2CZ1B

Photo-activation state of fe-type nhase with n-ba in anaerobic condition
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title photo-activation state of Fe-type NHase with n-BA in anaerobic condition
rcsb
molecule tags Lyase
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2cz1B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cz1B02
2QDYB 1GXIE 4OB3B 2CZ1B 1IREB 3A8OB 3VYHB 4FM4B 3X25B 3QYHB 4KT0E 2ZPGB 2D0QB 2ZPEB 1JB0E 2ZPFB 1PSFA 3HHTB 4RKUE 1DJ7B 1UGSB 3A8MB 5L8RE 2DD4B 4OB1B 1PSEA 2AHJB 2DD5A 3VYGB 3X28B 2CZ7B 1UGPB 2DXCA 2CZ0B 2CYZB 2PUKB 2PVDB 2DPPB 2PUOB 3X20B 1QP2A 2ZPHB 2PU9B 3A8HB 2O01E 4ZGEB 3LW5E 2DD5B 4Y28E 2WSCE 3X24B 2PVOB 3X26B 2DXCB 1AHJB 2WSEE 2ZPBB 2DXBB 3A8GB 3QYGB 2DXBA 1UGRB 2ZPIB 4ZGDB 1V29B 3VYGA 2CZ6B 3WVEB 3QZ5B 3QZ9B 1UGQB 3QXEB 2ZZDB 2PVGB 2ZZDA 2WSFE 1QP3A 4OB2B 3WVDB 4XK8E 3A8LB 4L6V5 4OB0B 4ZGJB 2ZCFB 2DD4A
chains in the Genus database with same CATH superfamily
2YRCA 3EH2A 1YHQQ 2LZ6B 1AVZC 3ASKA 2JJ9A 1XTDA 5FGKB 1RACB 1V76A 4M7AA 2CCHB 4C0DC 2A7YA 3OYYA 2NUPB 1C6VX 1M90R 2AKLA 1K8AR 5KCHA 4PJLA 1YJWQ 4F7UG 1YITT 1QMCA 2O9SA 4QVCA 3NDQA 4QQGA 3CCMQ 4Z88A 4ELJA 3VS4A 1C1AA 3G1JA 4C8QG 4RTYA 5GAN7 1RAIB 3OY9A 1P5EB 1VQ6T 3SWNA 3DB4A 2AZVA 2WACA 2YXYA 2EJGA 1EZZB 4KUDK 4F04B 4M7DC 1PKSA 1I4K1 2EW3A 2V1QA 5GANe 3H0IA 4HCBA 3I5SA 2Y90A 4J7IA 4JJDA 4RUGA 1UGVA 2HQXA 5GJWB 5IHIA 4ME7A 1WYXA 4M78C 1M2VB 4BE1A 2CCIB 2BTTA 3G6EA 2DD5B 3U23A 3POMA 2FHDA 4RMOA 1VQ9Q 3H6ZA 4CRLB 1N6AA 1VQ4Q 3L2RA 3VUBA 4MFEA 2JGZB 1M3BA 4N4GA 3OYEA 4J6XA 5I21A 1H24B 2M0OA 2AKKA 2JMAA 4B9WA 1FMKA 3H0FA 4EC9B 3OB9A 2E6ZA 4NOYA 2BPMB 1QP3A 3JCMJ 2DAQA 1K0SA 4JJBA 4UC4A 1XNIA 1D1CA 4ZGJB 3CC2Q 2HDAA 3VS2A 2GF7A 1QVFS 3G6ET 1AZGB 4X1VA 3UA6A 3TNIB 1H26B 2YT6A 4ZTJA 1WPYA 2VKNA 2CSIA 2QF7A 4OMPA 3A98A 1G3TA 5CCAA 1Y0MA 1UJYA 2FRYA 1N27A 5ACBA 3HO8A 1I5OB 3L2VA 1KC8R 1JB0E 1M1GA 2DZ9A 4EOIB 4YC3B 2KR6A 2RF0A 2I0NA 1X27A 4RCBA 3ZFJA 3RMSA 1XOVA 1Q82R 3J7AF 3HKSA 1JEGA 2RJEA 2OTLT 1WHGA 2QGSA 1X6GA 3TSWA 1YHQT 3N5BB 3M5AA 5GAOl 4QKUA 1FX7A 2XDBA 2AK5A 2C4GB 2HL5C 2GFAA 1QP2A 3INZA 3BG3A 4AMCA 1ZUKA 5HNBB 1UNHD 1MV0B 2C0IA 4LDYA 1NLOC 1YJWT 2C0TA 3OW2P 1H641 3CCMT 4PJOA 3I9QA 2GBQA 4OMOA 4D6WA 1K73R 3LWIA 2BS2A 3Q1JA 4C92B 4BCMB 4M77A 2KVQG 2WSEE 3HSBA 2K2VA 1VQ7Q 2F2VA 2K5LA 5HK0A 2C6TB 3OW2A 2V1RA 2DM1A 4DA4A 2KYMA 3CC4Q 2KGTA 1M8VA 3CCQA 2OTJQ 2EJFA 5IAYA 3FC3A 3S6WA 1NJIC 2E64A 1JRIA 4OP0A 4PJMA 4EOQB 3QJYA 5ECAA 1Q81U 1IXDA 4KGVB 3DDQB 4II1A 4LUDA 2CP5A 4LOCA 4MMKA 1UG1A 5D6WA 3CBOA 4C92E 5LJ5f 1H3HA 2XDDA 1NYFA 2YUPA 1VOMA 5DLOA 2EYXA 2NYSA 2DLPA 1VQLA 2EWNA 1VQ9T 4LDWA 4J6WA 4J6YA 3L2WA 2ED0A 3OMGA 2COZA 3JCMV 1SSFA 2WMAB 5A0GA 2LT1A 5KE3A 1VQ4T 2I40B 3OBWA 2QQBA 2RA2A 5GAMj 3NGPA 3WXMB 5IDPB 1FMVA 2A28A 1UECA 4HVVA 1RUWA 3A8OB 1H25B 1OULA 4FW1A 1CKAA 3META 3QG1A 1M2OA 5KH6A 4ZNXA 1WZOA 4F7SB 1N9SA 1PRMC 4BI4A 4BE2A 3DL1A 4OMLA 2RB6A 1IRXA 1R77A 2LQ8A 4QQDA 3HHTB 4GLMA 2LNVA 2L89A 1AOJA 3JB9F 3SHWA 3CCLQ 2D1XA 2H3EB 4BY7X 1J3TA 3OYHA 3CC2T 5GANg 2LDMA 1OI9B 1SG5A 4HVWA 3M56A 2EKOA 3OSSC 2CZ7B 3S3OA 2J6FA 2P0QA 3M0UA 1VQLT 5FU6C 2DPPB 3RIRA 2E10A 4BBRM 1QVPA 1VQNA 4A4KA 4J8OA 2UZLB 4EC8B 1N4MA 5FU7C 4OMFB 5IXFA 4PJOB 5HKCA 3CC4A 3M0QA 3BDUA 1RLPC 1YI2A 1WJSA 2DERA 3FJ5A 2QTVA 4M77B 1AHJB 1B7TA 2ZPBB 1KK7A 3OYGA 5J39A 3DTOA 3SDZA 4XTZA 3OS0A 4J9IA 3HRSA 4PLLA 5HK3A 5GANh 4QSHA 5FWBA 2DTOA 1Y07A 1M9SA 2JTMA 3M4YA 1W4SA 2NUTA 4BACA 1D3UB 3QKJA 4AFZC 3QHWB 2A3LA 5CK9A 1GUXA 3OYLA 5DY9A 3MEWA 4BE0A 1JBMA 2A08A 2I53A 4G6LB 2NLUA 4PJOF 1QWFA 4TVRA 1VQ7T 2CJMB 2GFUA 5LJ5e 5FRNA 4M77F 5EG2A 4C5EA 3GTMS 3CC4T 3G71Q 2OTJT 2QTXA 2RI3A 2X4YA 1GXIE 4EMKC 4LD9K 4E7ZA 3KBGA 2UZEB 4TTHA 2DL4A 2FEIA 2IPOB 1VYTA 2P84A 2HL3A 4RTZA 3O5ZA 4KT0E 4M7DD 1WDXA 1YJ9A 2CKKA 5D6YA 1AWWA 3M03A 4A53A 1T0JA 4RKUE 2X3XD 2DYBA 2L0AA 1YCYA 1YWOA 2GQVA 4HNTA 2EUFA 1JXMA 2CZ0B 5IDNB 5GAN5 4M7DG 2CUDA 1O9KA 1OIYB 2K6DA 1M4ZA 2QGGA 4PJJA 1MMNA 5J26A 1WJQA 4FSXA 3NTIA 4FT4A 5KYUA 2R58A 1VQKQ 1OIUB 2HNIA 2PJQA 1JJ2A 3CMEQ 3V7RA 3PTAA 5HVYB 2NUZA 2FB7A 3EGXA 3CCLT 4RTUA 2FZGB 2KXDA 1G3NC 1VIFA 2MAMA 3REBB 4DQ2A 2EQKA 4AI6A 2CDTA 3EG1A 4XTYA 1M30A 1KQ2A 1OL2B 5GAMg 1SRLA 3OYIA 1N8RU 4F7JB 5CVIA 3DLMA 3VYGA 2LNHB 3TW6A 2PTKA 3QIIA 2L2PA 4N0AA 2KEAA 1WA7A 4XTVA 3QWYA 1HSQA 2XIDA 4EOOB 1N8RC 2VGMA 2DJZA 2DVJA 4R0KA 2YWWA 4J9EA 2M0YA 1WHMA 5KYWB 3TCJA 4AKIA 2IW6B 4QT7A 2NWMA 2X9HA 3C94A 4RG2A 1H4LD 3J80E 4BCKB 3WVDB 2ABLA 3CCSQ 3JB9J 2DRMA 2GNCA 2XMFA 3JCMX 1WIEA 1Z9ZA 3CCRA 1WQWA 1T3SA 3FJPA 1KQ1A 3HTRA 2E5QA 2CP0A 3R6NA 4CC7A 1W2BS 4KH0B 3LLRA 3HZJA 2JM9A 4Y92A 1Q86R 5M9OA 5HBEB 1B3QA 2A0FB 1K9MR 2OAUA 3DJBA 4BCFB 3I55A 4ROCA 5IN1A 1WHJA 5CKBA 4C92C 3QUIA 1BBZA 2R57A 4FIBA 3V7CA 4LNPA 2DILA 4HVUA 3V8LA 1NM7A 5BNJB 4ELLA 5A0DA 1T3LA 1X6BA 2WMBB 2JS0A 1OKWB 4C5IA 1OPLA 2XD0A 4F16A 4F7UA 2QA4Q 3T9NA 1VQKA 3G71T 4JS5A 4C8QA 1SHGA 2PUKB 3BDLA 2G77A 4F17A 5A2QE 1WX6A 3PVLA 4GY5A 4PL6A 2DL5A 2PQWA 4LE9A 3P8HA 3RUXA 2RK2A 3OS2A 2YSQA 2C06A 2MI6A 5KCOA 1PKDB 1QKXA 3TVTA 4FL6A 3RESA 4JX6A 2DF6A 3JCMd 4RTTA 1BI3A 2JTEA 1M3CA 3CPFA 4PKCC 2CH4W 3VKGA 1HK9A 2G6FX 3H9NA 1QVGA 1VUBA 3EG9B 2DVEA 2DXBA 3P8DA 3JB9I 1TG0A 5I5ZB 1U1TA 1Q95G 2VYTA 4PFPA 2DL8A 5GAN3 3DDPB 5LQFB 1UTIA 2WJ9A 1IO6A 5LJ3d 2YUOA 3HFNA 2DK3A 1NZ9A 3HRUA 1E6GA 2H3JA 3FDRA 1VQKT 2ZGWA 2O4XA 3GF5A 4BCGB 1SPKA 3CMET 4A4FA 4HCKA 1IB8A 2M02A 1Y7XA 3BLHB 4YOSA 3E9GA 2C5VB 3MPUB 2OTLQ 3A8LB 4LN2A 5GMKe 1M5Q1 1MUZA 2CS7A 1IREB 3NMZC 1VQ6A 3X25B 3CXCS 4JRPA 2LX9A 4IUQA 1IZ6A 2E41A 4HCCA 3KHIA 1PCXA 2CREA 2ESWA 3MY5B 1YJNQ 1YIJQ 3AHUA 2GTOA 3MP1A 3CMAA 4E7KA 4J9GA 1PSFA 1WHLA 1KHIA 2PK2A 5IF1B 2DRKA 4CI0C 5LJ5h 5HY6A 3CCST 3L2ZA 1P92A 2KRMA 2L3PA 4BCIB 2KT1A 2P4TA 2QQ9A 4A4GA 4A4HA 4FCYA 2COWA 4CRIA 3HBLA 2K2MA 1ZSZA 2B86A 5GAN4 1PM3A 2X35A 1BU2A 2DZCA 1KFZA 3A8HB 2MOXA 3E19A 4CC3A 3NHNA 2XU8A 2CP3A 4DEXA 1PNJA 3M0TA 2QYZA 4ZGEB 2JTFA 4RTXA 4XAXB 4M4ZA 4JJCA 1KXUA 3S3MA 4CFUB 2EYQA 3I56Q 3H4CA 5LL6S 2K3BA 3PIOA 2K3XA 1Z9QA 2COYA 2DXBB 2F69A 3A5ZB 3LGLA 4DOWA 3CMAT 3E1SA 3REAB 2XG8D 4AKGA 3KXTA 2O88A 4ZGDB 1NPPA 1V29B 2E3HA 4HT9A 1X6OA 3VS0A 2DO3A 2E70A 2QASA 4BCPB 2ROLA 2PNIA 1TTHB 4J83A 4KRCB 1ABQA 3CD6Q 2KR3A 5DM7R 3VRZA 1Y96A 2QQAA 3ZEHA 5GANj 2B8AA 2AZSA 2RJFA 1KQSP 1K8AC 2EBPA 5D7UA 2WXVB 1D3BA 1LNXA 1WGSA 2PMIB 4M75B 5EJCA 2F2WA 4OB0B 4OR5B 1YIJA 3LX7A 4RODA 2A37A 2H8HA 3MHXA 3OS5A 1G2BA 4NL3A 1KQSA 3EGDA 3M4GA 3VRYA 2QFZA 1B34A 3TU4K 1FWZA 3HP9A 3QYHB 4E7IA 4FT2A 2RI2A 3PGGA 3RNJA 2OTLA 1Q7YU 5DLQE 3G7ZA 2DA9A 1M1KU 1YHQA 1ZUUA 2AIRB 1TUGB 2YUQA 4M75E 2ZPFB 5KE2A 6AT1B 2YHTA 2EGCA 1I81A 1GY3B 3RBBB 4IUVA 1I8FA 5EC7A 1Q7YC 5FW9A 1D1AA 1YJWA 1KD1U 1M1KC 3CCMA 3BG5A 2UUEB 2C0OA 3EFOA 3MEVA 4IUTA 2CGHA 2C5XB 2HQEA 4M7AB 4M75F 1OKVB 2FPFA 2RNAA 5GMKl 1MGQA 4ZN3A 4FW2A 3OA6A 2YRVA 1KD1C 3EFRA 3PO3S 1YJNT 3FEOA 1YIJT 2RMOA 2V8KA 4J5YA 2QGFB 2WFYB 4R56A 5I11A 3SWNB 3SB2A 3MCAB 5J3BA 1TXQA 