2CZ1B

Photo-activation state of fe-type nhase with n-ba in anaerobic condition
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title photo-activation state of Fe-type NHase with n-BA in anaerobic condition
rcsb
molecule tags Lyase
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2cz1B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cz1B02
3QYHB 2CZ7B 1GXIE 2O01E 3X28B 3A8MB 2DPPB 3LW5E 3VYHB 3QZ5B 2PUOB 1QP3A 3X24B 2ZPFB 2ZCFB 1UGSB 4OB1B 2QDYB 3VYGA 1JB0E 4FM4B 2ZPBB 2WSCE 1UGRB 1UGPB 2CYZB 3A8HB 4L6V5 3X20B 4Y28E 3A8GB 2CZ1B 2WSEE 3QZ9B 3X26B 2D0QB 2PVGB 4ZGDB 1UGQB 1QP2A 2DD4B 2CZ0B 4OB3B 3A8LB 2DD5B 2ZZDA 2ZPIB 3VYGB 2DXCB 2ZPGB 4OB0B 4RKUE 1V29B 2DXBB 2ZZDB 3HHTB 2ZPHB 1AHJB 3QXEB 4ZGEB 4KT0E 1IREB 2PVOB 2AHJB 2DD4A 2PUKB 2ZPEB 3WVEB 4ZGJB 4XK8E 2DD5A 5L8RE 3QYGB 4OB2B 2PU9B 3WVDB 1DJ7B 2DXCA 3A8OB 1PSFA 1PSEA 2PVDB 2DXBA 2WSFE 3X25B 2CZ6B
chains in the Genus database with same CATH superfamily
2XIDA 1WYXA 2QEXT 4AKGA 4C8QC 2LCLA 4HVUA 4WF2A 2QF7A 3GIBA 1U3OA 3GNGA 3I55A 1QP3A 2FB7A 1RAFB 1VQKT 1WIEA 3FJ5A 3QJYA 1MMGA 1NLOC 1K8AU 1D0XA 4JZ3A 2V8IA 3CPWA 3REAB 3OSVA 3VS0A 2XDBA 5GAMd 3TQ7P 4XQ3A 2FZGB 2E1HA 3META 2E64A 1VYUA 2IW9B 2F69A 4M78D 3RKXA 1NYFA 4FU6A 2COYA 3VS7A 2FHDA 2DA9A 4RMOA 2PK9B 2PVGB 1D3BB 4ZGDB 4LD6A 1QVFA 2D8HA 2DVEA 1D0ZA 1H27B 2XI9A 4BCGB 5HQ0B 3TW7A 3JCMg 3QIIA 4LDXA 2G9XB 3O5ZA 1BIBA 1VQ9A 4M7DF 4HNUA 3LYIA 3OSSC 2WFYB 2EQKA 2M0YA 3DB3A 3SB2A 4KH0B 3CCQQ 4CC3A 2IW6B 4MZMA 2KMTA 1M1GA 2GNCA 4M75D 1Q86U 1YJWA 2QQ9A 5GMKi 3OY9A 2DEQA 2DYIA 4N0AA 2QASA 2RNAA 4J9FA 4P5NA 1HXDA 1B7TA 2AT1B 1YJNQ 4F70B 3J80E 4F7UE 1QMCA 2PVOB 3JCMQ 5DQVA 1VQ5Q 2ED1A 2IW8B 2HQHA 3ZEHA 4F14A 1KC8R 3EG9B 3PMIA 1SPKA 4Z8AA 5FU6C 2D1XA 1VIFA 5IT9E 3JB9H 3H0HA 3M56A 3J7AF 2VGMA 3WVDB 3AHUA 2ESWA 1S1NA 1YP5A 3BDUA 1M90C 3NFCA 4RUGA 2LMJA 2MWOA 4VUBA 2QGGA 2PVDB 1OQKA 2I40B 3S3MA 1VQOQ 1FYNA 4PJJA 4A4GA 2JT4A 2HKNA 2YUPA 3UA6A 1BU1A 2KSSA 2KEAA 1YJ9Q 1GY3B 4F6SB 3F5XB 4JZ4A 4F7UG 2DETA 2GQIA 3VS4A 3CCJQ 1U5SA 1GFDA 2F2VA 3CMEA 1JEGA 3HBLA 3RGFB 2HQXA 4Y28E 4MZTA 2HL3A 1G8XA 5KYXA 4Y91A 5GMKj 5LJ3e 5GANf 5A0GA 1O75A 1OV3A 1TUGB 4J9GA 1ZHIA 3M0PA 3QO3A 2WIPB 3V7RA 1T3SA 1YI2A 3RDVA 1U8RA 3A8LB 4C0ZA 4E7IA 5KYUB 2C5VB 1BYMA 4CRLB 2EQJA 4BCQD 4QKUA 1OKVB 3GF5A 4C92F 2GCXA 5IF1B 2HBWA 3OYGA 3M54A 5HNBB 3OS0A 3OYBA 2ZZDB 