2CZ1B

Photo-activation state of fe-type nhase with n-ba in anaerobic condition
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title photo-activation state of Fe-type NHase with n-BA in anaerobic condition
rcsb
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2cz1B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cz1B02
2CZ1B 2DD5B 1QP2A 2ZPEB 1GXIE 3X28B 4KT0E 2CZ0B 2ZPGB 2ZPBB 2WSFE 1UGRB 1UGPB 3VYGB 1IREB 3A8LB 3WVDB 4Y28E 3X26B 3A8GB 3LW5E 3VYGA 4FM4B 3A8MB 2DD4B 2ZPHB 2DD5A 2CZ7B 2ZPFB 2PUOB 3A8HB 2DXBB 2PVGB 3A8OB 4L6V5 1UGSB 2ZZDB 2O01E 2PUKB 3QYHB 3QYGB 2D0QB 2CYZB 1V29B 5L8RE 3HHTB 1PSFA 2ZZDA 2WSCE 2PU9B 4OB0B 1PSEA 2DXCB 3X24B 3X25B 4ZGJB 4OB2B 2WSEE 1AHJB 3WVEB 2PVOB 3VYHB 1JB0E 4ZGEB 3QZ9B 2DD4A 4RKUE 1DJ7B 2ZCFB 2PVDB 3QXEB 2QDYB 2AHJB 2ZPIB 4OB1B 2CZ6B 2DXBA 3X20B 4ZGDB 2DXCA 4XK8E 1QP3A 4OB3B 2DPPB 3QZ5B 1UGQB
chains in the Genus database with same CATH superfamily
2XG8D 2XIDA 4JX5A 2JMAA 4ESRA 1VQMA 4AFSC 1Y57A 3QBYA 3KXTA 1OIUB 2QTVA 2DERA 2ECZA 1RI9A 4Y72B 3V7SA 1OPLA 2YHTA 5L2WB 2CJMB 2LJ0A 2A7YA 3V8LA 4X34A 4D8KA 4MDWA 2ABLA 3QJ6A 2PTKA 3FJ5A 3CCUA 2E41A 2C6TB 2E3IA 3CCRQ 4OP0A 4EMKB 1QVPA 2YXYA 1HJDA 4N4GA 4M7AG 3DJBA 1VQLT 1OYXA 3TW6A 1Q82R 5GMKl 3HBLA 1WDXA 2WXVB 1R77A 2RM4A 1LOJA 4M7AC 2XKOC 2YSQA 4F6WB 1U3OA 4OMOA 2QA4Q 2QA4T 4M7DB 2DD4B 1BCMA 2LQ8A 4OMNA 1H3ZA 4CC7A 4M7DG 4M7DE 5HCKA 2DXBB 3AT1B 1RLQC 1BK2A 4M7DA 1M8VA 1Q81C 5CYIB 2ZZDB 4M78C 1YIJT 2X4XA 4E7JA 1W4SA 3OYAA 2WMBB 4KRTA 3QKJA 5FWBA 2CYZB 2DRMA 3ASKA 3UPUA 4DEXA 2W10A 1D0XA 1AZEA 2KRNA 1WQ7A 5IT9E 1VQ9T 1PSEA 1QMZB 2L3QA 4ROEA 4P5NA 3EG2A 2WSEE 2QAZA 2FG0A 5CO7A 3EG9B 2O4XB 4A4GA 4F70B 4C0DB 3F5XB 2EQMA 2MF2A 1TG0A 3DOGB 4J9EA 4QVZA 2ZCFB 1OIYB 3BY7A 4AMCA 3L2ZA 3OYFA 2EFIA 2RHYA 5GAN7 4ZGDB 2DAQA 3I56Q 3L42A 1I5OB 1KD1R 3PVLA 1W6XA 1Y96A 5IF1B 2XU8A 3G6EQ 1QVGA 3DLMA 1M4ZA 4PKCC 3VRZA 1YI2A 4JS4A 2DD5B 2XD0A 4V2SA 4M6VA 3OMCA 3PFSA 4F16A 3CMEQ 1RABB 4IURA 4LD6A 1K4US 1JU5C 4DBFA 4M77G 1X2KA 3URGA 5IXBA 4JX6A 3LYIA 4NS5A 2DBKA 1WXTA 2OTLQ 1SHFA 2CREA 3FLGA 3GBQA 2AT1B 3WVDB 2COZA 3BDLA 1U8RA 2E10A 3LLRA 3META 2V8IA 3RERA 4CFUB 2LNVA 4C92G 1TSFA 1XO2A 2M51A 1P5EB 2HSPA 2YLBA 3BHTB 4A4EA 1PKDB 3HO8A 2FZCB 1MMNA 2BUDA 5HQ0B 4O5VA 4E6RA 3A8MB 1QVFS 4MZPA 4EMKC 3OB9A 2DLPA 4AFQC 3ZEHA 4D8DA 2RK1A 1KHCA 4NL3A 2C0TA 4Z6YA 4QVCA 3A5ZB 3A8OB 5A0DA 5GAMh 1WHGA 1VQPA 4FCYA 5GAOr 4M4ZA 4DOVA 3OYGA 3TSWA 2KSSA 2L3RA 3BLRB 1K9AA 1UDLA 4IUUA 2CT3A 3CPWS 5FGKB 2DJQA 3CMET 3MP8A 3G71A 4UC4A 2IN3A 3X25B 2XHCA 2EYXA 4CFVB 3CCQQ 4OB2B 2QQBA 2PK9B 3PIPA 3HPWA 2F2WA 2KQWA 1N8RU 1WIEA 2O88A 2X35A 1ENWA 2XDBA 2DYBA 4L59A 3VJPA 4AFUC 3C0CA 3CCLQ 5J26A 1JOWA 2LQKA 2JS0A 5BNJB 5CR2A 2EGCA 4GLKA 2EVRA 2FZKB 3JCMh 3QUIA 2LDMA 1TH7A 3PT9A 2GTJA 1K8AC 4C5GA 4PFPA 4J9GA 1RAAB 2KAFA 4XTXA 2LX7A 3REAB 1VQ5T 2LQNA 1FVVB 2DTHA 2OX7A 1GBRA 1AISB 1UJYA 2WMAB 2DYIA 5IHIA 2ZPBB 2RF0A 2M0OA 3QDFA 3QWYA 1KC8U 4HCZA 2DF6A 1HXDA 1ZLMA 4PJOB 5I21A 1QVFP 1YITQ 4ZTJA 1VQPQ 3CMAT 1YITT 2DL5A 4CC3A 4BCIB 4OMPA 1CKBA 4XQ3A 3BW1A 3VS1A 2EPDA 4C8QB 1X6GA 1VQ5A 1Q82U 3JCMP 1VQNT 2I53A 2PHGA 4FM4B 2CCHB 1NYGA 2G9XB 1WJQA 2DKGA 3J80E 4B9XA 1UUEA 2J6OA 3CEYA 1O9KB 3SEMA 2PUOB 3M58A 3QYEA 5GAMf 2OAWA 3V8JA 1TWBA 2P0QA 4C5HA 2YDLA 3RKYA 2EQUA 3BLQB 4Z88A 1VOLA 2EWNA 4M75C 2XDPA 3ZBDA 4EPCA 5LJ5g 2GTOA 2C5VB 2MWPA 2L5QA 4F7LB 2KR3A 2ZZDA 1M27C 1RAEB 6AT1B 3TVTA 4C92C 3CD6T 3OBYA 4C0FA 2K6DA 3RMQA 1VUBA 4M77C 1VQ6Q 1UNLD 2P4RA 4KGVB 1YI2T 3DDPB 4CFWB 2J6KA 4JZ4A 1FMVA 5KYWA 2DMEA 5IAYA 2GGRA 2EGAA 4J9FA 4M78A 1JKWA 1QMCA 4G6LB 3VUBA 3NTHA 3TNWB 1P92A 2P4TA 1T0JA 1GCQA 4EOJB 2DJZA 2ED1A 3VRYA 5CCAA 3OBWA 3M53A 5EFQB 5GAOp 1MNEA 5FLXE 1YITA 1NPPA 2K5LA 4NC6A 2KYBA 2LCLA 4PJOG 4R56A 4F7SB 3I56T 2DA9A 1KIKA 2QQRA 1G3NC 2E12A 2LVMA 3LQ5B 1AZGB 1TUCA 1U1TA 3VS2A 4E7ZA 2EYZA 4PJOC 1GUXB 2LCSA 1VQ4A 2ZGWA 4E7SA 3VYGB 1RADB 5GAN2 3OYEA 2LJ1A 2A0FB 4BE2A 4JS5A 1W2BP 5A2QE 2DNUA 1KXUA 1G3SA 2M9UA 4C92D 1X69A 4A4HA 2DRKA 4ORZA 1O9SA 2A28A 4M75D 2X3XD 1ZSZC 3PIOA 3DLLA 1T3SA 2EQJA 3JRZA 1VQ7Q 4M75F 1CSKA 2R57A 4AKGA 2NWMA 1EIFA 1S1NA 1X2QA 5FW9A 4EMKA 4F7UG 2KGTA 4J6YA 1M90C 3O5ZA 1A0NB 8ATCB 4JJDA 1OX9A 3TU4K 4MIMA 2VASA 2UZBB 3QIIA 4C0DC 2QEXT 4EOOB 2XI9A 2C5OB 3EOCB 4C8QC 4RMOA 3OS0A 1H3HA 2K5IA 5GAN5 3QWXX 1C9BA 3JCMW 4FYVB 2KT1A 1QCOA 1Y96B 3HRTA 3CC2A 5CQYA 3H41A 1IGQA 5GANd 4HKEA 3QYBA 1DJ7B 2EYYA 2D8JA 3EG3A 1C1AA 5KYXB 2DL8A 4BCJB 4CFUD 3CCMQ 1VQOQ 1K0SA 2ATCB 4HNTA 2OTLT 1SSHA 4C8QG 4KULA 2DEQA 2BZ8A 1PD0A 1E7OA 1JSUB 1M1KR 4ELLA 3M5AA 4QSHA 1BB9A 4HCBA 4KRDB 2F5KA 1IXDA 2CT4A 1RI0A 3CCEQ 2LP5A 1V76A 2QASA 2LW4A 1BU1A 3OSVA 2K2MA 1UGVA 2Y4YA 3OYHA 1LNXA 2RJEA 1ZSZA 3EFOB 5LJ3d 2KXDA 4X1VA 2AKKA 1MV3A 3CPFA 4WF2A 3CCLT 4PJOE 4M7DD 4F7UB 2HKNA 3MJXA 5LJ5h 1OULA 4PK4A 1W70A 4IIMA 1WI7A 2UZDB 8AT1B 3QO3A 5IHKA 4C8QA 1JXOA 4IUPA 1K73R 1QCNA 5CKBA 5GMKm 1M9SA 3ZFJA 4FSSA 1R0CB 1FMWA 4XAXB 4ATOA 4LE9A 1KQSS 3JB9F 4Z8AA 2KVQG 4C92A 2DVJA 4AKHA 2AK5A 2DL3A 3CD6A 4KH1B 2HZYA 2KK4A 1YIJQ 1F5QB 2YLCA 1H8KA 4RG8A 3UT1A 1XQHA 2YWWA 4IUVA 1KK7A 2WEVB 4F6SB 1RACB 2KYMA 1S72Q 3M0RA 2JXBA 4E2FB 4FYYB 2RK2A 2KMTA 2L8DA 5LJ3e 2PMIB 2WFYB 1VQKA 5HBEB 4LOCA 4ZGEB 5A0GA 2C5XB 1YN8A 4Z89A 1C6VX 2GCXA 2CCIB 1M3CA 5D6XA 3VUZA 1I8FA 2RHUA 1TOVA 4MFDA 2C06A 3M54A 1OU8A 2KROA 4M78F 3CCSA 2O9VA 2DFUA 1EFNA 2BE7D 3PGGA 1KHIA 5KYUB 3X28B 2BS4A 2HDAA 2BTTA 2UZLB 2HAXA 4BB7A 5D7UA 5DLQE 4N4HA 4AG1C 1H92A 2RQTA 2OI3A 1WJRA 3A98A 2QXFA 3WXMB 2YUOA 5ECAA 5CQXA 5FU7C 5FU6C 2K3YA 3BE3A 2X4WA 4FW2A 1M3AA 4LDXA 1D09B 3RMSA 5GMKh 1IHVA 5HY6A 1VQ9Q 3R6NA 1KQ1A 3JCMf 3UATA 2F2VA 1PNJA 3JCMV 3QWLA 3JCMQ 4C92B 3PNWC 4WCIA 2NUTB 2K3XA 4A53A 5IXFA 2ZPHB 4Y92A 3CXCP 2KEAA 3KUFA 4QW2A 2W0ZA 3EGXB 3M59A 3CCRT 4OMLA 2CZ7B 5KYUA 2F2CA 1XTDA 3CBPA 4QQGA 4C5IA 1YP5A 2KY9A 3I5RA 2Z0WA 4BE1A 2EW3A 3M57A 3CXCA 4DQ2A 1X27A 3CQTA 4CFMB 2RB6A 4JJNK 4DBRA 3TW7A 1JJ2A 3CC7Q 1Q7YU 3CC7T 4M7AF 1Q82C 4WTOB 1Z9QA 1ZSZB 4OGEA 1I0CA 1PG5B 1VIFA 2JTEA 3SWNC 4DA4A 4OMMA 1K76A 3VYHB 1M1GA 5FRMA 1Y07A 2QG9B 3REBB 1QWFA 4PJOD 5GMKj 4BDYA 3MHXA 4F7UE 2AZVA 1Q81R 3CCMA 2E1HA 1VQOA 3B57A 3MY5B 5CKDA 2FYKA 4J9DA 2RH2A 1AVZC 2DPPB 2CP2A 3DDQB 1O9KA 3EG9A 3QZ5B 4JJBA 1WX6A 2YT6A 2K9GA 1K8AU 1GXIE 2EJ9A 1M2VB 1PD1A 2YUPA 3CCUT 2D9TA 2X1NB 1G2BA 4PL6A 4X9DA 1VQ9A 5DY9A 1YHQQ 3BHVB 1MMAA 4EOMB 2HNIA 2OTJT 3H8ZA 5IHYA 4RG2A 4TTHA 4DOWA 1K73U 3FDRA 2PQWA 2M02A 4MDXA 3CCQT 4M75B 3NGPA 2JOYA 2WIHB 3MEUA 5FWCA 2GFAA 4PLLA 5CVIA 1OPKA 1Q7YC 3KFVA 3QPHA 5KE3A 3Q1JA 3OW2P 5CKFA 2A3LA 4FSXA 1SHGA 3UA6A 3NFCA 3VS5A 3CCVQ 3SDZA 4QKUA 3GNGA 1M90R 1WHMA 3TN8B 3G4ST 2PVGB 1M1FA 2XICA 4HNVA 1OGUB 2EUFA 4XTUA 4GLMA 1IRXA 3JB9I 1RAHB 5C0MA 2JTFA 3M4YA 1O75A 5CAIA 2MIOA 3CMAA 3G71Q 1ZSGA 1QKWA 1YNZA 5GMKi 1V29B 3NHNA 2IW8B 2WSCE 1VQ7A 2VXFA 4OMQA 1WFWA 4OB0B 4XTWA 1PM3A 4LUDA 3MO8A 1KD1U 4LDVA 2KMGA 2JN0A 1K1ZA 4KGXB 4HCCA 2RHXA 2EIFA 4EOQB 2F2XA 3NPFA 3RKWA 2CP7A 