCA 2C6TB 1WX6A 2LNHB 3M0TA 3OYHA 3CXCA 3KXTA 3JCMf 1QW1A 3FRNA 4F17A 3DKMA 2XMFA 4KT0E 4JJCA 3EG9A 4FT2A 2ESWA 2YXYA 3ZBDA 4BCPB 4RTTA 1O9KA 5A0GA 3O0GD 3JAME 3M0PA 1G2BA 1UNLD 2FHDA 2VB6A 2QG9B 2WJ9A 2DD5A 3DL1A 4FT4A 5GANf 3BLQB 2DE0X 3MEVA 2QA4T 5I2MA 2ENMA 1M1KU 2RHIA 5GMKl 2COWA 3SWNB 2CSIA 2DD4A 4E7HA 1LVKA 2HL5C 2KGTA 3UA6A 1OX8A 2QEXT 2JOYA 2E70A 3PIOA 1VQPQ 3I56Q 1H92A 3V7CA 2QQ9A 2KXDA 2FVUA 5KYUA 4C0FA 2RI5A 2V1QA 2LQWA 4NOYA 1AISB 1VUBA 4KRCB 4RG2A 5LJ5d 4YOOA 3ZFJA 3H8ZA 5LL6S 2A7YA 4ATOA 1UB4A 3QYGB 4IUQA 3JCMe 2K5LA 1Q95G 3QHSA 3M0QA 5FRMA 2C0TA 2LCSA 2QFZA 1RLQC 5GMKh 3DTOA 2KQWA 2FL7A 3DB4A 4UN0A 2KK4A 4YOSA 2JT4A 3CPFA 2RQUA 1K73U 5GANe 5J3BA 2OTLA 2WEVB 3C12A 2KMGA 3OS5A 3CQTA 2QGSA 1MNEA 5D7UA 1OZ2A 2CP5A 4C8QE 3INZA 1Y71A 5LJ3g 3CCEA 2VV5A 4F7UG 2XI9A 4M78G 3TQ7P 2JXBA 2LX9A 5GANh 1OGUB 5HVYB 1MMDA 4M7DB 2CREA 1KFZA 3JB9F 2DM1A 1G3TA 1IGUA 2LDMA 1VQ8Q 2C5OB 5HBJB 2DMEA 3EIDB 4M75B 4JX5A 3M0SA 5HY6A 1KD1C 3F70A 2AKKA 2PVGB 4RTYA 1VINA 3RKWA 2PZ1A 5D6YA 2LX7A 2BZYA 1PKTA 2C06A 4HCZA 1M2VA 3CMAQ 4BD3A 3VS4A 3CCET 3EGXB 1OL1B 2KEAA 3PO3S 2KRMA 3A8HB 3QJ6A 4J6YA 2PNIA 1YJWQ 2KNBB 2DK3A 4J83A 5CR2A 5FGKB 3V8KA 2EW3A 3EGDB 3CC4T 2HKNA 2VVKA 2WFYB 1FINB 4F70B 1JU5C 1HJDA 2NUZA 1VOMA 3BY7A 4FYXB 2QA4A 2AZSA 2K3BA 1FWZA 3HHTB 3WXMB 1AWWA 4ZGDB 2LMJA 1KQSP 4C8QA 1HD3A 4M77B 2JW4A 2P0PA 4EOPB 4L59A 1V1CA 2MI6A 2GTJA 5KYUB 2FB7A 2MAMA 1WXBA 4EMKA 2OAWA 1YJNA 2LZ6B 4LDVA 2KYBA 2KSSA 2OI3A 3OYCA 1JXMA 3B57A 3EG3A 3QXEB 2MWOA 4EOLB 2DEUA 5CKEA 4HA8A 4ELZC 2QEXQ 4EOKB 1O9SA 1KK7A 5HQ0B 1WZOA 1T3SA 1N8RU 5EG2A 5HK3A 1M8VA 4XU2A 5IF1B 3EG9B 5GAN2 3VRYA 1YI2T 1I81A 6AT1B 2KE9A 2QTXA 4BCIB 2F2CA 4O6JA 2CCIB 3IQLA 3MHXA 1C1AA 4JJDA 2JUFA 2C0IA 2YSQA 2X4YA 4QW2A 2E4HA 2O4XA 5IDNB 2EGEA 3RBBB 1U3OA 3RNJA 2DXUA 2X3WD 3EH2A 1FMVA 1UGQB 4OMPA 1IGQA 3H9NA 3JV3A 3SFMA 4E7IA 1GBRA 3VS5A 3TVTA 2CH4W 3OYEA 4M7AA 1EZZB 3VS6A 4AFSC 2WXVB 2RNAA 2RO0A 3RMQA 1WIEA 1ZQ1A 1OI9B 2WPAB 2E41A 3A8GB 3DB3A 4RMOA 1VQKT 2RI3A 1RI0A 4AKIA 4RUGA 4M7AC 3GNGA 4E6RA 1QVGP 3KFVA 1WXTA 2WSCE 2HQEA 3HFOA 1IHWA 2PTKA 4BI3A 2HKQB 2IG0A 1Q86U 3CCQA 2H8HA 3TNIB 2XHCA 4JDSA 3TU4K 2OTJA 2D1XA 4EMKC 4VUBA 5LJ5h 4Y72B 2XK0A 2B86A 2PU9B 1G8XA 1XOVA 4DEXA 4YOZA 2XU8A 3CCRT 4HCCA 1K8AC 2YUNA 2F2WA 5LJ3h 2DL3A 1YJNQ 1Q82U 1CKBA 4JZ3A 1M1GA 3H4CA 4GBQA 2M51A 4HNTA 2M02A 2MF2A 2J7IA 1M30A 2MCNA 4RTVA 2A3LA 1K0SA 1VIEA 3FLGA 2ZPBB 1JSUB 3TN8B 4ELLA 1LOJA 2JVVA 1KHCA 1YITT 5J39A 3CCVQ 3QBYA 3QZ9B 2O01E 2OX7A 3CC2A 3TNWB 4M77C 3UDCA 2EGAA 3VS3A 2ATCB 2HL3A 4O5VA 2DVEA 1OIYB 2M0YA 2AK5A 4ELJA 2DKGA 5GAMd 4QQ6A 3X26B 1PKDB 2HSPA 1VOLA 2ZAEA 4II1A 3O5ZA 1S72Q 4ROEA 4DOVA 2L3QA 1O9KB 2Y4XA 3I5SA 2VXEA 3META 3BE3A 1SEMA 2QF7A 4EOSB 2CP0A 3SD4A 3POMA 4BY6C 5BNJB 4PFZA 3EGUA 1MNDA 2RHXA 4C92B 1X6BA 1C0MA 1ARKA 1W1FA 2EUFA 4M7DD 2DL8A 3MEUA 2HAXA 1EIFA 4CFMB 1JRIA 1QVFP 2LQNA 3CC7Q 1BYMA 4F7LB 1BI2A 4BACA 4LN2A 4B9XA 5GAMf 5GAOn 4C0DB 3A5ZB 3CPWA 5LJ5j 1M9SA 2L2PA 2FEIA 4KULA 1ZSZC 1Q7YC 3V7SA 1J3TA 4M77F 1QLYA 1W2BP 1ZA1B 2R57A 5KYNA 1KQSA 1SHFA 3I56A 1EFNA 1MMGA 1H27B 2CSQA 1KHIA 4C0GA 2F69A 4M75E 2JMAA 1NZ9A 4M78A 1QVPA 5KYYB 3CCMA 3QWXX 1QLBA 1ZUKA 1AT1B 1QP3A 2K9GA 1A0NB 2C5XB 2UUEB 1NYFA 1GCQA 5LQFB 4BXXX 1N6AA 3QWYA 1WQWA 3VYHB 4QVZA 2HZYA 4IKFA 3HTRA 1RACB 2LT1A 5GMKi 4EOOB 2RM4A 2YWWA 3OW2A 2CP2A 1M2OA 1T3LA 1WJRA 1D3UB 1WDXA 3LGLA 1UGRB 4OB3B 1IZ6A 3BW1A 1VQ4A 4PJJA 3VKHA 2DRKA 2RB6A 2W10A 3H0IA 4OMFB 1R0BG 3OS1A 4F6WB 1JOWA 2ABLA 5FROA 2JS0A 2CT3A 2DF6A 1FYNA 1YHQQ 2BS3A 1WI7A 1WHHA 1B34A 3A8MB 3OYBA 1G83A 5LJ5g 3P8BB 2CS7A 3FEOA 1PG5B 1JB0E 2W9FA 5FU7C 1T0HA 3CMEQ 4AFZC 4BCFB 2E3IA 3C95A 2DL7A 2JTFA 1IREB 1TD6A 1PCXA 3RMSA 2DMOA 4LUEA 2I53A 4B6MA 3RR6A 3VKIA 1VQ4T 3RUXA 2CYZB 3PTAA 2PUOB 2UZLB 2X4XA 1WHMA 1JJ2P 2E64A 4C8QD 3NTHA 2C5NB 3I35A 4KRDB 4M7AB 5KCHA 4JX4A 4CC4B 3QDFA 4F6SB 2W9ZA 2LCCA 3G71Q 4BDYA 2KAFA 4BY1X 5DQWA 2J6FA 3FIFA 1SF9A 3LQ5B 3QUIA 1OQKA 1VQPT 3JCMb 2IW9B 1G3WA 1UECA 2XD0A 3OYMA 3HRUA 1K73C 2AT1B 5DM7R 3JB9G 2BZ8A 4FU6A 2FPEA 1OZ3A 1VQNQ 2CDTA 2KXCA 4XQ3A 1YNZA 1VQ5A 3TSWA 3EOCB 2K79A 3M57A 2JGZB 3OMGA 2ZZDA 3J7AF 2YLBA 1QWEA 2KR6A 1AWOA 2RHYA 1PSEA 2CZ7B 1AD6A 1E7PA 2R5AA 1TWBA 1H1QB 4OMMA 4HNUA 1TFBA 2O31A 1YHQA 4J9GA 4ANJA 2YLCA 3LX7A 2MWPA 1VQ7A 1C9BA 2V8JA 3OBYA 4KBMB 4C92D 1WYXA 4V2SA 4BCGB 2Y4YA 2FPFA 3OS2A 3MCAB 2CJMB 3EHQA 2DXBB 4PJOE 2D0NA 2NYSA 5L8RE 1N9RA 2V22B 2RQTA 3EJ1B 4A4EA 1KC8R 4QVDA 1ABOA 8AT1B 2LJ1A 5GAN4 4IIMA 3EH1A 3GPLA 2W99A 4JLGA 1I4K1 2RQRA 4M77A 3CCJT 2F5TX 4HVUA 2EQUA 2LTOA 4BBSM 1OEBA 2F2VA 1ZBJA 3WVDB 4PJOB 4BI8B 1W2BA 1IB8A 1F1BB 2GQIA 4AFQC 2RHUA 3JSCA 2CCHB 1UGVA 4LD9K 1UEBA 4KH1B 3CMAT 4OB1B 5FU6C 4M7AF 1B07A 2Z0WA 3M4GA 1YCSB 5GAOq 4RTZA 1N4MA 3WVEB 1JBMA 2BTTA 3E2UA 3OW2S 3MI9B 2KVQG 3UF4A 1TU0B 4BY6B 4M7DF 2KBTA 1GCPA 1XJWB 1H1RB 4RKUE 1YIJQ 1D0XA 1E6GA 1Q82R 1ZX6A 3RGFB 5FLXE 3LH5A 1GY3B 1I0CA 5HK0A 2YT6A 3OQ5A 2L89A 5FWBA 4M77E 3CCUQ 3JCMd 5FRNA 2COYA 3CCQQ 1U06A 4F6UB 4M7AG 2J6KA 2DIGA 2P4RA 3REBB 4J9IA 3MY5B 5IT9E 1VQMQ 2LQKA 1VQ8A 1M90C 3QZ5B 3JCMg 2BE9B 4HT8A 2MYSA 1MGQA 2HD0A 4IUPA 4QT7A 2XICA 4J9DA 3CCUT 3MPUB 3HZJA 5IHIA 2L5QA 1SRMA 3F5XB 3HO8A 1SG5A 1TH7A 5A0LA 5CQYA 4R0KA 4OGEA 2UZEB 1X2KA 2XDPA 1K8AU 3I55A 4BCKB 2JS2A 4MDWA 4X9CA 4E7JA 5M9OA 2Y90A 4F7UB 5CKBA 2HSEB 4F16A 1Y96A 1W6XA 2ED0A 4N4HA 2I2LA 1BKBA 3CXCS 1AEYA 3EAEA 3PMTA 1JSTB 3QIIA 4LDYA 2J6OA 3JB9D 3ZL7C 3LH0A 3L2QA 1YBYA 3EFOA 4JRQA 4DBFA 2FO0A 3OY9A 4JS4A 2DFUA
chains in the Genus database with same CATH topology
