2CZ0B

Photo-activation state of fe-type nhase in aerobic condition
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title photo-activation state of Fe-type NHase in aerobic condition
rcsb
molecule tags Lyase
total genus 56
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2cz0B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cz0B02
3QZ9B 1PSEA 2O01E 4RKUE 4ZGEB 2PU9B 4OB3B 2DD4B 5L8RE 2DXBA 2ZZDA 2ZPHB 4ZGJB 1JB0E 3X25B 2WSEE 2CZ0B 4KT0E 3VYGA 3QZ5B 4L6V5 2ZCFB 2AHJB 3LW5E 2PUKB 1V29B 4Y28E 3QXEB 3WVEB 2DXBB 2ZZDB 3X20B 1QP2A 2D0QB 3QYHB 3VYGB 2ZPIB 1QP3A 4XK8E 4OB0B 2PVDB 2PVOB 1DJ7B 2WSFE 1AHJB 1UGQB 1UGPB 3QYGB 2DD5A 2WSCE 3A8OB 2ZPBB 3X26B 2CZ1B 1UGRB 3A8LB 2ZPEB 2ZPGB 2QDYB 2DXCA 4ZGDB 2DD5B 3HHTB 2CZ7B 2DPPB 3A8HB 1GXIE 2ZPFB 3A8MB 2CZ6B 2PUOB 3X28B 3A8GB 4FM4B 2DXCB 1UGSB 2PVGB 3WVDB 3VYHB 1IREB 2DD4A 4OB2B 2CYZB 1PSFA 3X24B 4OB1B
chains in the Genus database with same CATH superfamily
3NPFA 5KYYA 4M7AA 3H4CA 2RHXA 3QZ9B 1YN8A 3JCMc 3CCVT 2QYZA 1N8RU 2WIPB 2M1HA 1X6GA 3BY7A 5D6XA 2FZKB 1KD1R 4AFSC 3JAME 3OSSC 1UG1A 3BG5A 1TOVA 5FRNA 2A3LA 1MMGA 2DL8A 2HBWA 2QQSA 3VUZA 2EYYA 4E7HA 2P0PA 3N5BB 4ELYC 3LGLA 3VYGA 2MWPA 1WHMA 4MFDA 5KCOA 3OYCA 2X3WD 2DEUA 4EOMB 1V1CA 4AT1B 3QXEB 5HBEB 1QVGP 1AWOA 1YHQT 2QTVA 1JJ2A 4M78B 1VYUA 1LNXA 4J9FA 2BKDN 3OW2S 4QVCA 3EJ1B 2YRCA 1B07A 3J81E 2MAMA 1NE8A 1M3CA 1ZBJA 2VWFA 3QKJA 1PNJA 1KD1C 4AKHA 1YJNQ 1JKWA 4HXJA 2E3IA 2CH4A 5A0LA 4XTUA 4LE9A 4LDXA 5EJCA 1ZUYA 2EWNA 4DBFA 4A63B 2ABLA 1YBYA 2JTFA 3VKHA 4IUTA 4RG8A 1YI2A 5FROA 2AT1B 2NLUA 2QQRA 4EOPB 4F16A 1VQMQ 3RKXA 4EMKB 2OTLQ 5I2MA 1PRLC 3OYHA 3RERA 3A8GB 1KC8R 1JQQA 1Z9ZA 1YJ9T 3WVDB 2DKGA 2NUPB 2HQHA 3VS5A 4M7DA 2DD4A 4A4EA 4BE2A 3S3OA 5GANh 3X24B 1RAFB 2QEXA 2EGCA 2K57A 4J9HA 3LLRA 4C8QE 2RHIA 4PFOA 3RKWA 1B34A 3O8VA 1I0CA 3M0UA 2XD0A 1YP5A 2PU9B 5AT1B 4QT7A 2PHGA 5L8RE 1VYVA 3EGXB 4M75G 3TCJA 1VQLT 5HK3A 2W0ZA 4JJCA 2LMJA 3RMSA 4DBQA 4OGEA 3CCJA 4LD9K 4OMFB 3REBB 1M3BA 3E2UA 3DJBA 2F2XA 3NTIA 3TSWA 3QDFA 1OPKA 4Y91A 2ED1A 2XDPA 4OMOA 2KRSA 3SDZA 1G3SA 3NGPA 3QIIA 4PLIA 4C92F 3L2UA 1KC8C 2L89A 3JCMW 4HNUA 4KRTA 1FX7A 5I2SA 2E4HA 2G9XB 5GANj 2OI3A 1IO6A 3H9NA 4LN2A 4BCQD 2WPAB 4M7AF 1OOTA 4GLKA 1UDLA 4BCKB 2KYMA 3TNHB 1R8OB 1BK2A 1TH7A 1W6XA 2AIRB 3CMET 3V8KA 3EHQA 2DRKA 1WFWA 2DL7A 1YWPA 3OS0A 1ZSZA 3CCEA 4BUGA 2DERA 4ROCA 5GAOm 1AWJA 4B9XA 1TUGB 2CSIA 3CPWA 1G2BA 2MYSA 2KMGA 4F04B 3BHVB 1RAHB 1GRIA 3ASKA 1AZGB 1Q86C 4LDUA 2E6ZA 3G71T 3C94A 2RPNA 4FL6A 3EH1A 2PUOB 2Y4YA 2XKOC 4EC8B 2KEAA 4KUIA 4M77A 2K2MA 2HD0A 1PRMC 4C0DB 2EPDA 1X01A 1K8AU 5HK0A 2CP7A 3M5AA 5GANd 4PJLA 3EFOA 2HL3A 1Y57A 1Q81U 3L1AA 4BDZA 2W99A 2HZYA 2RHZA 1QVFS 2KGTA 9ATCB 1BIBA 1BKBA 3CQTA 3RUXA 4FYWB 1UTIA 4XU3A 2UZBB 1N9SA 1W1FA 1HSQA 1WZOA 5FWBA 3CCRA 2DBMA 1VQPQ 3JCMg 2VXEA 3F70A 3OMGA 2H3EB 1BI3A 2GFAA 1JB0E 4LXCA 5A0GA 2WSEE 4C5GA 1U1TA 4LD6A 3BLRB 3M53A 2V22B 1NLOC 1AT1B 5KCHA 3MY1B 1G5VA 3HRTA 2LQKA 2B8AA 3MEUA 3CC2Q 1HD3A 3KXTA 2QK0A 3SB2A 4ELLA 1U1SA 3RESA 5GMKm 1M90R 4KGVB 2D0QB 3CCLA 4ZTFA 4F7SB 1WJSA 1WA7A 2Y4XA 3OYGA 5KH6A 2EAYA 1UNLD 3CC7A 2KR6A 2P4RA 1QKWA 4J9EA 3PIPA 5GMKl 1SRLA 2CZ1B 3A8LB 3POMA 4EC9B 2QQ8A 4P5NA 2SRCA 2MI6A 3M0SA 5CK9A 4JX5A 2LRQA 5GAOr 2DXCA 6AT1B 3CBOA 2MCNA 1D0ZA 1VQ5T 1RABB 2AKKA 4PJOB 4PFPA 4BCIB 4JS4A 4LNPA 3QUIA 4ME7A 2L5QA 3VS0A 4C92G 3UA6A 4PFZA 1MMNA 2EVRA 1YI2T 5IHKA 4IUQA 1RL2A 1WXUA 2BS4A 5J26A 3NHNA 4E7LA 3KBGA 2O9SA 2AK5A 5IXBA 2E5KA 3DDQB 3HB9A 3LWIA 1FXXA 1KK7A 4NL2A 3MJXA 4E7KA 3DOGB 3LYIA 2RD1A 1H4LD 3VS2A 3BFMA 1TTHB 2QEXT 3CCSQ 2HDAA 3VS7A 1YIJQ 2FPFA 2JGZB 5CYIB 2ENMA 5LQFB 1M3AA 4XQ3A 4CC3A 2KRNA 3G4ST 3BG9A 3CCJT 4M77F 2KT1A 1QLBA 3BDLA 1KJWA 4N4HA 3WVEB 3A5ZB 1TWBA 2R58A 4PKCC 5HQ0B 2E12A 3M0PA 1M2VA 3CCUA 1LVKA 2BZ8A 3JCMJ 1HK9A 3CCMA 1Q7YU 1KQ2A 4RTXA 1E9HB 1M90U 5DLQE 1B7TA 2F69A 3FJ5A 4N4GA 2PK9B 1I5OB 2EUFA 4CC2A 1OYXA 1D0XA 4FX3B 2VKNA 1VQNA 2IN3A 2M9UA 1WHLA 1IZ6A 3PMTA 1SRMA 1VQ7T 4M75A 2V1QA 1H1QB 2VASA 1UGPB 2DD5A 2JOYA 4UN0A 3GPLA 2DM1A 3CCQT 1URCB 2ZPBB 4ORZA 3FEOA 3QWYA 2KXCA 4F7LB 4JZ4A 5LJ3g 4AMCA 1YJWQ 2RJCA 2EJGA 5ICPB 3I55Q 4EOOB 1RAIB 1MV0B 2XDDA 4BE0A 4F7JB 3DLLA 2DIQA 3C4SA 2PMIB 3VJPA 4M78G 4BCND 5FGKB 1Y96A 2P4TA 3MEWA 2L0AA 2DK3A 4HKEA 1X43A 4E2FB 2LNHB 4OP0A 3HZJA 5J3BA 4D6WA 2B86A 2ZGWA 2LZ6B 1S72T 1FINB 4FT4A 1XQHA 3EGUA 2LP5A 4JS5A 2J6FA 1W4SA 4QQ6A 3E1SA 2BE7D 4OB2B 3NMZC 1O9KB 4OMPA 1YITA 3EH2A 2A37A 2DYIA 1OULA 2IIMA 4EORB 3EOCB 2GBQA 1NJIR 3I56Q 1WYXA 4JRPA 4MFEA 3GTMS 3FIFA 2WIHB 1H8KA 3CCRT 3J7AF 2ZZDA 3QHWB 4KH1B 1EX4A 2EYXA 1TS9A 5FU6B 5EC7A 1KQSS 3CD6T 5FRMA 2DILA 4YOZA 5GJWB 3OYKA 4FCYA 1U06A 2D8JA 1Q82U 3HO8A 2EKHA 1V29B 2O9VA 1KFZA 4IUVA 2PZ1A 1YWOA 1N8RR 4WTOB 2EIFA 1C1AA 5GMKi 4ESRA 4Q5WA 1GUXA 1YFNA 1AD6A 2WMBB 2RA2A 3G6EA 4RG2A 1NEBA 3CCLT 1G3WA 4C8QA 1EIFA 3RIRA 1QVGA 4CFNB 2RQTA 3KHIA 1QQJA 2PVOB 2E64A 1UGVA 3UA7A 1QVGS 1E7OA 1SPKA 2CH4W 3CC7T 1VQ4Q 1NPPA 3INZA 3OBWA 3CCVQ 4HVVA 1MHNA 2M16A 1GY3B 5GAN8 4OMLA 3GNFB 5HKCA 4BCQB 1FMWA 1AEYA 5GAN5 2D6FA 3DB4A 4O6JA 4M77G 3L2QA 2OTJT 2BS2A 1PD0A 1ZSGA 1N8RC 1YJNA 1T3SA 2HAXA 3A8HB 4XTWA 2K5FA 2R5MA 4IUPA 5KYUA 1AZEA 4IIOA 2ED0A 2KYBA 3PTAA 4CFXB 2C5XB 3FLGA 2PVGB 2FB7A 4MMKA 1WDXA 2HEQA 4HLQA 1LCKA 1IREB 3NDQA 1XNIA 1VQ9T 2OTLA 3ZBDA 3GP8A 3GF5A 1KHCA 3TU4K 4OGCA 1KQ1A 4IKFA 1G83A 2QGFB 2CP5A 2DTHA 1XJWB 4YOOA 2LVMA 3M59A 3EG0A 4PJOE 4C92A 1X2QA 2KXDA 3HRSA 2C6TB 4ZGJB 2NWMA 4M7AC 2IPOB 2RQVA 3DB3A 3VS3A 4R55A 2RI5A 2B9RA 2ZCFB 1E6HA 2CUBA 3CC4A 4DOWA 1SHGA 1UEBA 3EGDA 5KYXB 1D0YA 2NUZA 5GAMg 2WACA 3CCUT 1OI9B 2K4YA 2R7GA 2XMFA 1YJ9Q 4CXAB 2EJFA 2PQWA 2A08A 4EMGA 3I5RA 4J9GA 4JLGA 2P0KA 1OKVB 1K9MU 1OZ2A 1BI0A 2RK2A 1VQNT 1WQWA 3VU3C 2BZXA 1P92A 1NYFA 2M0OA 1VUBA 3X26B 1JU5C 4L5GA 4RCCA 2J7IA 3BHTB 3OW2A 2ZPEB 2UUEB 4KBMB 3M57A 2FO0A 3OYFA 2K6DA 2Z0WA 4PJJA 2I53A 2FL7A 5LJ5g 1FYNA 2P0QA 4KGXB 2QI2A 4FW1A 2RJEA 5LJ5f 4Z89A 3X28B 2QF7A 3BW1A 4C8QF 2DEQA 5HY6A 1I4K1 5LJ3h 2YUPA 1ACMB 1ZUKA 2LCCA 4OMMA 2EQUA 3JCMX 3CXCP 4EDUA 2QG9B 3CMAQ 4DEYA 3REAB 2CYZB 1MNEA 2O4XB 4C5EA 2YRVA 4CC4B 2VB6A 1YITT 1JO8A 3BLQB 2K2VA 1CSKA 4BCMD 2QQ9A 2VGMA 4AFQC 1C9BA 1BU2A 2LW4A 2JTEA 3TREA 4M7DC 2BUDA 5CQXA 5I11A 2DL3A 2GFUA 1K8AR 2CT4A 3M03A 2CP2A 2V8KA 5BNJB 2YT6A 3MY5B 4M78A 1N9RA 1D09B 2DXTA 3LGFA 2EBPA 1Q81R 2A28A 1FMVA 3FRNA 2YHTA 3G71Q 4A54A 1OPLA 1K73U 2UZLB 4M6VA 1WNLA 3MP6A 2D8HA 2IW9B 5LJ3e 4PJMA 2LQWA 1AOJA 3EG3A 2JS2A 1UB4A 2QDLA 3J80E 2L2PA 1WI7A 2C0OA 1WLPB 5CEIB 4RTTA 3OS1A 4MZTA 1IGQA 3PMIA 4OB0B 2A36A 4HNVA 4RCBA 2JZ2A 2ATCB 4EPCA 1U5SA 3OY9A 3G6ET 1W70A 3CC2A 2JXBA 1VQ6T 1UGQB 3QYGB 3EFRA 1K8AC 2VV5A 2I40B 1MMDA 2K3BA 4PL6A 2HKNA 4B9WA 3V7CA 4EMKA 1KXUA 1N4MA 3A98A 3C12A 1MMAA 2X4WA 2HQEA 4FW2A 1TFBA 2NUPA 2FZGB 2DPPB 1ENWA 1ZSZC 1ZX6A 2RMOA 5LJ3d 2EYZA 1GXIE 3JCMV 3NFCA 3G1JA 3UDCA 3EFOB 2YRDA 2KE9A 4XU0A 2NUTB 3GLXA 1MNDA 2J06A 1W2BP 1RADB 5IH2A 2P84A 4MZMA 2F5TX 1JJ2P 2MK5A 1QMCA 