3D7SB 4F6UB 4QVDA 1WXBA 1I07A 4Z02A 1W98B 1YITQ 2EGAA 1UJYA 2BS2A 4FX3B 1LOJA 3CC2Q 2EBPA 4NL3A 1D3BA 4MMLA 2HAXA 4II5B 5FRNA 4CXAB 1BU2A 3L1AA 3OQ5A 1K0SA 4RTYA 4UN0A 3UWNA 4XK8E 1BB9A 4DOVA 2AIRB 4F6WB 5GAMe 2RA2A 3VS5A 1G3WA 2DYBA 4LXCA 4AFZC 1SG5A 2JXBA 1RADB 1IRXA 1GCQA 1JRIA 3BLHB 3JCMh 4M7DE 4EOMB 1K73C 4Y92A 4F16A 2WSFE 3EOCB 3NHNA 4LE9A 4XTUA 4JUVA 3SWNA 2CUBA 4KBMB 2VXEA 5I2MA 2W9ZA 3I56T 4JJCA 1NEBA 2DJZA 1Y0MA 2K9GA 4E7HA 3JCMJ 3JCMf 3EG9A 3M0RA 3MJXA 4XAXB 1YBYA 3S3OA 4FM4B 3BLQB 4Y72B 2YDLA 1X2QA 3CCET 2XHCA 3ZBDA 2FRWA 1MV0B 4CFUD 2FO0A 1M3BA 2JTFA 1WPYA 1BI1A 3L2QA 2PHGA 3QG1A 1NG2A 5J3BA 3GBQA 3RMSA 3FLGA 1M4ZA 2DXTA 1SKUB 4PJOF 1TWBA 3OYMA 2UZBB 2EIFA 1GBRA 1CKAA 4GLMA 5L23A 1T0HA 1WHLA 1QVPA 1JKWA 5EC7A 2M51A 3LH0A 3PE0A 4M77C 3HSBA 2OJ2A 3BG5A 3A98A 2BE7D 4JS4A 5AT1B 4AKHA 2LVMA 3UF4A 5GAN5 1PHTA 5C6SA 2HD0A 2CT4A 2P0KA 2FRYA 4BBRM 1LVKA 4XU0A 3DL1A 1VQMA 1AVZC 1HD3A 4Z89A 2BZXA 4GY5A 4KT0E 2LJ3A 3CCMQ 1IREB 1B07A 3CCQA 1WQ7A 4ME7A 5GMKh 3TW6A 1TUCA 4ZTFA 2VC8A 3HL8A 1W4SA 2WACA 4M7DD 1KG1A 4PJOA 3SEMA 4KRCB 1NJIC 4L5GA 4KH1B 4BCNB 2H3EB 2DKGA 5KYUA 3CCRA 1BI2A 2CP0A 4JX6A 3M55A 4X9DA 2CSQA 1VQLA 1KC8U 1VQ8Q 3CD6Q 1VQ5A 2BPMB 3E9GA 1MHNA 2KT8A 2EQUA 1PSEA 3EG3A 3X25B 2ZZDA 5I2SA 4C92E 1X69A 1YN8A 3CC4A 1MMAA 2X1NB 4QQ6A 3PIPA 3VRZA 4EOIB 1N8RC 4RODA 1SSFA 4C0FA 4C8QB 4M77G 2PUOB 1WDXA 3GNFB 4WTOB 1QLYA 3SDZA 1RI0A 2ECZA 2K3YA 1VQOA 1X2KA 3VYGA 3C0CA 4IKFA 3T9NA 2WSCE 3P8BB 1UGPB 2BKDN 1I5OB 3M59A 5CKEA 2K2VA 3OYAA 1WHJA 1FMKA 2DBKA 3U23A 4LN2A 2DMOA 3QZ9B 3X26B 3PVQA 1NBEB 3CCST 4B9XA 3CCJA 5EFQB 2XU8A 5HY6A 4J6WA 4EC9B 4JPBW 4NOYA 3EHQA 1VYVA 5DLOA 1PD0A 3G6EQ 3JCMd 3MEVA 4B6MA 2M0OA 1NZ9A 5IHIA 1G2BA 1PKTA 2DXCB 1M3CA 2ED0A 2A3LA 1WGSA 1Q82C 4J83A 4HL4A 5CKHA 1C6VX 2K5IA 1ZSGA 4E6RA 1Q7YU 1OI9B 1S72T 3SFMA 2DF6A 2DIQA 2NWMA 3FRNA 2V8JA 2IG0A 1KFZA 3DDPB 2KK4A 2OAUA 1RAAB 2KYMA 2KQWA 2CP2A 2SEMA 3OYKA 1M2VB 3FIFA 5LJ5f 3OW2S 4PJOE 2CSIA 4C92D 3OYJA 4EOOB 3DLMA 1YITA 2QQSA 5FU6B 1NE8A 2L3SA 4AFSC 2A28A 5FLXE 4A4HA 2RJFA 4C5GA 3BW1A 1VUBA 1VQKQ 4LDUA 4QW2A 2G3RA 3OMGA 2LQ8A 1OU8A 1TU0B 3MHXA 4E47A 5DM7R 2GTJA 1OGUB 2K3XA 4DQ2A 2YUNA 3M53A 2O2OA 3LGLA 3RESA 4BE2A 3L2UA 1VQNA 1AWXA 2CDTA 5GAOm 1P92A 4CC2A 2EYWA 3C95A 4DOWA 3EH2A 4QSHA 4EMKB 3JCMb 4ATOA 1BBZA 2JZ2A 1UHFA 1UGSB 2D8JA 1KK7A 2RH2A 4O5VA 5J26A 3PMTA 