3QKJA 3GNGA 4M7AC 2RD1A 1VQOA 5GAOl 2BKDN 3LWIA 1Q86C 2JTMA 2WSCE 3CCUA 2HQEA 3HFOA 2GFAA 2YHTA 2LRQA 3MEWA 3G6ET 1G3SA 2DIQA 2E10A 2P0KA 3OYGA 4BI4A 4BI3A 1XNIA 1UGPB 2VYTA 2IG0A 1Q7YU 4XU0A 4BUGA 3CCQA 1Q86U 2K2VA 3CC2T 5CCAA 3CCLA 2XHCA 5CKFA 1VQLA 3QSUA 4QVCA 4JDSA 3TU4K 2ZZDB 4A53A 2OTJA 1XQHA 4EMKC 4VUBA 5LJ5h 4KUDK 2V8IA 2XK0A 4N0AC 2K3YA 3A8LB 4M75D 5C6SA 4E7LA 2PU9B 1YIJT 3T9NA 1W2BS 1JJ2A 2DJZA 1VQ9A 3JCMV 3BG5A 1XOVA 2QEXA 1YJ9A 4AI6A 2K4YA 3M55A 4RCCA 3JB9I 3OYYA 1KQSS 2RJFA 4AKGA 4XTXA 1Q82C 3QJYA 2XU8A 2FYKA 3GOXA 4C0DC 3CCRT 4HCCA 2M1HA 1K8AC 3LW5E 4PNOA 1VQPA 2ZCFB 2YRVA 3RERA 2BUDA 4OB2B 5LJ5e 5LJ3h 4A4HA 3CC4A 3CBOA 1Q82U 2PVDB 1RL2A 5GANd 2HQXA 4EMHA 1LJOA 4XTYA 4FM4B 4JLIA 1M1GA 4FSXA 3OYJA 3H4CA 2PQWA 2DXCA 3RESA 2E12A 3E19A 4R55A 1N9SA 4HNTA 4M78C 2K3XA 2MF2A 4RCBA 2QQRA 4ME7A 3HKSA 3QPHA 4ZGJB 3SWNC 1OYXA 3V8LA 3HP9A 2A3LA 2EJ9A 2G77A 3CBMA 4Q5WA 4C92F 1YIJA 1VIEA 3FLGA 4J7IA 3SB2A 2ZPBB 3PNWC 4KUIA 1W4SA 1LOJA 3UT1A 3HB9A 4IUTA 1NPRA 4J6WA 2JVVA 2EFIA 1KHCA 4M75C 1YITT 5J39A 1KC8C 3JB9J 5GAN3 3RKYA 3E9GA 4J6XA 4M75F 5GMKj 5GANj 3I55T 5HKCA 4ZTFA 3QBYA 5DLQE 1YITA 3QZ9B 2O01E 2L3RA 4Z6YA 3RKXA 3CC2A 1BI1A 2MMPA 3OSVA 5CAIA 5LJ5f 3L2UA 4YTLA 4C8QC 4M77C 3H6ZA 1WGSA 2HNIA 3UDCA 4C5GA 3CCSA 1VQMT 5GANg 4MZTA 4O5VA 2DVEA 5AYFA 1D3BB 1KG1A 3OBWA 1XTDA 5D6WA 3CEYA 4ELJA 2DKGA 1VIFA 3C4SA 3X26B 1M5Q1 4QQ6A 4DQ2A 2DTHA 5LJ3e 5GAMd 5GAOr 3MP6A 5LJ3j 4II1A 3FB9A 3QG1A 3S6WA 1AHJB 2K5FA 2LCLA 1PSFA 3M9QA 3MO8A 4EDUA 1KD1U 2OAUA 5J26A 4NL3A 3CCJA 4DOVA 3CCRA 2XG8D 5FU6B 1OI1A 4MMLA 2Y4XA 2G3RA 1Q81C 3GP8A 4M6VA 2VXEA 3OS0A 3X24B 4MZMA 3PMIA 2QI2A 3META 2EQMA 5GMKm 3OYNA 5A2QE 2EKOA 4M78D 3G7ZA 2RJEA 4IUVA 4NL2A 2OTLT 4M7AD 3P8HA 2F5KA 5CIUA 5FU7B 3EFRA 1VQNT 2QF7A 4F7UA 1JJ2S 3L42A 1VQ9T 3HSBA 3SD4A 4GY5A 4BY6C 5DLOA 4PJOC 1GXIE 1M1FA 2NLUA 1BIBA 1BI3A 1X6OA 2EQJA 3CBPA 4BB7A 3OA6A 1KQ2A 4M7AE 3KBGA 2IVWA 2RHXA 4OP0A 1KQ1A 4NC6A 2XKOC 4C92B 2GQVA 4M77G 2QQSA 4EMGA 4M7DD 3TCJA 5CVIA 2JZ2A 3TEEA 3VJPA 3OYAA 4BE0A 3JCMJ 3QYHB 1WQ7A 3CPWS 2K5IA 4TVRA 2HAXA 1HK9A 1R8OB 2LVMA 3MEUA 1EIFA 1JRIA 2H3JA 2RK2A 3QWLA 2EWNA 4N4IA 4J5YA 5IN1A 5KE2A 4M7DE 1BYMA 1BI2A 4BACA 1ZBXA 2RHZA 3FDRA 4B9XA 5GAMf 5GAOn 1I5LA 3TW6A 3LGFA 4C0DB 3A5ZB 3M5AA 3CPWA 5LJ5j 2RH2A 1M9SA 4FIBA 2EAYA 4KULA 1Q7YC 3V7SA 1V29B 4QQGA 4M77F 2WACA 3L2VA 4M75A 2R57A 3C94A 1H641 1KQSA 3I56A 4BDZA 2EIFA 3X25B 1KHIA 1WJQA 4B9WA 4JUVA 4C0GA 4M78B 1ZHIA 2F69A 3G4SA 4M75E 3SWNA 4Z02A 1QVGA 5GAMe 4Y91A 4CRIA 1NZ9A 4M78A 4PJOD 4HL4A 1QVPA 3ER0A 4FL6A 3GF5A 3CCVA 3CCMA 1QLBA 3M59A 1BI0A 5I2SA 1QP3A 3CMET 2KY9A 3HRSA 4XU1A 3PGGA 2CZ0B 3AHUA 1WNLA 5LJ3f 1UGSB 3MEAA 4A4KA 4QSHA 1N6AA 4C92A 3ME9A 2DXCB 4XTVA 1WQWA 2ZPEB 3OYIA 5KH6A 3VYHB 4QVZA 2EJFA 1U8RA 2JNGA 1VQNA 4IKFA 2AHJB 2LQ8A 4ZGEB 4X34A 4MFDA 4C8QB 4MDXA 3QDRB 1G3YA 2LT1A 3M4YA 5GAN6 5GMKi 4IUUA 3SDZA 2QQ8A 2RM4A 3VKGA 3G6EA 2DXTA 3OW2A 2P0QA 3DLMA 1WJRA 3LGLA 1UGRB 4OB3B 1IZ6A 2E6ZA 3BW1A 4M77D 4XTWA 4C92G 3G4ST 3VKHA 4Y28E 4CI0C 2RB6A 1VQ4A 4HCBA 4OMFB 1X01A 4PL6A 3OS1A 5FROA 2HBPA 1WPYA 5GAMj 3I56T 3OYHA 4JS5A 3CXCA 3KXTA 4XTZA 1QW1A 3JCMf 3OB9A 3RIRA 3FRNA 3DKMA 1QVFA 4DA4A 3CC7T 4M78E 2BS3A 3NTKA 4KT0E 4FT2A 5CQXA 1B34A 4F7UE 3A8MB 5A0DA 4OGCA 4F7UF 3ZBDA 3OYBA 4MIMA 5LJ5g 5A0GA 3CC7A 3FEOA 2CS7A 3P8BB 3JAME 1JB0E 4P5NA 5DY9A 2FHDA 4C8QG 1N27A 2WJ9A 2DD5A 5FU7C 3DL1A 4FT4A 1P92A 5GANf 3HBLA 3C95A 3P8DA 4C5IA 3MEVA 2JTFA 4NS5A 1S72A 2QA4T 5I2MA 3NTIA 1IREB 1M1KU 2RHIA 2DTIA 3RMSA 2QQBA 4LD9K 3OSSC 2DD4B 5GMKl 2OTJT 2RJDA 3SWNB 1M4ZA 1VQ7T 5GAN7 2DD4A 3VKIA 3LWHA 1VQ4T 3GLXA 4PLLA 3RUXA 4E7HA 2CYZB 4JRIA 4L5GA 4HLQA 4WF2A 3JCMX 3PTAA 2PUOB 1M1KC 4XTUA 4LOCA 2QEXT 2JOYA 2X4XA 1MHNA 2XDDA 4A4GA 2E70A 3PIOA 2DXBA 2E64A 2CKKA 4C8QD 3BDUA 3NTHA 4ZTJA 4M7AB 2QQ9A 3V7CA 5KCHA 4JX4A 2FVUA 1K9MU 4C0FA 3GNFB 1VQKA 2RI5A 4OB0B 2LCCA 3LYIA 4BDYA 2KAFA 1VUBA 4NOYA 4RG2A 4OF1A 5LJ5d 1YJWA 3FIFA 1K9MC 3ZFJA 3QUIA 4X9DA 3H8ZA 5I21A 5LL6S 5GAMg 5C0MA 2A7YA 4ATOA 1VQPT 1UB4A 3QYGB 4IUQA 2V8KA 3JCMe 3JCMb 1NJIC 1G3WA 2XD0A 3OYMA 3HRUA 2K5LA 2KDSA 4PJOG 5GAOm 1VQ8T 4JRPA 3QHSA 5FRMA 1K73C 1FXXA 4BE1A 2QFZA 3QO3A 3BG9A 5GMKh 5DM7R 2M9UA 4HNVA 3JB9G 4C92C 2X35A 5D6XA 2KQWA 4FU6A 2QDYB 2FL7A 3DB4A 1X75C 2RJCA 1OZ3A 2KK4A 3QYEA 2BS2A 3CPFA 3PIPA 4L6V5 4XQ3A 1K73U 2R58A 3MP8A 5GANe 1VQ5A 2WSFE 2ZPHB 5J3BA 3JCMc 2OTLA 3VV0A 3M57A 3M56A 3OMGA 2ZZDA 3L1AA 4R56A 3CCLT 2YLBA 3C12A 2KMGA 3J7AF 2KR6A 1VQ6T 2RHYA 4PJOA 1NPPA 3OS5A 4JX6A 1PSEA 2CZ7B 3VU3C 1OZ2A 1U1SA 4C8QE 5GAN8 3INZA 1Y71A 1E7PA 2R5AA 2DPPB 2D0QB 2XIDA 4C8QF 4J7FA 5KE3A 1G5VA 2M0OA 1H3ZA 5KCOA 5LJ3g 2BS4A 4HNUA 1SSFA 4MZPA 4EPCA 5CK9A 2VV5A 4F7UG 2YLCA 3CCEA 1YHQA 2XI9A 4LDXA 4M78G 2LX9A 3LX7A 2MWPA 5GANh 1VQ7A 2V8JA 3OBYA 4KBMB 4C92D 4V2SA 2QQAA 5LJ3d 1D3BA 3FJPA 2Y4YA 4M7DB 2WSEE 2QXFA 3EFSA 3M58A 3JB9F 3OS2A 1G3TA 4LDWA 2LDMA 3MCAB 3V7RA 1VQMA 5GAN5 3CCQT 4BE2A 2DXBB 2VGMA 2JN0A 4PJOE 5L8RE 1N9RA 4M75B 3R6OA 4A4EA 3URGA 4JX5A 3JCMh 4IURA 4QVDA 1M90U 3O8VA 3GIBA 3ASKA 4C5HA 2VUBA 3UPUA 5HY6A 1KD1C 3F70A 5GAN4 2PVGB 2E1HA 2CZ6B 5CKHA 4C5EA 3GPLA 4JLGA 3OYKA 5GMKe 1I4K1 3RKWA 5D6YA 4M77A 3CCJT 2F5TX 3S3OA 2RI3A 2EQUA 4OVAA 2C06A 1QVFS 4JRKA 2VXFA 2R5MA 4HCZA 2DEQA 2LTOA 2LC4A 4ELYC 4BD3A 2XDBA 4LD6A 4PLIA 4BBSM 3L2ZA 3CCET 2O4XB 2DD5B 2QDJA 3NFCA 3M54A 2CZ1B 3WVDB 3VYGB 2DZCA 3A8HB 4A4FA 3V8JA 2RI2A 4BI8B 4ZN1A 3M53A 1W2BA 4PJOB 1B34B 3QJ6A 4J6YA 1YJ9T 4XU3A 3CD6A 2D9TA 3BDLA 1YHQT 1Y96B 4UC4A 3JB9H 2RHUA 1I8FA 1VQ5T 2DK3A 2ZPGB 3JSCA 3G71A 4J83A 4M75G 3Q1JA 1YJNT 1QVGS 2BIVA 2GFUA 1UEBA 3V8KA 5CR2A 1YI2A 3CMAT 4OB1B 5FU6C 1YJWT 2DAQA 4PKCC 4M7AF 3M4GA 3CC4T 2VGNA 1LNXA 1DJ7B 1VQLT 5GAOq 3MP1A 3BY7A 4C0ZA 3S3NA 3WVEB 2X4JA 1JBMA 3JCMQ 1U1TA 2QA4A 3OW2S 2KVQG 3OYDA 1FWZA 3HHTB 5CKDA 4BY6B 3WXMB 4M7DF 4ZGDB 4RKUE 3LLRA 3PFSA 2P4TA 4C8QA 3N5BB 1FKMA 4M77B 2P0PA 3TW7A 4L59A 4MMKA 1YCYA 2RA2A 5FLXE 2DZ9A 1VQOT 2MI6A 5CO7A 