3MJXA 1QQJA 3MO8A 3OYDA 4EOLB 3VS1A 3X26B 1Y57A 3M53A 3JCMf 2CP7A 3RR6A 4B9XA 3PMIA 1YWPA 1CKBA 2MWOA 2EIFA 2M51A 2KSSA 1VQ9A 4AFSC 5CQXA 2VXFA 1G3SA 3JAME 4M7AF 2QI2A 3VS7A 5IT9E 1VQ4A 3WVEB 2V8IA 2VUBA 5I2MA 5LJ3f 4UN0A 2E4HA 1NJIU 4F6SB 2WSFE 3LH5A 4EORB 2QK0A 1Q81R 2GCXA 4II5B 2VASA 2HBWA 1D1BA 1O9SA 4JDSA 1EIFA 5CEIB 4C92D 4BCMD 2DBKA 2F5KA 1TFBA 4LDVA 1BCOA 4FU6A 4EMGA 3FIFA 3CC2A 1QVFP 2W9ZA 5CKDA 3TQ7P 3QJ6A 4DBFA 1KJWA 2I2LA 3C12A 2E65A 3M0RA 4R55A 4DOVA 2KYBA 4PLIA 2EQUA 3JSCA 3MP8A 4C92G 3SEMA 3EG2A 1N5ZA 2QAZA 3V7SA 2ECZA 1MMAA 1QMZB 1RABB 1OPKA 2RQTA 2F1LA 2VXEA 3EHRA 4OMMA 3L42A 1FKMA 5AT1B 2LW4A 2DEQA 1TD6A 3HPWA 1BK2A 1JXOA 4QVDA 5GMKh 1ARKA 4KUIA 2MWPA 1MHNA 1SHFA 2L3SA 3CCEQ 2J06A 3QPHA 3VU3C 5I22A 4JLIA 2FO0A 2RHXA 9ATCB 4HXJA 1VQ8Q 2E3IA 1G5VA 1OZ2A 5CO7A 3QDRB 2DTIA 1TH7A 3UWNA 3M55A 4QW2A 1OYXA 1H92A 1KIKA 1K0XA 1TUDA 1OX9A 2KNBB 2G9XB 4BDYA 2JZ2A 4M7DA 3OYJA 5GAOm 4F6WB 3X24B 1VQOQ 5CIUA 2DETA 5KYYA 2KAFA 3BE3A 1VQ5Q 1SF9A 1TSFA 2EQIA 4M78A 4DBRA 3CPWS 4RTWA 2HKQB 4BCQB 3E2UA 4RCCA 3RGFB 3JCMQ 4AG2C 1VQ7A 2WPAB 3JCMe 1XO2A 5HCKA 1BI0A 2OTJA 4JPBW 1AD5A 1FINB 2DXTA 4E7HA 3P8BB 2JOYA 4Y72B 4M6VA 1GFCA 3BFMA 2GTJA 2YLBA 1UE9A 3HRTA 2EPDA 5LJ3e 1TUCA 2FL7A 5HBJB 4M77D 2GQIA 2Y4XA 1X2QA 1G8XA 4PJOE 4EMHA 1BYMA 4BCNB 1JJ2S 2JVVA 1S72Q 4HCZA 2K9GA 3EHQA 4CFXB 1UDLA 4ROEA 2KRSA 2KMTA 2M9UA 1K76A 4M77E 4JX5A 5L2WB 1UHFA 4MDWA 2RQRA 3CC7Q 2ZPEB 2X1NB 3M0PA 1RI0A 4NL2A 1ZBXA 2HD0A 2VWFA 4M77G 1WI7A 3TN8B 1ZP2A 1LPLA 1UGSB 4C0DB 3HB9A 3GBQA 4D8DA 2EGEA 3FRNA 2E5KA 2LCLA 3FLGA 4EOPB 4BY6B 3CCJQ 2DXCA 2X4XA 1HD3A 4KH1B 3VS3A 3CCLA 2HSEB 4J9BA 2QEXQ 4J9FA 2X4WA 1PG5B 2LJ0A 2QXFA 2EFIA 8ATCB 2X4JA 5LJ5j 2P4RA 2PU9B 1I0CA 1XQHA 2RQUA 1QCOA 3CPWP 4M7DB 1TU0B 4ANJA 4C0ZA 2LJ1A 1FYNA 1YN8A 1ZX6A 4K11A 4MZMA 1QCNA 2DX1A 1RAFB 4GLKA 4M78B 3JCMc 1NE8A 1UJ0A 3FB9A 3JCMW 1ZA1B 1RADB 2X3WD 2LTOA 3CCET 4BCHB 4BY1X 1TS9A 4HL4A 1VQ8T 4OGRB 1IGUA 5CQYA 1I07A 1JOWA 1NYGA 3PVQA 1N8RR 4XU3A 4RG8A 4FYVB 7AT1B 3CCVQ 2BE9B 2D8HA 4M7DF 4XTWA 2IN3A 2BZYA 1VQOT 5A0LA 1QKWA 3B57A 4YOZA 1VYUA 2NUTB 2ZCFB 1JSUB 2F5TX 4EOMB 2DD4A 2DMEA 4CFWB 1WJRA 5IXBA 2W0ZA 1QLBA 4M78F 3UDCA 3LYIA 3OYAA 1GUXB 2RJDA 1HXDA 4WCIA 2IW8B 1AWOA 2PHGA 3SWNC 3G71A 3JCMb 3OSVA 4B6MA 5GJVB 1VQPQ 1RLQC 4AFQC 2FRWA 2MYSA 5GAOr 1EFNA 1E6HA 2AHJB 5GAMd 1NBEB 5GAOn 2LP5A 2HAXA 4C0FA 5ICPB 1U06A 4N4IA 5KYXA 1S72T 1GCQC 4N4HA 1E9HB 2FVUA 2KI7A 2YRDA 1QWEA 3HL8A 1WHKA 1BU1A 2RQWA 2XICA 3CC7T 3BG9A 1W6XA 5L23A 1FVVB 1GFDA 2RHIA 2J7IA 3CCUQ 2HZYA 3BHUB 2VGNA 2LMJA 4C5GA 2VVKA 2KRNA 3CMEA 3EFSA 3PIPA 1MV3A 1UGRB 1O9KB 3CCJT 3NPFA 4JS4A 4O6JA 4E7SA 2W2HA 1NPRA 2QEXT 5KYUB 4PFZA 1OQKA 1K9MU 2CH4A 1KSWA 4YOOA 2RHUA 3VUZA 3QYBA 2ED1A 4JLGA 1RAEB 4JRIA 1U3OA 3EGXB 1R0CB 1ZA2B 4EOJB 3QXEB 2F2CA 1G3YA 1M1FA 2NUPA 2SEMA 2RQVA 1Q86C 2EAYA 1K9MC 1X2KA 4J9HA 3MKDA 8AT1B 3NTKA 2V26A 4BI3A 4OB2B 4A54A 3EG0A 3EG3A 1SRMA 2L8DA 1F1BB 2DYIA 3UT1A 2XK0A 3VYGB 1UHCA 1BKBA 2CZ1B 3JRZA 3JCMh 1OV3A 4FM4B 3CCSA 2BUDA 1FXXA 3O8VA 4EPCA 4X9DA 1U8RA 3URGA 3L2UA 1VIEA 5LJ5g 1W2BP 4JRQA 2D0QB 1AZEA 2J05A 2K79A 3CCVT 2K5FA 5CKEA 4EMKA 4NS5A 3TSZA 5LJ3h 3G4SQ 1M2VA 1UEBA 2KBTA 3QDFA 3V8JA 1ZQ1A 3GNGA 3OYBA 2JW4A 1XJWB 1Y71A 3M59A 2RHZA 2DD5A 1CSKA 4F70B 1WQ7A 4F14A 2PK9B 2JMCA 4PJOC 1TWBA 2HQHA 3NFCA 2RN8A 2QA4A 4XU2A 4M77C 5CR2A 2ZPHB 3G6EQ 4BCJB 1OU8A 3DLLA 1VQPT 4LXCA 3I5RA 2JN0A 2E12A 5GMKj 4OMQA 4HNUA 5FU6B 2K57A 4F7UB 3MEAA 4C5HA 5FU7B 4C8QB 4HT8A 2JS2A 2ZPIB 1QLYA 3HFOA 2LRQA 2BS4A 2V22B 4CFVB 5CYIB 4J9DA 1OZ3A 5FROA 3VKHA 1BI1A 1UFFA 4HNVA 2W9FA 3C95A 1GCPA 3QZ5B 1SEMA 4F7UE 3PNWC 1YFNA 3G33B 4C8QE 2WHBB 3CCUT 2LQNA 4JX4A 2QA4T 1IHVA 2ROTA 3MEUA 4XTXA 1GBQA 3ME9A 2OI3A 4BY6C 1VYWB 3M0SA 1IGQA 1V1CA 4F7UF 4CFUD 1WLPB 4L6V5 3OYNA 2EJ9A 4FX3B 2BIVA 4C8QF 2ATCB 1M90U 1PWTA 1K8AU 2WIHB 3L2QA 3MIAB 3RDVA 3VYHB 1YBYA 2O4XB 3G4SA 2RJCA 1IHWA 2EQJA 2QDLA 2DJQA 3CXCP 1M90C 1QCFA 4MZPA 3QHRB 4A4EA 2OAWA 2DBMA 2W96A 4EMKB 2FPDA 4PNOA 4X34A 4GBQA 3K7AM 1Q7YR 4X9CA 1YJNA 1M1KR 1UB4A 1GCQA 4QVZA 3CXCA 2DNUA 3QYEA 4MMLA 1H1SB 2EGAA 4L5GA 4C92A 2CP6A 4M75D 3X28B 3D7SB 4AKHA 1JKWA 2D0NA 1KD1R 5GAMf 2W10A 1GBRA 3LQ5B 4Y91A 3RERA 3OW2S 3QSUA 2P0KA 2KQWA 3ZL7C 4MZTA 5GAOp 1C0MA 3IQLA 2K4YA 1GRIA 4MFDA 4KRTA 3QWXX 4KRDB 1FMWA 4OGCA 2EYZA 4PK4A 1I5LA 4MIMA 3CBPA 4M75G 1WHHA 3G4ST 1AEYA 2RI5A 3CCQQ 3I35A 2PVOB 5I2SA 2VV5A 5C0MA 2KROA 5CKHA 3TREA 1ZSZB 1N9RA 1NEGA 1LCKA 4FYXB 1KG1A 3I56A 2PZ1A 2IVWA 2QQSA 4DBQA 1WXBA 1UNGD 2DTHA 5EFQB 4RTVA 1JSTB 4M7AD 1OI1A 2E1HA 3MY1B 4V2SA 2BKZB 1YP5A 5FRMA 3BHTB 1X69A 2BE7D 2JUFA 3LGFA 1VQLQ 2C5NB 4EOSB 4JJNK 3TNHB 1NG2A 1ENWA 3OYMA 2ZZDA 4M7AE 3BW1A 3UATA 2XHCA 1ZBJA 3PMTA 5C6SA 4XU0A 2DXUA 2L3QA 3CD6A 1VA7A 1ZHIA 2FPEA 1GH6B 1K4US 1NJIR 4M7AG 2LCSA 2Z0WA 4VUBA 2QQ8A 4Q5WA 3MI9B 1OOTA 2CUBA 2HMAA 3AT1B 5IHNA 2O2OA 1KC8U 2FZKB 1Y96B 4EOKB 3GOXA 1ZLMA 4Z8AA 3JV3A 4PJNA 2K7AA 2SRCA 2DEUA 1ZUYA 2LT4A 3I56T 1D3BB 1Q82U 4HA8A 3OBYA 1KC8C 2W99A 2M1HA 2X51A 1PD0A 2JXBA 1H8KA 5L8RE 1WXUA 2FZCB 3EAEA 1OEBA 3EGDB 3H0HA 1B34B 4A63B 1Q82C 1VQNQ 2L5QA 4ESRA 3MP6A 4E2FB 1I1JA 3CD6T 2ZAEA 2Y4YA 2MCNA 1D0ZA 3VJPA 2MF2A 3DKMA 1K73U 2D8JA 1YI2Q 1D09B 2B9RA 1NEBA 2A36A 2YLCA 4NC6A 4FYWB 2DKGA 3M57A 3JB9D 4HLQA 4EDUA 3TW7A 4OVAA 5GAMe 1QVFA 5GMKm 1BIAA 4C0GA 4JRKA 4IUUA 3EFOB 1K73C 2WSCE 2ENMA 2KY9A 2C5OB 2K5IA 1Q81C 2HCKA 4N0AC 1YCSB 2DFUA 1PD1A 4I3ZB 3CQTA 4LDUA 4CFNB 2G3RA 4C92F 4IMYB 2F2XA 2WIPB 3JB9G 2D6FA 1H1RB 1H28B 1SSHA 2CZ6B 4EONB 1BB9A 1EX4A 1M27C 2ZZDB 4ZN1A 1W70A 3GP8A 4KULA 2IW9B 3S3NA 1GL5A 2LQWA 4BB7A 3CCQT 3VS6A 3BY7A 2MK5A 3M9QA 4XK8E 1U1SA 5GAN6 4CFMB 3RKXA 5FLXE 2XI9A 1UUEA 4BDZA 1R8OB 3C0CA 2QDJA 2DMOA 4BCOB 3F70A 2OX7A 2KK4A 4F7LB 2BS3A 2K3YA 4ZTFA 1S1NA 2LCCA 4BCQD 2RHYA 1YJ9Q 1JU5C 4JZ4A 1PRLC 2KDSA 2AT1B 2JNGA 2KXCA 4PJOD 5GANd 1BIBA 4C8QC 1DJ7B 2MIOA 2KMGA 3J81E 2VB6A 3SD4A 2KE9A 3OS1A 1PSEA 4IIOA 3PT9A 2FYKA 2GGRA 3LH0A 4Z89A 1UGPB 4IUPA 1E7OA 4PJOG 1T0HA 2PUOB 4BCND 5LJ3j 3RKWA 5D6XA 4E6RA 4CC2A 3CEYA 3CCEA 5GAN8 3BHVB 1VQ8A 4QQ6A 3UPUA 4Z02A 3H41A 4WTOB 1M3AA 2WEVB 4FSSA 4F7NB 1BCMA 3A8GB 3VV0A 3L1AA 1VQNT 2HKNA 3JB9H 3UF4A 5KYWA 1MNDA 2HBPA 3EH1A 2HSPA 3JCMP 1WFWA 4E47A 4AFUC 5IHKA 1VQOA 1OX8A 5IHYA 1VQ5A 4J7FA 2RO0A 1YI2T 2CP2A 2RK1A 4BI8B 4M75C 3EGUA 4IIMA 2EKHA 1UGQB 2KT8A 3F5XB 4LD6A 3O0GD 5IH2A 2DIQA 4AT1B 3H8ZA 1C9BA 3OMCA 5KYYB 3CCRQ 3SFMA 3CPWA 1RAGB 1RI9A 4KGZB 2O31A 3OYKA 1F5QB 4PFOA 2OJ2A 3PFSA 1G3WA 3BLQB 5CAIA 1A0NB 1BI2A 5HQ0B 3LWHA 4NSTB 1ZSGA 2E6NA 4M7DE 2L3RA 4JUVA 1TOVA 3KUFA 4KGXB 2QDYB 4M78D 2IG0A 3I55Q 4OB3B 3M54A 4CXAB 1SKUB 2M16A 1K1ZA 4ORZA 2CT3A 1JJ2P 1NLPC 4FYYB 2XKOC 2QQRA 2MPXC 1S72A 2VC8A 4M78E 1AISB 1G83A 3V8KA 2BKDN 4M7AC 3QHSA 2R7GA 2EVRA 4E7JA 1VQ5T 3OYCA 1ZSZC 3CC7A 4M78G 4OB1B 4OF1A 4J9CA 1LOJA 1MNEA 1LVKA 4XTUA 3DB3A 3QO3A 1X43A 3NTHA 2UZDB 3ZBDA 3EG9A 3ULRB 1VQMQ 1QVGS 4XU1A 2YDLA 2MMPA 1YJ9T 5GAOq 1VOLA 1D0XA 5FWCA 4ELZC 3CCJA 