3E9FA 4AMCA 1IGQA 1M9SA 5HKCA 2CP5A 4Z88A 2X35A 3FJPA 1TSFA 2NYSA 5CKDA 2IPOB 2X4WA 1XO2A 4BCOB 1IXDA 3ER0A 4JRIA 1LNXA 1KQSS 1N4MA 3EFOA 1QP2A 3MCAB 2V26A 1EX4A 4OMNA 4C8QA 1VQ4T 2KMGA 4XTXA 1I1JA 1W1FA 4BDYA 5L2WB 5GMKl 2NUPA 5CQXA 3CCVT 2VYTA 5KYNA 3MPUB 2V1RA 1OZ2A 2ZPIB 2RJCA 4KRDB 1UNLD 2HBPA 1K0XA 4EOJB 3L2VA 4CC4B 4OB0B 4K11A 4ZN3A 2DXBB 1GH6B 3HHTB 4UC4A 4LDYA 4XTZA 4D8DA 2I53A 1UGVA 4M7AD 1FWZA 5IHNA 4PJOD 2RD1A 1UNHD 2PTKA 5I21A 3Q1JA 2JN0A 3PNWC 1W2BS 2FEIA 2ZAEA 3RERA 4OMQA 4KULA 2CP3A 1YHQA 4M78C 2DTIA 4J7IA 4BCPB 1RUWA 3I55T 1ZA2B 2IN3A 1M3AA 1KD1R 2RHYA 1D1CA 2M16A 1N9SA 2LQWA 2LT1A 3RR6A 3CC7A 2MAMA 2K5LA 2K57A 4CFNB 1SEMA 2DXCA 4HT8A 3A8OB 2W9FA 4ROEA 1WHKA 4ELZC 5GANg 2Y90A 2HSEB 4F04B 5CKFA 5GANj 2JGZB 2LRQA 4RTWA 5GAOq 4M75C 2KRSA 3G71Q 3OYYA 2WJ9A 2RB6A 1VQ8A 4FSSA 2OAWA 2WXVB 1Z9ZA 2DL7A 1AWJA 4JX4A 1M2VA 3EIDB 2B86A 1C0MA 4A4FA 3JCMe 4YOOA 1VQ9T 3EJ1B 2FZKB 2X4XA 3HKSA 4HXJA 1G83A 3EH1A 3UDCA 2CYZB 3L2RA 4OGEA 1YJWT 2PQWA 2EJGA 1IO6A 3OBWA 2P4RA 1JJ2S 4IUTA 4M78G 1WLPB 2JM8A 2V1QA 3DKMA 3CPWP 3QWYA 4BY1X 4ELYC 4BY7X 2RK2A 5IHKA 3QHRB 2MPXC 5LMKB 5GAN2 1PC0A 1XTDA 1O9KB 2QXFA 4M77B 3BE3A 5AYFA 2KYBA 2O4XB 4RKUE 2J6OA 3VUZA 4JJNK 2CP7A 2JS2A 4M75G 3QJ6A 1KXUA 2JJ9A 1QVFP 2XK0A 3M0QA 1WA7A 4QQGA 3G6EA 2RM4A 1M1KC 1IHWA 2ROLA 5CR2A 4F7SB 9ATCB 4A4KA 1M8VA 2MIOA 1CSKA 3LQ5B 1PD1A 1TFBA 3L42A 1I5LA 4LUEA 1AD5A 5CAIA 2X4YA 3KXTA 1UHCA 3CCLA 4ZN1A 2CH4A 2OTLA 2RJEA 4C8QG 1J3TA 3CCUQ 4HNVA 1AD6A 2OI3A 2CP6A 4BCIB 4J9DA 2C0TA 1I8FA 4BCKB 2DXBA 5IH2A 5HK0A 1MMNA 1X6OA 1GXIE 1KHCA 2E6NA 1RABB 4YC3B 3PGGA 3OBYA 3X28B 3QSUA 5LL6S 4EOPB 1BKBA 4BCJB 2QFZA 4JX5A 2L5QA 2MYSA 3LW5E 3RIRA 2EAYA 2KNBB 1EZZB 1OOTA 1RAIB 3LGFA 2QYZA 2HMAA 4J9IA 1OIYB 3JSCA 2DERA 1YI2T 1ZUUA 1PNJA 2GGRA 1SHFA 2GF7A 2DILA 2YLCA 2EUFA 2YUQA 3A8HB 2F1LA 4PJNA 2X51A 3JCMW 3EAEA 3NGPA 3G4SA 5GJWB 5EG2A 4R55A 4KGZB 2RF0A 4EMKC 5IDNB 2QTVA 5LQFB 1JBMA 3N5BB 5GANh 2L3QA 4OMPA 4OMOA 3GP8A 2XKOC 1IZ6A 1OEBA 3M0SA 3OYIA 4M77F 1BK2A 4DBRA 2R7GA 3NTKA 3JB9I 3EFRA 1SHGA 2LT4A 2VASA 4XU1A 2X3WD 2DE0X 4KGXB 1D1AA 1QVGS 4EPCA 5GAN6 5ICPB 2KDSA 3ULRB 1Z9QA 1B34B 2DEUA 1B3QA 2I2LA 1ZX6A 4OGRB 1SF9A 1Q7YR 3OYEA 5IAYA 2ZPEB 4ZGJB 2VXFA 1JOWA 3MKDA 1PCXA 2DRKA 2QQBA 4X34A 1M90R 3O0GD 3VKGA 1O9KA 2LX9A 2VGNA 1N6AA 5CEIB 2BS3A 4M77A 4NS5A 4M7AB 4TTHA 1YIJQ 3FB9A 2O4XA 