2CZ0B

Photo-activation state of fe-type nhase in aerobic condition
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
211
structure length
211
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title photo-activation state of Fe-type NHase in aerobic condition
rcsb
molecule tags Lyase
total genus 56
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2cz0B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cz0B02
1UGSB 2D0QB 2PU9B 2AHJB 4OB0B 3VYGA 3QZ5B 2O01E 2ZPBB 4OB1B 3QYGB 4ZGJB 4FM4B 3LW5E 2ZZDA 2ZPEB 4ZGEB 3WVDB 3X26B 3A8GB 2PVDB 4ZGDB 4KT0E 2DD4B 2ZZDB 2ZCFB 2ZPFB 3QZ9B 3X28B 2DXBB 2WSEE 4OB3B 4OB2B 3WVEB 2QDYB 2DD4A 3HHTB 3X24B 2CZ6B 2ZPHB 3VYHB 2DXBA 1UGQB 2DXCB 1UGPB 2PUKB 3QXEB 4L6V5 5L8RE 4RKUE 3QYHB 2CZ1B 2PVOB 3X20B 2ZPGB 2DD5B 1AHJB 2DXCA 1QP3A 2WSFE 3A8HB 3A8LB 1JB0E 3X25B 2CZ0B 1V29B 2ZPIB 2DD5A 4Y28E 4XK8E 2DPPB 1DJ7B 3A8MB 1PSFA 2PUOB 2CZ7B 2WSCE 3VYGB 3A8OB 2PVGB 1QP2A 1GXIE 1IREB 1UGRB 2CYZB 1PSEA
chains in the Genus database with same CATH superfamily
2PU9B 5GMKi 1TOVA 4OB0B 2MF2A 1A0NB 1IXDA 1UJYA 4EC8B 2QTVA 1WA7A 3EG2A 4EORB 1VOMA 4AFSC 1VINA 3EAEA 1D3BB 2QGFB 1Y71A 3L42A 2YT6A 3VU3C 2I40B 5GAN5 5J26A 1QQJA 2X4YA 4F7UA 4CFMB 2HSPA 5CR2A 1N8RC 5HCKA 4GLKA 4BCOB 3P8HA 4QQGA 1GUXA 2XICA 4FSXA 4KGVB 1ZSGA 2QQAA 1GCQA 1H1PB 2Z0WA 1GBQA 2C5VB 3OB9A 1M1KC 4IURA 2LCCA 1B07A 1NJIU 1I0CA 4X9CA 4OMOA 1BI3A 4AKGA 1UHFA 3CPFA 4BY1X 2IPOB 4HL4A 2NLUA 1ZBJA 1Q95G 2EIFA 3VS2A 1YJWA 3VS0A 4J6WA 2X3WD 4XU3A 4K11A 2DD4A 4HLQA 4RMOA 1VA7A 2UZLB 3GBQA 1U3OA 4L5GA 1VQ9A 2DYIA 1WHLA 1SG5A 2JUFA 1OU9A 4E7JA 3BE3A 4AG2C 3CBOA 1RL2A 3JSCA 3JCMd 4LE9A 1RADB 1YIJA 3AT1B 2JM8A 5GJVB 1WYXA 4E7LA 1N8RU 4ROEA 2HEQA 3F70A 2GQVA 1KQSS 2LQNA 3OYHA 4HNUA 1ABQA 4JRKA 2KK4A 1M1KU 5GAMj 3PT9A 2NUTB 3TEEA 1G3NC 3QDRB 3CCQT 2CH4A 4EOQB 1WDXA 4HCCA 2K5FA 4C5IA 3CCMQ 2FEIA 1Z9ZA 2KXCA 4O6JA 5CIUA 3H8ZA 1VQOT 4FCYA 2CZ7B 3BW1A 1U8RA 1VQKA 4RTTA 1KD1C 3TN8B 5DLQE 2CYZB 2XD0A 3EG1A 4FIBA 3OYKA 1M9SA 1NG2A 4UN0A 4PJOA 1VQ4T 2MWPA 2DMEA 1X6GA 3REBB 5GAOn 2XU8A 2W96A 1O9KB 3N5BB 1AD5A 3JB9I 5GANj 4EMGA 2F2VA 3UWNA 1S72T 4MDXA 3PE0A 4R56A 1RLQC 3OS2A 2X35A 3CMAQ 1VQLA 4WF2A 1XO2A 1EFNA 2LRQA 3EGXA 5IXBA 1VOLA 1KD1U 4ZGDB 1R77A 3H6ZA 3VKGA 2WXVB 4XAXB 4C92G 5IHIA 2WIHB 2DIQA 5AYFA 4C8QG 4C8QC 3G6EA 4FW2A 2YLBA 1N9RA 3KBGA 1JOWA 2P4TA 2BS2A 5FRNA 4QKUA 2GQIA 2B9RA 3NMZC 1BCMA 2DXBA 1AWOA 2DTOA 1BIBA 2OTLT 2KY9A 3M03A 2HD0A 4G6LB 1M4ZA 1VQNA 1G3WA 2E12A 3X20B 1RACB 1SSFA 2ENMA 1YI2T 1TFBA 2JN0A 3UA7A 3J80E 4ROCA 3THKA 5IHKA 2DTHA 4RCCA 1JB0E 2L2PA 3CMEA 3GPLA 4C92D 3RESA 1YIJT 4F7NB 4C8QD 4LDYA 1G2BA 4CFWB 3DDPB 2VVKA 5IDNB 2DD5A 1ZLMA 4Y28E 3QHSA 5GAOp 4X34A 2DPPB 3OSSC 4IUTA 3ASKA 3POMA 5CK9A 5GAMg 3G71A 4D8KA 1PNJA 1GY3B 2F1LA 3VS3A 2QASA 2W9ZA 2QAZA 2LZ6B 4MDWA 1QP2A 1AD6A 3OYMA 1WHJA 3TW6A 2EQKA 2C4GB 4F04B 1S72Q 3GTMS 2LQKA 2QTXA 2XDPA 3JCMV 2XMFA 1PHTA 4PNOA 2IW8B 3BY7A 4RTUA 4RTWA 3P8BB 2Y4YA 1EIFA 4BCJB 3PMTA 1VQKT 3BHUB 3OW2P 2C06A 1QCFA 3EG9B 2K7AA 5C0MA 2M16A 1G3TA 2J6FA 2ROLA 2BUDA 1FKMA 4ZGEB 3WVDB 1B3QA 4ELZC 4RG8A 4JS4A 4M7DB 3B57A 2O31A 1KQSA 2PVDB 4L59A 5GANg 4F16A 2A37A 3HRUA 3VJPA 4JJBA 1M30A 4BD3A 4F7LB 2OTLQ 3RR6A 5I22A 3HSBA 4KGZB 3M57A 1N6AA 4EDUA 4I3ZB 1YI2Q 3DB4A 2D1XA 3LLRA 1NPPA 1RAIB 4AG1C 3OYFA 1BYMA 3LYIA 2RO0A 4E6RA 1NBEB 3VYHB 2FB7A 2EWNA 1VQ7T 2EUFA 5GAOr 2DXCB 4N0AC 1BU2A 3G6ET 1FMWA 3FB9A 1UFFA 1AISB 2X51A 1OZ3A 4PLIA 4J9HA 2XKOC 5FRMA 1Q82R 5D6WA 4D8DA 1D0YA 4BCGB 1HK9A 1QVGP 3A8LB 3GLXA 1ABOA 4OMNA 3M5AA 2D8HA 1VYVA 2KEAA 5CQYA 2EFIA 2DO3A 1WXBA 2M02A 2YDLA 3OBYA 2HMAA 2WFYB 1VQNT 1H3ZA 3FDRA 4HT8A 1GCPA 1H26B 4IUQA 2JXBA 1JSUB 2AT1B 5FROA 1PSFA 3TU4K 2NUPB 2YUOA 3BG3A 1H24B 2FO0A 2QDJA 3RIRA 2EYYA 4AKIA 3TW7A 1GXIE 2BE7D 2F5TX 4CC4B 1UGRB 3T9NA 1M3CA 4LDXA 3H4CA 5DQVA 2KDSA 4KH1B 3G71T 2IN3A 4KRDB 4JJDA 3OYIA 3CPWP 2E65A 1MMAA 3UATA 5IHNA 1YHQQ 1YITT 2DYBA 3CXCP 5LL6S 4F7UG 5LJ3d 1W2BP 1OGUB 1SKUB 5KYUA 3CD6A 1H3HA 2EQUA 4WCIA 1KC8R 2YWWA 4AFQC 1LOJA 3JCMJ 2V1QA 1GCQC 4RTVA 1OEBA 3TREA 1T3LA 2C0TA 1ZA1B 4BCHB 3QKJA 3H41A 2IW9B 3LX7A 1OI9B 1VQ7Q 1AVZC 2JT4A 1QVFP 2SRCA 1Q81C 3JB9J 4OB2B 1Q86R 1KSWA 3OSVA 2L89A 2FRYA 4JPBW 4BCFB 5GMKj 5FW9A 2XG8D 1VUBA 8ATCB 4JZ3A 2PUKB 4BY6C 3L2RA 3QYHB 2RHYA 1RAAB 3MEVA 2LT4A 1D0XA 3OS5A 2CP3A 4C92A 4LUDA 2ZPGB 1QVPA 1C9BA 2RMOA 4C8QA 2KSSA 2C5XB 1PCXA 1VQ8A 3EFRA 3OY9A 3TNIB 3G4SQ 3BLQB 4YOSA 4KUIA 3EIDB 3A98A 4RODA 2R58A 3QJYA 5KYYA 1Q81U 4OMMA 2CS7A 3VRYA 4C0DC 2D0NA 3PO3S 2RQTA 3EFOA 3MKDA 3CC7Q 2PK9B 4FX3B 1OKVB 3MY5B 4DBFA 2OAWA 2BE9B 4DOWA 4JRQA 1M90R 1YITQ 1JJ2A 1H25B 2KYBA 1OV3A 3VS7A 2VXFA 1PSEA 3I9QA 1UGSB 4PJOG 1BI0A 2BZXA 3OA6A 4PJOC 3QDFA 2ATCB 4PL6A 2PMIB 4C0ZA 1ZSZA 3KFVA 1OI1A 3I56T 2LJ0A 1LPLA 2CCIB 2OTJA 4M75E 4II5B 2E6NA 1SF9A 3DKMA 3TSWA 1PC0A 3C95A 2YUQA 4J6YA 4M78G 4IUVA 4M78C 4MZPA 2A7YA 1OULA 1TS9A 2R5AA 4M7DE 4Z8AA 2YXYA 1OX9A 3JB9H 5L2WB 3OBWA 3CC2Q 4EMKA 1IGUA 2XHCA 3INZA 5GAN3 2IW6B 3CD6T 4FW1A 1T0HA 1WI7A 3JCMQ 3UPUA 1K0SA 5KYNA 2P4RA 4KBMB 1EX4A 3P8DA 4M77E 2P0KA 2E10A 4PJLA 1WQWA 4JLGA 1K1ZA 1TXQA 5HQ0B 3TCJA 4C92F 6AT1B 3E9GA 5L8RE 1NEBA 4C8QF 4M78D 2D6FA 1WXUA 3E19A 5GAOq 1M2VA 4PJNA 4BCQB 2AZVA 5LJ5e 1BCOA 2I2LA 1M8VA 2C0OA 5CO7A 2JW4A 3CBPA 2PHGA 1N5ZA 3HRSA 1V29B 5GAN6 2CREA 2E3IA 3SWNC 2WMAB 3NTHA 4BI8B 3QWYA 3L2ZA 1DJ7B 4CFVB 3M0TA 4DBQA 3L1AA 3CCRQ 2KXDA 1K8AC 5I2SA 1WPYA 1T3SA 1KXUA 1K76A 3I56Q 1YJ9A 2PNIA 1RAHB 1MMGA 3MI9B 4J9IA 2O9VA 2DZCA 5FU6C 1G83A 3CCJA 2JGZB 3I5RA 2P0QA 2RJFA 4OMLA 1RI0A 1PM3A 4QVCA 4LOCA 1LVKA 4F7JB 5CKDA 1GUXB 5GAN4 2ZPBB 1XNIA 2JVVA 2K2MA 4LUEA 1M27C 1W4SA 4CXAB 2R7GA 2KBTA 3JCMh 4JJNK 5DQWA 2D8JA 5GMKm 1TD6A 1N9SA 5A2QE 5GAMd 1JU5C 3H0IA 3PVQA 2CSQA 2WHBB 1OL1B 1K8AU 2KR6A 5D6XA 3JCMe 2LCSA 1OZ2A 2DD4B 2OTJT 1OQKA 3CCUA 2E3HA 5KE2A 5J39A 4JJCA 3H0FA 1BI2A 2AK5A 3MP8A 3GNGA 1FWZA 2JMAA 3G7ZA 1NLPC 3VS6A 2G3RA 2F69A 1ZUYA 1Y96A 2DL3A 3HFNA 1SPKA 3OMCA 2L3SA 3MJXA 3V7CA 1X69A 1X27A 5AT1B 1D09B 1TUCA 3A5ZB 3QUIA 5IDPB 3CC4Q 5CQXA 3OYDA 2K3YA 1IZ6A 4XU2A 1SRMA 1AZGB 3Q1JA 2L3PA 5GANd 5GJWB 1QP3A 1UG1A 3HKSA 4C0DB 2DL7A 1C0MA 4M75G 3JCMb 3M9QA 2DA9A 5KE3A 2P84A 2L5QA 1VQMA 2ZPIB 2EW3A 2HSEB 4HVUA 3NDQA 1NYFA 3C12A 2CH4W 1UNGD 1H27B 3D7SB 1CSKA 1OL2B 1K9MC 2RB6A 4N4HA 4CC3A 4XQ3A 4HCZA 3OYBA 1NJIR 3M0SA 1QCNA 2KRNA 2RQRA 3EHQA 1Q7YC 3A8OB 2NWMA 4J7FA 4BCIB 1ZUKA 1GFCA 4M77G 2UZDB 2BKDN 4PFPA 4HT9A 3VYGA 2K79A 1OYXA 3PVLA 2FPDA 2XDDA 1P5EB 2EGEA 4M75D 4EOKB 4EOLB 1YJ9T 4EOOB 4OMFB 1N8RR 3EGXB 3FLGA 3CCSA 2QDLA 1VQPA 3CCJT 1IRXA 4JX4A 3ZL7C 4M7DD 3HZJA 1NYGA 2W10A 3CBMA 2RPNA 1K9MU 1M1KR 2XK0A 3HB9A 3RNJA 3A8GB 3S3OA 4BCMD 2F2CA 2VGMA 1G3YA 1YJNT 1RABB 4M4ZA 1Q7YU 2LJ3A 2IVWA 4F7UF 4M77D 3ME9A 2MPXC 5FGKB 2DXBB 4J8OA 2RN8A 3I55A 4J5YA 4XU0A 1O9SA 2K3XA 2DK3A 1OOTA 3JCMc 3MEWA 2EPDA 5FU7C 4JLIA 2I53A 3CCUT 2JM9A 4M78A 2HNIA 4M7AE 4J6XA 1XJWB 4EIKA 2YRCA 1WHKA 2E70A 2M1HA 3PIPA 3CCLA 2EKOA 4OVAA 3CCVA 3KXTA 