1E7PA 1RAAB 5AYFA 2O01E 1ABOA 3ER0A 3LW5E 2QEXA 2DE0X 4OMNA 2IVXA 3UA7A 1MMGA 1MMDA 4F6UB 1VINA 4HKEA 2LVMA 3QWLA 2EQMA 2DXCB 3DOGB 3OYFA 3QYGB 1X75C 4BBSM 1PHTA 1ACMB 2IIMA 4CC4B 2LQKA 3GPLA 5CKFA 2P0PA 2RPNA 1W1FA 5DQWA 1OU9A 3OQ5A 2R5MA 3VS5A 1B07A 4E7LA 1H1PB 3QZ9B 3GIBA 3CBMA 4WF2A 2BZ8A 5GAMh 5GAN2 1H27B 2PVGB 3E9FA 1YITQ 2JM8A 4YTLA 4LUEA 5DQVA 2DL7A 4IURA 4BD3A 1OGUB 1AD6A 1HJDA 4P5NA 1VQ6Q 3JCMg 2RD1A 3CCVA 3GLXA 1D0YA 1Q86U 2CSQA 3RKYA 4Z6YA 4OGEA 1AT1B 3CMAQ 5KYNA 3PE0A 3TEEA 2BZXA 5LJ3g 2FG0A 2ZPGB 3BLRB 3EJ1B 5HBHB 1WXTA 2UZBB 3CCRT 1QVGP 1VQMA 4EIKA 4BUGA 2V8JA 3A8MB 5GANf 2DD4B 1H1QB 1VQPA 1WNLA 2R5AA 1LJOA 1U5SA 1R0BG 2EYWA 3I55T 1W98B 2J6KA 4DBHA 4DEYA 3A1PA 1RL2A 1AWXA 1UNLD 2CYZB 1PC0A 2PVDB 2QG9B 3M58A 2EYYA 2RM4A 3EIDB 3X20B 2HEQA 4KBMB 2YUNA 1URCB 1K9AA 2DL3A 5GMKi 2LX7A 1OL1B 3EOCB 4MDXA 1W2BA 2D9TA 4Y28E 5LMKB 1VYVA 4ELYC 1PKTA 1YNZA 5KYXB 2XDPA 4BXXX 2LC4A 3TNWB 4IKFA 1M8MA 1KHCA 2DIGA 4JZ3A 3CCUA 3C4SA 4M75A 1VQMT 1YITA 3KFVA 2RH2A 2LJ3A 3GNFB 1RAHB 3RMQA 1QW1A 5LJ5d 1JO8A 1KQSS 4O5VA 2JT4A 3QBYA 4ATOA 1H3ZA 4XQ3A 4D8KA 3VKIA 1X01A 4L59A 1JQQA 1AWJA 2O9VA 1HYOA 3THKA 2CT4A 4LDXA 2J6OA 3R6OA 4C8QD 4AG1C 1O75A
chains in the Genus database with same CATH topology
4EMHA 4Q5WA 1BYMA 1JJ2S 2JVVA 3FJPA 4HCZA 1KQ1A 3ASKA 1KC8U 2E5QA 1XTDA 1W2BS 1Y96B 4M7AA 2KMTA 3LLRA 2M9UA 3HZJA 4M77E 4C0DC 2A7YA 3GOXA 4JX5A 3OYYA 5M9OA 2OAUA 4MDWA 3I55A 5KCHA 5IN1A 2LT4A 3I56T 1D3BB 5CKBA 2ZPEB 3QUIA 4C92C 4F7UG 4HA8A 1YITT 1Q82U 4QVCA 2R57A 4QQGA 4FIBA 3V7CA 1RI0A 4ELJA 3OBYA 1ZBXA 2HD0A 4NL2A 4M77G 1KC8C 3V8LA 2M1HA 4C8QG 1UGSB 4C0DB 3HB9A 5L8RE 5A0DA 5GAN7 1VQ6T 3OY9A 3SWNA 3DB4A 3EAEA 3FRNA 4C5IA 2XD0A 4F7UA 2WACA 1B34B 2LCLA 1Q82C 3FLGA 3T9NA 1VQKA 4BY6B 3G71T 2L5QA 2EJGA 4JS5A 4KUDK 4M7DC 3MP6A 2DXCA 2X4XA 4C8QA 3CCLA 1I4K1 5GANe 4HCBA 2PUKB 3CD6T 2Y4YA 2Y90A 3BDLA 2G77A 2X4WA 4J7IA 2QXFA 2EFIA 3VJPA 2MF2A 3DKMA 4GY5A 5A2QE 1K73U 2X4JA 4PL6A 5LJ5j 2PQWA 3R6OA 3P8HA 2PU9B 2HQXA 3RUXA 2RK2A 1XQHA 3OS2A 2YLCA 4ME7A 4NC6A 4M78C 2DKGA 3M57A 2C06A 2MI6A 4BE1A 5KCOA 3JB9D 4HLQA 4EDUA 3TW7A 4OVAA 5GAMe 4FL6A 1QVFA 3RESA 5GMKm 4C0ZA 1BIAA 4C0GA 4JX6A 3JCMd 4JRKA 3G6EA 2DD5B 4IUUA 1BI3A 2FHDA 1K73C 3CPFA 4PKCC 2WSCE 4RMOA 4MZMA 3VKGA 1HK9A 3H6ZA 1QVGA 2KY9A 1VUBA 2DVEA 1N6AA 2K5IA 2DXBA 4GLKA 3P8DA 3JB9I 4M78B 1U1TA 1NE8A 3JCMc 3FB9A 1Q81C 2VYTA 4N0AC 3JCMW 2LTOA 3L2RA 4LDUA 3VUBA 3CCET 4MFEA 5GAN3 2G3RA 4C92F 4HL4A 3JB9G 2WJ9A 4N4GA 5LJ3d 3OYEA 1VQ8T 4J6XA 2D6FA 5I21A 5CQYA 3HFNA 2DK3A 2CZ6B 2M0OA 1NZ9A 3HRUA 2H3JA 3FDRA 4B9WA 1VQKT 2ZGWA 2O4XA 3GF5A 2ZZDB 4XU3A 4RG8A 3CMET 4A4FA 3OB9A 4ZN1A 3GP8A 2E6ZA 4KULA 4NOYA 3S3NA 1Y7XA 4M7DF 1QP3A 4BB7A 3CCQT 3JCMJ 4XTWA 2DAQA 1VQOT 4UC4A 3BY7A 1XNIA 3E9GA 3M9QA 5A0LA 4XK8E 3A8LB 1U1SA 5GAN6 3RKXA 5FLXE 4ZGJB 2XI9A 4BDZA 1R8OB 2ZCFB 2F5TX 2QDJA 2DD4A 3F70A 1WJRA 2GF7A 5GMKe 1M5Q1 1QVFS 3G6ET 1QLBA 4M78F 2CS7A 2KK4A 3UDCA 4ZTJA 1IREB 2BS3A 2K3YA 1WPYA 3LYIA 3OYAA 3X25B 2LCCA 3CXCS 2LX9A 2QF7A 1IZ6A 1HXDA 2RJDA 4IUQA 4JRPA 2E41A 2RHYA 4HCCA 3KHIA 1G3TA 3SWNC 3G71A 3JCMb 3OSVA 2KDSA 5CCAA 2JNGA 4PJOD 3AHUA 1N27A 3MP1A 3HO8A 5GANd 3L2VA 3CMAA 1JB0E 1BIBA 1M1GA 4E7KA 1PSFA 2DZ9A 4C8QC 1DJ7B 1KHIA 2KR6A 4CI0C 2KMGA 5GAOr 5LJ5h 4RCBA 3J81E 5HY6A 3CCST 3SD4A 3ZFJA 3RMSA 1XOVA 3OS1A 3L2ZA 3J7AF 1PSEA 2AHJB 3HKSA 5GAMd 2RJEA 1P92A 5GAOn 3PT9A 2OTLT 2FYKA 3LH0A 2HAXA 2P4TA 2QQ9A 4A4GA 1UGPB 4IUPA 4A4HA 4C0FA 4N4IA 1YHQT 1S72T 3N5BB 4N4HA 4PJOG 3M5AA 4CRIA 3HBLA 5GAOl 1FX7A 2PUOB 2XDBA 2FVUA 5GAN4 5LJ3j 3RKWA 5D6XA 2GFAA 1QP2A 2X35A 3HL8A 3INZA 3BG3A 2DZCA 3CEYA 3A8HB 3E19A 2XICA 3CC7T 3CCEA 2XU8A 4LDYA 1YJWT 3BG9A 4ZGEB 5GAN8 1H641 2JTFA 3CCMT 4PJOA 1VQ8A 4XAXB 4QQ6A 4D6WA 3S3MA 3LWIA 3UPUA 2RHIA 4Z02A 2EYQA 2BS2A 3Q1JA 4C92B 3H4CA 2KVQG 4M77A 5LL6S 3PIOA 2VGNA 2K3XA 2WSEE 4C5GA 2DXBB 3A8GB 2K2VA 3L1AA 3VV0A 3HSBA 3CMEA 2F69A 2K5LA 3A5ZB 3LGLA 5HK0A 3EFSA 3OW2A 3PIPA 1VQNT 4DA4A 3JB9H 1UGRB 4DOWA 3CCJT 3CMAT 3E1SA 2HBPA 2XG8D 4JS4A 4AKGA 3KXTA 5J26A 3JCMP 1M8VA 4ZGDB 4O6JA 1NPPA 3CCQA 1V29B 1NPRA 2EJFA 4E47A 3S6WA 5IAYA 3FC3A 2QEXT 2E64A 1X6OA 1VQOA 1NJIC 2DO3A 1JRIA 2E70A 4OP0A 1VQ5A 1K9MU 3QJYA 1Q81U 4J7FA 2RO0A 2RHUA 1YI2T 4J83A 3VUZA 3QYBA 4II1A 2RK1A 4JLGA 4BI8B 4M75C 4JRIA 1UGQB 4LOCA 4LD6A 4MMKA 3QXEB 4VUBA 5D6WA 3CBOA 1Y96A 2QQAA 4C92E 5LJ5f 5DM7R 2XDDA 2DIQA 3H8ZA 1G3YA 1M1FA 3ZEHA 2B8AA 5DLOA 5GANj 1Q86C 3OMCA 2RJFA 2EAYA 3SFMA 3CPWA 1K9MC 1VQLA 1K8AC 2EWNA 1VQ9T 4LDWA 4J6WA 1D3BA 1LNXA 1WGSA 4J6YA 3OYKA 3L2WA 3OMGA 3NTKA 4BI3A 3PFSA 4OB2B 1G3WA 5CAIA 3JCMV 4M75B 4A54A 5EJCA 1SSFA 1BI2A 5A0GA 2LT1A 2L8DA 5KE3A 1VQ4T 4OB0B 3LWHA 3OBWA 3UT1A 1YIJA 2QQBA 2RA2A 3LX7A 5GAMj 2E6NA 2XK0A 4M7DE 3VYGB 2L3RA 3WXMB 3MHXA 3OS5A 4JUVA 1BKBA 3KUFA 4NL3A 2QDYB 4M78D 2IG0A 1KQSA 4OB3B 3M54A 2CZ1B 3JRZA 3A8OB 3M4GA 3JCMh 4FM4B 2QFZA 1B34A 2BUDA 1FWZA 1FXXA 3CCSA 3TU4K 3META 3HP9A 3QG1A 3QYHB 4E7IA 2M16A 3O8VA 4FT2A 4EPCA 2RI2A 3PGGA 4X9DA 5KH6A 2OTLA 1Q7YU 5DLQE 2XKOC 2QQRA 1U8RA 3URGA 3G7ZA 3L2UA 1VIEA 1N9SA 1YHQA 2VC8A 4M78E 5LJ5g 1S72A 4BI4A 1M1KU 4BE2A 4JRQA 4HT9A 2D0QB 3DL1A 2BKDN 3V8KA 2K5FA 3CCVT 4M7AC 4M75E 2ZPFB 2RB6A 5KE2A 3QHSA 5CKEA 4EMKA 2YHTA 2LQ8A 1I81A 4QQDA 3HHTB 4E7JA 1VQ5T 2LNVA 4NS5A 4IUVA 3OYCA 1I8FA 2L89A 5LJ3h 3JB9F 1UEBA 1Q7YC 3CC7A 4M78G 1YJWA 3V8JA 4OB1B 1ZQ1A 3GNGA 4OF1A 3OYBA 1KD1U 1M1KC 1LOJA 1Y71A 3CCMA 3BG5A 3M59A 2DD5A 2RHZA 3MEVA 4IUTA 1WQ7A 5GANg 3OYHA 2CGHA 3CC2T 2LDMA 2HQEA 4XTUA 3DB3A 3M56A 2EKOA 3OSSC 2CZ7B 3QO3A 4M75F 4M7AB 4PJOC 3S3OA 3NTHA 3ZBDA 5GMKl 1MGQA 2P0QA 1VQLT 5FU6C 4ZN3A 1QVGS 2DPPB 3NFCA 4XU1A 3RIRA 2MMPA 4PJOE 2E10A 4BBRM 3OA6A 1YJ9T 2YRVA 1QVPA 5GAOq 1KD1C 1VQNA 3EFRA 4A4KA 4XU2A 2QA4A 4J8OA 4M77C 4ELZC 5CR2A 2ZPHB 1E7PA 3CCJA 5AYFA 5FU7C 4OMFB 3DLLA 3FEOA 1YIJT 1YJNT 2V8KA 2O01E 3ER0A 4J5YA 4PJOB 3LW5E 1VQPT 2QEXA 2JN0A 2E12A 5GMKj 4R56A 5HKCA 3CC4A 4HNUA 5FU6B 3SWNB 3BDUA 3SB2A 2K57A 3MCAB 5J3BA 4F7UB 1WJSA 1YI2A 4HKEA 3MO8A 2LVMA 3MEAA 3QWLA 4M77B 4C5HA 3OYDA 3X26B 2EQMA 3M53A 5FU7B 2DXCB 1AHJB 4C8QB 2ZPBB 3OYFA 3QYGB 3OYGA 5J39A 4HT8A 1X75C 3JCMf 4B9XA 3PMIA 3SDZA 4BBSM 2ZPIB 4XTZA 3OS0A 2MWOA 3HRSA 2EIFA 4PLLA 5HK3A 5GANh 2LQKA 2KSSA 3GPLA 4QSHA 3HFOA 2LRQA 2BS4A 5CKFA 5CQXA 2DTOA 1VQ9A 1Y07A 2P0PA 2VXFA 1M9SA 2JTMA 1G3SA 3M4YA 3OQ5A 3JAME 4M7AF 1OZ3A 2R5MA 5FROA 3VKHA 1BI1A 1W4SA 4BACA 2QI2A 4HNVA 5IT9E 3C95A 1VQ4A 3QKJA 3WVEB 2A3LA 4E7LA 2V8IA 2VUBA 3QZ5B 5I2MA 4F7UE 3QZ9B 5CK9A 3CBMA 3GIBA 4WF2A 3PNWC 5GAMh 3OYLA 5LJ3f 5GAN2 5DY9A 2PVGB 3MEWA 1NJIU 3E9FA 2WSFE 4C8QE 4BE0A 4YTLA 1JBMA 2GCXA 2NLUA 3CCUT 4PJOF 4JX4A 2QA4T 4XTXA 4IURA 3MEUA 3ME9A 4BD3A 4BY6C 4TVRA 1O9SA 2GFUA 4JDSA 4P5NA 3JCMg 4F7UF 5LJ5e 2RD1A 1EIFA 4L6V5 3OYNA 3CCVA 2EJ9A 5FRNA 4C92D 4M77F 3GLXA 5EG2A 2BIVA 2F5KA 4C5EA 1Q86U 3RKYA 3CC4T 4LDVA 4C8QF 1M90U 2OTJT 2QTXA 2RI3A 1K8AU 3L2QA 2X4YA 1GXIE 4Z6YA 4EMKC 4OGEA 4LD9K 4FU6A 3VYHB 3KBGA 1YBYA 2O4XB 3FIFA 