3CMAA 4C5HA 1OU9A 1WHHA 2W2HA 1KD1U 1RAEB 2R57A 1ENWA 1ZQ1A 4EMGA 2YUOA 2ROTA 4HVVA 1UUEA 1VQ6Q 1CKBA 3MIAB 1OZ3A 4CFWB 4X1VA 2LZ6B 2YSQA 4ELLA 3VU3C 2WHBB 2GTOA 2LP5A 3P8HA 2QDJA 1K76A 3PIOA 4BI3A 1Q81U 4OB1B 1ACMB 2A0FB 4A53A 1VA7A 2QA4A 1MV3A 3QDFA 1WQWA 3M03A 1MNDA 1Y7XA 3CCSQ 3EG2A 1MUZA 3TREA 2QQAA 2BE9B 1K1ZA 2RQRA 4LNPA 4M7DC 3V7CA 3X20B 3G71A 1H3HA 5ECAA 1RL2A 2C6TB 3L2WA 1VQMT 1OX8A 1VQPA 3TN8B 4RTVA 5FW9A 2EYQA 2E5QA 1H641 3I5SA 3OW2A 5LJ5g 4A63B 3CXCA 2DD4B 3LLRA 2EKHA 2RHXA 2K7AA 2C0OA 1VYWB 5LJ5j 1N5ZA 1WJRA 1D1BA 5A2QE 2G6FX 2JNGA 2KAFA 3H8ZA 4E7SA 1S72Q 4CFMB 2HL5C 3I5RA 3CCRT 3BG9A 1VQLT 2YLBA 1OI1A 5FU7C 4JJBA 2KE9A 4HCBA 1VQ5T 1H28B 1AHJB 1VQ7T 2L3PA 1FMWA 2QQRA 2KI7A 2HNIA 2X3XD 2DLPA 6AT1B 3CC4T 4LDWA 1R77A 4MIMA 1K9MU 1WJQA 1T0JA 2EYZA 4ORZA 2H8HA 3JB9J 4XTVA 4RCCA 3S6WA 2PUKB 5A0DA 2DM1A 1G5VA 4M78B 3VS2A 2D6FA 3NTHA 2MMPA 2A7YA 1VQOT 2OTJT 2LTOA 1M5Q1 4M77E 2ABLA 1PSFA 1EFNA 2HDAA 1KQSA 1WNLA 3BHUB 4PJMA 1UJ0A 4PLIA 4EOLB 5GANd 4EIKA 2DBMA 1H24B 2J05A 1Y57A 2IVXA 1B34A 3CBOA 1VYTA 2EGEA 1K8AC 4M75B 3CCUA 3OYLA 1YJNA 4DBFA 1WX6A 2ZPFB 4BCHB 1SRMA 5KCHA 3EG0A 2RI2A 3OS1A 3JCMP 4E7LA 1HK9A 2K79A 2L3RA 2WIHB 4HCZA 4R0KA 1HJDA 3REBB 1QQJA 1D0YA 5KYWB 2HZYA 5CQYA 4HCCA 3A8GB 1TOVA 1K4US 1VQ4Q 2J7IA 2KY9A 2V22B 4XTYA 1W2BA 4KRTA 2CKKA 2MWPA 2I0NA 3SHWA 4Z6YA 4C92C 3CCVQ 4QVCA 2NUZA 2E12A 2RMOA 4IURA 3L2ZA 2F2XA 3C94A 2ZGWA 1BCMA 1OL2B 4OF1A 4FYYB 1M1FA 2RI5A 1Q86C 1ZSZC 2V8KA 2CT3A 2F2WA 4FYWB 2FYKA 2RHIA 1M2OA 3VRYA 3QDRB 5FWBA 3LH5A 1YJ9A 1GL5A 2Y4YA 1X27A 2LCSA 2K3BA 4BD3A 1VIEA 5GAOr 2YWWA 1YWOA 1MNEA 4FW1A 1QW1A 2MCNA 3VKHA 1PRLC 3I55Q 3PO3S 3URGA 3CPFA 5KE3A 3BG3A 2GBQA 5IDPB 1ABQA 3EGUA 2FZCB 4M78F 2EYYA 1HSQA 1VQNT 2DD4A 1WFWA 1RACB 3GPLA 2D0NA 2QGSA 2EGCA 2HKQB 3PVLA 2RPNA 3LWIA 2BZ8A 5LJ5h 8AT1B 2B9RA 3OYDA 2A08A 1JJ2A 2W0ZA 2QQ8A 2DL3A 2CJMB 3JCMc 2M9UA 3OYFA 2QTXA 2E4HA 1N8RR 3QYHB 2DTHA 2CZ7B 1M90U 1W6XA 2O01E 4M75F 1VQ9Q 4F7JB 3HRTA 2RHZA 4BCQB 3UA7A 1WI7A 2DO3A 5D6YA 2EPDA 3TU4K 3CXCS 1YIJA 3VS6A 2QG9B 1PRMC 1I81A 4M7AC 1YJWQ 2KR6A 2COZA 2QEXQ 2VKNA 4M78A 3CC2A 1C9BA 2CH4W 4C0GA 1ZBJA 2KROA 3UPUA 4RG2A 1VQ6A 2DRMA 2DK3A 5DQWA 2XDPA 2DNUA 4C8QF 2A37A 2KXDA 3M4YA 1AISB 3HFOA 3K7AM 3UATA 3GTMS 1WHGA 2EW3A 3M9QA 4XTWA 2WMBB 2F2CA 3CCSA 1YCSB 1V76A 1BI0A 1QMZB 4M75A 4FL6A 1YHQT 2LNHB 1M8MA 4F7LB 4J9HA 