2OTJQ 2LX9A 4JLGA 3RDVA 2P0KA 4BDZA 2LQWA 1YFNA 2ENMA 4JDSA 3FC3A 1NG2A 4OB1B 2CZ6B 1N9RA 2DEUA 2DXBA 3I5SA 2JTMA 1YWOA 1RLPC 1SKUB 4GBQA 4KBMB 2W96A 3UWNA 2K57A 2I2LA 3I56A 3EHRA 3SWNB 3INZA 2VXEA 4JX4A 2QQSA 4BUGA 4F04B 1Q95G 3HKSA 1H26B 2MOXA 2MAMA 3I35A 3NMZC 2JM9A 4R0KA 1VQ4Q 2MI6A 2F1LA 3G6ET 1VIEA 2JJ9A 3VS3A 1ZA2B 1OL1B 4EDUA 1ZHIA 1ZUUA 1UFFA 2BPMB 1XJWB 4PFOA 1QW1A 2QFZA 3BG3A 3H0HA 2XK0A 1Y71A 2HD0A 2V8JA 2O31A 1WPYA 2DMOA 2E5KA 4DBQA 3M0QA 4DEYA 1WHHA 1H25B 1YI2Q 4ELYC 2DD5A 1I81A 1W2BS 2RJFA 2ZPFB 1D0YA 2QEXA 2CP6A 2EYQA 4J9IA 2W9FA 3CCJQ 4BCKB 1R0BG 1Q7YR 3EHQA 1LPLA 1TTHB 2HL5C 2CUBA 3OYMA 4FYWB 4OMFB 1OL2B 4BBSM 1YBYA 2RMOA 3L2WA 3HRUA 1QCFA 4J9BA 4CRIA 1Q86U 2YRCA 2B9RA 3E9GA 5IN1A 2FVUA 3OSSC 5LJ5f 3QDRB 4YOOA 1VOMA 5HBJB 2R58A 4F6UB 2AKLA 5KCOA 4BI3A 3F70A 4BCFB 4JRIA 2CH4A 1E6HA 1KSWA 2OAUA 5GAN4 3CC4Q 2JW4A 3OYKA 5GAN6 1I07A 3EFSA 2HKQB 4LDYA 4M75E 2RI2A 5GAN3 1RUWA 2RI3A 3BG9A 3V7RA 1NJIU 3BDUA 2RHIA 1ARKA 4EMHA 1VQMT 1BKBA 1W98B 2OTJA 3G1JA 4CRLB 1UECA 4HVUA 1PRLC 2BZYA 2GQVA 4XTVA 2R5MA 1VYWB 1PRMC 1D3BB 2RO0A 5LJ3g 5J3BA 2V1RA 2D6FA 2QI2A 3FJPA 3CCJT 3NTKA 4RTTA 2HBWA 2HQHA 4CC4B 3G71T 2CKKA 4BY7X 1JSTB 3QHRB 1WGSA 2NUTA 4BCMB 3QG1A 4J6XA 2X4JA 4JRPA 1UNHD 3LWIA 1MV0B 3A8GB 2NLUA 2IIMA 2MYSA 2Y90A 2DBMA 3ME9A 2IVWA 3PMIA 3OS1A 4PLIA 3RNJA 5GAOq 3M0SA 1YJ9Q 4F7UF 1PKSA 1ZX6A 4OGCA 4E7HA 2D0NA 1LCKA 2HEQA 2RHZA 4M77D 5IHNA 3RUXA 3TCJA 5FROA 1ZQ1A 5LJ5j 1VQ8A 1PCXA 1QLYA 3L2RA 1BI1A 5HVYB 2QQ9A 5KYNA 5A0LA 1YIJA 4N0AA 2O9SA 3HB9A 5CEIB 5DM7R 3CC4A 1PKTA 1M90U 4IUTA 1M30A 4E47A 2K7AA 3DB4A 1NLOC 1YCYA 2FPDA 3HHTB 1PSFA 1VQ6A 2V22B 2EKOA 4FW1A 2KE9A 2P0PA 5GANg 2RQVA 1T3LA 2XDDA 1HK9A 4M7AE 3RBBB 3HFOA 3M0TA 1VQ8T 5CKHA 4XU2A 4MMLA 2PVOB 3DB3A 3M56A 2KDSA 3OW2A 4ZN1A 2NUPB 1AOJA 1JB0E 2FPFA 3HRSA 2R7GA 2DD4A 1GUXA 1VQNA 4KUDK 3CD6Q 1TD6A 2SEMA 2ZPIB 1QLBA 3JCMe 2EBPA 4FX3B 1VYTA 2YRVA 2DETA 2DXCA 4XK8E 4EORB 1SG5A 3G6EA 3CPWA 2GQIA 3LWHA 3OY9A 3JCMg 3OYBA 2EQKA 1R8OB 3J7AF 2KI7A 3JAME 2QGSA 4EOLB 1JO8A 2LTOA 4M75G 4JRKA 4CFXB 4BD3A 3VKIA 1WLPB 2HQEA 4BI4A 3PE0A 4M75A 3N5BB 4HVVA 1OZ2A 3MEWA 1WHKA 5KYYB 1N5ZA 2FRYA 3CC2T 2WPAB 2JUFA 2NYSA 1VQNQ 2E65A 5GMKe 1UGPB 1GL5A 3MPUB 4HVWA 4RCCA 7AT1B 1IREB 1KG1A 3EGDA 3JB9J 2GFUA 1E7PA 4O6JA 5LJ3h 2HCKA 4HT8A 1KD1C 1NJIC 3RGFB 1QVGP 1UG1A 1SEMA 3LX7A 2O2OA 4PFZA 4RTYA 1OX8A 5EG2A 4E7IA 1BCOA 2IPOB 2X9HA 1NE8A 1D3UB 5FRNA 1H1QB 1JRIA 2YUQA 3I55Q 3ER0A 2BIVA 2W99A 3FB9A 1VQ5Q 2KBTA 1UE9A 4JJCA 3MKDA 2KT8A 2RQRA 1ZP2A 4ME7A 4XU0A 4DBHA 4RTUA 3TQ7P 2O01E 4AI6A 4A4FA 4C8QF 3NDQA 2EAYA 3DTOA 2L89A 1G8XA 1K0XA 1YJ9A 3OYLA 1VQKQ 3OW2S 3FEOA 1IGUA 1UHFA 1F1BB 1FKMA 4YOZA 2COWA 2PJQA 3CCQA 5IDNB 2I0NA 3DKMA 2CDTA 3BFMA 4AFZC 1QVGS 1GCPA 4F7NB 1M1KU 2F5TX 5GAOm 1ZBXA 4A4KA 5GANe 1K73C 1G3TA 3CCRA 3GLXA 3OYCA 4BY6B 2MMPA 4KH0B 4RKUE 3POMA 4LDWA 3J81E 1M3BA 2A08A 3S3NA 1KC8C 3EIDB 4EONB 2AHJB 2QDLA 2EQIA 2RQWA 3OS2A 4BE0A 1KFZA 3HSBA 2QA4A 2JMCA 3CCJA 4J7FA 1ZUKA 1WHLA 2CH4W 3TNHB 4ANJA 4F7JB 1QP2A 1OQKA 4QT7A 1U5SA 1HSQA 3GOXA 3PTAA 3KBGA 1VQLQ 1EZZB 1D3BA 1KQ2A 1ZA1B 5FU6B 3MP6A 1AT1B 2K3BA 1UGRB 5ACBA 2VYTA 3NTIA 5KE2A 1NYFA 4BBRM 1VQKT 2QTXA 3BG5A 5LJ3f 5GAOl 1X75C 1AWJA 1CKAA 4Y28E 4LNPA 2E6NA 1N8RC 1YJWA 2IW6B 3M03A 1MMGA 1OOTA 4D6WA 3E9FA 3C4SA 1IO6A 1D1AA 3RIRA 1AWXA 2SRCA 2L2PA 1JJ2S 2C4GB 2VUBA 4M78G 1XOVA 3BHUB 2J05A 2QQ8A 1OKVB 1B7TA 5LJ3j 3UA7A 1M2VA 5GAOn 1D1CA 4NOYA 3K7AM 4PJOA 2LMJA 2PU9B 4RTVA 5KYWB 5D6WA 3JCMb 1JEGA 2JS2A 1IZ6A 2LT4A 2NUZA 1AHJB 3SD4A 3H0FA 3GNFB 4K11A 4EC9B 2RQUA 1I1JA 1VQLA 2J06A 4XU3A 1YHQT 1WZOA 1QKXA 5HNBB 3C12A 3IQLA 1VINA 4OR5B 1H24B 1C0MA 1FWZA 1MGQA 4M78D 3MCAB 5C6SA 2KXCA 2JGZB 3OYYA 4JLIA 1VQ8Q 1G83A 3CCSQ 4MZMA 5GAMd 2FL7A 1OKWB 2FPEA 1BBZA 4ZN3A 2CZ1B 4YOSA 1B07A 1E9HB 2MWOA 3S3OA 1SF9A 2F69A 1JXMA 1B3QA 2ZPEB 4C92E 1GFCA 5I22A 4HL4A 3VS4A 4J9CA 4RTZA 2E70A 3QHWB 1AWWA 2KRSA 2ROTA 4KT0E 4F17A 1YJWQ 4CFNB 2ZPGB 1VQ4T 1GH6B 1RAIB 3E1SA 5GAN8 1NJIR 2KRMA 2KR6A 2WACA 3ULRB 2K79A 5IDPB 4C0ZA 5LJ5e 1TUDA 9ATCB 3PMTA 1D1BA 4AKIA 3GTMS 2E64A 1NLPC 3H4CA 1VYUA 2QQAA 2RJCA 5EJCA 2GBQA 3LW5E 3G33B 2BS2A 2BKZB 4LUEA 4B9WA 1D0ZA 4CXAB 4HCKA 2D1XA 5GANj 4NSTB 1FINB 4B6MA 1M2OA 2J7IA 2L0AA 1UJ0A 1Q81U 4MFEA 1X6BA 4L6V5 1H27B 1ACMB 2CS7A 1ABOA 2HSEB 4A54A 2KNBB 2GNCA 4C92F 2WHBB 5I2MA 3I55T 1G3WA 2LC4A 2DXTA 1BI3A 2BKDN 2Y4XA 5FU7B 4Z02A 4IUQA 4M78E 3CCVT 2DXCB 3GPLA 1W1FA 2V8KA 4HLQA 3MEVA 1BI2A 3DL1A 4FIBA 1S72A 2DM1A 3JCMJ 1QQJA 3VS7A 4J8OA 3GF5A 2X4YA 2B8AA 5HK0A 2CSIA 3EFOA 4E7KA 3X20B 2OTLA 1FMKA 3OYIA 1ZUYA 3G4SA 3RKXA 1TS9A 4X9CA 4EOIB 1H641 2EYWA 4BXXX 3R6OA 2LRQA 1UGQB 4EOSB 2DVEA 4YC3B 4J6WA 1WXUA 4HA8A 5ICPB 2W2HA 1S72T 4FL6A 4KGZB 3EGDB 1YWPA 1TXQA 3EH2A 5GJWB 2CP5A 2H3EB 2LCCA 2WSFE 1BIBA 1OZ3A 3PVQA 4LDUA 4OVAA 1N8RR 2M1HA 1TUGB 2YUNA 3EH1A 1OU9A 3L1AA 4ELZC 3CCLA 3ZL7C 2LJ3A 4EOKB 4NL2A 4BY1X 4L5GA 4M77B 3CMEA 5GANf 4JUVA 4II1A 1N27A 4R55A 1VA7A 1OI1A 2RI5A 2CP0A 2P84A 1IHWA 1I4K1 4N0AC 1Q86C 1IB8A 2DTIA 4TVRA 1LJOA 4OF1A 1OEBA 3MI9B 3RESA 1H1PB 3CC4T 3H9NA 1GCQC 2OJ2A 1Y7XA 2JVVA 3SB2A 5I11A 3P8DA 3O8VA 3TEEA 4CI0C 1VYVA 1VQ6T 3GP8A 1VQ7T 3VV0A 5AT1B 4J9HA 2IW9B 1KC8R 3JSCA 3QYGB 3OS5A 2D0QB 4QQ6A 2RN8A 1TU0B 2J6FA 3SWNA 2K2VA 1PWTA 2L3SA 2R5AA 4M77A 2DL7A 2ROLA 3G7ZA 4EC8B 1XNIA 2EJFA 1FYNA 4BCHB 4KUIA 2C0IA 4XU1A 4FU6A 2FB7A 3S3MA 2CGHA 2V26A 4I3ZB 3CXCS 3JCMd 1SRLA 3CCMT 1VQOT 2WJ9A 1N9SA 3CCUQ 4OGRB 3P8BB 2DIQA 4A63B 4J83A 2QK0A 1YJ9T 4OB3B 2ZAEA 3H6ZA 2VC8A 3V7CA 3JCMX 4BCMD 1X6OA 2G6FX 3CBOA 1LVKA 2XMFA 1WYXA 2B86A 1PC0A 3E19A 2DXUA 1VQMQ 4BY6C 1WA7A 1KQSA 1H4LD 2MK5A 2EJGA 5GANh 1J3TA 1SRMA 3E2UA 5HBHB 1WNLA 4GY5A 3JB9H 1TFBA 4M7AD 4ZTFA 1SSFA 4XTYA 2FZGB 4LN2A 2LT1A 5GJVB 2PNIA 4AT1B 1GFDA 2BZXA 4AG2C 2FRWA 3EGUA 4BACA 3I55A 4C5EA 1H1RB 1NM7A 3EFRA 1NZ9A 2QEXQ 1NBEB 2LZ6B 2IG0A 3M9QA 4HNUA 4M7DF 4Y91A 2V1QA 5J39A 2JZ2A 1Q86R 4E7LA 3D7SB 1K9MC 4JZ3A 4BCNB 4BCGB 2VV5A 1HYOA 5CIUA 3QYHB 2E4HA 4N4IA 4M7DC 2LNHB 2QGGA 3JB9D 3HP9A 4EIKA 1VQPT 5I5ZB 3L2QA 5DQWA 3CC7A 4FT2A 2QGFB 5GAMj 2FEIA 2YRDA 4ZGJB 3M0PA 2HBPA 2K5FA 5I2SA 5LJ5d 1M5Q1 4M78B 2EKHA 4BI8B 3CC2Q 4LXCA 3UDCA 1KQSP 2RPNA 1WJSA 1UEBA 3QZ9B 2COYA 3EAEA 3LH0A 2PVDB 3OYJA 3EG1A 1JBMA 3G4SQ 1WXBA 2CUDA 1RL2A 2NUPA 1I5LA 2BE9B 4C8QD 2RNAA 5CKEA 5GAMe 3L2UA 3OYNA 1MMDA 5KCHA 3TSZA 1AEYA 4QQDA 1N4MA 4PNOA 2VWFA 5M9OA 2JT4A 3OYDA 3LH5A 1H28B 2CZ0B 1WQWA 3I9QA 5HKCA 1QVFA 3JCMc 3UF4A 2AIRB 4C0GA 1UTIA 1YJWT 2H8HA 2VKNA 2QYZA 3L2VA 3CCEA 4RTWA 2QDJA 1JJ2P 3HZJA 4PJOF 3A8LB 2WIPB 1BIAA 3U23A 2ESWA 3JV3A 3X26B 2RA2A 5KYYA 2D8HA 4LD9K 3TNIB 2DK3A 3FIFA 1JQQA 1M1KC 3MIAB 2FHDA 1E6GA 4J7IA 2VGNA 2HQXA 1ZBJA 1UNGD 3VYGA 3HL8A 2BS3A 1G5VA 4BCOB 3OMGA 1MNDA 1RAGB 3MEAA 4RCBA 4PJNA 3P8HA 5AYFA 3A8HB 5L23A 4EOPB 3S6WA 1G3YA 4EMGA 4RTXA 3CCVA 1UGSB 2X3WD 2VB6A 1T0HA 5IH2A 4HXJA 2HMAA 5HK3A 4YTLA 4BCQB 1AWOA 4BCPB 3QHSA 3FRNA 1UHCA 5DQVA 2JM8A 2MCNA 4BCQD 2O4XA 2JNGA 