4EMGA 3G4SA 2RJCA 3CC2A 4ZTFA 2EQJA 5CKDA 3TEEA 3QJ6A 5LJ3g 4KT0E 2I2LA 3C12A 1M90C 4M7DD 2ZPGB 2E65A 4MZPA 4A4EA 4R55A 4DOVA 4PLIA 4EMKB 2EQUA 3JSCA 2CKKA 3MP8A 4PNOA 5D6YA 4C92G 4X34A 3CCRT 1YJ9A 4A53A 4M7DB 1VQMA 4RKUE 3V7SA 4X9CA 4BUGA 2V8JA 2VXEA 3A8MB 5GANf 1UB4A 1YJNA 2DD4B 1VQ7T 3L42A 1FKMA 2DEQA 4QVZA 1YCYA 3CXCA 1VQPA 3QYEA 2GQVA 1WNLA 3HPWA 4MMLA 2R5AA 4L5GA 1LJOA 4HNTA 4QVDA 5GMKh 4KUIA 4C92A 2MWPA 4M75D 3X28B 1MHNA 3I55T 2CZ0B 1RL2A 3QPHA 2CYZB 4AKHA 3VU3C 2PVDB 5GAN5 4JLIA 5GAMf 2RHXA 1VQ6A 4M7DG 3M58A 4Y91A 1M4ZA 3RERA 3OW2S 1G5VA 3QSUA 1OZ2A 2P0KA 2RM4A 3QDRB 2DTIA 3X20B 1TH7A 5CO7A 1WJQA 4KBMB 4FSXA 3UWNA 3M55A 4QW2A 1OYXA 3NTIA 4FT4A 2KQWA 2R58A 4MZTA 5GAOp 2HNIA 4BDYA 2K4YA 2JZ2A 4MFDA 4M7DA 5GMKi 1JJ2A 4OGCA 3V7RA 3PTAA 1I5LA 3OYJA 5GAOm 4MDXA 1W2BA 2D9TA 2FB7A 4MIMA 3CBPA 4M75G 3G4ST 4Y28E 4ELYC 3CCLT 2RI5A 3X24B 2PVOB 5I2SA 2XDPA 2VV5A 5CIUA 1VIFA 2MAMA 5C0MA 4DQ2A 2KAFA 2EQKA 2LC4A 4AI6A 5CKHA 3TREA 4IKFA 1N9RA 4M78A 1KHCA 2DIGA 3CPWS 3CCUA 1KG1A 4XTYA 3I56A 3C4SA 1KQ2A 2IVWA 2QQSA 4M75A 1VQMT 1YITA 4RCCA 3JCMQ 5GAMg 1N8RU 2DTHA 2RH2A 3OYIA 3GNFB 1VQ7A 4M7AD 1OI1A 3RMQA 1QW1A 2E1HA 3JCMe 5CVIA 5LJ5d 4V2SA 3DLMA 3VYGA 5FRMA 3LGFA 2JUFA 1BI0A 3TW6A 2OTJA 1KQSS 4O5VA 4JJNK 3QIIA 4N0AA 2DXTA 3QBYA 4XTVA 3OYMA 4E7HA 2ZZDA 2XIDA 4ATOA 3BW1A 2JOYA 3P8BB 1N8RC 2XHCA 3PMTA 4M7AE 1H3ZA 2VGMA 5C6SA 4M6VA 2DJZA 3BFMA 4XQ3A 3VKIA 1X01A 2DXUA 4XU0A 2YLBA 3CD6A 4L59A 3TCJA 1ZHIA 4AKIA 3HRTA 4RG2A 3C94A 5LJ3e 3J80E 3WVDB 3JB9J 4M7AG 3JCMX 2FL7A 4LDXA 4M77D 3CCRA 1WQWA 4C8QD 2Y4XA 1O75A 2QQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QDY B;  1GXI E;  4OB3 B;  2CZ1 B;  1IRE B;  3A8O B;  3VYH B;  4FM4 B;  3X25 B;  3QYH B;  4KT0 E;  2ZPG B;  2D0Q B;  2ZPE B;  1JB0 E;  2ZPF B;  1PSF A;  3HHT B;  4RKU E;  1DJ7 B;  1UGS B;  3A8M B;  5L8R E;  2DD4 B;  4OB1 B;  1PSE A;  2AHJ B;  2DD5 A;  3VYG B;  3X28 B;  2CZ7 B;  1UGP B;  2DXC A;  2CZ0 B;  2CYZ B;  2PUK B;  2PVD B;  2DPP B;  2PUO B;  3X20 B;  1QP2 A;  2ZPH B;  2PU9 B;  3A8H B;  2O01 E;  4ZGE B;  3LW5 E;  2DD5 B;  4Y28 E;  2WSC E;  3X24 B;  2PVO B;  3X26 B;  2DXC B;  1AHJ B;  2WSE E;  2ZPB B;  2DXB B;  3A8G B;  3QYG B;  2DXB A;  1UGR B;  2ZPI B;  4ZGD B;  1V29 B;  3VYG A;  2CZ6 B;  3WVE B;  3QZ5 B;  3QZ9 B;  1UGQ B;  3QXE B;  2ZZD B;  2PVG B;  2ZZD A;  2WSF E;  1QP3 A;  4OB2 B;  3WVD B;  4XK8 E;  3A8L B;  4L6V 5;  4OB0 B;  4ZGJ B;  2ZCF B;  2DD4 A; 
#chains in the Genus database with same CATH topology
 2YRC A;  3EH2 A;  1YHQ Q;  2LZ6 B;  1AVZ C;  3ASK A;  2JJ9 A;  1XTD A;  5FGK B;  1RAC B;  1V76 A;  4M7A A;  2CCH B;  4C0D C;  2A7Y A;  3OYY A;  2NUP B;  1C6V X;  1M90 R;  2AKL A;  1K8A R;  5KCH A;  4PJL A;  1YJW Q;  4F7U G;  1YIT T;  1QMC A;  2O9S A;  4QVC A;  3NDQ A;  4QQG A;  3CCM Q;  4Z88 A;  4ELJ A;  3VS4 A;  1C1A A;  3G1J A;  4C8Q G;  4RTY A;  5GAN 7;  1RAI B;  3OY9 A;  1P5E B;  1VQ6 T;  3SWN A;  3DB4 A;  2AZV A;  2WAC A;  2YXY A;  2EJG A;  1EZZ B;  4KUD K;  4F04 B;  4M7D C;  1PKS A;  1I4K 1;  2EW3 A;  2V1Q A;  5GAN e;  3H0I A;  4HCB A;  3I5S A;  2Y90 A;  4J7I A;  4JJD A;  4RUG A;  1UGV A;  2HQX A;  5GJW B;  5IHI A;  4ME7 A;  1WYX A;  4M78 C;  1M2V B;  4BE1 A;  2CCI B;  2BTT A;  3G6E A;  2DD5 B;  3U23 A;  3POM A;  2FHD A;  4RMO A;  1VQ9 Q;  3H6Z A;  4CRL B;  1N6A A;  1VQ4 Q;  3L2R A;  3VUB A;  4MFE A;  2JGZ B;  1M3B A;  4N4G A;  3OYE A;  4J6X A;  5I21 A;  1H24 B;  2M0O A;  2AKK A;  2JMA A;  4B9W A;  1FMK A;  3H0F A;  4EC9 B;  3OB9 A;  2E6Z A;  4NOY A;  2BPM B;  1QP3 A;  3JCM J;  2DAQ A;  1K0S A;  4JJB A;  4UC4 A;  1XNI A;  1D1C A;  4ZGJ B;  3CC2 Q;  2HDA A;  3VS2 A;  2GF7 A;  1QVF S;  3G6E T;  1AZG B;  4X1V A;  3UA6 A;  3TNI B;  1H26 B;  2YT6 A;  4ZTJ A;  1WPY A;  2VKN A;  2CSI A;  2QF7 A;  4OMP A;  3A98 A;  1G3T A;  5CCA A;  1Y0M A;  1UJY A;  2FRY A;  1N27 A;  5ACB A;  3HO8 A;  1I5O B;  3L2V A;  1KC8 R;  1JB0 E;  1M1G A;  2DZ9 A;  4EOI B;  4YC3 B;  2KR6 A;  2RF0 A;  2I0N A;  1X27 A;  4RCB A;  3ZFJ A;  3RMS A;  1XOV A;  1Q82 R;  3J7A F;  3HKS A;  1JEG A;  2RJE A;  2OTL T;  1WHG A;  2QGS A;  1X6G A;  3TSW A;  1YHQ T;  3N5B B;  3M5A A;  5GAO l;  4QKU A;  1FX7 A;  2XDB A;  2AK5 A;  2C4G B;  2HL5 C;  2GFA A;  1QP2 A;  3INZ A;  3BG3 A;  4AMC A;  1ZUK A;  5HNB B;  1UNH D;  1MV0 B;  2C0I A;  4LDY A;  1NLO C;  1YJW T;  2C0T A;  3OW2 P;  1H64 1;  3CCM T;  4PJO A;  3I9Q A;  2GBQ A;  4OMO A;  4D6W A;  1K73 R;  3LWI A;  2BS2 A;  3Q1J A;  4C92 B;  4BCM B;  4M77 A;  2KVQ G;  2WSE E;  3HSB A;  2K2V A;  1VQ7 Q;  2F2V A;  2K5L A;  5HK0 A;  2C6T B;  3OW2 A;  2V1R A;  2DM1 A;  4DA4 A;  2KYM A;  3CC4 Q;  2KGT A;  1M8V A;  3CCQ A;  2OTJ Q;  2EJF A;  5IAY A;  3FC3 A;  3S6W A;  1NJI C;  2E64 A;  1JRI A;  4OP0 A;  4PJM A;  4EOQ B;  3QJY A;  5ECA A;  1Q81 U;  1IXD A;  4KGV B;  3DDQ B;  4II1 A;  4LUD A;  2CP5 A;  4LOC A;  4MMK A;  1UG1 A;  5D6W A;  3CBO A;  4C92 E;  5LJ5 f;  1H3H A;  2XDD A;  1NYF A;  2YUP A;  1VOM A;  5DLO A;  2EYX A;  2NYS A;  2DLP A;  1VQL A;  2EWN A;  1VQ9 T;  4LDW A;  4J6W A;  4J6Y A;  3L2W A;  2ED0 A;  3OMG A;  2COZ A;  3JCM V;  1SSF A;  2WMA B;  5A0G A;  2LT1 A;  5KE3 A;  1VQ4 T;  2I40 B;  3OBW A;  2QQB A;  2RA2 A;  5GAM j;  3NGP A;  3WXM B;  5IDP B;  1FMV A;  2A28 A;  1UEC A;  4HVV A;  1RUW A;  3A8O B;  1H25 B;  1OUL A;  4FW1 A;  1CKA A;  3MET A;  3QG1 A;  1M2O A;  5KH6 A;  4ZNX A;  1WZO A;  4F7S B;  1N9S A;  1PRM C;  4BI4 A;  4BE2 A;  3DL1 A;  4OML A;  2RB6 A;  1IRX A;  1R77 A;  2LQ8 A;  4QQD A;  3HHT B;  4GLM A;  2LNV A;  2L89 A;  1AOJ A;  3JB9 F;  3SHW A;  3CCL Q;  2D1X A;  2H3E B;  4BY7 X;  1J3T A;  3OYH A;  3CC2 T;  5GAN g;  2LDM A;  1OI9 B;  1SG5 A;  4HVW A;  3M56 A;  2EKO A;  3OSS C;  2CZ7 B;  3S3O A;  2J6F A;  2P0Q A;  3M0U A;  1VQL T;  5FU6 C;  2DPP B;  3RIR A;  2E10 A;  4BBR M;  1QVP A;  1VQN A;  4A4K A;  4J8O A;  2UZL B;  4EC8 B;  1N4M A;  5FU7 C;  4OMF B;  5IXF A;  4PJO B;  5HKC A;  3CC4 A;  3M0Q A;  3BDU A;  1RLP C;  1YI2 A;  1WJS A;  2DER A;  3FJ5 A;  2QTV A;  4M77 B;  1AHJ B;  1B7T A;  2ZPB B;  1KK7 A;  3OYG A;  5J39 A;  3DTO A;  3SDZ A;  4XTZ A;  3OS0 A;  4J9I A;  3HRS A;  4PLL A;  5HK3 A;  5GAN h;  4QSH A;  5FWB A;  2DTO A;  1Y07 A;  1M9S A;  2JTM A;  3M4Y A;  1W4S A;  2NUT A;  4BAC A;  1D3U B;  3QKJ A;  4AFZ C;  3QHW B;  2A3L A;  5CK9 A;  1GUX A;  3OYL A;  5DY9 A;  3MEW A;  4BE0 A;  1JBM A;  2A08 A;  2I53 A;  4G6L B;  2NLU A;  4PJO F;  1QWF A;  4TVR A;  1VQ7 T;  2CJM B;  2GFU A;  5LJ5 e;  5FRN A;  4M77 F;  5EG2 A;  4C5E A;  3GTM S;  3CC4 T;  3G71 Q;  2OTJ T;  2QTX A;  2RI3 A;  2X4Y A;  1GXI E;  4EMK C;  4LD9 K;  4E7Z A;  3KBG A;  2UZE B;  4TTH A;  2DL4 A;  2FEI A;  2IPO B;  1VYT A;  2P84 A;  2HL3 A;  4RTZ A;  3O5Z A;  4KT0 E;  4M7D D;  1WDX A;  1YJ9 A;  2CKK A;  5D6Y A;  1AWW A;  3M03 A;  4A53 A;  1T0J A;  4RKU E;  2X3X D;  2DYB A;  2L0A A;  1YCY A;  1YWO A;  2GQV A;  4HNT A;  2EUF A;  1JXM A;  2CZ0 B;  5IDN B;  5GAN 5;  4M7D G;  2CUD