3ME9A 4AI6A 4IMYB 2DD5B 1FX7A 4FIBA 1M30A 3BHTB 4IIOA 2BZYA 2JVVA 4E7ZA 4N4IA 1PM3A 1Q82R 3H0FA 3CC7T 1F1BB 3V8LA 1PWTA 4JRQA 2ZPHB 5GANe 4CC7A 2VUBA 1IGUA 3OA6A 2KT1A 4HA8A 4M7AG 3R6NA 4CFUB 2RO0A 3G1JA 1OULA 4XU2A 1MMDA 4PKCC 4C5IA 2C5OB 1QWEA 4CFXB 3JRZA 5IXFA 1WJSA 2LQNA 1A0NB 2DMEA 4BCFB 2LW4A 2C06A 3KUFA 3FEOA 1JXOA 1YI2Q 1X43A 1WXTA 4KUDK 1K73U 3M4GA 4V2SA 3MY1B 1AWWA 3JB9G 4C0DC 4BCMD 2YRCA 1OPLA 2DIGA 4NSTB 2C5XB 3QZ5B 2MI6A 3TVTA 1SSHA 5CVIA 5FROA 3CCMA 1VOMA 4M78E 2DTOA 1QVGA 2MF2A 4ZTJA 2AZSA 1R0BG 3BHVB 1Q81R 1UFFA 2QAZA 4ROCA 4M7DB 1NEGA 3OYNA 4FT2A 4AT1B 1RAGB 2FG0A 3CD6A 3JCMX 3MY5B 1TUDA 3C12A 2P84A 5FWCA 4F17A 4AG1C 1X01A 5LJ5d 4M75E 4BDZA 1VQ4A 3EFSA 4OP0A 2AKLA 3CCLT 3EGDB 4X9CA 2KGTA 2RQUA 3H4CA 2OTLT 1QWFA 1TG0A 1KQ2A 2CCHB 2ZPGB 3C4SA 4N4HA 5CCAA 2LNVA 3H0IA 2JM9A 1H4LD 3VS1A 5FGKB 2EKOA 5FU7B 4ZGEB 3B57A 1GFCA 5KYXB 5DLQE 4C8QE 2XG8D 2VWFA 1N9RA 2P0PA 4JRKA 4EMKA 2AZVA 4EOQB 1OX9A 3I35A 4A54A 2EVRA 2KBTA 3ASKA 2WPAB 4BI4A 3OYCA 2LDMA 1K9MR 2RQTA 1KC8C 2DD5A 2RI3A 3QYGB 3VV0A 4EDUA 1NJIU 3H9NA 1Q95G 1DJ7B 5GAN8 4BY6C 2EQIA 1FXXA 1XOVA 5IHYA 1KIKA 4YOSA 3G4ST 4JDSA 5BNJB 1Y96B 2K6DA 1K9AA 4HKEA 1FVVB 3RBBB 3OYHA 1X6BA 3M58A 4O6JA 5EJCA 2RQVA 1H8KA 2WEVB 2A36A 1N8RU 4HLQA 1VQMQ 1LJOA 2FPFA 3CMET 2DJQA 3QUIA 3I56Q 5GMKe 3QHWB 4G6LB 3I9QA 3MO8A 4BB7A 3SD4A 2BUDA 3TNHB 4L6V5 4NC6A 3E19A 4AG2C 5GJVB 2SRCA 4BCND 1U1SA 2CZ1B 2WSEE 3FC3A 2QEXA 4JJDA 3CCEQ 1LCKA 1N27A 4C92B 5HBJB 2KRNA 4IIMA 2YXYA 1D09B 3CCRQ 4TVRA 4BACA 3SWNB 1VQLQ 1VQKA 3V8JA 3GOXA 2ENMA 2DZ9A 2DL8A 2F5KA 2RK1A 5FRMA 1G3TA 2BS4A 5GMKm 1VQ7Q 3JCMV 1QCFA 1H92A 2L89A 1ZSZB 3AT1B 5HVYB 2CREA 3CC4Q 4C8QD 5KYYB 4E7KA 4CI0C 1Q7YC 3HB9A 1ZUYA 1H25B 2EWNA 2Z0WA 3H6ZA 4IUQA 4OGCA 4CFVB 1M1KR 3CMAT 1IB8A 4ELJA 3QXEB 2O9SA 2MOXA 4AFUC 4M7DA 3OB9A 5KE2A 3E1SA 3HRSA 1WHMA 1BI3A 1Q82U 2KVQG 2E6ZA 2OTJQ 4II1A 2EJFA 3VUBA 1NLPC 5CK9A 2G77A 4RTUA 2QGFB 2EJ9A 2RJDA 5GAOn 2YRDA 3KFVA 5D6XA 4JS5A 1U1TA 3P8DA 5L8RE 3EGDA 2QA4T 2PU9B 3ZFJA 2JW4A 3FDRA 4FW2A 3QWLA 2W99A 3DJBA 1H1SB 1AZGB 2C4GB 3G71T 1GCPA 2CZ6B 4F7NB 4J9BA 5GAOp 2KRMA 1VQPT 1AWOA 2Y4XA 1AOJA 5HK3A 3QYBA 2W96A 3QYEA 1OPKA 1JU5C 1H1RB 1UEBA 3VYHB 2IVWA 2O88A 1UG1A 1URCB 1TH7A 5LJ5e 1JSUB 5CYIB 1NPPA 2ZCFB 1KSWA 3H41A 4D6WA 4BUGA 1JB0E 4BXXX 4PJOB 4RTTA 2ZPBB 4J9EA 4N0AC 1QKXA 5D7UA 4DBHA 2EYXA 3PTAA 1G3NC 