3RR6A 1KJWA 2DILA 2GF7A 4RODA 2CP3A 1YHQA 4ELJA 2VVKA 2RD1A 4QVDA 5EC7A 2EGEA 1MHNA 2UZEB 1U1SA 3GIBA 3SHWA 1RAFB 4C8QE 3OA6A 2C5NB 4FT4A 2K4YA 4ZNXA 1QWEA 2QDYB 3VS6A 4PJJA 1AD6A 3H0IA 3CCET 1GBQA 3MY1B 3OQ5A 5KH6A 4KRCB 2RJDA 2M16A 3M4GA 2W9ZA 3EGXA 3HFNA 4CC2A 1ABQA 3HTRA 3PO3S 4II5B 2QF7A 1BI0A 1GRIA 2FO0A 1U06A 1X43A 3VS0A 3EJ1B 2X51A 3M0UA 2L3PA 4J5YA 2G77A 1Z9ZA 2MPXC 1YJNT 3C94A 2VGMA 3SFMA 1AD5A 4M7AA 1FXXA 3KHIA 1NEBA 1EX4A 4BCND 1OI9B 4IKFA 1Y0MA 2HL3A 4XTZA 3LGFA 3VKGA 5DLOA 3THKA 3V8KA 2H3JA 2PZ1A 4M77F 1K8AR 2C0OA 5D6YA 1YJNA 1N6AA 3CBMA 2IVXA 1H1SB 2PK2A 1GY3B 2M0YA 1X01A 1FX7A 4PJMA 3M55A 1PHTA 4IIOA 1K9MR 1B34B 5CK9A 2I40B 4IMYB 5LQFB 3BLHB 3QSUA 2DO3A 4M7AB 2DZ9A 1NEGA 1UB4A 4UN0A 2DTOA 1M8MA 5LMKB 4MMKA 2A36A 3CMAQ 4F7UA 1URCB 4ROCA 2G3RA 3JB9G 2PUKB 3LGLA 3QJYA 3CCST 4FYXB 2AZSA 1MUZA 1HD3A 2E6ZA 1SPKA 3CPWP 1YJNQ 5L8RE 2E5QA 5LL6S 3MP1A 1W2BA 1NPRA 1OV3A 4MZTA 1WHJA 2UUEB 3TREA 2DIGA 4Q5WA 4JRQA 1YCSB 3X24B 4PJLA 2DL4A 3A1PA 1K9MU 3WVEB 3O0GD 1BU2A 3C95A 3VU3C 1V1CA 2A37A 1B34A 4JPBW 2DZCA 1BYMA 5GAMg 2DX1A 4M77E 4RUGA 3QXEB 4HT9A 2E3HA 3EG0A 3AHUA 5KYXA 1QP3A 4VUBA 4F14A 2CSQA 3T9NA 2DE0X 3VKHA 2ED0A
chains in the Genus database with same CATH topology
1BKBA 2XG8D 2XIDA 2OTJA 4JX5A 2DVEA 1VQMA 4J6WA 2GQVA 3QBYA 4XTVA 3KXTA 2R5MA 3M5AA 4HA8A 3V7SA 4QSHA 2YHTA 1S72T 4FL6A 1D3BB 4HCBA 2RO0A 5LJ3g 5J3BA 2A7YA 2D6FA 3V8LA 2F5KA 2QI2A 3FJPA 1RI0A 3CCJT 3CCLT 4PJOE 3NTKA 2LCCA 2WSFE 1BIBA 1OZ3A 4LDUA 4MDWA 4OVAA 4X34A 2M1HA 3G71T 2CKKA 3OSVA 3QJ6A 1WGSA 3QG1A 4J6XA 2Y4YA 3OYHA 1LNXA 2RJEA 2E41A 2X4JA 5LJ3d 3CCUA 4JRPA 3L1AA 4OP0A 4EMKB 1QVPA 4ELZC 3LWIA 3CCLA 3A8GB 4N4GA 4M7AG 2NLUA 4NL2A 2Y90A 3CPFA 4WF2A 4L5GA 1VQLT 3ME9A 2IVWA 3PMIA 3OS1A 4M77B 1OYXA 4F7UB 3TW6A 4PLIA 5GMKl 4JUVA 3HBLA 5GANf 4II1A 1N27A 5GAOq 4R55A 5LJ5h 4F7UF 1OI1A 2RI5A 2RM4A 4OGCA 1LOJA 4E7HA 1I4K1 2XKOC 4M7AC 4N0AC 1Q86C 2DTIA 3QO3A 4TVRA 4C8QA 2QA4T 2RHZA 4IUPA 1LJOA 4M77D 4M7DB 4OF1A 2DD4B 3RUXA 3RESA 5CKBA 2LQ8A 3TCJA 5FROA 5GMKm 1ZQ1A 1M9SA 3ZFJA 3CC4T 1H3ZA 4M7DG 5LJ5j 4XAXB 1VQ8A 4ATOA 4M7DE 1KQSS 3JB9F 2DXBB 1Y7XA 2JVVA 3SB2A 3L2RA 1BI1A 2KVQG 4C92A 3P8DA 2QQ9A 4M7DA 4AKHA 5A0LA 1YIJA 4N0AA 1Q81C 1M8VA 3CD6A 2ZZDB 3O8VA 3HB9A 3TEEA 4CI0C 4M78C 5DM7R 3CC4A 1VQ6T 3GP8A 1YIJT 2X4XA 3VV0A 1W4SA 4E7JA 3OYAA 2KK4A 1M90U 1VQ7T 2YLCA 3JSCA 3QYGB 3OS5A 2D0QB 4IUTA 3QKJA 4QQ6A 4RG8A 4E47A 3DB4A 3UT1A 2CYZB 1XQHA 1YCYA 4IUVA 3ASKA 3UPUA 3HHTB 1PSFA 1VQ6A 2EKOA 3SWNA 1WQ7A 2K2VA 2P0PA 5GANg 5IT9E 1VQ9T 1PSEA 2R5AA 2XDDA 1HK9A 4M77A 4M7AE 4P5NA 3G7ZA 2WSEE 1XNIA 2RK2A 3HFOA 1VQ8T 2KMTA 5CO7A 2EJFA 5CKHA 2L8DA 4XU2A 2O4XB 4MMLA 4KUIA 4A4GA 2PVOB 3DB3A 3M56A 5LJ3e 2KDSA 4XU1A 4FU6A 4C0DB 3OW2A 2FB7A 4ZN1A 3S3MA 1VQKA 1JB0E 2EQMA 4LOCA 4ZGEB 2MF2A 3HRSA 2DD4A 5A0GA 2CGHA 4QVZA 1VQNA 2ZCFB 4KUDK 3CXCS 3BY7A 3JCMd 3L2ZA 3CCMT 1VQOT 2ZPIB 1QLBA 2GCXA 3JCMe 2EFIA 5D6XA 2YRVA 3OYFA 3VUZA 2WJ9A 1I8FA 1N9SA 2RHYA 2RHUA 5GAN7 3P8BB 4ZGDB 2DIQA 2DXCA 2DAQA 4J83A 3L42A 4XK8E 4MFDA 3G6EA 2C06A 3M54A 3CPWA 1YJ9T 4OB3B 4M78F 1Y96A 3CCSA 2XU8A 3OY9A 3LWHA 3JCMg 3OYBA 2EQKA 1R8OB 3H6ZA 3DLMA 1M4ZA 4PKCC 1YI2A 1QVGA 4JS4A 2DD5B 2XD0A 2VC8A 3V7CA 4V2SA 3JCMX 4M6VA 3JAME 3OMCA 4M75G 2LTOA 3PGGA 1KHIA 4JRKA 1X6OA 4BD3A 3X28B 2BS4A 2HQEA 3PFSA 3VKIA 4BI4A 3CBOA 4M75A 3N5BB 2HAXA 4BB7A 5DLQE 1OZ2A 4IURA 1YJNT 3MEWA 4LD6A 4N4HA 3CC2T 4M77G 3URGA 2JUFA 4JX6A 3E19A 2E65A 3LYIA 1WJRA 4NS5A 5GMKe 1UGPB 2DXUA 2QXFA 4RCCA 3WXMB 4BY6C 1KQSA 1IREB 1KG1A 3JB9J 3FLGA 2EJGA 5GANh 3WVDB 5CQXA 5FU7C 3BDLA 5FU6C 1U8RA 2E10A 2K3YA 1WNLA 2GFUA 4GY5A 3LLRA 2X4WA 3META 3JB9H 4M7AD 4ZTFA 1SSFA 1E7PA 4O6JA 4XTYA 2V8IA 5LJ3h 4HT8A 1KD1C 2LNVA 5GMKh 3RMSA 4LDXA 3RERA 4C92G 1NJIC 5HY6A 2LT1A 1KQ1A 3LX7A 3JCMf 2YLBA 4A4EA 5EG2A 3JCMV 4E7IA 3QWLA 3JCMQ 4BACA 1NE8A 4C92B 3HO8A 3I55A 3PNWC 5FRNA 2BUDA 1JRIA 4O5VA 4C5EA 3A8MB 2K3XA 2OTLT 4A53A 1QVFS 2ZPHB 3EFRA 1NZ9A 3KUFA 2IG0A 3M9QA 4HNUA 4MZPA 4QW2A 4Y91A 4EMKC 3M59A 3ER0A 5J39A 2CZ7B 2BIVA 3CCRT 3FB9A 3OB9A 3ZEHA 1XTDA 3CBPA 2JZ2A 4QQGA 4E7LA 2RK1A 1KHCA 1K9MC 4NL3A 4Z6YA 4C5IA 4QVCA 4ME7A 3A5ZB 3A8OB 4XU0A 5A0DA 2O01E 2KY9A 4AI6A 4A4FA 5GAMh 2VV5A 1VQPA 4C8QF 5GAOr 4BE1A 5CIUA 2EAYA 3M57A 4DOVA 2L89A 3QYHB 4N4IA 4DQ2A 3OYGA 3CXCA 1YJ9A 3OYLA 4M7DC 2RB6A 4JJNK 3OW2S 3TW7A 2KSSA 2L3RA 3FEOA 3HP9A 3JB9D 1JJ2A 4M7DF 1Q7YU 3CC7T 4M7AF 4M7DD 1VQPT 1FKMA 4IUUA 3L2QA 3CPWS 3CCQA 1Q82C 3CC7A 4FT2A 5GAMj 3CMET 3MP8A 3G71A 3DKMA 4UC4A 3X25B 4ZGJB 2XHCA 2HBPA 3BFMA 4OGEA 1QVGS 4OB2B 2QQBA 2K5FA 2F5TX 5I2SA 1M5Q1 5LJ5d 4M78B 3HPWA 5GAOm 1ZBXA 4A4KA 4BI8B 5GANe 1VIFA 3SWNC 4DA4A 1K73C 2KQWA 3J7AF 1G3TA 3UDCA 1N8RU 3CCRA 1M1GA 3VYHB 5FRMA 2X35A 1Y07A 1WJSA 3GLXA 2XDBA 3OYCA 1UEBA 4L59A 3VJPA 3QZ9B 2MMPA 4RKUE 4BY6B 4LDWA 3J81E 4PJOD 5GMKj 3EAEA 3LH0A 2PVDB 5J26A 3OYJA 4BDYA 3G4ST 3S3NA 1KC8C 3MHXA 2AHJB 4F7UE 2LQKA 3OS2A 4BE0A 1JBMA 3CCMA 2E1HA 1VQOA 5CR2A 3HSBA 5CKDA 2QA4A 1RL2A 2FYKA 4GLKA 1I5LA 2RH2A 2DPPB 3JCMh 3QUIA 3CCJA 4J7FA 4C8QD 3QZ5B 2LDMA 1TH7A 3PT9A 5CKEA 1K8AC 1M1KU 4C5GA 1QP2A 5GAMe 3L2UA 1K8AU 2KAFA 3OYNA 4XTXA 5KCHA 1GXIE 3GOXA 2EJ9A 4QQDA 3PTAA 3KBGA 4PNOA 1VQ5T 2DTHA 5M9OA 3OYDA 2CZ0B 3CCUT 1D3BA 2D9TA 1KQ2A 1WQWA 5FU6B 2ZPBB 5HKCA 1QVFA 3MP6A 4PL6A 3JCMc 1UGRB 4C0GA 2VYTA 3NTIA 4X9DA 1VQ9A 5KE2A 1YJWT 2M0OA 3L2VA 3CCEA 5DY9A 4HCZA 4BBRM 1KC8U 1VQKT 2QDJA 3HZJA 1HXDA 2HNIA 3A8LB 2QTXA 1BIAA 4PJOF 2OTJT 3BG5A 5LJ3f 5GAOl 3H8ZA 1X75C 4PJOB 5I21A 4Y28E 3X26B 2RA2A 4ZTJA 4RG2A 4DOWA 2E6NA 1YITT 3CMAT 1N8RC 1YJWA 1K73U 3FDRA 4LD9K 2DK3A 2PQWA 3FIFA 3PIPA 1M1KC 4MDXA 3CCQT 2FHDA 4M75B 4XQ3A 2JOYA 3BW1A 4J7IA 3MEUA 4C8QB 2VGNA 1VQ5A 4D6WA 2GFAA 2HQXA 3E9FA 4PLLA 5CVIA 3JCMP 1Q82U 1VQNT 3VYGA 3C4SA 3HL8A 2BS3A 4FM4B 1Q7YC 1G5VA 3QPHA 3RIRA 3Q1JA 3OMGA 5KE3A 1WJQA 2DKGA 5CKFA 3J80E 4B9XA 2A3LA 2VUBA 3CEYA 3MEAA 4FSXA 4M78G 4RCBA 1JJ2S 3P8HA 5AYFA 3NFCA 1XOVA 2PUOB 3A8HB 3M58A 3QYEA 3SDZA 3V8JA 5GAMf 3GNGA 2P0QA 4C5HA 3S6WA 1G3YA 3RKYA 2PVGB 1M1FA 2EQUA 4HNVA 2XICA 2QQ8A 1UGSB 4EMGA 4XTUA 3CCVA 3JB9I 5LJ3j 2EWNA 4M75C 5C0MA 5HK3A 2JTFA 2XDPA 3M4YA 1O75A 4YTLA 3ZBDA 4EPCA 5CAIA 5GAOn 3CMAA 5LJ5g 3QHSA 5GMKi 3FRNA 1V29B 2MWPA 4NOYA 2O4XA 4PJOA 2JNGA 2L5QA 2VXFA 2WSCE 2ZZDA 1VQ7A 2PU9B 4OB0B 4C92C 4XTWA 3OBYA 3CD6T 4C0FA 5D6WA 3JCMb 2GF7A 1IZ6A 2LT4A 3RMQA 1VUBA 1YHQA 3MO8A 4M77C 4ELJA 1AHJB 2RD1A 4QVDA 1KD1U 4LDVA 3SD4A 2KMGA 2JN0A 4HCCA 1MHNA 1U1SA 1YI2T 3GIBA 3GNFB 2RHXA 2EIFA 4C8QE 3OA6A 1VQLA 3RKWA 4XU3A 4FT4A 1YHQT 2K4YA 2LX9A 5IAYA 3C12A 4JLGA 2P0KA 1FWZA 4BDZA 2QDYB 1MGQA 4JDSA 4M78D 4M78A 3MCAB 4OB1B 3FC3A 2CZ6B 1N9RA 5C6SA 3CCET 2DXBA 3OYYA 3OQ5A 4JLIA 2JTMA 5KH6A 3VUBA 2RJDA 2M16A 4KBMB 3M4GA 3NTHA 3HFNA 1P92A 2P4TA 4MZMA 3UWNA 5GAMd 2K57A 2FL7A 2I2LA 1BI0A 2QF7A 4ZN3A 2CZ1B 2DJZA 3I56A 5CCAA 3OBWA 3SWNB 3INZA 3M53A 2G77A 2MWOA 2VXEA 4J5YA 4JX4A 2QQSA 4BUGA 2F69A 5FLXE 5GAOp 3S3OA 3HKSA 1YITA 2ZPEB 4C92E 3C94A 2VGMA 