A;  1O9K A;  1OIY B;  2K6D A;  1M4Z A;  2QGG A;  4PJJ A;  1MMN A;  5J26 A;  1WJQ A;  4FSX A;  3NTI A;  4FT4 A;  5KYU A;  2R58 A;  1VQK Q;  1OIU B;  2HNI A;  2PJQ A;  1JJ2 A;  3CME Q;  3V7R A;  3PTA A;  5HVY B;  2NUZ A;  2FB7 A;  3EGX A;  3CCL T;  4RTU A;  2FZG B;  2KXD A;  1G3N C;  1VIF A;  2MAM A;  3REB B;  4DQ2 A;  2EQK A;  4AI6 A;  2CDT A;  3EG1 A;  4XTY A;  1M30 A;  1KQ2 A;  1OL2 B;  5GAM g;  1SRL A;  3OYI A;  1N8R U;  4F7J B;  5CVI A;  3DLM A;  3VYG A;  2LNH B;  3TW6 A;  2PTK A;  3QII A;  2L2P A;  4N0A A;  2KEA A;  1WA7 A;  4XTV A;  3QWY A;  1HSQ A;  2XID A;  4EOO B;  1N8R C;  2VGM A;  2DJZ A;  2DVJ A;  4R0K A;  2YWW A;  4J9E A;  2M0Y A;  1WHM A;  5KYW B;  3TCJ A;  4AKI A;  2IW6 B;  4QT7 A;  2NWM A;  2X9H A;  3C94 A;  4RG2 A;  1H4L D;  3J80 E;  4BCK B;  3WVD B;  2ABL A;  3CCS Q;  3JB9 J;  2DRM A;  2GNC A;  2XMF A;  3JCM X;  1WIE A;  1Z9Z A;  3CCR A;  1WQW A;  1T3S A;  3FJP A;  1KQ1 A;  3HTR A;  2E5Q A;  2CP0 A;  3R6N A;  4CC7 A;  1W2B S;  4KH0 B;  3LLR A;  3HZJ A;  2JM9 A;  4Y92 A;  1Q86 R;  5M9O A;  5HBE B;  1B3Q A;  2A0F B;  1K9M R;  2OAU A;  3DJB A;  4BCF B;  3I55 A;  4ROC A;  5IN1 A;  1WHJ A;  5CKB A;  4C92 C;  3QUI A;  1BBZ A;  2R57 A;  4FIB A;  3V7C A;  4LNP A;  2DIL A;  4HVU A;  3V8L A;  1NM7 A;  5BNJ B;  4ELL A;  5A0D A;  1T3L A;  1X6B A;  2WMB B;  2JS0 A;  1OKW B;  4C5I A;  1OPL A;  2XD0 A;  4F16 A;  4F7U A;  2QA4 Q;  3T9N A;  1VQK A;  3G71 T;  4JS5 A;  4C8Q A;  1SHG A;  2PUK B;  3BDL A;  2G77 A;  4F17 A;  5A2Q E;  1WX6 A;  3PVL A;  4GY5 A;  4PL6 A;  2DL5 A;  2PQW A;  4LE9 A;  3P8H A;  3RUX A;  2RK2 A;  3OS2 A;  2YSQ A;  2C06 A;  2MI6 A;  5KCO A;  1PKD B;  1QKX A;  3TVT A;  4FL6 A;  3RES A;  4JX6 A;  2DF6 A;  3JCM d;  4RTT A;  1BI3 A;  2JTE A;  1M3C A;  3CPF A;  4PKC C;  2CH4 W;  3VKG A;  1HK9 A;  2G6F X;  3H9N A;  1QVG A;  1VUB A;  3EG9 B;  2DVE A;  2DXB A;  3P8D A;  3JB9 I;  1TG0 A;  5I5Z B;  1U1T A;  1Q95 G;  2VYT A;  4PFP A;  2DL8 A;  5GAN 3;  3DDP B;  5LQF B;  1UTI A;  2WJ9 A;  1IO6 A;  5LJ3 d;  2YUO A;  3HFN A;  2DK3 A;  1NZ9 A;  3HRU A;  1E6G A;  2H3J A;  3FDR A;  1VQK T;  2ZGW A;  2O4X A;  3GF5 A;  4BCG B;  1SPK A;  3CME T;  4A4F A;  4HCK A;  1IB8 A;  2M02 A;  1Y7X A;  3BLH B;  4YOS A;  3E9G A;  2C5V B;  3MPU B;  2OTL Q;  3A8L B;  4LN2 A;  5GMK e;  1M5Q 1;  1MUZ A;  2CS7 A;  1IRE B;  3NMZ C;  1VQ6 A;  3X25 B;  3CXC S;  4JRP A;  2LX9 A;  4IUQ A;  1IZ6 A;  2E41 A;  4HCC A;  3KHI A;  1PCX A;  2CRE A;  2ESW A;  3MY5 B;  1YJN Q;  1YIJ Q;  3AHU A;  2GTO A;  3MP1 A;  3CMA A;  4E7K A;  4J9G A;  1PSF A;  1WHL A;  1KHI A;  2PK2 A;  5IF1 B;  2DRK A;  4CI0 C;  5LJ5 h;  5HY6 A;  3CCS T;  3L2Z A;  1P92 A;  2KRM A;  2L3P A;  4BCI B;  2KT1 A;  2P4T A;  2QQ9 A;  4A4G A;  4A4H A;  4FCY A;  2COW A;  4CRI A;  3HBL A;  2K2M A;  1ZSZ A;  2B86 A;  5GAN 4;  1PM3 A;  2X35 A;  1BU2 A;  2DZC A;  1KFZ A;  3A8H B;  2MOX A;  3E19 A;  4CC3 A;  3NHN A;  2XU8 A;  2CP3 A;  4DEX A;  1PNJ A;  3M0T A;  2QYZ A;  4ZGE B;  2JTF A;  4RTX A;  4XAX B;  4M4Z A;  4JJC A;  1KXU A;  3S3M A;  4CFU B;  2EYQ A;  3I56 Q;  3H4C A;  5LL6 S;  2K3B A;  3PIO A;  2K3X A;  1Z9Q A;  2COY A;  2DXB B;  2F69 A;  3A5Z B;  3LGL A;  4DOW A;  3CMA T;  3E1S A;  3REA B;  2XG8 D;  4AKG A;  3KXT A;  2O88 A;  4ZGD B;  1NPP A;  1V29 B;  2E3H A;  4HT9 A;  1X6O A;  3VS0 A;  2DO3 A;  2E70 A;  2QAS A;  4BCP B;  2ROL A;  2PNI A;  1TTH B;  4J83 A;  4KRC B;  1ABQ A;  3CD6 Q;  2KR3 A;  5DM7 R;  3VRZ A;  1Y96 A;  2QQA A;  3ZEH A;  5GAN j;  2B8A A;  2AZS A;  2RJF A;  1KQS P;  1K8A C;  2EBP A;  5D7U A;  2WXV B;  1D3B A;  1LNX A;  1WGS A;  2PMI B;  4M75 B;  5EJC A;  2F2W A;  4OB0 B;  4OR5 B;  1YIJ A;  3LX7 A;  4ROD A;  2A37 A;  2H8H A;  3MHX A;  3OS5 A;  1G2B A;  4NL3 A;  1KQS A;  3EGD A;  3M4G A;  3VRY A;  2QFZ A;  1B34 A;  3TU4 K;  1FWZ A;  3HP9 A;  3QYH B;  4E7I A;  4FT2 A;  2RI2 A;  3PGG A;  3RNJ A;  2OTL A;  1Q7Y U;  5DLQ E;  3G7Z A;  2DA9 A;  1M1K U;  1YHQ A;  1ZUU A;  2AIR B;  1TUG B;  2YUQ A;  4M75 E;  2ZPF B;  5KE2 A;  6AT1 B;  2YHT A;  2EGC A;  1I81 A;  1GY3 B;  3RBB B;  4IUV A;  1I8F A;  5EC7 A;  1Q7Y C;  5FW9 A;  1D1A A;  1YJW A;  1KD1 U;  1M1K C;  3CCM A;  3BG5 A;  2UUE B;  2C0O A;  3EFO A;  3MEV A;  4IUT A;  2CGH A;  2C5X B;  2HQE A;  4M7A B;  4M75 F;  1OKV B;  2FPF A;  2RNA A;  5GMK l;  1MGQ A;  4ZN3 A;  4FW2 A;  3OA6 A;  2YRV A;  1KD1 C;  3EFR A;  3PO3 S;  1YJN T;  3FEO A;  1YIJ T;  2RMO A;  2V8K A;  4J5Y A;  2QGF B;  2WFY B;  4R56 A;  5I11 A;  3SWN B;  3SB2 A;  3MCA B;  5J3B A;  1TXQ A;  3MJX A;  1QQJ A;  3MO8 A;  3OYD A;  4EOL B;  3VS1 A;  3X26 B;  1Y57 A;  3M53 A;  3JCM f;  2CP7 A;  3RR6 A;  4B9X A;  3PMI A;  1YWP A;  1CKB A;  2MWO A;  2EIF A;  2M51 A;  2KSS A;  1VQ9 A;  4AFS C;  5CQX A;  2VXF A;  1G3S A;  3JAM E;  4M7A F;  2QI2 A;  3VS7 A;  5IT9 E;  1VQ4 A;  3WVE B;  2V8I A;  2VUB A;  5I2M A;  5LJ3 f;  4UN0 A;  2E4H A;  1NJI U;  4F6S B;  2WSF E;  3LH5 A;  4EOR B;  2QK0 A;  1Q81 R;  2GCX A;  4II5 B;  2VAS A;  2HBW A;  1D1B A;  1O9S A;  4JDS A;  1EIF A;  5CEI B;  4C92 D;  4BCM D;  2DBK A;  2F5K A;  1TFB A;  4LDV A;  1BCO A;  4FU6 A;  4EMG A;  3FIF A;  3CC2 A;  1QVF P;  2W9Z A;  5CKD A;  3TQ7 P;  3QJ6 A;  4DBF A;  1KJW A;  2I2L A;  3C12 A;  2E65 A;  3M0R A;  4R55 A;  4DOV A;  2KYB A;  4PLI A;  2EQU A;  3JSC A;  3MP8 A;  4C92 G;  3SEM A;  3EG2 A;  1N5Z A;  2QAZ A;  3V7S A;  2ECZ A;  1MMA A;  1QMZ B;  1RAB B;  1OPK A;  2RQT A;  2F1L A;  2VXE A;  3EHR A;  4OMM A;  3L42 A;  1FKM A;  5AT1 B;  2LW4 A;  2DEQ A;  1TD6 A;  3HPW A;  1BK2 A;  1JXO A;  4QVD A;  5GMK h;  1ARK A;  4KUI A;  2MWP A;  1MHN A;  1SHF A;  2L3S A;  3CCE Q;  2J06 A;  3QPH A;  3VU3 C;  5I22 A;  4JLI A;  2FO0 A;  2RHX A;  9ATC B;  4HXJ A;  1VQ8 Q;  2E3I A;  1G5V A;  1OZ2 A;  5CO7 A;  3QDR B;  2DTI A;  1TH7 A;  3UWN A;  3M55 A;  4QW2 A;  1OYX A;  1H92 A;  1KIK A;  1K0X A;  1TUD A;  1OX9 A;  2KNB B;  2G9X B;  4BDY A;  2JZ2 A;  4M7D A;  3OYJ A;  5GAO m;  4F6W B;  3X24 B;  1VQO Q;  5CIU A;  2DET A;  5KYY A;  2KAF A;  3BE3 A;  1VQ5 Q;  1SF9 A;  1TSF A;  2EQI A;  4M78 A;  4DBR A;  3CPW S;  4RTW A;  2HKQ B;  4BCQ B;  3E2U A;  4RCC A;  3RGF B;  3JCM Q;  4AG2 C;  1VQ7 A;  2WPA B;  3JCM e;  1XO2 A;  5HCK A;  1BI0 A;  2OTJ A;  4JPB W;  1AD5 A;  1FIN B;  2DXT A;  4E7H A;  3P8B B;  2JOY A;  4Y72 B;  4M6V A;  1GFC A;  3BFM A;  2GTJ A;  2YLB A;  1UE9 A;  3HRT A;  2EPD A;  5LJ3 e;  1TUC A;  2FL7 A;  5HBJ B;  4M77 D;  2GQI A;  2Y4X A;  1X2Q A;  1G8X A;  4PJO E;  4EMH A;  1BYM A;  4BCN B;  1JJ2 S;  2JVV A;  1S72 Q;  4HCZ A;  2K9G A;  3EHQ A;  4CFX B;  1UDL A;  4ROE A;  2KRS A;  2KMT A;  2M9U A;  1K76 A;  4M77 E;  4JX5 A;  5L2W B;  1UHF A;  4MDW A;  2RQR A;  3CC7 Q;  2ZPE B;  2X1N B;  3M0P A;  1RI0 A;  4NL2 A;  1ZBX A;  2HD0 A;  2VWF A;  4M77 G;  1WI7 A;  3TN8 B;  1ZP2 A;  1LPL A;  1UGS B;  4C0D B;  3HB9 A;  3GBQ A;  4D8D A;  2EGE A;  3FRN A;  2E5K A;  2LCL A;  3FLG A;  4EOP B;  4BY6 B;  3CCJ Q;  2DXC A;  2X4X