2J6KA 1OIUB 3PFSA 1BCOA 2XMFA 3IQLA 1X6GA 5I5ZB 4ESRA 4BCMB 2IIMA 1VOLA 4JLGA 4J6XA 4MFDA 2F5TX 5KCOA 1Y96A 2UZLB 3CEYA 3HTRA 1PKDB 1YFNA 2BTTA 2FVUA 2E3IA 1Y71A 4M6VA 4E2FB 1H26B 1MGQA 4OB3B 3R6OA 1QCNA 2HCKA 2FPDA 2PMIB 4PLLA 4HVWA 4EOKB 2AKKA 3HP9A 3VYGB 1NPRA 2RN8A 1UECA 2QI2A 3CPWS 1YWPA 2K4YA 1V29B 7AT1B 4OMLA 1VQNQ 5LJ3g 2L2PA 3QPHA 3OW2P 1X75C 3CCQT 3CXCP 2E41A 3OMCA 3M5AA 1UTIA 3F70A 5LJ3j 1D3UB 4AKIA 2L8DA 4C92A 2AHJB 2DFUA 1H1PB 1XQHA 3E2UA 4DA4A 3KBGA 2DZCA 3CCUT 1QLBA 2C5NB 1YJNT 1TS9A 1QVFS 1ZLMA 1FINB 1IHVA 2ATCB 1TTHB 2R5MA 3V8KA 1ZSZA 4EOSB 5KYYA 3NTIA 1ARKA 4ANJA 3MP8A 1E6HA 2VB6A 4OMMA 5CIUA 3DOGB 2FL7A 1Y07A 4A4EA 1AEYA 4MZPA 4LD9K 5GAOl 3MP6A 4KUIA 2C0IA 4C0DB 3DTOA 4M7AF 2B8AA 4M7DG 1K73R 3NDQA 4MFEA 4PL6A 4PFZA 1ZBXA 4DBQA 5GAMg 2QDYB 4LDVA 1BIAA 2O9VA 2LQKA 2K5FA 2CS7A 2JTMA 3RMQA 1KQSP 5GAMj 1YJ9T 4FYXB 5A0LA 3MEAA 1YHQQ 3DLLA 2LX7A 4YOZA 3CCJT 1RLQC 2UZEB 3I56A 3POMA 1U06A 1GUXB 3WXMB 4HT9A 4CRIA 3JB9F 4GBQA 4L59A 3TEEA 3CC7Q 2JUFA 3LX7A 1OKWB 2CZ0B 3MEWA 5KH6A 3HZJA 3BFMA 2J6FA 2E70A 1P5EB 1C1AA 1GCQC 5GAN7 4M7AA 4B9WA 2DXUA 3CCEA 1W2BP 2DL4A 1TXQA 1H3ZA 1OL1B 1HYOA 1JSTB 1E6GA 2XICA 3SWNC 1FKMA 2KR3A 2X4JA 2JTEA 2RHUA 3QHSA 3RKWA 5I11A 1G3SA 1VQ7A 4MDWA 1ZUKA 3M57A 2MK5A 2NUTB 3OS2A 4EMHA 2VVKA 4E7JA 2KXCA 1NYGA 3HRUA 4MMKA 3EFOB 1KQ1A 1M1KU 3WVEB 3TSZA 4DEYA 4OMFB 1YIJT 2HSPA 3THKA 3QBYA 2EFIA 1T3LA 4IUVA 2WMAB 2J06A 4J7FA 3VS3A 1YITT 1AT1B 2VV5A 4J8OA 3CC2T 4PNOA 2NUPB 3RUXA 1VQ6T 3VJPA 2OTJA 1YCYA 1E9HB 4WCIA 4EONB 4BY6B 1M27C 1NJIR 1VINA 1K8AR 4M77D 5IXBA 4JLIA 3A8MB 1ABOA 2E65A 4FCYA 1JQQA 5LJ3h 4PJLA 2E3HA 2GFAA 1GBQA 4BE1A 1JJ2P 2YT6A 2P0QA 4BI8B 3A1PA 3DDQB 2CUDA 4C92G 4LOCA 1ZA1B 3HO8A 3EGXB 3J81E 5DY9A 2M1HA 4QT7A 2OX7A 4RCBA 4FT4A 5LJ3f 1EIFA 3O8VA 3G7ZA 4F7UB 2E5KA 5GAN3 4M4ZA 3CCLQ 4PFOA 3MP1A 1I0CA 2OTLQ 4PJOC 5I22A 1Q86R 1KHIA 2JOYA 2R5AA 1G3YA 4JRPA 1O9SA 1AZEA 1UDLA 5HBEB 4AFQC 2NLUA 4M7AE 3G33B 3QWXX 4C5EA 3RNJA 4LUDA 2DAQA 5GAMh 5IN1A 1WZOA 2JMAA 2QDLA 4PFPA 5CKBA 5HBHB 2HQEA 1R8OB 2DL5A 1OYXA 3QKJA 3JAME 5HCKA 1GUXA 2CCIB 1UE9A 2JMCA 4QVZA 3TCJA 2UUEB 3V7SA 3GLXA 2EQMA 4OR5B 2PNIA 3A5ZB 2LC4A 4ZNXA 5M9OA 2GFUA 1F5QB 2DVJA 4QQDA 5GAMf 1R0CB 3G4SQ 1NM7A 3CCMT 3TNIB 4J5YA 5KYWA 3RKYA 3PT9A 3TSWA 5C0MA 1QCOA 4HNTA 1KD1C 2CGHA 4I3ZB 2R58A 3CBMA 2FPEA 4Q5WA 4HCKA 3EG1A 3OS5A 1S72A 1ZP2A 