5EG2A 4C92C 3FIFA 1U1TA 2DD5B 5HK0A 4QQDA 3E2UA 3RKWA 2QA4A 2VKNA 3DB3A 2HL3A 2ED1A 4FYXB 4AI6A 3G1JA 4ELLA 2CP6A 2A08A 1HXDA 4EPCA 3OS0A 3G33B 1X2QA 4ANJA 2V1RA 1MV3A 5DM7R 3UDCA 3CCQQ 1GRIA 1YJWT 1KD1R 2YRDA 5GAOm 2K2VA 3GF5A 5L23A 3UT1A 3H9NA 2DE0X 1YJ9Q 1JQQA 1VQ9T 5ICPB 3HBLA 4PFZA 1VQOQ 3MEAA 3RGFB 1KJWA 1PKDB 4ZN1A 1JXMA 2D0QB 5CKEA 2QEXA 3S6WA 4OMPA 1JRIA 1W98B 1ZSZC 4J9CA 2BS3A 3SWNA 1D0ZA 1LJOA 1AZEA 1XQHA 4ZTFA 1PG5B 3TSZA 1YJNQ 1QVFA 1VQ4Q 1ZQ1A 1TUDA 2DL4A 3OYEA 3MHXA 1H641 3LQ5B 2LNHB 3QYGB 4BDZA 5A0GA 1D3UB 2DFUA 2EGCA 4PJOF 2K5IA 2RM4A 1M2OA 2QQ9A 3MEUA 5FWBA 4BDYA 2W0ZA 2CGHA 2A36A 2XIDA 1M1FA 4EMKC 1OIUB 3CCST 2ZPFB 1VQPT 1AOJA 1AEYA 2FZGB 3DL1A 1QKWA 1QCOA 1T0JA 4CFUD 4A54A 1WJRA 4M78F 3ER0A 5HNBB 5FLXE 2SEMA 1QMZB 4MFDA 3JCMW 3OS1A 3X24B 5I5ZB 3EGDA 2CP0A 1G3SA 4P5NA 4OGRB 2DXUA 2GNCA 2RHXA 3K7AM 3NFCA 4BCNB 3I55T 1JJ2S 4ELYC 3VUZA 4YOZA 3SDZA 4MFEA 2EKHA 4N4GA 4Z88A 1BKBA 3TQ7P 5D7UA 5KYXA 4DEYA 1YJWQ 1KHIA 1XOVA 2WSFE 4EC9B 1VQLT 3MY1B 4OF1A 2MCNA 5KH6A 5KCHA 1NE8A 4E7SA 4BE2A 3M59A 1D1AA 2H3EB 1VQ9Q 1M5Q1 2VYTA 1R8OB 3PIOA 2KT1A 3CCLT 5GAN7 2LDMA 2PTKA 3QWLA 2DJZA 2KI7A 1YIJQ 2QA4T 3LWIA 3HRTA 3FJPA 2DVEA 2DNUA 2RD1A 3VV0A 1UNHD 2HQEA 5LJ3e 3JCMg 2OI3A 2V8IA 3DDQB 1E7PA 7AT1B 4M75A 4HVWA 2DZ9A 2AHJB 4TTHA 1H92A 3V8JA 1BB9A 3CCEA 4IUUA 1WJQA 3BFMA 9ATCB 5KYUB 2RHIA 3M54A 2DTIA 4M7AG 3RKXA 3CMET 2QQSA 4OB1B 1VQKQ 1MHNA 1VYWB 4IUPA 4E47A 2DILA 4AKHA 1NLOC 2EQMA 3LW5E 2DL8A 2AZSA 5HY6A 2RA2A 2O4XA 4BBRM 3QG1A 4RTZA 2G6FX 4MMLA 2XDBA 3META 1AWWA 2LQWA 1IB8A 2WMBB 4M77A 1ARKA 2RI5A 1K73C 1GBRA 3MP6A 1VQ5A 1J3TA 4D6WA 5A0DA 4OB3B 1YP5A 1FXXA 2E64A 2G77A 3NTIA 1D1BA 4M7AD 1YCSB 3RKYA 1M1GA 1VQLQ 4DBRA 4RCBA 4C92B 4J83A 3TNWB 4BUGA 5CEIB 2A0FB 2RQVA 2F2WA 4C8QB 1Y07A 4HKEA 4KGXB 2M51A 4BB7A 2R5MA 4A4HA 5CYIB 3SHWA 4CRLB 4C5EA 3EJ1B 3QO3A 2GBQA 3G6EQ 5IN1A 5KYYB 4NS5A 2FPFA 5LJ5f 3H0HA 1E7OA 2QYZA 1VQ6A 4DBHA 3EFOB 2MIOA 1C1AA 4QQ6A 4FT4A 2EYQA 2FG0A 2ZGWA 2LC4A 3NHNA 1K73U 4HCKA 1TWBA 1KQ1A 1UECA 2GCXA 3I5SA 1O75A 1VQNQ 2KAFA 2WEVB 3E9FA 1KFZA 3LGLA 1I4K1 5IF1B 4M75F 1BU1A 4ZNXA 1RI9A 3CMEQ 1PKSA 2PZ1A 2J6KA 2RJEA 4V2SA 2JZ2A 4ZN3A 1NM7A 2JTEA 1Y57A 1X43A 4FYYB 4RTYA 2DRMA 3RMQA 3RBBB 5KYWA 2KRSA 2IG0A 1JO8A 4Y72B 3IQLA 2B86A 3M4YA 3HTRA 4XU1A 3G71Q 2O2OA 2FPEA 4HCBA 1ENWA 3V8KA 4EMKB 4M77F 4F6WB 3CCET 1D1CA 4EONB 3DTOA 3EOCB 3M0UA 4JRIA 2RI2A 2FRWA 3X26B 3OQ5A 1H1RB 3PNWC 3JCMf 1KQSP 2DRKA 2JTFA 1G5VA 2NYSA 3OYNA 2VWFA 1WFWA 4F7SB 1Q81R 2ZZDB 2V26A 3RUXA 1B34B 3EH1A 1MV0B 2WPAB 3VS4A 2HDAA 3QBYA 3JCMP 3QPHA 3REAB 4HA8A 3TVTA 1OPKA 1K0XA 3OW2S 2DJQA 2LW4A 1WHHA 3OMGA 4RG2A 1QMCA 3QYBA 2QF7A 1M2VB 1SHFA 5I21A 3QHWB 4GLMA 5D6YA 2JOYA 3HFOA 1VQ5T 4ESRA 3QIIA 2BTTA 1VIFA 2BZ8A 2HAXA 2GTOA 3CCMA 1FMKA 4F17A 2WIPB 2RI3A 1HSQA 2YUPA 4MZMA 4E7HA 2X4XA 3DLMA 3MPUB 3A1PA 3O8VA 1PRLC 3M0QA 1AWJA 1UTIA 2LVMA 3O0GD 2J06A 5LJ5h 1YBYA 1UDLA 2ROTA 1VQ6T 2X4WA 4B9XA 4YTLA 4OGEA 2YRVA 1YN8A 1RUWA 2RH2A 2EBPA 5HBHB 2VB6A 4AT1B 3VKIA 1WNLA 1G8XA 3CMAA 5DY9A 1EZZB 2RK1A 1QVGS 1OKWB 1ZX6A 2YUNA 1SSHA 2ZAEA 2RJCA 1PD1A 4CFNB 3F5XB 1GH6B 2CUBA 3PTAA 1VQ8T 2L3RA 4F14A 1UHCA 2OAUA 2HZYA 3L2VA 2ZPEB 4LNPA 4KUDK 4IMYB 1OX8A 2XI9A 2CT3A 3KHIA 3HPWA 2H3JA 4MMKA 5IHYA 4F7UB 3QZ9B 1SHGA 3ULRB 1Y96B 4M7AA 1NPRA 3BDUA 4BY7X 5GANe 4NOYA 1RAFB 1S1NA 1W70A 3CPWS 2ED0A 3CD6Q 4GBQA 1KIKA 1QLBA 3OYLA 5I2MA 1URCB 1SEMA 2JS2A 1VYUA 3LGFA 2ZPHB 1H4LD 1IHVA 2DF6A 3CXCS 1W2BS 3QXEB 2QI2A 4C8QE 3NGPA 4J9EA 4EOMB 2KRMA 2P0PA 2DVJA 3R6NA 1Z9QA 1U06A 2M0YA 4UC4A 4BY6B 3LWHA 5ECAA 1X6OA 3R6OA 2CZ0B 1S72A 1QVFS 1JXOA 3M58A 3CCMT 4FL6A 3EH2A 4C5HA 2VXEA 1K8AR 4A4KA 2QGGA 1HYOA 2CDTA 3OYYA 3SD4A 2MYSA 1QKXA 2RF0A 3CQTA 2PUOB 1VYTA 2WSCE 3VYGB 2MOXA 4LD9K 1TH7A 1JJ2P 1VQ8Q 4JZ4A 1UE9A 2E41A 4J9GA 5CKBA 3JB9G 2NUZA 4M75C 2UZEB 3SB2A 2C0IA 2QQBA 4PLLA 2EJ9A 4M7DG 1I1JA 3OW2A 2OX7A 4M7DC 2OTLA 3M0RA 2EAYA 2KGTA 2QQRA 2EJFA 2JNGA 3OYGA 3CMAT 4PJOB 3URGA 1BIAA 1R0CB 1YI2A 2COYA 5GMKl 4LDUA 1D3BA 2RNAA 3C94A 1CKAA 1WGSA 4M77C 1R0BG 1FX7A 4M7AF 1TSFA 3J81E 3QHRB 3HO8A 4VUBA 2RK2A 5CKFA 2GF7A 4HNVA 2ZCFB 2WACA 1AT1B 3JB9D 4OGCA 2EYZA 4M78B 4A53A 2OTJQ 1JEGA 1AWXA 3L2WA 2OJ2A 1H28B 3EFSA 1YWOA 4DA4A 5LJ5j 2QDYB 2LX7A 4ME7A 4JRPA 2MWOA 1ZBXA 2B8AA 2EGAA 1UUEA 4BCND 4YC3B 1MNEA 2BZYA 3ZFJA 4RKUE 2PVOB 2O88A 2C6TB 4R0KA 2MMPA 1E6GA 2LT1A 4F6UB 1B7TA 2KMGA 1TG0A 2CP5A 1TUGB 4XTWA 1WX6A 3FJ5A 1QVGA 1SRLA 4JX5A 5GAN2 1UGVA 2CKKA 2JTMA 2M0OA 4LDVA 2C5OB 3X25B 4BCPB 1N4MA 2E1HA 1Y7XA 1K9MR 4ZTJA 2FZCB 2ABLA 2DETA 1Q7YR 2IIMA 3A8MB 4Q5WA 2NUTA 4XTYA 1OPLA 1YHQA 5LJ3f 1I81A 2CSIA 3QJ6A 1GFDA 2VV5A 3SWNB 4JDSA 1UEBA 2GTJA 1IREB 2FL7A 5A0LA 4IIMA 2UUEB 2PJQA 3MCAB 3BLHB 3DLLA 1NZ9A 3CPWA 2LQ8A 2FZKB 2X9HA 2MAMA 1VQ7A 4X1VA 1MMDA 1TTHB 5FU6B 4PJJA 1N27A 3CXCA 4Y92A 1X6BA 2RQUA 1W2BA 5HVYB 1VQMT 4XTXA 4BI3A 4LXCA 5EC7A 3JV3A 1O9KA 2KNBB 3CCJQ 4CFXB 2V8KA 4BBSM 2CP2A 2RHUA 1W1FA 2DAQA 2BIVA 2EYXA 2HCKA 3LH5A 4F7UE 4EOSB 2DX1A 3EGDB 1Y0MA 4FT2A 4A4GA 2L3QA 1HJDA 3UF4A 4XTVA 3QSUA 4C5GA 5HBJB 3HHTB 3QYEA 1PKTA 3VUBA 4Y91A 1I07A 2BKZB 2K6DA 3I35A 3G4SA 5KYXB 2KE9A 2LCLA 4JS5A 4J7IA 2COZA 1PD0A 4J9FA 2F2XA 3U23A 4A63B 3RMSA 3CCUQ 1MNDA 2ECZA 2QQ8A 4LN2A 3CC7A 5LJ5g 5GMKh 2O9SA 4KRTA 5FWCA 4BCKB 2GFAA 4CI0C 2RJDA 1K4US 3NPFA 1AHJB 4R55A 2DBMA 1I5LA 4CC7A 1BI1A 1YITA 1F5QB 4F70B 2K57A 2LMJA 5GMKe 3KUFA 1Q82C 2KR3A 4E7IA 4C0GA 4ELJA 2K4YA 4JUVA 4E7ZA 2AKLA 1ZHIA 1K9AA 4WTOB 1W6XA 2QK0A 3M0PA 1BBZA 4M75B 1X2KA 2WJ9A 3EG0A 5GAOl 4BI4A 4A4FA 1LNXA 2AIRB 4II1A 2R57A 4QT7A 1VQMQ 1PWTA 1FINB 4E2FB 3CCVT 1MUZA 1YHQT 4F6SB 4MIMA 5BNJB 4BCMB 5LJ3h 1KHCA 4XTUA 3CC2A 2O4XB 8AT1B 1Q82U 2HBWA 2DL5A 4M77B 3M55A 4ZGJB 4B6MA 2QGSA 1IGQA 4PJOE 2X4JA 1E6HA 2HKQB 2LX9A 4QVZA 2KT8A 2JS0A 3EG9A 3JCMX 2IVXA 5GAN8 3OYCA 2QFZA 2KMTA 4EOJB 3WXMB 1ACMB 3FRNA 2J6OA 1KC8C 1H8KA 3BHVB 4NL2A 2E5KA 4AMCA 2HL5C 4M7AC 4KULA 4M7DA 4M78E 3CCSQ 2A28A 1VQPQ 4E7KA 4Z02A 4LDWA 2QEXT 5CVIA 2DBKA 1C6VX 4AFZC 1VIEA 2CZ6B 1Q86C 5ACBA 2DM1A 3JAME 2CZ1B 4NSTB 5FU7B 3VS5A 2DKGA 4CC2A 2X3XD 2W99A 4RUGA 2RQWA 3CCRA 3I55Q 3ZEHA 3M53A 3G4ST 1OIYB 2DXCA 3I56A 3A8HB 3DOGB 2JMCA 2CUDA 3OYJA 4EMHA 1E9HB 1KC8U 2GFUA 3C4SA 1WZOA 4DQ2A 1LCKA 3J7AF 3CC7T 5EFQB 2HBPA 1BK2A 4BE1A 2A3LA 3BLRB 4QSHA 4XK8E 1M3AA 1UJ0A 3CCLQ 3CCVQ 1I8FA 4BCQD 2EQIA 2Y90A 1Q86U 1WJSA 5KYWB 2QA4Q 3PGGA 5GAMf 4BXXX 4QVDA 1H1SB 2W9FA 5LQFB 2NUPA 1FVVB 1M90C 4OMQA 4AFUC 4C0FA 1ZP2A 1NEGA 2V8JA 2UZBB 2JJ9A 2VASA 1WHGA 2CT4A 3QZ5B 5C6SA 2YLCA 1YWPA 1X75C 2O01E 5I11A 1ZA2B 2F5KA 4NL3A 4Z89A 4MZTA 5KCOA 4CFUB 1JSTB 4FM4B 3SFMA 5HKCA 2BPMB 2VC8A 3JB9F 1ZSZB 3HL8A 2CP7A 3FEOA 4DOVA 1U5SA 1I5OB 2Y4XA 3CC2T 2QEXQ 4OP0A 4M7DF 1K73R 5CAIA 3OYAA 3EGUA 3CC4A 1IHWA 2K9GA 1RLPC 2EJGA 2DERA 1RAGB 2YSQA 3X28B 5GANf 2V22B 4X9DA 1M90U 2LTOA 2LP5A 1GL5A 5HBEB 2HKNA 4TVRA 3O5ZA 3HP9A 3E1SA 1QWFA 1UGQB 3M56A 1UGPB 4L6V5 1MMNA 5J3BA 2MI6A 2DMOA 4N4IA 2PK2A 2QG9B 2EVRA 1KG1A 4EOIB 4O5VA 3VRZA 