3L2WA 4J8OA 2FB7A 5HK0A 3L2RA 2DO3A 2KMTA 2MAMA 2X4WA 3OQ5A 2B8AA 2L89A 4N0AA 3CMEA 4HT9A 4EMKB 2EQKA 4M77E 2ZPIB 4C92E 3JCMd 5FRNA 4EMKA 3X20B 1YJNA 4M7AG 4LDVA 2KSSA 2DIGA 2PUKB 3OYCA 3HPWA 5IT9E 2LQKA 4N4GA 4QQDA 1VQ8A 1M90C 3QZ5B 1HXDA 2LT4A 3A8OB 2EYQA 3JCMg 3VUZA 3QXEB 2MWOA 1VQ6A 3CCST 3KUFA 3VUBA 1NJIU 3X28B 2RK1A 1MGQA 2HD0A 2L8DA 4IUPA 5CKEA 4HT8A 4GLKA 4HA8A 2XICA 1Y7XA 4PJOF 4ELZC 1O9SA 3HL8A 4XK8E 3CCUT 3HZJA 1N8RU 4E7KA 1KC8U 4M7DC 3UWNA 5EG2A 2PVOB 5HK3A 2CGHA 3FC3A 2L5QA 2EJGA 1M8VA 4XU2A 3HO8A 1TH7A 2LNVA 4E47A 5A0LA 4ZN3A 3QYBA 4RG8A 5CQYA 5GAN2 1N8RC 3PT9A 3CMAA 1YI2T 1I81A 4OGEA 2QTXA 2XDPA 3CD6T 4D6WA 4O6JA 2ZGWA 1K8AU 5IAYA 3MHXA 5GAMh 3I55A 3JCMP 2JUFA 4DOWA 4MDWA 4X9CA 2X4YA 4QW2A 4E7JA 5M9OA 3J81E 2Y90A 2O4XA 4A54A 4XAXB 2GCXA 3HFNA 1S72T 3JRZA 4F7UB 5CKBA 3KHIA 2E5QA 3E9FA 3TREA 3E1SA 5GAOp 2DXUA 3JCMW 4AKHA 1Y96A 3G71T 1WJSA 3DLLA 2ZPFB 1UGQB 3BG3A 1BIAA 4M78F 3OYFA 4M7DG 4N4HA 3SFMA 1Y07A 4E7IA 2I2LA 3OMCA 3S3MA 2E65A 1BKBA 3CXCS 3OYEA 3VYGA 3EAEA 3PMTA 4M7AA 3J80E 3OYLA 2E6NA 3QIIA 4HKEA 1QP2A 1O75A 2VC8A 3BFMA 1NE8A 3HRTA 4LDYA 2GF7A 3ZEHA 2RO0A 3RMQA 4JJNK 1ZQ1A 2M16A 3JB9D 4MFEA 1FX7A 3LH0A 4BBRM 4LDUA 1YBYA 2E41A 3L2QA 3A8GB 1Q81U 2DTOA 2D6FA 4JRQA 3DB3A 4RMOA 1VQKT 3CCMT 3CCVT 4JS4A 3OY9A 2K57A 4M7DA 1RI0A 5EJCA 4AKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DD4 A;  4OB1 B;  2CYZ B;  1GXI E;  2PUO B;  2WSC E;  1DJ7 B;  2DXB A;  3WVE B;  1UGP B;  3QYH B;  3HHT B;  4ZGD B;  4RKU E;  2ZZD B;  4OB0 B;  3A8L B;  2PU9 B;  3QYG B;  1V29 B;  2ZPI B;  3X20 B;  3LW5 E;  2ZCF B;  3X25 B;  2PUK B;  4OB2 B;  2QDY B;  3QZ5 B;  3A8O B;  3QXE B;  2PVD B;  4L6V 5;  4FM4 B;  2WSF E;  2ZPH B;  3X28 B;  2ZZD A;  2DXC A;  1QP3 A;  4XK8 E;  1PSE A;  2CZ7 B;  4ZGJ B;  2CZ0 B;  2DPP B;  2D0Q B;  1UGS B;  2PVO B;  2DXC B;  2ZPE B;  3VYH B;  2ZPB B;  2AHJ B;  4ZGE B;  2WSE E;  3QZ9 B;  2O01 E;  1UGR B;  4OB3 B;  2DXB B;  4Y28 E;  5L8R E;  2PVG B;  2CZ6 B;  3X26 B;  2ZPF B;  1UGQ B;  4KT0 E;  3A8M B;  1AHJ B;  1PSF A;  3VYG A;  2DD5 B;  1JB0 E;  2DD5 A;  2CZ1 B;  3WVD B;  3VYG B;  1QP2 A;  3A8H B;  3X24 B;  1IRE B;  3A8G B;  2DD4 B;  2ZPG B; 
#chains in the Genus database with same CATH topology
 1GCQ C;  2VKN A;  1Q86 R;  2RD1 A;  5GAO l;  1D0Y A;  1R77 A;  2AIR B;  5HBE B;  1Q86 C;  2JTM A;  3NDQ A;  2DBM A;  2GFA A;  1ENW A;  1S1N A;  2CP3 A;  2P0K A;  4BI4 A;  1UGP B;  1Q7Y U;  4BCH B;  2K2V A;  1M90 R;  1Z9Z A;  2JTE A;  5CCA A;  3CCL A;  1VQL A;  1VYU A;  2ZZD B;  4PJL A;  2EQI A;  2G6F X;  2C4G B;  1X6G A;  3A8L B;  2FRY A;  1VQ9 A;  1ZSZ A;  2EYY A;  1LCK A;  1B7T A;  4AI6 A;  3MKD A;  3M55 A;  2K7A A;  2RQV A;  3OYY A;  3G4S Q;  4AKG A;  4XTX A;  4I3Z B;  1Q82 C;  3GOX A;  1GFD A;  4CFW B;  3EGD A;  2YRV A;  2PVD B;  1RL2 A;  5GAN d;  2HQX A;  1YI2 Q;  4FSX A;  2V26 A;  4ROD A;  2DXC A;  2JMC A;  2LP5 A;  4OML A;  4M78 C;  2QQR A;  4ZGJ B;  2GNC A;  2CUB A;  3HP9 A;  4WCI A;  2G77 A;  2MIO A;  4Q5W A;  4J7I A;  3PNW C;  3VS7 A;  3CCL Q;  1W4S A;  3UT1 A;  1RAD B;  3THK A;  1F5Q B;  4CC3 A;  2QAZ A;  1PM3 A;  3RKY A;  5I11 A;  3I55 T;  3U23 A;  5HKC A;  4OR5 B;  2L3R A;  3NPF A;  1PRL C;  3OSV A;  5LJ5 f;  3L2U A;  4LXC A;  4YTL A;  1WGS A;  1T0J A;  1RLP C;  5GAN g;  2FZK B;  1KD1 R;  1XTD A;  1M5Q 1;  5LJ3 e;  2DTH A;  5LJ3 j;  1AHJ B;  2K5F A;  2LCL A;  4EDU A;  2WIH B;  1X43 A;  4DBQ A;  2MK5 A;  3CCR A;  4MML A;  1NYG A;  3X24 B;  4MZM A;  1E6H A;  2QI2 A;  2EQM A;  3H0F A;  1VQ9 Q;  2YRC A;  2RJE A;  3G7Z A;  4IUV A;  2OTL T;  1MMA A;  2EBP A;  2WHB B;  4F7U A;  1VQ9 T;  1VQK Q;  1M1F A;  1BIB A;  1BI3 A;  4M7A E;  3CBP A;  1H3H A;  1TTH B;  2L0A A;  2IVW A;  4M77 G;  2P84 A;  2I0N A;  4AMC A;  2HCK A;  4FCY A;  1UJY A;  4GLM A;  3QYH B;  4TVR A;  3DDP B;  2DRM A;  2LVM A;  3QWL A;  4M7D E;  1ZBX A;  1QCN A;  1KJW A;  2RH2 A;  5FWC A;  4FIB A;  1U5S A;  1BK2 A;  2CT4 A;  4BCN D;  1K1Z A;  2EIF A;  2EYZ A;  3X25 B;  1WJQ A;  2KYM A;  4B9W A;  1ZHI A;  4PK4 A;  3G4S A;  3SWN A;  1I5O B;  5GAM e;  4D8D A;  4HL4 A;  1BB9 A;  5GJW B;  4FL6 A;  1KXU A;  2ED1 A;  3BHU B;  1BI0 A;  2UZD B;  1QQJ A;  2X9H A;  8ATC B;  3PGG A;  1RAE B;  1WNL A;  1UGS B;  4C92 A;  4QSH A;  3ME9 A;  4II5 B;  2ZPE B;  3OYI A;  2R7G A;  1U8R A;  2JNG A;  2AHJ B;  4BCO B;  4K11 A;  4MFD A;  4EOI B;  5GAN 6;  1KC8 C;  2QQ8 A;  2DXT A;  2YRD A;  4OMN A;  1VQ6 Q;  3DLM A;  1NLO C;  2WMB B;  2FZC B;  4RTW A;  1TS9 A;  4XTW A;  3NMZ C;  1NM7 A;  4C92 G;  3G4S T;  1TG0 A;  5HCK A;  3VS2 A;  2HBP A;  2H3E B;  4JS5 A;  1YIT Q;  1UTI A;  1QCO A;  1QVF A;  4DA4 A;  4BCN B;  5CQX A;  5A0D A;  4OGC A;  4F7U F;  4MIM A;  3CC7 A;  4P5N A;  1FMK A;  1N27 A;  5I5Z B;  1W70 A;  3HBL A;  3P8D A;  4NS5 A;  1JEG A;  1VYW B;  2RF0 A;  2C0O A;  2DTI A;  3EG1 A;  2OTJ T;  2DBK A;  1RAG B;  4M4Z A;  1OPL A;  1IRX A;  1AVZ C;  2FZG B;  3JCM X;  2LW4 A;  3A1P A;  5I22 A;  4XTU A;  1MHN A;  2XDD A;  2DXB A;  5ECA A;  2COZ A;  1YFN A;  2CKK A;  3BDU A;  4KGV B;  4ZTJ A;  4FYW B;  2B9R A;  5KYX B;  2EYW A;  2SEM A;  1UHF A;  4PJN A;  4EON B;  4OB0 B;  1K8A R;  1WFW A;  1UE9 A;  1YWP A;  2GTO A;  1H26 B;  2RPN A;  1YJW A;  1G3N C;  1K9M C;  4X9D A;  5I21 A;  1W98 B;  1FVV B;  5C0M A;  1GUX A;  1D1A A;  5KYW B;  1VQ8 T;  4JRP A;  1D1B A;  4PFO A;  4BE1 A;  3QO3 A;  4IMY B;  4E7S A;  2QDY B;  2D8J A;  3QYE A;  2BS2 A;  3PIP A;  4EIK A;  4CFX B;  4L6V 5;  2R58 A;  3MP8 A;  1NJI R;  3VV0 A;  3M56 A;  4R56 A;  1UNH D;  2L3S A;  4Z89 A;  3VU3 C;  5GAN 8;  5KE3 A;  2DPP B;  2D0Q B;  2XID A;  5L2W B;  2BS4 A;  4G6L B;  5CK9 A;  4EPC A;  1M3A A;  1I07 A;  3UAT A;  2QQA A;  1D3B A;  1X69 A;  2WSE E;  1UDL A;  4EC8 B;  2IW8 