4HL4A 1NPPA 2K5LA 3SFMA 4NC6A 2E70A 2LCLA 4PJOG 1FXXA 4M7AA 4R56A 2MAMA 4KT0E 3I56T 2QQRA 3KHIA 2E12A 2LVMA 1U1TA 2ZPGB 1VQ4T 2MI6A 3E1SA 3G6ET 1VIEA 4IKFA 4PJOC 4EDUA 1VQ4A 2ZGWA 3VYGB 1ZHIA 5GAN8 4XTZA 5GAN2 3OYEA 3LGFA 3VKGA 5DLOA 4BE2A 2KR6A 2WACA 5A2QE 4JS5A 1G3SA 2M9UA 4C92D 3V8KA 4A4HA 4C0ZA 5LJ5e 2H3JA 1O9SA 4M77F 3PMTA 4M75D 4AKIA 5D6YA 3PIOA 1QW1A 1YJNA 3DLLA 1N6AA 2E64A 3CBMA 2QFZA 2EQJA 3JRZA 3BG3A 2QQAA 3H4CA 2XK0A 1X01A 1FX7A 1Y71A 2HD0A 2RJCA 4M75F 5EJCA 2V8JA 3LW5E 2R57A 3M55A 4AKGA 1WPYA 1B34B 5CK9A 2BS2A 1EIFA 4B9WA 4ELYC 3QSUA 2DD5A 2DO3A 4M7AB 2DZ9A 1I81A 1UB4A 1W2BS 4EMKA 2DTOA 2RJFA 4F7UG 2ZPFB 4J6YA 5GANj 1M90C 4MMKA 2QEXA 4F7UA 1Q81U 2EYQA 4MFEA 4L6V5 2G3RA 3JB9G 2CS7A 2PUKB 3TU4K 3LGLA 3QJYA 3OYMA 3CCST 4OMFB 4MIMA 4A54A 3QIIA 4C0DC 4C92F 2QEXT 2E6ZA 5I2MA 3I55T 2XI9A 5L8RE 2E5QA 5LL6S 3MP1A 1W2BA 1NPRA 1G3WA 4BBSM 1YBYA 2LC4A 4MZTA 4C8QC 4RMOA 2DXTA 3L2WA 3HRUA 3TREA 3OS0A 2DIGA 1BI3A 4CRIA 2BKDN 2K5IA 2Y4XA 5FU7B 5GAN5 1Q86U 4Z02A 4Q5WA 4IUQA 4M78E 3CCVT 4JRQA 3JCMW 2DXCB 3X24B 3E9GA 5IN1A 2FVUA 3OSSC 5LJ5f 3GPLA 1Y96B 2V8KA 3HRTA 3QDRB 3CC2A 4HLQA 3MEVA 2R58A 1BI2A 5KCOA 3WVEB 1K9MU 3C95A 4BI3A 3F70A 3DL1A 4JRIA 4FIBA 3VU3C 1S72A 2OAUA 1B34A 5CQYA 2DZCA 5GANd 3JCMJ 1BYMA 4J8OA 4HKEA 3QYBA 5GAMg 1DJ7B 5GAN4 3GF5A 2X4YA 4M77E 2B8AA 3OYKA 3QXEB 5HK0A 5GAN6 3EFSA 4HT9A 4E7KA 4LDYA 4M75E 3X20B 2RI2A 5GAN3 3OYIA 3CMEA 2OTLA 3AHUA 2RI3A 3BG9A 1QP3A 4VUBA 3G4SA 3RKXA 4X9CA 4HNTA 1H641 3V7RA 1NJIU 3BDUA 2RHIA 3T9NA 3R6OA 3VKHA 4C8QG 4EMHA 2LRQA 4KULA 1VQMT 1UGQB 2DEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZ1 B;  2DD5 B;  1QP2 A;  2ZPE B;  1GXI E;  3X28 B;  4KT0 E;  2CZ0 B;  2ZPG B;  2ZPB B;  2WSF E;  1UGR B;  1UGP B;  3VYG B;  1IRE B;  3A8L B;  3WVD B;  4Y28 E;  3X26 B;  3A8G B;  3LW5 E;  3VYG A;  4FM4 B;  3A8M B;  2DD4 B;  2ZPH B;  2DD5 A;  2CZ7 B;  2ZPF B;  2PUO B;  3A8H B;  2DXB B;  2PVG B;  3A8O B;  4L6V 5;  1UGS B;  2ZZD B;  2O01 E;  2PUK B;  3QYH B;  3QYG B;  2D0Q B;  2CYZ B;  1V29 B;  5L8R E;  3HHT B;  1PSF A;  2ZZD A;  2WSC E;  2PU9 B;  4OB0 B;  1PSE A;  2DXC B;  3X24 B;  3X25 B;  4ZGJ B;  4OB2 B;  2WSE E;  1AHJ B;  3WVE B;  2PVO B;  3VYH B;  1JB0 E;  4ZGE B;  3QZ9 B;  2DD4 A;  4RKU E;  1DJ7 B;  2ZCF B;  2PVD B;  3QXE B;  2QDY B;  2AHJ B;  2ZPI B;  4OB1 B;  2CZ6 B;  2DXB A;  3X20 B;  4ZGD B;  2DXC A;  4XK8 E;  1QP3 A;  4OB3 B;  2DPP B;  3QZ5 B;  1UGQ B; 
#chains in the Genus database with same CATH topology
 2XG8 D;  2XID A;  4JX5 A;  2JMA A;  4ESR A;  1VQM A;  4AFS C;  1Y57 A;  3QBY A;  3KXT A;  1OIU B;  2QTV A;  2DER A;  2ECZ A;  1RI9 A;  4Y72 B;  3V7S A;  1OPL A;  2YHT A;  5L2W B;  2CJM B;  2LJ0 A;  2A7Y A;  3V8L A;  4X34 A;  4D8K A;  4MDW A;  2ABL A;  3QJ6 A;  2PTK A;  3FJ5 A;  3CCU A;  2E41 A;  2C6T B;  2E3I A;  3CCR Q;  4OP0 A;  4EMK B;  1QVP A;  2YXY A;  1HJD A;  4N4G A;  4M7A G;  3DJB A;  1VQL T;  1OYX A;  3TW6 A;  1Q82 R;  5GMK l;  3HBL A;  1WDX A;  2WXV B;  1R77 A;  2RM4 A;  1LOJ A;  4M7A C;  2XKO C;  2YSQ A;  4F6W B;  1U3O A;  4OMO A;  2QA4 Q;  2QA4 T;  4M7D B;  2DD4 B;  1BCM A;  2LQ8 A;  4OMN A;  1H3Z A;  4CC7 A;  4M7D G;  4M7D E;  5HCK A;  2DXB B;  3AT1 B;  1RLQ C;  1BK2 A;  4M7D A;  1M8V A;  1Q81 C;  5CYI B;  2ZZD B;  4M78 C;  1YIJ T;  2X4X A;  4E7J A;  1W4S A;  3OYA A;  2WMB B;  4KRT A;  3QKJ A;  5FWB A;  2CYZ B;  2DRM A;  3ASK A;  3UPU A;  4DEX A;  2W10 A;  1D0X A;  1AZE A;  2KRN A;  1WQ7 A;  5IT9 E;  1VQ9 T;  1PSE A;  1QMZ B;  2L3Q A;  4ROE A;  4P5N A;  3EG2 A;  2WSE E;  2QAZ A;  2FG0 A;  5CO7 A;  3EG9 B;  2O4X B;  4A4G A;  4F70 B;  4C0D B;  3F5X B;  2EQM A;  2MF2 A;  1TG0 A;  3DOG B;  4J9E A;  4QVZ A;  2ZCF B;  1OIY B;  3BY7 A;  4AMC A;  3L2Z A;  3OYF A;  2EFI A;  2RHY A;  5GAN 7;  4ZGD B;  2DAQ A;  3I56 Q;  3L42 A;  1I5O B;  1KD1 R;  3PVL A;  1W6X A;  1Y96 A;  5IF1 B;  2XU8 A;  3G6E Q;  1QVG A;  3DLM A;  1M4Z A;  4PKC C;  3VRZ A;  1YI2 A;  4JS4 A;  2DD5 B;  2XD0 A;  4V2S A;  4M6V A;  3OMC A;  3PFS A;  4F16 A;  3CME Q;  1RAB B;  4IUR A;  4LD6 A;  1K4U S;  1JU5 C;  4DBF A;  4M77 G;  1X2K A;  3URG A;  5IXB A;  4JX6 A;  3LYI A;  4NS5 A;  2DBK A;  1WXT A;  2OTL Q;  1SHF A;  2CRE A;  3FLG A;  3GBQ A;  2AT1 B;  3WVD B;  2COZ A;  3BDL A;  1U8R A;  2E10 A;  3LLR A;  3MET A;  2V8I A;  3RER A;  4CFU B;  2LNV A;  4C92 G;  1TSF A;  1XO2 A;  2M51 A;  1P5E B;  2HSP A;  2YLB A;  3BHT B;  4A4E A;  1PKD B;  3HO8 A;  2FZC B;  1MMN A;  2BUD A;  5HQ0 B;  4O5V A;  4E6R A;  3A8M B;  1QVF S;  4MZP A;  4EMK C;  3OB9 A;  2DLP A;  4AFQ C;  3ZEH A;  4D8D A;  2RK1 A;  1KHC A;  4NL3 A;  2C0T A;  4Z6Y A;  4QVC A;  3A5Z B;  3A8O B;  5A0D A;  5GAM h;  1WHG A;  1VQP A;  4FCY A;  5GAO r;  4M4Z A;  4DOV A;  3OYG A;  3TSW A;  2KSS A;  2L3R A;  3BLR B;  1K9A A;  1UDL A;  4IUU A;  2CT3 A;  3CPW S;  5FGK B;  2DJQ A;  3CME T;  3MP8 A;  3G71 A;  4UC4 A;  2IN3 A;  3X25 B;  2XHC A;  2EYX A;  4CFV B;  3CCQ Q;  4OB2 B;  2QQB A;  2PK9 B;  3PIP A;  3HPW A;  2F2W A;  2KQW A;  1N8R U;  1WIE A;  2O88 A;  2X35 A;  1ENW A;  2XDB A;  2DYB A;  4L59 A;  3VJP A;  4AFU C;  3C0C A;  3CCL Q;  5J26 A;  1JOW A;  2LQK A;  2JS0 A;  5BNJ B;  5CR2 A;  2EGC A;  4GLK A;  2EVR A;  2FZK B;  3JCM h;  3QUI A;  2LDM A;  1TH7 A;  3PT9 A;  2GTJ A;  1K8A C;  4C5G A;  4PFP A;  4J9G A;  1RAA B;  2KAF A;  4XTX A;  2LX7 A;  3REA B;  1VQ5 T;  2LQN A;  1FVV B;  2DTH A;  2OX7 A;  1GBR A;  1AIS B;  1UJY A;  2WMA B;  2DYI A;  5IHI A;  2ZPB B;  2RF0 A;  2M0O A;  3QDF A;  3QWY A;  1KC8 U;  4HCZ A;  2DF6 A;  1HXD A;  1ZLM A;  4PJO B;  5I21 A;  1QVF P;  1YIT Q;  4ZTJ A;  1VQP Q;  3CMA T;  1YIT T;  2DL5 A;  4CC3 A;  4BCI B;  4OMP A;  1CKB A;  4XQ3 A;  3BW1 A;  3VS1 A;  2EPD A;  4C8Q B;  1X6G A;  1VQ5 A;  1Q82 U;  3JCM P;  1VQN T;  2I53 A;  2PHG A;  4FM4 B;  2CCH B;  1NYG A;  2G9X B;  1WJQ A;  2DKG A;  3J80 E;  4B9X A;  1UUE A;  2J6O A;  3CEY A;  1O9K B;  3SEM A;  2PUO B;  3M58 A;  3QYE A;  5GAM f;  2OAW A;  3V8J A;  1TWB A;  2P0Q A;  4C5H A;  2YDL A;  3RKY A;  2EQU A;  3BLQ B;  4Z88 A;  1VOL A;  2EWN A;  4M75 C;  2XDP A;  3ZBD A;  4EPC A;  5LJ5 g;  2GTO A;  2C5V B;  2MWP A;  2L5Q A;  4F7L B;  2KR3 A;  2ZZD A;  1M27 C;  1RAE B;  6AT1 B;  3TVT A;  4C92 C;  3CD6 T;  3OBY A;  4C0F A;  2K6D A;  3RMQ A;  1VUB A;  4M77 C;  1VQ6 Q;  1UNL D;  2P4R A;  4KGV B;  1YI2 T;  3DDP B;  4CFW B;  2J6K A;  4JZ4 A;  1FMV A;  5KYW A;  2DME A;  5IAY A;  2GGR A;  2EGA A;  4J9F A;  4M78 A;  1JKW A;  1QMC A;  4G6L B;  3VUB A;  3NTH A;  3TNW B;  1P92 A;  2P4T A;  1T0J A;  1GCQ A;  4EOJ B;  2DJZ A;  2ED1 A;  3VRY A;  5CCA A;  3OBW A;  3M53 A;  5EFQ B;  5GAO p;  1MNE A;  5FLX E;  1YIT A;  1NPP A;  2K5L A;  4NC6 A;  2KYB A;  2LCL A;  4PJO G;  4R56 A;  4F7S B;  3I56 T;  2DA9 A;  1KIK A;  2QQR A;  1G3N C;  2E12 A;  2LVM A;  3LQ5 B;  1AZG B;  1TUC A;  1U1T A;  3VS2 A;  4E7Z A;  2EYZ A;  4PJO C;  1GUX B;  2LCS A;  1VQ4 A;  2ZGW A;  4E7S A;  3VYG B;  1RAD B;  5GAN 2;  3OYE