3S3MA 4J9DA 3M4GA 4OR5B 2AKKA 3V7RA 5LJ3j 1RAEB 2X1NB 1F1BB 4HVVA 1TU0B 2PQWA 4ORZA 3BG9A 3BDLA 4ATOA 1WIEA 2CJMB 4PK4A 1FYNA 2VUBA 3MIAB 4A4EA 3CCRT 1M8MA 3V7SA 2W2HA 2EYWA 3QWXX 4FYWB 2L0AA 5IAYA 4LD6A 1YFNA 3EG3A 2KQWA 1U1SA 1IO6A 2PVGB 5LMKB 2H8HA 1ZUUA 4JX6A 4RTXA 3SEMA 1CKBA 4BE0A 4FSSA 1QLYA 4NC6A 3ZBDA 1WHMA 1KQ2A 1X01A 3BHTB 4Z6YA 2EQJA 3GNFB 3NTKA 4J9BA 4KRCB 3RDVA 3V8LA 5GAMh 1FMVA 5HK3A 4PJOD 1XTDA 3S3NA 2J7IA 1OU8A 1YNZA 2DEQA 2ZZDA 4CRIA 1WXTA 2DLPA 5GAMe 2C5NB 4XTZA 1B34A 2VGNA 1WQ7A 1QWEA 4M7AB 5IT9E 1H1QB 3CCEQ 4IKFA 4KT0E 2FYKA 3L2UA 2MK5A 4DEXA 1YCYA 4BACA 2KROA 2QXFA 2WSEE 4PFOA 3C0CA 3VS1A 2E5QA 2E6ZA 2FVUA 3WVEB 3AHUA 5CKHA 3GIBA 3CEYA 1JBMA 4EOPB 3DJBA 2BS4A 3BG5A 3UA6A 3MO8A 3L2QA 3CC4T 1KK7A 5DLOA 3VKHA 2L8DA 2DEUA 2J05A 4N0AA 5GANh 3EHRA 2G9XB 3CCQA 1QW1A 2COWA 3MP1A 3PMIA 4KH0B 4HXJA 1VQ5Q 1PRMC 2LJ1A 1M3BA 2HQXA 1MGQA 4IIOA 1HD3A 2KYMA 2ESWA 2M9UA 1VQOA 2K5LA 2YHTA 2FHDA 3GP8A 5IH2A 2HQHA 5M9OA 3LH0A 4YOOA 3GOXA 4M6VA 3PFSA 4C92E 3TNHB 5CCAA 2D9TA 3RERA 2E4HA 2KVQG 1V1CA 2CCHB 5LJ3g 4B9WA 4GY5A 1YJNA 4FYVB 1VQ4A 1UNLD 5EJCA 4PJMA 1WLPB 4QW2A 2DIGA 1JKWA 2K3BA 1P92A 1V76A 3FC3A 3JRZA 1VQ6Q 4HNTA 5IXFA 2LNVA 4PKCC 1NJIC 5LJ5d 2RHZA 2DXTA 2I0NA 2GGRA 1UB4A 4FU6A
chains in the Genus database with same CATH topology
1UGSB 4M75A 4PJOG 3DLLA 2DZ9A 1BI0A 2AHJB 2PU9B 5GMKi 3OA6A 4OB0B 4PJOC 2MF2A 3V8JA 1NZ9A 4PL6A 3CCEA 4IUUA 4C0ZA 1WJQA 3BFMA 3CPWA 2LQ8A 2RHIA 3M54A 2DTIA 2MAMA 1OI1A 4M7AG 1VQ7A 3I56T 3RKXA 3EAEA 1D3BB 5FU6B 3CMET 2QQSA 4OB1B 1MHNA 1Y71A 1N27A 3L42A 3CXCA 2OTJA 4IUPA 3VU3C 4E47A 4M75E 2E6NA 4AKHA 2EQMA 5GAN5 3DKMA 3LW5E 5J26A 2X4YA 4F7UA 1W2BA 5CR2A 1VQMT 4XTXA 4J6YA 3C95A 2RA2A 4M78G 5HY6A 2O4XA 4BI3A 1N8RC 4BBRM 3QG1A 4GLKA 4IUVA 3P8HA 4M78C 4MMLA 4QQGA 2XICA 4MZPA 2A7YA 4FSXA 3META 2XDBA 2R5AA 4BBSM 2RHUA 2QQAA 2V8KA 4M77A 4M7DE 3JB9H 2DAQA 3OB9A 3OBWA 4IURA 1M1KC 2BIVA 2LCCA 4EMKA 5GAN3 2XHCA 3INZA 1NJIU 4F7UE 4X9CA 1BI3A 3CD6T 4AKGA 2RI5A 1K73C 3JCMQ 3CPFA 2NLUA 3MP6A 4HL4A 4FT2A 4A4GA 4D6WA 5A0DA 3UPUA 1VQ5A 4OB3B 2EIFA 1FXXA 4KBMB 2E64A 4XTVA 1YJWA 3QSUA 2G77A 4J6WA 3P8DA 3NTIA 4M77E 4XU3A 2DD4A 2E10A 2P0KA 4HLQA 3HHTB 3QYEA 1WQWA 3VUBA 4RMOA 4JLGA 4M7AD 4Y91A 3RKYA 1M1GA 4RCBA 4C92B 4L5GA 3G4SA 1VQ9A 2JUFA 4E7JA 4J83A 4BUGA 2LCLA 4C8QB 4JS5A 3CBOA 1Y07A 1RL2A 3JSCA 4HKEA 4J7IA 3TCJA 4C92F 3JCMd 3RMSA 3E9GA 5L8RE 4BB7A 2R5MA 4C8QF 4A4HA 1YIJA 4M78D 2D6FA 2QQ8A 4E7LA 1N8RU 3CC7A 5LJ5g 5GMKh 3F70A 3E19A 5GAOq 2GFAA 2GQVA 3QO3A 4C5EA 2RJDA 4CI0C 1KQSS 5IN1A 4NS5A 1AHJB 4R55A 4HNUA 3OYHA 5LJ5f 4JRKA 5LJ5e 1I5LA 1VQ6A 2I2LA 2KK4A 1M1KU 1BI1A 1YITA 3AHUA 5GAMj 4QQ6A 2K57A 3PT9A 5GMKe 4FT4A 1M8VA 3KUFA 1Q82C 5CO7A 3TEEA 4E7IA 3CBPA 2EYQA 3HRSA 3QDRB 3CCQT 2ZGWA 1V29B 2LC4A 1K73U 4C0GA 5GAN6 4HCCA 4ELJA 1KQ1A 2K4YA 4JUVA 3SWNC 2GCXA 1ZHIA 3NTHA 4BI8B 3L2ZA 2K5FA 1O75A 4C5IA 1DJ7B 2KAFA 4O6JA 5CIUA 4M75B 3E9FA 3L1AA 3H8ZA 2WJ9A 1VQOT 1K8AC 2CZ7B 5I2SA 5GAOl 3LGLA 3BW1A 1U8RA 1I4K1 1WPYA 4BI4A 1VQKA 4A4FA 1LNXA 4M75F 1KD1C 1YJ9A 4II1A 2R57A 5DLQE 2RJEA 4V2SA 2JZ2A 2CYZB 4ZN3A 2XD0A 2DZCA 5FU6C 4FIBA 3OYKA 1M9SA 3CCJA 3RMQA 4PJOA 1VQ4T 2MWPA 3CCVT 1YHQT 4MIMA 2IG0A 2P0QA 2RJFA 5LJ3h 1KHCA 4XTUA 1RI0A 5GAOn 1VQOA 3CC2A 2XU8A 2O4XB 4QVCA 4LOCA 3M4YA 3N5BB 4XU1A 5CKDA 5GAN4 1Q82U 2ZPBB 1XNIA 2JVVA 3JB9I 5GANj 4EMGA 4M77B 3M55A 3UWNA 4HCBA 4ZGJB 1S72T 1W4SA 3JCMh 3V8KA 4R56A 4JJNK 4MDXA 4EMKB 4M77F 5GMKm 1N9SA 4PJOE 3CCET 2X4JA 5A2QE 2LX9A 4QVZA 3OS2A 5GAMd 2X35A 4JRIA 2RI2A 3X26B 3OQ5A 3JCMX 1VQLA 4WF2A 5GAN8 3PNWC 3JCMf 1K8AU 3OYCA 2KR6A 2JTFA 5D6XA 2LRQA 2QFZA 2KMTA 3JCMe 1G5VA 3OYNA 3WXMB 1KD1U 4ZGDB 1OZ2A 2DD4B 3FRNA 3H6ZA 3VKGA 2OTJT 3CCUA 4XAXB 2ZZDB 1KC8C 4C92G 3RUXA 4NL2A 5KE2A 5J39A 2DIQA 5AYFA 1B34B 4C8QG 4M7AC 4KULA 4M7DA 4C8QC 3QBYA 4M78E 3G6EA 1BI2A 3JCMP 3QPHA 2YLBA 1N9RA 3KBGA 3MP8A 4E7KA 3GNGA 1FWZA 2P4TA 4Z02A 2BS2A 3G7ZA 4LDWA 4HA8A 2QEXT 5FRNA 2G3RA 2F69A 5CVIA 3OW2S 1VIEA 3OMGA 4RG2A 3QYBA 2QF7A 2CZ6B 1Y96A 3HFNA 3OMCA 5I21A 1Q86C 3V7CA 2DXBA 2DTOA 1BIBA 2OTLT 5D6YA 2JOYA 3HFOA 3JAME 1VQ5T 3QIIA 3A5ZB 3QUIA 2CZ1B 1VIFA 2KY9A 2HAXA 2HD0A 1M4ZA 5CQXA 2K3YA 1IZ6A 1G3WA 2E12A 5FU7B 4C5GA 3OYDA 3CCMA 1VQNA 2DKGA 3X20B 4XU2A 1SSFA 3CCRA 1YI2T 3ZEHA 3M53A 3Q1JA 5GANd 3G4ST 2JN0A 3J80E 2DXCA 1QP3A 2RI3A 3HKSA 3A8HB 3I56A 2DTHA 4RCCA 1JB0E 4C0DB 4MZMA 4EMHA 3OYJA 3CMEA 4E7HA 3GPLA 4C92D 4M75G 1KC8U 3JCMb 2GFUA 3C4SA 3RESA 2X4XA 1YIJT 3M9QA 3DLMA 4DQ2A 4C8QD 4LDYA 5KE3A 3J7AF 3CC7T 2L5QA 2HBPA 1VQMA 3O8VA 2ZPIB 2DD5A 4BE1A 4Y28E 2A3LA 3C12A 2LVMA 4QSHA 3QHSA 5GAOp 4X34A 4XK8E 2DPPB 5LJ5h 1YBYA 3OSSC 4IUTA 1K9MC 1VQ6T 1I8FA 2RB6A 3ASKA 2X4WA 4N4HA 4B9XA 4XQ3A 4HCZA 5CK9A 5GAMg 3OYBA 2Y90A 1Q86U 3G71A 4YTLA 4OGEA 2YRVA 1WJSA 1Q7YC 2RH2A 3PGGA 3A8OB 5GAMf 4MDWA 4QVDA 1QP2A 3OYMA 4J7FA 3TW6A 2EQKA 3VKIA 2LQKA 2XDPA 2QTXA 3JCMV 1WNLA 4M77G 3CMAA 4PNOA 2BKDN 3BY7A 5DY9A 1M90C 3P8BB 4HT9A 2Y4YA 3VYGA 1EIFA 2RK1A 1OYXA 4C0FA 1QVGS 3PMTA 2V8JA 1VQKT 2XDDA 2RJCA 4M75D 1YJ9T 4OMFB 3PTAA 3QZ5B 2C06A 5C6SA 2YLCA 1X75C 2O01E 2F5KA 1VQ8T 4NL3A 5C0MA 2L3RA 3FLGA 4MZTA 2OAUA 3SFMA 5KCOA 4FM4B 2M16A 5HKCA 2VC8A 3L2VA 3CCJT 3CCSA 1VQPA 3JB9F 4JX4A 2ZPEB 1G3TA 3HZJA 3HL8A 4M7DD 2BUDA 3CBMA 3FEOA 4DOVA 1FKMA 4KUDK 4ZGEB 1K9MU 3WVDB 2Y4XA 3CC2T 4ELZC 4RG8A 4JS4A 2XK0A 3HB9A 4M7DB 3A8GB 2XI9A 3S3OA 1KQSA 2VGMA 1G3YA 4OP0A 1YJNT 3KHIA 1Q7YU 4M7DF 2PVDB 4L59A 5CAIA 3HPWA 5GANg 2H3JA 4MMKA 4F7UB 2IVWA 3OYAA 3HRUA 3VJPA 3CC4A 3QZ9B 4BD3A 2EJGA 4F7UF 4M77D 1Y96B 3X28B 3ME9A 5GANf 4M7AA 1NPRA 3BDUA 2DXBB 4X9DA 5GANe 1M90U 3HSBA 4J8OA 3I55A 3M57A 4NOYA 4J5YA 2LTOA 4XU0A 1O9SA 2K3XA 2DK3A 1N6AA 3JCMc 4EDUA 3CPWS 3MEWA 1QLBA 3OYLA 5I2MA 5FU7C 3DB4A 3LLRA 1NPPA 4JLIA 3OYFA 1BYMA 3CCUT 3LYIA 2RO0A 3LGFA 4TVRA 4M78A 3HP9A 2ZPHB 3VYHB 2FB7A 3E1SA 1UGQB 2EWNA 3CXCS 1VQ7T 2HNIA 5GAOr 3M56A 2DXCB 1UGPB 4N0AC 4J6XA 1W2BS 4M7AE 3G6ET 3QXEB 2QI2A 4L6V5 5J3BA 3FB9A 2MI6A 4C8QE 2E70A 2M1HA 4N4IA 1OZ3A 4PLIA 3PIPA 3CCLA 1KG1A 4O5VA 2EKOA 3S3MA 4OVAA 3CCVA 2XKOC 3KXTA 5FRMA 5EG2A 4C92C 2P0PA 3FIFA 1U1TA 3M4GA 2DD5B 5D6WA 3V7RA 5LJ3j 5HK0A 1HK9A 4QQDA 4UC4A 3RKWA 2QA4A 3A8LB 3GLXA 4BY6B 3LWHA 3M5AA 3DB3A 5CQYA 4AI6A 2PQWA 2EFIA 2DO3A 1X6OA 3R6OA 3BG9A 2CZ0B 1S72A 1QVFS 3BDLA 3OBYA 4ATOA 1HXDA 4EPCA 1VQNT 1H3ZA 3M58A 3CCMT 3FDRA 3OS0A 4HT8A 4FL6A 4C5HA 2VUBA 2VXEA 4A4EA 4IUQA 3CCRT 4A4KA 5DM7R 3UDCA 3V7SA 3OYYA 3SD4A 1YJWT 5FROA 1PSFA 5GAOm 3TU4K 2K2VA 3GF5A 2PUOB 3BG3A 3UT1A 5IAYA 2WSCE 3VYGB 4LD6A 4LD9K 2KQWA 1U1SA 1VQ9T 1TH7A 3HBLA 2QDJA 2PVGB 3RIRA 4AKIA 3MEAA 4JX6A 3TW7A 1GXIE 2E41A 2F5TX 1UGRB 3T9NA 4ZN1A 4BE0A 5CKBA 3JB9G 4M75C 4LDXA 3H4CA 3SB2A 2KDSA 2D0QB 2QQBA 5CKEA 2QEXA 4NC6A 3ZBDA 3S6WA 1JRIA 3G71T 1KQ2A 1X01A 2BS3A 3SWNA 4Z6YA 2EQJA 4PLLA 3GNFB 3NTKA 2E65A 3OYIA 1LJOA 2EJ9A 1XQHA 4ZTFA 4M7DG 3OW2A 3V8LA 5GAMh 1QVFA 5HK3A 4PJOD 4M7DC 1ZQ1A 2OTLA 1YITT 1XTDA 3OYEA 2EAYA 3MHXA 3S3NA 2EJFA 1H641 2JNGA 2QQRA 5LL6S 