B;  3M58 A;  3PVQ A;  5DQV A;  5ICP B;  1M1K R;  1VYT A;  3V7R A;  1VQM A;  2GBQ A;  5GAN 5;  3CCQ T;  2VGM A;  2JN0 A;  3R6O A;  3URG A;  1M90 U;  3JCM h;  2KRO A;  4C5H A;  3AT1 B;  1RAB B;  2X1N B;  2CZ6 B;  5CKH A;  5GMK e;  2R5M A;  2DEQ A;  2D8H A;  1ZLM A;  2LC4 A;  2O88 A;  4ELY C;  2XDB A;  4LD6 A;  2O4X B;  3NFC A;  3M54 A;  3M0R A;  3VYG B;  4A4F A;  1E7O A;  1K76 A;  2RI2 A;  3V8J A;  1B34 B;  4XU3 A;  3BDL A;  4FYY B;  4UC4 A;  4FSS A;  4DBH A;  3G71 A;  4M75 G;  3Q1J A;  4LUD A;  2VGN A;  5CEI B;  1DJ7 B;  3MP1 A;  1OPK A;  3CPW P;  2X4J A;  1GUX B;  3JCM Q;  1U1T A;  4JZ4 A;  3OYD A;  5CKD A;  3GBQ A;  3FJ5 A;  3LLR A;  2P4T A;  1AOJ A;  2LJ3 A;  3TW7 A;  1VQO T;  5CO7 A;  2QGG A;  3L2R A;  2DO3 A;  3BLR B;  2X4W A;  2C5V B;  2JM8 A;  2B8A A;  4N0A A;  3BHT B;  4EMK B;  2EQK A;  2ZPI B;  4C92 E;  3K7A M;  5L23 A;  2PUK B;  3HPW A;  4N4G A;  1VQ7 Q;  3A8O B;  4HVW A;  4CXA B;  1WHG A;  1RUW A;  3VUB A;  1NJI U;  3X28 B;  2L8D A;  3R6N A;  1Y7X A;  4PJO F;  4EOM B;  4BY7 X;  4XK8 E;  3ULR B;  2DA9 A;  2WIP B;  2PVO B;  3FC3 A;  3QHR B;  2YUQ A;  2QA4 Q;  4E47 A;  2KI7 A;  3QYB A;  1VYV A;  3CMA A;  1TUD A;  3UA7 A;  3VS0 A;  1K9M R;  3CD6 T;  4D6W A;  5IAY A;  1GH6 B;  1TOV A;  5GAM h;  3JCM P;  4DOW A;  1OX9 A;  4EOR B;  3J81 E;  4A54 A;  1N5Z A;  4XAX B;  3DJB A;  2GCX A;  2J06 A;  3HFN A;  1S72 T;  1QKW A;  3JRZ A;  1UUE A;  3KHI A;  3E9F A;  5GAO p;  3JCM W;  2W2H A;  1OL2 B;  4AKH A;  1MMN A;  3VRZ A;  1WJS A;  3G71 T;  3BG3 A;  4M7D G;  1AZE A;  3S3M A;  3OMC A;  2QGF B;  3VYG A;  2AZV A;  4E7Z A;  1Z9Q A;  1GL5 A;  1D0Z A;  2E6N A;  4HKE A;  3HRT A;  1QP2 A;  3ZEH A;  3BFM A;  4BE2 A;  2CP7 A;  2M16 A;  4LDU A;  2DYI A;  2D6F A;  2DTO A;  3CCV T;  4YC3 B;  4M7D A;  5EJC A;  1BU2 A;  3QKJ A;  2BKD N;  3MY1 B;  1R0C B;  3A98 A;  3NGP A;  2LRQ A;  3MEW A;  1G3S A;  2CH4 A;  4TTH A;  3OYG A;  2VYT A;  3CC2 T;  2K2M A;  4XU0 A;  1GFC A;  4BUG A;  2YUO A;  5CKF A;  4OMO A;  4JPB W;  1XQH A;  3CCJ Q;  1MV0 B;  4KUD K;  2V8I A;  5C6S A;  4E7L A;  1YIJ T;  1W2B S;  2DJZ A;  3JCM V;  1C6V X;  2YDL A;  1HYO A;  2K4Y A;  3JB9 I;  4RCC A;  3BLH B;  2RJF A;  3QJY A;  1ZP2 A;  5IDP B;  4C0D C;  3LW5 E;  4PNO A;  1VQP A;  2ZCF B;  4KGZ B;  4OB2 B;  2NUT A;  2BKZ B;  1ZSZ B;  3CBO A;  1QWF A;  3EG0 A;  4HCK A;  4XTY A;  3OYJ A;  2PQW A;  3E19 A;  2K3X A;  1PD0 A;  4ME7 A;  4ZNX A;  3HKS A;  1OYX A;  4J9E A;  3BHV B;  4KUI A;  3REA B;  4IUT A;  4M75 C;  2EFI A;  1BBZ A;  3JB9 J;  5GMK j;  5KYX A;  4AFU C;  4ZTF A;  3EFO B;  1YIT A;  4Z8A A;  1ACM B;  4Z6Y A;  2F2X A;  5CAI A;  2MMP A;  1GRI A;  3H6Z A;  1H1P B;  3CD6 Q;  4C5G A;  1IO6 A;  4Z88 A;  2A0F B;  9ATC B;  3PE0 A;  1KG1 A;  5AYF A;  5CYI B;  5D6W A;  3C4S A;  2A36 A;  2JM9 A;  2A37 A;  2J05 A;  3EHR A;  3FB9 A;  3QG1 A;  1KD1 U;  1PSF A;  3M9Q A;  2DIL A;  1OKV B;  2IVX A;  1PNJ A;  4FYV B;  4CFN B;  1Q81 C;  3OS0 A;  1Q81 R;  2EPD A;  5GMK m;  3OYN A;  2QAS A;  4M7A D;  5CIU A;  5FU7 B;  3EFR A;  2MOX A;  1VQN T;  1JJ2 S;  1LPL A;  3L42 A;  3HSB A;  2WMA B;  4GY5 A;  1CSK A;  5DLO A;  4PJO C;  3EG2 A;  1X6O A;  3SEM A;  1KQ2 A;  4NC6 A;  1RAH B;  2W96 A;  2JZ2 A;  3VJP A;  4BE0 A;  3JCM J;  1WQ7 A;  3CPW S;  2K5I A;  1RAA B;  1KSW A;  4N4I A;  2H3J A;  2RK2 A;  2EWN A;  4CRL B;  4J5Y A;  1WHL A;  1UJ0 A;  3FDR A;  2CUD A;  2EKH A;  1SRL A;  1V29 B;  3I9Q A;  1H28 B;  1YP5 A;  3L2V A;  4OMQ A;  4M75 A;  2O2O A;  4J9H A;  3C94 A;  1H64 1;  4X1V A;  5ACB A;  1SSH A;  4DBR A;  3H41 A;  1WA7 A;  1K9A A;  2YUP A;  4Z02 A;  1QVG A;  4Y91 A;  2DYB A;  3M59 A;  1TUC A;  3CME T;  4XU1 A;  2CZ0 B;  5LJ3 f;  4A4K A;  3PVL A;  4XTV A;  5KH6 A;  2EJF A;  5LMK B;  2DX1 A;  4ZGE B;  4C8Q B;  2LJ0 A;  4MDX A;  3QDR B;  5IXB A;  2OTL Q;  2NUT B;  3G6E A;  2JJ9 A;  3G33 B;  4M77 D;  4Y28 E;  4CI0 C;  1X01 A;  4PL6 A;  1ZUU A;  3CCE Q;  1WPY A;  5GAM j;  3I56 T;  1X27 A;  1ZSG A;  5IHN A;  2A08 A;  3CC2 Q;  2ROT A;  1BU1 A;  4XTZ A;  3OB9 A;  3RIR A;  2IW6 B;  3CC7 T;  4M78 E;  3NTK A;  2FPD A;  1PWT A;  4F7U E;  1TXQ A;  3QHW B;  4CFU B;  5DY9 A;  2HDA A;  3EGX A;  4C8Q G;  1VQL Q;  1P92 A;  1M2V B;  4C5I A;  2V1R A;  1S72 A;  3NTI A;  3I5R A;  2DL5 A;  1PHT A;  2QQB A;  4CC2 A;  3OSS C;  2DD4 B;  1I1J A;  2RJD A;  1M4Z A;  1VQ7 T;  5GAN 7;  2BZX A;  3LWH A;  3GLX A;  4PLL A;  4JRI A;  4L5G A;  4HLQ A;  4WF2 A;  1M1K C;  3M0U A;  4AG2 C;  4LOC A;  2PMI B;  4A4G A;  1JKW A;  1NG2 A;  3TSZ A;  4J9C A;  2A28 A;  1K9M U;  2DJQ A;  3GNF B;  1VQK A;  1K4U S;  1D09 B;  3LYI A;  4F7J B;  5IH2 A;  4OF1 A;  2L3P A;  2KT8 A;  5GAM g;  4CFU D;  2IIM A;  2V8K A;  1NJI C;  4BCQ B;  4A63 B;  4BCM B;  2KDS A;  4PJO G;  5GAO m;  1FXX A;  1SHG A;  3BG9 A;  2M9U A;  2HQH A;  4HNV A;  3H0H A;  4C92 C;  2X35 A;  5D6X A;  1OIU B;  1X75 C;  2RJC A;  2OTJ Q;  2WSF E;  2ZPH B;  3JCM c;  1AD5 A;  3L1A A;  3CCL T;  4RTU A;  4F14 A;  5IXF A;  1VQ6 T;  1BCM A;  4PJO A;  1NPP A;  4JX6 A;  1RI9 A;  1U1S A;  2MPX C;  4C8Q F;  1G5V A;  1H3Z A;  4J7F A;  2M0O A;  2VWF A;  5KCO A;  1H8K A;  4MZP A;  1SSF A;  2DVJ A;  2FG0 A;  4LDX A;  3MIA B;  1UNG D;  3M03 A;  4IIO A;  5LJ3 d;  3FJP A;  1Y57 A;  1KIK A;  2QXF A;  3EFS A;  2E5K A;  1VQO Q;  4LDW A;  2QYZ A;  1H4L D;  2CP6 A;  3G6E Q;  1OU9 A;  2PJQ A;  1JQQ A;  3NHN A;  4IUR A;  3GIB A;  3O8V A;  3ASK A;  2VUB A;  3UPU A;  2E1H A;  4C5E A;  1YWO A;  4HXJ A;  3OYK A;  2O9S A;  2KRN A;  1NEG A;  3S3O A;  3MJX A;  4OVA A;  1QVF S;  1OU8 A;  4JRK A;  2VXF A;  1OKW B;  1TUG B;  5IHK A;  4PLI A;  3L2Z A;  1SPK A;  2DD5 B;  1WHJ A;  2QDJ A;  4FW1 A;  2HBW A;  2CZ1 B;  2GGR A;  4D8K A;  2DZC A;  4ZN1 A;  2X3X D;  3M53 A;  4FW2 A;  