5D6YA 3FC3A 3EGXA 1CKAA 1PSFA 4M7AD 4OB1B 4BCNB 4NC6A 1PKTA 2IG0A 4M77C 4AFUC 2OTLT 1M8MA 2RN8A 3RBBB 2ROLA 2GCXA 4HCCA 4BY6C 1G3NC 2O01E 1V76A 4E7IA 4ZGEB 3RGFB 3OYLA 1X75C 5GAOl 1I1JA 2PTKA 4F7UB 2HQXA 5HNBB 5FU7B 3VS1A 1QVFA 3QWXX 3RNJA 1VQ5Q 4CFVB 1UUEA 2J6OA 1O75A 1H28B 4C5IA 1F1BB 1D3BA 1YI2Q 3CC4T 4C8QG 3ZFJA 4HNTA 2YWWA 4M7AE 2KI7A 4BCOB 2KAFA 5FU7C 4J6WA 1WIEA 1P5EB 2W9FA 4XK8E 4B6MA 5KYWB 3JCMf 2WSFE 1MGQA 1VA7A 2COWA 1ARKA 5GMKh 2LNVA 4M78F 3V8LA 1ZLMA 3MO8A 3L2VA 3QPHA 1D1CA 3T9NA 1Q7YR 3OYBA 1MV3A 1NM7A 4J6XA 2HSEB 4EMHA 2BS3A 4FYXB 1X69A 1N5ZA 1N6AA 4BD3A 3G4SQ 3V7RA 2SEMA 3CCJQ 5DQWA 4AKIA 1VIEA 4ZNXA 1JBMA 1NG2A 1YJWA 2GGRA 2J6KA 2QQBA 2VXFA 3I55A 1PCXA 1UGSB 2LJ0A 2MF2A 4ZN3A 2DXUA 4M7DD 3Q1JA 1WJQA 3L2WA 3B57A 2RJFA 2G3RA 2M0YA 5GMKj 1U8RA 1NZ9A 1TXQA 2BIVA 1OGUB 1X27A 3H8ZA 3M58A 4IIMA 1NEGA 4JDSA 5LJ5h 1FMKA 1VQ7Q 1VQ8Q 1Q7YC 4ROEA 1QCNA 4PLLA 4HVUA 5GMKe 3CCQQ 1OU9A 1M90C 5HVYB 4J9IA 3JB9H 4BCFB 2QTXA 1R0CB 1WQ7A 4KULA 1KSWA 3D7SB 3L2RA 2DX1A 2LQNA 2PNIA 1FVVB 2RO0A 4KT0E 4A4FA 2AHJB 4M7DE 4Z88A 4A4HA 3CPWP 4CRLB 5L23A 2EYWA 1Y07A 2DXBB 3TNWB 1NPRA 4OMQA 2XK0A 3I35A 1VYWB 2RQRA 1Y0MA 3MP1A 4NOYA 4TTHA 1C0MA 1VQKA 1S72Q 5LJ5j 2HNIA 4E7SA 1S1NA 4C0GA 4PJNA 1R0BG 4FT2A 1BU1A 2JMCA 3TVTA 4BDYA 4EOQB 4J83A 4ZTJA 4HL4A 2XI9A 5LJ5e 1MUZA 4XTYA 1Q82R 5HBHB 2BZYA 1AHJB 1PHTA 4PJOA 3DDPB 2DZ9A 2VGNA 4BCJB 5IN1A 4HCZA 2CSQA 3CCRQ 1H24B 4M75C 4F70B 5J39A 2JW4A 3CD6Q 4J9DA 2E41A 1VQ4A 4DBHA 3CCVA 3M4YA 1GBRA 2V26A 1BB9A 2YXYA 1UHCA 1UNHD 4EOSB 4M77D 2FVUA 1JSUB 2F2WA 4II1A 3HKSA 1M1GA 2LT1A 3EIDB 1QLYA 1PKSA 5CO7A 5LJ5d 3CCET 4ATOA 4NL3A 4F6WB 4JRKA 5LJ3f 2LQ8A 1JEGA 3PE0A 2DTIA 3QYBA 2E65A 1IB8A 2MIOA 2KSSA 2XHCA 1I8FA 4KH0B 2CJMB 2FZCB 3MIAB 1OQKA 1PWTA 1U3OA 2VUBA 2E6NA 2MOXA 1XOVA 2IVWA 4FSXA 5KE3A 1XO2A 2CCIB 5D6WA 3BDUA 4N0AA 4ELZC 2ROTA 3JB9F 1SHFA 3X25B 4JUVA 4R56A 1H25B 5IHYA 2GQIA 3JCMQ 2OTJQ 2RQWA 3JRZA 3LW5E 4BCMB 3JCMP 3OQ5A 5HCKA 2DL4A 2C5OB 2W9ZA 3JSCA 2CUDA 2OAUA 1QCFA 1OX9A 2EQKA 3M55A 4FSSA 4OVAA 1PG5B 2HBPA 2QA4A 2W96A 2CS7A 1KQSA 1T3LA 2XIDA 3HTRA 4CRIA 1VQOA 4A53A 4JJDA 1H92A 2BKZB 5GANg 1VQ9Q 2QGSA 5KYNA 4RUGA 3MCAB 4JPBW 5GJVB 4BI3A 1FWZA 4LDYA 3M0TA 2OX7A 4F7UE 5IT9E 5DY9A 2COZA 1UGRB 4M4ZA 4HA8A 1ZP2A 1YJ9A 3VRZA 4EOKB 1JXOA 4XTVA 4X1VA 4C8QC 3JCMh 1RAEB 1T0HA 2KVQG 4MIMA 2ZPGB 2KT8A 1QW1A 4JRQA 1M1KR 1K9MR 3ER0A 2EKOA 3SWNA 3QJYA 4XTZA 3GIBA 2MWOA 2Y90A 1NJIC 3K7AM 3H41A 3QO3A 1K0XA 3VUBA 3A8MB 1ABQA 1O9KA 5CIUA 4D8DA 4VUBA 2WEVB 2FRWA 2QAZA 3TEEA 8AT1B 1IXDA 1CKBA 2H8HA 2NYSA 5CKBA 3CCUQ 4MDWA 1YJWT 3EG9B 2XDBA 5EG2A 2EQIA 3PVQA 3VYHB 3I55T 4HT9A 4UC4A 3V8JA 3GBQA 4PJOF 1H3ZA 4BCHB 1OV3A 4WCIA 2FRYA 1VQNQ 3PT9A 2DO3A 1M8VA 4BCPB 3TN8B 2G77A 4AG1C 1ABOA 1H27B 1TSFA 1WHHA 2LCLA 3CXCA 1YHQQ 1HYOA 1LJOA 5A0DA 3EHRA 4X9CA 3S6WA 3JCMe 3CXCS 3CMAA 2CP3A 2E3HA 1K9MC 3OYAA 2YSQA 4LUDA 2DE0X 1RLQC 2FPEA 5KYYB 4M7AB 3TQ7P 1VQMA 2CT3A 4L6V5 2PUKB 3HFNA 2UZEB 2DRMA 1H3HA 2JS0A 4C92C 1GFCA 5GAOp 2XICA 2AZVA 3VS6A 3WXMB 2C4GB 2RF0A 3OS5A 4RTYA 3VYGB 1VQKT 1IHWA 1QP3A 1VIFA 3CBMA 4QQGA 4JZ3A 3JB9I 3G71A 3QSUA 1GCQA 2K5LA 3QHRB 1KHIA 2LC4A 2F2VA 3LH5A 4M75D 2GTJA 2KBTA 4DEXA 3OS2A 2R5AA 3EAEA 1K73R 3JCMd 4RTUA 5ACBA 3PIOA 4G6LB 1M1FA 2DFUA 2WHBB 4F7UG 3I9QA 3OYIA 3E9FA 4JX4A 2ZAEA 3CCMT 5GAN4 3JB9G 2AZSA 3BG3A 2FYKA 5GAMf 1OIUB 1BCMA 2F2CA 1M1KU 1K1ZA 4OMNA 2CZ7B 3P8HA 1VQ4T 1TUCA 2ZPFB 3URGA 4CFMB 2RHUA 2FPDA 4M75E 4RTZA 2O31A 1QMZB 1RI0A 2V8IA 3OYEA 4JRIA 3DTOA 4F6SB 1VQLQ 2LX7A 1K73C 4BXXX 3G6EQ 2RK1A 1NBEB 3UF4A 3OB9A 1VQ6Q 4EOLB 4A4KA 3M56A 1W2BA 2GQVA 1H1SB 1PSEA 3PGGA 1W2BS 4DQ2A 3PO3S 2HKQB 3MEVA 4HT8A 1OEBA 1WHJA 2KY9A 1Q95G 4M7DB 2DD4B 5KYXA 1JJ2S 3QBYA 4F6UB 3QG1A 4J7FA 2KDSA 5I5ZB 4CFWB 2VYTA 1WPYA 4WF2A 1N27A 4E7ZA 1H1PB 4BBRM 3I5SA 2X4JA 2E1HA 3VS4A 2K3YA 4AFZC 4FYVB 3E19A 2JT4A 1D3UB 2KMTA 2MPXC 1B34B 1C6VX 2F1LA 4QKUA 4BI8B 3CMEQ 3ULRB 2X4YA 3FJPA 3F5XB 3SEMA 2RJDA 4M78C 4DA4A 4FIBA 3VKGA 3C95A 1AVZC 2VVKA 5C0MA 5I22A 1PKDB 3QYHB 2O2OA 3MHXA 5IHIA 1VQ5A 2L3SA 3OMCA 4C8QD 1D1AA 3AHUA 4XU2A 4IMYB 3CEYA 2D0NA 4PJOG 5A2QE 2QA4T 1X6BA 1K0SA 2CCHB 3META 2PVDB 2RI2A 1VQOT 4CC7A 1AWXA 2YUNA 2YLBA 1OL2B 1T0JA 2EJ9A 4XAXB 5LJ3j 4V2SA 1QKXA 1ZQ1A 3TSZA 3A8OB 1JSTB 3VKIA 1VQPA 2FHDA 2QXFA 2DZCA 4TVRA 1I07A 5CKEA 3EG1A 4X9DA 2ESWA 4J9BA 1WHGA 2A7YA 4EONB 3BHUB 3SHWA 1A0NB 4J6YA 2DL5A 3BE3A 4ZGDB 4C0ZA 3VV0A 4EMKC 3L42A 8ATCB 4HCBA 1KG1A 1ZSZB 2O4XA 3PFSA 2COYA 2CP6A 3OYYA 3QDRB 3LWHA 3CC4Q 4J5YA 2C0TA 3AT1B 4JJNK 2DA9A 1FKMA 1B3QA 2PK2A 3HRUA 1Q81C 1HJDA 1KD1U 2WFYB 3G4SA 2DBKA 4AG2C 4J7IA 2JVVA 3U23A 3CBPA 2KQWA 4E7JA 1G8XA 4RMOA 5IF1B 2HL5C 2KNBB 2DMEA 2J05A 1OI1A 1ZHIA 4M77B 5CKFA 3UPUA 1YJNT 5DQVA 1Q86R 5L2WB 1NLPC 4BY6B 4C92D 1BIAA 4LDWA 2L3QA 2A0FB 4MZPA 5FWCA 2DVJA 2JUFA 2KROA 1RAGB 3CMAT 4JX6A 1VQ7A 3OW2P 1VQ8A 4CFUD 2K7AA 5GANe 1D3BB 2VC8A 4IURA 1VOLA 3CCQA 1BCOA 3UWNA 2DETA 2EGAA 1VQMT 1WHKA 2IW8B 2DTOA 1KIKA 2EQMA 1M4ZA 3HFOA 2WXVB 2YLCA 5LMKB 4XU1A 1RAAB 2C5NB 2ZPIB 2OAWA 4LUEA 1UNGD 2DNUA 1IGUA 1RLPC 4C92E 2QGGA 3CPWS 4N4IA 3LH0A 1SKUB 3JV3A 3CCSA 2CREA 1IRXA 1GBQA 2DIGA 2C06A 3R6OA 1YIJA 1S72A 4J8OA 2GF7A 4L59A 4QVDA 3SFMA 1KC8U 1I5LA 4QSHA 4E47A 4AKGA 1M5Q1 1VYTA 2LJ1A 2NUTA 2CKKA 2R57A 3O5ZA 3M0RA 5KE2A 3HL8A 3MPUB 1K9AA 2AKLA 4YC3B 7AT1B 2CZ6B 3IQLA 2LTOA 4RTVA 2RM4A 1RI9A 2YDLA 4C0DC 2QDJA 1YCYA 2QEXQ 2DXCB 5GAMh 3CD6A 1M9SA 4ANJA 4BE1A 1H1RB 1XTDA 3THKA 3R6NA 1VINA 4F7UA 3KUFA 2E70A 5D7UA 3HPWA 4YOSA 4C5HA 2CP0A 4QW2A 4OR5B 2JM8A 1SEMA 1H641 1X2KA 4RKUE 4M7DF 2W2HA 4HCKA 2HCKA 1Q86U 1PM3A 4XTXA 1JOWA 1M27C 2DMOA 1IHVA 1E7PA 4M78D 2H3JA 3MEAA 1G3TA 3H0IA 3M54A 3QJ6A 2X35A 1M2OA 4FU6A 2K79A 5GAMj 5KYWA 1JXMA 2RI3A 4Y28E 3OA6A 4E6RA 1TD6A 1ZBXA 3TW7A 1QP2A 1LPLA 2C5VB 3NTHA 2I0NA 5GAMe 1X6OA 3OBYA 1J3TA 1BYMA 3CCEQ 4LDVA 2OTJA 5EFQB 1DJ7B 2KK4A 4M78E 1M2VB 4X34A 4PK4A 2WSCE 3I56A 5HBJB 4KRDB 1RUWA 2KR3A 2HMAA 3OYJA 4AI6A 1VQPT 2JM9A 5CVIA 2JMAA 1AWWA 1SSHA 4BBSM 2M51A 4J9CA 1E6GA 4M7AG 3H0FA 5FW9A 1VQ9A 2QDYB 4M75B 3FDRA 4F17A 2DD5B 3JB9J 1R77A 4PJOC 2BPMB 4K11A 2DJZA 1JRIA 4FYYB 1OU8A 1OL1B 1M30A 1QVFP 4D8KA 5GAMd 2LCSA 2FG0A 3ZL7C 1PD1A 1Y7XA 5M9OA 3CC2T 5GAOn 2D1XA 4OGRB 5IDPB 4IUUA 3DL1A 3UT1A 1H26B 2LJ3A 4ZN1A 1OKWB 3OYNA 2GTOA 3TNIB 1UJ0A 4C0FA 1I81A 2HSPA 3P8BB 2KRMA 3RKYA 5FLXE 1LOJA 4KUDK 1Y96B 4RTWA 2YUQA 1WJRA 3H6ZA 1GFDA 1YCSB 4ELJA 5GAN2 3SD4A 1GL5A 1QWFA 3MP8A 4Z6YA 5I21A 3QHSA 2EFIA 2UZDB 4O5VA 2GNCA 3MKDA 2DXBA 3CPFA 4Z02A 3ZEHA 4Z8AA 2ZPHB 4I3ZB 3M0QA 1W98B 2BE9B 2RNAA 1EZZB 2CZ0B 3MI9B 2BTTA 2G6FX 1Q82C 3CCLQ 3A1PA 4QVZA 4BY1X 1VQ8T 3OSVA 2K3XA 3TW6A 4F14A 3S3NA 1YHQA 4EOJB 3RR6A 1WXTA 2JN0A 3PVLA 3CC7Q 2LDMA 2L8DA 1ZA1B 3ME9A 2ZZDB 4N0AC 4F7UF 4QQDA 1TU0B 3UATA 4BB7A 1AISB 2EGEA 4NSTB 1BI1A 1ZA2B 4BACA 4M77E 3LQ5B 2OJ2A 4GLMA 3S3MA 2L3PA 4BY7X 4DOVA 1SSFA 3RDVA 2IVXA 1D1BA 2DYBA 1BBZA 2E10A 1TUDA 4M7DG 3CCST 1GUXB 1GCPA 1OZ3A 2LX9A 4DBRA 1YIJT 1EFNA 3C0CA 