3QYGB 3OYGA 3CMAT 4F7UG 4BDZA 4PJOB 5A0GA 5LJ3d 3URGA 2DEQA 2ZZDA 1BIAA 4CRIA 3CD6A 4PJOF 2K5IA 2RM4A 5GAMe 1YI2A 2QQ9A 4XTZA 5GMKl 1B34A 2VGNA 3MEUA 1WQ7A 2EQUA 4LDUA 4M7AB 1D3BA 3C94A 4BDYA 5IT9E 1LOJA 3JCMJ 1WGSA 4M77C 2CGHA 1FX7A 4M7AF 3TREA 2XIDA 3J81E 4IKFA 3HO8A 1M1FA 4KT0E 4VUBA 2RK2A 5CKFA 3QKJA 4EMKC 2GF7A 4HNVA 2ZCFB 2ZPFB 2WACA 3LX7A 3CCST 1VQPT 2FYKA 3DL1A 3L2UA 4OGCA 3JB9D 4M78B 4A53A 1YCYA 4BACA 4A54A 2QXFA 2WSEE 1WJRA 3JB9J 4OB2B 1Q81C 2E5QA 4M78F 2E6ZA 3L2WA 2FVUA 3EFSA 3ER0A 4DA4A 3WVEB 2QDYB 2L89A 3OSVA 4ME7A 5CKHA 5FLXE 5LJ5j 3CEYA 4MFDA 3JCMW 4JRPA 1JBMA 3GIBA 2MWOA 5GMKj 3OS1A 3X24B 2XG8D 2BS4A 3BG5A 1VUBA 3MO8A 1ZBXA 3L2QA 3CC4T 2B8AA 5DLOA 3VKHA 1G3SA 2L8DA 2PUKB 4P5NA 4N0AA 5GANh 4BY6C 3L2RA 3ZFJA 4RKUE 3QYHB 2DXUA 1JJ2S 2RHXA 2RHYA 2PVOB 3NFCA 3I55T 3CCQA 1QW1A 4ELYC 3MP1A 3VUZA 3PMIA 3SDZA 4MFEA 3MEVA 2LT4A 2MMPA 3OS5A 4N4GA 1BKBA 2LT1A 4C92A 2KMGA 2ZPGB 2HQXA 1QVPA 4XTWA 1KHIA 4C8QA 1MGQA 2KSSA 1XOVA 2WSFE 1QVGA 1VQLT 4JX5A 5GAN2 4OF1A 5KH6A 5KCHA 1NE8A 4BE2A 1VQ8A 2CKKA 2JTMA 2M9UA 2K5LA 2M0OA 3EFRA 3M59A 2YHTA 4LDVA 3OY9A 3X25B 2FHDA 3GP8A 5M9OA 1M5Q1 4KUIA 2VYTA 1R8OB 2E1HA 1Y7XA 3PIOA 5GAN7 3LH0A 2R58A 3QJYA 3GOXA 3CCLT 4M6VA 1Q81U 3PFSA 2LDMA 4C92E 3QWLA 2CS7A 5CCAA 2D9TA 2DJZA 4ZTJA 3RERA 2KVQG 4C0DC 5LJ3g 2QA4T 3LWIA 4B9WA 4GY5A 3A8MB 3HRTA 4Q5WA 3FJPA 1YJNA 2DVEA 4XTYA 1VQ4A 5EJCA 2RD1A 1YHQA 5LJ3f 3VV0A 1I81A 4QW2A 2HQEA 2DIGA 5LJ3e 3FC3A 3QJ6A 1P92A 2VV5A 3JRZA 4DOWA 4HNTA 3SWNB 3JCMg 2LNVA 4JDSA 1UEBA 4PKCC 4JRQA 5LJ5d 1NJIC 1JJ2A 2V8IA 2RHZA 2DXTA 1IREB 2FL7A 5A0LA 1UB4A 2VXFA 1E7PA 1PSEA 4FU6A 3MCAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGS B;  2D0Q B;  2PU9 B;  2AHJ B;  4OB0 B;  3VYG A;  3QZ5 B;  2O01 E;  2ZPB B;  4OB1 B;  3QYG B;  4ZGJ B;  4FM4 B;  3LW5 E;  2ZZD A;  2ZPE B;  4ZGE B;  3WVD B;  3X26 B;  3A8G B;  2PVD B;  4ZGD B;  4KT0 E;  2DD4 B;  2ZZD B;  2ZCF B;  2ZPF B;  3QZ9 B;  3X28 B;  2DXB B;  2WSE E;  4OB3 B;  4OB2 B;  3WVE B;  2QDY B;  2DD4 A;  3HHT B;  3X24 B;  2CZ6 B;  2ZPH B;  3VYH B;  2DXB A;  1UGQ B;  2DXC B;  1UGP B;  2PUK B;  3QXE B;  4L6V 5;  5L8R E;  4RKU E;  3QYH B;  2CZ1 B;  2PVO B;  3X20 B;  2ZPG B;  2DD5 B;  1AHJ B;  2DXC A;  1QP3 A;  2WSF E;  3A8H B;  3A8L B;  1JB0 E;  3X25 B;  2CZ0 B;  1V29 B;  2ZPI B;  2DD5 A;  4Y28 E;  4XK8 E;  2DPP B;  1DJ7 B;  3A8M B;  1PSF A;  2PUO B;  2CZ7 B;  2WSC E;  3VYG B;  3A8O B;  2PVG B;  1QP2 A;  1GXI E;  1IRE B;  1UGR B;  2CYZ B;  1PSE A; 
#chains in the Genus database with same CATH topology
 2PU9 B;  5GMK i;  1TOV A;  4OB0 B;  2MF2 A;  1A0N B;  1IXD A;  1UJY A;  4EC8 B;  2QTV A;  1WA7 A;  3EG2 A;  4EOR B;  1VOM A;  4AFS C;  1VIN A;  3EAE A;  1D3B B;  2QGF B;  1Y71 A;  3L42 A;  2YT6 A;  3VU3 C;  2I40 B;  5GAN 5;  5J26 A;  1QQJ A;  2X4Y A;  4F7U A;  4CFM B;  2HSP A;  5CR2 A;  1N8R C;  5HCK A;  4GLK A;  4BCO B;  3P8H A;  4QQG A;  1GUX A;  2XIC A;  4FSX A;  4KGV B;  1ZSG A;  2QQA A;  1GCQ A;  1H1P B;  2Z0W A;  1GBQ A;  2C5V B;  3OB9 A;  1M1K C;  4IUR A;  2LCC A;  1B07 A;  1NJI U;  1I0C A;  4X9C A;  4OMO A;  1BI3 A;  4AKG A;  1UHF A;  3CPF A;  4BY1 X;  2IPO B;  4HL4 A;  2NLU A;  1ZBJ A;  1Q95 G;  2EIF A;  3VS2 A;  1YJW A;  3VS0 A;  4J6W A;  2X3W D;  4XU3 A;  4K11 A;  2DD4 A;  4HLQ A;  4RMO A;  1VA7 A;  2UZL B;  3GBQ A;  1U3O A;  4L5G A;  1VQ9 A;  2DYI A;  1WHL A;  1SG5 A;  2JUF A;  1OU9 A;  4E7J A;  3BE3 A;  4AG2 C;  3CBO A;  1RL2 A;  3JSC A;  3JCM d;  4LE9 A;  1RAD B;  1YIJ A;  3AT1 B;  2JM8 A;  5GJV B;  1WYX A;  4E7L A;  1N8R U;  4ROE A;  2HEQ A;  3F70 A;  2GQV A;  1KQS S;  2LQN A;  3OYH A;  4HNU A;  1ABQ A;  4JRK A;  2KK4 A;  1M1K U;  5GAM j;  3PT9 A;  2NUT B;  3TEE A;  1G3N C;  3QDR B;  3CCQ T;  2CH4 A;  4EOQ B;  1WDX A;  4HCC A;  2K5F A;  4C5I A;  3CCM Q;  2FEI A;  1Z9Z A;  2KXC A;  4O6J A;  5CIU A;  3H8Z A;  1VQO T;  4FCY A;  2CZ7 B;  3BW1 A;  1U8R A;  1VQK A;  4RTT A;  1KD1 C;  3TN8 B;  5DLQ E;  2CYZ B;  2XD0 A;  3EG1 A;  4FIB A;  3OYK A;  1M9S A;  1NG2 A;  4UN0 A;  4PJO A;  1VQ4 T;  2MWP A;  2DME A;  1X6G A;  3REB B;  5GAO n;  2XU8 A;  2W96 A;  1O9K B;  3N5B B;  1AD5 A;  3JB9 I;  5GAN j;  4EMG A;  2F2V A;  3UWN A;  1S72 T;  4MDX A;  3PE0 A;  4R56 A;  1RLQ C;  3OS2 A;  2X35 A;  3CMA Q;  1VQL A;  4WF2 A;  1XO2 A;  1EFN A;  2LRQ A;  3EGX A;  5IXB A;  1VOL A;  1KD1 U;  4ZGD B;  1R77 A;  3H6Z A;  3VKG A;  2WXV B;  4XAX B;  4C92 G;  5IHI A;  2WIH B;  2DIQ A;  5AYF A;  4C8Q G;  4C8Q C;  3G6E A;  4FW2 A;  2YLB A;  1N9R A;  3KBG A;  1JOW A;  2P4T A;  2BS2 A;  5FRN A;  4QKU A;  2GQI A;  2B9R A;  3NMZ C;  1BCM A;  2DXB A;  1AWO A;  2DTO A;  1BIB A;  2OTL T;  2KY9 A;  3M03 A;  2HD0 A;  4G6L B;  1M4Z A;  1VQN A;  1G3W A;  2E12 A;  3X20 B;  1RAC B;  1SSF A;  2ENM A;  1YI2 T;  1TFB A;  2JN0 A;  3UA7 A;  3J80 E;  4ROC A;  3THK A;  5IHK A;  2DTH A;  4RCC A;  1JB0 E;  2L2P A;  3CME A;  3GPL A;  4C92 D;  3RES A;  1YIJ T;  4F7N B;  4C8Q D;  4LDY A;  1G2B A;  4CFW B;  3DDP B;  2VVK A;  5IDN B;  2DD5 A;  1ZLM A;  4Y28 E;  3QHS A;  5GAO p;  4X34 A;  2DPP B;  3OSS C;  4IUT A;  3ASK A;  3POM A;  5CK9 A;  5GAM g;  3G71 A;  4D8K A;  1PNJ A;  1GY3 B;  2F1L A;  3VS3 A;  2QAS A;  2W9Z A;  2QAZ A;  2LZ6 B;  4MDW A;  1QP2 A;  1AD6 A;  3OYM A;  1WHJ A;  3TW6 A;  2EQK A;  2C4G B;  4F04 B;  1S72 Q;  3GTM S;  2LQK A;  2QTX A;  2XDP A;  3JCM V;  2XMF A;  1PHT A;  4PNO A;  2IW8 B;  3BY7 A;  4RTU A;  4RTW A;  3P8B B;  2Y4Y A;  1EIF A;  4BCJ B;  3PMT A;  1VQK T;  3BHU B;  3OW2 P;  2C06 A;  1QCF A;  3EG9 B;  2K7A A;  5C0M A;  2M16 A;  1G3T A;  2J6F A;  2ROL A;  2BUD A;  1FKM A;  4ZGE B;  3WVD B;  1B3Q A;  4ELZ C;  4RG8 A;  4JS4 A;  4M7D B;  3B57 A;  2O31 A;  1KQS A;  2PVD B;  4L59 A;  5GAN g;  4F16 A;  2A37 A;  3HRU A;  3VJP A;  4JJB A;  1M30 A;  4BD3 A;  4F7L B;  2OTL Q;  3RR6 A;  5I22 A;  3HSB A;  4KGZ B;  3M57 A;  1N6A A;  4EDU A;  4I3Z B;  1YI2 Q;  3DB4 A;  2D1X A;  3LLR A;  1NPP A;  1RAI B;  4AG1 C;  3OYF A;  1BYM A;  3LYI A;  2RO0 A;  4E6R A;  1NBE B;  3VYH B;  2FB7 A;  2EWN A;  1VQ7 T;  2EUF A;  5GAO r;  2DXC B;  4N0A C;  1BU2 A;  3G6E T;  1FMW A;  3FB9 A;  1UFF A;  1AIS B;  2X51 A;  1OZ3 A;  4PLI A;  4J9H A;  2XKO C;  5FRM A;  1Q82 R;  5D6W A;  4D8D A;  1D0Y A;  4BCG B;  1HK9 A;  1QVG P;  3A8L B;  3GLX A;  1ABO A;  4OMN A;  3M5A A;  2D8H A;  1VYV A;  2KEA A;  5CQY A;  2EFI A;  2DO3 A;  1WXB A;  2M02 A;  2YDL A;  3OBY A;  2HMA A;  2WFY B;  1VQN T;  1H3Z A;  3FDR A;  4HT8 A;  1GCP A;  1H26 B;  4IUQ A;  2JXB A;  1JSU B;  2AT1 B;  5FRO A;  1PSF A;  3TU4 K;  2NUP B;  2YUO A;  3BG3 A;  1H24 B;  2FO0 A;  2QDJ A;  3RIR A;  2EYY A;  4AKI A;  3TW7 A;  1GXI E;  2BE7 D;  2F5T X;  4CC4 B;  1UGR B;  3T9N A;  1M3C A;  4LDX A;  3H4C A;  5DQV A;  2KDS A;  4KH1 B;  3G71 T;  2IN3 A;  4KRD B;  4JJD A;  3OYI A;  3CPW P;  2E65 A;  1MMA A;  3UAT A;  5IHN A;  1YHQ Q;  1YIT T;  2DYB A;  3CXC P;  5LL6 S;  4F7U G;  5LJ3 d;  1W2B P;  1OGU B;  1SKU B;  5KYU A;  3CD6 