2DNU A;  2ECZ A;  1YJ9 T;  3CD6 A;  1XO2 A;  3RDV A;  2D9T A;  1YHQ T;  4J9F A;  1Y96 B;  3JB9 H;  1I8F A;  1PKS A;  1VQ5 T;  2ZPG B;  1YJN T;  1QVG S;  2RN8 A;  2BIV A;  2GFU A;  1YI2 A;  1YJW T;  2FRW A;  1QKX A;  1VA7 A;  2DAQ A;  4PKC C;  4E2F B;  5HBH B;  1LNX A;  1VQL T;  1QMC A;  4C0Z A;  3S3N A;  1P5E B;  1RAI B;  1QMZ B;  1B3Q A;  3PFS A;  3N5B B;  4CFV B;  1FKM A;  4MMK A;  5KYY A;  1YCY A;  2RA2 A;  2DZ9 A;  2KT1 A;  3L2W A;  4J8O A;  3I55 Q;  1FMW A;  2PK9 B;  2KMT A;  2PHG A;  3SHW A;  4CC7 A;  3CME A;  4HT9 A;  1ZUY A;  4J9B A;  4BCJ B;  2I40 B;  4LE9 A;  4ESR A;  3X20 B;  1BCO A;  3G1J A;  1Y0M A;  2EGC A;  3CCS Q;  4QQD A;  1D1C A;  1PC0 A;  1AWJ A;  1HXD A;  2EYQ A;  2LT4 A;  3VUZ A;  1VQ6 A;  3CCS T;  3KUF A;  1Q7Y R;  1PD1 A;  2RK1 A;  4BCQ D;  4RTX A;  2NUP A;  4GLK A;  5FW9 A;  3HL8 A;  3DDQ B;  4E7K A;  1KC8 U;  4M7D C;  1ABQ A;  3UWN A;  1JO8 A;  2CGH A;  3TNH B;  1URC B;  2EJG A;  1YJ9 Q;  2LNV A;  4ZN3 A;  4ORZ A;  4RG8 A;  1N8R C;  3PT9 A;  2VAS A;  4NST B;  1SKU B;  1M3B A;  1WXU A;  2IPO B;  3D7S B;  3CXC P;  1JXO A;  4PJM A;  2ZGW A;  5EC7 A;  1M3C A;  3GTM S;  1YN8 A;  4WTO B;  2E5Q A;  4PFP A;  3E1S A;  3TRE A;  4EC9 B;  3DLL A;  2ZPF B;  1K73 R;  1AZG B;  1BIA A;  4JJB A;  4M78 F;  2PK2 A;  3OYF A;  1Y07 A;  1X2Q A;  1NEB A;  2E65 A;  1NLP C;  3J80 E;  3OYL A;  1ZA2 B;  1O75 A;  2VC8 A;  1NE8 A;  4JJN K;  2GF7 A;  1MUZ A;  2OJ2 A;  4MFE A;  1FX7 A;  4HVV A;  4BBR M;  1HSQ A;  1UFF A;  3CCM T;  2K57 A;  2X51 A;  1VQO A;  3LWI A;  4FX3 B;  4AG1 C;  3CCU A;  2YHT A;  3G6E T;  2DIQ A;  4KGX B;  2E10 A;  1XNI A;  4KH0 B;  2F1L A;  2EYX A;  1IXD A;  3QSU A;  3CCR Q;  4QVC A;  2RMO A;  4A53 A;  1M27 C;  4N0A C;  2K3Y A;  4M75 D;  1JJ2 A;  4OGR B;  3T9N A;  2NWM A;  2DL4 A;  3BG5 A;  2QEX A;  1YJ9 A;  1WLP B;  1KQS S;  2FYK A;  2DET A;  2M1H A;  4F04 B;  3RER A;  2BUD A;  5LJ5 e;  4A4H A;  3CC4 A;  2DER A;  1OOT A;  4EMH A;  1LJO A;  4FM4 B;  4JLI A;  1H1S B;  4QKU A;  3RES A;  2BPM B;  2E12 A;  4R55 A;  1N9S A;  5HNB B;  4RCB A;  3QPH A;  1GBQ A;  3SWN C;  1WHK A;  3V8L A;  2EJ9 A;  3CBM A;  4C92 F;  2AKL A;  1YIJ A;  1EX4 A;  3SB2 A;  3HB9 A;  4J6W A;  1CKA A;  1NPR A;  5GAN 3;  2QTV A;  3E9G A;  4J6X A;  4M75 F;  3CCM Q;  5GAN j;  2QK0 A;  4EOJ B;  5DLQ E;  2G9X B;  3RKX A;  1BI1 A;  1PRM C;  4C8Q C;  2HNI A;  1K0X A;  3CCS A;  1VQM T;  2SRC A;  4MZT A;  1D3B B;  3OBW A;  3OW2 P;  2UZB B;  1OUL A;  2O9V A;  3CEY A;  5AT1 B;  1VIF A;  2K6D A;  4DQ2 A;  5GAO r;  3MP6 A;  2RQW A;  3VS1 A;  3S6W A;  1Q81 U;  4F7S B;  3MO8 A;  2OAU A;  5J26 A;  4NL3 A;  3CCJ A;  1M8M A;  1VQ4 Q;  2XG8 D;  5FU6 B;  1OI1 A;  2G3R A;  3GP8 A;  4M6V A;  3PMI A;  5A2Q E;  2EKO A;  4M78 D;  4LNP A;  4NL2 A;  3P8H A;  2F5K A;  2HMA A;  1GXI E;  2NLU A;  3OA6 A;  1UG1 A;  2EQJ A;  4BB7 A;  1NBE B;  2ROL A;  3KBG A;  2KR3 A;  1KQ1 A;  4OP0 A;  2IN3 A;  2XKO C;  1QCF A;  2GQV A;  1RAF B;  2QQS A;  4EMG A;  5KYW A;  1H25 B;  3TCJ A;  5CVI A;  1N8R R;  3TEE A;  3OYA A;  1HK9 A;  1R8O B;  3DOG B;  5KE2 A;  5IN1 A;  5IHY A;  1I5L A;  2RHZ A;  3C0C A;  3TW6 A;  3LGF A;  3M5A A;  2EAY A;  2HEQ A;  1AWX A;  4QQG A;  7AT1 B;  2WAC A;  1V76 A;  5EFQ B;  1IHV A;  1TSF A;  2NUP B;  4BDZ A;  4DEY A;  4JUV A;  4M78 B;  2DLP A;  4PJO D;  4CRI A;  3ER0 A;  3GF5 A;  3CCV A;  4F7N B;  3CC4 Q;  4KRT A;  4Y92 A;  5I2S A;  4ROC A;  2EVR A;  2KY9 A;  4EOQ B;  3HRS A;  3AHU A;  1MV3 A;  3MEA A;  5GJV B;  2DXC B;  1E9H B;  4AT1 B;  2E3H A;  1VQN A;  1OV3 A;  2LQ8 A;  4X34 A;  1G3Y A;  3M4Y A;  1VQ5 Q;  4IUU A;  3SDZ A;  3VKG A;  1H24 B;  2P0Q A;  2W0Z A;  2QDL A;  2E6Z A;  4HCB A;  4BCM D;  2BE7 D;  2KRS A;  1UHC A;  2C6T B;  1WX6 A;  2LNH B;  3M0T A;  3OYH A;  3CXC A;  3KXT A;  3JCM f;  1QW1 A;  3FRN A;  4F17 A;  3DKM A;  2XMF A;  4KT0 E;  4JJC A;  3EG9 A;  4FT2 A;  2ESW A;  2YXY A;  3ZBD A;  4BCP B;  4RTT A;  1O9K A;  5A0G A;  3O0G D;  3JAM E;  3M0P A;  1G2B A;  1UNL D;  2FHD A;  2VB6 A;  2QG9 B;  2WJ9 A;  2DD5 A;  3DL1 A;  4FT4 A;  5GAN f;  3BLQ B;  2DE0 X;  3MEV A;  2QA4 T;  5I2M A;  2ENM A;  1M1K U;  2RHI A;  5GMK l;  2COW A;  3SWN B;  2CSI A;  2DD4 A;  4E7H A;  1LVK A;  2HL5 C;  2KGT A;  3UA6 A;  1OX8 A;  2QEX T;  2JOY A;  2E70 A;  3PIO A;  1VQP Q;  3I56 Q;  1H92 A;  3V7C A;  2QQ9 A;  2KXD A;  2FVU A;  5KYU A;  4C0F A;  2RI5 A;  2V1Q A;  2LQW A;  4NOY A;  1AIS B;  1VUB A;  4KRC B;  4RG2 A;  5LJ5 d;  4YOO A;  3ZFJ A;  3H8Z A;  5LL6 S;  2A7Y A;  4ATO A;  1UB4 A;  3QYG B;  4IUQ A;  3JCM e;  2K5L A;  1Q95 G;  3QHS A;  3M0Q A;  5FRM A;  2C0T A;  2LCS A;  2QFZ A;  1RLQ C;  5GMK h;  3DTO A;  2KQW A;  2FL7 A;  3DB4 A;  4UN0 A;  2KK4 A;  4YOS A;  2JT4 A;  3CPF A;  2RQU A;  1K73 U;  5GAN e;  5J3B A;  2OTL A;  2WEV B;  3C12 A;  2KMG A;  3OS5 A;  3CQT A;  2QGS A;  1MNE A;  5D7U A;  1OZ2 A;  2CP5 A;  4C8Q E;  3INZ A;  1Y71 A;  5LJ3 g;  3CCE A;  2VV5 A;  4F7U G;  2XI9 A;  4M78 G;  3TQ7 P;  2JXB A;  2LX9 A;  5GAN h;  1OGU B;  5HVY B;  1MMD A;  4M7D B;  2CRE A;  1KFZ A;  3JB9 F;  2DM1 A;  1G3T A;  1IGU A;  2LDM A;  1VQ8 Q;  2C5O B;  5HBJ B;  2DME A;  3EID B;  4M75 B;  4JX5 A;  3M0S A;  5HY6 A;  1KD1 C;  3F70 A;  2AKK A;  2PVG B;  4RTY A;  1VIN A;  3RKW A;  2PZ1 A;  5D6Y A;  2LX7 A;  2BZY A;  1PKT A;  2C06 A;  4HCZ A;  1M2V A;  3CMA Q;  4BD3 A;  3VS4 A;  3CCE T;  3EGX B;  1OL1 B;  2KEA A;  3PO3 S;  2KRM A;  3A8H B;  3QJ6 A;  4J6Y A;  2PNI A;  1YJW Q;  2KNB B;  2DK3 A;  4J83 A;  5CR2 A;  5FGK B;  3V8K A;  2EW3 A;  3EGD B;  3CC4 T;  2HKN A;  2VVK A;  2WFY B;  1FIN B;  4F70 B;  1JU5 C;  1HJD A;  2NUZ A;  1VOM A;  3BY7 A;  4FYX B;  2QA4 A;  2AZS A;  2K3B A;  1FWZ A;  3HHT B;  3WXM B;  1AWW A;  4ZGD B;  2LMJ A;  1KQS P;  4C8Q