A;  2LJ1 A;  2A0F B;  4BE2 A;  4JS5 A;  1W2B P;  5A2Q E;  2DNU A;  1KXU A;  1G3S A;  2M9U A;  4C92 D;  1X69 A;  4A4H A;  2DRK A;  4ORZ A;  1O9S A;  2A28 A;  4M75 D;  2X3X D;  1ZSZ C;  3PIO A;  3DLL A;  1T3S A;  2EQJ A;  3JRZ A;  1VQ7 Q;  4M75 F;  1CSK A;  2R57 A;  4AKG A;  2NWM A;  1EIF A;  1S1N A;  1X2Q A;  5FW9 A;  4EMK A;  4F7U G;  2KGT A;  4J6Y A;  1M90 C;  3O5Z A;  1A0N B;  8ATC B;  4JJD A;  1OX9 A;  3TU4 K;  4MIM A;  2VAS A;  2UZB B;  3QII A;  4C0D C;  2QEX T;  4EOO B;  2XI9 A;  2C5O B;  3EOC B;  4C8Q C;  4RMO A;  3OS0 A;  1H3H A;  2K5I A;  5GAN 5;  3QWX X;  1C9B A;  3JCM W;  4FYV B;  2KT1 A;  1QCO A;  1Y96 B;  3HRT A;  3CC2 A;  5CQY A;  3H41 A;  1IGQ A;  5GAN d;  4HKE A;  3QYB A;  1DJ7 B;  2EYY A;  2D8J A;  3EG3 A;  1C1A A;  5KYX B;  2DL8 A;  4BCJ B;  4CFU D;  3CCM Q;  1VQO Q;  1K0S A;  2ATC B;  4HNT A;  2OTL T;  1SSH A;  4C8Q G;  4KUL A;  2DEQ A;  2BZ8 A;  1PD0 A;  1E7O A;  1JSU B;  1M1K R;  4ELL A;  3M5A A;  4QSH A;  1BB9 A;  4HCB A;  4KRD B;  2F5K A;  1IXD A;  2CT4 A;  1RI0 A;  3CCE Q;  2LP5 A;  1V76 A;  2QAS A;  2LW4 A;  1BU1 A;  3OSV A;  2K2M A;  1UGV A;  2Y4Y A;  3OYH A;  1LNX A;  2RJE A;  1ZSZ A;  3EFO B;  5LJ3 d;  2KXD A;  4X1V A;  2AKK A;  1MV3 A;  3CPF A;  4WF2 A;  3CCL T;  4PJO E;  4M7D D;  4F7U B;  2HKN A;  3MJX A;  5LJ5 h;  1OUL A;  4PK4 A;  1W70 A;  4IIM A;  1WI7 A;  2UZD B;  8AT1 B;  3QO3 A;  5IHK A;  4C8Q A;  1JXO A;  4IUP A;  1K73 R;  1QCN A;  5CKB A;  5GMK m;  1M9S A;  3ZFJ A;  4FSS A;  1R0C B;  1FMW A;  4XAX B;  4ATO A;  4LE9 A;  1KQS S;  3JB9 F;  4Z8A A;  2KVQ G;  4C92 A;  2DVJ A;  4AKH A;  2AK5 A;  2DL3 A;  3CD6 A;  4KH1 B;  2HZY A;  2KK4 A;  1YIJ Q;  1F5Q B;  2YLC A;  1H8K A;  4RG8 A;  3UT1 A;  1XQH A;  2YWW A;  4IUV A;  1KK7 A;  2WEV B;  4F6S B;  1RAC B;  2KYM A;  1S72 Q;  3M0R A;  2JXB A;  4E2F B;  4FYY B;  2RK2 A;  2KMT A;  2L8D A;  5LJ3 e;  2PMI B;  2WFY B;  1VQK A;  5HBE B;  4LOC A;  4ZGE B;  5A0G A;  2C5X B;  1YN8 A;  4Z89 A;  1C6V X;  2GCX A;  2CCI B;  1M3C A;  5D6X A;  3VUZ A;  1I8F A;  2RHU A;  1TOV A;  4MFD A;  2C06 A;  3M54 A;  1OU8 A;  2KRO A;  4M78 F;  3CCS A;  2O9V A;  2DFU A;  1EFN A;  2BE7 D;  3PGG A;  1KHI A;  5KYU B;  3X28 B;  2BS4 A;  2HDA A;  2BTT A;  2UZL B;  2HAX A;  4BB7 A;  5D7U A;  5DLQ E;  4N4H A;  4AG1 C;  1H92 A;  2RQT A;  2OI3 A;  1WJR A;  3A98 A;  2QXF A;  3WXM B;  2YUO A;  5ECA A;  5CQX A;  5FU7 C;  5FU6 C;  2K3Y A;  3BE3 A;  2X4W A;  4FW2 A;  1M3A A;  4LDX A;  1D09 B;  3RMS A;  5GMK h;  1IHV A;  5HY6 A;  1VQ9 Q;  3R6N A;  1KQ1 A;  3JCM f;  3UAT A;  2F2V A;  1PNJ A;  3JCM V;  3QWL A;  3JCM Q;  4C92 B;  3PNW C;  4WCI A;  2NUT B;  2K3X A;  4A53 A;  5IXF A;  2ZPH B;  4Y92 A;  3CXC P;  2KEA A;  3KUF A;  4QW2 A;  2W0Z A;  3EGX B;  3M59 A;  3CCR T;  4OML A;  2CZ7 B;  5KYU A;  2F2C A;  1XTD A;  3CBP A;  4QQG A;  4C5I A;  1YP5 A;  2KY9 A;  3I5R A;  2Z0W A;  4BE1 A;  2EW3 A;  3M57 A;  3CXC A;  4DQ2 A;  1X27 A;  3CQT A;  4CFM B;  2RB6 A;  4JJN K;  4DBR A;  3TW7 A;  1JJ2 A;  3CC7 Q;  1Q7Y U;  3CC7 T;  4M7A F;  1Q82 C;  4WTO B;  1Z9Q A;  1ZSZ B;  4OGE A;  1I0C A;  1PG5 B;  1VIF A;  2JTE A;  3SWN C;  4DA4 A;  4OMM A;  1K76 A;  3VYH B;  1M1G A;  5FRM A;  1Y07 A;  2QG9 B;  3REB B;  1QWF A;  4PJO D;  5GMK j;  4BDY A;  3MHX A;  4F7U E;  2AZV A;  1Q81 R;  3CCM A;  2E1H A;  1VQO A;  3B57 A;  3MY5 B;  5CKD A;  2FYK A;  4J9D A;  2RH2 A;  1AVZ C;  2DPP B;  2CP2 A;  3DDQ B;  1O9K A;  3EG9 A;  3QZ5 B;  4JJB A;  1WX6 A;  2YT6 A;  2K9G A;  1K8A U;  1GXI E;  2EJ9 A;  1M2V B;  1PD1 A;  2YUP A;  3CCU T;  2D9T A;  2X1N B;  1G2B A;  4PL6 A;  4X9D A;  1VQ9 A;  5DY9 A;  1YHQ Q;  3BHV B;  1MMA A;  4EOM B;  2HNI A;  2OTJ T;  3H8Z A;  5IHY A;  4RG2 A;  4TTH A;  4DOW A;  1K73 U;  3FDR A;  2PQW A;  2M02 A;  4MDX A;  3CCQ T;  4M75 B;  3NGP A;  2JOY A;  2WIH B;  3MEU A;  5FWC A;  2GFA A;  4PLL A;  5CVI A;  1OPK A;  1Q7Y C;  3KFV A;  3QPH A;  5KE3 A;  3Q1J A;  3OW2 P;  5CKF A;  2A3L A;  4FSX A;  1SHG A;  3UA6 A;  3NFC A;  3VS5 A;  3CCV Q;  3SDZ A;  4QKU A;  3GNG A;  1M90 R;  1WHM A;  3TN8 B;  3G4S T;  2PVG B;  1M1F A;  2XIC A;  4HNV A;  1OGU B;  2EUF A;  4XTU A;  4GLM A;  1IRX A;  3JB9 I;  1RAH B;  5C0M A;  2JTF A;  3M4Y A;  1O75 A;  5CAI A;  2MIO A;  3CMA A;  3G71 Q;  1ZSG A;  1QKW A;  1YNZ A;  5GMK i;  1V29 B;  3NHN A;  2IW8 B;  2WSC E;  1VQ7 A;  2VXF A;  4OMQ A;  1WFW A;  4OB0 B;  4XTW A;  1PM3 A;  4LUD A;  3MO8 A;  1KD1 U;  4LDV A;  2KMG A;  2JN0 A;  1K1Z A;  4KGX B;  4HCC A;  2RHX A;  2EIF A;  4EOQ B;  2F2X A;  3NPF A;  3RKW A;  2CP7 A;  2OTJ Q;  2LX9 A;  4JLG A;  3RDV A;  2P0K A;  4BDZ A;  2LQW A;  1YFN A;  2ENM A;  4JDS A;  3FC3 A;  1NG2 A;  4OB1 B;  2CZ6 B;  1N9R A;  2DEU A;  2DXB A;  3I5S A;  2JTM A;  1YWO A;  1RLP C;  1SKU B;  4GBQ A;  4KBM B;  2W96 A;  3UWN A;  2K57 A;  2I2L A;  3I56 A;  3EHR A;  3SWN B;  3INZ A;  2VXE A;  4JX4 A;  2QQS A;  4BUG A;  4F04 B;  1Q95 G;  3HKS A;  1H26 B;  2MOX A;  2MAM A;  3I35 A;  3NMZ C;  2JM9 A;  4R0K A;  1VQ4 Q;  2MI6 A;  2F1L A;  3G6E T;  1VIE A;  2JJ9 A;  3VS3 A;  1ZA2 B;  1OL1 B;  4EDU A;  1ZHI A;  1ZUU A;  1UFF A;  2BPM B;  1XJW B;  4PFO A;  1QW1 A;  2QFZ A;  3BG3 A;  3H0H A;  2XK0 A;  1Y71 A;  2HD0 A;  2V8J A;  2O31 A;  1WPY A;  2DMO A;  2E5K A;  4DBQ A;  3M0Q A;  4DEY A;  1WHH A;  1H25 B;  1YI2 Q;  4ELY C;  2DD5 A;  1I81 A;  1W2B S;  2RJF A;  2ZPF B;  1D0Y A;  2QEX A;  2CP6 A;  2EYQ A;  4J9I A;  2W9F A;  3CCJ Q;  4BCK B;  1R0B G;  1Q7Y R;  3EHQ A;  1LPL A;  1TTH B;  2HL5 C;  2CUB A;  3OYM A;  4FYW B;  4OMF B;  1OL2 B;  4BBS M;  1YBY A;  2RMO A;  3L2W A;  3HRU A;  1QCF A;  4J9B A;  4CRI A;  1Q86 U;  2YRC A;  2B9R A;  3E9G A;  5IN1 A;  2FVU A;  3OSS C;  5LJ5 f;  3QDR B;  4YOO A;  1VOM A;  5HBJ B;  2R58 A;  4F6U B;  2AKL A;  5KCO A;  4BI3 A;  3F70 A;  4BCF B;  4JRI A;  2CH4 A;  1E6H A;  1KSW A;  2OAU A;  5GAN 4;  3CC4 Q;  2JW4 A;  3OYK A;  5GAN 6;  1I07 A;  3EFS A;  2HKQ B;  4LDY A;  4M75 E;  2RI2 A;  5GAN 3;  1RUW A;  2RI3 A;  3BG9 A;  3V7R A;  1NJI U;  3BDU A;  2RHI A;  1ARK A;  4EMH A;  1VQM T;  1BKB A;  1W98 B;  2OTJ A;  3G1J A;  4CRL B;  1UEC A;  4HVU A;  1PRL C;  2BZY A;  2GQV A;  4XTV A;  2R5M A;  1VYW B;  1PRM C;  1D3B B;  2RO0 A;  5LJ3 g;  5J3B A;  2V1R A;  2D6F A;  2QI2 A;  3FJP A;  3CCJ T;  3NTK A;  4RTT A;  2HBW A;  2HQH A;  4CC4 B;  3G71 T;  2CKK A;  4BY7 X;  1JST B;  3QHR B;  1WGS A;  2NUT A;  4BCM B;  3QG1 A;  4J6X A;  2X4J A;  4JRP A;  1UNH D;  3LWI A;  1MV0 B;  3A8G B;  2NLU A;  2IIM A;  2MYS A;  2Y90 A;  2DBM A;  3ME9 A;  2IVW A;  3PMI A;  3OS1 A;  4PLI A;  3RNJ A;  5GAO q;  3M0S A;  1YJ9 Q;  4F7U F;  1PKS A;  1ZX6 A;  4OGC A;  4E7H A;  2D0N A;  1LCK A;  2HEQ A;  2RHZ A;  4M77 D;  5IHN A;  3RUX A;  3TCJ A;  5FRO A;  1ZQ1 A;  5LJ5 j;  1VQ8 A;  1PCX A;  1QLY A;  3L2R A;  1BI1 A;  5HVY B;  2QQ9 A;  5KYN A;  5A0L A;  1YIJ A;  4N0A A;  2O9S A;  3HB9 A;  5CEI B;  5DM7 R;  3CC4 A;  1PKT A;  1M90 U;  4IUT A;  1M30 A;  4E47 A;  2K7A