A;  1H3H A;  2EQU A;  4WCI A;  1KC8 R;  2YWW A;  4AFQ C;  1LOJ A;  3JCM J;  2V1Q A;  1GCQ C;  4RTV A;  1OEB A;  3TRE A;  1T3L A;  2C0T A;  1ZA1 B;  4BCH B;  3QKJ A;  3H41 A;  2IW9 B;  3LX7 A;  1OI9 B;  1VQ7 Q;  1AVZ C;  2JT4 A;  1QVF P;  2SRC A;  1Q81 C;  3JB9 J;  4OB2 B;  1Q86 R;  1KSW A;  3OSV A;  2L89 A;  2FRY A;  4JPB W;  4BCF B;  5GMK j;  5FW9 A;  2XG8 D;  1VUB A;  8ATC B;  4JZ3 A;  2PUK B;  4BY6 C;  3L2R A;  3QYH B;  2RHY A;  1RAA B;  3MEV A;  2LT4 A;  1D0X A;  3OS5 A;  2CP3 A;  4C92 A;  4LUD A;  2ZPG B;  1QVP A;  1C9B A;  2RMO A;  4C8Q A;  2KSS A;  2C5X B;  1PCX A;  1VQ8 A;  3EFR A;  3OY9 A;  3TNI B;  3G4S Q;  3BLQ B;  4YOS A;  4KUI A;  3EID B;  3A98 A;  4ROD A;  2R58 A;  3QJY A;  5KYY A;  1Q81 U;  4OMM A;  2CS7 A;  3VRY A;  4C0D C;  2D0N A;  3PO3 S;  2RQT A;  3EFO A;  3MKD A;  3CC7 Q;  2PK9 B;  4FX3 B;  1OKV B;  3MY5 B;  4DBF A;  2OAW A;  2BE9 B;  4DOW A;  4JRQ A;  1M90 R;  1YIT Q;  1JJ2 A;  1H25 B;  2KYB A;  1OV3 A;  3VS7 A;  2VXF A;  1PSE A;  3I9Q A;  1UGS B;  4PJO G;  1BI0 A;  2BZX A;  3OA6 A;  4PJO C;  3QDF A;  2ATC B;  4PL6 A;  2PMI B;  4C0Z A;  1ZSZ A;  3KFV A;  1OI1 A;  3I56 T;  2LJ0 A;  1LPL A;  2CCI B;  2OTJ A;  4M75 E;  4II5 B;  2E6N A;  1SF9 A;  3DKM A;  3TSW A;  1PC0 A;  3C95 A;  2YUQ A;  4J6Y A;  4M78 G;  4IUV A;  4M78 C;  4MZP A;  2A7Y A;  1OUL A;  1TS9 A;  2R5A A;  4M7D E;  4Z8A A;  2YXY A;  1OX9 A;  3JB9 H;  5L2W B;  3OBW A;  3CC2 Q;  4EMK A;  1IGU A;  2XHC A;  3INZ A;  5GAN 3;  2IW6 B;  3CD6 T;  4FW1 A;  1T0H A;  1WI7 A;  3JCM Q;  3UPU A;  1K0S A;  5KYN A;  2P4R A;  4KBM B;  1EX4 A;  3P8D A;  4M77 E;  2P0K A;  2E10 A;  4PJL A;  1WQW A;  4JLG A;  1K1Z A;  1TXQ A;  5HQ0 B;  3TCJ A;  4C92 F;  6AT1 B;  3E9G A;  5L8R E;  1NEB A;  4C8Q F;  4M78 D;  2D6F A;  1WXU A;  3E19 A;  5GAO q;  1M2V A;  4PJN A;  4BCQ B;  2AZV A;  5LJ5 e;  1BCO A;  2I2L A;  1M8V A;  2C0O A;  5CO7 A;  2JW4 A;  3CBP A;  2PHG A;  1N5Z A;  3HRS A;  1V29 B;  5GAN 6;  2CRE A;  2E3I A;  3SWN C;  2WMA B;  3NTH A;  4BI8 B;  3QWY A;  3L2Z A;  1DJ7 B;  4CFV B;  3M0T A;  4DBQ A;  3L1A A;  3CCR Q;  2KXD A;  1K8A C;  5I2S A;  1WPY A;  1T3S A;  1KXU A;  1K76 A;  3I56 Q;  1YJ9 A;  2PNI A;  1RAH B;  1MMG A;  3MI9 B;  4J9I A;  2O9V A;  2DZC A;  5FU6 C;  1G83 A;  3CCJ A;  2JGZ B;  3I5R A;  2P0Q A;  2RJF A;  4OML A;  1RI0 A;  1PM3 A;  4QVC A;  4LOC A;  1LVK A;  4F7J B;  5CKD A;  1GUX B;  5GAN 4;  2ZPB B;  1XNI A;  2JVV A;  2K2M A;  4LUE A;  1M27 C;  1W4S A;  4CXA B;  2R7G A;  2KBT A;  3JCM h;  4JJN K;  5DQW A;  2D8J A;  5GMK m;  1TD6 A;  1N9S A;  5A2Q E;  5GAM d;  1JU5 C;  3H0I A;  3PVQ A;  2CSQ A;  2WHB B;  1OL1 B;  1K8A U;  2KR6 A;  5D6X A;  3JCM e;  2LCS A;  1OZ2 A;  2DD4 B;  2OTJ T;  1OQK A;  3CCU A;  2E3H A;  5KE2 A;  5J39 A;  4JJC A;  3H0F A;  1BI2 A;  2AK5 A;  3MP8 A;  3GNG A;  1FWZ A;  2JMA A;  3G7Z A;  1NLP C;  3VS6 A;  2G3R A;  2F69 A;  1ZUY A;  1Y96 A;  2DL3 A;  3HFN A;  1SPK A;  3OMC A;  2L3S A;  3MJX A;  3V7C A;  1X69 A;  1X27 A;  5AT1 B;  1D09 B;  1TUC A;  3A5Z B;  3QUI A;  5IDP B;  3CC4 Q;  5CQX A;  3OYD A;  2K3Y A;  1IZ6 A;  4XU2 A;  1SRM A;  1AZG B;  3Q1J A;  2L3P A;  5GAN d;  5GJW B;  1QP3 A;  1UG1 A;  3HKS A;  4C0D B;  2DL7 A;  1C0M A;  4M75 G;  3JCM b;  3M9Q A;  2DA9 A;  5KE3 A;  2P84 A;  2L5Q A;  1VQM A;  2ZPI B;  2EW3 A;  2HSE B;  4HVU A;  3NDQ A;  1NYF A;  3C12 A;  2CH4 W;  1UNG D;  1H27 B;  3D7S B;  1CSK A;  1OL2 B;  1K9M C;  2RB6 A;  4N4H A;  4CC3 A;  4XQ3 A;  4HCZ A;  3OYB A;  1NJI R;  3M0S A;  1QCN A;  2KRN A;  2RQR A;  3EHQ A;  1Q7Y C;  3A8O B;  2NWM A;  4J7F A;  4BCI B;  1ZUK A;  1GFC A;  4M77 G;  2UZD B;  2BKD N;  4PFP A;  4HT9 A;  3VYG A;  2K79 A;  1OYX A;  3PVL A;  2FPD A;  2XDD A;  1P5E B;  2EGE A;  4M75 D;  4EOK B;  4EOL B;  1YJ9 T;  4EOO B;  4OMF B;  1N8R R;  3EGX B;  3FLG A;  3CCS A;  2QDL A;  1VQP A;  3CCJ T;  1IRX A;  4JX4 A;  3ZL7 C;  4M7D D;  3HZJ A;  1NYG A;  2W10 A;  3CBM A;  2RPN A;  1K9M U;  1M1K R;  2XK0 A;  3HB9 A;  3RNJ A;  3A8G B;  3S3O A;  4BCM D;  2F2C A;  2VGM A;  1G3Y A;  1YJN T;  1RAB B;  4M4Z A;  1Q7Y U;  2LJ3 A;  2IVW A;  4F7U F;  4M77 D;  3ME9 A;  2MPX C;  5FGK B;  2DXB B;  4J8O A;  2RN8 A;  3I55 A;  4J5Y A;  4XU0 A;  1O9S A;  2K3X A;  2DK3 A;  1OOT A;  3JCM c;  3MEW A;  2EPD A;  5FU7 C;  4JLI A;  2I53 A;  3CCU T;  2JM9 A;  4M78 A;  2HNI A;  4M7A E;  4J6X A;  1XJW B;  4EIK A;  2YRC A;  1WHK A;  2E70 A;  2M1H A;  3PIP A;  3CCL A;  2EKO A;  4OVA A;  3CCV A;  3KXT A;  5EG2 A;  4C92 C;  3FIF A;  1U1T A;  2DD5 B;  5HK0 A;  4QQD A;  3E2U A;  3RKW A;  2QA4 A;  2VKN A;  3DB3 A;  2HL3 A;  2ED1 A;  4FYX B;  4AI6 A;  3G1J A;  4ELL A;  2CP6 A;  2A08 A;  1HXD A;  4EPC A;  3OS0 A;  3G33 B;  1X2Q A;  4ANJ A;  2V1R A;  1MV3 A;  5DM7 R;  3UDC A;  3CCQ Q;  1GRI A;  1YJW T;  1KD1 R;  2YRD A;  5GAO m;  2K2V A;  3GF5 A;  5L23 A;  3UT1 A;  3H9N A;  2DE0 X;  1YJ9 Q;  1JQQ A;  1VQ9 T;  5ICP B;  3HBL A;  4PFZ A;  1VQO Q;  3MEA A;  3RGF B;  1KJW A;  1PKD B;  4ZN1 A;  1JXM A;  2D0Q B;  5CKE A;  2QEX A;  3S6W A;  4OMP A;  1JRI A;  1W98 B;  1ZSZ C;  4J9C A;  2BS3 A;  3SWN A;  1D0Z A;  1LJO A;  1AZE A;  1XQH A;  4ZTF A;  1PG5 B;  3TSZ A;  1YJN Q;  1QVF A;  1VQ4 Q;  1ZQ1 A;  1TUD A;  2DL4 A;  3OYE A;  3MHX A;  1H64 1;  3LQ5 B;  2LNH B;  3QYG B;  4BDZ A;  5A0G A;  1D3U B;  2DFU A;  2EGC A;  4PJO F;  2K5I A;  2RM4 A;  1M2O A;  2QQ9 A;  3MEU A;  5FWB A;  4BDY A;  2W0Z A;  2CGH A;  2A36 A;  2XID A;  1M1F A;  4EMK C;  1OIU B;  3CCS T;  2ZPF B;  1VQP T;  1AOJ A;  1AEY A;  2FZG B;  3DL1 A;  1QKW A;  1QCO A;  1T0J A;  4CFU D;  4A54 A;  1WJR A;  4M78 F;  3ER0 A;  5HNB B;  5FLX E;  2SEM A;  1QMZ B;  4MFD A;  3JCM W;  3OS1 A;  3X24 B;  5I5Z B;  3EGD A;  2CP0 A;  1G3S A;  4P5N A;  4OGR B;  2DXU A;  2GNC A;  2RHX A;  3K7A M;  3NFC A;  4BCN B;  3I55 T;  1JJ2 S;  4ELY C;  3VUZ A;  4YOZ A;  3SDZ A;  4MFE A;  2EKH A;  4N4G A;  4Z88 A;  1BKB A;  3TQ7 P;  5D7U A;  5KYX A;  4DEY A;  1YJW Q;  1KHI A;  1XOV A;  2WSF E;  4EC9 B;  1VQL T;  3MY1 B;  4OF1 A;  2MCN A;  5KH6 A;  5KCH A;  1NE8 A;  4E7S A;  4BE2 A;  3M59 A;  1D1A A;  2H3E B;  1VQ9 Q;  1M5Q 1;  2VYT A;  1R8O B;  3PIO A;  2KT1 A;  3CCL T;  5GAN 7;  2LDM A;  2PTK A;  3QWL A;  2DJZ A;  2KI7 A;  1YIJ Q;  2QA4 T;  3LWI A;  3HRT A;  3FJP A;  2DVE A;  2DNU A;  2RD1 A;  3VV0 A;  1UNH D;  2HQE A;  5LJ3 e;  3JCM g;  2OI3 A;  2V8I A;  3DDQ B;  1E7P A;  7AT1 B;  4M75 A;  4HVW A;  2DZ9 A;  2AHJ B;  4TTH A;  1H92 A;  3V8J A;  1BB9 A;  3CCE A;  4IUU A;  1WJQ A;  3BFM A;  9ATC B;  5KYU B;  2RHI A;  3M54 A;  2DTI A;  4M7A G;  3RKX A;  3CME T;  2QQS A;  4OB1 B;  1VQK Q;  1MHN A;  1VYW B;  4IUP A;  4E47 A;  2DIL A;  4AKH A;  1NLO C;  2EQM A;  3LW5 E;  2DL8 A;  2AZS A;  5HY6 A;  2RA2 A;  2O4X A;  4BBR M;  3QG1 A;  4RTZ A;  2G6F X;  4MML A;  2XDB A;  3MET A;  1AWW A;  2LQW A;  1IB8 A;  2WMB B;  4M77 A;  1ARK A;  2RI5 A;  1K73 C;  1GBR A;  3MP6 A;  1VQ5 A;  1J3T A;  4D6W A;  5A0D A;  4OB3 B;  1YP5 A;  1FXX