2CZ0B

Photo-activation state of fe-type nhase in aerobic condition
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title photo-activation state of Fe-type NHase in aerobic condition
rcsb
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 56
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2cz0B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cz0B02
2DD4B 2ZPHB 3X20B 2ZCFB 4OB3B 2DXBA 1QP2A 3X24B 4RKUE 3QZ5B 3X28B 3X26B 1DJ7B 2PVDB 4OB0B 1UGRB 1AHJB 4XK8E 4ZGDB 2DXCA 1V29B 3A8HB 2CYZB 3LW5E 2D0QB 2ZPIB 3A8LB 2ZZDB 1UGQB 3A8OB 2PU9B 1QP3A 2PVOB 3WVEB 2ZPGB 2DXCB 5L8RE 3WVDB 4ZGJB 2DPPB 3QYGB 2DD4A 1UGSB 3QXEB 1IREB 2CZ6B 3VYHB 4ZGEB 2ZZDA 2WSEE 2O01E 1PSFA 3QYHB 2DD5B 1PSEA 1GXIE 2CZ7B 2WSFE 3QZ9B 3VYGA 2CZ0B 4FM4B 2AHJB 2QDYB 3HHTB 4L6V5 2PVGB 3A8MB 2ZPBB 1UGPB 4OB2B 2WSCE 4OB1B 3VYGB 3X25B 4KT0E 2PUKB 2DXBB 2ZPEB 2CZ1B 1JB0E 2PUOB 2ZPFB 4Y28E 2DD5A 3A8GB
chains in the Genus database with same CATH superfamily
1E7PA 3THKA 5D6XA 2F5KA 4CFMB 1F5QB 4AG2C 4EMGA 5IDPB 3OW2S 2VYTA 4FSSA 1Y7XA 2VGNA 1HK9A 3BW1A 4M75G 1OI9B 2ZGWA 4PJOA 3H8ZA 5DLOA 1KIKA 4CFUB 2VC8A 3QDFA 2R7GA 1M27C 2MAMA 2C5OB 4XU1A 2DFUA 2BIVA 3JCMd 3CEYA 1YI2A 1W70A 2P0QA 4F7UA 1VQLQ 2EIFA 2RHUA 5GMKe 2C6TB 1RLQC 1WI7A 2DZ9A 1SG5A 2EJ9A 2VUBA 3VS4A 1S72Q 1KC8U 2K5FA 2W10A 4E7HA 4DOVA 4QVZA 2LCSA 4C0DB 3OYDA 1OZ3A 5KYUA 2M16A 2DERA 2RO0A 3INZA 1VA7A 4HCCA 2IG0A 4FW2A 2BZYA 1PKTA 1GH6B 3EG9A 4BY6B 1UDLA 2DLPA 4MZMA 4PLIA 3P8BB 3LH5A 4OP0A 4M78G 1FXXA 2OJ2A 4WF2A 5KYWB 3BG9A 2F2CA 3CBMA 1ZHIA 5LL6S 1VQ4A 1D1BA 2X51A 1N4MA 1VQOT 4BY6C 2LTOA 2V22B 3EG3A 3BFMA 3OYBA 3OYYA 3SWNA 3GP8A 4BCNB 2L3RA 3G6EQ 4PJMA 3CCJT 3JCMf 2RA2A 4M7DF 3EFOB 3MY1B 3H0FA 1D1AA 1W6XA 3C12A 1ZQ1A 2EGCA 1O9SA 1TUCA 3PVQA 2PK9B 1VUBA 1VQOQ 2ZPFB 3EHRA 2KYBA 3CCQA 5HBEB 2RK2A 2E5KA 4M7AD 4BE0A 3B57A 2X4YA 1QCNA 1QVGP 3DLMA 4BCOB 4M78B 3O5ZA 1B3QA 3VRZA 3M03A 1NZ9A 5IXBA 3LQ5B 1RI0A 4ZNXA 5FWCA 3HRTA 3CMAQ 2RQWA 2LQWA 2DXUA 3NGPA 2D8HA 2OTJT 4ZGDB 1QLYA 3E1SA 5DLQE 4DBRA 3PIPA 1ZLMA 2YUOA 4A4GA 4D8DA 5LJ3e 1G3SA 1SF9A 2K4YA 4ELZC 5DQWA 2PU9B 2JMAA 3OBWA 2ZPGB 4BCHB 4N0AC 4QVCA 4F7SB 3WVDB 1VQPQ 3EGDB 1FYNA 1AT1B 2K5IA 2HAXA 3MO8A 3S3OA 4C8QE 1JEGA 2G9XB 5GAN2 2M9UA 1H24B 2ZZDA 1IXDA 2K5LA 1UHCA 3BE3A 1WHJA 1ZUKA 3F70A 3CMET 4AG1C 3QSUA 2LT1A 3QO3A 1HXDA 3CCLQ 4JDSA 3G7ZA 3TW6A 2HBWA 4F7LB 4KULA 5GAMg 3FJ5A 1OKWB 4J7IA 2IW6B 3JB9I 4OMOA 5GAOn 4BI3A 2MWOA 2DTHA 1SPKA 4UN0A 3HHTB 3M0UA 3I55A 2SRCA 2EBPA 2PVGB 1K73U 1MV3A 1G8XA 1K8AR 4DEYA 1H92A 2MWPA 1KD1U 2VKNA 1JXMA 3VV0A 3C0CA 3UA6A 4OMFB 5GMKm 3LWHA 2JN0A 3OYIA 3RKYA 5D7UA 1KFZA 4CC3A 4JJNK 4PJOB 4BCQD 4E2FB 2YT6A 1TU0B 4EOPB 1G3YA 2IW9B 4MDXA 2KRNA 1WNLA 4FYYB 4E7IA 4AFQC 3JCMJ 4DQ2A 5LJ5j 1LVKA 2D1XA 2YRVA 4F14A 1KQSA 3X26B 3PT9A 1WA7A 3MP6A 2PVDB 3M59A 4J5YA 1M3AA 2JTEA 4F7UB 3RIRA 4BUGA 5KYNA 1URCB 4QQGA 1TUGB 2HKQB 1UNHD 3HFNA 4JRPA 1M2OA 4XK8E 1AZGB 3A8HB 3G33B 3M54A 1VQ4Q 4AKHA 4V2SA 2ZZDB 2QDLA 1VQNQ 4JS4A 2EJFA 3EGXB 1RAHB 3S3MA 4OMLA 2QXFA 2GGRA 4G6LB 1C6VX 1NM7A 1VYUA 2BS2A 1CSKA 4OGRB 2JT4A 1MNEA 2KAFA 1OYXA 1H26B 4HCKA 2KRSA 4BI4A 1VQOA 2LC4A 2RHIA 4JPBW 2K2MA 4M77A 4AI6A 1V1CA 5LMKB 2DL4A 2WSFE 2WJ9A 2HQEA 5CO7A 2EUFA 1K73C 2LJ1A 4J83A 2E65A 3A98A 3JCMV 3CCJA 3VYGA 1NEBA 2QGFB 4BCIB 4Z02A 4F16A 2XHCA 5GAOr 2QTXA 3FEOA 1GBRA 2X3WD 5A0DA 3LLRA 3G6ET 4R56A 3N5BB 1X6GA 3EFRA 5GJWB 5A0GA 2CJMB 1K0SA 4MFEA 2BS4A 1Q7YU 4KRDB 1WJSA 1ACMB 2CSIA 2P0KA 3JCMb 3REBB 4C92B 3V7CA 5HNBB 1JO8A 3EFOA 4FSXA 1PC0A 2EPDA 2R58A 2CP5A 2ZPHB 2GNCA 2ZCFB 2FZCB 1SHFA 2OTJA 2DYBA 4Y72B 5GAMf 1I4K1 2E4HA 9ATCB 4RKUE 3SFMA 3CCQT 1YJ9T 3VKGA 3H41A 4F7JB 2BS3A 4QVDA 1HJDA 3M55A 2FRYA 2VASA 5GMKh 4IMYB 3G71T 2KQWA 3CD6Q 3CC4A 2VXFA 4M7AE 3HRUA 1OGUB 3QPHA 5I22A 3LW5E 2QFZA 3EIDB 5CKDA 2IPOB 2F2XA 5IDNB 1YWOA 3H4CA 4ZN3A 1QP3A 1Q86U 2FZKB 1JSUB 1NLPC 3QDRB 4RTXA 1VINA 3ME9A 1M1KR 3OS5A 1OKVB 5HQ0B 2VXEA 2KGTA 2Y90A 1OL2B 3L2VA 1OPLA 3UATA 2HQHA 1M90C 1BB9A 5FROA 2ROLA 1IREB 3RMQA 3S6WA 1NPRA 3NPFA 3JCMe 2DL7A 4IIMA 2W99A 2W9FA 4PFPA 1Y57A 4J8OA 1YJ9Q 4BD3A 1MUZA 1YJWT 3UT1A 5AT1B 1Y0MA 1M2VA 2QG9B 3RMSA 1D3BB 1QCOA 5IF1B 3TREA 1K1ZA 5I11A 2RQUA 1YCSB 2YUQA 2J6FA 5KYYA 5J26A 4J9GA 3CQTA 2I53A 1X27A 2QTVA 1PCXA 1O9KB 3CCEQ 1JSTB 5KYUB 4NSTB 2V26A 1G83A 5HK0A 2RMOA 4YTLA 2EJGA 4Q5WA 3I55T 1K73R 1TXQA 3OA6A 1VQLA 4XTVA 1G3NC 1PKSA 4M78F 1VQ9A 1AD6A 2WMAB 1Q82R 2DIGA 4BCFB 2CCIB 4M6VA 1KC8R 4A4KA 5FU7C 2QGSA 1JXOA 1OQKA 1YIJT 3MI9B 2AKLA 3EFSA 4EPCA 2WEVB 1UECA 2CP6A 1VYTA 5LJ3h 3M58A 2QA4A 5EFQB 5D6YA 5GAMj 2B9RA 3I5RA 5GAN5 3EGXA 2KEAA 4L5GA 4N4GA 3CCVA 5HCKA 2DJZA 1W1FA 2DL3A 4OVAA 3L2WA 2JTFA 1UHFA 1KG1A 1VQ8A 5GANg 1LOJA 3MEUA 2DBKA 2DILA 2NUZA 1RABB 2EQJA 3VU3C 2GQIA 1NJIU 1FVVB 1K8AU 2C06A 2KROA 3OYLA 1VQ4T 2DXCB 1M2VB 1X6BA 3CBOA 4BDZA 1SRLA 1M8VA 2QQ9A 3KUFA 3ZFJA 4AFSC 1Q86R 3HO8A 3RBBB 2G3RA 2EAYA 2EGAA 5IT9E 4JX5A 1SHGA 5GAN4 3GPLA 1YITA 4YC3B 2M0YA 4IUTA 1MNDA 2LNHB 2B86A 1GXIE 3MIAB 4LDUA 1X2QA 5FRNA 4ELLA 3OYNA 1WYXA 2HSPA 3QJYA 4ANJA 3CCMT 4P5NA 3M0QA 3TW7A 4JS5A 3H0HA 2RQVA 4F70B 2X4WA 4LD6A 3DLLA 1I1JA 4J7FA 4HNUA 4C0ZA 3SWNB 1S72A 2OX7A 3VYGB 4LDYA 2WPAB 4EC8B 1M3BA 3HBLA 4XU0A 1I5LA 1K9MU 8AT1B 2EKHA 4E7JA 1WJRA 2EKOA 2O9VA 4ESRA 2EYYA 3ER0A 3SB2A 4KH1B 4GBQA 3MEAA 4NL2A 1VQPA 4OB3B 1Q7YR 1R77A 3I5SA 1NE8A 3X24B 5IHKA 1X69A 4OF1A 1EFNA 3HZJA 2FG0A 3VS0A 1LCKA 2HCKA 2XIDA 2KK4A 2DL8A 3QBYA 3OYHA 2CP7A 1OOTA 4UC4A 3L2UA 3REAB 1BI2A 4WCIA 1VQ5T 3HP9A 2EFIA 2QQRA 2OTLQ 5GANj 2EW3A 1QWEA 4F7UE 1UGQB 4LNPA 5C6SA 4MIMA 2RHZA 5LJ5h 4II1A 2LDMA 1RI9A 4X1VA 1Q81U 4F17A 2C5VB 4JJCA 1CKBA 4R55A 4M75E 1VIEA 2LCCA 4PJOE 4HVVA 4LD9K 3LGFA 3EGUA 2I2LA 4PL6A 1WZOA 2JZ2A 3TVTA 2C0TA 4M75C 1FMWA 2H3EB 1PWTA 1M1KU 3HPWA 4EOSB 1RAAB 1N8RR 3UF4A 2AKKA 2H8HA 3JCMW 4BBRM 4PJNA 1Z9QA 4LE9A 2GTOA 2L8DA 3RKWA 3AHUA 1OI1A 1G5VA 2QDJA 4XQ3A 1KQ2A 1GCPA 2XK0A 4CI0C 4M75B 2VB6A 2ED1A 3MP8A 3O8VA 2KYMA 2D9TA 2NWMA 2V1QA 2DK3A 2DYIA 2RNAA 3HB9A 1TFBA 4DBHA 1NPPA 4F6UB 2UZDB 3QYBA 2HL5C 1Q81C 1D0ZA 3BLHB 4BE2A 3SD4A 2HEQA 3CCET 2CGHA 4BCMB 2PUKB 1OU9A 4NL3A 1K76A 1GUXB 1UNGD 4BCPB 1K9AA 5CIUA 3PTAA 4IURA 4KBMB 3P8HA 4Y92A 4OMMA 1H3ZA 1H27B 2DD4B 4F7UF 1BCOA 4CXAB 4RG8A 5LJ3f 4FT2A 1QP2A 1W98B 2HL3A 3C4SA 1HSQA 2FPDA 4DBQA 3CBPA 2IW8B 3X28B 1X2KA 2QF7A 3MPUB 4EOIB 3R6NA 2BKZB 4M75F 1RUWA 1U1TA 1M90U 3EH2A 1M30A 5CQXA 5IHNA 4QQDA 2UUEB 2K79A 3CCMQ 3VUZA 1NYGA 3A1PA 4EOJB 2D0QB 4TTHA 2KDSA 2YSQA 4CC7A 2PK2A 2DNUA 3GLXA 1UTIA 3DB3A 2COYA 1QMZB 2QQBA 3JCMh 4ELJA 5IHIA 3EG1A 3OYMA 3DL1A 4RCCA 2M02A 2DO3A 1B34A 4PJOD 4KGZB 1WHMA 1H8KA 5GAOl 3DOGB 2LQNA 2X35A 2C5NB 3CC2A 2CZ6B 1WX6A 1WIEA 2CSQA 2YDLA 3JCMg 1K8AC 1TH7A 4OGEA 3QYHB 2LX9A 2FRWA 4FYWB 1OIUB 2LQ8A 3CXCS 3BY7A 2W96A 2E41A 1JKWA 1M9SA 2VV5A 2OTJQ 2BZXA 2PNIA 2DXTA 3IQLA 3CMAT 4XU2A 4CRLB 3C94A 3CC2Q 5IH2A 4EMKB 1FINB 3GOXA 1WQ7A 2F5TX 1H4LD 4KUDK 2CP2A 1BCMA 1YNZA 4EOOB 1N8RC 1VQKQ 1UG1A 2E5QA 1I81A 