A;  3DB4 A;  1NLO C;  1YCY A;  2FPD A;  3HHT B;  1PSF A;  1VQ6 A;  2V22 B;  2EKO A;  4FW1 A;  2KE9 A;  2P0P A;  5GAN g;  2RQV A;  1T3L A;  2XDD A;  1HK9 A;  4M7A E;  3RBB B;  3HFO A;  3M0T A;  1VQ8 T;  5CKH A;  4XU2 A;  4MML A;  2PVO B;  3DB3 A;  3M56 A;  2KDS A;  3OW2 A;  4ZN1 A;  2NUP B;  1AOJ A;  1JB0 E;  2FPF A;  3HRS A;  2R7G A;  2DD4 A;  1GUX A;  1VQN A;  4KUD K;  3CD6 Q;  1TD6 A;  2SEM A;  2ZPI B;  1QLB A;  3JCM e;  2EBP A;  4FX3 B;  1VYT A;  2YRV A;  2DET A;  2DXC A;  4XK8 E;  4EOR B;  1SG5 A;  3G6E A;  3CPW A;  2GQI A;  3LWH A;  3OY9 A;  3JCM g;  3OYB A;  2EQK A;  1R8O B;  3J7A F;  2KI7 A;  3JAM E;  2QGS A;  4EOL B;  1JO8 A;  2LTO A;  4M75 G;  4JRK A;  4CFX B;  4BD3 A;  3VKI A;  1WLP B;  2HQE A;  4BI4 A;  3PE0 A;  4M75 A;  3N5B B;  4HVV A;  1OZ2 A;  3MEW A;  1WHK A;  5KYY B;  1N5Z A;  2FRY A;  3CC2 T;  2WPA B;  2JUF A;  2NYS A;  1VQN Q;  2E65 A;  5GMK e;  1UGP B;  1GL5 A;  3MPU B;  4HVW A;  4RCC A;  7AT1 B;  1IRE B;  1KG1 A;  3EGD A;  3JB9 J;  2GFU A;  1E7P A;  4O6J A;  5LJ3 h;  2HCK A;  4HT8 A;  1KD1 C;  1NJI C;  3RGF B;  1QVG P;  1UG1 A;  1SEM A;  3LX7 A;  2O2O A;  4PFZ A;  4RTY A;  1OX8 A;  5EG2 A;  4E7I A;  1BCO A;  2IPO B;  2X9H A;  1NE8 A;  1D3U B;  5FRN A;  1H1Q B;  1JRI A;  2YUQ A;  3I55 Q;  3ER0 A;  2BIV A;  2W99 A;  3FB9 A;  1VQ5 Q;  2KBT A;  1UE9 A;  4JJC A;  3MKD A;  2KT8 A;  2RQR A;  1ZP2 A;  4ME7 A;  4XU0 A;  4DBH A;  4RTU A;  3TQ7 P;  2O01 E;  4AI6 A;  4A4F A;  4C8Q F;  3NDQ A;  2EAY A;  3DTO A;  2L89 A;  1G8X A;  1K0X A;  1YJ9 A;  3OYL A;  1VQK Q;  3OW2 S;  3FEO A;  1IGU A;  1UHF A;  1F1B B;  1FKM A;  4YOZ A;  2COW A;  2PJQ A;  3CCQ A;  5IDN B;  2I0N A;  3DKM A;  2CDT A;  3BFM A;  4AFZ C;  1QVG S;  1GCP A;  4F7N B;  1M1K U;  2F5T X;  5GAO m;  1ZBX A;  4A4K A;  5GAN e;  1K73 C;  1G3T A;  3CCR A;  3GLX A;  3OYC A;  4BY6 B;  2MMP A;  4KH0 B;  4RKU E;  3POM A;  4LDW A;  3J81 E;  1M3B A;  2A08 A;  3S3N A;  1KC8 C;  3EID B;  4EON B;  2AHJ B;  2QDL A;  2EQI A;  2RQW A;  3OS2 A;  4BE0 A;  1KFZ A;  3HSB A;  2QA4 A;  2JMC A;  3CCJ A;  4J7F A;  1ZUK A;  1WHL A;  2CH4 W;  3TNH B;  4ANJ A;  4F7J B;  1QP2 A;  1OQK A;  4QT7 A;  1U5S A;  1HSQ A;  3GOX A;  3PTA A;  3KBG A;  1VQL Q;  1EZZ B;  1D3B A;  1KQ2 A;  1ZA1 B;  5FU6 B;  3MP6 A;  1AT1 B;  2K3B A;  1UGR B;  5ACB A;  2VYT A;  3NTI A;  5KE2 A;  1NYF A;  4BBR M;  1VQK T;  2QTX A;  3BG5 A;  5LJ3 f;  5GAO l;  1X75 C;  1AWJ A;  1CKA A;  4Y28 E;  4LNP A;  2E6N A;  1N8R C;  1YJW A;  2IW6 B;  3M03 A;  1MMG A;  1OOT A;  4D6W A;  3E9F A;  3C4S A;  1IO6 A;  1D1A A;  3RIR A;  1AWX A;  2SRC A;  2L2P A;  1JJ2 S;  2C4G B;  2VUB A;  4M78 G;  1XOV A;  3BHU B;  2J05 A;  2QQ8 A;  1OKV B;  1B7T A;  5LJ3 j;  3UA7 A;  1M2V A;  5GAO n;  1D1C A;  4NOY A;  3K7A M;  4PJO A;  2LMJ A;  2PU9 B;  4RTV A;  5KYW B;  5D6W A;  3JCM b;  1JEG A;  2JS2 A;  1IZ6 A;  2LT4 A;  2NUZ A;  1AHJ B;  3SD4 A;  3H0F A;  3GNF B;  4K11 A;  4EC9 B;  2RQU A;  1I1J A;  1VQL A;  2J06 A;  4XU3 A;  1YHQ T;  1WZO A;  1QKX A;  5HNB B;  3C12 A;  3IQL A;  1VIN A;  4OR5 B;  1H24 B;  1C0M A;  1FWZ A;  1MGQ A;  4M78 D;  3MCA B;  5C6S A;  2KXC A;  2JGZ B;  3OYY A;  4JLI A;  1VQ8 Q;  1G83 A;  3CCS Q;  4MZM A;  5GAM d;  2FL7 A;  1OKW B;  2FPE A;  1BBZ A;  4ZN3 A;  2CZ1 B;  4YOS A;  1B07 A;  1E9H B;  2MWO A;  3S3O A;  1SF9 A;  2F69 A;  1JXM A;  1B3Q A;  2ZPE B;  4C92 E;  1GFC A;  5I22 A;  4HL4 A;  3VS4 A;  4J9C A;  4RTZ A;  2E70 A;  3QHW B;  1AWW A;  2KRS A;  2ROT A;  4KT0 E;  4F17 A;  1YJW Q;  4CFN B;  2ZPG B;  1VQ4 T;  1GH6 B;  1RAI B;  3E1S A;  5GAN 8;  1NJI R;  2KRM A;  2KR6 A;  2WAC A;  3ULR B;  2K79 A;  5IDP B;  4C0Z A;  5LJ5 e;  1TUD A;  9ATC B;  3PMT A;  1D1B A;  4AKI A;  3GTM S;  2E64 A;  1NLP C;  3H4C A;  1VYU A;  2QQA A;  2RJC A;  5EJC A;  2GBQ A;  3LW5 E;  3G33 B;  2BS2 A;  2BKZ B;  4LUE A;  4B9W A;  1D0Z A;  4CXA B;  4HCK A;  2D1X A;  5GAN j;  4NST B;  1FIN B;  4B6M A;  1M2O A;  2J7I A;  2L0A A;  1UJ0 A;  1Q81 U;  4MFE A;  1X6B A;  4L6V 5;  1H27 B;  1ACM B;  2CS7 A;  1ABO A;  2HSE B;  4A54 A;  2KNB B;  2GNC A;  4C92 F;  2WHB B;  5I2M A;  3I55 T;  1G3W A;  2LC4 A;  2DXT A;  1BI3 A;  2BKD N;  2Y4X A;  5FU7 B;  4Z02 A;  4IUQ A;  4M78 E;  3CCV T;  2DXC B;  3GPL A;  1W1F A;  2V8K A;  4HLQ A;  3MEV A;  1BI2 A;  3DL1 A;  4FIB A;  1S72 A;  2DM1 A;  3JCM J;  1QQJ A;  3VS7 A;  4J8O A;  3GF5 A;  2X4Y A;  2B8A A;  5HK0 A;  2CSI A;  3EFO A;  4E7K A;  3X20 B;  2OTL A;  1FMK A;  3OYI A;  1ZUY A;  3G4S A;  3RKX A;  1TS9 A;  4X9C A;  4EOI B;  1H64 1;  2EYW A;  4BXX X;  3R6O A;  2LRQ A;  1UGQ B;  4EOS B;  2DVE A;  4YC3 B;  4J6W A;  1WXU A;  4HA8 A;  5ICP B;  2W2H A;  1S72 T;  4FL6 A;  4KGZ B;  3EGD B;  1YWP A;  1TXQ A;  3EH2 A;  5GJW B;  2CP5 A;  2H3E B;  2LCC A;  2WSF E;  1BIB A;  1OZ3 A;  3PVQ A;  4LDU A;  4OVA A;  1N8R R;  2M1H A;  1TUG B;  2YUN A;  3EH1 A;  1OU9 A;  3L1A A;  4ELZ C;  3CCL A;  3ZL7 C;  2LJ3 A;  4EOK B;  4NL2 A;  4BY1 X;  4L5G A;  4M77 B;  3CME A;  5GAN f;  4JUV A;  4II1 A;  1N27 A;  4R55 A;  1VA7 A;  1OI1 A;  2RI5 A;  2CP0 A;  2P84 A;  1IHW A;  1I4K 1;  4N0A C;  1Q86 C;  1IB8 A;  2DTI A;  4TVR A;  1LJO A;  4OF1 A;  1OEB A;  3MI9 B;  3RES A;  1H1P B;  3CC4 T;  3H9N A;  1GCQ C;  2OJ2 A;  1Y7X A;  2JVV A;  3SB2 A;  5I11 A;  3P8D A;  3O8V A;  3TEE A;  4CI0 C;  1VYV A;  1VQ6 T;  3GP8 A;  1VQ7 T;  3VV0 A;  5AT1 B;  4J9H A;  2IW9 B;  1KC8 R;  3JSC A;  3QYG B;  3OS5 A;  2D0Q B;  4QQ6 A;  2RN8 A;  1TU0 B;  2J6F A;  3SWN A;  2K2V A;  1PWT A;  2L3S A;  2R5A A;  4M77 A;  2DL7 A;  2ROL A;  3G7Z A;  4EC8 B;  1XNI A;  2EJF A;  1FYN A;  4BCH B;  4KUI A;  2C0I A;  4XU1 A;  4FU6 A;  2FB7 A;  3S3M A;  2CGH A;  2V26 A;  4I3Z B;  3CXC S;  3JCM d;  1SRL A;  3CCM T;  1VQO T;  2WJ9 A;  1N9S A;  3CCU Q;  4OGR B;  3P8B B;  2DIQ A;  4A63 B;  4J83 A;  2QK0 A;  1YJ9 T;  4OB3 B;  2ZAE A;  3H6Z A;  2VC8 A;  3V7C A;  3JCM X;  4BCM D;  1X6O A;  2G6F X;  3CBO A;  1LVK A;  2XMF A;  1WYX A;  2B86 A;  1PC0 A;  3E19 A;  2DXU A;  1VQM Q;  4BY6 C;  1WA7 A;  1KQS A;  1H4L D;  2MK5 A;  2EJG A;  5GAN h;  1J3T A;  1SRM A;  3E2U A;  5HBH B;  1WNL A;  4GY5 A;  3JB9 H;  1TFB A;  4M7A D;  4ZTF A;  1SSF A;  4XTY A;  2FZG B;  4LN2 A;  2LT1 A;  5GJV B;  2PNI A;  4AT1 B;  1GFD A;  2BZX A;  4AG2 C;  2FRW A;  3EGU A;  4BAC A;  3I55 A;  4C5E A;  1H1R B;  1NM7 A;  3EFR A;  1NZ9 A;  2QEX Q;  1NBE B;  2LZ6 B;  2IG0 A;  3M9Q A;  4HNU A;  4M7D F;  4Y91 A;  2V1Q A;  5J39 A;  2JZ2 A;  1Q86 R;  4E7L A;  3D7S B;  1K9M C;  4JZ3 A;  4BCN B;  4BCG B;  2VV5 A;  1HYO A;  5CIU A;  3QYH B;  2E4H A;  4N4I A;  4M7D C;  2LNH B;  2QGG A;  3JB9 D;  3HP9 A;  4EIK A;  1VQP T;  5I5Z B;  3L2Q A;  5DQW A;  3CC7 A;  4FT2 A;  2QGF B;  5GAM j;  2FEI A;  2YRD A;  4ZGJ B;  3M0P A;  2HBP A;  2K5F A;  5I2S A;  5LJ5 d;  1M5Q 1;  4M78 B;  2EKH A;  4BI8 B;  3CC2 Q;  4LXC A;  3UDC A;  1KQS P;  2RPN A;  1WJS A;  1UEB A;  3QZ9 B;  2COY A;  3EAE A;  3LH0 A;  2PVD B;  3OYJ A;  3EG1 A;  