5GAN6 3M9QA 4KGZB 4A4GA 4C8QB 3SWNB 2DLPA 1BI2A 3E9GA 1OX8A 2RHYA 2D9TA 3P8DA 4Y92A 3HSBA 2RQUA 4MMLA 4PNOA 5IHNA 2O88A 3EG2A 3JB9D 3LX7A 5CKHA 2JTMA 4YTLA 1PC0A 2X4XA 1O9SA 3GOXA 2W10A 2I2LA 5GANf 1WX6A 5CR2A 5GAN7 4FM4B 1QCOA 2XU8A 1NYGA 1VOMA 3GNGA 2V1RA 2E5QA 3SWNC 3NTKA 1TG0A 3OYMA 1UHFA 4OF1A 2QQAA 3FB9A 1OIYB 1VQKQ 3QWLA 5KYUB 2X51A 5AYFA 1Y71A 2CDTA 1QWEA 2DF6A 2EYQA 5DLOA 5GAOq 4GY5A 1YNZA 1K4US 2YUOA 2DVEA 2RH2A 4HVWA 3V7SA 4BI4A 2ECZA 1VQLA 5ECAA 4OB3B 1ZUUA 3M4GA 5FU6C 3CCMQ 5C6SA 1UE9A 3O0GD 5CKDA 1VQ6A 3RMQA 4LOCA 3KFVA 3QZ5B 5CAIA 3JCMb 2QFZA 1WGSA 2F5KA 2EW3A 2M02A 1UECA 3HP9A 4C92B 3X20B 4II5B 2K5IA 1UJYA 3H0HA 1M1KC 4MDXA 3HBLA 4Y72B 4CFUB 3CMEA 2IW6B 2RB6A 2JNGA 3EGDB 1K76A 4KRCB 2XG8D 2K9GA 5IAYA 2CGHA 4PJOD 2PJQA 2FEIA 4BCGB 2QASA 4F7NB 5IXFA 5DM7R 5LL6S 3I56T 1UFFA 1SG5A 5CQYA 5GAN3 3DKMA 1GCQC 2C0IA 3G7ZA 1F5QB 2DJQA 4EIKA 4M75F 5CCAA 2WJ9A 2MMPA 4EOIB 2JJ9A 3EG9A 3QYEA 3L2ZA 3HHTB 1Z9QA 3PNWC 4R0KA 2X9HA 2EQJA 2X1NB 1AD5A 2DAQA 3BLHB 1YITQ 1HXDA 1G3YA 4NS5A 1NJIU 4GBQA 3VRYA 3OYDA 3G33B 4JLIA 2WMAB 1QVPA 4JJBA 1GH6B 2V8JA 2X3XD 2QA4Q 5IDNB 1RACB 4RODA 4CI0C 1WXBA 1VQOQ 2L3RA 1SF9A 2LT4A 3DLMA 1KQSP 3EFSA
chains in the Genus database with same CATH topology
1Q7YC 1ZHIA 4M7AA 4M77B 3H4CA 5CKFA 2RHXA 4PLLA 3QZ9B 3JCMc 3CCVT 3UPUA 5GMKe 1YJNT 1M90C 4BY6B 1N8RU 2M1HA 3JB9H 4JRPA 4MFEA 3FIFA 2QTXA 3BY7A 1BIAA 1WQ7A 4KULA 5D6XA 4C92D 3CCRT 4LDWA 4MZPA 3J7AF 3JAME 3L2RA 2ZZDA 3OSSC 2JUFA 3BG5A 5FRNA 2A3LA 5FU6B 2QQSA 3VUZA 3CMAT 1KQSS 3CD6T 4JX6A 4E7HA 1VQ7A 2P0PA 3N5BB 4ELYC 1VQ8A 5FRMA 2RO0A 3LGLA 4KT0E 3VYGA 5GANe 4A4FA 1D3BB 2MWPA 2VC8A 4IURA 2AHJB 4MFDA 5KCOA 3OYCA 3CCQA 3UWNA 3OYKA 4M7DE 1VQMT 4A4HA 3HO8A 1Q82U 2DTOA 1V29B 3QXEB 4IUVA 2EQMA 1Y07A 1YHQT 1M4ZA 2DXBB 1NPRA 2XK0A 1JJ2A 3HFOA 2EIFA 4M78B 2YLCA 4C8QF 5GMKi 4XU1A 3MP1A 4NOYA 4Q5WA 1VQKA 1LNXA 5LJ5j 2BKDN 2HNIA 3OW2S 4QVCA 2ZPIB 4C0GA 2RA2A 3G6EA 4RG2A 4FT2A 3CCLT 3CXCS 1G3WA 4C8QA 1EIFA 3RIRA 4BDYA 1QVGA 3KHIA 4J83A 2PVOB 4C92E 2E64A 3CPWS 4ZTJA 4N4IA 4HL4A 2XI9A 3LH0A 2MAMA 5LJ5e 3J81E 1NE8A 4XTYA 1QVGS 3CCSA 1AHJB 3CC7T 1NPPA 2DIGA 3INZA 3QKJA 2C06A 3OBWA 3R6OA 1YIJA 4PJOA 1KD1C 4AKHA 1S72A 1MHNA 2DZ9A 2M16A 2VGNA 4J8OA 2GF7A 4L59A 5GAN8 4QVDA 3GNFB 5IN1A 4HCZA 3SFMA 5A0LA 5HKCA 1KC8U 4XTUA 1I5LA 4QSHA 4E47A 5GAN5 5EJCA 4AKGA 2EWNA 1M5Q1 4LDXA 2D6FA 2CKKA 4M75C 5J39A 2R57A 1YBYA 2JTFA 3DB4A 3VKHA 2E41A 4O6JA 1VQ4A 4IUTA 4M77G 3L2QA 5KE2A 4RG8A 3CCVA 2OTJT 3M4YA 2BS2A 1N8RC 1YJNA 1YI2A 3HL8A 5FROA 2HAXA 3A8HB 2NLUA 2K5FA 2QQRA 4XTWA 2R5MA 3RKXA 4IUPA 2CZ6B 4EMKB 5I2MA 3RERA 3OYHA 2LTOA 4M77D 2RM4A 2FVUA 3A8GB 4C0DC 2QDJA 1YCYA 3PTAA 2DXCB 4II1A 3FLGA 3HKSA 1M1GA 5GAMh 2PVGB 3CD6A 1M9SA 2FB7A 2LT1A 4MMKA 1YJ9T 3WVDB 2DKGA 4HLQA 5CO7A 5LJ5d 4BE1A 3CCET 4ATOA 1XTDA 4NL3A 4M7DA 1IREB 2DD4A 4JRKA 1XNIA 5LJ3f 4F7UA 2LQ8A 3KUFA 2E70A 4A4EA 4BE2A 1VQ9T 3S3OA 2OTLA 5GANh 2DTIA 3QYBA 2E65A 3X24B 3GF5A 2KSSA 2XHCA 1I8FA 3HPWA 3ZBDA 4C5HA 2QEXA 4QW2A 1KHCA 3TU4K 2K57A 4C8QE 3LLRA 3GP8A 2RHIA 2VUBA 4OGCA 2E6NA 3RKWA 1H641 1KQ1A 4RKUE 4M7DF 1B34A 1XOVA 4IKFA 3O8VA 1Q86U 2IVWA 2XD0A 4XTXA 2PU9B 2DTHA 2LVMA 3M59A 4FSXA 1E7PA 4M78D 5L8RE 5KE3A 2H3JA 4M75G 3TCJA 5D6WA 4PJOE 3MEAA 3BDUA 4C92A 1VQLT 4N0AA 5HK3A 4ELZC 1G3TA 3HRSA 3M54A 3RMSA 4ZGJB 4OGEA 3JB9F 3X25B 4M7AC 4JUVA 3CCJA 3DB3A 3QJ6A 4R56A 4OMFB 4LD9K 4R55A 2RI5A 3NTIA 2ZCFB 3JCMQ 2X35A 4Y91A 3JRZA 2XDPA 3LW5E 4FU6A 3CC4A 5GAMj 3JCMP 2RI3A 3OQ5A 1G3SA 4PLIA 3QIIA 4Y28E 3SDZA 4C92F 1UEBA 4DOWA 3OA6A 3L2UA 2L89A 1KC8C 3JCMW 4HNUA 3JSCA 1ZBXA 3TW7A 1FX7A 1QP2A 2OAUA 3NTHA 3M55A 2EQKA 5GAMg 4OVAA 2WACA 5I2SA 2K4YA 3CCUT 5GAMe 5GANj 2HBPA 1X6OA 2CS7A 2QA4A 3OBYA 1KQSA 2XIDA 1BYMA 4CRIA 4M7AF 4GLKA 4LDVA 2EJFA 2PQWA 1VQOA 4A53A 4EMGA 2OTJA 4JLGA 2P0KA 1R8OB 1TH7A 1K9MU 5GANg 1DJ7B 1OZ2A 1BI0A 2KK4A 2RK2A 1WQWA 4M78E 3VU3C 1VQNT 3CMET 3MCAB 1P92A 3V8KA 4X34A 4BI3A 1FWZA 2WSCE 4LDYA 3I56A 4F7UE 5IT9E 2M0OA 1VUBA 5DY9A 3X26B 4L5GA 4RCCA 1UGRB 4HA8A 3OYJA 1YJ9A 4AI6A 3OS0A 1VQPT 4XTVA 5CVIA 3CCEA 4BUGA 4C8QC 3OW2A 3QSUA 2ZPEB 4BBSM 3JCMh 2KVQG 5GAOm 4M7AG 4MIMA 2ZPGB 1VQ9A 2QDYB 1QW1A 4B9XA 4KBMB 4JRQA 3M57A 3CPWA 3OYFA 4M75B 3FDRA 3JB9J 2DD5B 2KMGA 4PJOC 3ER0A 2EKOA 3ASKA 3QJYA 4XTZA 3SWNA 2DJZA 2FL7A 5LJ5g 3GIBA 1Q86C 2P0QA 2MWOA 1JRIA 2E6ZA 2Y90A 4LDUA 3G71T 1NJIC 2QI2A 3QO3A 3VUBA 3A8MB 3C94A 4FL6A 5GAMd 2PUOB 1Y7XA 2RJEA 2XKOC 2Y4YA 5M9OA 5GAOn 5CIUA 3CC2T 5LJ5f 4VUBA 2QF7A 3X28B 3BW1A 4KUIA 4M77A 2DEQA 3DL1A 4IUUA 1I4K1 2HD0A 5HY6A 5LJ3h 5CKBA 3TEEA 3UT1A 2LCCA 1X01A 4C0DB 4ZN1A 1YJWT 4MDWA 3OYNA 1K8AU 2EQUA 5HK0A 2XDBA 3M5AA 5EG2A 5GANd 4C0FA 1I81A 3VYHB 3JCMX 3I55T 4HT9A 4UC4A 3V8JA 4EDUA 4PJOF 1Q81U 1H3ZA 3P8BB 3RKYA 3L1AA 5FLXE 1LOJA 4BDZA 2RHZA 4KUDK 1QVFS 2CYZB 2O4XB 1Y96B 4C5EA 2YRVA 3PT9A 1WJRA 3H6ZA 2DO3A 1BIBA 1BKBA 1M8VA 4ELJA 5GAN2 1YITT 3SD4A 2G77A 2K2VA 3RUXA 4XU3A 2QQ9A 2VGMA 1N9SA 2LCLA 3MP8A 3CXCA 3CCRA 4Z6YA 3TREA 4M7DC 2BUDA 5CQXA 5I21A 3JCMg 2GFUA 1LJOA 3QHSA 2EFIA 5A0DA 2VXEA 3JCMe 4X9CA 4O5VA 3F70A 3OMGA 2DXBA 3CPFA 2V8KA 4Z02A 3S6WA 3ZEHA 3CMAA 2ZPHB 4M78A 3OYAA 1N9RA 1BI3A 2DXTA 2GFAA 3LGFA 1JB0E 5A0GA 2WSEE 4C5GA 1U1TA 2CZ0B 4LD6A 4M7AB 3M53A 1Q82C 4QVZA 1VQMA 4L6V5 1VQ8T 3FRNA 3OSVA 2K3XA 3TW6A 2YHTA 5KCHA 3S3NA 2PUKB 1YHQA 1G5VA 2JN0A 3HRTA 3HFNA 4A54A 1K73U 2LDMA 2L8DA 4C92C 2LQKA 2B8AA 3MEUA 3ME9A 4N0AC 2ZZDB 5GAOp 2XICA 3KXTA 4M6VA 1WNLA 3MP6A 3WXMB 4F7UF 3SB2A 4QQDA 5LJ3e 1U1SA 3RESA 5GMKm 4BB7A 3OS5A 2D0QB 1UB4A 3CCLA 3VYGB 3J80E 1BI1A 4ZTFA 1VQKT 4BACA 1QP3A 1WJSA 1VIFA 3CBMA 4M77E 4QQGA 3OS1A 4MZTA 2Y4XA 3S3MA 3PMIA 3JB9I 3OYGA 4OB0B 5KH6A 3G71A 4HNVA 2EAYA 2JZ2A 2K5LA 4RCBA 4EPCA 3OY9A 1KHIA 2LC4A 3G6ET 4DOVA 3CC7A 4M75D 1SSFA 2KR6A 3CC2A 1VQ6T 3OS2A 1UGQB 3QYGB 2E10A 2R5AA 3EFRA 3EAEA 3JCMd 3PIPA 1K8AC 4M7DG 3PIOA 2VV5A 3CCST 1M1FA 5GMKl 1OZ3A 2LX9A 2CZ1B 4PL6A 4F7UG 3A8LB 4B9WA 1YIJT 5GAN6 3V7CA 4EMKA 3OYIA 3E9FA 2QQ8A 4P5NA 3M9QA 2MI6A 4JX4A 4A4GA 4C8QB 5CK9A 3SWNB 4JX5A 1BI2A 3E9GA 3CCMT 2LRQA 5GAN4 5GAOr 3JB9G 3C12A 2RHYA 2D9TA 2DXCA 2HQEA 2X4WA 3P8DA 3HSBA 3CBOA 3BG3A 4MMLA 4PNOA 2FYKA 1VQ5T 5GAMf 1M1KU 4PJOB 4JS4A 3JB9D 2CZ7B 2DPPB 2L5QA 3LX7A 3P8HA 3QUIA 4ME7A 4C92G 1VQ4T 5CKHA 5LJ3d 1GXIE 2JTMA 2ZPFB 4YTLA 2X4XA 1YI2T 1O9SA 3URGA 4IUQA 3JCMV 3GOXA 1RL2A 2I2LA 2RHUA 5GANf 3NFCA 3UDCA 5CR2A 4M75E 5GAN7 4FM4B 2BS4A 2XU8A 4XU0A 1RI0A 3GLXA 5J26A 4E7LA 3GNGA 2E5QA 2V8IA 3SWNC 3OYEA 3KBGA 3NTKA 4JRIA 4MZMA 2F5TX 3OYMA 4OF1A 2QQAA 3FB9A 1K9MC 3QWLA 3HB9A 3FC3A 5D6YA 3LWIA 1K73C 1FXXA 4NL2A 5AYFA 2RK1A 1PSFA 4E7KA 4M7AD 1Y71A 3LYIA 2IG0A 4OB1B 4NC6A 3OB9A 4M77C 2RD1A 2OTLT 2EYQA 5DLOA 4A4KA 1W2BA 3M56A 2GQVA 5GAOq 2GCXA 3BFMA 4GY5A 1PSEA 4HCCA 4BY6C 2O01E 2DVEA 2RH2A 3PGGA 2QEXT 4ZGEB 4E7IA 1W2BS 3OYLA 3V7SA 4BI4A 1X75C 4DQ2A 5GAOl 3MEVA 1VQLA 4HT8A 2KY9A 4OB3B 4M7DB 2DD4B 1JJ2S 3M4GA 4F7UB 2HQXA 3QBYA 3QG1A 5FU6C 4J7FA 5FU7B 2KDSA 5C6SA 2VYTA 1WPYA 