1UGPB 1IRXA 1W4SA 1Q82C 3CD6A 4FW1A 1R8OB 2RI2A 3M4YA 3SWNC 1OULA 2YUNA 4L59A 6AT1B 3PMTA 2DA9A 1W2BS 1IGUA 5CYIB 5GMKl 4RMOA 1GL5A 2DJQA 1YWPA 2FYKA 3I35A 1BYMA 3TNIB 5FRMA 1IGQA 4KGXB 4DEXA 4M7AA 4KH0B 3BDLA 1B07A 2GBQA 3URGA 3CCJQ 4C0FA 2QQ8A 2L2PA 3QZ5B 3CC7T 2P84A 2DTIA 3QIIA 2JS0A 4M7DA 2WIHB 2WXVB 1PM3A 5CKEA 2YLCA 1A0NB 3MJXA 3WXMB 1VQPT 1QQJA 2K9GA 3M9QA 1O9KA 2LVMA 3TCJA 2RN8A 2IN3A 3G71Q 1H25B 3EH1A 1FWZA 2KMTA 2C5XB 1WLPB 5GAN7 2R57A 1QMCA 3CCQQ 2DTOA 1QLBA 3CMAA 5HKCA 3WVEB 5CKHA 1IHVA 2YWWA 2ATCB 1VQNT 5I2SA 1M1KC 2A7YA 3QYGB 2CH4W 4CRIA 5GMKi 3QXEB 2RPNA 1JBMA 3R6OA 3CCRQ 1YP5A 1E6GA 1WPYA 3CPWS 2NUTA 2O2OA 5GANh 4C8QG 2AIRB 4IIOA 2O9SA 4PJOG 4BB7A 1PSEA 3NTIA 1OPKA 2EQIA 3NHNA 4NOYA 2HZYA 4M78A 2KSSA 4M7DD 1Q82U 1X43A 1WFWA 3JCMP 4FT4A 3A5ZB 4PLLA 1UE9A 4Y91A 5KYXB 5CR2A 2K2VA 1ZBXA 3CCSA 1VQ6T 2XG8D 4N0AA 4Z88A 2AHJB 3ZEHA 3PE0A 2CT3A 4M7AC 3NFCA 2XD0A 2QA4Q 1S1NA 4RTYA 3O0GD 2WACA 2MMPA 1XTDA 2AZSA 4O6JA 3CCUA 3A8MB 2KBTA 5C0MA 2EVRA 3I9QA 5CKBA 4OB2B 3J7AF 1TS9A 3G4ST 2QQSA 2D8JA 1VQ7A 3V8LA 3KHIA 2FPEA 3JSCA 5GAN6 2PUOB 4Y28E 4HT9A 1TWBA 2ABLA 4A4HA 1Q7YC 1KK7A 4Z89A 3CCMA 2E1HA 2HMAA 4MFDA 3HL8A 3CCLT 4BACA 3BLQB 5LJ3j 4OMQA 4DA4A 5HBJB 1LJOA 3QWLA 3M56A 2YRCA 2RH2A 3OW2A 1YJNT 2K6DA 4FIBA 5GAMh 2DZCA 3CMEQ 1VQ7Q 2H3JA 1EIFA 2KRMA 2PQWA 3G4SA 4LDXA 2HKNA 1DJ7B 1NJIC 2BZ8A 5LJ5e 3CPFA 5I2MA 2CKKA 3HFOA 3LH0A 3P8DA 2DXCA 3OS2A 1FX7A 4A63B 3TQ7P 4RTZA 1BI1A 3JAME 2A08A 1M8MA 2LP5A 1BIBA 2X1NB 3M0RA 1X01A 2A37A 3EG0A 4PJOF 5GANd 2XICA 2PTKA 1SSHA 3FIFA 1TOVA 4A53A 2JOYA 4PJLA 4EIKA 3PGGA 5AYFA 4MMLA 1F1BB 5CKFA 3ZL7C 4E6RA 1PHTA 2LZ6B 1KHIA 2L0AA 2BPMB 2DVEA 1WHLA 1M4ZA 2CH4A 5HBHB 4FCYA 1LPLA 1ZSZA 3VRYA 1K9MR 5CEIB 3G6EA 2NUPA 3CCVQ 4J9HA 5IHYA 2DETA 4QW2A 3RR6A 5FLXE 1YIJQ 4PJJA 1ABQA 3CC2T 1SKUB 3DTOA 4M77F 2WHBB 1VOMA 3LYIA 4BE1A 3M0TA 1GBQA 4XAXB 1H1QB 4BCKB 4DOWA 2A28A 2W2HA 2Y4XA 4N4HA 1PNJA 5FU7B 4ZTJA 5KCOA 1VQMA 1N9RA 1R0CB 2E10A 4J6WA 3H6ZA 1WHKA 1X6OA 1QCFA 3NTKA 4A54A 5GANf 5KE2A 2XI9A 1LNXA 1M3CA 4KT0E 1AISB 2CP0A 2LJ3A 5ECAA 2J06A 4J6YA 1M90R 1D09B 4EC9B 2E3HA 2FO0A 1ZSGA 2RHYA 3M5AA 3DB4A 3A8GB 5I5ZB 4EOQB 3PFSA 4C8QF 2MI6A 3GNGA 2LW4A 5GAOp 4M7DC 3FDRA 1C0MA 2FEIA 4JJBA 1MMGA 1XQHA 3F5XB 2KT1A 2UZBB 4M77B 1XJWB 4JZ3A 2EQMA 4B9XA 3VKIA 2C4GB 2NUPB 2J6KA 4LDWA 2OAUA 2O88A 1D0YA 1OX9A 1VIFA 2CYZB 2O4XB 3QHRB 4HCZA 4RTTA 2A0FB 2JM8A 2A3LA 3RUXA 1SRMA 1AEYA 2YXYA 1N5ZA 2GFUA 3QYEA 4C92E 3EGDA 1VQ5Q 2HNIA 1YJWA 2DD4A 4M7AG 3EG2A 3LGLA 1BU1A 1QVFS 2JXBA 2OTLT 2O31A 4ATOA 4J9BA 4XTYA 3NMZC 1H3HA 3JB9H 2QEXA 3SEMA 2VGMA 4XTXA 3I55Q 1FMKA 4M7DG 3GBQA 3OSVA 3BLRB 2EYWA 2DD5B 2CP3A 2RD1A 4M77G 2JVVA 5J39A 3DDQB 1Y71A 3TNWB 3RNJA 4C8QC 2JTMA 5FU6B 2LQKA 3QUIA 2YHTA 2XMFA 4RG2A 3JRZA 4ROCA 4M75A 1BU2A 2W0ZA 1RLPC 1M1GA 2YLBA 4I3ZB 1QVGS 3L2ZA 4YOSA 2JM9A 1ZUYA 3CCLA 3MHXA 4MZTA 4BBSM 3X25B 4M7DE 2JMCA 1ABOA 1QKXA 4RTWA 1U3OA 3L42A 3G4SQ 4JLIA 2EGEA 1YI2Q 3DDPB 3ZBDA 2ESWA 2EYQA 4BY7X 3UDCA 2DRKA 1K9MC 4EMKC 1ARKA 1PG5B 1RL2A 1X75C 2E64A 4IUUA 3AT1B 4LN2A 2BE9B 4WTOB 4D8KA 2P4TA 4E7ZA 1BK2A 1BI0A 5EG2A 3NTHA 4OB0B 1QKWA 1QVPA 3QWYA 4ORZA 4CFUD 1AHJB 5HK3A 1Z9ZA 1KD1C 1YIJA 1KQSP 2FPFA 2HDAA 3ULRB 4E7LA 1KXUA 2B8AA 4AFZC 2F69A 2Z0WA 5A2QE 1YJNA 3A8LB 3PMIA 4M75D 3C95A 1GRIA 1OEBA 5GAN8 1VQ9Q 2R5AA 3JB9F 4C5IA 2RJCA 4GY5A 2X9HA 2HBPA 1GCQC 4C92D 1MMNA 2M51A 1PKDB 1T0HA 4M4ZA 4ZGEB 2EYXA 1D0XA 1EZZB 2O01E 4XTUA 3V7SA 5LJ3g 1OV3A 4OR5B 3EG9B 2BKDN 3BHTB 1VQMQ 2J6OA 2R5MA 4YOZA 2KVQG 4X9DA 3MY5B 3OYGA 3M4GA 3RERA 2GF7A 2RHXA 4FL6A 1G2BA 3FC3A 4C5GA 4J9EA 3BG5A 1UUEA 2LNVA 5GANe 2HD0A 4C8QB 1XOVA 2NUTB 3OW2P 2ECZA 1VQ6Q 3LWIA 1AWOA 1JJ2A 5IAYA 5LJ5g 1XO2A 2ZPBB 2WSCE 2COZA 4F6SB 1CKAA 5ICPB 1GFCA 2DBMA 2JS2A 1AZEA 2CREA 2E70A 5LJ5d 5DM7R 3BDUA 3G71A 5GAMe 1RAGB 1D1CA 2A36A 3I56A 1W2BP 4C92A 4OMNA 2M1HA 4QSHA 3OS1A 4J9FA 2ED0A 2V1RA 1VQ5A 3KXTA 4NS5A 2W9ZA 1SEMA 2DXBA 3CPWP 4JZ4A 1VYWB 3CCRA 3JB9G 2GTJA 2LX7A 1FMVA 5J3BA 3UA7A 2QEXQ 4PJOC 4EMHA 4M77D 1Q81R 2C0OA 2RJFA 3T9NA 1VQKA 2E3IA 3I56T 4ME7A 2K7AA 2KT8A 2P0PA 1UNLD 3OYJA 3EAEA 1VQLT 4HL4A 1D3UB 4KRCB 3KBGA 1K4US 2QI2A 3A8OB 3U23A 2DRMA 2RF0A 1MGQA 2L3QA 4JRIA 4F7UG 3CC7Q 1N6AA 4X9CA 5IXFA 4J9IA 1U06A 5L8RE 2O4XA 3PIOA 4ZGJB 4B6MA 1V76A 1H641 1O75A 2J7IA 2D0NA 1H1RB 4BCQB 1I8FA 2G77A 2WMBB 2GFAA 2CDTA 2MK5A 1KQSS 2DX1A 4HT8A 3HTRA 2XDBA 1NEGA 2FZGB 2SEMA 1VQ7T 2IVWA 2COWA 3VS3A 2QYZA 3VS1A 3CCEA 2OTLA 3TSZA 5FW9A 2CZ0B 4EOLB 1UJYA 4C5EA 3VS5A 1AVZC 3CMEA 3L2QA 1AWXA 1C1AA 3DJBA 1B7TA 1YN8A 5LJ3d 2MF2A 2WIPB 1T3SA 1H1SB 4KRTA 2QQAA 4XU3A 4CC2A 4DBFA 1OU8A 3RDVA 4CC4B 4B9WA 2OAWA 2KMGA 1YJ9A 2HSEB 2X4JA 2G6FX 4EORB 5KH6A 3ASKA 3JB9J 1UFFA 3QWXX 4XTWA 1MMDA 4J9DA 4C5HA 2QA4T 3OS0A 4NC6A 1TSFA 3D7SB 3QG1A 3FB9A 5HVYB 2XDDA 1QVGA 2DVJA 1JU5C 1J3TA 4F7NB 2RJEA 1ZP2A 4FU6A 5ACBA 5FGKB 4JJDA 5LQFB 4LUDA 4M78C 2CT4A 4EDUA 2YUPA 4O5VA 2K57A 4E7KA 1YI2T 3META 1M5Q1 2X3XD 2UZLB 4QQ6A 4PFZA 2QAZA 3M57A 3BG3A 1QWFA 3QHSA 1VQMT 4IUPA 4HNTA 4C92G 5KCHA 3CXCP 4ZTFA 1P92A 1WHHA 2FVUA 1Y96A 1NJIR 3GTMS 5FU6C 4ZN1A 3L2RA 1V29B 4J9CA 3H0IA 2RI3A 5GAN3 1VQ9T 1NLOC 1KD1R 1OIYB 1PRMC 4C0GA 1FKMA 4MDWA 3M53A 4PK4A 5GJVB 4F6WB 1KQ1A 4BY1X 2PVOB 1VQ6A 3RGFB 2X4XA 5CK9A 1BBZA 1MMAA 4M78E 1UGSB 3KFVA 2L3SA 1E9HB 3MKDA 1VQ8Q 3DKMA 1NYFA 1YHQT 2V8IA 1OX8A 2F2VA 2EWNA 4AKIA 3SHWA 4MZPA 2I40B 1YBYA 4IUVA 2L3PA 1PSFA 4X34A 1WHGA 2L89A 3S3NA 3MEWA 4ROEA 3PNWC 2ZAEA 1Q95G 4C8QD 4HVUA 4A4EA 3EOCB 3VUBA 4C92C 3JCMX 2NLUA 1BI3A 4MMKA 3CD6T 3QZ9B 4XTZA 1I07A 2FB7A 5DY9A 2K3YA 4QT7A 4JLGA 4FM4B 4RTVA 2YRDA 2PHGA 5I21A 1VYVA 4L6V5 4FYVB 2I0NA 2AT1B 3OB9A 1ZA2B 3CCVT 1MHNA 2KY9A 2NYSA 2MYSA 4RCBA 3RKXA 4BI8B 1T0JA 2JUFA 1JB0E 4BCJB 2LCLA 3CC7A 3TN8B 1UB4A 3CC4Q 3X20B 2LMJA 1YJWQ 2IIMA 1AOJA 1NBEB 1K0XA 1D3BA 1KSWA 1S72T 1WGSA 4PKCC 1TUDA 3VJPA 5GMKj 2QGGA 3VKHA 1WXUA 5KYYB 4PNOA 4GLKA 2HQXA 2CUDA 4CFXB 1ZX6A 3PO3S 1T3LA 2DF6A 3TNHB 4RUGA 1U1SA 3OYKA 3CCRT 3Q1JA 2AK5A 3HSBA 2J05A 2CS7A 4JX6A 5A0LA 4K11A 1PD1A 1G3TA 4JRKA 1OL1B 3FJPA 4Z8AA 3CC4T 3UWNA 3V8JA 4AT1B 5GAMd 5DQVA 1RAIB 3VS6A 1YCYA 3FLGA 1GY3B 1JQQA 4GLMA 5BNJB 3OQ5A 1JJ2P 3OMCA 1WXBA 1AWWA 3OBYA 1RACB 3VYHB 2EYZA 4BXXX 4RTUA 3VS7A 4C0DC 2IVXA 2MCNA 5M9OA 3CCST 3K7AM 1P5EB 4M78D 4HCBA 3J80E 2JJ9A 1IB8A 1HYOA 4HA8A 1W2BA 2K3XA 4LXCA 3CCUT 2LT4A 4EOKB 4VUBA 2L5QA 2MIOA 4HLQA 1VOLA 4RODA 1PRLC 1WQWA 3MEVA 5CCAA 2EQUA 3GF5A 3CPWA 2E6NA 3E9GA 3V7RA 4EONB 1WJQA 4OGCA 2KNBB 1ZBJA 3G1JA 1RAFB 2RK1A 1IZ6A 3CXCA 1ENWA 2DMEA 2MOXA 1Y07A 5FWBA 1U8RA 1YJNQ 2BUDA 4CFWB 2CZ1B 2CUBA 4N4IA 1I0CA 2QASA 4C8QA 3BHVB 2KXCA 1ZSZB 4ELYC 3OY9A 1AD5A 4HNVA 2RQTA 3CCUQ 2ENMA 3GIBA 2VVKA 1EX4A 2DIQA 1SSFA 1U5SA 3TU4K 3CCSQ 1JJ2S 1GCQA 1UGVA 1HD3A 3E9FA 3H9NA 4BDYA 1WDXA 1ZA1B 2RJDA 1QVFP 2K3BA 3GNFB 1I5OB 4FYXB 3BHUB 2KR6A 2RI5A 1KHCA 5CAIA 1M1FA 4M77C 1H1PB 3PVLA 2XKOC 2F1LA 3LX7A 1YHQA 1N9SA 1N27A 2PMIB 1H28B 4LDVA 3OYFA 5L2WB 1YITQ 1OZ2A 5GAOm 4J6XA 