A;  2E64 A;  2G77 A;  3NTI A;  1D1B A;  4M7A D;  1YCS B;  3RKY A;  1M1G A;  1VQL Q;  4DBR A;  4RCB A;  4C92 B;  4J83 A;  3TNW B;  4BUG A;  5CEI B;  2A0F B;  2RQV A;  2F2W A;  4C8Q B;  1Y07 A;  4HKE A;  4KGX B;  2M51 A;  4BB7 A;  2R5M A;  4A4H A;  5CYI B;  3SHW A;  4CRL B;  4C5E A;  3EJ1 B;  3QO3 A;  2GBQ A;  3G6E Q;  5IN1 A;  5KYY B;  4NS5 A;  2FPF A;  5LJ5 f;  3H0H A;  1E7O A;  2QYZ A;  1VQ6 A;  4DBH A;  3EFO B;  2MIO A;  1C1A A;  4QQ6 A;  4FT4 A;  2EYQ A;  2FG0 A;  2ZGW A;  2LC4 A;  3NHN A;  1K73 U;  4HCK A;  1TWB A;  1KQ1 A;  1UEC A;  2GCX A;  3I5S A;  1O75 A;  1VQN Q;  2KAF A;  2WEV B;  3E9F A;  1KFZ A;  3LGL A;  1I4K 1;  5IF1 B;  4M75 F;  1BU1 A;  4ZNX A;  1RI9 A;  3CME Q;  1PKS A;  2PZ1 A;  2J6K A;  2RJE A;  4V2S A;  2JZ2 A;  4ZN3 A;  1NM7 A;  2JTE A;  1Y57 A;  1X43 A;  4FYY B;  4RTY A;  2DRM A;  3RMQ A;  3RBB B;  5KYW A;  2KRS A;  2IG0 A;  1JO8 A;  4Y72 B;  3IQL A;  2B86 A;  3M4Y A;  3HTR A;  4XU1 A;  3G71 Q;  2O2O A;  2FPE A;  4HCB A;  1ENW A;  3V8K A;  4EMK B;  4M77 F;  4F6W B;  3CCE T;  1D1C A;  4EON B;  3DTO A;  3EOC B;  3M0U A;  4JRI A;  2RI2 A;  2FRW A;  3X26 B;  3OQ5 A;  1H1R B;  3PNW C;  3JCM f;  1KQS P;  2DRK A;  2JTF A;  1G5V A;  2NYS A;  3OYN A;  2VWF A;  1WFW A;  4F7S B;  1Q81 R;  2ZZD B;  2V26 A;  3RUX A;  1B34 B;  3EH1 A;  1MV0 B;  2WPA B;  3VS4 A;  2HDA A;  3QBY A;  3JCM P;  3QPH A;  3REA B;  4HA8 A;  3TVT A;  1OPK A;  1K0X A;  3OW2 S;  2DJQ A;  2LW4 A;  1WHH A;  3OMG A;  4RG2 A;  1QMC A;  3QYB A;  2QF7 A;  1M2V B;  1SHF A;  5I21 A;  3QHW B;  4GLM A;  5D6Y A;  2JOY A;  3HFO A;  1VQ5 T;  4ESR A;  3QII A;  2BTT A;  1VIF A;  2BZ8 A;  2HAX A;  2GTO A;  3CCM A;  1FMK A;  4F17 A;  2WIP B;  2RI3 A;  1HSQ A;  2YUP A;  4MZM A;  4E7H A;  2X4X A;  3DLM A;  3MPU B;  3A1P A;  3O8V A;  1PRL C;  3M0Q A;  1AWJ A;  1UTI A;  2LVM A;  3O0G D;  2J06 A;  5LJ5 h;  1YBY A;  1UDL A;  2ROT A;  1VQ6 T;  2X4W A;  4B9X A;  4YTL A;  4OGE A;  2YRV A;  1YN8 A;  1RUW A;  2RH2 A;  2EBP A;  5HBH B;  2VB6 A;  4AT1 B;  3VKI A;  1WNL A;  1G8X A;  3CMA A;  5DY9 A;  1EZZ B;  2RK1 A;  1QVG S;  1OKW B;  1ZX6 A;  2YUN A;  1SSH A;  2ZAE A;  2RJC A;  1PD1 A;  4CFN B;  3F5X B;  1GH6 B;  2CUB A;  3PTA A;  1VQ8 T;  2L3R A;  4F14 A;  1UHC A;  2OAU A;  2HZY A;  3L2V A;  2ZPE B;  4LNP A;  4KUD K;  4IMY B;  1OX8 A;  2XI9 A;  2CT3 A;  3KHI A;  3HPW A;  2H3J A;  4MMK A;  5IHY A;  4F7U B;  3QZ9 B;  1SHG A;  3ULR B;  1Y96 B;  4M7A A;  1NPR A;  3BDU A;  4BY7 X;  5GAN e;  4NOY A;  1RAF B;  1S1N A;  1W70 A;  3CPW S;  2ED0 A;  3CD6 Q;  4GBQ A;  1KIK A;  1QLB A;  3OYL A;  5I2M A;  1URC B;  1SEM A;  2JS2 A;  1VYU A;  3LGF A;  2ZPH B;  1H4L D;  1IHV A;  2DF6 A;  3CXC S;  1W2B S;  3QXE B;  2QI2 A;  4C8Q E;  3NGP A;  4J9E A;  4EOM B;  2KRM A;  2P0P A;  2DVJ A;  3R6N A;  1Z9Q A;  1U06 A;  2M0Y A;  4UC4 A;  4BY6 B;  3LWH A;  5ECA A;  1X6O A;  3R6O A;  2CZ0 B;  1S72 A;  1QVF S;  1JXO A;  3M58 A;  3CCM T;  4FL6 A;  3EH2 A;  4C5H A;  2VXE A;  1K8A R;  4A4K A;  2QGG A;  1HYO A;  2CDT A;  3OYY A;  3SD4 A;  2MYS A;  1QKX A;  2RF0 A;  3CQT A;  2PUO B;  1VYT A;  2WSC E;  3VYG B;  2MOX A;  4LD9 K;  1TH7 A;  1JJ2 P;  1VQ8 Q;  4JZ4 A;  1UE9 A;  2E41 A;  4J9G A;  5CKB A;  3JB9 G;  2NUZ A;  4M75 C;  2UZE B;  3SB2 A;  2C0I A;  2QQB A;  4PLL A;  2EJ9 A;  4M7D G;  1I1J A;  3OW2 A;  2OX7 A;  4M7D C;  2OTL A;  3M0R A;  2EAY A;  2KGT A;  2QQR A;  2EJF A;  2JNG A;  3OYG A;  3CMA T;  4PJO B;  3URG A;  1BIA A;  1R0C B;  1YI2 A;  2COY A;  5GMK l;  4LDU A;  1D3B A;  2RNA A;  3C94 A;  1CKA A;  1WGS A;  4M77 C;  1R0B G;  1FX7 A;  4M7A F;  1TSF A;  3J81 E;  3QHR B;  3HO8 A;  4VUB A;  2RK2 A;  5CKF A;  2GF7 A;  4HNV A;  2ZCF B;  2WAC A;  1AT1 B;  3JB9 D;  4OGC A;  2EYZ A;  4M78 B;  4A53 A;  2OTJ Q;  1JEG A;  1AWX A;  3L2W A;  2OJ2 A;  1H28 B;  3EFS A;  1YWO A;  4DA4 A;  5LJ5 j;  2QDY B;  2LX7 A;  4ME7 A;  4JRP A;  2MWO A;  1ZBX A;  2B8A A;  2EGA A;  1UUE A;  4BCN D;  4YC3 B;  1MNE A;  2BZY A;  3ZFJ A;  4RKU E;  2PVO B;  2O88 A;  2C6T B;  4R0K A;  2MMP A;  1E6G A;  2LT1 A;  4F6U B;  1B7T A;  2KMG A;  1TG0 A;  2CP5 A;  1TUG B;  4XTW A;  1WX6 A;  3FJ5 A;  1QVG A;  1SRL A;  4JX5 A;  5GAN 2;  1UGV A;  2CKK A;  2JTM A;  2M0O A;  4LDV A;  2C5O B;  3X25 B;  4BCP B;  1N4M A;  2E1H A;  1Y7X A;  1K9M R;  4ZTJ A;  2FZC B;  2ABL A;  2DET A;  1Q7Y R;  2IIM A;  3A8M B;  4Q5W A;  2NUT A;  4XTY A;  1OPL A;  1YHQ A;  5LJ3 f;  1I81 A;  2CSI A;  3QJ6 A;  1GFD A;  2VV5 A;  3SWN B;  4JDS A;  1UEB A;  2GTJ A;  1IRE B;  2FL7 A;  5A0L A;  4IIM A;  2UUE B;  2PJQ A;  3MCA B;  3BLH B;  3DLL A;  1NZ9 A;  3CPW A;  2LQ8 A;  2FZK B;  2X9H A;  2MAM A;  1VQ7 A;  4X1V A;  1MMD A;  1TTH B;  5FU6 B;  4PJJ A;  1N27 A;  3CXC A;  4Y92 A;  1X6B A;  2RQU A;  1W2B A;  5HVY B;  1VQM T;  4XTX A;  4BI3 A;  4LXC A;  5EC7 A;  3JV3 A;  1O9K A;  2KNB B;  3CCJ Q;  4CFX B;  2V8K A;  4BBS M;  2CP2 A;  2RHU A;  1W1F A;  2DAQ A;  2BIV A;  2EYX A;  2HCK A;  3LH5 A;  4F7U E;  4EOS B;  2DX1 A;  3EGD B;  1Y0M A;  4FT2 A;  4A4G A;  2L3Q A;  1HJD A;  3UF4 A;  4XTV A;  3QSU A;  4C5G A;  5HBJ B;  3HHT B;  3QYE A;  1PKT A;  3VUB A;  4Y91 A;  1I07 A;  2BKZ B;  2K6D A;  3I35 A;  3G4S A;  5KYX B;  2KE9 A;  2LCL A;  4JS5 A;  4J7I A;  2COZ A;  1PD0 A;  4J9F A;  2F2X A;  3U23 A;  4A63 B;  3RMS A;  3CCU Q;  1MND A;  2ECZ A;  2QQ8 A;  4LN2 A;  3CC7 A;  5LJ5 g;  5GMK h;  2O9S A;  4KRT A;  5FWC A;  4BCK B;  2GFA A;  4CI0 C;  2RJD A;  1K4U S;  3NPF A;  1AHJ B;  4R55 A;  2DBM A;  1I5L A;  4CC7 A;  1BI1 A;  1YIT A;  1F5Q B;  4F70 B;  2K57 A;  2LMJ A;  5GMK e;  3KUF A;  1Q82 C;  2KR3 A;  4E7I A;  4C0G A;  4ELJ A;  2K4Y A;  4JUV A;  4E7Z A;  2AKL A;  1ZHI A;  1K9A A;  4WTO B;  1W6X A;  2QK0 A;  3M0P A;  1BBZ A;  4M75 B;  1X2K A;  2WJ9 A;  3EG0 A;  5GAO l;  4BI4 A;  4A4F A;  1LNX A;  2AIR B;  4II1 A;  2R57 A;  4QT7 A;  1VQM Q;  1PWT A;  1FIN B;  4E2F B;  3CCV T;  1MUZ A;  1YHQ T;  4F6S B;  4MIM A;  5BNJ B;  4BCM B;  5LJ3 h;  1KHC A;  4XTU A;  3CC2 A;  2O4X B;  8AT1 B;  1Q82 U;  2HBW A;  2DL5 A;  4M77 B;  3M55 A;  4ZGJ B;  4B6M A;  2QGS A;  1IGQ A;  4PJO E;  2X4J A;  1E6H A;  2HKQ B;  2LX9 A;  4QVZ A;  2KT8 A;  2JS0 A;  3EG9 A;  3JCM X;  2IVX A;  5GAN 8;  3OYC A;  2QFZ A;  2KMT A;  4EOJ B;  3WXM B;  1ACM B;  3FRN A;  2J6O A;  1KC8 C;  1H8K A;  3BHV B;  4NL2 A;  2E5K A;  4AMC A;  2HL5 C;  4M7A C;  4KUL A;  4M7D A;  4M78 E;  3CCS Q;  2A28 A;  1VQP Q;  4E7K A;  4Z02 A;  4LDW A;  2QEX T;  5CVI A;  2DBK A;  1C6V X;  4AFZ C;  1VIE A;  2CZ6 B;  1Q86 C;  5ACB A;  2DM1 A;  3JAM E;  2CZ1 B;  4NST B;  5FU7 B;  3VS5 A;  2DKG A;  4CC2 A;  2X3X D;  2W99 A;  4RUG A;  2RQW A;  3CCR A;  3I55 Q;  3ZEH A;  3M53 A;  3G4S T;  1OIY B;  2DXC A;  3I56 A;  3A8H B;  3DOG B;  2JMC A;  2CUD A;  3OYJ A;  4EMH A;  1E9H B;  1KC8 U;  2GFU A;  3C4S A;  1WZO A;  4DQ2 A;  1LCK A;  3J7A F;  3CC7 T;  5EFQ B;  2HBP A;  1BK2 A;  4BE1 A;  2A3L A;  3BLR B;  4QSH A;  4XK8 E;  1M3A A;  1UJ0 A;  3CCL Q;  3CCV