A;  1HD3 A;  4KH1 B;  3VS3 A;  3CCL A;  2HSE B;  4J9B A;  2QEX Q;  4J9F A;  2X4W A;  1PG5 B;  2LJ0 A;  2QXF A;  2EFI A;  8ATC B;  2X4J A;  5LJ5 j;  2P4R A;  2PU9 B;  1I0C A;  1XQH A;  2RQU A;  1QCO A;  3CPW P;  4M7D B;  1TU0 B;  4ANJ A;  4C0Z A;  2LJ1 A;  1FYN A;  1YN8 A;  1ZX6 A;  4K11 A;  4MZM A;  1QCN A;  2DX1 A;  1RAF B;  4GLK A;  4M78 B;  3JCM c;  1NE8 A;  1UJ0 A;  3FB9 A;  3JCM W;  1ZA1 B;  1RAD B;  2X3W D;  2LTO A;  3CCE T;  4BCH B;  4BY1 X;  1TS9 A;  4HL4 A;  1VQ8 T;  4OGR B;  1IGU A;  5CQY A;  1I07 A;  1JOW A;  1NYG A;  3PVQ A;  1N8R R;  4XU3 A;  4RG8 A;  4FYV B;  7AT1 B;  3CCV Q;  2BE9 B;  2D8H A;  4M7D F;  4XTW A;  2IN3 A;  2BZY A;  1VQO T;  5A0L A;  1QKW A;  3B57 A;  4YOZ A;  1VYU A;  2NUT B;  2ZCF B;  1JSU B;  2F5T X;  4EOM B;  2DD4 A;  2DME A;  4CFW B;  1WJR A;  5IXB A;  2W0Z A;  1QLB A;  4M78 F;  3UDC A;  3LYI A;  3OYA A;  1GUX B;  2RJD A;  1HXD A;  4WCI A;  2IW8 B;  1AWO A;  2PHG A;  3SWN C;  3G71 A;  3JCM b;  3OSV A;  4B6M A;  5GJV B;  1VQP Q;  1RLQ C;  4AFQ C;  2FRW A;  2MYS A;  5GAO r;  1EFN A;  1E6H A;  2AHJ B;  5GAM d;  1NBE B;  5GAO n;  2LP5 A;  2HAX A;  4C0F A;  5ICP B;  1U06 A;  4N4I A;  5KYX A;  1S72 T;  1GCQ C;  4N4H A;  1E9H B;  2FVU A;  2KI7 A;  2YRD A;  1QWE A;  3HL8 A;  1WHK A;  1BU1 A;  2RQW A;  2XIC A;  3CC7 T;  3BG9 A;  1W6X A;  5L23 A;  1FVV B;  1GFD A;  2RHI A;  2J7I A;  3CCU Q;  2HZY A;  3BHU B;  2VGN A;  2LMJ A;  4C5G A;  2VVK A;  2KRN A;  3CME A;  3EFS A;  3PIP A;  1MV3 A;  1UGR B;  1O9K B;  3CCJ T;  3NPF A;  4JS4 A;  4O6J A;  4E7S A;  2W2H A;  1NPR A;  2QEX T;  5KYU B;  4PFZ A;  1OQK A;  1K9M U;  2CH4 A;  1KSW A;  4YOO A;  2RHU A;  3VUZ A;  3QYB A;  2ED1 A;  4JLG A;  1RAE B;  4JRI A;  1U3O A;  3EGX B;  1R0C B;  1ZA2 B;  4EOJ B;  3QXE B;  2F2C A;  1G3Y A;  1M1F A;  2NUP A;  2SEM A;  2RQV A;  1Q86 C;  2EAY A;  1K9M C;  1X2K A;  4J9H A;  3MKD A;  8AT1 B;  3NTK A;  2V26 A;  4BI3 A;  4OB2 B;  4A54 A;  3EG0 A;  3EG3 A;  1SRM A;  2L8D A;  1F1B B;  2DYI A;  3UT1 A;  2XK0 A;  3VYG B;  1UHC A;  1BKB A;  2CZ1 B;  3JRZ A;  3JCM h;  1OV3 A;  4FM4 B;  3CCS A;  2BUD A;  1FXX A;  3O8V A;  4EPC A;  4X9D A;  1U8R A;  3URG A;  3L2U A;  1VIE A;  5LJ5 g;  1W2B P;  4JRQ A;  2D0Q B;  1AZE A;  2J05 A;  2K79 A;  3CCV T;  2K5F A;  5CKE A;  4EMK A;  4NS5 A;  3TSZ A;  5LJ3 h;  3G4S Q;  1M2V A;  1UEB A;  2KBT A;  3QDF A;  3V8J A;  1ZQ1 A;  3GNG A;  3OYB A;  2JW4 A;  1XJW B;  1Y71 A;  3M59 A;  2RHZ A;  2DD5 A;  1CSK A;  4F70 B;  1WQ7 A;  4F14 A;  2PK9 B;  2JMC A;  4PJO C;  1TWB A;  2HQH A;  3NFC A;  2RN8 A;  2QA4 A;  4XU2 A;  4M77 C;  5CR2 A;  2ZPH B;  3G6E Q;  4BCJ B;  1OU8 A;  3DLL A;  1VQP T;  4LXC A;  3I5R A;  2JN0 A;  2E12 A;  5GMK j;  4OMQ A;  4HNU A;  5FU6 B;  2K57 A;  4F7U B;  3MEA A;  4C5H A;  5FU7 B;  4C8Q B;  4HT8 A;  2JS2 A;  2ZPI B;  1QLY A;  3HFO A;  2LRQ A;  2BS4 A;  2V22 B;  4CFV B;  5CYI B;  4J9D A;  1OZ3 A;  5FRO A;  3VKH A;  1BI1 A;  1UFF A;  4HNV A;  2W9F A;  3C95 A;  1GCP A;  3QZ5 B;  1SEM A;  4F7U E;  3PNW C;  1YFN A;  3G33 B;  4C8Q E;  2WHB B;  3CCU T;  2LQN A;  4JX4 A;  2QA4 T;  1IHV A;  2ROT A;  3MEU A;  4XTX A;  1GBQ A;  3ME9 A;  2OI3 A;  4BY6 C;  1VYW B;  3M0S A;  1IGQ A;  1V1C A;  4F7U F;  4CFU D;  1WLP B;  4L6V 5;  3OYN A;  2EJ9 A;  4FX3 B;  2BIV A;  4C8Q F;  2ATC B;  1M90 U;  1PWT A;  1K8A U;  2WIH B;  3L2Q A;  3MIA B;  3RDV A;  3VYH B;  1YBY A;  2O4X B;  3G4S A;  2RJC A;  1IHW A;  2EQJ A;  2QDL A;  2DJQ A;  3CXC P;  1M90 C;  1QCF A;  4MZP A;  3QHR B;  4A4E A;  2OAW A;  2DBM A;  2W96 A;  4EMK B;  2FPD A;  4PNO A;  4X34 A;  4GBQ A;  3K7A M;  1Q7Y R;  4X9C A;  1YJN A;  1M1K R;  1UB4 A;  1GCQ A;  4QVZ A;  3CXC A;  2DNU A;  3QYE A;  4MML A;  1H1S B;  2EGA A;  4L5G A;  4C92 A;  2CP6 A;  4M75 D;  3X28 B;  3D7S B;  4AKH A;  1JKW A;  2D0N A;  1KD1 R;  5GAM f;  2W10 A;  1GBR A;  3LQ5 B;  4Y91 A;  3RER A;  3OW2 S;  3QSU A;  2P0K A;  2KQW A;  3ZL7 C;  4MZT A;  5GAO p;  1C0M A;  3IQL A;  2K4Y A;  1GRI A;  4MFD A;  4KRT A;  3QWX X;  4KRD B;  1FMW A;  4OGC A;  2EYZ A;  4PK4 A;  1I5L A;  4MIM A;  3CBP A;  4M75 G;  1WHH A;  3G4S T;  1AEY A;  2RI5 A;  3CCQ Q;  3I35 A;  2PVO B;  5I2S A;  2VV5 A;  5C0M A;  2KRO A;  5CKH A;  3TRE A;  1ZSZ B;  1N9R A;  1NEG A;  1LCK A;  4FYX B;  1KG1 A;  3I56 A;  2PZ1 A;  2IVW A;  2QQS A;  4DBQ A;  1WXB A;  1UNG D;  2DTH A;  5EFQ B;  4RTV A;  1JST B;  4M7A D;  1OI1 A;  2E1H A;  3MY1 B;  4V2S A;  2BKZ B;  1YP5 A;  5FRM A;  3BHT B;  1X69 A;  2BE7 D;  2JUF A;  3LGF A;  1VQL Q;  2C5N B;  4EOS B;  4JJN K;  3TNH B;  1NG2 A;  1ENW A;  3OYM A;  2ZZD A;  4M7A E;  3BW1 A;  3UAT A;  2XHC A;  1ZBJ A;  3PMT A;  5C6S A;  4XU0 A;  2DXU A;  2L3Q A;  3CD6 A;  1VA7 A;  1ZHI A;  2FPE A;  1GH6 B;  1K4U S;  1NJI R;  4M7A G;  2LCS A;  2Z0W A;  4VUB A;  2QQ8 A;  4Q5W A;  3MI9 B;  1OOT A;  2CUB A;  2HMA A;  3AT1 B;  5IHN A;  2O2O A;  1KC8 U;  2FZK B;  1Y96 B;  4EOK B;  3GOX A;  1ZLM A;  4Z8A A;  3JV3 A;  4PJN A;  2K7A A;  2SRC A;  2DEU A;  1ZUY A;  2LT4 A;  3I56 T;  1D3B B;  1Q82 U;  4HA8 A;  3OBY A;  1KC8 C;  2W99 A;  2M1H A;  2X51 A;  1PD0 A;  2JXB A;  1H8K A;  5L8R E;  1WXU A;  2FZC B;  3EAE A;  1OEB A;  3EGD B;  3H0H A;  1B34 B;  4A63 B;  1Q82 C;  1VQN Q;  2L5Q A;  4ESR A;  3MP6 A;  4E2F B;  1I1J A;  3CD6 T;  2ZAE A;  2Y4Y A;  2MCN A;  1D0Z A;  3VJP A;  2MF2 A;  3DKM A;  1K73 U;  2D8J A;  1YI2 Q;  1D09 B;  2B9R A;  1NEB A;  2A36 A;  2YLC A;  4NC6 A;  4FYW B;  2DKG A;  3M57 A;  3JB9 D;  4HLQ A;  4EDU A;  3TW7 A;  4OVA A;  5GAM e;  1QVF A;  5GMK m;  1BIA A;  4C0G A;  4JRK A;  4IUU A;  3EFO B;  1K73 C;  2WSC E;  2ENM A;  2KY9 A;  2C5O B;  2K5I A;  1Q81 C;  2HCK A;  4N0A C;  1YCS B;  2DFU A;  1PD1 A;  4I3Z B;  3CQT A;  4LDU A;  4CFN B;  2G3R A;  4C92 F;  4IMY B;  2F2X A;  2WIP B;  3JB9 G;  2D6F A;  1H1R B;  1H28 B;  1SSH A;  2CZ6 B;  4EON B;  1BB9 A;  1EX4 A;  1M27 C;  2ZZD B;  4ZN1 A;  1W70 A;  3GP8 A;  4KUL A;  2IW9 B;  3S3N A;  1GL5 A;  2LQW A;  4BB7 A;  3CCQ T;  3VS6 A;  3BY7 A;  2MK5 A;  3M9Q A;  4XK8 E;  1U1S A;  5GAN 6;  4CFM B;  3RKX A;  5FLX E;  2XI9 A;  1UUE A;  4BDZ A;  1R8O B;  3C0C A;  2QDJ A;  2DMO A;  4BCO B;  3F70 A;  2OX7 A;  2KK4 A;  4F7L B;  2BS3 A;  2K3Y A;  4ZTF A;  1S1N A;  2LCC A;  4BCQ D;  2RHY A;  1YJ9 Q;  1JU5 C;  4JZ4 A;  1PRL C;  2KDS A;  2AT1 B;  2JNG A;  2KXC A;  4PJO D;  5GAN d;  1BIB A;  4C8Q C;  1DJ7 B;  2MIO A;  2KMG A;  3J81 E;  2VB6 A;  3SD4 A;  2KE9 A;  3OS1 A;  1PSE A;  4IIO A;  3PT9 A;  2FYK A;  2GGR A;  3LH0 A;  4Z89 A;  1UGP B;  4IUP A;  1E7O A;  4PJO G;  1T0H A;  2PUO B;  4BCN D;  5LJ3 j;  3RKW A;  5D6X A;  4E6R A;  4CC2 A;  3CEY A;  3CCE A;  5GAN 8;  3BHV B;  1VQ8 A;  4QQ6 A;  3UPU A;  4Z02 A;  3H41 A;  4WTO B;  1M3A A;  2WEV B;  4FSS A;  4F7N B;  1BCM A;  3A8G B;  3VV0 A;  3L1A A;  1VQN T;  2HKN A;  3JB9 H;  3UF4 A;  5KYW A;  1MND A;  2HBP A;  3EH1 A;  2HSP A;  3JCM P;  1WFW A;  4E47 A;  4AFU C;  5IHK A;  1VQO A;  1OX8 A;  5IHY A;  1VQ5 