1YITT 2DEUA 1VQ8T 4A4FA 3VS2A 4KUIA 4QKUA 1YHQQ 1RAEB 3J81E 2WFYB 2MPXC 1KC8C 2RB6A 3I56Q 2JGZB 2F2WA 2WSEE 5GAOq 1BIAA 4LOCA 4AKGA 4EMKA 1TG0A 3HRSA 5EC7A 4E47A 2EQKA 3POMA 1TD6A 4HVWA 2FL7A 2CCHB 4CFNB 3QJ6A 5EJCA 1BKBA 1TTHB 2KI7A 2PJQA 2BE7D 4AFUC 3OYEA 2QDYB 1YFNA 4M77E 1VQNA 2D6FA 1E7OA 2DAQA 1NG2A 2RM4A 4C92F 4HXJA 5D6WA 2RQRA 4LUEA 4IKFA 2DXBB 1IO6A 1AWJA 2ROTA 1MV0B 2KR3A 1GFDA 2QK0A 3TEEA 1XNIA 1RADB 2VWFA 3FRNA 2XDPA 4M7AB 2DD5A 2DE0X 5LJ5f 2XU8A 4D6WA 1R0BG 3OSSC 4KGVB 2V8KA 3MCAB 5L23A 4JX4A 4F04B 4AMCA 4M7DB 2LRQA 2FHDA 8ATCB 4II5B 3E19A 3QKJA 1KJWA 2BTTA 2GCXA 4BCND 4JRQA 3UPUA 1UGRB 3E2UA 4EOMB 2KXDA 4CFVB 3RESA 4IUQA 3OMGA 1UEBA 3MP1A 3M0PA 3HKSA 2V8JA 4JUVA 2ZPIB 5CQYA 2P4RA 4R0KA 2DL5A 4TVRA 2QEXT 2DMOA 3QHWB 2JW4A 2DPPB 1QW1A 1QVFA 4M7AF 5IN1A 4BCMD 1WXTA 1C9BA 7AT1B 5KYXA 1E6HA 3JCMQ 1PD0A 3NDQA 2C0IA 5CVIA 1JRIA 2DM1A 2E6ZA 2CZ7B 1IHWA 1Y96B 2Y4YA 1G3WA 2UZEB 2KE9A 2AZVA 2E12A 4YOOA 2DKGA 3SDZA 4E7SA 2JNGA 5KE3A 2PZ1A 1B34B 1UJ0A 4OB1B 4OMPA 5KYWA 2OI3A 1VQKT 3JB9D 3V8KA 2LJ0A 3JCMc 3JV3A 1JOWA 2M0OA 4FX3B 3EJ1B 1Q86C 1ZUUA 2GQVA 4BCGB 2ZPEB 4PFOA 3M0SA 3OYAA 3TSWA 3OYCA 1GUXA 4HKEA 5HY6A 4Z6YA 3EHQA 2DEQA 3L1AA 1N8RU 1ZSZC
chains in the Genus database with same CATH topology
1E7PA 4O5VA 2E1HA 2F5KA 5D6XA 2K57A 4E7KA 4MFDA 4M6VA 3HL8A 3CCLT 4BACA 1YI2T 4A4KA 3META 5FU7C 4EMGA 5LJ3j 4DA4A 3OW2S 1LJOA 1M5Q1 3QWLA 2VYTA 3M56A 2RH2A 3OW2A 1YJNT 1Y7XA 2VGNA 1YIJT 4QQ6A 4FIBA 1HK9A 3EFSA 5GAMh 2DZCA 3M57A 4EPCA 2H3JA 1EIFA 3BG3A 2PQWA 3G4SA 4LDXA 3QHSA 3BW1A 4M75G 5LJ3h 1VQMT 4IUPA 4HNTA 1DJ7B 3M58A 2ZGWA 1NJIC 4C92G 2QA4A 5D6YA 4PJOA 5GAMj 5KCHA 5GAN5 5LJ5e 3CPFA 3H8ZA 5DLOA 2VC8A 1P92A 2FVUA 5I2MA 4ZTFA 4L5GA 1Y96A 4N4GA 2CKKA 3HFOA 3CCVA 2DJZA 3LH0A 5FU6C 4OVAA 4ZN1A 3L2WA 3P8DA 2DXCA 3OS2A 1V29B 2JTFA 3L2RA 2MAMA 1KG1A 2RI3A 1VQ8A 1FX7A 5GANg 4XU1A 5GAN3 1VQ9T 1BI1A 3JAME 1LOJA 1BIBA 2BIVA 3JCMd 3CEYA 3MEUA 4C0GA 1FKMA 1X01A 3M53A 4MDWA 4PJOF 2EQJA 5GANd 3VU3C 1YI2A 2P0QA 2XICA 4F7UA 2EIFA 1KQ1A 5GAMg 1NJIU 3FIFA 1K8AU 2C06A 3OYLA 2PVOB 2RHUA 5GMKe 1VQ4T 1VQ6A 2X4XA 4A53A 2VUBA 2DXCB 2DZ9A 2EJ9A 2JOYA 5CK9A 1KC8U 3CBOA 4F7UB 2K5FA 4BDZA 4M78E 4E7HA 1M8VA 4DOVA 2QQ9A 3KUFA 3ZFJA 4QVZA 3PGGA 1UGSB 5AYFA 4MMLA 4C0DB 5CKFA 3OYDA 1OZ3A 3DKMA 2M16A 1YHQT 2V8IA 2RO0A 1KHIA 3HO8A 2DVEA 3INZA 2EWNA 4HCCA 1M4ZA 2IG0A 4AKIA 2EAYA 2G3RA 5IT9E 4MZPA 4JX5A 1YBYA 5GAN4 4BY6B 3GPLA 1YITA 4IUVA 4MZMA 1PSFA 4X34A 4PLIA 2L89A 3P8BB 4IUTA 1GXIE 4OP0A 3G6EA 3MEWA 3S3NA 4M78G 1FXXA 3PNWC 4LDUA 4WF2A 4C92C 4C8QD 3BG9A 4A4EA 3VUBA 3JCMX 5FRNA 3CBMA 3OYNA 2NLUA 1BI3A 4MMKA 3QJYA 4QW2A 5FLXE 1ZHIA 3CD6T 3QZ9B 3CCMT 5LL6S 1VQ4A 4XTZA 3CC2T 4P5NA 2FB7A 5DY9A 2K3YA 4M77F 3TW7A 4JS5A 1VQOT 4JLGA 3LYIA 4BY6C 2LTOA 4FM4B 4BE1A 4XAXB 4DOWA 2X4WA 2Y4XA 4LD6A 5I21A 3BFMA 3OYBA 4N4HA 4J7FA 3DLLA 3OYYA 4L6V5 3SWNA 3GP8A 5FU7B 4ZTJA 5KCOA 1VQMA 4HNUA 4C0ZA 2L3RA 1N9RA 3SWNB 1S72A 3CCJT 4M7DF 3JCMf 2RA2A 2E10A 4J6WA 3H6ZA 3VYGB 1X6OA 4LDYA 3NTKA 3OB9A 4A54A 3C12A 5GANf 3HBLA 1ZQ1A 5KE2A 4XU0A 3CCVT 2XI9A 1LNXA 1O9SA 4KT0E 1I5LA 1MHNA 2KY9A 4RCBA 3RKXA 4BI8B 4J6YA 1K9MU 1VUBA 4E7JA 2JUFA 1JB0E 1WJRA 2ZPFB 2EKOA 2RHYA 2LCLA 3M5AA 3CC7A 3CCQA 2RK2A 3DB4A 3A8GB 4BE0A 4M7AD 1UB4A 3ER0A 3SB2A 2X4YA 3X20B 3MEAA 3PFSA 4NL2A 3DLMA 4OB3B 4C8QF 1VQPA 2MI6A 4M78B 1NE8A 3GNGA 1D3BA 1NZ9A 3X24B 5GAOp 1S72T 4M7DC 1WGSA 4OF1A 3FDRA 4PKCC 1XQHA 1RI0A 3HZJA 3VJPA 5GMKj 3HRTA 4M77B 3OYHA 2XIDA 3VKHA 2KK4A 3QBYA 2EQMA 4UC4A 4B9XA 2DXUA 3VKIA 3L2UA 4PNOA 4GLKA 2HQXA 4LDWA 2OAUA 1BI2A 2OTJT 1VQ5T 4ZGDB 3HP9A 3E1SA 5DLQE 2EFIA 2QQRA 1VIFA 2CYZB 2O4XB 3PIPA 5GANj 3OYKA 4HCZA 1U1SA 3CCRT 2A3LA 3RUXA 4F7UE 3Q1JA 1UGQB 3HSBA 4A4GA 5LJ3e 1G3SA 2CS7A 4JX6A 2K4YA 5A0LA 1G3TA 4JRKA 4ELZC 5C6SA 2PU9B 4MIMA 2RHZA 5LJ5h 2GFUA 4II1A 2LDMA 3FJPA 3OBWA 3QYEA 3CC4T 1Q81U 2ZPGB 4N0AC 3UWNA 3V8JA 4C92E 4QVCA 5GAMd 4R55A 2HNIA 3WVDB 2DD4A 4M75E 3LGLA 1YJWA 4M7AG 1VIEA 1YCYA 3FLGA 1QVFS 2OTLT 4ATOA 2LCCA 3OQ5A 4PJOE 2K5IA 2HAXA 3OMCA 3LGFA 4LD9K 3MO8A 3S3OA 4XTYA 4C8QE 5GAN2 2I2LA 2M9UA 3OBYA 4PL6A 2JZ2A 3VYHB 4C0DC 3JB9H 2ZZDA 2QEXA 5M9OA 3CCST 2K5LA 2VGMA 4M75C 1M1KU 3CMET 3F70A 4XTXA 3HPWA 4HCBA 4M78D 3J80E 4M7DG 3OSVA 4HA8A 3QSUA 2LT1A 2DD5B 1W2BA 2RD1A 3JCMW 4M7DB 4BBRM 1HXDA 3QO3A 4M77G 2K3XA 4JDSA 3G7ZA 3TW6A 2LT4A 2L8DA 2JVVA 4VUBA 3RKWA 5J39A 2L5QA 3CCUT 3AHUA 1OI1A 1Y71A 1G5VA 2QDJA 4KULA 2JTMA 5FU6B 2LQKA 3QUIA 4XQ3A 4HLQA 4C8QC 2XK0A 2YHTA 1WQWA 3MEVA 4J7IA 5CCAA 4CI0C 4RG2A 3JB9I 4M75B 5GAOn 3JRZA 4BI3A 2EQUA 2MWOA 2DTHA 4M75A 3GF5A 3CPWA 2E6NA 3E9GA 3V7RA 3MP8A 3O8VA 3HHTB 1M1GA 1WJQA 2D9TA 4OGCA 2YLBA 3I55A 2DK3A 2PVGB 1QVGS 3L2ZA 1K73U 3HB9A 1NPPA 2RK1A 3CCLA 3QYBA 3MHXA 1IZ6A 4MZTA 3CXCA 1Q81C 4BBSM 4BE2A 3X25B 4M7DE 3SD4A 3CCET 2CGHA 1Y07A 2MWPA 1U8RA 1KD1U 2PUKB 3L42A 4NL3A 2BUDA 4JLIA 3VV0A 2CZ1B 4N4IA 3ZBDA 4OMFB 4C8QA 2EYQA 5GMKm 3LWHA 5CIUA 2JN0A 3OYIA 3UDCA 3RKYA 4ELYC 3PTAA 3OY9A 4IURA 4EMKC 1K9MC 3P8HA 4HNVA 4PJOB 4JJNK 1H3ZA 2DD4B 3GIBA 4F7UF 1G3YA 4MDXA 1RL2A 1X75C 1WNLA 4RG8A 2DIQA 5LJ3f 4FT2A 1QP2A 1SSFA 2E64A 4IUUA 4E7IA 3C4SA 3TU4K 3JCMJ 4DQ2A 1JJ2S 5LJ5j 2P4TA 3E9FA 4BDYA 2RJDA 2YRVA 3CBPA 3X28B 1KQSA 3X26B 2QF7A 3PT9A 3GNFB 1BI0A 4M75F 3NTHA 5EG2A 3MP6A 2PVDB 3M59A 1U1TA 4OB0B 4J5YA 2KR6A 1QVPA 2RI5A 1KHCA 5CQXA 4QQDA 3RIRA 4BUGA 5CAIA 4QQGA 3VUZA 1AHJB 3HFNA 5HK3A 1M1FA 4M77C 4JRPA 4XK8E 2XKOC 1KD1C 1YIJA 3A8HB 3LX7A 3M54A 4E7LA 1YHQA 2D0QB 1N9SA 2KDSA 2B8AA 4AKHA 2F69A 5A2QE 3GLXA 1YJNA 3A8LB 3PMIA 4M75D 2ZZDB 4V2SA 1N27A 3C95A 3DB3A 2QQBA 4LDVA 3JCMh 3OYFA 4ELJA 3OYMA 2EJFA 4JS4A 3DL1A 5GAN8 4RCCA 1OZ2A 2DO3A 3S3MA 5GAOm 1B34A 2QXFA 2R5AA 4J6XA 1YITT 4PJOD 3JB9F 1VQ8T 4C5IA 4A4FA 2RJCA 2BS2A 4GY5A 5GAOl 2HBPA 4C92D 4KUIA 2KAFA 2X35A 3J81E 1OYXA 1KC8C 2CZ6B 3CC2A 4ZGEB 2RB6A 5GAOq 2WSEE 4BI4A 2O01E 1VQOA 1BIAA 2LC4A 1TH7A 4XTUA 2RHIA 3JCMg 3V7SA 1K8AC 4LOCA 4OGEA 5LJ3g 4AKGA 4M77A 4EMKA 4AI6A 3HRSA 2BKDN 3QYHB 2LX9A 2R5MA 2KVQG 4X9DA 3OYGA 4E47A 2EQKA 3M4GA 1K73C 2WSFE 2WJ9A 2HQEA 2FL7A 2GF7A 2RHXA 5CO7A 2LQ8A 4FL6A 4J83A 3CXCS 3RERA 2E65A 3BY7A 3QJ6A 5EJCA 2E41A 2VV5A 1M9SA 3JCMV 1BKBA 3FC3A 3CCJA 3VYGA 4C5GA 2DXTA 3BG5A 3CMAT 2LNVA 4XU2A 5GANe 2HD0A 3C94A 4C8QB 1XOVA 4Z02A 3OYEA 2QDYB 4M77E 4EMKB 3GOXA 1VQNA 1WQ7A 2F5TX 4KUDK 2D6FA 2XHCA 5GAOr 2DAQA 2QTXA 3FEOA 1N8RC 3LWIA 2E5QA 1I81A 2RM4A 5A0DA 5IAYA 2ZPBB 3LLRA 5LJ5g 3G6ET 1UGPB 2WSCE 1W4SA 4R56A 3N5BB 4C92F 1R8OB 2RI2A 1Q82C 3CD6A 3M4YA 3SWNC 3EFRA 5D6WA 4L59A 2E70A 5LJ5d 5DM7R 3PMTA 5A0GA 3BDUA 1W2BS 4IKFA 4MFEA 2BS4A 5GMKl 1Q7YU 2DXBB 4RMOA 3G71A 5GAMe 3I56A 1WJSA 4C92A 2P0KA 3JCMb 2FYKA 2M1HA 1BYMA 4QSHA 1XNIA 3TEEA 3V7CA 4C92B 3OS1A 3FRNA 5FRMA 2XDPA 4M7AB 4FSXA 2DD5A 1KQ2A 2R58A 4M7AA 1VQ5A 2ZPHB 5LJ5f 2ZCFB 2XU8A 4NS5A 3BDLA 3KXTA 4D6WA 3OSSC 3URGA 2OTJA 2DXBA 3CCRA 5GAMf 3JB9G 2V8KA 3MCAB 1I4K1 4C0FA 4JX4A 5J3BA 2QQ8A 4RKUE 3QZ5B 3SFMA 3CCQT 2DTIA 3QIIA 2LRQA 1YJ9T 4EMHA 