4WF2A 1N27A 1QVFA 4BBRM 5CKDA 4XQ3A 2X4JA 1VQ6A 2E1HA 3RMQA 2K3YA 3E19A 4LOCA 3G4ST 3QZ5B 5CAIA 3JCMb 2KMTA 3BG9A 3CCJT 4M77F 2QFZA 1O75A 1B34B 1QLBA 1WGSA 4BI8B 3BDLA 2X4YA 3FJPA 4N4HA 4C5IA 3WVEB 1D3BA 3A5ZB 2RJDA 3CC4T 2F5KA 2R58A 4PKCC 4M78C 2E12A 4C8QG 3HP9A 3ZFJA 3X20B 4HNTA 4FIBA 4C92B 3CCUA 4DA4A 3VKGA 3JCMJ 1HK9A 3C95A 3CCMA 1Q7YU 4M7AE 1KQ2A 2K5IA 5C0MA 2KAFA 3MHXA 3QYHB 5DLQE 1M1KC 1M90U 1VQ5A 4MDXA 3OMCA 3HBLA 2F69A 4J6WA 5FU7C 4N4GA 4C8QD 3AHUA 4XU2A 1OYXA 3CEYA 4PJOG 5A2QE 2QA4T 4XK8E 1VQNA 3CMEA 3META 2M9UA 3JCMf 2PVDB 2RB6A 2RI2A 1IZ6A 2JNGA 1VQOT 3PMTA 2WSFE 1MGQA 2XG8D 5IAYA 2YLBA 1VQ7T 2CGHA 2EJ9A 4M75A 4XAXB 5LJ3j 4V2SA 4PJOD 1UGPB 2DD5A 1ZQ1A 2JOYA 5GMKh 3GPLA 2LNVA 3CCQT 3A8OB 1VQPA 2ZPBB 4M78F 3V8LA 3VKIA 5DM7R 2FHDA 3MO8A 5LL6S 3L2VA 2QXFA 3QPHA 3FEOA 3I56T 2DZCA 3T9NA 3OYBA 4TVRA 5LJ3g 5CQYA 5GAN3 3DKMA 5CKEA 4X9DA 3G7ZA 5CCAA 4J6XA 4M75F 2WJ9A 2A7YA 2MMPA 4EMHA 2RJCA 2EJGA 4J6YA 2BS3A 2XDDA 3QYEA 4ZGDB 3L2ZA 3HHTB 1N6AA 4C0ZA 4BE0A 3PNWC 4BD3A 2EQJA 3V7RA 3DLLA 2DIQA 4AKIA 3C4SA 1VIEA 3VV0A 3VJPA 4EMKC 3L42A 4HCBA 4M78G 1KG1A 2DAQA 2O4XA 1Y96A 2P4TA 3PFSA 1HXDA 1JBMA 1G3YA 3MEWA 2DK3A 3OYYA 3QDRB 4HKEA 4NS5A 3LWHA 4J5YA 1YJWA 4OP0A 3HZJA 3OYDA 1NJIU 2QQBA 5J3BA 4D6WA 2VXFA 4JJNK 2ZGWA 3I55A 1UGSB 1FKMA 3HRUA 1S72T 2MF2A 1Q81C 1KD1U 4ZN3A 2DXUA 4FT4A 1XQHA 4JLIA 4M7DD 3Q1JA 3G4SA 1WJQA 3L2WA 4JS5A 4J7IA 2JVVA 1QVPA 2RJFA 3CBPA 2KQWA 1W4SA 2G3RA 2V8JA 5GMKj 1NZ9A 4QQ6A 2BIVA 4RMOA 3E1SA 4E7JA 1U8RA 3M58A 3H8ZA 4CI0C 4OB2B 2L3RA 3DLMA 2LT4A 4JDSA 5LJ5h 3EFSA 1YITA 1OI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QZ9 B;  1PSE A;  2O01 E;  4RKU E;  4ZGE B;  2PU9 B;  4OB3 B;  2DD4 B;  5L8R E;  2DXB A;  2ZZD A;  2ZPH B;  4ZGJ B;  1JB0 E;  3X25 B;  2WSE E;  2CZ0 B;  4KT0 E;  3VYG A;  3QZ5 B;  4L6V 5;  2ZCF B;  2AHJ B;  3LW5 E;  2PUK B;  1V29 B;  4Y28 E;  3QXE B;  3WVE B;  2DXB B;  2ZZD B;  3X20 B;  1QP2 A;  2D0Q B;  3QYH B;  3VYG B;  2ZPI B;  1QP3 A;  4XK8 E;  4OB0 B;  2PVD B;  2PVO B;  1DJ7 B;  2WSF E;  1AHJ B;  1UGQ B;  1UGP B;  3QYG B;  2DD5 A;  2WSC E;  3A8O B;  2ZPB B;  3X26 B;  2CZ1 B;  1UGR B;  3A8L B;  2ZPE B;  2ZPG B;  2QDY B;  2DXC A;  4ZGD B;  2DD5 B;  3HHT B;  2CZ7 B;  2DPP B;  3A8H B;  1GXI E;  2ZPF B;  3A8M B;  2CZ6 B;  2PUO B;  3X28 B;  3A8G B;  4FM4 B;  2DXC B;  1UGS B;  2PVG B;  3WVD B;  3VYH B;  1IRE B;  2DD4 A;  4OB2 B;  2CYZ B;  1PSF A;  3X24 B;  4OB1 B; 
#chains in the Genus database with same CATH topology
 3NPF A;  5KYY A;  4M7A A;  3H4C A;  2RHX A;  3QZ9 B;  1YN8 A;  3JCM c;  3CCV T;  2QYZ A;  1N8R U;  2WIP B;  2M1H A;  1X6G A;  3BY7 A;  5D6X A;  2FZK B;  1KD1 R;  4AFS C;  3JAM E;  3OSS C;  1UG1 A;  3BG5 A;  1TOV A;  5FRN A;  2A3L A;  1MMG A;  2DL8 A;  2HBW A;  2QQS A;  3VUZ A;  2EYY A;  4E7H A;  2P0P A;  3N5B B;  4ELY C;  3LGL A;  3VYG A;  2MWP A;  1WHM A;  4MFD A;  5KCO A;  3OYC A;  2X3W D;  2DEU A;  4EOM B;  1V1C A;  4AT1 B;  3QXE B;  5HBE B;  1QVG P;  1AWO A;  1YHQ T;  2QTV A;  1JJ2 A;  4M78 B;  1VYU A;  1LNX A;  4J9F A;  2BKD N;  3OW2 S;  4QVC A;  3EJ1 B;  2YRC A;  1B07 A;  3J81 E;  2MAM A;  1NE8 A;  1M3C A;  1ZBJ A;  2VWF A;  3QKJ A;  1PNJ A;  1KD1 C;  4AKH A;  1YJN Q;  1JKW A;  4HXJ A;  2E3I A;  2CH4 A;  5A0L A;  4XTU A;  4LE9 A;  4LDX A;  5EJC A;  1ZUY A;  2EWN A;  4DBF A;  4A63 B;  2ABL A;  1YBY A;  2JTF A;  3VKH A;  4IUT A;  4RG8 A;  1YI2 A;  5FRO A;  2AT1 B;  2NLU A;  2QQR A;  4EOP B;  4F16 A;  1VQM Q;  3RKX A;  4EMK B;  2OTL Q;  5I2M A;  1PRL C;  3OYH A;  3RER A;  3A8G B;  1KC8 R;  1JQQ A;  1Z9Z A;  1YJ9 T;  3WVD B;  2DKG A;  2NUP B;  2HQH A;  3VS5 A;  4M7D A;  2DD4 A;  4A4E A;  4BE2 A;  3S3O A;  5GAN h;  3X24 B;  1RAF B;  2QEX A;  2EGC A;  2K57 A;  4J9H A;  3LLR A;  4C8Q E;  2RHI A;  4PFO A;  3RKW A;  1B34 A;  3O8V A;  1I0C A;  3M0U A;  2XD0 A;  1YP5 A;  2PU9 B;  5AT1 B;  4QT7 A;  2PHG A;  5L8R E;  1VYV A;  3EGX B;  4M75 G;  3TCJ A;  1VQL T;  5HK3 A;  2W0Z A;  4JJC A;  2LMJ A;  3RMS A;  4DBQ A;  4OGE A;  3CCJ A;  4LD9 K;  4OMF B;  3REB B;  1M3B A;  3E2U A;  3DJB A;  2F2X A;  3NTI A;  3TSW A;  3QDF A;  1OPK A;  4Y91 A;  2ED1 A;  2XDP A;  4OMO A;  2KRS A;  3SDZ A;  1G3S A;  3NGP A;  3QII A;  4PLI A;  4C92 F;  3L2U A;  1KC8 C;  2L89 A;  3JCM W;  4HNU A;  4KRT A;  1FX7 A;  5I2S A;  2E4H A;  2G9X B;  5GAN j;  2OI3 A;  1IO6 A;  3H9N A;  4LN2 A;  4BCQ D;  2WPA B;  4M7A F;  1OOT A;  4GLK A;  1UDL A;  4BCK B;  2KYM A;  3TNH B;  1R8O B;  1BK2 A;  1TH7 A;  1W6X A;  2AIR B;  3CME T;  3V8K A;  3EHQ A;  2DRK A;  1WFW A;  2DL7 A;  1YWP A;  3OS0 A;  1ZSZ A;  3CCE A;  4BUG A;  2DER A;  4ROC A;  5GAO m;  1AWJ A;  4B9X A;  1TUG B;  2CSI A;  3CPW A;  1G2B A;  2MYS A;  2KMG A;  4F04 B;  3BHV B;  1RAH B;  1GRI A;  3ASK A;  1AZG B;  1Q86 C;  4LDU A;  2E6Z A;  3G71 T;  3C94 A;  2RPN A;  4FL6 A;  3EH1 A;  2PUO B;  2Y4Y A;  2XKO C;  4EC8 B;  2KEA A;  4KUI A;  4M77 A;  2K2M A;  2HD0 A;  1PRM C;  4C0D B;  2EPD A;  1X01 A;  1K8A U;  5HK0 A;  2CP7 A;  3M5A A;  5GAN d;  4PJL A;  3EFO A;  2HL3 A;  1Y57 A;  1Q81 U;  3L1A A;  4BDZ A;  2W99 A;  2HZY A;  2RHZ A;  1QVF S;  2KGT A;  9ATC B;  1BIB A;  1BKB A;  3CQT A;  3RUX A;  4FYW B;  1UTI A;  4XU3 A;  2UZB B;  1N9S A;  1W1F A;  1HSQ A;  1WZO A;  5FWB A;  3CCR A;  2DBM A;  1VQP Q;  3JCM g;  2VXE A;  3F70 A;  3OMG A;  2H3E B;  1BI3 A;  2GFA A;  1JB0 E;  4LXC A;  5A0G A;  2WSE E;  4C5G A;  1U1T A;  4LD6 A;  3BLR B;  3M53 A;  2V22 B;  1NLO C;  1AT1 B;  5KCH A;  3MY1 B;  1G5V A;  3HRT A;  2LQK A;  2B8A A;  3MEU A;  3CC2 Q;  1HD3 A;  3KXT A;  2QK0 A;  3SB2 A;  4ELL A;  1U1S A;  3RES A;  5GMK m;  1M90 R;  4KGV B;  2D0Q B;  3CCL A;  4ZTF A;  4F7S B;  1WJS A;  1WA7 A;  2Y4X A;  3OYG A;  5KH6 A;  2EAY A;  1UNL D;  3CC7 A;  2KR6 A;  2P4R A;  1QKW A;  4J9E A;  3PIP A;  5GMK l;  1SRL A;  2CZ1 B;  3A8L B;  3POM A;  4EC9 B;  2QQ8 A;  4P5N A;  2SRC A;  2MI6 A;  3M0S A;  5CK9 A;  4JX5 A;  2LRQ A;  5GAO r;  2DXC A;  6AT1 B;  3CBO A;  2MCN A;  1D0Z A;  1VQ5 T;  1RAB B;  2AKK A;  4PJO B;  4PFP A;  4BCI B;  4JS4 A;  4LNP A;  3QUI A;  4ME7 A;  2L5Q A;  3VS0 A;  4C92 G;  3UA6 A;  4PFZ A;  1MMN A;  2EVR A;  1YI2 T;  5IHK A;  4IUQ A;  1RL2 A;  1WXU A;  2BS4 A;  5J26 A;  3NHN A;  4E7L A;  3KBG A;  2O9S A;  2AK5 A;  5IXB A;  2E5K A;  3DDQ B;  3HB9 A;  3LWI A;  1FXX A;  1KK7 A;  4NL2 A;  3MJX A;  4E7K A;  3DOG B;  3LYI A;  2RD1 A;  1H4L D;  3VS2 A;  3BFM A;  1TTH B;  2QEX T;  3CCS Q;  2HDA A;  3VS7 A;  1YIJ Q;  2FPF A;  2JGZ B;  5CYI B;  2ENM A;  5LQF B;  1M3A A;  4XQ3 A;  4CC3 A;  2KRN A;  3G4S T;  3BG9 A;  3CCJ T;  4M77 F;  2KT1 A;  1QLB A;  3BDL A;  1KJW A;  4N4H A;  3WVE B;  3A5Z B;  1TWB A;  2R58 A;  4PKC C;  5HQ0 B;  2E12 A;  3M0P A;  1M2V A;  3CCU A;  1LVK A;  2BZ8 A;  3JCM J;  1HK9 A;  3CCM A;  1Q7Y U;  1KQ2 A;  4RTX A;  1E9H B;  1M90 U;  5DLQ E;  1B7T A;  2F69 A;  3FJ5 A;  4N4G A;  2PK9 B;  1I5O B;  2EUF A;  4CC2 A;  1OYX A;  1D0X A;  4FX3 B;  2VKN A;  