A;  4J7F A;  2RO0 A;  1YI2 T;  2CP2 A;  2RK1 A;  4BI8 B;  4M75 C;  3EGU A;  4IIM A;  2EKH A;  1UGQ B;  2KT8 A;  3F5X B;  4LD6 A;  3O0G D;  5IH2 A;  2DIQ A;  4AT1 B;  3H8Z A;  1C9B A;  3OMC A;  5KYY B;  3CCR Q;  3SFM A;  3CPW A;  1RAG B;  1RI9 A;  4KGZ B;  2O31 A;  3OYK A;  1F5Q B;  4PFO A;  2OJ2 A;  3PFS A;  1G3W A;  3BLQ B;  5CAI A;  1A0N B;  1BI2 A;  5HQ0 B;  3LWH A;  4NST B;  1ZSG A;  2E6N A;  4M7D E;  2L3R A;  4JUV A;  1TOV A;  3KUF A;  4KGX B;  2QDY B;  4M78 D;  2IG0 A;  3I55 Q;  4OB3 B;  3M54 A;  4CXA B;  1SKU B;  2M16 A;  1K1Z A;  4ORZ A;  2CT3 A;  1JJ2 P;  1NLP C;  4FYY B;  2XKO C;  2QQR A;  2MPX C;  1S72 A;  2VC8 A;  4M78 E;  1AIS B;  1G83 A;  3V8K A;  2BKD N;  4M7A C;  3QHS A;  2R7G A;  2EVR A;  4E7J A;  1VQ5 T;  3OYC A;  1ZSZ C;  3CC7 A;  4M78 G;  4OB1 B;  4OF1 A;  4J9C A;  1LOJ A;  1MNE A;  1LVK A;  4XTU A;  3DB3 A;  3QO3 A;  1X43 A;  3NTH A;  2UZD B;  3ZBD A;  3EG9 A;  3ULR B;  1VQM Q;  1QVG S;  4XU1 A;  2YDL A;  2MMP A;  1YJ9 T;  5GAO q;  1VOL A;  1D0X A;  5FWC A;  4ELZ C;  3CCJ A;  1E7P A;  1RAA B;  5AYF A;  2O01 E;  1ABO A;  3ER0 A;  3LW5 E;  2QEX A;  2DE0 X;  4OMN A;  2IVX A;  3UA7 A;  1MMG A;  1MMD A;  4F6U B;  1VIN A;  4HKE A;  2LVM A;  3QWL A;  2EQM A;  2DXC B;  3DOG B;  3OYF A;  3QYG B;  1X75 C;  4BBS M;  1PHT A;  1ACM B;  2IIM A;  4CC4 B;  2LQK A;  3GPL A;  5CKF A;  2P0P A;  2RPN A;  1W1F A;  5DQW A;  1OU9 A;  3OQ5 A;  2R5M A;  3VS5 A;  1B07 A;  4E7L A;  1H1P B;  3QZ9 B;  3GIB A;  3CBM A;  4WF2 A;  2BZ8 A;  5GAM h;  5GAN 2;  1H27 B;  2PVG B;  3E9F A;  1YIT Q;  2JM8 A;  4YTL A;  4LUE A;  5DQV A;  2DL7 A;  4IUR A;  4BD3 A;  1OGU B;  1AD6 A;  1HJD A;  4P5N A;  1VQ6 Q;  3JCM g;  2RD1 A;  3CCV A;  3GLX A;  1D0Y A;  1Q86 U;  2CSQ A;  3RKY A;  4Z6Y A;  4OGE A;  1AT1 B;  3CMA Q;  5KYN A;  3PE0 A;  3TEE A;  2BZX A;  5LJ3 g;  2FG0 A;  2ZPG B;  3BLR B;  3EJ1 B;  5HBH B;  1WXT A;  2UZB B;  3CCR T;  1QVG P;  1VQM A;  4EIK A;  4BUG A;  2V8J A;  3A8M B;  5GAN f;  2DD4 B;  1H1Q B;  1VQP A;  1WNL A;  2R5A A;  1LJO A;  1U5S A;  1R0B G;  2EYW A;  3I55 T;  1W98 B;  2J6K A;  4DBH A;  4DEY A;  3A1P A;  1RL2 A;  1AWX A;  1UNL D;  2CYZ B;  1PC0 A;  2PVD B;  2QG9 B;  3M58 A;  2EYY A;  2RM4 A;  3EID B;  3X20 B;  2HEQ A;  4KBM B;  2YUN A;  1URC B;  1K9A A;  2DL3 A;  5GMK i;  2LX7 A;  1OL1 B;  3EOC B;  4MDX A;  1W2B A;  2D9T A;  4Y28 E;  5LMK B;  1VYV A;  4ELY C;  1PKT A;  1YNZ A;  5KYX B;  2XDP A;  4BXX X;  2LC4 A;  3TNW B;  4IKF A;  1M8M A;  1KHC A;  2DIG A;  4JZ3 A;  3CCU A;  3C4S A;  4M75 A;  1VQM T;  1YIT A;  3KFV A;  2RH2 A;  2LJ3 A;  3GNF B;  1RAH B;  3RMQ A;  1QW1 A;  5LJ5 d;  1JO8 A;  1KQS S;  4O5V A;  2JT4 A;  3QBY A;  4ATO A;  1H3Z A;  4XQ3 A;  4D8K A;  3VKI A;  1X01 A;  4L59 A;  1JQQ A;  1AWJ A;  2O9V A;  1HYO A;  3THK A;  2CT4 A;  4LDX A;  2J6O A;  3R6O A;  4C8Q D;  4AG1 C;  1O75 A; 
#chains in the Genus database with same CATH homology
 4EMH A;  4Q5W A;  1BYM A;  1JJ2 S;  2JVV A;  3FJP A;  4HCZ A;  1KQ1 A;  3ASK A;  1KC8 U;  2E5Q A;  1XTD A;  1W2B S;  1Y96 B;  4M7A A;  2KMT A;  3LLR A;  2M9U A;  3HZJ A;  4M77 E;  4C0D C;  2A7Y A;  3GOX A;  4JX5 A;  3OYY A;  5M9O A;  2OAU A;  4MDW A;  3I55 A;  5KCH A;  5IN1 A;  2LT4 A;  3I56 T;  1D3B B;  5CKB A;  2ZPE B;  3QUI A;  4C92 C;  4F7U G;  4HA8 A;  1YIT T;  1Q82 U;  4QVC A;  2R57 A;  4QQG A;  4FIB A;  3V7C A;  1RI0 A;  4ELJ A;  3OBY A;  1ZBX A;  2HD0 A;  4NL2 A;  4M77 G;  1KC8 C;  3V8L A;  2M1H A;  4C8Q G;  1UGS B;  4C0D B;  3HB9 A;  5L8R E;  5A0D A;  5GAN 7;  1VQ6 T;  3OY9 A;  3SWN A;  3DB4 A;  3EAE A;  3FRN A;  4C5I A;  2XD0 A;  4F7U A;  2WAC A;  1B34 B;  2LCL A;  1Q82 C;  3FLG A;  3T9N A;  1VQK A;  4BY6 B;  3G71 T;  2L5Q A;  2EJG A;  4JS5 A;  4KUD K;  4M7D C;  3MP6 A;  2DXC A;  2X4X A;  4C8Q A;  3CCL A;  1I4K 1;  5GAN e;  4HCB A;  2PUK B;  3CD6 T;  2Y4Y A;  2Y90 A;  3BDL A;  2G77 A;  2X4W A;  4J7I A;  2QXF A;  2EFI A;  3VJP A;  2MF2 A;  3DKM A;  4GY5 A;  5A2Q E;  1K73 U;  2X4J A;  4PL6 A;  5LJ5 j;  2PQW A;  3R6O A;  3P8H A;  2PU9 B;  2HQX A;  3RUX A;  2RK2 A;  1XQH A;  3OS2 A;  2YLC A;  4ME7 A;  4NC6 A;  4M78 C;  2DKG A;  3M57 A;  2C06 A;  2MI6 A;  4BE1 A;  5KCO A;  3JB9 D;  4HLQ A;  4EDU A;  3TW7 A;  4OVA A;  5GAM e;  4FL6 A;  1QVF A;  3RES A;  5GMK m;  4C0Z A;  1BIA A;  4C0G A;  4JX6 A;  3JCM d;  4JRK A;  3G6E A;  2DD5 B;  4IUU A;  1BI3 A;  2FHD A;  1K73 C;  3CPF A;  4PKC C;  2WSC E;  4RMO A;  4MZM A;  3VKG A;  1HK9 A;  3H6Z A;  1QVG A;  2KY9 A;  1VUB A;  2DVE A;  1N6A A;  2K5I A;  2DXB A;  4GLK A;  3P8D A;  3JB9 I;  4M78 B;  1U1T A;  1NE8 A;  3JCM c;  3FB9 A;  1Q81 C;  2VYT A;  4N0A C;  3JCM W;  2LTO A;  3L2R A;  4LDU A;  3VUB A;  3CCE T;  4MFE A;  5GAN 3;  2G3R A;  4C92 F;  4HL4 A;  3JB9 G;  2WJ9 A;  4N4G A;  5LJ3 d;  3OYE A;  1VQ8 T;  4J6X A;  2D6F A;  5I21 A;  5CQY A;  3HFN A;  2DK3 A;  2CZ6 B;  2M0O A;  1NZ9 A;  3HRU A;  2H3J A;  3FDR A;  4B9W A;  1VQK T;  2ZGW A;  2O4X A;  3GF5 A;  2ZZD B;  4XU3 A;  4RG8 A;  3CME T;  4A4F A;  3OB9 A;  4ZN1 A;  3GP8 A;  2E6Z A;  4KUL A;  4NOY A;  3S3N A;  1Y7X A;  4M7D F;  1QP3 A;  4BB7 A;  3CCQ T;  3JCM J;  4XTW A;  2DAQ A;  1VQO T;  4UC4 A;  3BY7 A;  1XNI A;  3E9G A;  3M9Q A;  5A0L A;  4XK8 E;  3A8L B;  1U1S A;  5GAN 6;  3RKX A;  5FLX E;  4ZGJ B;  2XI9 A;  4BDZ A;  1R8O B;  2ZCF B;  2F5T X;  2QDJ A;  2DD4 A;  3F70 A;  1WJR A;  2GF7 A;  5GMK e;  1M5Q 1;  1QVF S;  3G6E T;  1QLB A;  4M78 F;  2CS7 A;  2KK4 A;  3UDC A;  4ZTJ A;  1IRE B;  2BS3 A;  2K3Y A;  1WPY A;  3LYI A;  3OYA A;  3X25 B;  2LCC A;  3CXC S;  2LX9 A;  2QF7 A;  1IZ6 A;  1HXD A;  2RJD A;  4IUQ A;  4JRP A;  2E41 A;  2RHY A;  4HCC A;  3KHI A;  1G3T A;  3SWN C;  3G71 A;  3JCM b;  3OSV A;  2KDS A;  5CCA A;  2JNG A;  4PJO D;  3AHU A;  1N27 A;  3MP1 A;  3HO8 A;  5GAN d;  3L2V A;  3CMA A;  1JB0 E;  1BIB A;  1M1G A;  4E7K A;  1PSF A;  2DZ9 A;  4C8Q C;  1DJ7 B;  1KHI A;  2KR6 A;  4CI0 C;  2KMG A;  5GAO r;  5LJ5 h;  4RCB A;  3J81 E;  5HY6 A;  3CCS T;  3SD4 A;  3ZFJ A;  3RMS A;  1XOV A;  3OS1 A;  3L2Z A;  3J7A F;  1PSE A;  2AHJ B;  3HKS A;  5GAM d;  2RJE A;  1P92 A;  5GAO n;  3PT9 A;  2OTL T;  2FYK A;  3LH0 A;  2HAX A;  2P4T A;  2QQ9 A;  4A4G A;  1UGP B;  4IUP A;  4A4H A;  4C0F A;  4N4I A;  1YHQ T;  1S72 T;  3N5B B;  4N4H A;  4PJO G;  3M5A A;  4CRI A;  3HBL A;  5GAO l;  1FX7 A;  2PUO B;  2XDB A;  2FVU A;  5GAN 4;  5LJ3 j;  3RKW A;  5D6X A;  2GFA A;  1QP2 A;  2X35 A;  3HL8 A;  3INZ A;  3BG3 A;  2DZC A;  3CEY A;  3A8H B;  3E19 A;  2XIC A;  3CC7 T;  3CCE A;  2XU8 A;  4LDY A;  1YJW T;  3BG9 A;  4ZGE B;  5GAN 8;  1H64 1;  2JTF A;  3CCM T;  4PJO A;  1VQ8 A;  4XAX B;  4QQ6 A;  4D6W A;  3S3M A;  3LWI A;  3UPU A;  2RHI A;  4Z02 A;  2EYQ A;  2BS2 A;  3Q1J A;  4C92 B;  3H4C A;  2KVQ G;  4M77 A;  5LL6 S;  3PIO A;  2VGN A;  2K3X A;  2WSE E;  4C5G A;  2DXB B;  3A8G B;  2K2V A;  3L1A A;  3VV0 A;  3HSB A;  3CME A;  2F69 A;  2K5L A;  3A5Z B;  3LGL A;  5HK0 A;  3EFS A;  3OW2 A;  3PIP