A;  1HD3 A;  4M77 B;  2JW4 A;  2P0P A;  4EOP B;  4L59 A;  1V1C A;  2MI6 A;  2GTJ A;  5KYU B;  2FB7 A;  2MAM A;  1WXB A;  4EMK A;  2OAW A;  1YJN A;  2LZ6 B;  4LDV A;  2KYB A;  2KSS A;  2OI3 A;  3OYC A;  1JXM A;  3B57 A;  3EG3 A;  3QXE B;  2MWO A;  4EOL B;  2DEU A;  5CKE A;  4HA8 A;  4ELZ C;  2QEX Q;  4EOK B;  1O9S A;  1KK7 A;  5HQ0 B;  1WZO A;  1T3S A;  1N8R U;  5EG2 A;  5HK3 A;  1M8V A;  4XU2 A;  5IF1 B;  3EG9 B;  5GAN 2;  3VRY A;  1YI2 T;  1I81 A;  6AT1 B;  2KE9 A;  2QTX A;  4BCI B;  2F2C A;  4O6J A;  2CCI B;  3IQL A;  3MHX A;  1C1A A;  4JJD A;  2JUF A;  2C0I A;  2YSQ A;  2X4Y A;  4QW2 A;  2E4H A;  2O4X A;  5IDN B;  2EGE A;  3RBB B;  1U3O A;  3RNJ A;  2DXU A;  2X3W D;  3EH2 A;  1FMV A;  1UGQ B;  4OMP A;  1IGQ A;  3H9N A;  3JV3 A;  3SFM A;  4E7I A;  1GBR A;  3VS5 A;  3TVT A;  2CH4 W;  3OYE A;  4M7A A;  1EZZ B;  3VS6 A;  4AFS C;  2WXV B;  2RNA A;  2RO0 A;  3RMQ A;  1WIE A;  1ZQ1 A;  1OI9 B;  2WPA B;  2E41 A;  3A8G B;  3DB3 A;  4RMO A;  1VQK T;  2RI3 A;  1RI0 A;  4AKI A;  4RUG A;  4M7A C;  3GNG A;  4E6R A;  1QVG P;  3KFV A;  1WXT A;  2WSC E;  2HQE A;  3HFO A;  1IHW A;  2PTK A;  4BI3 A;  2HKQ B;  2IG0 A;  1Q86 U;  3CCQ A;  2H8H A;  3TNI B;  2XHC A;  4JDS A;  3TU4 K;  2OTJ A;  2D1X A;  4EMK C;  4VUB A;  5LJ5 h;  4Y72 B;  2XK0 A;  2B86 A;  2PU9 B;  1G8X A;  1XOV A;  4DEX A;  4YOZ A;  2XU8 A;  3CCR T;  4HCC A;  1K8A C;  2YUN A;  2F2W A;  5LJ3 h;  2DL3 A;  1YJN Q;  1Q82 U;  1CKB A;  4JZ3 A;  1M1G A;  3H4C A;  4GBQ A;  2M51 A;  4HNT A;  2M02 A;  2MF2 A;  2J7I A;  1M30 A;  2MCN A;  4RTV A;  2A3L A;  1K0S A;  1VIE A;  3FLG A;  2ZPB B;  1JSU B;  3TN8 B;  4ELL A;  1LOJ A;  2JVV A;  1KHC A;  1YIT T;  5J39 A;  3CCV Q;  3QBY A;  3QZ9 B;  2O01 E;  2OX7 A;  3CC2 A;  3TNW B;  4M77 C;  3UDC A;  2EGA A;  3VS3 A;  2ATC B;  2HL3 A;  4O5V A;  2DVE A;  1OIY B;  2M0Y A;  2AK5 A;  4ELJ A;  2DKG A;  5GAM d;  4QQ6 A;  3X26 B;  1PKD B;  2HSP A;  1VOL A;  2ZAE A;  4II1 A;  3O5Z A;  1S72 Q;  4ROE A;  4DOV A;  2L3Q A;  1O9K B;  2Y4X A;  3I5S A;  2VXE A;  3MET A;  3BE3 A;  1SEM A;  2QF7 A;  4EOS B;  2CP0 A;  3SD4 A;  3POM A;  4BY6 C;  5BNJ B;  4PFZ A;  3EGU A;  1MND A;  2RHX A;  4C92 B;  1X6B A;  1C0M A;  1ARK A;  1W1F A;  2EUF A;  4M7D D;  2DL8 A;  3MEU A;  2HAX A;  1EIF A;  4CFM B;  1JRI A;  1QVF P;  2LQN A;  3CC7 Q;  1BYM A;  4F7L B;  1BI2 A;  4BAC A;  4LN2 A;  4B9X A;  5GAM f;  5GAO n;  4C0D B;  3A5Z B;  3CPW A;  5LJ5 j;  1M9S A;  2L2P A;  2FEI A;  4KUL A;  1ZSZ C;  1Q7Y C;  3V7S A;  1J3T A;  4M77 F;  1QLY A;  1W2B P;  1ZA1 B;  2R57 A;  5KYN A;  1KQS A;  1SHF A;  3I56 A;  1EFN A;  1MMG A;  1H27 B;  2CSQ A;  1KHI A;  4C0G A;  2F69 A;  4M75 E;  2JMA A;  1NZ9 A;  4M78 A;  1QVP A;  5KYY B;  3CCM A;  3QWX X;  1QLB A;  1ZUK A;  1AT1 B;  1QP3 A;  2K9G A;  1A0N B;  2C5X B;  2UUE B;  1NYF A;  1GCQ A;  5LQF B;  4BXX X;  1N6A A;  3QWY A;  1WQW A;  3VYH B;  4QVZ A;  2HZY A;  4IKF A;  3HTR A;  1RAC B;  2LT1 A;  5GMK i;  4EOO B;  2RM4 A;  2YWW A;  3OW2 A;  2CP2 A;  1M2O A;  1T3L A;  1WJR A;  1D3U B;  1WDX A;  3LGL A;  1UGR B;  4OB3 B;  1IZ6 A;  3BW1 A;  1VQ4 A;  4PJJ A;  3VKH A;  2DRK A;  2RB6 A;  2W10 A;  3H0I A;  4OMF B;  1R0B G;  3OS1 A;  4F6W B;  1JOW A;  2ABL A;  5FRO A;  2JS0 A;  2CT3 A;  2DF6 A;  1FYN A;  1YHQ Q;  2BS3 A;  1WI7 A;  1WHH A;  1B34 A;  3A8M B;  3OYB A;  1G83 A;  5LJ5 g;  3P8B B;  2CS7 A;  3FEO A;  1PG5 B;  1JB0 E;  2W9F A;  5FU7 C;  1T0H A;  3CME Q;  4AFZ C;  4BCF B;  2E3I A;  3C95 A;  2DL7 A;  2JTF A;  1IRE B;  1TD6 A;  1PCX A;  3RMS A;  2DMO A;  4LUE A;  2I53 A;  4B6M A;  3RR6 A;  3VKI A;  1VQ4 T;  3RUX A;  2CYZ B;  3PTA A;  2PUO B;  2UZL B;  2X4X A;  1WHM A;  1JJ2 P;  2E64 A;  4C8Q D;  3NTH A;  2C5N B;  3I35 A;  4KRD B;  4M7A B;  5KCH A;  4JX4 A;  4CC4 B;  3QDF A;  4F6S B;  2W9Z A;  2LCC A;  3G71 Q;  4BDY A;  2KAF A;  4BY1 X;  5DQW A;  2J6F A;  3FIF A;  1SF9 A;  3LQ5 B;  3QUI A;  1OQK A;  1VQP T;  3JCM b;  2IW9 B;  1G3W A;  1UEC A;  2XD0 A;  3OYM A;  3HRU A;  1K73 C;  2AT1 B;  5DM7 R;  3JB9 G;  2BZ8 A;  4FU6 A;  2FPE A;  1OZ3 A;  1VQN Q;  2CDT A;  2KXC A;  4XQ3 A;  1YNZ A;  1VQ5 A;  3TSW A;  3EOC B;  2K79 A;  3M57 A;  2JGZ B;  3OMG A;  2ZZD A;  3J7A F;  2YLB A;  1QWE A;  2KR6 A;  1AWO A;  2RHY A;  1PSE A;  2CZ7 B;  1AD6 A;  1E7P A;  2R5A A;  1TWB A;  1H1Q B;  4OMM A;  4HNU A;  1TFB A;  2O31 A;  1YHQ A;  4J9G A;  4ANJ A;  2YLC A;  3LX7 A;  2MWP A;  1VQ7 A;  1C9B A;  2V8J A;  3OBY A;  4KBM B;  4C92 D;  1WYX A;  4V2S A;  4BCG B;  2Y4Y A;  2FPF A;  3OS2 A;  3MCA B;  2CJM B;  3EHQ A;  2DXB B;  4PJO E;  2D0N A;  2NYS A;  5L8R E;  1N9R A;  2V22 B;  2RQT A;  3EJ1 B;  4A4E A;  1KC8 R;  4QVD A;  1ABO A;  8AT1 B;  2LJ1 A;  5GAN 4;  4IIM A;  3EH1 A;  3GPL A;  2W99 A;  4JLG A;  1I4K 1;  2RQR A;  4M77 A;  3CCJ T;  2F5T X;  4HVU A;  2EQU A;  2LTO A;  4BBS M;  1OEB A;  2F2V A;  1ZBJ A;  3WVD B;  4PJO B;  4BI8 B;  1W2B A;  1IB8 A;  1F1B B;  2GQI A;  4AFQ C;  2RHU A;  3JSC A;  2CCH B;  1UGV A;  4LD9 K;  1UEB A;  4KH1 B;  3CMA T;  4OB1 B;  5FU6 C;  4M7A F;  1B07 A;  2Z0W A;  3M4G A;  1YCS B;  5GAO q;  4RTZ A;  1N4M A;  3WVE B;  1JBM A;  2BTT A;  3E2U A;  3OW2 S;  3MI9 B;  2KVQ G;  3UF4 A;  1TU0 B;  4BY6 B;  4M7D F;  2KBT A;  1GCP A;  1XJW B;  1H1R B;  4RKU E;  1YIJ Q;  1D0X A;  1E6G A;  1Q82 R;  1ZX6 A;  3RGF B;  5FLX E;  3LH5 A;  1GY3 B;  1I0C A;  5HK0 A;  2YT6 A;  3OQ5 A;  2L89 A;  5FWB A;  4M77 E;  3CCU Q;  3JCM d;  5FRN A;  2COY A;  3CCQ Q;  1U06 A;  4F6U B;  4M7A G;  2J6K A;  2DIG A;  2P4R A;  3REB B;  4J9I A;  3MY5 B;  5IT9 E;  1VQM Q;  2LQK A;  1VQ8 A;  1M90 C;  3QZ5 B;  3JCM g;  2BE9 B;  4HT8 A;  2MYS A;  1MGQ A;  2HD0 A;  4IUP A;  4QT7 A;  2XIC A;  4J9D A;  3CCU T;  3MPU B;  3HZJ A;  5IHI A;  2L5Q A;  1SRM A;  3F5X B;  3HO8 A;  1SG5 A;  1TH7 A;  5A0L A;  5CQY A;  4R0K A;  4OGE A;  2UZE B;  1X2K A;  2XDP A;  1K8A U;  3I55 A;  4BCK B;  2JS2 A;  4MDW A;  4X9C A;  4E7J A;  5M9O A;  2Y90 A;  4F7U B;  5CKB A;  2HSE B;  4F16 A;  1Y96 A;  1W6X A;  2ED0 A;  4N4H A;  2I2L A;  1BKB A;  3CXC S;  1AEY A;  3EAE A;  3PMT A;  1JST B;  3QII A;  4LDY A;  2J6O A;  3JB9 D;  3ZL7 C;  3LH0 A;  3L2Q A;  1YBY A;  3EFO A;  4JRQ A;  4DBF A;  2FO0 A;  3OY9 A;  4JS4 A;  2DFU A; 