Q;  1I8F A;  4BCQ D;  2EQI A;  2Y90 A;  1Q86 U;  1WJS A;  5KYW B;  2QA4 Q;  3PGG A;  5GAM f;  4BXX X;  4QVD A;  1H1S B;  2W9F A;  5LQF B;  2NUP A;  1FVV B;  1M90 C;  4OMQ A;  4AFU C;  4C0F A;  1ZP2 A;  1NEG A;  2V8J A;  2UZB B;  2JJ9 A;  2VAS A;  1WHG A;  2CT4 A;  3QZ5 B;  5C6S A;  2YLC A;  1YWP A;  1X75 C;  2O01 E;  5I11 A;  1ZA2 B;  2F5K A;  4NL3 A;  4Z89 A;  4MZT A;  5KCO A;  4CFU B;  1JST B;  4FM4 B;  3SFM A;  5HKC A;  2BPM B;  2VC8 A;  3JB9 F;  1ZSZ B;  3HL8 A;  2CP7 A;  3FEO A;  4DOV A;  1U5S A;  1I5O B;  2Y4X A;  3CC2 T;  2QEX Q;  4OP0 A;  4M7D F;  1K73 R;  5CAI A;  3OYA A;  3EGU A;  3CC4 A;  1IHW A;  2K9G A;  1RLP C;  2EJG A;  2DER A;  1RAG B;  2YSQ A;  3X28 B;  5GAN f;  2V22 B;  4X9D A;  1M90 U;  2LTO A;  2LP5 A;  1GL5 A;  5HBE B;  2HKN A;  4TVR A;  3O5Z A;  3HP9 A;  3E1S A;  1QWF A;  1UGQ B;  3M56 A;  1UGP B;  4L6V 5;  1MMN A;  5J3B A;  2MI6 A;  2DMO A;  4N4I A;  2PK2 A;  2QG9 B;  2EVR A;  1KG1 A;  4EOI B;  4O5V A;  3VRZ A;  3S3M A;  4J9D A;  3M4G A;  4OR5 B;  2AKK A;  3V7R A;  5LJ3 j;  1RAE B;  2X1N B;  1F1B B;  4HVV A;  1TU0 B;  2PQW A;  4ORZ A;  3BG9 A;  3BDL A;  4ATO A;  1WIE A;  2CJM B;  4PK4 A;  1FYN A;  2VUB A;  3MIA B;  4A4E A;  3CCR T;  1M8M A;  3V7S A;  2W2H A;  2EYW A;  3QWX X;  4FYW B;  2L0A A;  5IAY A;  4LD6 A;  1YFN A;  3EG3 A;  2KQW A;  1U1S A;  1IO6 A;  2PVG B;  5LMK B;  2H8H A;  1ZUU A;  4JX6 A;  4RTX A;  3SEM A;  1CKB A;  4BE0 A;  4FSS A;  1QLY A;  4NC6 A;  3ZBD A;  1WHM A;  1KQ2 A;  1X01 A;  3BHT B;  4Z6Y A;  2EQJ A;  3GNF B;  3NTK A;  4J9B A;  4KRC B;  3RDV A;  3V8L A;  5GAM h;  1FMV A;  5HK3 A;  4PJO D;  1XTD A;  3S3N A;  2J7I A;  1OU8 A;  1YNZ A;  2DEQ A;  2ZZD A;  4CRI A;  1WXT A;  2DLP A;  5GAM e;  2C5N B;  4XTZ A;  1B34 A;  2VGN A;  1WQ7 A;  1QWE A;  4M7A B;  5IT9 E;  1H1Q B;  3CCE Q;  4IKF A;  4KT0 E;  2FYK A;  3L2U A;  2MK5 A;  4DEX A;  1YCY A;  4BAC A;  2KRO A;  2QXF A;  2WSE E;  4PFO A;  3C0C A;  3VS1 A;  2E5Q A;  2E6Z A;  2FVU A;  3WVE B;  3AHU A;  5CKH A;  3GIB A;  3CEY A;  1JBM A;  4EOP B;  3DJB A;  2BS4 A;  3BG5 A;  3UA6 A;  3MO8 A;  3L2Q A;  3CC4 T;  1KK7 A;  5DLO A;  3VKH A;  2L8D A;  2DEU A;  2J05 A;  4N0A A;  5GAN h;  3EHR A;  2G9X B;  3CCQ A;  1QW1 A;  2COW A;  3MP1 A;  3PMI A;  4KH0 B;  4HXJ A;  1VQ5 Q;  1PRM C;  2LJ1 A;  1M3B A;  2HQX A;  1MGQ A;  4IIO A;  1HD3 A;  2KYM A;  2ESW A;  2M9U A;  1VQO A;  2K5L A;  2YHT A;  2FHD A;  3GP8 A;  5IH2 A;  2HQH A;  5M9O A;  3LH0 A;  4YOO A;  3GOX A;  4M6V A;  3PFS A;  4C92 E;  3TNH B;  5CCA A;  2D9T A;  3RER A;  2E4H A;  2KVQ G;  1V1C A;  2CCH B;  5LJ3 g;  4B9W A;  4GY5 A;  1YJN A;  4FYV B;  1VQ4 A;  1UNL D;  5EJC A;  4PJM A;  1WLP B;  4QW2 A;  2DIG A;  1JKW A;  2K3B A;  1P92 A;  1V76 A;  3FC3 A;  3JRZ A;  1VQ6 Q;  4HNT A;  5IXF A;  2LNV A;  4PKC C;  1NJI C;  5LJ5 d;  2RHZ A;  2DXT A;  2I0N A;  2GGR A;  1UB4 A;  4FU6 A; 
#chains in the Genus database with same CATH homology
 1UGS B;  4M75 A;  4PJO G;  3DLL A;  2DZ9 A;  1BI0 A;  2AHJ B;  2PU9 B;  5GMK i;  3OA6 A;  4OB0 B;  4PJO C;  2MF2 A;  3V8J A;  1NZ9 A;  4PL6 A;  3CCE A;  4IUU A;  4C0Z A;  1WJQ A;  3BFM A;  3CPW A;  2LQ8 A;  2RHI A;  3M54 A;  2DTI A;  2MAM A;  1OI1 A;  4M7A G;  1VQ7 A;  3I56 T;  3RKX A;  3EAE A;  1D3B B;  5FU6 B;  3CME T;  2QQS A;  4OB1 B;  1MHN A;  1Y71 A;  1N27 A;  3L42 A;  3CXC A;  2OTJ A;  4IUP A;  3VU3 C;  4E47 A;  4M75 E;  2E6N A;  4AKH A;  2EQM A;  5GAN 5;  3DKM A;  3LW5 E;  5J26 A;  2X4Y A;  4F7U A;  1W2B A;  5CR2 A;  1VQM T;  4XTX A;  4J6Y A;  3C95 A;  2RA2 A;  4M78 G;  5HY6 A;  2O4X A;  4BI3 A;  1N8R C;  4BBR M;  3QG1 A;  4GLK A;  4IUV A;  3P8H A;  4M78 C;  4MML A;  4QQG A;  2XIC A;  4MZP A;  2A7Y A;  4FSX A;  3MET A;  2XDB A;  2R5A A;  4BBS M;  2RHU A;  2QQA A;  2V8K A;  4M77 A;  4M7D E;  3JB9 H;  2DAQ A;  3OB9 A;  3OBW A;  4IUR A;  1M1K C;  2BIV A;  2LCC A;  4EMK A;  5GAN 3;  2XHC A;  3INZ A;  1NJI U;  4F7U E;  4X9C A;  1BI3 A;  3CD6 T;  4AKG A;  2RI5 A;  1K73 C;  3JCM Q;  3CPF A;  2NLU A;  3MP6 A;  4HL4 A;  4FT2 A;  4A4G A;  4D6W A;  5A0D A;  3UPU A;  1VQ5 A;  4OB3 B;  2EIF A;  1FXX A;  4KBM B;  2E64 A;  4XTV A;  1YJW A;  3QSU A;  2G77 A;  4J6W A;  3P8D A;  3NTI A;  4M77 E;  4XU3 A;  2DD4 A;  2E10 A;  2P0K A;  4HLQ A;  3HHT B;  3QYE A;  1WQW A;  3VUB A;  4RMO A;  4JLG A;  4M7A D;  4Y91 A;  3RKY A;  1M1G A;  4RCB A;  4C92 B;  4L5G A;  3G4S A;  1VQ9 A;  2JUF A;  4E7J A;  4J83 A;  4BUG A;  2LCL A;  4C8Q B;  4JS5 A;  3CBO A;  1Y07 A;  1RL2 A;  3JSC A;  4HKE A;  4J7I A;  3TCJ A;  4C92 F;  3JCM d;  3RMS A;  3E9G A;  5L8R E;  4BB7 A;  2R5M A;  4C8Q F;  4A4H A;  1YIJ A;  4M78 D;  2D6F A;  2QQ8 A;  4E7L A;  1N8R U;  3CC7 A;  5LJ5 g;  5GMK h;  3F70 A;  3E19 A;  5GAO q;  2GFA A;  2GQV A;  3QO3 A;  4C5E A;  2RJD A;  4CI0 C;  1KQS S;  5IN1 A;  4NS5 A;  1AHJ B;  4R55 A;  4HNU A;  3OYH A;  5LJ5 f;  4JRK A;  5LJ5 e;  1I5L A;  1VQ6 A;  2I2L A;  2KK4 A;  1M1K U;  1BI1 A;  1YIT A;  3AHU A;  5GAM j;  4QQ6 A;  2K57 A;  3PT9 A;  5GMK e;  4FT4 A;  1M8V A;  3KUF A;  1Q82 C;  5CO7 A;  3TEE A;  4E7I A;  3CBP A;  2EYQ A;  3HRS A;  3QDR B;  3CCQ T;  2ZGW A;  1V29 B;  2LC4 A;  1K73 U;  4C0G A;  5GAN 6;  4HCC A;  4ELJ A;  1KQ1 A;  2K4Y A;  4JUV A;  3SWN C;  2GCX A;  1ZHI A;  3NTH A;  4BI8 B;  3L2Z A;  2K5F A;  1O75 A;  4C5I A;  1DJ7 B;  2KAF A;  4O6J A;  5CIU A;  4M75 B;  3E9F A;  3L1A A;  3H8Z A;  2WJ9 A;  1VQO T;  1K8A C;  2CZ7 B;  5I2S A;  5GAO l;  3LGL A;  3BW1 A;  1U8R A;  1I4K 1;  1WPY A;  4BI4 A;  1VQK A;  4A4F A;  1LNX A;  4M75 F;  1KD1 C;  1YJ9 A;  4II1 A;  2R57 A;  5DLQ E;  2RJE A;  4V2S A;  2JZ2 A;  2CYZ B;  4ZN3 A;  2XD0 A;  2DZC A;  5FU6 C;  4FIB A;  3OYK A;  1M9S A;  3CCJ A;  3RMQ A;  4PJO A;  1VQ4 T;  2MWP A;  3CCV T;  1YHQ T;  4MIM A;  2IG0 A;  2P0Q A;  2RJF A;  5LJ3 h;  1KHC A;  4XTU A;  1RI0 A;  5GAO n;  1VQO A;  3CC2 A;  2XU8 A;  2O4X B;  4QVC A;  4LOC A;  3M4Y A;  3N5B B;  4XU1 A;  5CKD A;  5GAN 4;  1Q82 U;  2ZPB B;  1XNI A;  2JVV A;  3JB9 I;  5GAN j;  4EMG A;  4M77 B;  3M55 A;  3UWN A;  4HCB A;  4ZGJ B;  1S72 T;  1W4S A;  3JCM h;  3V8K A;  4R56 A;  4JJN K;  4MDX A;  4EMK B;  4M77 F;  5GMK m;  1N9S A;  4PJO E;  3CCE T;  2X4J A;  5A2Q E;  2LX9 A;  4QVZ A;  3OS2 A;  5GAM d;  2X35 A;  4JRI A;  2RI2 A;  3X26 B;  3OQ5 A;  3JCM X;  1VQL A;  4WF2 A;  5GAN 8;  3PNW C;  3JCM f;  1K8A U;  3OYC A;  2KR6 A;  2JTF A;  5D6X A;  2LRQ A;  2QFZ A;  2KMT A;  3JCM e;  1G5V A;  3OYN A;  3WXM B;  1KD1 U;  4ZGD B;  1OZ2 A;  2DD4 B;  3FRN A;  3H6Z A;  3VKG A;  2OTJ T;  3CCU A;  4XAX B;  2ZZD B;  1KC8 C;  4C92 G;  3RUX A;  4NL2 A;  5KE2 A;  5J39 A;  2DIQ A;  5AYF A;  1B34 B;  4C8Q G;  4M7A C;  4KUL A;  4M7D A;  4C8Q C;  3QBY A;  4M78 E;  3G6E A;  1BI2 A;  3JCM P;  3QPH A;  2YLB A;  1N9R A;  3KBG A;  3MP8 A;  4E7K A;  3GNG A;  1FWZ A;  2P4T A;  4Z02 A;  2BS2 A;  3G7Z A;  4LDW A;  4HA8 A;  2QEX T;  5FRN A;  2G3R A;  2F69 A;  5CVI A;  3OW2 S;  1VIE A;  3OMG A;  4RG2 A;  3QYB A;  2QF7 