3VKGA 2FHDA 3CC7T 4PJOC 4M77D 4M7DA 3E19A 5CKEA 2BS3A 3QKJA 4QVDA 2YLCA 2GCXA 2RJFA 3WXMB 3M55A 3G71T 3T9NA 5GMKh 4JRQA 1VQPT 3UPUA 1VQKA 1UGRB 2KQWA 3I56T 4ME7A 3RESA 4IUQA 3CC4A 2VXFA 4M7AE 3OMGA 3HRUA 1UEBA 3MP1A 3QPHA 3HKSA 2V8JA 2P0PA 3LW5E 3M9QA 2LVMA 3EAEA 2QFZA 3TCJA 4JUVA 4HL4A 3OYJA 1VQLT 2ZPIB 5CQYA 3KBGA 2QI2A 5CKDA 3A8OB 1MGQA 1FWZA 2KMTA 4JRIA 3H4CA 5GAN7 4ZN3A 2R57A 4TVRA 4F7UG 2QEXT 1QP3A 2DTOA 1Q86U 1QLBA 3CMAA 1N6AA 4X9CA 5HKCA 3WVEB 5CKHA 3QDRB 3ME9A 1VQNT 3OS5A 5I2SA 2VXEA 5L8RE 1M1KC 2O4XA 3PIOA 4ZGJB 2DPPB 3QYGB 2A7YA 2Y90A 4CRIA 3L2VA 5GMKi 1M90C 3QXEB 1QW1A 1JBMA 1QVFA 4M7AF 3R6OA 5IN1A 5FROA 1IREB 1WPYA 1H641 3RMQA 3S6WA 1O75A 1NPRA 3CPWS 3JCMQ 1I8FA 3JCMe 2G77A 5GANh 2GFAA 4C8QG 1KQSS 4HT8A 4PJOG 4BB7A 1M90U 4J8OA 2XDBA 5CVIA 1PSEA 3NTIA 1JRIA 4BD3A 1YJWT 3UT1A 2E6ZA 1VQ7T 2CZ7B 4NOYA 1Y96B 2Y4YA 1G3WA 4M78A 2IVWA 2KSSA 4M7DD 1Q82U 3JCMP 4FT4A 1D3BB 3A5ZB 4PLLA 3RMSA 2E12A 4Y91A 5CR2A 3CCEA 1JJ2A 2OTLA 2K2VA 2CZ0B 1ZBXA 4C5EA 3CCSA 3CMEA 3L2QA 2DKGA 3SDZA 2XG8D 4N0AA 3TREA 1VQ6T 5LJ3d 2AHJB 3ZEHA 3CCMA 2JNGA 4M7AC 2MF2A 5KE3A 3NFCA 2XD0A 2QQAA 4XU3A 2WACA 2MMPA 1XTDA 5J26A 4B9WA 4O6JA 3CCUA 2KMGA 3A8MB 5C0MA 1B34B 2X4JA 5CKBA 1YJ9A 4OB2B 3JB9J 5KH6A 3ASKA 3J7AF 4OB1B 3G4ST 2QQSA 4XTWA 1VQKT 4C5HA 3JB9D 3V8KA 2QA4T 3OS0A 4NC6A 3JCMc 3QG1A 3FB9A 1VQ7A 2M0OA 2XDDA 3V8LA 3KHIA 1QVGA 1Q86C 3JSCA 2GQVA 4YTLA 5GAN6 2EJGA 2ZPEB 4Q5WA 2RJEA 5HK0A 3OYCA 3OYAA 2PUOB 3I55T 4HKEA 4Y28E 5HY6A 3OA6A 4XTVA 1VQLA 4HT9A 4A4HA 4FU6A 4Z6YA 4M78F 1Q7YC 2DEQA 4M78C 3L1AA 1VQ9A 4EDUA 1N8RU 2DIGA 4KBMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DD4 B;  2ZPH B;  3X20 B;  2ZCF B;  4OB3 B;  2DXB A;  1QP2 A;  3X24 B;  4RKU E;  3QZ5 B;  3X28 B;  3X26 B;  1DJ7 B;  2PVD B;  4OB0 B;  1UGR B;  1AHJ B;  4XK8 E;  4ZGD B;  2DXC A;  1V29 B;  3A8H B;  2CYZ B;  3LW5 E;  2D0Q B;  2ZPI B;  3A8L B;  2ZZD B;  1UGQ B;  3A8O B;  2PU9 B;  1QP3 A;  2PVO B;  3WVE B;  2ZPG B;  2DXC B;  5L8R E;  3WVD B;  4ZGJ B;  2DPP B;  3QYG B;  2DD4 A;  1UGS B;  3QXE B;  1IRE B;  2CZ6 B;  3VYH B;  4ZGE B;  2ZZD A;  2WSE E;  2O01 E;  1PSF A;  3QYH B;  2DD5 B;  1PSE A;  1GXI E;  2CZ7 B;  2WSF E;  3QZ9 B;  3VYG A;  2CZ0 B;  4FM4 B;  2AHJ B;  2QDY B;  3HHT B;  4L6V 5;  2PVG B;  3A8M B;  2ZPB B;  1UGP B;  4OB2 B;  2WSC E;  4OB1 B;  3VYG B;  3X25 B;  4KT0 E;  2PUK B;  2DXB B;  2ZPE B;  2CZ1 B;  1JB0 E;  2PUO B;  2ZPF B;  4Y28 E;  2DD5 A;  3A8G B; 
#chains in the Genus database with same CATH topology
 1E7P A;  3THK A;  5D6X A;  2F5K A;  4CFM B;  1F5Q B;  4AG2 C;  4EMG A;  5IDP B;  3OW2 S;  2VYT A;  4FSS A;  1Y7X A;  2VGN A;  1HK9 A;  3BW1 A;  4M75 G;  1OI9 B;  2ZGW A;  4PJO A;  3H8Z A;  5DLO A;  1KIK A;  4CFU B;  2VC8 A;  3QDF A;  2R7G A;  1M27 C;  2MAM A;  2C5O B;  4XU1 A;  2DFU A;  2BIV A;  3JCM d;  3CEY A;  1YI2 A;  1W70 A;  2P0Q A;  4F7U A;  1VQL Q;  2EIF A;  2RHU A;  5GMK e;  2C6T B;  1RLQ C;  1WI7 A;  2DZ9 A;  1SG5 A;  2EJ9 A;  2VUB A;  3VS4 A;  1S72 Q;  1KC8 U;  2K5F A;  2W10 A;  4E7H A;  4DOV A;  4QVZ A;  2LCS A;  4C0D B;  3OYD A;  1OZ3 A;  5KYU A;  2M16 A;  2DER A;  2RO0 A;  3INZ A;  1VA7 A;  4HCC A;  2IG0 A;  4FW2 A;  2BZY A;  1PKT A;  1GH6 B;  3EG9 A;  4BY6 B;  1UDL A;  2DLP A;  4MZM A;  4PLI A;  3P8B B;  3LH5 A;  4OP0 A;  4M78 G;  1FXX A;  2OJ2 A;  4WF2 A;  5KYW B;  3BG9 A;  2F2C A;  3CBM A;  1ZHI A;  5LL6 S;  1VQ4 A;  1D1B A;  2X51 A;  1N4M A;  1VQO T;  4BY6 C;  2LTO A;  2V22 B;  3EG3 A;  3BFM A;  3OYB A;  3OYY A;  3SWN A;  3GP8 A;  4BCN B;  2L3R A;  3G6E Q;  4PJM A;  3CCJ T;  3JCM f;  2RA2 A;  4M7D F;  3EFO B;  3MY1 B;  3H0F A;  1D1A A;  1W6X A;  3C12 A;  1ZQ1 A;  2EGC A;  1O9S A;  1TUC A;  3PVQ A;  2PK9 B;  1VUB A;  1VQO Q;  2ZPF B;  3EHR A;  2KYB A;  3CCQ A;  5HBE B;  2RK2 A;  2E5K A;  4M7A D;  4BE0 A;  3B57 A;  2X4Y A;  1QCN A;  1QVG P;  3DLM A;  4BCO B;  4M78 B;  3O5Z A;  1B3Q A;  3VRZ A;  3M03 A;  1NZ9 A;  5IXB A;  3LQ5 B;  1RI0 A;  4ZNX A;  5FWC A;  3HRT A;  3CMA Q;  2RQW A;  2LQW A;  2DXU A;  3NGP A;  2D8H A;  2OTJ T;  4ZGD B;  1QLY A;  3E1S A;  5DLQ E;  4DBR A;  3PIP A;  1ZLM A;  2YUO A;  4A4G A;  4D8D A;  5LJ3 e;  1G3S A;  1SF9 A;  2K4Y A;  4ELZ C;  5DQW A;  2PU9 B;  2JMA A;  3OBW A;  2ZPG B;  4BCH B;  4N0A C;  4QVC A;  4F7S B;  3WVD B;  1VQP Q;  3EGD B;  1FYN A;  1AT1 B;  2K5I A;  2HAX A;  3MO8 A;  3S3O A;  4C8Q E;  1JEG A;  2G9X B;  5GAN 2;  2M9U A;  1H24 B;  2ZZD A;  1IXD A;  2K5L A;  1UHC A;  3BE3 A;  1WHJ A;  1ZUK A;  3F70 A;  3CME T;  4AG1 C;  3QSU A;  2LT1 A;  3QO3 A;  1HXD A;  3CCL Q;  4JDS A;  3G7Z A;  3TW6 A;  2HBW A;  4F7L B;  4KUL A;  5GAM g;  3FJ5 A;  1OKW B;  4J7I A;  2IW6 B;  3JB9 I;  4OMO A;  5GAO n;  4BI3 A;  2MWO A;  2DTH A;  1SPK A;  4UN0 A;  3HHT B;  3M0U A;  3I55 A;  2SRC A;  2EBP A;  2PVG B;  1K73 U;  1MV3 A;  1G8X A;  1K8A R;  4DEY A;  1H92 A;  2MWP A;  1KD1 U;  2VKN A;  1JXM A;  3VV0 A;  3C0C A;  3UA6 A;  4OMF B;  5GMK m;  3LWH A;  2JN0 A;  3OYI A;  3RKY A;  5D7U A;  1KFZ A;  4CC3 A;  4JJN K;  4PJO B;  4BCQ D;  4E2F B;  2YT6 A;  1TU0 B;  4EOP B;  1G3Y A;  2IW9 B;  4MDX A;  2KRN A;  1WNL A;  4FYY B;  4E7I A;  4AFQ C;  3JCM J;  4DQ2 A;  5LJ5 j;  1LVK A;  2D1X A;  2YRV A;  4F14 A;  1KQS A;  3X26 B;  3PT9 A;  1WA7 A;  3MP6 A;  2PVD B;  3M59 A;  4J5Y A;  1M3A A;  2JTE A;  4F7U B;  3RIR A;  4BUG A;  5KYN A;  1URC B;  4QQG A;  1TUG B;  2HKQ B;  1UNH D;  3HFN A;  4JRP A;  1M2O A;  4XK8 E;  1AZG B;  3A8H B;  3G33 B;  3M54 A;  1VQ4 Q;  4AKH A;  4V2S A;  2ZZD B;  2QDL A;  1VQN Q;  4JS4 A;  2EJF A;  3EGX B;  1RAH B;  3S3M A;  4OML A;  2QXF A;  2GGR A;  4G6L B;  1C6V X;  1NM7 A;  1VYU A;  2BS2 A;  1CSK A;  4OGR B;  2JT4 A;  1MNE A;  2KAF A;  1OYX A;  1H26 B;  4HCK A;  2KRS A;  4BI4 A;  1VQO A;  2LC4 A;  2RHI A;  4JPB W;  2K2M A;  4M77 A;  4AI6 A;  1V1C A;  5LMK B;  2DL4 A;  2WSF E;  2WJ9 A;  2HQE A;  5CO7 A;  2EUF A;  1K73 C;  2LJ1 A;  4J83 A;  2E65 A;  3A98 A;  3JCM V;  3CCJ A;  3VYG A;  1NEB A;  2QGF B;  4BCI B;  4Z02 A;  4F16 A;  2XHC A;  5GAO r;  2QTX A;  3FEO A;  1GBR A;  2X3W D;  5A0D A;  3LLR A;  3G6E T;  4R56 A;  3N5B B;  1X6G A;  3EFR A;  5GJW B;  5A0G A;  2CJM B;  1K0S A;  4MFE A;  2BS4 A;  1Q7Y U;  4KRD B;  1WJS A;  1ACM B;  2CSI A;  2P0K A;  3JCM b;  3REB B;  4C92 B;  3V7C A;  5HNB B;  1JO8 A;  3EFO A;  4FSX A;  1PC0 A;  2EPD A;  2R58 A;  2CP5 A;  2ZPH B;  2GNC A;  2ZCF B;  2FZC B;  1SHF A;  2OTJ A;  2DYB A;  4Y72 B;  5GAM f;  1I4K 1;  2E4H A;  9ATC B;  4RKU E;  3SFM A;  3CCQ T;  1YJ9 T;  3VKG A;  3H41 A;  4F7J B;  2BS3 A;  4QVD A;  1HJD A;  3M55 A;  2FRY A;  2VAS A;  5GMK h;  4IMY B;  3G71 T;  2KQW A;  3CD6 Q;  3CC4 A;  2VXF A;  4M7A E;  3HRU A;  1OGU B;  3QPH A;  5I22 A;  3LW5 E;  2QFZ A;  3EID B;  5CKD A;  2IPO B;  2F2X A;  5IDN B;  1YWO A;  3H4C A;  4ZN3 A;  1QP3 A;  1Q86 U;  2FZK B;  1JSU B;  1NLP C;  3QDR B;  4RTX A;  1VIN A;  3ME9 A;  1M1K R;  3OS5 A;  1OKV B;  5HQ0 B;  2VXE A;  2KGT A;  2Y90 