A;  1VQN T;  4DA4 A;  3JB9 H;  1UGR B;  4DOW A;  3CCJ T;  3CMA T;  3E1S A;  2HBP A;  2XG8 D;  4JS4 A;  4AKG A;  3KXT A;  5J26 A;  3JCM P;  1M8V A;  4ZGD B;  4O6J A;  1NPP A;  3CCQ A;  1V29 B;  1NPR A;  2EJF A;  4E47 A;  3S6W A;  5IAY A;  3FC3 A;  2QEX T;  2E64 A;  1X6O A;  1VQO A;  1NJI C;  2DO3 A;  1JRI A;  2E70 A;  4OP0 A;  1VQ5 A;  1K9M U;  3QJY A;  1Q81 U;  4J7F A;  2RO0 A;  2RHU A;  1YI2 T;  4J83 A;  3VUZ A;  3QYB A;  4II1 A;  2RK1 A;  4JLG A;  4BI8 B;  4M75 C;  4JRI A;  1UGQ B;  4LOC A;  4LD6 A;  4MMK A;  3QXE B;  4VUB A;  5D6W A;  3CBO A;  1Y96 A;  2QQA A;  4C92 E;  5LJ5 f;  5DM7 R;  2XDD A;  2DIQ A;  3H8Z A;  1G3Y A;  1M1F A;  3ZEH A;  2B8A A;  5DLO A;  5GAN j;  1Q86 C;  3OMC A;  2RJF A;  2EAY A;  3SFM A;  3CPW A;  1K9M C;  1VQL A;  1K8A C;  2EWN A;  1VQ9 T;  4LDW A;  4J6W A;  1D3B A;  1LNX A;  1WGS A;  4J6Y A;  3OYK A;  3L2W A;  3OMG A;  3NTK A;  4BI3 A;  3PFS A;  4OB2 B;  1G3W A;  5CAI A;  3JCM V;  4M75 B;  4A54 A;  5EJC A;  1SSF A;  1BI2 A;  5A0G A;  2LT1 A;  2L8D A;  5KE3 A;  1VQ4 T;  4OB0 B;  3LWH A;  3OBW A;  3UT1 A;  1YIJ A;  2QQB A;  2RA2 A;  3LX7 A;  5GAM j;  2E6N A;  2XK0 A;  4M7D E;  3VYG B;  2L3R A;  3WXM B;  3MHX A;  3OS5 A;  4JUV A;  1BKB A;  3KUF A;  4NL3 A;  2QDY B;  4M78 D;  2IG0 A;  1KQS A;  4OB3 B;  3M54 A;  2CZ1 B;  3JRZ A;  3A8O B;  3M4G A;  3JCM h;  4FM4 B;  2QFZ A;  1B34 A;  2BUD A;  1FWZ A;  1FXX A;  3CCS A;  3TU4 K;  3MET A;  3HP9 A;  3QG1 A;  3QYH B;  4E7I A;  2M16 A;  3O8V A;  4FT2 A;  4EPC A;  2RI2 A;  3PGG A;  4X9D A;  5KH6 A;  2OTL A;  1Q7Y U;  5DLQ E;  2XKO C;  2QQR A;  1U8R A;  3URG A;  3G7Z A;  3L2U A;  1VIE A;  1N9S A;  1YHQ A;  2VC8 A;  4M78 E;  5LJ5 g;  1S72 A;  4BI4 A;  1M1K U;  4BE2 A;  4JRQ A;  4HT9 A;  2D0Q B;  3DL1 A;  2BKD N;  3V8K A;  2K5F A;  3CCV T;  4M7A C;  4M75 E;  2ZPF B;  2RB6 A;  5KE2 A;  3QHS A;  5CKE A;  4EMK A;  2YHT A;  2LQ8 A;  1I81 A;  4QQD A;  3HHT B;  4E7J A;  1VQ5 T;  2LNV A;  4NS5 A;  4IUV A;  3OYC A;  1I8F A;  2L89 A;  5LJ3 h;  3JB9 F;  1UEB A;  1Q7Y C;  3CC7 A;  4M78 G;  1YJW A;  3V8J A;  4OB1 B;  1ZQ1 A;  3GNG A;  4OF1 A;  3OYB A;  1KD1 U;  1M1K C;  1LOJ A;  1Y71 A;  3CCM A;  3BG5 A;  3M59 A;  2DD5 A;  2RHZ A;  3MEV A;  4IUT A;  1WQ7 A;  5GAN g;  3OYH A;  2CGH A;  3CC2 T;  2LDM A;  2HQE A;  4XTU A;  3DB3 A;  3M56 A;  2EKO A;  3OSS C;  2CZ7 B;  3QO3 A;  4M75 F;  4M7A B;  4PJO C;  3S3O A;  3NTH A;  3ZBD A;  5GMK l;  1MGQ A;  2P0Q A;  1VQL T;  5FU6 C;  4ZN3 A;  1QVG S;  2DPP B;  3NFC A;  4XU1 A;  3RIR A;  2MMP A;  4PJO E;  2E10 A;  4BBR M;  3OA6 A;  1YJ9 T;  2YRV A;  1QVP A;  5GAO q;  1KD1 C;  1VQN A;  3EFR A;  4A4K A;  4XU2 A;  2QA4 A;  4J8O A;  4M77 C;  4ELZ C;  5CR2 A;  2ZPH B;  1E7P A;  3CCJ A;  5AYF A;  5FU7 C;  4OMF B;  3DLL A;  3FEO A;  1YIJ T;  1YJN T;  2V8K A;  2O01 E;  3ER0 A;  4J5Y A;  4PJO B;  3LW5 E;  1VQP T;  2QEX A;  2JN0 A;  2E12 A;  5GMK j;  4R56 A;  5HKC A;  3CC4 A;  4HNU A;  5FU6 B;  3SWN B;  3BDU A;  3SB2 A;  2K57 A;  3MCA B;  5J3B A;  4F7U B;  1WJS A;  1YI2 A;  4HKE A;  3MO8 A;  2LVM A;  3MEA A;  3QWL A;  4M77 B;  4C5H A;  3OYD A;  3X26 B;  2EQM A;  3M53 A;  5FU7 B;  2DXC B;  1AHJ B;  4C8Q B;  2ZPB B;  3OYF A;  3QYG B;  3OYG A;  5J39 A;  4HT8 A;  1X75 C;  3JCM f;  4B9X A;  3PMI A;  3SDZ A;  4BBS M;  2ZPI B;  4XTZ A;  3OS0 A;  2MWO A;  3HRS A;  2EIF A;  4PLL A;  5HK3 A;  5GAN h;  2LQK A;  2KSS A;  3GPL A;  4QSH A;  3HFO A;  2LRQ A;  2BS4 A;  5CKF A;  5CQX A;  2DTO A;  1VQ9 A;  1Y07 A;  2P0P A;  2VXF A;  1M9S A;  2JTM A;  1G3S A;  3M4Y A;  3OQ5 A;  3JAM E;  4M7A F;  1OZ3 A;  2R5M A;  5FRO A;  3VKH A;  1BI1 A;  1W4S A;  4BAC A;  2QI2 A;  4HNV A;  5IT9 E;  3C95 A;  1VQ4 A;  3QKJ A;  3WVE B;  2A3L A;  4E7L A;  2V8I A;  2VUB A;  3QZ5 B;  5I2M A;  4F7U E;  3QZ9 B;  5CK9 A;  3CBM A;  3GIB A;  4WF2 A;  3PNW C;  5GAM h;  3OYL A;  5LJ3 f;  5GAN 2;  5DY9 A;  2PVG B;  3MEW A;  1NJI U;  3E9F A;  2WSF E;  4C8Q E;  4BE0 A;  4YTL A;  1JBM A;  2GCX A;  2NLU A;  3CCU T;  4PJO F;  4JX4 A;  2QA4 T;  4XTX A;  4IUR A;  3MEU A;  3ME9 A;  4BD3 A;  4BY6 C;  4TVR A;  1O9S A;  2GFU A;  4JDS A;  4P5N A;  3JCM g;  4F7U F;  5LJ5 e;  2RD1 A;  1EIF A;  4L6V 5;  3OYN A;  3CCV A;  2EJ9 A;  5FRN A;  4C92 D;  4M77 F;  3GLX A;  5EG2 A;  2BIV A;  2F5K A;  4C5E A;  1Q86 U;  3RKY A;  3CC4 T;  4LDV A;  4C8Q F;  1M90 U;  2OTJ T;  2QTX A;  2RI3 A;  1K8A U;  3L2Q A;  2X4Y A;  1GXI E;  4Z6Y A;  4EMK C;  4OGE A;  4LD9 K;  4FU6 A;  3VYH B;  3KBG A;  1YBY A;  2O4X B;  3FIF A;  4EMG A;  3G4S A;  2RJC A;  3CC2 A;  4ZTF A;  2EQJ A;  5CKD A;  3TEE A;  3QJ6 A;  5LJ3 g;  4KT0 E;  2I2L A;  3C12 A;  1M90 C;  4M7D D;  2ZPG B;  2E65 A;  4MZP A;  4A4E A;  4R55 A;  4DOV A;  4PLI A;  4EMK B;  2EQU A;  3JSC A;  2CKK A;  3MP8 A;  4PNO A;  5D6Y A;  4C92 G;  4X34 A;  3CCR T;  1YJ9 A;  4A53 A;  4M7D B;  1VQM A;  4RKU E;  3V7S A;  4X9C A;  4BUG A;  2V8J A;  2VXE A;  3A8M B;  5GAN f;  1UB4 A;  1YJN A;  2DD4 B;  1VQ7 T;  3L42 A;  1FKM A;  2DEQ A;  4QVZ A;  1YCY A;  3CXC A;  1VQP A;  3QYE A;  2GQV A;  1WNL A;  3HPW A;  4MML A;  2R5A A;  4L5G A;  1LJO A;  4HNT A;  4QVD A;  5GMK h;  4KUI A;  4C92 A;  2MWP A;  4M75 D;  3X28 B;  1MHN A;  3I55 T;  2CZ0 B;  1RL2 A;  3QPH A;  2CYZ B;  4AKH A;  3VU3 C;  2PVD B;  5GAN 5;  4JLI A;  5GAM f;  2RHX A;  1VQ6 A;  4M7D G;  3M58 A;  4Y91 A;  1M4Z A;  3RER A;  3OW2 S;  1G5V A;  3QSU A;  1OZ2 A;  2P0K A;  2RM4 A;  3QDR B;  2DTI A;  3X20 B;  1TH7 A;  5CO7 A;  1WJQ A;  4KBM B;  4FSX A;  3UWN A;  3M55 A;  4QW2 A;  1OYX A;  3NTI A;  4FT4 A;  2KQW A;  2R58 A;  4MZT A;  5GAO p;  2HNI A;  4BDY A;  2K4Y A;  2JZ2 A;  4MFD A;  4M7D A;  5GMK i;  1JJ2 A;  4OGC A;  3V7R A;  3PTA A;  1I5L A;  3OYJ A;  5GAO m;  4MDX A;  1W2B A;  2D9T A;  2FB7 A;  4MIM A;  3CBP A;  4M75 G;  3G4S T;  4Y28 E;  4ELY C;  3CCL T;  2RI5 A;  3X24 B;  2PVO B;  5I2S A;  2XDP A;  2VV5 A;  5CIU A;  1VIF A;  2MAM A;  5C0M A;  4DQ2 A;  2KAF A;  2EQK A;  2LC4 A;  4AI6 A;  5CKH A;  3TRE A;  4IKF A;  1N9R A;  4M78 A;  1KHC A;  2DIG A;  3CPW S;  3CCU A;  1KG1 A;  4XTY A;  3I56 A;  3C4S A;  1KQ2 A;  2IVW A;  2QQS A;  4M75 A;  1VQM T;  1YIT A;  4RCC A;  3JCM Q;  5GAM g;  1N8R U;  2DTH A;  2RH2 A;  3OYI A;  3GNF B;  1VQ7 A;  4M7A D;  1OI1 A;  3RMQ A;  1QW1 A;  2E1H A;  3JCM e;  5CVI A;  5LJ5 d;  4V2S A;  3DLM A;  3VYG A;  5FRM A;  3LGF A;  2JUF A;  1BI0 A;  3TW6 A;  2OTJ A;  1KQS S;  4O5V A;  4JJN K;  3QII A;  4N0A A;  2DXT A;  3QBY A;  4XTV A;  3OYM A;  4E7H A;  2ZZD A;  2XID A;  4ATO A;  3BW1 A;  2JOY A;  3P8B B;  1N8R C;  2XHC A;  3PMT A;  4M7A E;  1H3Z A;  2VGM A;  5C6S A;  4M6V A;  2DJZ A;  3BFM A;  4XQ3 A;  3VKI A;  1X01 A;  2DXU A;  4XU0 A;  2YLB A;  3CD6 A;  4L59 A;  3TCJ A;  1ZHI A;  4AKI A;  3HRT A;  4RG2 A;  3C94 A;  5LJ3 e;  3J80 E;  3WVD B;  3JB9 J;  4M7A G;  3JCM X;  2FL7 A;  4LDX A;  4M77 D;  3CCR A;  1WQW A;  4C8Q D;  2Y4X A;  1O75 A;  2QQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...