#chains in the Genus database with same CATH homology
 3QKJ A;  3GNG A;  4M7A C;  2RD1 A;  1VQO A;  5GAO l;  2BKD N;  3LWI A;  1Q86 C;  2JTM A;  2WSC E;  3CCU A;  2HQE A;  3HFO A;  2GFA A;  2YHT A;  2LRQ A;  3MEW A;  3G6E T;  1G3S A;  2DIQ A;  2E10 A;  2P0K A;  3OYG A;  4BI4 A;  4BI3 A;  1XNI A;  1UGP B;  2VYT A;  2IG0 A;  1Q7Y U;  4XU0 A;  4BUG A;  3CCQ A;  1Q86 U;  2K2V A;  3CC2 T;  5CCA A;  3CCL A;  2XHC A;  5CKF A;  1VQL A;  3QSU A;  4QVC A;  4JDS A;  3TU4 K;  2ZZD B;  4A53 A;  2OTJ A;  1XQH A;  4EMK C;  4VUB A;  5LJ5 h;  4KUD K;  2V8I A;  2XK0 A;  4N0A C;  2K3Y A;  3A8L B;  4M75 D;  5C6S A;  4E7L A;  2PU9 B;  1YIJ T;  3T9N A;  1W2B S;  1JJ2 A;  2DJZ A;  1VQ9 A;  3JCM V;  3BG5 A;  1XOV A;  2QEX A;  1YJ9 A;  4AI6 A;  2K4Y A;  3M55 A;  4RCC A;  3JB9 I;  3OYY A;  1KQS S;  2RJF A;  4AKG A;  4XTX A;  1Q82 C;  3QJY A;  2XU8 A;  2FYK A;  3GOX A;  4C0D C;  3CCR T;  4HCC A;  2M1H A;  1K8A C;  3LW5 E;  4PNO A;  1VQP A;  2ZCF B;  2YRV A;  3RER A;  2BUD A;  4OB2 B;  5LJ5 e;  5LJ3 h;  4A4H A;  3CC4 A;  3CBO A;  1Q82 U;  2PVD B;  1RL2 A;  5GAN d;  2HQX A;  4EMH A;  1LJO A;  4XTY A;  4FM4 B;  4JLI A;  1M1G A;  4FSX A;  3OYJ A;  3H4C A;  2PQW A;  2DXC A;  3RES A;  2E12 A;  3E19 A;  4R55 A;  1N9S A;  4HNT A;  4M78 C;  2K3X A;  2MF2 A;  4RCB A;  2QQR A;  4ME7 A;  3HKS A;  3QPH A;  4ZGJ B;  3SWN C;  1OYX A;  3V8L A;  3HP9 A;  2A3L A;  2EJ9 A;  2G77 A;  3CBM A;  4Q5W A;  4C92 F;  1YIJ A;  1VIE A;  3FLG A;  4J7I A;  3SB2 A;  2ZPB B;  3PNW C;  4KUI A;  1W4S A;  1LOJ A;  3UT1 A;  3HB9 A;  4IUT A;  1NPR A;  4J6W A;  2JVV A;  2EFI A;  1KHC A;  4M75 C;  1YIT T;  5J39 A;  1KC8 C;  3JB9 J;  5GAN 3;  3RKY A;  3E9G A;  4J6X A;  4M75 F;  5GMK j;  5GAN j;  3I55 T;  5HKC A;  4ZTF A;  3QBY A;  5DLQ E;  1YIT A;  3QZ9 B;  2O01 E;  2L3R A;  4Z6Y A;  3RKX A;  3CC2 A;  1BI1 A;  2MMP A;  3OSV A;  5CAI A;  5LJ5 f;  3L2U A;  4YTL A;  4C8Q C;  4M77 C;  3H6Z A;  1WGS A;  2HNI A;  3UDC A;  4C5G A;  3CCS A;  1VQM T;  5GAN g;  4MZT A;  4O5V A;  2DVE A;  5AYF A;  1D3B B;  1KG1 A;  3OBW A;  1XTD A;  5D6W A;  3CEY A;  4ELJ A;  2DKG A;  1VIF A;  3C4S A;  3X26 B;  1M5Q 1;  4QQ6 A;  4DQ2 A;  2DTH A;  5LJ3 e;  5GAM d;  5GAO r;  3MP6 A;  5LJ3 j;  4II1 A;  3FB9 A;  3QG1 A;  3S6W A;  1AHJ B;  2K5F A;  2LCL A;  1PSF A;  3M9Q A;  3MO8 A;  4EDU A;  1KD1 U;  2OAU A;  5J26 A;  4NL3 A;  3CCJ A;  4DOV A;  3CCR A;  2XG8 D;  5FU6 B;  1OI1 A;  4MML A;  2Y4X A;  2G3R A;  1Q81 C;  3GP8 A;  4M6V A;  2VXE A;  3OS0 A;  3X24 B;  4MZM A;  3PMI A;  2QI2 A;  3MET A;  2EQM A;  5GMK m;  3OYN A;  5A2Q E;  2EKO A;  4M78 D;  3G7Z A;  2RJE A;  4IUV A;  4NL2 A;  2OTL T;  4M7A D;  3P8H A;  2F5K A;  5CIU A;  5FU7 B;  3EFR A;  1VQN T;  2QF7 A;  4F7U A;  1JJ2 S;  3L42 A;  1VQ9 T;  3HSB A;  3SD4 A;  4GY5 A;  4BY6 C;  5DLO A;  4PJO C;  1GXI E;  1M1F A;  2NLU A;  1BIB A;  1BI3 A;  1X6O A;  2EQJ A;  3CBP A;  4BB7 A;  3OA6 A;  1KQ2 A;  4M7A E;  3KBG A;  2IVW A;  2RHX A;  4OP0 A;  1KQ1 A;  4NC6 A;  2XKO C;  4C92 B;  2GQV A;  4M77 G;  2QQS A;  4EMG A;  4M7D D;  3TCJ A;  5CVI A;  2JZ2 A;  3TEE A;  3VJP A;  3OYA A;  4BE0 A;  3JCM J;  3QYH B;  1WQ7 A;  3CPW S;  2K5I A;  4TVR A;  2HAX A;  1HK9 A;  1R8O B;  2LVM A;  3MEU A;  1EIF A;  1JRI A;  2H3J A;  2RK2 A;  3QWL A;  2EWN A;  4N4I A;  4J5Y A;  5IN1 A;  5KE2 A;  4M7D E;  1BYM A;  1BI2 A;  4BAC A;  1ZBX A;  2RHZ A;  3FDR A;  4B9X A;  5GAM f;  5GAO n;  1I5L A;  3TW6 A;  3LGF A;  4C0D B;  3A5Z B;  3M5A A;  3CPW A;  5LJ5 j;  2RH2 A;  1M9S A;  4FIB A;  2EAY A;  4KUL A;  1Q7Y C;  3V7S A;  1V29 B;  4QQG A;  4M77 F;  2WAC A;  3L2V A;  4M75 A;  2R57 A;  3C94 A;  1H64 1;  1KQS A;  3I56 A;  4BDZ A;  2EIF A;  3X25 B;  1KHI A;  1WJQ A;  4B9W A;  4JUV A;  4C0G A;  4M78 B;  1ZHI A;  2F69 A;  3G4S A;  4M75 E;  3SWN A;  4Z02 A;  1QVG A;  5GAM e;  4Y91 A;  4CRI A;  1NZ9 A;  4M78 A;  4PJO D;  4HL4 A;  1QVP A;  3ER0 A;  4FL6 A;  3GF5 A;  3CCV A;  3CCM A;  1QLB A;  3M59 A;  1BI0 A;  5I2S A;  1QP3 A;  3CME T;  2KY9 A;  3HRS A;  4XU1 A;  3PGG A;  2CZ0 B;  3AHU A;  1WNL A;  5LJ3 f;  1UGS B;  3MEA A;  4A4K A;  4QSH A;  1N6A A;  4C92 A;  3ME9 A;  2DXC B;  4XTV A;  1WQW A;  2ZPE B;  3OYI A;  5KH6 A;  3VYH B;  4QVZ A;  2EJF A;  1U8R A;  2JNG A;  1VQN A;  4IKF A;  2AHJ B;  2LQ8 A;  4ZGE B;  4X34 A;  4MFD A;  4C8Q B;  4MDX A;  3QDR B;  1G3Y A;  2LT1 A;  3M4Y A;  5GAN 6;  5GMK i;  4IUU A;  3SDZ A;  2QQ8 A;  2RM4 A;  3VKG A;  3G6E A;  2DXT A;  3OW2 A;  2P0Q A;  3DLM A;  1WJR A;  3LGL A;  1UGR B;  4OB3 B;  1IZ6 A;  2E6Z A;  3BW1 A;  4M77 D;  4XTW A;  4C92 G;  3G4S T;  3VKH A;  4Y28 E;  4CI0 C;  2RB6 A;  1VQ4 A;  4HCB A;  4OMF B;  1X01 A;  4PL6 A;  3OS1 A;  5FRO A;  2HBP A;  1WPY A;  5GAM j;  3I56 T;  3OYH A;  4JS5 A;  3CXC A;  3KXT A;  4XTZ A;  1QW1 A;  3JCM f;  3OB9 A;  3RIR A;  3FRN A;  3DKM A;  1QVF A;  4DA4 A;  3CC7 T;  4M78 E;  2BS3 A;  3NTK A;  4KT0 E;  4FT2 A;  5CQX A;  1B34 A;  4F7U E;  3A8M B;  5A0D A;  4OGC A;  4F7U F;  3ZBD A;  3OYB A;  4MIM A;  5LJ5 g;  5A0G A;  3CC7 A;  3FEO A;  2CS7 A;  3P8B B;  3JAM E;  1JB0 E;  4P5N A;  5DY9 A;  2FHD A;  4C8Q G;  1N27 A;  2WJ9 A;  2DD5 A;  5FU7 C;  3DL1 A;  4FT4 A;  1P92 A;  5GAN f;  3HBL A;  3C95 A;  3P8D A;  4C5I A;  3MEV A;  2JTF A;  4NS5 A;  1S72 A;  2QA4 T;  5I2M A;  