A;  1OL2 B;  3L2V A;  1OPL A;  3UAT A;  2HQH A;  1M90 C;  1BB9 A;  5FRO A;  2ROL A;  1IRE B;  3RMQ A;  3S6W A;  1NPR A;  3NPF A;  3JCM e;  2DL7 A;  4IIM A;  2W99 A;  2W9F A;  4PFP A;  1Y57 A;  4J8O A;  1YJ9 Q;  4BD3 A;  1MUZ A;  1YJW T;  3UT1 A;  5AT1 B;  1Y0M A;  1M2V A;  2QG9 B;  3RMS A;  1D3B B;  1QCO A;  5IF1 B;  3TRE A;  1K1Z A;  5I11 A;  2RQU A;  1YCS B;  2YUQ A;  2J6F A;  5KYY A;  5J26 A;  4J9G A;  3CQT A;  2I53 A;  1X27 A;  2QTV A;  1PCX A;  1O9K B;  3CCE Q;  1JST B;  5KYU B;  4NST B;  2V26 A;  1G83 A;  5HK0 A;  2RMO A;  4YTL A;  2EJG A;  4Q5W A;  3I55 T;  1K73 R;  1TXQ A;  3OA6 A;  1VQL A;  4XTV A;  1G3N C;  1PKS A;  4M78 F;  1VQ9 A;  1AD6 A;  2WMA B;  1Q82 R;  2DIG A;  4BCF B;  2CCI B;  4M6V A;  1KC8 R;  4A4K A;  5FU7 C;  2QGS A;  1JXO A;  1OQK A;  1YIJ T;  3MI9 B;  2AKL A;  3EFS A;  4EPC A;  2WEV B;  1UEC A;  2CP6 A;  1VYT A;  5LJ3 h;  3M58 A;  2QA4 A;  5EFQ B;  5D6Y A;  5GAM j;  2B9R A;  3I5R A;  5GAN 5;  3EGX A;  2KEA A;  4L5G A;  4N4G A;  3CCV A;  5HCK A;  2DJZ A;  1W1F A;  2DL3 A;  4OVA A;  3L2W A;  2JTF A;  1UHF A;  1KG1 A;  1VQ8 A;  5GAN g;  1LOJ A;  3MEU A;  2DBK A;  2DIL A;  2NUZ A;  1RAB B;  2EQJ A;  3VU3 C;  2GQI A;  1NJI U;  1FVV B;  1K8A U;  2C06 A;  2KRO A;  3OYL A;  1VQ4 T;  2DXC B;  1M2V B;  1X6B A;  3CBO A;  4BDZ A;  1SRL A;  1M8V A;  2QQ9 A;  3KUF A;  3ZFJ A;  4AFS C;  1Q86 R;  3HO8 A;  3RBB B;  2G3R A;  2EAY A;  2EGA A;  5IT9 E;  4JX5 A;  1SHG A;  5GAN 4;  3GPL A;  1YIT A;  4YC3 B;  2M0Y A;  4IUT A;  1MND A;  2LNH B;  2B86 A;  1GXI E;  3MIA B;  4LDU A;  1X2Q A;  5FRN A;  4ELL A;  3OYN A;  1WYX A;  2HSP A;  3QJY A;  4ANJ A;  3CCM T;  4P5N A;  3M0Q A;  3TW7 A;  4JS5 A;  3H0H A;  2RQV A;  4F70 B;  2X4W A;  4LD6 A;  3DLL A;  1I1J A;  4J7F A;  4HNU A;  4C0Z A;  3SWN B;  1S72 A;  2OX7 A;  3VYG B;  4LDY A;  2WPA B;  4EC8 B;  1M3B A;  3HBL A;  4XU0 A;  1I5L A;  1K9M U;  8AT1 B;  2EKH A;  4E7J A;  1WJR A;  2EKO A;  2O9V A;  4ESR A;  2EYY A;  3ER0 A;  3SB2 A;  4KH1 B;  4GBQ A;  3MEA A;  4NL2 A;  1VQP A;  4OB3 B;  1Q7Y R;  1R77 A;  3I5S A;  1NE8 A;  3X24 B;  5IHK A;  1X69 A;  4OF1 A;  1EFN A;  3HZJ A;  2FG0 A;  3VS0 A;  1LCK A;  2HCK A;  2XID A;  2KK4 A;  2DL8 A;  3QBY A;  3OYH A;  2CP7 A;  1OOT A;  4UC4 A;  3L2U A;  3REA B;  1BI2 A;  4WCI A;  1VQ5 T;  3HP9 A;  2EFI A;  2QQR A;  2OTL Q;  5GAN j;  2EW3 A;  1QWE A;  4F7U E;  1UGQ B;  4LNP A;  5C6S A;  4MIM A;  2RHZ A;  5LJ5 h;  4II1 A;  2LDM A;  1RI9 A;  4X1V A;  1Q81 U;  4F17 A;  2C5V B;  4JJC A;  1CKB A;  4R55 A;  4M75 E;  1VIE A;  2LCC A;  4PJO E;  4HVV A;  4LD9 K;  3LGF A;  3EGU A;  2I2L A;  4PL6 A;  1WZO A;  2JZ2 A;  3TVT A;  2C0T A;  4M75 C;  1FMW A;  2H3E B;  1PWT A;  1M1K U;  3HPW A;  4EOS B;  1RAA B;  1N8R R;  3UF4 A;  2AKK A;  2H8H A;  3JCM W;  4BBR M;  4PJN A;  1Z9Q A;  4LE9 A;  2GTO A;  2L8D A;  3RKW A;  3AHU A;  1OI1 A;  1G5V A;  2QDJ A;  4XQ3 A;  1KQ2 A;  1GCP A;  2XK0 A;  4CI0 C;  4M75 B;  2VB6 A;  2ED1 A;  3MP8 A;  3O8V A;  2KYM A;  2D9T A;  2NWM A;  2V1Q A;  2DK3 A;  2DYI A;  2RNA A;  3HB9 A;  1TFB A;  4DBH A;  1NPP A;  4F6U B;  2UZD B;  3QYB A;  2HL5 C;  1Q81 C;  1D0Z A;  3BLH B;  4BE2 A;  3SD4 A;  2HEQ A;  3CCE T;  2CGH A;  4BCM B;  2PUK B;  1OU9 A;  4NL3 A;  1K76 A;  1GUX B;  1UNG D;  4BCP B;  1K9A A;  5CIU A;  3PTA A;  4IUR A;  4KBM B;  3P8H A;  4Y92 A;  4OMM A;  1H3Z A;  1H27 B;  2DD4 B;  4F7U F;  1BCO A;  4CXA B;  4RG8 A;  5LJ3 f;  4FT2 A;  1QP2 A;  1W98 B;  2HL3 A;  3C4S A;  1HSQ A;  2FPD A;  4DBQ A;  3CBP A;  2IW8 B;  3X28 B;  1X2K A;  2QF7 A;  3MPU B;  4EOI B;  3R6N A;  2BKZ B;  4M75 F;  1RUW A;  1U1T A;  1M90 U;  3EH2 A;  1M30 A;  5CQX A;  5IHN A;  4QQD A;  2UUE B;  2K79 A;  3CCM Q;  3VUZ A;  1NYG A;  3A1P A;  4EOJ B;  2D0Q B;  4TTH A;  2KDS A;  2YSQ A;  4CC7 A;  2PK2 A;  2DNU A;  3GLX A;  1UTI A;  3DB3 A;  2COY A;  1QMZ B;  2QQB A;  3JCM h;  4ELJ A;  5IHI A;  3EG1 A;  3OYM A;  3DL1 A;  4RCC A;  2M02 A;  2DO3 A;  1B34 A;  4PJO D;  4KGZ B;  1WHM A;  1H8K A;  5GAO l;  3DOG B;  2LQN A;  2X35 A;  2C5N B;  3CC2 A;  2CZ6 B;  1WX6 A;  1WIE A;  2CSQ A;  2YDL A;  3JCM g;  1K8A C;  1TH7 A;  4OGE A;  3QYH B;  2LX9 A;  2FRW A;  4FYW B;  1OIU B;  2LQ8 A;  3CXC S;  3BY7 A;  2W96 A;  2E41 A;  1JKW A;  1M9S A;  2VV5 A;  2OTJ Q;  2BZX A;  2PNI A;  2DXT A;  3IQL A;  3CMA T;  4XU2 A;  4CRL B;  3C94 A;  3CC2 Q;  5IH2 A;  4EMK B;  1FIN B;  3GOX A;  1WQ7 A;  2F5T X;  1H4L D;  4KUD K;  2CP2 A;  1BCM A;  1YNZ A;  4EOO B;  1N8R C;  1VQK Q;  1UG1 A;  2E5Q A;  1I81 A;  1UGP B;  1IRX A;  1W4S A;  1Q82 C;  3CD6 A;  4FW1 A;  1R8O B;  2RI2 A;  3M4Y A;  3SWN C;  1OUL A;  2YUN A;  4L59 A;  6AT1 B;  3PMT A;  2DA9 A;  1W2B S;  1IGU A;  5CYI B;  5GMK l;  4RMO A;  1GL5 A;  2DJQ A;  1YWP A;  2FYK A;  3I35 A;  1BYM A;  3TNI B;  5FRM A;  1IGQ A;  4KGX B;  4DEX A;  4M7A A;  4KH0 B;  3BDL A;  1B07 A;  2GBQ A;  3URG A;  3CCJ Q;  4C0F A;  2QQ8 A;  2L2P A;  3QZ5 B;  3CC7 T;  2P84 A;  2DTI A;  3QII A;  2JS0 A;  4M7D A;  2WIH B;  2WXV B;  1PM3 A;  5CKE A;  2YLC A;  1A0N B;  3MJX A;  3WXM B;  1VQP T;  1QQJ A;  2K9G A;  3M9Q A;  1O9K A;  2LVM A;  3TCJ A;  2RN8 A;  2IN3 A;  3G71 Q;  1H25 B;  3EH1 A;  1FWZ A;  2KMT A;  2C5X B;  1WLP B;  5GAN 7;  2R57 A;  1QMC A;  3CCQ Q;  2DTO A;  1QLB A;  3CMA A;  5HKC A;  3WVE B;  5CKH A;  1IHV A;  2YWW A;  2ATC B;  1VQN T;  5I2S A;  1M1K C;  2A7Y A;  3QYG B;  2CH4 W;  4CRI A;  5GMK i;  3QXE B;  2RPN A;  1JBM A;  3R6O A;  3CCR Q;  1YP5 A;  1E6G A;  1WPY A;  3CPW S;  2NUT A;  2O2O A;  5GAN h;  4C8Q G;  2AIR B;  4IIO A;  2O9S A;  4PJO G;  4BB7 A;  1PSE A;  3NTI A;  1OPK A;  2EQI A;  3NHN A;  4NOY A;  2HZY A;  4M78 A;  2KSS A;  4M7D D;  1Q82 U;  1X43 A;  1WFW A;  3JCM P;  4FT4 A;  3A5Z B;  4PLL A;  1UE9 A;  4Y91 A;  5KYX B;  5CR2 A;  2K2V A;  1ZBX A;  3CCS A;  1VQ6 T;  2XG8 D;  4N0A A;  4Z88 A;  2AHJ B;  3ZEH A;  3PE0 A;  2CT3 A;  4M7A C;  3NFC A;  2XD0 A;  2QA4 Q;  1S1N A;  4RTY A;  3O0G D;  2WAC A;  2MMP A;  1XTD A;  2AZS A;  4O6J A;  3CCU A;  3A8M B;  2KBT A;  5C0M A;  2EVR A;  3I9Q A;  5CKB A;  4OB2 B;  3J7A F;  1TS9 A;  3G4S T;  2QQS A;  2D8J A;  1VQ7 A;  3V8L A;  3KHI A;  2FPE A;  3JSC A;  5GAN 6;  2PUO B;  4Y28 E;  4HT9 A;  1TWB A;  2ABL A;  4A4H A;  1Q7Y C;  1KK7 A;  4Z89 A;  3CCM A;  2E1H A;  2HMA A;  4MFD A;  3HL8 A;  3CCL T;  4BAC A;  3BLQ B;  5LJ3 j;  4OMQ A;  4DA4 A;  5HBJ B;  1LJO A;  3QWL A;  3M56 A;  2YRC A;  2RH2 A;  3OW2 A;  1YJN T;  2K6D A;  4FIB A;  5GAM h;  2DZC A;  3CME Q;  1VQ7 Q;  2H3J A;  1EIF A;  2KRM A;  2PQW A;  3G4S A;  4LDX A;  2HKN A;  1DJ7 B;  1NJI C;  2BZ8 A;  5LJ5 e;  3CPF A;  5I2M A;  2CKK A;  3HFO A;  3LH0 A;  3P8D A;  2DXC A;  3OS2 A;  1FX7 A;  4A63 B;  3TQ7 P;  4RTZ A;  1BI1 A;  3JAM E;  2A08 A;  1M8M A;  2LP5 A;  1BIB A;  2X1N B;  3M0R A;  1X01 A;  2A37 A;  3EG0 A;  4PJO F;  5GAN d;  2XIC A;  2PTK A;  1SSH A;  3FIF A;  1TOV A;  4A53 A;  2JOY A;  4PJL A;  4EIK A;  3PGG A;  5AYF A;  4MML A;  1F1B B;  