4PJOG 2XDDA 4EC8B 3CMEQ 2NUTA 2X9HA 1Q81C 1VQ8T 3CD6T 2DPPB 1I4K1 4N4GA 3X24B 1KJWA 4NL2A 1YNZA 2E10A 1E7OA 8ATCB 4RG8A 1RLPC 2LJ1A 2H3JA 1TD6A 4J6YA 1RAHB 4DEXA 1UB4A 2QK0A 4RTXA 4YTLA 1RI9A 1UGRB 2D9TA 1JXMA 4F7UF 1WXUA 5J39A 4D8KA 2L0AA 2COWA 1W70A 2YRVA 2BIVA 3S3NA 2PJQA 1QKWA 3CQTA 5CO7A 2D0QB 1V1CA 1UGQB 3CBPA 3NMZC 4PK4A 3KHIA 2W10A 1XJWB 3LWHA 2LCCA 2RQWA 2AK5A 2K2MA 1QVGP 2JS0A 5ACBA 3CMAQ 2XD0A 1PG5B 1FMVA 4IUUA 1H1QB 2BKZB 3MI9B 3M0TA 3BDLA 1GRIA 3INZA 2HEQA 3EGXA 4IUPA 4BE0A 2UZDB 1LPLA 3JV3A 4RTZA 3M0UA 4MDXA 1K9MC 3NPFA 3G6ET 4OVAA 4EORB 3EHRA 4J9CA 5LJ3d 4F7UA 4R56A 2YHTA 3JB9D 1SRLA 2QA4Q 3HPWA 2PZ1A 4FSXA 3DB4A 4GLKA 2M02A 3BLRB 5GAN4 2PK2A 1XNIA 3TNWB 3CCVA 1JO8A 2P4TA 2GQVA 2O31A 4BBSM 3HFNA 3BY7A 2LJ0A 1VQPQ 4OB2B 4FYVB 2DX1A 3VKIA 3ZL7C 4KGVB 3MEUA 1UNGD 1PKSA 3UT1A 5D6WA 4XU3A 1E7PA
chains in the Genus database with same CATH topology
5GANd 2LQ8A 2XIDA 4E47A 3MHXA 5DM7R 5GAOp 1VQPT 2Y4XA 2QEXT 4AKGA 2K3XA 4C8QC 4DQ2A 5HK3A 3M53A 3QYBA 2LCLA 3LGLA 1B34A 3CBOA 4WF2A 3QYEA 2QF7A 3RESA 4BE2A 3GIBA 3L2UA 1VQNA 1UEBA 3VYHB 1P92A 2IVWA 3GNGA 5GAOm 4M75B 3CCUA 1K8AC 3I55A 1TH7A 3C95A 4DOWA 1QP3A 5LJ5e 2FB7A 3OYLA 1YJNA 1VQKT 4QSHA 4EMKB 3JCMb 4ATOA 3QJYA 1NPPA 2JZ2A 2ZPFB 2ZCFB 1UGSB 3OS1A 5KCHA 3JCMP 2RI2A 1K8AU 4D6WA 4BUGA 4E7LA 1HK9A 2L3RA 2V8IA 3CPWA 1JB0E 3OSVA 2XDBA 2RH2A 5GAMd 4O5VA 4PJOB 4HCZA 2ZPBB 4XQ3A 4N0AC 5J26A 2E1HA 3PMTA 3E9FA 1M9SA 5HKCA 3PTAA 3META 2E64A 5CQYA 3PFSA 2X35A 2F69A 3FJPA 4HCCA 3A8GB 4M78D 4XTYA 2KY9A 3RKXA 5CKDA 2X4WA 4FU6A 1W2BA 2CKKA 2FHDA 2MWPA 4JLGA 4J6XA 4MFDA 2F5TX 4Z6YA 4C92C 5KCOA 4RMOA 3ER0A 4JRIA 1Y96A 3CEYA 1LNXA 4QVCA 1KQSS 2PVGB 2E12A 1D3BB 4ZGDB 3L2ZA 2FVUA 4IURA 4LD6A 1QP2A 1QVFA 2DVEA 3MCAB 3C94A 1Y71A 4M6VA 2ZGWA 2XI9A 4C8QA 1VQ4T 2KMGA 4XTXA 3TW7A 4OF1A 1MGQA 3JCMg 4BDYA 3QIIA 4LDXA 4OB3B 1M1FA 5GMKl 1VQ9A 1BIBA 2RI5A 3R6OA 2V8KA 5CQXA 4HNUA 2VYTA 3LYIA 3CCVT 3OSSC 1Q86C 2FYKA 2RHIA 1OZ2A 2ZPIB 2EQKA 3DB3A 2RJCA 4PLLA 3QDRB 3SB2A 2HBPA 4MZMA 3HP9A 2KMTA 1M1GA 2Y4YA 3VYGB 4M75D 1NPRA 4OB0B 4BD3A 1VIEA 3L2VA 1Q86U 4ZN3A 1YJWA 2QI2A 2QQ9A 5GMKi 2DEQA 3OY9A 3CPWS 2K4YA 1V29B 5GAOr 1YJ9A 4N0AA 2DXBB 1QW1A 3VKHA 4P5NA 3HHTB 5LJ3g 4UC4A 4LDYA 4XTZA 1HXDA 3URGA 3QPHA 4M7AD 1FWZA 1X75C 3CPFA 4PJOD 2RD1A 5KE3A 3J80E 3CCQT 2E41A 3OMCA 5I21A 3BG3A 2JN0A 3Q1JA 4F7UE 3M5AA 3F70A 