1VQN A;  2IN3 A;  2M9U A;  1WHL A;  1IZ6 A;  3PMT A;  1SRM A;  1VQ7 T;  4M75 A;  2V1Q A;  1H1Q B;  2VAS A;  1UGP B;  2DD5 A;  2JOY A;  4UN0 A;  3GPL A;  2DM1 A;  3CCQ T;  1URC B;  2ZPB B;  4ORZ A;  3FEO A;  3QWY A;  2KXC A;  4F7L B;  4JZ4 A;  5LJ3 g;  4AMC A;  1YJW Q;  2RJC A;  2EJG A;  5ICP B;  3I55 Q;  4EOO B;  1RAI B;  1MV0 B;  2XDD A;  4BE0 A;  4F7J B;  3DLL A;  2DIQ A;  3C4S A;  2PMI B;  3VJP A;  4M78 G;  4BCN D;  5FGK B;  1Y96 A;  2P4T A;  3MEW A;  2L0A A;  2DK3 A;  4HKE A;  1X43 A;  4E2F B;  2LNH B;  4OP0 A;  3HZJ A;  5J3B A;  4D6W A;  2B86 A;  2ZGW A;  2LZ6 B;  1S72 T;  1FIN B;  4FT4 A;  1XQH A;  3EGU A;  2LP5 A;  4JS5 A;  2J6F A;  1W4S A;  4QQ6 A;  3E1S A;  2BE7 D;  4OB2 B;  3NMZ C;  1O9K B;  4OMP A;  1YIT A;  3EH2 A;  2A37 A;  2DYI A;  1OUL A;  2IIM A;  4EOR B;  3EOC B;  2GBQ A;  1NJI R;  3I56 Q;  1WYX A;  4JRP A;  4MFE A;  3GTM S;  3FIF A;  2WIH B;  1H8K A;  3CCR T;  3J7A F;  2ZZD A;  3QHW B;  4KH1 B;  1EX4 A;  2EYX A;  1TS9 A;  5FU6 B;  5EC7 A;  1KQS S;  3CD6 T;  5FRM A;  2DIL A;  4YOZ A;  5GJW B;  3OYK A;  4FCY A;  1U06 A;  2D8J A;  1Q82 U;  3HO8 A;  2EKH A;  1V29 B;  2O9V A;  1KFZ A;  4IUV A;  2PZ1 A;  1YWO A;  1N8R R;  4WTO B;  2EIF A;  1C1A A;  5GMK i;  4ESR A;  4Q5W A;  1GUX A;  1YFN A;  1AD6 A;  2WMB B;  2RA2 A;  3G6E A;  4RG2 A;  1NEB A;  3CCL T;  1G3W A;  4C8Q A;  1EIF A;  3RIR A;  1QVG A;  4CFN B;  2RQT A;  3KHI A;  1QQJ A;  2PVO B;  2E64 A;  1UGV A;  3UA7 A;  1QVG S;  1E7O A;  1SPK A;  2CH4 W;  3CC7 T;  1VQ4 Q;  1NPP A;  3INZ A;  3OBW A;  3CCV Q;  4HVV A;  1MHN A;  2M16 A;  1GY3 B;  5GAN 8;  4OML A;  3GNF B;  5HKC A;  4BCQ B;  1FMW A;  1AEY A;  5GAN 5;  2D6F A;  3DB4 A;  4O6J A;  4M77 G;  3L2Q A;  2OTJ T;  2BS2 A;  1PD0 A;  1ZSG A;  1N8R C;  1YJN A;  1T3S A;  2HAX A;  3A8H B;  4XTW A;  2K5F A;  2R5M A;  4IUP A;  5KYU A;  1AZE A;  4IIO A;  2ED0 A;  2KYB A;  3PTA A;  4CFX B;  2C5X B;  3FLG A;  2PVG B;  2FB7 A;  4MMK A;  1WDX A;  2HEQ A;  4HLQ A;  1LCK A;  1IRE B;  3NDQ A;  1XNI A;  1VQ9 T;  2OTL A;  3ZBD A;  3GP8 A;  3GF5 A;  1KHC A;  3TU4 K;  4OGC A;  1KQ1 A;  4IKF A;  1G83 A;  2QGF B;  2CP5 A;  2DTH A;  1XJW B;  4YOO A;  2LVM A;  3M59 A;  3EG0 A;  4PJO E;  4C92 A;  1X2Q A;  2KXD A;  3HRS A;  2C6T B;  4ZGJ B;  2NWM A;  4M7A C;  2IPO B;  2RQV A;  3DB3 A;  3VS3 A;  4R55 A;  2RI5 A;  2B9R A;  2ZCF B;  1E6H A;  2CUB A;  3CC4 A;  4DOW A;  1SHG A;  1UEB A;  3EGD A;  5KYX B;  1D0Y A;  2NUZ A;  5GAM g;  2WAC A;  3CCU T;  1OI9 B;  2K4Y A;  2R7G A;  2XMF A;  1YJ9 Q;  4CXA B;  2EJF A;  2PQW A;  2A08 A;  4EMG A;  3I5R A;  4J9G A;  4JLG A;  2P0K A;  1OKV B;  1K9M U;  1OZ2 A;  1BI0 A;  2RK2 A;  1VQN T;  1WQW A;  3VU3 C;  2BZX A;  1P92 A;  1NYF A;  2M0O A;  1VUB A;  3X26 B;  1JU5 C;  4L5G A;  4RCC A;  2J7I A;  3BHT B;  3OW2 A;  2ZPE B;  2UUE B;  4KBM B;  3M57 A;  2FO0 A;  3OYF A;  2K6D A;  2Z0W A;  4PJJ A;  2I53 A;  2FL7 A;  5LJ5 g;  1FYN A;  2P0Q A;  4KGX B;  2QI2 A;  4FW1 A;  2RJE A;  5LJ5 f;  4Z89 A;  3X28 B;  2QF7 A;  3BW1 A;  4C8Q F;  2DEQ A;  5HY6 A;  1I4K 1;  5LJ3 h;  2YUP A;  1ACM B;  1ZUK A;  2LCC A;  4OMM A;  2EQU A;  3JCM X;  3CXC P;  4EDU A;  2QG9 B;  3CMA Q;  4DEY A;  3REA B;  2CYZ B;  1MNE A;  2O4X B;  4C5E A;  2YRV A;  4CC4 B;  2VB6 A;  1YIT T;  1JO8 A;  3BLQ B;  2K2V A;  1CSK A;  4BCM D;  2QQ9 A;  2VGM A;  4AFQ C;  1C9B A;  1BU2 A;  2LW4 A;  2JTE A;  3TRE A;  4M7D C;  2BUD A;  5CQX A;  5I11 A;  2DL3 A;  2GFU A;  1K8A R;  2CT4 A;  3M03 A;  2CP2 A;  2V8K A;  5BNJ B;  2YT6 A;  3MY5 B;  4M78 A;  1N9R A;  1D09 B;  2DXT A;  3LGF A;  2EBP A;  1Q81 R;  2A28 A;  1FMV A;  3FRN A;  2YHT A;  3G71 Q;  4A54 A;  1OPL A;  1K73 U;  2UZL B;  4M6V A;  1WNL A;  3MP6 A;  2D8H A;  2IW9 B;  5LJ3 e;  4PJM A;  2LQW A;  1AOJ A;  3EG3 A;  2JS2 A;  1UB4 A;  2QDL A;  3J80 E;  2L2P A;  1WI7 A;  2C0O A;  1WLP B;  5CEI B;  4RTT A;  3OS1 A;  4MZT A;  1IGQ A;  3PMI A;  4OB0 B;  2A36 A;  4HNV A;  4RCB A;  2JZ2 A;  2ATC B;  4EPC A;  1U5S A;  3OY9 A;  3G6E T;  1W70 A;  3CC2 A;  2JXB A;  1VQ6 T;  1UGQ B;  3QYG B;  3EFR A;  1K8A C;  2VV5 A;  2I40 B;  1MMD A;  2K3B A;  4PL6 A;  2HKN A;  4B9W A;  3V7C A;  4EMK A;  1KXU A;  1N4M A;  3A98 A;  3C12 A;  1MMA A;  2X4W A;  2HQE A;  4FW2 A;  1TFB A;  2NUP A;  2FZG B;  2DPP B;  1ENW A;  1ZSZ C;  1ZX6 A;  2RMO A;  5LJ3 d;  2EYZ A;  1GXI E;  3JCM V;  3NFC A;  3G1J A;  3UDC A;  3EFO B;  2YRD A;  2KE9 A;  4XU0 A;  2NUT B;  3GLX A;  1MND A;  2J06 A;  1W2B P;  1RAD B;  5IH2 A;  2P84 A;  4MZM A;  2F5T X;  1JJ2 P;  2MK5 A;  1QMC A;  5D6Y A;  3FC3 A;  3EGX A;  1CKA A;  1PSF A;  4M7A D;  4OB1 B;  4BCN B;  4NC6 A;  1PKT A;  2IG0 A;  4M77 C;  4AFU C;  2OTL T;  1M8M A;  2RN8 A;  3RBB B;  2ROL A;  2GCX A;  4HCC A;  4BY6 C;  1G3N C;  2O01 E;  1V76 A;  4E7I A;  4ZGE B;  3RGF B;  3OYL A;  1X75 C;  5GAO l;  1I1J A;  2PTK A;  4F7U B;  2HQX A;  5HNB B;  5FU7 B;  3VS1 A;  1QVF A;  3QWX X;  3RNJ A;  1VQ5 Q;  4CFV B;  1UUE A;  2J6O A;  1O75 A;  1H28 B;  4C5I A;  1F1B B;  1D3B A;  1YI2 Q;  3CC4 T;  4C8Q G;  3ZFJ A;  4HNT A;  2YWW A;  4M7A E;  2KI7 A;  4BCO B;  2KAF A;  5FU7 C;  4J6W A;  1WIE A;  1P5E B;  2W9F A;  4XK8 E;  4B6M A;  5KYW B;  3JCM f;  2WSF E;  1MGQ A;  1VA7 A;  2COW A;  1ARK A;  5GMK h;  2LNV A;  4M78 F;  3V8L A;  1ZLM A;  3MO8 A;  3L2V A;  3QPH A;  1D1C A;  3T9N A;  1Q7Y R;  3OYB A;  1MV3 A;  1NM7 A;  4J6X A;  2HSE B;  4EMH A;  2BS3 A;  4FYX B;  1X69 A;  1N5Z A;  1N6A A;  4BD3 A;  3G4S Q;  3V7R A;  2SEM A;  3CCJ Q;  5DQW A;  4AKI A;  1VIE A;  4ZNX A;  1JBM A;  1NG2 A;  1YJW A;  2GGR A;  2J6K A;  2QQB A;  2VXF A;  3I55 A;  1PCX A;  1UGS B;  2LJ0 A;  2MF2 A;  4ZN3 A;  2DXU A;  4M7D D;  3Q1J A;  1WJQ A;  3L2W A;  3B57 A;  2RJF A;  2G3R A;  2M0Y A;  5GMK j;  1U8R A;  1NZ9 A;  1TXQ A;  2BIV A;  1OGU B;  1X27 A;  3H8Z A;  3M58 A;  4IIM A;  1NEG A;  4JDS A;  5LJ5 h;  1FMK A;  1VQ7 Q;  1VQ8 Q;  1Q7Y C;  4ROE A;  1QCN A;  4PLL A;  4HVU A;  5GMK e;  3CCQ Q;  1OU9 A;  1M90 C;  5HVY B;  4J9I A;  3JB9 H;  4BCF B;  2QTX A;  1R0C B;  1WQ7 A;  4KUL A;  1KSW A;  3D7S B;  3L2R A;  2DX1 A;  2LQN A;  2PNI A;  1FVV B;  2RO0 A;  4KT0 E;  4A4F A;  2AHJ B;  4M7D E;  4Z88 A;  4A4H A;  3CPW P;  4CRL B;  5L23 A;  2EYW A;  1Y07 A;  2DXB B;  3TNW B;  1NPR A;  4OMQ A;  2XK0 A;  3I35 A;  1VYW B;  2RQR A;  1Y0M A;  3MP1 A;  4NOY A;  4TTH A;  1C0M A;  1VQK A;  1S72 Q;  5LJ5 j;  2HNI A;  4E7S A;  1S1N A;  4C0G A;  4PJN A;  1R0B G;  4FT2 A;  1BU1 A;  2JMC A;  3TVT A;  4BDY A;  4EOQ B;  4J83 A;  4ZTJ A;  4HL4 A;  2XI9 A;  5LJ5 e;  1MUZ A;  4XTY A;  1Q82 R;  5HBH B;  2BZY A;  1AHJ B;  1PHT A;  4PJO A;  3DDP B;  2DZ9 A;  2VGN A;  4BCJ B;  5IN1 A;  4HCZ A;  2CSQ A;  3CCR Q;  1H24 B;  4M75 C;  4F70 B;  5J39 A;  2JW4 A;  3CD6 Q;  4J9D A;  2E41 A;  1VQ4 A;  4DBH A;  3CCV A;  3M4Y A;  1GBR A;  2V26 A;  1BB9 A;  2YXY A;  1UHC A;  1UNH D;  4EOS B;  4M77 D;  2FVU A;  1JSU B;  2F2W A;  4II1 A;  3HKS A;  1M1G A;  2LT1 A;  3EID B;  1QLY A;  