5CKF A;  3ZL7 C;  4E6R A;  1PHT A;  2LZ6 B;  1KHI A;  2L0A A;  2BPM B;  2DVE A;  1WHL A;  1M4Z A;  2CH4 A;  5HBH B;  4FCY A;  1LPL A;  1ZSZ A;  3VRY A;  1K9M R;  5CEI B;  3G6E A;  2NUP A;  3CCV Q;  4J9H A;  5IHY A;  2DET A;  4QW2 A;  3RR6 A;  5FLX E;  1YIJ Q;  4PJJ A;  1ABQ A;  3CC2 T;  1SKU B;  3DTO A;  4M77 F;  2WHB B;  1VOM A;  3LYI A;  4BE1 A;  3M0T A;  1GBQ A;  4XAX B;  1H1Q B;  4BCK B;  4DOW A;  2A28 A;  2W2H A;  2Y4X A;  4N4H A;  1PNJ A;  5FU7 B;  4ZTJ A;  5KCO A;  1VQM A;  1N9R A;  1R0C B;  2E10 A;  4J6W A;  3H6Z A;  1WHK A;  1X6O A;  1QCF A;  3NTK A;  4A54 A;  5GAN f;  5KE2 A;  2XI9 A;  1LNX A;  1M3C A;  4KT0 E;  1AIS B;  2CP0 A;  2LJ3 A;  5ECA A;  2J06 A;  4J6Y A;  1M90 R;  1D09 B;  4EC9 B;  2E3H A;  2FO0 A;  1ZSG A;  2RHY A;  3M5A A;  3DB4 A;  3A8G B;  5I5Z B;  4EOQ B;  3PFS A;  4C8Q F;  2MI6 A;  3GNG A;  2LW4 A;  5GAO p;  4M7D C;  3FDR A;  1C0M A;  2FEI A;  4JJB A;  1MMG A;  1XQH A;  3F5X B;  2KT1 A;  2UZB B;  4M77 B;  1XJW B;  4JZ3 A;  2EQM A;  4B9X A;  3VKI A;  2C4G B;  2NUP B;  2J6K A;  4LDW A;  2OAU A;  2O88 A;  1D0Y A;  1OX9 A;  1VIF A;  2CYZ B;  2O4X B;  3QHR B;  4HCZ A;  4RTT A;  2A0F B;  2JM8 A;  2A3L A;  3RUX A;  1SRM A;  1AEY A;  2YXY A;  1N5Z A;  2GFU A;  3QYE A;  4C92 E;  3EGD A;  1VQ5 Q;  2HNI A;  1YJW A;  2DD4 A;  4M7A G;  3EG2 A;  3LGL A;  1BU1 A;  1QVF S;  2JXB A;  2OTL T;  2O31 A;  4ATO A;  4J9B A;  4XTY A;  3NMZ C;  1H3H A;  3JB9 H;  2QEX A;  3SEM A;  2VGM A;  4XTX A;  3I55 Q;  1FMK A;  4M7D G;  3GBQ A;  3OSV A;  3BLR B;  2EYW A;  2DD5 B;  2CP3 A;  2RD1 A;  4M77 G;  2JVV A;  5J39 A;  3DDQ B;  1Y71 A;  3TNW B;  3RNJ A;  4C8Q C;  2JTM A;  5FU6 B;  2LQK A;  3QUI A;  2YHT A;  2XMF A;  4RG2 A;  3JRZ A;  4ROC A;  4M75 A;  1BU2 A;  2W0Z A;  1RLP C;  1M1G A;  2YLB A;  4I3Z B;  1QVG S;  3L2Z A;  4YOS A;  2JM9 A;  1ZUY A;  3CCL A;  3MHX A;  4MZT A;  4BBS M;  3X25 B;  4M7D E;  2JMC A;  1ABO A;  1QKX A;  4RTW A;  1U3O A;  3L42 A;  3G4S Q;  4JLI A;  2EGE A;  1YI2 Q;  3DDP B;  3ZBD A;  2ESW A;  2EYQ A;  4BY7 X;  3UDC A;  2DRK A;  1K9M C;  4EMK C;  1ARK A;  1PG5 B;  1RL2 A;  1X75 C;  2E64 A;  4IUU A;  3AT1 B;  4LN2 A;  2BE9 B;  4WTO B;  4D8K A;  2P4T A;  4E7Z A;  1BK2 A;  1BI0 A;  5EG2 A;  3NTH A;  4OB0 B;  1QKW A;  1QVP A;  3QWY A;  4ORZ A;  4CFU D;  1AHJ B;  5HK3 A;  1Z9Z A;  1KD1 C;  1YIJ A;  1KQS P;  2FPF A;  2HDA A;  3ULR B;  4E7L A;  1KXU A;  2B8A A;  4AFZ C;  2F69 A;  2Z0W A;  5A2Q E;  1YJN A;  3A8L B;  3PMI A;  4M75 D;  3C95 A;  1GRI A;  1OEB A;  5GAN 8;  1VQ9 Q;  2R5A A;  3JB9 F;  4C5I A;  2RJC A;  4GY5 A;  2X9H A;  2HBP A;  1GCQ C;  4C92 D;  1MMN A;  2M51 A;  1PKD B;  1T0H A;  4M4Z A;  4ZGE B;  2EYX A;  1D0X A;  1EZZ B;  2O01 E;  4XTU A;  3V7S A;  5LJ3 g;  1OV3 A;  4OR5 B;  3EG9 B;  2BKD N;  3BHT B;  1VQM Q;  2J6O A;  2R5M A;  4YOZ A;  2KVQ G;  4X9D A;  3MY5 B;  3OYG A;  3M4G A;  3RER A;  2GF7 A;  2RHX A;  4FL6 A;  1G2B A;  3FC3 A;  4C5G A;  4J9E A;  3BG5 A;  1UUE A;  2LNV A;  5GAN e;  2HD0 A;  4C8Q B;  1XOV A;  2NUT B;  3OW2 P;  2ECZ A;  1VQ6 Q;  3LWI A;  1AWO A;  1JJ2 A;  5IAY A;  5LJ5 g;  1XO2 A;  2ZPB B;  2WSC E;  2COZ A;  4F6S B;  1CKA A;  5ICP B;  1GFC A;  2DBM A;  2JS2 A;  1AZE A;  2CRE A;  2E70 A;  5LJ5 d;  5DM7 R;  3BDU A;  3G71 A;  5GAM e;  1RAG B;  1D1C A;  2A36 A;  3I56 A;  1W2B P;  4C92 A;  4OMN A;  2M1H A;  4QSH A;  3OS1 A;  4J9F A;  2ED0 A;  2V1R A;  1VQ5 A;  3KXT A;  4NS5 A;  2W9Z A;  1SEM A;  2DXB A;  3CPW P;  4JZ4 A;  1VYW B;  3CCR A;  3JB9 G;  2GTJ A;  2LX7 A;  1FMV A;  5J3B A;  3UA7 A;  2QEX Q;  4PJO C;  4EMH A;  4M77 D;  1Q81 R;  2C0O A;  2RJF A;  3T9N A;  1VQK A;  2E3I A;  3I56 T;  4ME7 A;  2K7A A;  2KT8 A;  2P0P A;  1UNL D;  3OYJ A;  3EAE A;  1VQL T;  4HL4 A;  1D3U B;  4KRC B;  3KBG A;  1K4U S;  2QI2 A;  3A8O B;  3U23 A;  2DRM A;  2RF0 A;  1MGQ A;  2L3Q A;  4JRI A;  4F7U G;  3CC7 Q;  1N6A A;  4X9C A;  5IXF A;  4J9I A;  1U06 A;  5L8R E;  2O4X A;  3PIO A;  4ZGJ B;  4B6M A;  1V76 A;  1H64 1;  1O75 A;  2J7I A;  2D0N A;  1H1R B;  4BCQ B;  1I8F A;  2G77 A;  2WMB B;  2GFA A;  2CDT A;  2MK5 A;  1KQS S;  2DX1 A;  4HT8 A;  3HTR A;  2XDB A;  1NEG A;  2FZG B;  2SEM A;  1VQ7 T;  2IVW A;  2COW A;  3VS3 A;  2QYZ A;  3VS1 A;  3CCE A;  2OTL A;  3TSZ A;  5FW9 A;  2CZ0 B;  4EOL B;  1UJY A;  4C5E A;  3VS5 A;  1AVZ C;  3CME A;  3L2Q A;  1AWX A;  1C1A A;  3DJB A;  1B7T A;  1YN8 A;  5LJ3 d;  2MF2 A;  2WIP B;  1T3S A;  1H1S B;  4KRT A;  2QQA A;  4XU3 A;  4CC2 A;  4DBF A;  1OU8 A;  3RDV A;  4CC4 B;  4B9W A;  2OAW A;  2KMG A;  1YJ9 A;  2HSE B;  2X4J A;  2G6F X;  4EOR B;  5KH6 A;  3ASK A;  3JB9 J;  1UFF A;  3QWX X;  4XTW A;  1MMD A;  4J9D A;  4C5H A;  2QA4 T;  3OS0 A;  4NC6 A;  1TSF A;  3D7S B;  3QG1 A;  3FB9 A;  5HVY B;  2XDD A;  1QVG A;  2DVJ A;  1JU5 C;  1J3T A;  4F7N B;  2RJE A;  1ZP2 A;  4FU6 A;  5ACB A;  5FGK B;  4JJD A;  5LQF B;  4LUD A;  4M78 C;  2CT4 A;  4EDU A;  2YUP A;  4O5V A;  2K57 A;  4E7K A;  1YI2 T;  3MET A;  1M5Q 1;  2X3X D;  2UZL B;  4QQ6 A;  4PFZ A;  2QAZ A;  3M57 A;  3BG3 A;  1QWF A;  3QHS A;  1VQM T;  4IUP A;  4HNT A;  4C92 G;  5KCH A;  3CXC P;  4ZTF A;  1P92 A;  1WHH A;  2FVU A;  1Y96 A;  1NJI R;  3GTM S;  5FU6 C;  4ZN1 A;  3L2R A;  1V29 B;  4J9C A;  3H0I A;  2RI3 A;  5GAN 3;  1VQ9 T;  1NLO C;  1KD1 R;  1OIY B;  1PRM C;  4C0G A;  1FKM A;  4MDW A;  3M53 A;  4PK4 A;  5GJV B;  4F6W B;  1KQ1 A;  4BY1 X;  2PVO B;  1VQ6 A;  3RGF B;  2X4X A;  5CK9 A;  1BBZ A;  1MMA A;  4M78 E;  1UGS B;  3KFV A;  2L3S A;  1E9H B;  3MKD A;  1VQ8 Q;  3DKM A;  1NYF A;  1YHQ T;  2V8I A;  1OX8 A;  2F2V A;  2EWN A;  4AKI A;  3SHW A;  4MZP A;  2I40 B;  1YBY A;  4IUV A;  2L3P A;  1PSF A;  4X34 A;  1WHG A;  2L89 A;  3S3N A;  3MEW A;  4ROE A;  3PNW C;  2ZAE A;  1Q95 G;  4C8Q D;  4HVU A;  4A4E A;  3EOC B;  3VUB A;  4C92 C;  3JCM X;  2NLU A;  1BI3 A;  4MMK A;  3CD6 T;  3QZ9 B;  4XTZ A;  1I07 A;  2FB7 A;  5DY9 A;  2K3Y A;  4QT7 A;  4JLG A;  4FM4 B;  4RTV A;  2YRD A;  2PHG A;  5I21 A;  1VYV A;  4L6V 5;  4FYV B;  2I0N A;  2AT1 B;  3OB9 A;  1ZA2 B;  3CCV T;  1MHN A;  2KY9 A;  2NYS A;  2MYS A;  4RCB A;  3RKX A;  4BI8 B;  1T0J A;  2JUF A;  1JB0 E;  4BCJ B;  2LCL A;  3CC7 A;  3TN8 B;  1UB4 A;  3CC4 Q;  3X20 B;  2LMJ A;  1YJW Q;  2IIM A;  1AOJ A;  1NBE B;  1K0X A;  1D3B A;  1KSW A;  1S72 T;  1WGS A;  4PKC C;  1TUD A;  3VJP A;  5GMK j;  2QGG A;  3VKH A;  1WXU A;  5KYY B;  4PNO A;  4GLK A;  2HQX A;  2CUD A;  4CFX B;  1ZX6 A;  3PO3 S;  1T3L A;  2DF6 A;  3TNH B;  4RUG A;  1U1S A;  3OYK A;  3CCR T;  3Q1J A;  2AK5 A;  3HSB A;  2J05 A;  2CS7 A;  4JX6 A;  5A0L A;  4K11 A;  1PD1 A;  1G3T A;  4JRK A;  1OL1 B;  3FJP A;  4Z8A A;  3CC4 T;  3UWN A;  3V8J A;  4AT1 B;  5GAM d;  5DQV A;  1RAI B;  3VS6 A;  1YCY A;  3FLG A;  1GY3 B;  1JQQ A;  4GLM A;  5BNJ B;  3OQ5 A;  1JJ2 P;  3OMC A;  1WXB A;  1AWW A;  3OBY A;  1RAC B;  3VYH B;  2EYZ A;  4BXX X;  4RTU A;  3VS7 A;  4C0D C;  2IVX A;  2MCN A;  5M9O A;  3CCS T;  3K7A M;  1P5E B;  