3NTI A;  1IRE B;  1M1K U;  2RHI A;  2DTI A;  3RMS A;  2QQB A;  4LD9 K;  3OSS C;  2DD4 B;  5GMK l;  2OTJ T;  2RJD A;  3SWN B;  1M4Z A;  1VQ7 T;  5GAN 7;  2DD4 A;  3VKI A;  3LWH A;  1VQ4 T;  3GLX A;  4PLL A;  3RUX A;  4E7H A;  2CYZ B;  4JRI A;  4L5G A;  4HLQ A;  4WF2 A;  3JCM X;  3PTA A;  2PUO B;  1M1K C;  4XTU A;  4LOC A;  2QEX T;  2JOY A;  2X4X A;  1MHN A;  2XDD A;  4A4G A;  2E70 A;  3PIO A;  2DXB A;  2E64 A;  2CKK A;  4C8Q D;  3BDU A;  3NTH A;  4ZTJ A;  4M7A B;  2QQ9 A;  3V7C A;  5KCH A;  4JX4 A;  2FVU A;  1K9M U;  4C0F A;  3GNF B;  1VQK A;  2RI5 A;  4OB0 B;  2LCC A;  3LYI A;  4BDY A;  2KAF A;  1VUB A;  4NOY A;  4RG2 A;  4OF1 A;  5LJ5 d;  1YJW A;  3FIF A;  1K9M C;  3ZFJ A;  3QUI A;  4X9D A;  3H8Z A;  5I21 A;  5LL6 S;  5GAM g;  5C0M A;  2A7Y A;  4ATO A;  1VQP T;  1UB4 A;  3QYG B;  4IUQ A;  2V8K A;  3JCM e;  3JCM b;  1NJI C;  1G3W A;  2XD0 A;  3OYM A;  3HRU A;  2K5L A;  2KDS A;  4PJO G;  5GAO m;  1VQ8 T;  4JRP A;  3QHS A;  5FRM A;  1K73 C;  1FXX A;  4BE1 A;  2QFZ A;  3QO3 A;  3BG9 A;  5GMK h;  5DM7 R;  2M9U A;  4HNV A;  3JB9 G;  4C92 C;  2X35 A;  5D6X A;  2KQW A;  4FU6 A;  2QDY B;  2FL7 A;  3DB4 A;  1X75 C;  2RJC A;  1OZ3 A;  2KK4 A;  3QYE A;  2BS2 A;  3CPF A;  3PIP A;  4L6V 5;  4XQ3 A;  1K73 U;  2R58 A;  3MP8 A;  5GAN e;  1VQ5 A;  2WSF E;  2ZPH B;  5J3B A;  3JCM c;  2OTL A;  3VV0 A;  3M57 A;  3M56 A;  3OMG A;  2ZZD A;  3L1A A;  4R56 A;  3CCL T;  2YLB A;  3C12 A;  2KMG A;  3J7A F;  2KR6 A;  1VQ6 T;  2RHY A;  4PJO A;  1NPP A;  3OS5 A;  4JX6 A;  1PSE A;  2CZ7 B;  3VU3 C;  1OZ2 A;  1U1S A;  4C8Q E;  5GAN 8;  3INZ A;  1Y71 A;  1E7P A;  2R5A A;  2DPP B;  2D0Q B;  2XID A;  4C8Q F;  4J7F A;  5KE3 A;  1G5V A;  2M0O A;  1H3Z A;  5KCO A;  5LJ3 g;  2BS4 A;  4HNU A;  1SSF A;  4MZP A;  4EPC A;  5CK9 A;  2VV5 A;  4F7U G;  2YLC A;  3CCE A;  1YHQ A;  2XI9 A;  4LDX A;  4M78 G;  2LX9 A;  3LX7 A;  2MWP A;  5GAN h;  1VQ7 A;  2V8J A;  3OBY A;  4KBM B;  4C92 D;  4V2S A;  2QQA A;  5LJ3 d;  1D3B A;  3FJP A;  2Y4Y A;  4M7D B;  2WSE E;  2QXF A;  3EFS A;  3M58 A;  3JB9 F;  3OS2 A;  1G3T A;  4LDW A;  2LDM A;  3MCA B;  3V7R A;  1VQM A;  5GAN 5;  3CCQ T;  4BE2 A;  2DXB B;  2VGM A;  2JN0 A;  4PJO E;  5L8R E;  1N9R A;  4M75 B;  3R6O A;  4A4E A;  3URG A;  4JX5 A;  3JCM h;  4IUR A;  4QVD A;  1M90 U;  3O8V A;  3GIB A;  3ASK A;  4C5H A;  2VUB A;  3UPU A;  5HY6 A;  1KD1 C;  3F70 A;  5GAN 4;  2PVG B;  2E1H A;  2CZ6 B;  5CKH A;  4C5E A;  3GPL A;  4JLG A;  3OYK A;  5GMK e;  1I4K 1;  3RKW A;  5D6Y A;  4M77 A;  3CCJ T;  2F5T X;  3S3O A;  2RI3 A;  2EQU A;  4OVA A;  2C06 A;  1QVF S;  4JRK A;  2VXF A;  2R5M A;  4HCZ A;  2DEQ A;  2LTO A;  2LC4 A;  4ELY C;  4BD3 A;  2XDB A;  4LD6 A;  4PLI A;  4BBS M;  3L2Z A;  3CCE T;  2O4X B;  2DD5 B;  2QDJ A;  3NFC A;  3M54 A;  2CZ1 B;  3WVD B;  3VYG B;  2DZC A;  3A8H B;  4A4F A;  3V8J A;  2RI2 A;  4BI8 B;  4ZN1 A;  3M53 A;  1W2B A;  4PJO B;  1B34 B;  3QJ6 A;  4J6Y A;  1YJ9 T;  4XU3 A;  3CD6 A;  2D9T A;  3BDL A;  1YHQ T;  1Y96 B;  4UC4 A;  3JB9 H;  2RHU A;  1I8F A;  1VQ5 T;  2DK3 A;  2ZPG B;  3JSC A;  3G71 A;  4J83 A;  4M75 G;  3Q1J A;  1YJN T;  1QVG S;  2BIV A;  2GFU A;  1UEB A;  3V8K A;  5CR2 A;  1YI2 A;  3CMA T;  4OB1 B;  5FU6 C;  1YJW T;  2DAQ A;  4PKC C;  4M7A F;  3M4G A;  3CC4 T;  2VGN A;  1LNX A;  1DJ7 B;  1VQL T;  5GAO q;  3MP1 A;  3BY7 A;  4C0Z A;  3S3N A;  3WVE B;  2X4J A;  1JBM A;  3JCM Q;  1U1T A;  2QA4 A;  3OW2 S;  2KVQ G;  3OYD A;  1FWZ A;  3HHT B;  5CKD A;  4BY6 B;  3WXM B;  4M7D F;  4ZGD B;  4RKU E;  3LLR A;  3PFS A;  2P4T A;  4C8Q A;  3N5B B;  1FKM A;  4M77 B;  2P0P A;  3TW7 A;  4L59 A;  4MMK A;  1YCY A;  2RA2 A;  5FLX E;  2DZ9 A;  1VQO T;  2MI6 A;  5CO7 A;  3L2W A;  4J8O A;  2FB7 A;  5HK0 A;  3L2R A;  2DO3 A;  2KMT A;  2MAM A;  2X4W A;  3OQ5 A;  2B8A A;  2L89 A;  4N0A A;  3CME A;  4HT9 A;  4EMK B;  2EQK A;  4M77 E;  2ZPI B;  4C92 E;  3JCM d;  5FRN A;  4EMK A;  3X20 B;  1YJN A;  4M7A G;  4LDV A;  2KSS A;  2DIG A;  2PUK B;  3OYC A;  3HPW A;  5IT9 E;  2LQK A;  4N4G A;  4QQD A;  1VQ8 A;  1M90 C;  3QZ5 B;  1HXD A;  2LT4 A;  3A8O B;  2EYQ A;  3JCM g;  3VUZ A;  3QXE B;  2MWO A;  1VQ6 A;  3CCS T;  3KUF A;  3VUB A;  1NJI U;  3X28 B;  2RK1 A;  1MGQ A;  2HD0 A;  2L8D A;  4IUP A;  5CKE A;  4HT8 A;  4GLK A;  4HA8 A;  2XIC A;  1Y7X A;  4PJO F;  4ELZ C;  1O9S A;  3HL8 A;  4XK8 E;  3CCU T;  3HZJ A;  1N8R U;  4E7K A;  1KC8 U;  4M7D C;  3UWN A;  5EG2 A;  2PVO B;  5HK3 A;  2CGH A;  3FC3 A;  2L5Q A;  2EJG A;  1M8V A;  4XU2 A;  3HO8 A;  1TH7 A;  2LNV A;  4E47 A;  5A0L A;  4ZN3 A;  3QYB A;  4RG8 A;  5CQY A;  5GAN 2;  1N8R C;  3PT9 A;  3CMA A;  1YI2 T;  1I81 A;  4OGE A;  2QTX A;  2XDP A;  3CD6 T;  4D6W A;  4O6J A;  2ZGW A;  1K8A U;  5IAY A;  3MHX A;  5GAM h;  3I55 A;  3JCM P;  2JUF A;  4DOW A;  4MDW A;  4X9C A;  2X4Y A;  4QW2 A;  4E7J A;  5M9O A;  3J81 E;  2Y90 A;  2O4X A;  4A54 A;  4XAX B;  2GCX A;  3HFN A;  1S72 T;  3JRZ A;  4F7U B;  5CKB A;  3KHI A;  2E5Q A;  3E9F A;  3TRE A;  3E1S A;  5GAO p;  2DXU A;  3JCM W;  4AKH A;  1Y96 A;  3G71 T;  1WJS A;  3DLL A;  2ZPF B;  1UGQ B;  3BG3 A;  1BIA A;  4M78 F;  3OYF A;  4M7D G;  4N4H A;  3SFM A;  1Y07 A;  4E7I A;  2I2L A;  3OMC A;  3S3M A;  2E65 A;  1BKB A;  3CXC S;  3OYE A;  3VYG A;  3EAE A;  3PMT A;  4M7A A;  3J80 E;  3OYL A;  2E6N A;  3QII A;  4HKE A;  1QP2 A;  1O75 A;  2VC8 A;  3BFM A;  1NE8 A;  3HRT A;  4LDY A;  2GF7 A;  3ZEH A;  2RO0 A;  3RMQ A;  4JJN K;  1ZQ1 A;  2M16 A;  3JB9 D;  4MFE A;  1FX7 A;  3LH0 A;  4BBR M;  4LDU A;  1YBY A;  2E41 A;  3L2Q A;  3A8G B;  1Q81 U;  2DTO A;  2D6F A;  4JRQ A;  3DB3 A;  4RMO A;  1VQK T;  3CCM T;  3CCV T;  4JS4 A;  3OY9 A;  2K57 A;  4M7D A;  1RI0 A;  5EJC A;  4AKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...