1PKS A;  5CO7 A;  5LJ5 d;  3CCE T;  4ATO A;  4NL3 A;  4F6W B;  4JRK A;  5LJ3 f;  2LQ8 A;  1JEG A;  3PE0 A;  2DTI A;  3QYB A;  2E65 A;  1IB8 A;  2MIO A;  2KSS A;  2XHC A;  1I8F A;  4KH0 B;  2CJM B;  2FZC B;  3MIA B;  1OQK A;  1PWT A;  1U3O A;  2VUB A;  2E6N A;  2MOX A;  1XOV A;  2IVW A;  4FSX A;  5KE3 A;  1XO2 A;  2CCI B;  5D6W A;  3BDU A;  4N0A A;  4ELZ C;  2ROT A;  3JB9 F;  1SHF A;  3X25 B;  4JUV A;  4R56 A;  1H25 B;  5IHY A;  2GQI A;  3JCM Q;  2OTJ Q;  2RQW A;  3JRZ A;  3LW5 E;  4BCM B;  3JCM P;  3OQ5 A;  5HCK A;  2DL4 A;  2C5O B;  2W9Z A;  3JSC A;  2CUD A;  2OAU A;  1QCF A;  1OX9 A;  2EQK A;  3M55 A;  4FSS A;  4OVA A;  1PG5 B;  2HBP A;  2QA4 A;  2W96 A;  2CS7 A;  1KQS A;  1T3L A;  2XID A;  3HTR A;  4CRI A;  1VQO A;  4A53 A;  4JJD A;  1H92 A;  2BKZ B;  5GAN g;  1VQ9 Q;  2QGS A;  5KYN A;  4RUG A;  3MCA B;  4JPB W;  5GJV B;  4BI3 A;  1FWZ A;  4LDY A;  3M0T A;  2OX7 A;  4F7U E;  5IT9 E;  5DY9 A;  2COZ A;  1UGR B;  4M4Z A;  4HA8 A;  1ZP2 A;  1YJ9 A;  3VRZ A;  4EOK B;  1JXO A;  4XTV A;  4X1V A;  4C8Q C;  3JCM h;  1RAE B;  1T0H A;  2KVQ G;  4MIM A;  2ZPG B;  2KT8 A;  1QW1 A;  4JRQ A;  1M1K R;  1K9M R;  3ER0 A;  2EKO A;  3SWN A;  3QJY A;  4XTZ A;  3GIB A;  2MWO A;  2Y90 A;  1NJI C;  3K7A M;  3H41 A;  3QO3 A;  1K0X A;  3VUB A;  3A8M B;  1ABQ A;  1O9K A;  5CIU A;  4D8D A;  4VUB A;  2WEV B;  2FRW A;  2QAZ A;  3TEE A;  8AT1 B;  1IXD A;  1CKB A;  2H8H A;  2NYS A;  5CKB A;  3CCU Q;  4MDW A;  1YJW T;  3EG9 B;  2XDB A;  5EG2 A;  2EQI A;  3PVQ A;  3VYH B;  3I55 T;  4HT9 A;  4UC4 A;  3V8J A;  3GBQ A;  4PJO F;  1H3Z A;  4BCH B;  1OV3 A;  4WCI A;  2FRY A;  1VQN Q;  3PT9 A;  2DO3 A;  1M8V A;  4BCP B;  3TN8 B;  2G77 A;  4AG1 C;  1ABO A;  1H27 B;  1TSF A;  1WHH A;  2LCL A;  3CXC A;  1YHQ Q;  1HYO A;  1LJO A;  5A0D A;  3EHR A;  4X9C A;  3S6W A;  3JCM e;  3CXC S;  3CMA A;  2CP3 A;  2E3H A;  1K9M C;  3OYA A;  2YSQ A;  4LUD A;  2DE0 X;  1RLQ C;  2FPE A;  5KYY B;  4M7A B;  3TQ7 P;  1VQM A;  2CT3 A;  4L6V 5;  2PUK B;  3HFN A;  2UZE B;  2DRM A;  1H3H A;  2JS0 A;  4C92 C;  1GFC A;  5GAO p;  2XIC A;  2AZV A;  3VS6 A;  3WXM B;  2C4G B;  2RF0 A;  3OS5 A;  4RTY A;  3VYG B;  1VQK T;  1IHW A;  1QP3 A;  1VIF A;  3CBM A;  4QQG A;  4JZ3 A;  3JB9 I;  3G71 A;  3QSU A;  1GCQ A;  2K5L A;  3QHR B;  1KHI A;  2LC4 A;  2F2V A;  3LH5 A;  4M75 D;  2GTJ A;  2KBT A;  4DEX A;  3OS2 A;  2R5A A;  3EAE A;  1K73 R;  3JCM d;  4RTU A;  5ACB A;  3PIO A;  4G6L B;  1M1F A;  2DFU A;  2WHB B;  4F7U G;  3I9Q A;  3OYI A;  3E9F A;  4JX4 A;  2ZAE A;  3CCM T;  5GAN 4;  3JB9 G;  2AZS A;  3BG3 A;  2FYK A;  5GAM f;  1OIU B;  1BCM A;  2F2C A;  1M1K U;  1K1Z A;  4OMN A;  2CZ7 B;  3P8H A;  1VQ4 T;  1TUC A;  2ZPF B;  3URG A;  4CFM B;  2RHU A;  2FPD A;  4M75 E;  4RTZ A;  2O31 A;  1QMZ B;  1RI0 A;  2V8I A;  3OYE A;  4JRI A;  3DTO A;  4F6S B;  1VQL Q;  2LX7 A;  1K73 C;  4BXX X;  3G6E Q;  2RK1 A;  1NBE B;  3UF4 A;  3OB9 A;  1VQ6 Q;  4EOL B;  4A4K A;  3M56 A;  1W2B A;  2GQV A;  1H1S B;  1PSE A;  3PGG A;  1W2B S;  4DQ2 A;  3PO3 S;  2HKQ B;  3MEV A;  4HT8 A;  1OEB A;  1WHJ A;  2KY9 A;  1Q95 G;  4M7D B;  2DD4 B;  5KYX A;  1JJ2 S;  3QBY A;  4F6U B;  3QG1 A;  4J7F A;  2KDS A;  5I5Z B;  4CFW B;  2VYT A;  1WPY A;  4WF2 A;  1N27 A;  4E7Z A;  1H1P B;  4BBR M;  3I5S A;  2X4J A;  2E1H A;  3VS4 A;  2K3Y A;  4AFZ C;  4FYV B;  3E19 A;  2JT4 A;  1D3U B;  2KMT A;  2MPX C;  1B34 B;  1C6V X;  2F1L A;  4QKU A;  4BI8 B;  3CME Q;  3ULR B;  2X4Y A;  3FJP A;  3F5X B;  3SEM A;  2RJD A;  4M78 C;  4DA4 A;  4FIB A;  3VKG A;  3C95 A;  1AVZ C;  2VVK A;  5C0M A;  5I22 A;  1PKD B;  3QYH B;  2O2O A;  3MHX A;  5IHI A;  1VQ5 A;  2L3S A;  3OMC A;  4C8Q D;  1D1A A;  3AHU A;  4XU2 A;  4IMY B;  3CEY A;  2D0N A;  4PJO G;  5A2Q E;  2QA4 T;  1X6B A;  1K0S A;  2CCH B;  3MET A;  2PVD B;  2RI2 A;  1VQO T;  4CC7 A;  1AWX A;  2YUN A;  2YLB A;  1OL2 B;  1T0J A;  2EJ9 A;  4XAX B;  5LJ3 j;  4V2S A;  1QKX A;  1ZQ1 A;  3TSZ A;  3A8O B;  1JST B;  3VKI A;  1VQP A;  2FHD A;  2QXF A;  2DZC A;  4TVR A;  1I07 A;  5CKE A;  3EG1 A;  4X9D A;  2ESW A;  4J9B A;  1WHG A;  2A7Y A;  4EON B;  3BHU B;  3SHW A;  1A0N B;  4J6Y A;  2DL5 A;  3BE3 A;  4ZGD B;  4C0Z A;  3VV0 A;  4EMK C;  3L42 A;  8ATC B;  4HCB A;  1KG1 A;  1ZSZ B;  2O4X A;  3PFS A;  2COY A;  2CP6 A;  3OYY A;  3QDR B;  3LWH A;  3CC4 Q;  4J5Y A;  2C0T A;  3AT1 B;  4JJN K;  2DA9 A;  1FKM A;  1B3Q A;  2PK2 A;  3HRU A;  1Q81 C;  1HJD A;  1KD1 U;  2WFY B;  3G4S A;  2DBK A;  4AG2 C;  4J7I A;  2JVV A;  3U23 A;  3CBP A;  2KQW A;  4E7J A;  1G8X A;  4RMO A;  5IF1 B;  2HL5 C;  2KNB B;  2DME A;  2J05 A;  1OI1 A;  1ZHI A;  4M77 B;  5CKF A;  3UPU A;  1YJN T;  5DQV A;  1Q86 R;  5L2W B;  1NLP C;  4BY6 B;  4C92 D;  1BIA A;  4LDW A;  2L3Q A;  2A0F B;  4MZP A;  5FWC A;  2DVJ A;  2JUF A;  2KRO A;  1RAG B;  3CMA T;  4JX6 A;  1VQ7 A;  3OW2 P;  1VQ8 A;  4CFU D;  2K7A A;  5GAN e;  1D3B B;  2VC8 A;  4IUR A;  1VOL A;  3CCQ A;  1BCO A;  3UWN A;  2DET A;  2EGA A;  1VQM T;  1WHK A;  2IW8 B;  2DTO A;  1KIK A;  2EQM A;  1M4Z A;  3HFO A;  2WXV B;  2YLC A;  5LMK B;  4XU1 A;  1RAA B;  2C5N B;  2ZPI B;  2OAW A;  4LUE A;  1UNG D;  2DNU A;  1IGU A;  1RLP C;  4C92 E;  2QGG A;  3CPW S;  4N4I A;  3LH0 A;  1SKU B;  3JV3 A;  3CCS A;  2CRE A;  1IRX A;  1GBQ A;  2DIG A;  2C06 A;  3R6O A;  1YIJ A;  1S72 A;  4J8O A;  2GF7 A;  4L59 A;  4QVD A;  3SFM A;  1KC8 U;  1I5L A;  4QSH A;  4E47 A;  4AKG A;  1M5Q 1;  1VYT A;  2LJ1 A;  2NUT A;  2CKK A;  2R57 A;  3O5Z A;  3M0R A;  5KE2 A;  3HL8 A;  3MPU B;  1K9A A;  2AKL A;  4YC3 B;  7AT1 B;  2CZ6 B;  3IQL A;  2LTO A;  4RTV A;  2RM4 A;  1RI9 A;  2YDL A;  4C0D C;  2QDJ A;  1YCY A;  2QEX Q;  2DXC B;  5GAM h;  3CD6 A;  1M9S A;  4ANJ A;  4BE1 A;  1H1R B;  1XTD A;  3THK A;  3R6N A;  1VIN A;  4F7U A;  3KUF A;  2E70 A;  5D7U A;  3HPW A;  4YOS A;  4C5H A;  2CP0 A;  4QW2 A;  4OR5 B;  2JM8 A;  1SEM A;  1H64 1;  1X2K A;  4RKU E;  4M7D F;  2W2H A;  4HCK A;  2HCK A;  1Q86 U;  1PM3 A;  4XTX A;  1JOW A;  1M27 C;  2DMO A;  1IHV A;  1E7P A;  4M78 D;  2H3J A;  3MEA A;  1G3T A;  3H0I A;  3M54 A;  3QJ6 A;  2X35 A;  1M2O A;  4FU6 A;  2K79 A;  5GAM j;  5KYW A;  1JXM A;  2RI3 A;  4Y28 E;  3OA6 A;  4E6R A;  1TD6 A;  1ZBX A;  3TW7 A;  1QP2 A;  1LPL A;  2C5V B;  3NTH A;  2I0N A;  5GAM e;  1X6O A;  3OBY A;  1J3T A;  1BYM A;  3CCE Q;  4LDV A;  2OTJ A;  5EFQ B;  1DJ7 B;  2KK4 A;  4M78 E;  1M2V B;  4X34 A;  4PK4 A;  2WSC E;  3I56 A;  5HBJ B;  4KRD B;  1RUW A;  2KR3 A;  2HMA A;  3OYJ A;  4AI6 A;  1VQP T;  2JM9 A;  5CVI A;  2JMA A;  1AWW A;  1SSH A;  4BBS M;  2M51 A;  4J9C A;  1E6G A;  4M7A G;  3H0F A;  5FW9 A;  1VQ9 A;  2QDY B;  4M75 B;  3FDR A;  4F17 A;  2DD5 B;  3JB9 J;  1R77 A;  4PJO C;  2BPM B;  4K11 A;  2DJZ A;  1JRI A;  4FYY B;  1OU8 A;  1OL1 B;  1M30 A;  1QVF P;  4D8K A;  5GAM d;  2LCS A;  2FG0 A;  3ZL7 C;  1PD1 A;  1Y7X A;  5M9O A;  3CC2 T;  5GAO n;  2D1X A;  4OGR B;  5IDP B;  4IUU A;  3DL1 A;  3UT1 A;  1H26 B;  2LJ3 A;  