A;  2CZ6 B;  1Y96 A;  3HFN A;  3OMC A;  5I21 A;  1Q86 C;  3V7C A;  2DXB A;  2DTO A;  1BIB A;  2OTL T;  5D6Y A;  2JOY A;  3HFO A;  3JAM E;  1VQ5 T;  3QII A;  3A5Z B;  3QUI A;  2CZ1 B;  1VIF A;  2KY9 A;  2HAX A;  2HD0 A;  1M4Z A;  5CQX A;  2K3Y A;  1IZ6 A;  1G3W A;  2E12 A;  5FU7 B;  4C5G A;  3OYD A;  3CCM A;  1VQN A;  2DKG A;  3X20 B;  4XU2 A;  1SSF A;  3CCR A;  1YI2 T;  3ZEH A;  3M53 A;  3Q1J A;  5GAN d;  3G4S T;  2JN0 A;  3J80 E;  2DXC A;  1QP3 A;  2RI3 A;  3HKS A;  3A8H B;  3I56 A;  2DTH A;  4RCC A;  1JB0 E;  4C0D B;  4MZM A;  4EMH A;  3OYJ A;  3CME A;  4E7H A;  3GPL A;  4C92 D;  4M75 G;  1KC8 U;  3JCM b;  2GFU A;  3C4S A;  3RES A;  2X4X A;  1YIJ T;  3M9Q A;  3DLM A;  4DQ2 A;  4C8Q D;  4LDY A;  5KE3 A;  3J7A F;  3CC7 T;  2L5Q A;  2HBP A;  1VQM A;  3O8V A;  2ZPI B;  2DD5 A;  4BE1 A;  4Y28 E;  2A3L A;  3C12 A;  2LVM A;  4QSH A;  3QHS A;  5GAO p;  4X34 A;  4XK8 E;  2DPP B;  5LJ5 h;  1YBY A;  3OSS C;  4IUT A;  1K9M C;  1VQ6 T;  1I8F A;  2RB6 A;  3ASK A;  2X4W A;  4N4H A;  4B9X A;  4XQ3 A;  4HCZ A;  5CK9 A;  5GAM g;  3OYB A;  2Y90 A;  1Q86 U;  3G71 A;  4YTL A;  4OGE A;  2YRV A;  1WJS A;  1Q7Y C;  2RH2 A;  3PGG A;  3A8O B;  5GAM f;  4MDW A;  4QVD A;  1QP2 A;  3OYM A;  4J7F A;  3TW6 A;  2EQK A;  3VKI A;  2LQK A;  2XDP A;  2QTX A;  3JCM V;  1WNL A;  4M77 G;  3CMA A;  4PNO A;  2BKD N;  3BY7 A;  5DY9 A;  1M90 C;  3P8B B;  4HT9 A;  2Y4Y A;  3VYG A;  1EIF A;  2RK1 A;  1OYX A;  4C0F A;  1QVG S;  3PMT A;  2V8J A;  1VQK T;  2XDD A;  2RJC A;  4M75 D;  1YJ9 T;  4OMF B;  3PTA A;  3QZ5 B;  2C06 A;  5C6S A;  2YLC A;  1X75 C;  2O01 E;  2F5K A;  1VQ8 T;  4NL3 A;  5C0M A;  2L3R A;  3FLG A;  4MZT A;  2OAU A;  3SFM A;  5KCO A;  4FM4 B;  2M16 A;  5HKC A;  2VC8 A;  3L2V A;  3CCJ T;  3CCS A;  1VQP A;  3JB9 F;  4JX4 A;  2ZPE B;  1G3T A;  3HZJ A;  3HL8 A;  4M7D D;  2BUD A;  3CBM A;  3FEO A;  4DOV A;  1FKM A;  4KUD K;  4ZGE B;  1K9M U;  3WVD B;  2Y4X A;  3CC2 T;  4ELZ C;  4RG8 A;  4JS4 A;  2XK0 A;  3HB9 A;  4M7D B;  3A8G B;  2XI9 A;  3S3O A;  1KQS A;  2VGM A;  1G3Y A;  4OP0 A;  1YJN T;  3KHI A;  1Q7Y U;  4M7D F;  2PVD B;  4L59 A;  5CAI A;  3HPW A;  5GAN g;  2H3J A;  4MMK A;  4F7U B;  2IVW A;  3OYA A;  3HRU A;  3VJP A;  3CC4 A;  3QZ9 B;  4BD3 A;  2EJG A;  4F7U F;  4M77 D;  1Y96 B;  3X28 B;  3ME9 A;  5GAN f;  4M7A A;  1NPR A;  3BDU A;  2DXB B;  4X9D A;  5GAN e;  1M90 U;  3HSB A;  4J8O A;  3I55 A;  3M57 A;  4NOY A;  4J5Y A;  2LTO A;  4XU0 A;  1O9S A;  2K3X A;  2DK3 A;  1N6A A;  3JCM c;  4EDU A;  3CPW S;  3MEW A;  1QLB A;  3OYL A;  5I2M A;  5FU7 C;  3DB4 A;  3LLR A;  1NPP A;  4JLI A;  3OYF A;  1BYM A;  3CCU T;  3LYI A;  2RO0 A;  3LGF A;  4TVR A;  4M78 A;  3HP9 A;  2ZPH B;  3VYH B;  2FB7 A;  3E1S A;  1UGQ B;  2EWN A;  3CXC S;  1VQ7 T;  2HNI A;  5GAO r;  3M56 A;  2DXC B;  1UGP B;  4N0A C;  4J6X A;  1W2B S;  4M7A E;  3G6E T;  3QXE B;  2QI2 A;  4L6V 5;  5J3B A;  3FB9 A;  2MI6 A;  4C8Q E;  2E70 A;  2M1H A;  4N4I A;  1OZ3 A;  4PLI A;  3PIP A;  3CCL A;  1KG1 A;  4O5V A;  2EKO A;  3S3M A;  4OVA A;  3CCV A;  2XKO C;  3KXT A;  5FRM A;  5EG2 A;  4C92 C;  2P0P A;  3FIF A;  1U1T A;  3M4G A;  2DD5 B;  5D6W A;  3V7R A;  5LJ3 j;  5HK0 A;  1HK9 A;  4QQD A;  4UC4 A;  3RKW A;  2QA4 A;  3A8L B;  3GLX A;  4BY6 B;  3LWH A;  3M5A A;  3DB3 A;  5CQY A;  4AI6 A;  2PQW A;  2EFI A;  2DO3 A;  1X6O A;  3R6O A;  3BG9 A;  2CZ0 B;  1S72 A;  1QVF S;  3BDL A;  3OBY A;  4ATO A;  1HXD A;  4EPC A;  1VQN T;  1H3Z A;  3M58 A;  3CCM T;  3FDR A;  3OS0 A;  4HT8 A;  4FL6 A;  4C5H A;  2VUB A;  2VXE A;  4A4E A;  4IUQ A;  3CCR T;  4A4K A;  5DM7 R;  3UDC A;  3V7S A;  3OYY A;  3SD4 A;  1YJW T;  5FRO A;  1PSF A;  5GAO m;  3TU4 K;  2K2V A;  3GF5 A;  2PUO B;  3BG3 A;  3UT1 A;  5IAY A;  2WSC E;  3VYG B;  4LD6 A;  4LD9 K;  2KQW A;  1U1S A;  1VQ9 T;  1TH7 A;  3HBL A;  2QDJ A;  2PVG B;  3RIR A;  4AKI A;  3MEA A;  4JX6 A;  3TW7 A;  1GXI E;  2E41 A;  2F5T X;  1UGR B;  3T9N A;  4ZN1 A;  4BE0 A;  5CKB A;  3JB9 G;  4M75 C;  4LDX A;  3H4C A;  3SB2 A;  2KDS A;  2D0Q B;  2QQB A;  5CKE A;  2QEX A;  4NC6 A;  3ZBD A;  3S6W A;  1JRI A;  3G71 T;  1KQ2 A;  1X01 A;  2BS3 A;  3SWN A;  4Z6Y A;  2EQJ A;  4PLL A;  3GNF B;  3NTK A;  2E65 A;  3OYI A;  1LJO A;  2EJ9 A;  1XQH A;  4ZTF A;  4M7D G;  3OW2 A;  3V8L A;  5GAM h;  1QVF A;  5HK3 A;  4PJO D;  4M7D C;  1ZQ1 A;  2OTL A;  1YIT T;  1XTD A;  3OYE A;  2EAY A;  3MHX A;  3S3N A;  2EJF A;  1H64 1;  2JNG A;  2QQR A;  5LL6 S;  3QYG B;  3OYG A;  3CMA T;  4F7U G;  4BDZ A;  4PJO B;  5A0G A;  5LJ3 d;  3URG A;  2DEQ A;  2ZZD A;  1BIA A;  4CRI A;  3CD6 A;  4PJO F;  2K5I A;  2RM4 A;  5GAM e;  1YI2 A;  2QQ9 A;  4XTZ A;  5GMK l;  1B34 A;  2VGN A;  3MEU A;  1WQ7 A;  2EQU A;  4LDU A;  4M7A B;  1D3B A;  3C94 A;  4BDY A;  5IT9 E;  1LOJ A;  3JCM J;  1WGS A;  4M77 C;  2CGH A;  1FX7 A;  4M7A F;  3TRE A;  2XID A;  3J81 E;  4IKF A;  3HO8 A;  1M1F A;  4KT0 E;  4VUB A;  2RK2 A;  5CKF A;  3QKJ A;  4EMK C;  2GF7 A;  4HNV A;  2ZCF B;  2ZPF B;  2WAC A;  3LX7 A;  3CCS T;  1VQP T;  2FYK A;  3DL1 A;  3L2U A;  4OGC A;  3JB9 D;  4M78 B;  4A53 A;  1YCY A;  4BAC A;  4A54 A;  2QXF A;  2WSE E;  1WJR A;  3JB9 J;  4OB2 B;  1Q81 C;  2E5Q A;  4M78 F;  2E6Z A;  3L2W A;  2FVU A;  3EFS A;  3ER0 A;  4DA4 A;  3WVE B;  2QDY B;  2L89 A;  3OSV A;  4ME7 A;  5CKH A;  5FLX E;  5LJ5 j;  3CEY A;  4MFD A;  3JCM W;  4JRP A;  1JBM A;  3GIB A;  2MWO A;  5GMK j;  3OS1 A;  3X24 B;  2XG8 D;  2BS4 A;  3BG5 A;  1VUB A;  3MO8 A;  1ZBX A;  3L2Q A;  3CC4 T;  2B8A A;  5DLO A;  3VKH A;  1G3S A;  2L8D A;  2PUK B;  4P5N A;  4N0A A;  5GAN h;  4BY6 C;  3L2R A;  3ZFJ A;  4RKU E;  3QYH B;  2DXU A;  1JJ2 S;  2RHX A;  2RHY A;  2PVO B;  3NFC A;  3I55 T;  3CCQ A;  1QW1 A;  4ELY C;  3MP1 A;  3VUZ A;  3PMI A;  3SDZ A;  4MFE A;  3MEV A;  2LT4 A;  2MMP A;  3OS5 A;  4N4G A;  1BKB A;  2LT1 A;  4C92 A;  2KMG A;  2ZPG B;  2HQX A;  1QVP A;  4XTW A;  1KHI A;  4C8Q A;  1MGQ A;  2KSS A;  1XOV A;  2WSF E;  1QVG A;  1VQL T;  4JX5 A;  5GAN 2;  4OF1 A;  5KH6 A;  5KCH A;  1NE8 A;  4BE2 A;  1VQ8 A;  2CKK A;  2JTM A;  2M9U A;  2K5L A;  2M0O A;  3EFR A;  3M59 A;  2YHT A;  4LDV A;  3OY9 A;  3X25 B;  2FHD A;  3GP8 A;  5M9O A;  1M5Q 1;  4KUI A;  2VYT A;  1R8O B;  2E1H A;  1Y7X A;  3PIO A;  5GAN 7;  3LH0 A;  2R58 A;  3QJY A;  3GOX A;  3CCL T;  4M6V A;  1Q81 U;  3PFS A;  2LDM A;  4C92 E;  3QWL A;  2CS7 A;  5CCA A;  2D9T A;  2DJZ A;  4ZTJ A;  3RER A;  2KVQ G;  4C0D C;  5LJ3 g;  2QA4 T;  3LWI A;  4B9W A;  4GY5 A;  3A8M B;  3HRT A;  4Q5W A;  3FJP A;  1YJN A;  2DVE A;  4XTY A;  1VQ4 A;  5EJC A;  2RD1 A;  1YHQ A;  5LJ3 f;  3VV0 A;  1I81 A;  4QW2 A;  2HQE A;  2DIG A;  5LJ3 e;  3FC3 A;  3QJ6 A;  1P92 A;  2VV5 A;  3JRZ A;  4DOW A;  4HNT A;  3SWN B;  3JCM g;  2LNV A;  4JDS A;  1UEB A;  4PKC C;  4JRQ A;  5LJ5 d;  1NJI C;  1JJ2 A;  2V8I A;  2RHZ A;  2DXT A;  1IRE B;  2FL7 A;  5A0L A;  1UB4 A;  2VXF A;  1E7P A;  1PSE A;  4FU6 A;  3MCA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...