4M78 D;  4HCB A;  3J80 E;  2JJ9 A;  1IB8 A;  1HYO A;  4HA8 A;  1W2B A;  2K3X A;  4LXC A;  3CCU T;  2LT4 A;  4EOK B;  4VUB A;  2L5Q A;  2MIO A;  4HLQ A;  1VOL A;  4ROD A;  1PRL C;  1WQW A;  3MEV A;  5CCA A;  2EQU A;  3GF5 A;  3CPW A;  2E6N A;  3E9G A;  3V7R A;  4EON B;  1WJQ A;  4OGC A;  2KNB B;  1ZBJ A;  3G1J A;  1RAF B;  2RK1 A;  1IZ6 A;  3CXC A;  1ENW A;  2DME A;  2MOX A;  1Y07 A;  5FWB A;  1U8R A;  1YJN Q;  2BUD A;  4CFW B;  2CZ1 B;  2CUB A;  4N4I A;  1I0C A;  2QAS A;  4C8Q A;  3BHV B;  2KXC A;  1ZSZ B;  4ELY C;  3OY9 A;  1AD5 A;  4HNV A;  2RQT A;  3CCU Q;  2ENM A;  3GIB A;  2VVK A;  1EX4 A;  2DIQ A;  1SSF A;  1U5S A;  3TU4 K;  3CCS Q;  1JJ2 S;  1GCQ A;  1UGV A;  1HD3 A;  3E9F A;  3H9N A;  4BDY A;  1WDX A;  1ZA1 B;  2RJD A;  1QVF P;  2K3B A;  3GNF B;  1I5O B;  4FYX B;  3BHU B;  2KR6 A;  2RI5 A;  1KHC A;  5CAI A;  1M1F A;  4M77 C;  1H1P B;  3PVL A;  2XKO C;  2F1L A;  3LX7 A;  1YHQ A;  1N9S A;  1N27 A;  2PMI B;  1H28 B;  4LDV A;  3OYF A;  5L2W B;  1YIT Q;  1OZ2 A;  5GAO m;  4J6X A;  1YIT T;  2DEU A;  1VQ8 T;  4A4F A;  3VS2 A;  4KUI A;  4QKU A;  1YHQ Q;  1RAE B;  3J81 E;  2WFY B;  2MPX C;  1KC8 C;  2RB6 A;  3I56 Q;  2JGZ B;  2F2W A;  2WSE E;  5GAO q;  1BIA A;  4LOC A;  4AKG A;  4EMK A;  1TG0 A;  3HRS A;  5EC7 A;  4E47 A;  2EQK A;  3POM A;  1TD6 A;  4HVW A;  2FL7 A;  2CCH B;  4CFN B;  3QJ6 A;  5EJC A;  1BKB A;  1TTH B;  2KI7 A;  2PJQ A;  2BE7 D;  4AFU C;  3OYE A;  2QDY B;  1YFN A;  4M77 E;  1VQN A;  2D6F A;  1E7O A;  2DAQ A;  1NG2 A;  2RM4 A;  4C92 F;  4HXJ A;  5D6W A;  2RQR A;  4LUE A;  4IKF A;  2DXB B;  1IO6 A;  1AWJ A;  2ROT A;  1MV0 B;  2KR3 A;  1GFD A;  2QK0 A;  3TEE A;  1XNI A;  1RAD B;  2VWF A;  3FRN A;  2XDP A;  4M7A B;  2DD5 A;  2DE0 X;  5LJ5 f;  2XU8 A;  4D6W A;  1R0B G;  3OSS C;  4KGV B;  2V8K A;  3MCA B;  5L23 A;  4JX4 A;  4F04 B;  4AMC A;  4M7D B;  2LRQ A;  2FHD A;  8ATC B;  4II5 B;  3E19 A;  3QKJ A;  1KJW A;  2BTT A;  2GCX A;  4BCN D;  4JRQ A;  3UPU A;  1UGR B;  3E2U A;  4EOM B;  2KXD A;  4CFV B;  3RES A;  4IUQ A;  3OMG A;  1UEB A;  3MP1 A;  3M0P A;  3HKS A;  2V8J A;  4JUV A;  2ZPI B;  5CQY A;  2P4R A;  4R0K A;  2DL5 A;  4TVR A;  2QEX T;  2DMO A;  3QHW B;  2JW4 A;  2DPP B;  1QW1 A;  1QVF A;  4M7A F;  5IN1 A;  4BCM D;  1WXT A;  1C9B A;  7AT1 B;  5KYX A;  1E6H A;  3JCM Q;  1PD0 A;  3NDQ A;  2C0I A;  5CVI A;  1JRI A;  2DM1 A;  2E6Z A;  2CZ7 B;  1IHW A;  1Y96 B;  2Y4Y A;  1G3W A;  2UZE B;  2KE9 A;  2AZV A;  2E12 A;  4YOO A;  2DKG A;  3SDZ A;  4E7S A;  2JNG A;  5KE3 A;  2PZ1 A;  1B34 B;  1UJ0 A;  4OB1 B;  4OMP A;  5KYW A;  2OI3 A;  1VQK T;  3JB9 D;  3V8K A;  2LJ0 A;  3JCM c;  3JV3 A;  1JOW A;  2M0O A;  4FX3 B;  3EJ1 B;  1Q86 C;  1ZUU A;  2GQV A;  4BCG B;  2ZPE B;  4PFO A;  3M0S A;  3OYA A;  3TSW A;  3OYC A;  1GUX A;  4HKE A;  5HY6 A;  4Z6Y A;  3EHQ A;  2DEQ A;  3L1A A;  1N8R U;  1ZSZ C; 
#chains in the Genus database with same CATH homology
 1E7P A;  4O5V A;  2E1H A;  2F5K A;  5D6X A;  2K57 A;  4E7K A;  4MFD A;  4M6V A;  3HL8 A;  3CCL T;  4BAC A;  1YI2 T;  4A4K A;  3MET A;  5FU7 C;  4EMG A;  5LJ3 j;  4DA4 A;  3OW2 S;  1LJO A;  1M5Q 1;  3QWL A;  2VYT A;  3M56 A;  2RH2 A;  3OW2 A;  1YJN T;  1Y7X A;  2VGN A;  1YIJ T;  4QQ6 A;  4FIB A;  1HK9 A;  3EFS A;  5GAM h;  2DZC A;  3M57 A;  4EPC A;  2H3J A;  1EIF A;  3BG3 A;  2PQW A;  3G4S A;  4LDX A;  3QHS A;  3BW1 A;  4M75 G;  5LJ3 h;  1VQM T;  4IUP A;  4HNT A;  1DJ7 B;  3M58 A;  2ZGW A;  1NJI C;  4C92 G;  2QA4 A;  5D6Y A;  4PJO A;  5GAM j;  5KCH A;  5GAN 5;  5LJ5 e;  3CPF A;  3H8Z A;  5DLO A;  2VC8 A;  1P92 A;  2FVU A;  5I2M A;  4ZTF A;  4L5G A;  1Y96 A;  4N4G A;  2CKK A;  3HFO A;  3CCV A;  2DJZ A;  3LH0 A;  5FU6 C;  4OVA A;  4ZN1 A;  3L2W A;  3P8D A;  2DXC A;  3OS2 A;  1V29 B;  2JTF A;  3L2R A;  2MAM A;  1KG1 A;  2RI3 A;  1VQ8 A;  1FX7 A;  5GAN g;  4XU1 A;  5GAN 3;  1VQ9 T;  1BI1 A;  3JAM E;  1LOJ A;  1BIB A;  2BIV A;  3JCM d;  3CEY A;  3MEU A;  4C0G A;  1FKM A;  1X01 A;  3M53 A;  4MDW A;  4PJO F;  2EQJ A;  5GAN d;  3VU3 C;  1YI2 A;  2P0Q A;  2XIC A;  4F7U A;  2EIF A;  1KQ1 A;  5GAM g;  1NJI U;  3FIF A;  1K8A U;  2C06 A;  3OYL A;  2PVO B;  2RHU A;  5GMK e;  1VQ4 T;  1VQ6 A;  2X4X A;  4A53 A;  2VUB A;  2DXC B;  2DZ9 A;  2EJ9 A;  2JOY A;  5CK9 A;  1KC8 U;  3CBO A;  4F7U B;  2K5F A;  4BDZ A;  4M78 E;  4E7H A;  1M8V A;  4DOV A;  2QQ9 A;  3KUF A;  3ZFJ A;  4QVZ A;  3PGG A;  1UGS B;  5AYF A;  4MML A;  4C0D B;  5CKF A;  3OYD A;  1OZ3 A;  3DKM A;  2M16 A;  1YHQ T;  2V8I A;  2RO0 A;  1KHI A;  3HO8 A;  2DVE A;  3INZ A;  2EWN A;  4HCC A;  1M4Z A;  2IG0 A;  4AKI A;  2EAY A;  2G3R A;  5IT9 E;  4MZP A;  4JX5 A;  1YBY A;  5GAN 4;  4BY6 B;  3GPL A;  1YIT A;  4IUV A;  4MZM A;  1PSF A;  4X34 A;  4PLI A;  2L89 A;  3P8B B;  4IUT A;  1GXI E;  4OP0 A;  3G6E A;  3MEW A;  3S3N A;  4M78 G;  1FXX A;  3PNW C;  4LDU A;  4WF2 A;  4C92 C;  4C8Q D;  3BG9 A;  4A4E A;  3VUB A;  3JCM X;  5FRN A;  3CBM A;  3OYN A;  2NLU A;  1BI3 A;  4MMK A;  3QJY A;  4QW2 A;  5FLX E;  1ZHI A;  3CD6 T;  3QZ9 B;  3CCM T;  5LL6 S;  1VQ4 A;  4XTZ A;  3CC2 T;  4P5N A;  2FB7 A;  5DY9 A;  2K3Y A;  4M77 F;  3TW7 A;  4JS5 A;  1VQO T;  4JLG A;  3LYI A;  4BY6 C;  2LTO A;  4FM4 B;  4BE1 A;  4XAX B;  4DOW A;  2X4W A;  2Y4X A;  4LD6 A;  5I21 A;  3BFM A;  3OYB A;  4N4H A;  4J7F A;  3DLL A;  3OYY A;  4L6V 5;  3SWN A;  3GP8 A;  5FU7 B;  4ZTJ A;  5KCO A;  1VQM A;  4HNU A;  4C0Z A;  2L3R A;  1N9R A;  3SWN B;  1S72 A;  3CCJ T;  4M7D F;  3JCM f;  2RA2 A;  2E10 A;  4J6W A;  3H6Z A;  3VYG B;  1X6O A;  4LDY A;  3NTK A;  3OB9 A;  4A54 A;  3C12 A;  5GAN f;  3HBL A;  1ZQ1 A;  5KE2 A;  4XU0 A;  3CCV T;  2XI9 A;  1LNX A;  1O9S A;  4KT0 E;  1I5L A;  1MHN A;  2KY9 A;  4RCB A;  3RKX A;  4BI8 B;  4J6Y A;  1K9M U;  1VUB A;  4E7J A;  2JUF A;  1JB0 E;  1WJR A;  2ZPF B;  2EKO A;  2RHY A;  2LCL A;  3M5A A;  3CC7 A;  3CCQ A;  2RK2 A;  3DB4 A;  3A8G B;  4BE0 A;  4M7A D;  1UB4 A;  3ER0 A;  3SB2 A;  2X4Y A;  3X20 B;  3MEA A;  3PFS A;  4NL2 A;  3DLM A;  4OB3 B;  4C8Q F;  1VQP A;  2MI6 A;  4M78 B;  1NE8 A;  3GNG A;  1D3B A;  1NZ9 A;  3X24 B;  5GAO p;  1S72 T;  4M7D C;  1WGS A;  4OF1 A;  3FDR A;  4PKC C;  1XQH A;  1RI0 A;  3HZJ A;  3VJP A;  5GMK j;  3HRT A;  4M77 B;  3OYH A;  2XID A;  3VKH A;  2KK4 A;  3QBY A;  2EQM A;  4UC4 A;  4B9X A;  2DXU A;  3VKI A;  3L2U A;  4PNO A;  4GLK A;  2HQX A;  4LDW A;  2OAU A;  1BI2 A;  2OTJ T;  1VQ5 T;  4ZGD B;  3HP9 A;  3E1S A;  5DLQ E;  2EFI A;  2QQR A;  1VIF A;  2CYZ B;  2O4X B;  3PIP A;  5GAN j;  3OYK A;  4HCZ A;  1U1S A;  3CCR T;  2A3L A;  3RUX A;  4F7U E;  3Q1J A;  1UGQ B;  3HSB A;  4A4G A;  5LJ3 e;  1G3S A;  2CS7 A;  4JX6 A;  2K4Y A;  5A0L A;  1G3T A;  4JRK A;  4ELZ C;  5C6S A;  2PU9 B;  4MIM A;  2RHZ A;  5LJ5 h;  2GFU A;  4II1 A;  2LDM A;  3FJP A;  3OBW A;  3QYE A;  3CC4 T;  1Q81 U;  2ZPG B;  4N0A C;  3UWN A;  3V8J A;  4C92 E;  4QVC A;  5GAM d;  4R55 A;  2HNI A;  3WVD B;  2DD4 A;  4M75 E;  3LGL A;  1YJW A;  4M7A G;  1VIE