4ZN1 A;  1OKW B;  3OYN A;  2GTO A;  3TNI B;  1UJ0 A;  4C0F A;  1I81 A;  2HSP A;  3P8B B;  2KRM A;  3RKY A;  5FLX E;  1LOJ A;  4KUD K;  1Y96 B;  4RTW A;  2YUQ A;  1WJR A;  3H6Z A;  1GFD A;  1YCS B;  4ELJ A;  5GAN 2;  3SD4 A;  1GL5 A;  1QWF A;  3MP8 A;  4Z6Y A;  5I21 A;  3QHS A;  2EFI A;  2UZD B;  4O5V A;  2GNC A;  3MKD A;  2DXB A;  3CPF A;  4Z02 A;  3ZEH A;  4Z8A A;  2ZPH B;  4I3Z B;  3M0Q A;  1W98 B;  2BE9 B;  2RNA A;  1EZZ B;  2CZ0 B;  3MI9 B;  2BTT A;  2G6F X;  1Q82 C;  3CCL Q;  3A1P A;  4QVZ A;  4BY1 X;  1VQ8 T;  3OSV A;  2K3X A;  3TW6 A;  4F14 A;  3S3N A;  1YHQ A;  4EOJ B;  3RR6 A;  1WXT A;  2JN0 A;  3PVL A;  3CC7 Q;  2LDM A;  2L8D A;  1ZA1 B;  3ME9 A;  2ZZD B;  4N0A C;  4F7U F;  4QQD A;  1TU0 B;  3UAT A;  4BB7 A;  1AIS B;  2EGE A;  4NST B;  1BI1 A;  1ZA2 B;  4BAC A;  4M77 E;  3LQ5 B;  2OJ2 A;  4GLM A;  3S3M A;  2L3P A;  4BY7 X;  4DOV A;  1SSF A;  3RDV A;  2IVX A;  1D1B A;  2DYB A;  1BBZ A;  2E10 A;  1TUD A;  4M7D G;  3CCS T;  1GUX B;  1GCP A;  1OZ3 A;  2LX9 A;  4DBR A;  1YIJ T;  1EFN A;  3C0C A;  5GAN 6;  3M9Q A;  4KGZ B;  4A4G A;  4C8Q B;  3SWN B;  2DLP A;  1BI2 A;  3E9G A;  1OX8 A;  2RHY A;  2D9T A;  3P8D A;  4Y92 A;  3HSB A;  2RQU A;  4MML A;  4PNO A;  5IHN A;  2O88 A;  3EG2 A;  3JB9 D;  3LX7 A;  5CKH A;  2JTM A;  4YTL A;  1PC0 A;  2X4X A;  1O9S A;  3GOX A;  2W10 A;  2I2L A;  5GAN f;  1WX6 A;  5CR2 A;  5GAN 7;  4FM4 B;  1QCO A;  2XU8 A;  1NYG A;  1VOM A;  3GNG A;  2V1R A;  2E5Q A;  3SWN C;  3NTK A;  1TG0 A;  3OYM A;  1UHF A;  4OF1 A;  2QQA A;  3FB9 A;  1OIY B;  1VQK Q;  3QWL A;  5KYU B;  2X51 A;  5AYF A;  1Y71 A;  2CDT A;  1QWE A;  2DF6 A;  2EYQ A;  5DLO A;  5GAO q;  4GY5 A;  1YNZ A;  1K4U S;  2YUO A;  2DVE A;  2RH2 A;  4HVW A;  3V7S A;  4BI4 A;  2ECZ A;  1VQL A;  5ECA A;  4OB3 B;  1ZUU A;  3M4G A;  5FU6 C;  3CCM Q;  5C6S A;  1UE9 A;  3O0G D;  5CKD A;  1VQ6 A;  3RMQ A;  4LOC A;  3KFV A;  3QZ5 B;  5CAI A;  3JCM b;  2QFZ A;  1WGS A;  2F5K A;  2EW3 A;  2M02 A;  1UEC A;  3HP9 A;  4C92 B;  3X20 B;  4II5 B;  2K5I A;  1UJY A;  3H0H A;  1M1K C;  4MDX A;  3HBL A;  4Y72 B;  4CFU B;  3CME A;  2IW6 B;  2RB6 A;  2JNG A;  3EGD B;  1K76 A;  4KRC B;  2XG8 D;  2K9G A;  5IAY A;  2CGH A;  4PJO D;  2PJQ A;  2FEI A;  4BCG B;  2QAS A;  4F7N B;  5IXF A;  5DM7 R;  5LL6 S;  3I56 T;  1UFF A;  1SG5 A;  5CQY A;  5GAN 3;  3DKM A;  1GCQ C;  2C0I A;  3G7Z A;  1F5Q B;  2DJQ A;  4EIK A;  4M75 F;  5CCA A;  2WJ9 A;  2MMP A;  4EOI B;  2JJ9 A;  3EG9 A;  3QYE A;  3L2Z A;  3HHT B;  1Z9Q A;  3PNW C;  4R0K A;  2X9H A;  2EQJ A;  2X1N B;  1AD5 A;  2DAQ A;  3BLH B;  1YIT Q;  1HXD A;  1G3Y A;  4NS5 A;  1NJI U;  4GBQ A;  3VRY A;  3OYD A;  3G33 B;  4JLI A;  2WMA B;  1QVP A;  4JJB A;  1GH6 B;  2V8J A;  2X3X D;  2QA4 Q;  5IDN B;  1RAC B;  4ROD A;  4CI0 C;  1WXB A;  1VQO Q;  2L3R A;  1SF9 A;  2LT4 A;  3DLM A;  1KQS P;  3EFS A; 
#chains in the Genus database with same CATH homology
 1Q7Y C;  1ZHI A;  4M7A A;  4M77 B;  3H4C A;  5CKF A;  2RHX A;  4PLL A;  3QZ9 B;  3JCM c;  3CCV T;  3UPU A;  5GMK e;  1YJN T;  1M90 C;  4BY6 B;  1N8R U;  2M1H A;  3JB9 H;  4JRP A;  4MFE A;  3FIF A;  2QTX A;  3BY7 A;  1BIA A;  1WQ7 A;  4KUL A;  5D6X A;  4C92 D;  3CCR T;  4LDW A;  4MZP A;  3J7A F;  3JAM E;  3L2R A;  2ZZD A;  3OSS C;  2JUF A;  3BG5 A;  5FRN A;  2A3L A;  5FU6 B;  2QQS A;  3VUZ A;  3CMA T;  1KQS S;  3CD6 T;  4JX6 A;  4E7H A;  1VQ7 A;  2P0P A;  3N5B B;  4ELY C;  1VQ8 A;  5FRM A;  2RO0 A;  3LGL A;  4KT0 E;  3VYG A;  5GAN e;  4A4F A;  1D3B B;  2MWP A;  2VC8 A;  4IUR A;  2AHJ B;  4MFD A;  5KCO A;  3OYC A;  3CCQ A;  3UWN A;  3OYK A;  4M7D E;  1VQM T;  4A4H A;  3HO8 A;  1Q82 U;  2DTO A;  1V29 B;  3QXE B;  4IUV A;  2EQM A;  1Y07 A;  1YHQ T;  1M4Z A;  2DXB B;  1NPR A;  2XK0 A;  1JJ2 A;  3HFO A;  2EIF A;  4M78 B;  2YLC A;  4C8Q F;  5GMK i;  4XU1 A;  3MP1 A;  4NOY A;  4Q5W A;  1VQK A;  1LNX A;  5LJ5 j;  2BKD N;  2HNI A;  3OW2 S;  4QVC A;  2ZPI B;  4C0G A;  2RA2 A;  3G6E A;  4RG2 A;  4FT2 A;  3CCL T;  3CXC S;  1G3W A;  4C8Q A;  1EIF A;  3RIR A;  4BDY A;  1QVG A;  3KHI A;  4J83 A;  2PVO B;  4C92 E;  2E64 A;  3CPW S;  4ZTJ A;  4N4I A;  4HL4 A;  2XI9 A;  3LH0 A;  2MAM A;  5LJ5 e;  3J81 E;  1NE8 A;  4XTY A;  1QVG S;  3CCS A;  1AHJ B;  3CC7 T;  1NPP A;  2DIG A;  3INZ A;  3QKJ A;  2C06 A;  3OBW A;  3R6O A;  1YIJ A;  4PJO A;  1KD1 C;  4AKH A;  1S72 A;  1MHN A;  2DZ9 A;  2M16 A;  2VGN A;  4J8O A;  2GF7 A;  4L59 A;  5GAN 8;  4QVD A;  3GNF B;  5IN1 A;  4HCZ A;  3SFM A;  5A0L A;  5HKC A;  1KC8 U;  4XTU A;  1I5L A;  4QSH A;  4E47 A;  5GAN 5;  5EJC A;  4AKG A;  2EWN A;  1M5Q 1;  4LDX A;  2D6F A;  2CKK A;  4M75 C;  5J39 A;  2R57 A;  1YBY A;  2JTF A;  3DB4 A;  3VKH A;  2E41 A;  4O6J A;  1VQ4 A;  4IUT A;  4M77 G;  3L2Q A;  5KE2 A;  4RG8 A;  3CCV A;  2OTJ T;  3M4Y A;  2BS2 A;  1N8R C;  1YJN A;  1YI2 A;  3HL8 A;  5FRO A;  2HAX A;  3A8H B;  2NLU A;  2K5F A;  2QQR A;  4XTW A;  2R5M A;  3RKX A;  4IUP A;  2CZ6 B;  4EMK B;  5I2M A;  3RER A;  3OYH A;  2LTO A;  4M77 D;  2RM4 A;  2FVU A;  3A8G B;  4C0D C;  2QDJ A;  1YCY A;  3PTA A;  2DXC B;  4II1 A;  3FLG A;  3HKS A;  1M1G A;  5GAM h;  2PVG B;  3CD6 A;  1M9S A;  2FB7 A;  2LT1 A;  4MMK A;  1YJ9 T;  3WVD B;  2DKG A;  4HLQ A;  5CO7 A;  5LJ5 d;  4BE1 A;  3CCE T;  4ATO A;  1XTD A;  4NL3 A;  4M7D A;  1IRE B;  2DD4 A;  4JRK A;  1XNI A;  5LJ3 f;  4F7U A;  2LQ8 A;  3KUF A;  2E70 A;  4A4E A;  4BE2 A;  1VQ9 T;  3S3O A;  2OTL A;  5GAN h;  2DTI A;  3QYB A;  2E65 A;  3X24 B;  3GF5 A;  2KSS A;  2XHC A;  1I8F A;  3HPW A;  3ZBD A;  4C5H A;  2QEX A;  4QW2 A;  1KHC A;  3TU4 K;  2K57 A;  4C8Q E;  3LLR A;  3GP8 A;  2RHI A;  2VUB A;  4OGC A;  2E6N A;  3RKW A;  1H64 1;  1KQ1 A;  4RKU E;  4M7D F;  1B34 A;  1XOV A;  4IKF A;  3O8V A;  1Q86 U;  2IVW A;  2XD0 A;  4XTX A;  2PU9 B;  2DTH A;  2LVM A;  3M59 A;  4FSX A;  1E7P A;  4M78 D;  5L8R E;  5KE3 A;  2H3J A;  4M75 G;  3TCJ A;  5D6W A;  4PJO E;  3MEA A;  3BDU A;  4C92 A;  1VQL T;  4N0A A;  5HK3 A;  4ELZ C;  1G3T A;  3HRS A;  3M54 A;  3RMS A;  4ZGJ B;  4OGE A;  3JB9 F;  3X25 B;  4M7A C;  4JUV A;  3CCJ A;  3DB3 A;  3QJ6 A;  4R56 A;  4OMF B;  4LD9 K;  4R55 A;  2RI5 A;  3NTI A;  2ZCF B;  3JCM Q;  2X35 A;  4Y91 A;  3JRZ A;  2XDP A;  3LW5 E;  4FU6 A;  3CC4 A;  5GAM j;  3JCM P;  2RI3 A;  3OQ5 A;  1G3S A;  4PLI A;  3QII A;  4Y28 E;  3SDZ A;  4C92 F;  1UEB A;  4DOW A;  3OA6 A;  3L2U A;  2L89 A;  1KC8 C;  3JCM W;  4HNU A;  3JSC A;  1ZBX A;  3TW7 A;  1FX7 A;  1QP2 A;  2OAU A;  3NTH A;  3M55 A;  2EQK A;  5GAM g;  4OVA A;  2WAC A;  5I2S A;  2K4Y A;  3CCU T;  5GAM e;  5GAN j;  2HBP A;  1X6O A;  2CS7 A;  2QA4 A;  3OBY A;  1KQS A;  2XID A;  1BYM A;  4CRI A;  4M7A F;  4GLK A;  4LDV A;  2EJF A;  2PQW A;  1VQO A;  4A53 A;  4EMG A;  2OTJ A;  4JLG A;  2P0K A;  1R8O B;  1TH7 A;  1K9M U;  5GAN g;  1DJ7 B;  1OZ2 A;  1BI0 A;  2KK4 A;  2RK2 A;  1WQW A;  4M78 E;  3VU3 C;  1VQN T;  3CME T;  3MCA B;  1P92 A;  3V8K A;  4X34 A;  4BI3 A;  1FWZ A;  2WSC