1JBM A;  3G4S Q;  1WXB A;  2CUD A;  1RL2 A;  2NUP A;  1I5L A;  2BE9 B;  4C8Q D;  2RNA A;  5CKE A;  5GAM e;  3L2U A;  3OYN A;  1MMD A;  5KCH A;  3TSZ A;  1AEY A;  4QQD A;  1N4M A;  4PNO A;  2VWF A;  5M9O A;  2JT4 A;  3OYD A;  3LH5 A;  1H28 B;  2CZ0 B;  1WQW A;  3I9Q A;  5HKC A;  1QVF A;  3JCM c;  3UF4 A;  2AIR B;  4C0G A;  1UTI A;  1YJW T;  2H8H A;  2VKN A;  2QYZ A;  3L2V A;  3CCE A;  4RTW A;  2QDJ A;  1JJ2 P;  3HZJ A;  4PJO F;  3A8L B;  2WIP B;  1BIA A;  3U23 A;  2ESW A;  3JV3 A;  3X26 B;  2RA2 A;  5KYY A;  2D8H A;  4LD9 K;  3TNI B;  2DK3 A;  3FIF A;  1JQQ A;  1M1K C;  3MIA B;  2FHD A;  1E6G A;  4J7I A;  2VGN A;  2HQX A;  1ZBJ A;  1UNG D;  3VYG A;  3HL8 A;  2BS3 A;  1G5V A;  4BCO B;  3OMG A;  1MND A;  1RAG B;  3MEA A;  4RCB A;  4PJN A;  3P8H A;  5AYF A;  3A8H B;  5L23 A;  4EOP B;  3S6W A;  1G3Y A;  4EMG A;  4RTX A;  3CCV A;  1UGS B;  2X3W D;  2VB6 A;  1T0H A;  5IH2 A;  4HXJ A;  2HMA A;  5HK3 A;  4YTL A;  4BCQ B;  1AWO A;  4BCP B;  3QHS A;  3FRN A;  1UHC A;  5DQV A;  2JM8 A;  2MCN A;  4BCQ D;  2O4X A;  2JNG A;  3RR6 A;  1KJW A;  2DIL A;  2GF7 A;  4ROD A;  2CP3 A;  1YHQ A;  4ELJ A;  2VVK A;  2RD1 A;  4QVD A;  5EC7 A;  2EGE A;  1MHN A;  2UZE B;  1U1S A;  3GIB A;  3SHW A;  1RAF B;  4C8Q E;  3OA6 A;  2C5N B;  4FT4 A;  2K4Y A;  4ZNX A;  1QWE A;  2QDY B;  3VS6 A;  4PJJ A;  1AD6 A;  3H0I A;  3CCE T;  1GBQ A;  3MY1 B;  3OQ5 A;  5KH6 A;  4KRC B;  2RJD A;  2M16 A;  3M4G A;  2W9Z A;  3EGX A;  3HFN A;  4CC2 A;  1ABQ A;  3HTR A;  3PO3 S;  4II5 B;  2QF7 A;  1BI0 A;  1GRI A;  2FO0 A;  1U06 A;  1X43 A;  3VS0 A;  3EJ1 B;  2X51 A;  3M0U A;  2L3P A;  4J5Y A;  2G77 A;  1Z9Z A;  2MPX C;  1YJN T;  3C94 A;  2VGM A;  3SFM A;  1AD5 A;  4M7A A;  1FXX A;  3KHI A;  1NEB A;  1EX4 A;  4BCN D;  1OI9 B;  4IKF A;  1Y0M A;  2HL3 A;  4XTZ A;  3LGF A;  3VKG A;  5DLO A;  3THK A;  3V8K A;  2H3J A;  2PZ1 A;  4M77 F;  1K8A R;  2C0O A;  5D6Y A;  1YJN A;  1N6A A;  3CBM A;  2IVX A;  1H1S B;  2PK2 A;  1GY3 B;  2M0Y A;  1X01 A;  1FX7 A;  4PJM A;  3M55 A;  1PHT A;  4IIO A;  1K9M R;  1B34 B;  5CK9 A;  2I40 B;  4IMY B;  5LQF B;  3BLH B;  3QSU A;  2DO3 A;  4M7A B;  2DZ9 A;  1NEG A;  1UB4 A;  4UN0 A;  2DTO A;  1M8M A;  5LMK B;  4MMK A;  2A36 A;  3CMA Q;  4F7U A;  1URC B;  4ROC A;  2G3R A;  3JB9 G;  2PUK B;  3LGL A;  3QJY A;  3CCS T;  4FYX B;  2AZS A;  1MUZ A;  1HD3 A;  2E6Z A;  1SPK A;  3CPW P;  1YJN Q;  5L8R E;  2E5Q A;  5LL6 S;  3MP1 A;  1W2B A;  1NPR A;  1OV3 A;  4MZT A;  1WHJ A;  2UUE B;  3TRE A;  2DIG A;  4Q5W A;  4JRQ A;  1YCS B;  3X24 B;  4PJL A;  2DL4 A;  3A1P A;  1K9M U;  3WVE B;  3O0G D;  1BU2 A;  3C95 A;  3VU3 C;  1V1C A;  2A37 A;  1B34 A;  4JPB W;  2DZC A;  1BYM A;  5GAM g;  2DX1 A;  4M77 E;  4RUG A;  3QXE B;  4HT9 A;  2E3H A;  3EG0 A;  3AHU A;  5KYX A;  1QP3 A;  4VUB A;  4F14 A;  2CSQ A;  3T9N A;  2DE0 X;  3VKH A;  2ED0 A; 
#chains in the Genus database with same CATH homology
 1BKB A;  2XG8 D;  2XID A;  2OTJ A;  4JX5 A;  2DVE A;  1VQM A;  4J6W A;  2GQV A;  3QBY A;  4XTV A;  3KXT A;  2R5M A;  3M5A A;  4HA8 A;  3V7S A;  4QSH A;  2YHT A;  1S72 T;  4FL6 A;  1D3B B;  4HCB A;  2RO0 A;  5LJ3 g;  5J3B A;  2A7Y A;  2D6F A;  3V8L A;  2F5K A;  2QI2 A;  3FJP A;  1RI0 A;  3CCJ T;  3CCL T;  4PJO E;  3NTK A;  2LCC A;  2WSF E;  1BIB A;  1OZ3 A;  4LDU A;  4MDW A;  4OVA A;  4X34 A;  2M1H A;  3G71 T;  2CKK A;  3OSV A;  3QJ6 A;  1WGS A;  3QG1 A;  4J6X A;  2Y4Y A;  3OYH A;  1LNX A;  2RJE A;  2E41 A;  2X4J A;  5LJ3 d;  3CCU A;  4JRP A;  3L1A A;  4OP0 A;  4EMK B;  1QVP A;  4ELZ C;  3LWI A;  3CCL A;  3A8G B;  4N4G A;  4M7A G;  2NLU A;  4NL2 A;  2Y90 A;  3CPF A;  4WF2 A;  4L5G A;  1VQL T;  3ME9 A;  2IVW A;  3PMI A;  3OS1 A;  4M77 B;  1OYX A;  4F7U B;  3TW6 A;  4PLI A;  5GMK l;  4JUV A;  3HBL A;  5GAN f;  4II1 A;  1N27 A;  5GAO q;  4R55 A;  5LJ5 h;  4F7U F;  1OI1 A;  2RI5 A;  2RM4 A;  4OGC A;  1LOJ A;  4E7H A;  1I4K 1;  2XKO C;  4M7A C;  4N0A C;  1Q86 C;  2DTI A;  3QO3 A;  4TVR A;  4C8Q A;  2QA4 T;  2RHZ A;  4IUP A;  1LJO A;  4M77 D;  4M7D B;  4OF1 A;  2DD4 B;  3RUX A;  3RES A;  5CKB A;  2LQ8 A;  3TCJ A;  5FRO A;  5GMK m;  1ZQ1 A;  1M9S A;  3ZFJ A;  3CC4 T;  1H3Z A;  4M7D G;  5LJ5 j;  4XAX B;  1VQ8 A;  4ATO A;  4M7D E;  1KQS S;  3JB9 F;  2DXB B;  1Y7X A;  2JVV A;  3SB2 A;  3L2R A;  1BI1 A;  2KVQ G;  4C92 A;  3P8D A;  2QQ9 A;  4M7D A;  4AKH A;  5A0L A;  1YIJ A;  4N0A A;  1Q81 C;  1M8V A;  3CD6 A;  2ZZD B;  3O8V A;  3HB9 A;  3TEE A;  4CI0 C;  4M78 C;  5DM7 R;  3CC4 A;  1VQ6 T;  3GP8 A;  1YIJ T;  2X4X A;  3VV0 A;  1W4S A;  4E7J A;  3OYA A;  2KK4 A;  1M90 U;  1VQ7 T;  2YLC A;  3JSC A;  3QYG B;  3OS5 A;  2D0Q B;  4IUT A;  3QKJ A;  4QQ6 A;  4RG8 A;  4E47 A;  3DB4 A;  3UT1 A;  2CYZ B;  1XQH A;  1YCY A;  4IUV A;  3ASK A;  3UPU A;  3HHT B;  1PSF A;  1VQ6 A;  2EKO A;  3SWN A;  1WQ7 A;  2K2V A;  2P0P A;  5GAN g;  5IT9 E;  1VQ9 T;  1PSE A;  2R5A A;  2XDD A;  1HK9 A;  4M77 A;  4M7A E;  4P5N A;  3G7Z A;  2WSE E;  1XNI A;  2RK2 A;  3HFO A;  1VQ8 T;  2KMT A;  5CO7 A;  2EJF A;  5CKH A;  2L8D A;  4XU2 A;  2O4X B;  4MML A;  4KUI A;  4A4G A;  2PVO B;  3DB3 A;  3M56 A;  5LJ3 e;  2KDS A;  4XU1 A;  4FU6 A;  4C0D B;  3OW2 A;  2FB7 A;  4ZN1 A;  3S3M A;  1VQK A;  1JB0 E;  2EQM A;  4LOC A;  4ZGE B;  2MF2 A;  3HRS A;  2DD4 A;  5A0G A;  2CGH A;  4QVZ A;  1VQN A;  2ZCF B;  4KUD K;  3CXC S;  3BY7 A;  3JCM d;  3L2Z A;  3CCM T;  1VQO T;  2ZPI B;  1QLB A;  2GCX A;  3JCM e;  2EFI A;  5D6X A;  2YRV A;  3OYF A;  3VUZ A;  2WJ9 A;  1I8F A;  1N9S A;  2RHY A;  2RHU A;  5GAN 7;  3P8B B;  4ZGD B;  2DIQ A;  2DXC A;  2DAQ A;  4J83 A;  3L42 A;  4XK8 E;  4MFD A;  3G6E A;  2C06 A;  3M54 A;  3CPW A;  1YJ9 T;  4OB3 B;  4M78 F;  1Y96 A;  3CCS A;  2XU8 A;  3OY9 A;  3LWH A;  3JCM g;  3OYB A;  2EQK A;  1R8O B;  3H6Z A;  3DLM A;  1M4Z A;  4PKC C;  1YI2 A;  1QVG A;  4JS4 A;  2DD5 B;  2XD0 A;  2VC8 A;  3V7C A;  4V2S A;  3JCM X;  4M6V A;  3JAM E;  3OMC A;  4M75 G;  2LTO A;  3PGG A;  1KHI A;  4JRK A;  1X6O A;  4BD3 A;  3X28 B;  2BS4 A;  2HQE A;  3PFS A;  3VKI A;  4BI4 A;  3CBO A;  4M75 A;  3N5B B;  2HAX A;  4BB7 A;  5DLQ E;  1OZ2 A;  4IUR A;  1YJN T;  3MEW A;  4LD6 A;  4N4H A;  3CC2 T;  4M77 G;  3URG A;  2JUF A;  4JX6 A;  3E19 A;  2E65 A;  3LYI A;  1WJR A;  4NS5 A;  5GMK e;  1UGP B;  2DXU A;  2QXF A;  4RCC A;  3WXM B;  4BY6 C;  1KQS A;  1IRE B;  1KG1 A;  3JB9 J;  3FLG A;  2EJG A;  5GAN h;  3WVD B;  5CQX A;  5FU7 C;  3BDL A;  5FU6 C;  1U8R A;  2E10 A;  2K3Y A;  1WNL A;  2GFU A;  4GY5 A;  3LLR A;  2X4W A;  3MET A;  3JB9 H;  4M7A D;  4ZTF A;  1SSF A;  1E7P A;  4O6J A;  4XTY A;  2V8I A;  5LJ3 h;  4HT8 A;  1KD1 C;  2LNV A;  5GMK h;  3RMS A;  4LDX A;  3RER A;  4C92 G;  1NJI C;  5HY6 A;  2LT1 A;  1KQ1 A;  3LX7 A;  3JCM f;  2YLB A;  4A4E A;  5EG2 A;  3JCM V;  4E7I A;  3QWL A;  3JCM Q;  4BAC A;  1NE8 A;  4C92 B;  3HO8 A;  3I55 A;  3PNW C;  5FRN A;  2BUD A;  1JRI A;  4O5V A;  4C5E A;  3A8M B;  2K3X A;  2OTL T;  4A53 A;  1QVF S;  2ZPH B;  