A;  1YCY A;  3FLG A;  1QVF S;  2OTL T;  4ATO A;  2LCC A;  3OQ5 A;  4PJO E;  2K5I A;  2HAX A;  3OMC A;  3LGF A;  4LD9 K;  3MO8 A;  3S3O A;  4XTY A;  4C8Q E;  5GAN 2;  2I2L A;  2M9U A;  3OBY A;  4PL6 A;  2JZ2 A;  3VYH B;  4C0D C;  3JB9 H;  2ZZD A;  2QEX A;  5M9O A;  3CCS T;  2K5L A;  2VGM A;  4M75 C;  1M1K U;  3CME T;  3F70 A;  4XTX A;  3HPW A;  4HCB A;  4M78 D;  3J80 E;  4M7D G;  3OSV A;  4HA8 A;  3QSU A;  2LT1 A;  2DD5 B;  1W2B A;  2RD1 A;  3JCM W;  4M7D B;  4BBR M;  1HXD A;  3QO3 A;  4M77 G;  2K3X A;  4JDS A;  3G7Z A;  3TW6 A;  2LT4 A;  2L8D A;  2JVV A;  4VUB A;  3RKW A;  5J39 A;  2L5Q A;  3CCU T;  3AHU A;  1OI1 A;  1Y71 A;  1G5V A;  2QDJ A;  4KUL A;  2JTM A;  5FU6 B;  2LQK A;  3QUI A;  4XQ3 A;  4HLQ A;  4C8Q C;  2XK0 A;  2YHT A;  1WQW A;  3MEV A;  4J7I A;  5CCA A;  4CI0 C;  4RG2 A;  3JB9 I;  4M75 B;  5GAO n;  3JRZ A;  4BI3 A;  2EQU A;  2MWO A;  2DTH A;  4M75 A;  3GF5 A;  3CPW A;  2E6N A;  3E9G A;  3V7R A;  3MP8 A;  3O8V A;  3HHT B;  1M1G A;  1WJQ A;  2D9T A;  4OGC A;  2YLB A;  3I55 A;  2DK3 A;  2PVG B;  1QVG S;  3L2Z A;  1K73 U;  3HB9 A;  1NPP A;  2RK1 A;  3CCL A;  3QYB A;  3MHX A;  1IZ6 A;  4MZT A;  3CXC A;  1Q81 C;  4BBS M;  4BE2 A;  3X25 B;  4M7D E;  3SD4 A;  3CCE T;  2CGH A;  1Y07 A;  2MWP A;  1U8R A;  1KD1 U;  2PUK B;  3L42 A;  4NL3 A;  2BUD A;  4JLI A;  3VV0 A;  2CZ1 B;  4N4I A;  3ZBD A;  4OMF B;  4C8Q A;  2EYQ A;  5GMK m;  3LWH A;  5CIU A;  2JN0 A;  3OYI A;  3UDC A;  3RKY A;  4ELY C;  3PTA A;  3OY9 A;  4IUR A;  4EMK C;  1K9M C;  3P8H A;  4HNV A;  4PJO B;  4JJN K;  1H3Z A;  2DD4 B;  3GIB A;  4F7U F;  1G3Y A;  4MDX A;  1RL2 A;  1X75 C;  1WNL A;  4RG8 A;  2DIQ A;  5LJ3 f;  4FT2 A;  1QP2 A;  1SSF A;  2E64 A;  4IUU A;  4E7I A;  3C4S A;  3TU4 K;  3JCM J;  4DQ2 A;  1JJ2 S;  5LJ5 j;  2P4T A;  3E9F A;  4BDY A;  2RJD A;  2YRV A;  3CBP A;  3X28 B;  1KQS A;  3X26 B;  2QF7 A;  3PT9 A;  3GNF B;  1BI0 A;  4M75 F;  3NTH A;  5EG2 A;  3MP6 A;  2PVD B;  3M59 A;  1U1T A;  4OB0 B;  4J5Y A;  2KR6 A;  1QVP A;  2RI5 A;  1KHC A;  5CQX A;  4QQD A;  3RIR A;  4BUG A;  5CAI A;  4QQG A;  3VUZ A;  1AHJ B;  3HFN A;  5HK3 A;  1M1F A;  4M77 C;  4JRP A;  4XK8 E;  2XKO C;  1KD1 C;  1YIJ A;  3A8H B;  3LX7 A;  3M54 A;  4E7L A;  1YHQ A;  2D0Q B;  1N9S A;  2KDS A;  2B8A A;  4AKH A;  2F69 A;  5A2Q E;  3GLX A;  1YJN A;  3A8L B;  3PMI A;  4M75 D;  2ZZD B;  4V2S A;  1N27 A;  3C95 A;  3DB3 A;  2QQB A;  4LDV A;  3JCM h;  3OYF A;  4ELJ A;  3OYM A;  2EJF A;  4JS4 A;  3DL1 A;  5GAN 8;  4RCC A;  1OZ2 A;  2DO3 A;  3S3M A;  5GAO m;  1B34 A;  2QXF A;  2R5A A;  4J6X A;  1YIT T;  4PJO D;  3JB9 F;  1VQ8 T;  4C5I A;  4A4F A;  2RJC A;  2BS2 A;  4GY5 A;  5GAO l;  2HBP A;  4C92 D;  4KUI A;  2KAF A;  2X35 A;  3J81 E;  1OYX A;  1KC8 C;  2CZ6 B;  3CC2 A;  4ZGE B;  2RB6 A;  5GAO q;  2WSE E;  4BI4 A;  2O01 E;  1VQO A;  1BIA A;  2LC4 A;  1TH7 A;  4XTU A;  2RHI A;  3JCM g;  3V7S A;  1K8A C;  4LOC A;  4OGE A;  5LJ3 g;  4AKG A;  4M77 A;  4EMK A;  4AI6 A;  3HRS A;  2BKD N;  3QYH B;  2LX9 A;  2R5M A;  2KVQ G;  4X9D A;  3OYG A;  4E47 A;  2EQK A;  3M4G A;  1K73 C;  2WSF E;  2WJ9 A;  2HQE A;  2FL7 A;  2GF7 A;  2RHX A;  5CO7 A;  2LQ8 A;  4FL6 A;  4J83 A;  3CXC S;  3RER A;  2E65 A;  3BY7 A;  3QJ6 A;  5EJC A;  2E41 A;  2VV5 A;  1M9S A;  3JCM V;  1BKB A;  3FC3 A;  3CCJ A;  3VYG A;  4C5G A;  2DXT A;  3BG5 A;  3CMA T;  2LNV A;  4XU2 A;  5GAN e;  2HD0 A;  3C94 A;  4C8Q B;  1XOV A;  4Z02 A;  3OYE A;  2QDY B;  4M77 E;  4EMK B;  3GOX A;  1VQN A;  1WQ7 A;  2F5T X;  4KUD K;  2D6F A;  2XHC A;  5GAO r;  2DAQ A;  2QTX A;  3FEO A;  1N8R C;  3LWI A;  2E5Q A;  1I81 A;  2RM4 A;  5A0D A;  5IAY A;  2ZPB B;  3LLR A;  5LJ5 g;  3G6E T;  1UGP B;  2WSC E;  1W4S A;  4R56 A;  3N5B B;  4C92 F;  1R8O B;  2RI2 A;  1Q82 C;  3CD6 A;  3M4Y A;  3SWN C;  3EFR A;  5D6W A;  4L59 A;  2E70 A;  5LJ5 d;  5DM7 R;  3PMT A;  5A0G A;  3BDU A;  1W2B S;  4IKF A;  4MFE A;  2BS4 A;  5GMK l;  1Q7Y U;  2DXB B;  4RMO A;  3G71 A;  5GAM e;  3I56 A;  1WJS A;  4C92 A;  2P0K A;  3JCM b;  2FYK A;  2M1H A;  1BYM A;  4QSH A;  1XNI A;  3TEE A;  3V7C A;  4C92 B;  3OS1 A;  3FRN A;  5FRM A;  2XDP A;  4M7A B;  4FSX A;  2DD5 A;  1KQ2 A;  2R58 A;  4M7A A;  1VQ5 A;  2ZPH B;  5LJ5 f;  2ZCF B;  2XU8 A;  4NS5 A;  3BDL A;  3KXT A;  4D6W A;  3OSS C;  3URG A;  2OTJ A;  2DXB A;  3CCR A;  5GAM f;  3JB9 G;  2V8K A;  3MCA B;  1I4K 1;  4C0F A;  4JX4 A;  5J3B A;  2QQ8 A;  4RKU E;  3QZ5 B;  3SFM A;  3CCQ T;  2DTI A;  3QII A;  2LRQ A;  1YJ9 T;  4EMH A;  3VKG A;  2FHD A;  3CC7 T;  4PJO C;  4M77 D;  4M7D A;  3E19 A;  5CKE A;  2BS3 A;  3QKJ A;  4QVD A;  2YLC A;  2GCX A;  2RJF A;  3WXM B;  3M55 A;  3G71 T;  3T9N A;  5GMK h;  4JRQ A;  1VQP T;  3UPU A;  1VQK A;  1UGR B;  2KQW A;  3I56 T;  4ME7 A;  3RES A;  4IUQ A;  3CC4 A;  2VXF A;  4M7A E;  3OMG A;  3HRU A;  1UEB A;  3MP1 A;  3QPH A;  3HKS A;  2V8J A;  2P0P A;  3LW5 E;  3M9Q A;  2LVM A;  3EAE A;  2QFZ A;  3TCJ A;  4JUV A;  4HL4 A;  3OYJ A;  1VQL T;  2ZPI B;  5CQY A;  3KBG A;  2QI2 A;  5CKD A;  3A8O B;  1MGQ A;  1FWZ A;  2KMT A;  4JRI A;  3H4C A;  5GAN 7;  4ZN3 A;  2R57 A;  4TVR A;  4F7U G;  2QEX T;  1QP3 A;  2DTO A;  1Q86 U;  1QLB A;  3CMA A;  1N6A A;  4X9C A;  5HKC A;  3WVE B;  5CKH A;  3QDR B;  3ME9 A;  1VQN T;  3OS5 A;  5I2S A;  2VXE A;  5L8R E;  1M1K C;  2O4X A;  3PIO A;  4ZGJ B;  2DPP B;  3QYG B;  2A7Y A;  2Y90 A;  4CRI A;  3L2V A;  5GMK i;  1M90 C;  3QXE B;  1QW1 A;  1JBM A;  1QVF A;  4M7A F;  3R6O A;  5IN1 A;  5FRO A;  1IRE B;  1WPY A;  1H64 1;  3RMQ A;  3S6W A;  1O75 A;  1NPR A;  3CPW S;  3JCM Q;  1I8F A;  3JCM e;  2G77 A;  5GAN h;  2GFA A;  4C8Q G;  1KQS S;  4HT8 A;  4PJO G;  4BB7 A;  1M90 U;  4J8O A;  2XDB A;  5CVI A;  1PSE A;  3NTI A;  1JRI A;  4BD3 A;  1YJW T;  3UT1 A;  2E6Z A;  1VQ7 T;  2CZ7 B;  4NOY A;  1Y96 B;  2Y4Y A;  1G3W A;  4M78 A;  2IVW A;  2KSS A;  4M7D D;  1Q82 U;  3JCM P;  4FT4 A;  1D3B B;  3A5Z B;  4PLL A;  3RMS A;  2E12 A;  4Y91 A;  5CR2 A;  3CCE A;  1JJ2 A;  2OTL A;  2K2V A;  2CZ0 B;  1ZBX A;  4C5E A;  3CCS A;  3CME A;  3L2Q A;  2DKG A;  3SDZ A;  2XG8 D;  4N0A A;  3TRE A;  1VQ6 T;  5LJ3 d;  2AHJ B;  3ZEH A;  3CCM A;  2JNG A;  4M7A C;  2MF2 A;  5KE3 A;  3NFC A;  2XD0 A;  2QQA A;  4XU3 A;  2WAC A;  2MMP A;  1XTD A;  5J26 A;  4B9W A;  4O6J A;  3CCU A;  2KMG A;  3A8M B;  5C0M A;  1B34 B;  2X4J A;  5CKB A;  1YJ9 A;  4OB2 B;  3JB9 J;  5KH6 A;  3ASK A;  3J7A F;  4OB1 B;  3G4S T;  2QQS A;  4XTW A;  1VQK T;  4C5H A;  3JB9 D;  3V8K A;  2QA4 T;  3OS0 A;  4NC6 A;  3JCM c;  3QG1 A;  3FB9 A;  1VQ7 A;  2M0O A;  2XDD A;  3V8L A;  3KHI A;  1QVG A;  1Q86 C;  3JSC A;  2GQV A;  4YTL A;  5GAN 6;  2EJG A;  2ZPE B;  4Q5W A;  2RJE A;  5HK0 A;  3OYC A;  3OYA A;  2PUO B;  3I55 T;  4HKE A;  4Y28 E;  5HY6 A;  3OA6 A;  4XTV A;  1VQL A;  4HT9 A;  4A4H A;  4FU6 A;  4Z6Y A;  4M78 F;  1Q7Y C;  2DEQ A;  4M78 C;  3L1A A;  1VQ9 A;  4EDU A;  1N8R U;  2DIG A;  4KBM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...