E;  4LDY A;  3I56 A;  4F7U E;  5IT9 E;  2M0O A;  1VUB A;  5DY9 A;  3X26 B;  4L5G A;  4RCC A;  1UGR B;  4HA8 A;  3OYJ A;  1YJ9 A;  4AI6 A;  3OS0 A;  1VQP T;  4XTV A;  5CVI A;  3CCE A;  4BUG A;  4C8Q C;  3OW2 A;  3QSU A;  2ZPE B;  4BBS M;  3JCM h;  2KVQ G;  5GAO m;  4M7A G;  4MIM A;  2ZPG B;  1VQ9 A;  2QDY B;  1QW1 A;  4B9X A;  4KBM B;  4JRQ A;  3M57 A;  3CPW A;  3OYF A;  4M75 B;  3FDR A;  3JB9 J;  2DD5 B;  2KMG A;  4PJO C;  3ER0 A;  2EKO A;  3ASK A;  3QJY A;  4XTZ A;  3SWN A;  2DJZ A;  2FL7 A;  5LJ5 g;  3GIB A;  1Q86 C;  2P0Q A;  2MWO A;  1JRI A;  2E6Z A;  2Y90 A;  4LDU A;  3G71 T;  1NJI C;  2QI2 A;  3QO3 A;  3VUB A;  3A8M B;  3C94 A;  4FL6 A;  5GAM d;  2PUO B;  1Y7X A;  2RJE A;  2XKO C;  2Y4Y A;  5M9O A;  5GAO n;  5CIU A;  3CC2 T;  5LJ5 f;  4VUB A;  2QF7 A;  3X28 B;  3BW1 A;  4KUI A;  4M77 A;  2DEQ A;  3DL1 A;  4IUU A;  1I4K 1;  2HD0 A;  5HY6 A;  5LJ3 h;  5CKB A;  3TEE A;  3UT1 A;  2LCC A;  1X01 A;  4C0D B;  4ZN1 A;  1YJW T;  4MDW A;  3OYN A;  1K8A U;  2EQU A;  5HK0 A;  2XDB A;  3M5A A;  5EG2 A;  5GAN d;  4C0F A;  1I81 A;  3VYH B;  3JCM X;  3I55 T;  4HT9 A;  4UC4 A;  3V8J A;  4EDU A;  4PJO F;  1Q81 U;  1H3Z A;  3P8B B;  3RKY A;  3L1A A;  5FLX E;  1LOJ A;  4BDZ A;  2RHZ A;  4KUD K;  1QVF S;  2CYZ B;  2O4X B;  1Y96 B;  4C5E A;  2YRV A;  3PT9 A;  1WJR A;  3H6Z A;  2DO3 A;  1BIB A;  1BKB A;  1M8V A;  4ELJ A;  5GAN 2;  1YIT T;  3SD4 A;  2G77 A;  2K2V A;  3RUX A;  4XU3 A;  2QQ9 A;  2VGM A;  1N9S A;  2LCL A;  3MP8 A;  3CXC A;  3CCR A;  4Z6Y A;  3TRE A;  4M7D C;  2BUD A;  5CQX A;  5I21 A;  3JCM g;  2GFU A;  1LJO A;  3QHS A;  2EFI A;  5A0D A;  2VXE A;  3JCM e;  4X9C A;  4O5V A;  3F70 A;  3OMG A;  2DXB A;  3CPF A;  2V8K A;  4Z02 A;  3S6W A;  3ZEH A;  3CMA A;  2ZPH B;  4M78 A;  3OYA A;  1N9R A;  1BI3 A;  2DXT A;  2GFA A;  3LGF A;  1JB0 E;  5A0G A;  2WSE E;  4C5G A;  1U1T A;  2CZ0 B;  4LD6 A;  4M7A B;  3M53 A;  1Q82 C;  4QVZ A;  1VQM A;  4L6V 5;  1VQ8 T;  3FRN A;  3OSV A;  2K3X A;  3TW6 A;  2YHT A;  5KCH A;  3S3N A;  2PUK B;  1YHQ A;  1G5V A;  2JN0 A;  3HRT A;  3HFN A;  4A54 A;  1K73 U;  2LDM A;  2L8D A;  4C92 C;  2LQK A;  2B8A A;  3MEU A;  3ME9 A;  4N0A C;  2ZZD B;  5GAO p;  2XIC A;  3KXT A;  4M6V A;  1WNL A;  3MP6 A;  3WXM B;  4F7U F;  3SB2 A;  4QQD A;  5LJ3 e;  1U1S A;  3RES A;  5GMK m;  4BB7 A;  3OS5 A;  2D0Q B;  1UB4 A;  3CCL A;  3VYG B;  3J80 E;  1BI1 A;  4ZTF A;  1VQK T;  4BAC A;  1QP3 A;  1WJS A;  1VIF A;  3CBM A;  4M77 E;  4QQG A;  3OS1 A;  4MZT A;  2Y4X A;  3S3M A;  3PMI A;  3JB9 I;  3OYG A;  4OB0 B;  5KH6 A;  3G71 A;  4HNV A;  2EAY A;  2JZ2 A;  2K5L A;  4RCB A;  4EPC A;  3OY9 A;  1KHI A;  2LC4 A;  3G6E T;  4DOV A;  3CC7 A;  4M75 D;  1SSF A;  2KR6 A;  3CC2 A;  1VQ6 T;  3OS2 A;  1UGQ B;  3QYG B;  2E10 A;  2R5A A;  3EFR A;  3EAE A;  3JCM d;  3PIP A;  1K8A C;  4M7D G;  3PIO A;  2VV5 A;  3CCS T;  1M1F A;  5GMK l;  1OZ3 A;  2LX9 A;  2CZ1 B;  4PL6 A;  4F7U G;  3A8L B;  4B9W A;  1YIJ T;  5GAN 6;  3V7C A;  4EMK A;  3OYI A;  3E9F A;  2QQ8 A;  4P5N A;  3M9Q A;  2MI6 A;  4JX4 A;  4A4G A;  4C8Q B;  5CK9 A;  3SWN B;  4JX5 A;  1BI2 A;  3E9G A;  3CCM T;  2LRQ A;  5GAN 4;  5GAO r;  3JB9 G;  3C12 A;  2RHY A;  2D9T A;  2DXC A;  2HQE A;  2X4W A;  3P8D A;  3HSB A;  3CBO A;  3BG3 A;  4MML A;  4PNO A;  2FYK A;  1VQ5 T;  5GAM f;  1M1K U;  4PJO B;  4JS4 A;  3JB9 D;  2CZ7 B;  2DPP B;  2L5Q A;  3LX7 A;  3P8H A;  3QUI A;  4ME7 A;  4C92 G;  1VQ4 T;  5CKH A;  5LJ3 d;  1GXI E;  2JTM A;  2ZPF B;  4YTL A;  2X4X A;  1YI2 T;  1O9S A;  3URG A;  4IUQ A;  3JCM V;  3GOX A;  1RL2 A;  2I2L A;  2RHU A;  5GAN f;  3NFC A;  3UDC A;  5CR2 A;  4M75 E;  5GAN 7;  4FM4 B;  2BS4 A;  2XU8 A;  4XU0 A;  1RI0 A;  3GLX A;  5J26 A;  4E7L A;  3GNG A;  2E5Q A;  2V8I A;  3SWN C;  3OYE A;  3KBG A;  3NTK A;  4JRI A;  4MZM A;  2F5T X;  3OYM A;  4OF1 A;  2QQA A;  3FB9 A;  1K9M C;  3QWL A;  3HB9 A;  3FC3 A;  5D6Y A;  3LWI A;  1K73 C;  1FXX A;  4NL2 A;  5AYF A;  2RK1 A;  1PSF A;  4E7K A;  4M7A D;  1Y71 A;  3LYI A;  2IG0 A;  4OB1 B;  4NC6 A;  3OB9 A;  4M77 C;  2RD1 A;  2OTL T;  2EYQ A;  5DLO A;  4A4K A;  1W2B A;  3M56 A;  2GQV A;  5GAO q;  2GCX A;  3BFM A;  4GY5 A;  1PSE A;  4HCC A;  4BY6 C;  2O01 E;  2DVE A;  2RH2 A;  3PGG A;  2QEX T;  4ZGE B;  4E7I A;  1W2B S;  3OYL A;  3V7S A;  4BI4 A;  1X75 C;  4DQ2 A;  5GAO l;  3MEV A;  1VQL A;  4HT8 A;  2KY9 A;  4OB3 B;  4M7D B;  2DD4 B;  1JJ2 S;  3M4G A;  4F7U B;  2HQX A;  3QBY A;  3QG1 A;  5FU6 C;  4J7F A;  5FU7 B;  2KDS A;  5C6S A;  2VYT A;  1WPY A;  4WF2 A;  1N27 A;  1QVF A;  4BBR M;  5CKD A;  4XQ3 A;  2X4J A;  1VQ6 A;  2E1H A;  3RMQ A;  2K3Y A;  3E19 A;  4LOC A;  3G4S T;  3QZ5 B;  5CAI A;  3JCM b;  2KMT A;  3BG9 A;  3CCJ T;  4M77 F;  2QFZ A;  1O75 A;  1B34 B;  1QLB A;  1WGS A;  4BI8 B;  3BDL A;  2X4Y A;  3FJP A;  4N4H A;  4C5I A;  3WVE B;  1D3B A;  3A5Z B;  2RJD A;  3CC4 T;  2F5K A;  2R58 A;  4PKC C;  4M78 C;  2E12 A;  4C8Q G;  3HP9 A;  3ZFJ A;  3X20 B;  4HNT A;  4FIB A;  4C92 B;  3CCU A;  4DA4 A;  3VKG A;  3JCM J;  1HK9 A;  3C95 A;  3CCM A;  1Q7Y U;  4M7A E;  1KQ2 A;  2K5I A;  5C0M A;  2KAF A;  3MHX A;  3QYH B;  5DLQ E;  1M1K C;  1M90 U;  1VQ5 A;  4MDX A;  3OMC A;  3HBL A;  2F69 A;  4J6W A;  5FU7 C;  4N4G A;  4C8Q D;  3AHU A;  4XU2 A;  1OYX A;  3CEY A;  4PJO G;  5A2Q E;  2QA4 T;  4XK8 E;  1VQN A;  3CME A;  3MET A;  2M9U A;  3JCM f;  2PVD B;  2RB6 A;  2RI2 A;  1IZ6 A;  2JNG A;  1VQO T;  3PMT A;  2WSF E;  1MGQ A;  2XG8 D;  5IAY A;  2YLB A;  1VQ7 T;  2CGH A;  2EJ9 A;  4M75 A;  4XAX B;  5LJ3 j;  4V2S A;  4PJO D;  1UGP B;  2DD5 A;  1ZQ1 A;  2JOY A;  5GMK h;  3GPL A;  2LNV A;  3CCQ T;  3A8O B;  1VQP A;  2ZPB B;  4M78 F;  3V8L A;  3VKI A;  5DM7 R;  2FHD A;  3MO8 A;  5LL6 S;  3L2V A;  2QXF A;  3QPH A;  3FEO A;  3I56 T;  2DZC A;  3T9N A;  3OYB A;  4TVR A;  5LJ3 g;  5CQY A;  5GAN 3;  3DKM A;  5CKE A;  4X9D A;  3G7Z A;  5CCA A;  4J6X A;  4M75 F;  2WJ9 A;  2A7Y A;  2MMP A;  4EMH A;  2RJC A;  2EJG A;  4J6Y A;  2BS3 A;  2XDD A;  3QYE A;  4ZGD B;  3L2Z A;  3HHT B;  1N6A A;  4C0Z A;  4BE0 A;  3PNW C;  4BD3 A;  2EQJ A;  3V7R A;  3DLL A;  2DIQ A;  4AKI A;  3C4S A;  1VIE A;  3VV0 A;  3VJP A;  4EMK C;  3L42 A;  4HCB A;  4M78 G;  1KG1 A;  2DAQ A;  2O4X A;  1Y96 A;  2P4T A;  3PFS A;  1HXD A;  1JBM A;  1G3Y A;  3MEW A;  2DK3 A;  3OYY A;  3QDR B;  4HKE A;  4NS5 A;  3LWH A;  4J5Y A;  1YJW A;  4OP0 A;  3HZJ A;  3OYD A;  1NJI U;  2QQB A;  5J3B A;  4D6W A;  2VXF A;  4JJN K;  2ZGW A;  3I55 A;  1UGS B;  1FKM A;  3HRU A;  1S72 T;  2MF2 A;  1Q81 C;  1KD1 U;  4ZN3 A;  2DXU A;  4FT4 A;  1XQH A;  4JLI A;  4M7D D;  3Q1J A;  3G4S A;  1WJQ A;  3L2W A;  4JS5 A;  4J7I A;  2JVV A;  1QVP A;  2RJF A;  3CBP A;  2KQW A;  1W4S A;  2G3R A;  2V8J A;  5GMK j;  1NZ9 A;  4QQ6 A;  2BIV A;  4RMO A;  3E1S A;  4E7J A;  1U8R A;  3M58 A;  3H8Z A;  4CI0 C;  4OB2 B;  2L3R A;  3DLM A;  2LT4 A;  4JDS A;  5LJ5 h;  3EFS A;  1YIT A;  1OI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...