3EFR A;  1NZ9 A;  3KUF A;  2IG0 A;  3M9Q A;  4HNU A;  4MZP A;  4QW2 A;  4Y91 A;  4EMK C;  3M59 A;  3ER0 A;  5J39 A;  2CZ7 B;  2BIV A;  3CCR T;  3FB9 A;  3OB9 A;  3ZEH A;  1XTD A;  3CBP A;  2JZ2 A;  4QQG A;  4E7L A;  2RK1 A;  1KHC A;  1K9M C;  4NL3 A;  4Z6Y A;  4C5I A;  4QVC A;  4ME7 A;  3A5Z B;  3A8O B;  4XU0 A;  5A0D A;  2O01 E;  2KY9 A;  4AI6 A;  4A4F A;  5GAM h;  2VV5 A;  1VQP A;  4C8Q F;  5GAO r;  4BE1 A;  5CIU A;  2EAY A;  3M57 A;  4DOV A;  2L89 A;  3QYH B;  4N4I A;  4DQ2 A;  3OYG A;  3CXC A;  1YJ9 A;  3OYL A;  4M7D C;  2RB6 A;  4JJN K;  3OW2 S;  3TW7 A;  2KSS A;  2L3R A;  3FEO A;  3HP9 A;  3JB9 D;  1JJ2 A;  4M7D F;  1Q7Y U;  3CC7 T;  4M7A F;  4M7D D;  1VQP T;  1FKM A;  4IUU A;  3L2Q A;  3CPW S;  3CCQ A;  1Q82 C;  3CC7 A;  4FT2 A;  5GAM j;  3CME T;  3MP8 A;  3G71 A;  3DKM A;  4UC4 A;  3X25 B;  4ZGJ B;  2XHC A;  2HBP A;  3BFM A;  4OGE A;  1QVG S;  4OB2 B;  2QQB A;  2K5F A;  2F5T X;  5I2S A;  1M5Q 1;  5LJ5 d;  4M78 B;  3HPW A;  5GAO m;  1ZBX A;  4A4K A;  4BI8 B;  5GAN e;  1VIF A;  3SWN C;  4DA4 A;  1K73 C;  2KQW A;  3J7A F;  1G3T A;  3UDC A;  1N8R U;  3CCR A;  1M1G A;  3VYH B;  5FRM A;  2X35 A;  1Y07 A;  1WJS A;  3GLX A;  2XDB A;  3OYC A;  1UEB A;  4L59 A;  3VJP A;  3QZ9 B;  2MMP A;  4RKU E;  4BY6 B;  4LDW A;  3J81 E;  4PJO D;  5GMK j;  3EAE A;  3LH0 A;  2PVD B;  5J26 A;  3OYJ A;  4BDY A;  3G4S T;  3S3N A;  1KC8 C;  3MHX A;  2AHJ B;  4F7U E;  2LQK A;  3OS2 A;  4BE0 A;  1JBM A;  3CCM A;  2E1H A;  1VQO A;  5CR2 A;  3HSB A;  5CKD A;  2QA4 A;  1RL2 A;  2FYK A;  4GLK A;  1I5L A;  2RH2 A;  2DPP B;  3JCM h;  3QUI A;  3CCJ A;  4J7F A;  4C8Q D;  3QZ5 B;  2LDM A;  1TH7 A;  3PT9 A;  5CKE A;  1K8A C;  1M1K U;  4C5G A;  1QP2 A;  5GAM e;  3L2U A;  1K8A U;  2KAF A;  3OYN A;  4XTX A;  5KCH A;  1GXI E;  3GOX A;  2EJ9 A;  4QQD A;  3PTA A;  3KBG A;  4PNO A;  1VQ5 T;  2DTH A;  5M9O A;  3OYD A;  2CZ0 B;  3CCU T;  1D3B A;  2D9T A;  1KQ2 A;  1WQW A;  5FU6 B;  2ZPB B;  5HKC A;  1QVF A;  3MP6 A;  4PL6 A;  3JCM c;  1UGR B;  4C0G A;  2VYT A;  3NTI A;  4X9D A;  1VQ9 A;  5KE2 A;  1YJW T;  2M0O A;  3L2V A;  3CCE A;  5DY9 A;  4HCZ A;  4BBR M;  1KC8 U;  1VQK T;  2QDJ A;  3HZJ A;  1HXD A;  2HNI A;  3A8L B;  2QTX A;  1BIA A;  4PJO F;  2OTJ T;  3BG5 A;  5LJ3 f;  5GAO l;  3H8Z A;  1X75 C;  4PJO B;  5I21 A;  4Y28 E;  3X26 B;  2RA2 A;  4ZTJ A;  4RG2 A;  4DOW A;  2E6N A;  1YIT T;  3CMA T;  1N8R C;  1YJW A;  1K73 U;  3FDR A;  4LD9 K;  2DK3 A;  2PQW A;  3FIF A;  3PIP A;  1M1K C;  4MDX A;  3CCQ T;  2FHD A;  4M75 B;  4XQ3 A;  2JOY A;  3BW1 A;  4J7I A;  3MEU A;  4C8Q B;  2VGN A;  1VQ5 A;  4D6W A;  2GFA A;  2HQX A;  3E9F A;  4PLL A;  5CVI A;  3JCM P;  1Q82 U;  1VQN T;  3VYG A;  3C4S A;  3HL8 A;  2BS3 A;  4FM4 B;  1Q7Y C;  1G5V A;  3QPH A;  3RIR A;  3Q1J A;  3OMG A;  5KE3 A;  1WJQ A;  2DKG A;  5CKF A;  3J80 E;  4B9X A;  2A3L A;  2VUB A;  3CEY A;  3MEA A;  4FSX A;  4M78 G;  4RCB A;  1JJ2 S;  3P8H A;  5AYF A;  3NFC A;  1XOV A;  2PUO B;  3A8H B;  3M58 A;  3QYE A;  3SDZ A;  3V8J A;  5GAM f;  3GNG A;  2P0Q A;  4C5H A;  3S6W A;  1G3Y A;  3RKY A;  2PVG B;  1M1F A;  2EQU A;  4HNV A;  2XIC A;  2QQ8 A;  1UGS B;  4EMG A;  4XTU A;  3CCV A;  3JB9 I;  5LJ3 j;  2EWN A;  4M75 C;  5C0M A;  5HK3 A;  2JTF A;  2XDP A;  3M4Y A;  1O75 A;  4YTL A;  3ZBD A;  4EPC A;  5CAI A;  5GAO n;  3CMA A;  5LJ5 g;  3QHS A;  5GMK i;  3FRN A;  1V29 B;  2MWP A;  4NOY A;  2O4X A;  4PJO A;  2JNG A;  2L5Q A;  2VXF A;  2WSC E;  2ZZD A;  1VQ7 A;  2PU9 B;  4OB0 B;  4C92 C;  4XTW A;  3OBY A;  3CD6 T;  4C0F A;  5D6W A;  3JCM b;  2GF7 A;  1IZ6 A;  2LT4 A;  3RMQ A;  1VUB A;  1YHQ A;  3MO8 A;  4M77 C;  4ELJ A;  1AHJ B;  2RD1 A;  4QVD A;  1KD1 U;  4LDV A;  3SD4 A;  2KMG A;  2JN0 A;  4HCC A;  1MHN A;  1U1S A;  1YI2 T;  3GIB A;  3GNF B;  2RHX A;  2EIF A;  4C8Q E;  3OA6 A;  1VQL A;  3RKW A;  4XU3 A;  4FT4 A;  1YHQ T;  2K4Y A;  2LX9 A;  5IAY A;  3C12 A;  4JLG A;  2P0K A;  1FWZ A;  4BDZ A;  2QDY B;  1MGQ A;  4JDS A;  4M78 D;  4M78 A;  3MCA B;  4OB1 B;  3FC3 A;  2CZ6 B;  1N9R A;  5C6S A;  3CCE T;  2DXB A;  3OYY A;  3OQ5 A;  4JLI A;  2JTM A;  5KH6 A;  3VUB A;  2RJD A;  2M16 A;  4KBM B;  3M4G A;  3NTH A;  3HFN A;  1P92 A;  2P4T A;  4MZM A;  3UWN A;  5GAM d;  2K57 A;  2FL7 A;  2I2L A;  1BI0 A;  2QF7 A;  4ZN3 A;  2CZ1 B;  2DJZ A;  3I56 A;  5CCA A;  3OBW A;  3SWN B;  3INZ A;  3M53 A;  2G77 A;  2MWO A;  2VXE A;  4J5Y A;  4JX4 A;  2QQS A;  4BUG A;  2F69 A;  5FLX E;  5GAO p;  3S3O A;  3HKS A;  1YIT A;  2ZPE B;  4C92 E;  3C94 A;  2VGM A;  4HL4 A;  1NPP A;  2K5L A;  3SFM A;  4NC6 A;  2E70 A;  2LCL A;  4PJO G;  1FXX A;  4M7A A;  4R56 A;  2MAM A;  4KT0 E;  3I56 T;  2QQR A;  3KHI A;  2E12 A;  2LVM A;  1U1T A;  2ZPG B;  1VQ4 T;  2MI6 A;  3E1S A;  3G6E T;  1VIE A;  4IKF A;  4PJO C;  4EDU A;  1VQ4 A;  2ZGW A;  3VYG B;  1ZHI A;  5GAN 8;  4XTZ A;  5GAN 2;  3OYE A;  3LGF A;  3VKG A;  5DLO A;  4BE2 A;  2KR6 A;  2WAC A;  5A2Q E;  4JS5 A;  1G3S A;  2M9U A;  4C92 D;  3V8K A;  4A4H A;  4C0Z A;  5LJ5 e;  2H3J A;  1O9S A;  4M77 F;  3PMT A;  4M75 D;  4AKI A;  5D6Y A;  3PIO A;  1QW1 A;  1YJN A;  3DLL A;  1N6A A;  2E64 A;  3CBM A;  2QFZ A;  2EQJ A;  3JRZ A;  3BG3 A;  2QQA A;  3H4C A;  2XK0 A;  1X01 A;  1FX7 A;  1Y71 A;  2HD0 A;  2RJC A;  4M75 F;  5EJC A;  2V8J A;  3LW5 E;  2R57 A;  3M55 A;  4AKG A;  1WPY A;  1B34 B;  5CK9 A;  2BS2 A;  1EIF A;  4B9W A;  4ELY C;  3QSU A;  2DD5 A;  2DO3 A;  4M7A B;  2DZ9 A;  1I81 A;  1UB4 A;  1W2B S;  4EMK A;  2DTO A;  2RJF A;  4F7U G;  2ZPF B;  4J6Y A;  5GAN j;  1M90 C;  4MMK A;  2QEX A;  4F7U A;  1Q81 U;  2EYQ A;  4MFE A;  4L6V 5;  2G3R A;  3JB9 G;  2CS7 A;  2PUK B;  3TU4 K;  3LGL A;  3QJY A;  3OYM A;  3CCS T;  4OMF B;  4MIM A;  4A54 A;  3QII A;  4C0D C;  4C92 F;  2QEX T;  2E6Z A;  5I2M A;  3I55 T;  2XI9 A;  5L8R E;  2E5Q A;  5LL6 S;  3MP1 A;  1W2B A;  1NPR A;  1G3W A;  4BBS M;  1YBY A;  2LC4 A;  4MZT A;  4C8Q C;  4RMO A;  2DXT A;  3L2W A;  3HRU A;  3TRE A;  3OS0 A;  2DIG A;  1BI3 A;  4CRI A;  2BKD N;  2K5I A;  2Y4X A;  5FU7 B;  5GAN 5;  1Q86 U;  4Z02 A;  4Q5W A;  4IUQ A;  4M78 E;  3CCV T;  4JRQ A;  3JCM W;  2DXC B;  3X24 B;  3E9G A;  5IN1 A;  2FVU A;  3OSS C;  5LJ5 f;  3GPL A;  1Y96 B;  2V8K A;  3HRT A;  3QDR B;  3CC2 A;  4HLQ A;  3MEV A;  2R58 A;  1BI2 A;  5KCO A;  3WVE B;  1K9M U;  3C95 A;  4BI3 A;  3F70 A;  3DL1 A;  4JRI A;  4FIB A;  3VU3 C;  1S72 A;  2OAU A;  1B34 A;  5CQY A;  2DZC A;  5GAN d;  3JCM J;  1BYM A;  4J8O A;  4HKE A;  3QYB A;  5GAM g;  1DJ7 B;  5GAN 4;  3GF5 A;  2X4Y A;  4M77 E;  2B8A A;  3OYK A;  3QXE B;  5HK0 A;  5GAN 6;  3EFS A;  4HT9 A;  4E7K A;  4LDY A;  4M75 E;  3X20 B;  2RI2 A;  5GAN 3;  3OYI A;  3CME A;  2OTL A;  3AHU A;  2RI3 A;  3BG9 A;  1QP3 A;  4VUB A;  3G4S A;  3RKX A;  4X9C A;  4HNT A;  1H64 1;  3V7R A;  1NJI U;  3BDU A;  2RHI A;  3T9N A;  3R6O A;  3VKH A;  4C8Q G;  4EMH A;  2LRQ A;  4KUL A;  1VQM T;  1UGQ B;  2DEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...