5LJ3j 3PNWC 4AKIA 2L8DA 2PVOB 3JCMQ 1W2BS 3RERA 4C92A 2AHJB 4KULA 4M78F 1XQHA 1YHQA 4M78C 4DA4A 3ZEHA 2DTIA 1VQNT 2DD4A 4J7IA 3KBGA 2DZCA 3CCUT 1QLBA 3I55T 3GPLA 3PMIA 1YJNT 1QVFS 2RHYA 5FU6C 2M16A 1N9SA 2LT1A 2R5MA 3V8KA 3LWIA 1VIFA 5LJ5h 3CC7A 5IT9E 2MAMA 3JB9H 3M56A 3J7AF 2K5LA 2VGMA 3WVDB 3OYDA 2K57A 3AHUA 3BDUA 2DXCA 1JJ2A 4HT8A 3A8OB 1M90C 2QQ8A 3NTIA 3NFCA 3MP8A 2MWOA 4VUBA 4ELZC 2PVDB 5GANg 3JCMc 3S3MA 2M9UA 2Y90A 3OYFA 2QTXA 3QYHB 2DTHA 2CZ7B 5CIUA 1M90U 5CKFA 2O01E 5GANj 4M75F 2LRQA 4M7DF 2FL7A 1Y07A 5GAOq 4A4EA 4M75C 3HRTA 4MZPA 4A4GA 4LD9K 5GAOl 3MP6A 2RHZA 2DO3A 4KUIA 3OYYA 5D6YA 3TU4K 4C0DB 2WJ9A 3CXCS 2KSSA 2RB6A 1YIJA 2B8AA 1VQ8A 4M7AF 4M7DG 1I81A 4M7AC 4F7UG 2KR6A 4JX4A 4MFEA 4PL6A 4A4FA 3JCMe 1ZBXA 4M78A 5GAMg 2QDYB 4LDVA 1BIAA 3CC2A 2LQKA 1VQ9T 2K5FA 2CS7A 2X4XA 2JTMA 4C0GA 3HKSA 3UPUA 4RG2A 1VQ6A 3RMQA 5GAMj 3CMEA 3UDCA 2DK3A 2XDPA 2CYZB 3HBLA 3L2RA 1YJ9T 2HQXA 4OGEA 4Y28E 4MZTA 2PQWA 4C8QF 1YJWT 2EJGA 5A0LA 3MEAA 3OBWA 3DLLA 4Y91A 5GMKj 5LJ3e 3M4YA 1JJ2S 3HFOA 5GANf 3CCJT 4IUTA 4M78G 5A0GA 1O75A 3M9QA 4XTWA 3I56A 1ZHIA 3QO3A 3CCSA 3WXMB 4HT9A 4CRIA 3JB9F 3DKMA 4L59A 3TEEA 1BI0A 4M75A 2JUFA 4FL6A 3V7RA 1YI2A 3LX7A 1U8RA 1YHQT 4ELYC 2CZ0B 3MEWA 2RK2A 3A8LB 5KH6A 3HZJA 4C0ZA 4E7IA 3ME9A 4AI6A 3BFMA 2DD5B 5GAN2 1FX7A 1XTDA 4FIBA 2E70A 5GAN7 1BYMA 2EQJA 4M7AA 2QXFA 2JVVA 4B9WA 2DXUA 4N4IA 3CCEA 4M77B 3GF5A 5AYFA 4C92F 3CC7T 4QW2A 2O4XB 2GCXA 3V8LA 4RKUE 3OYGA 1H3ZA 3M54A 2XICA 3VUZA 3OS0A 2ZZDB 3OYBA 4JJNK 4JRQA 2ZPHB 1FKMA 2X4JA 3QJ6A 4M75G 3SWNC 5GANe 4QVDA 2XK0A 2RHUA 2VUBA 4QQGA 3G6EA 4Z02A 3QHSA 3RKWA 2RM4A 1G3SA 1M1KC 4MDWA 3OA6A 1VQ7A 3M57A 2BS2A 1LOJA 3OS2A 4HA8A 5CR2A 4NL3A 4M7AG 4EMHA 1D3BA 4MMLA 4A4KA 1M8VA 4E7JA 2HAXA 3HRUA 4MMKA 1KQ1A 1M1KU 5FRNA 3L1AA 3L42A 1I5LA 3WVEB 3OQ5A 1YIJT 4OMFB 3UWNA 3QBYA 2EFIA 2RO0A 2X4YA 4IUVA 4XK8E 5CAIA 4ZN1A 3KXTA 3CCLA 4J7FA 4DOVA 1YITT 4XU2A 4PKCC 2OTLA 4C5IA 5GAMe 2RA2A 2VV5A 1G3WA 2RJEA 4J8OA 3CC2T 4PNOA 3JRZA 3RUXA 4C8QG 1VQ6T 3VJPA 2OTJA 4HNVA 1YCYA 1WJSA 1JRIA 3JCMh 4M7DE 1K73C 1I8FA 2DXBA 2WSFE 2C06A 3KUFA 5HK0A 3FEOA 4BY6B 1X6OA 1GXIE 4XTUA 1KHCA 2E6NA 4JUVA 4KUDK 1K73U 3PGGA 3M4GA 3OBYA 3X28B 4M77D 3QSUA 4V2SA 3SWNA 5LL6S 3JB9G 4C0DC 4JLIA 4KBMB 1BKBA 2VXEA 3A8MB 2QFZA 5I2MA 4JX5A 2L5QA 3I56T 2DJZA 2E65A 3LW5E 4E7HA 2DIGA 3RIRA 3JCMJ 2EAYA 3QZ5B 2MI6A 5LJ3h 3LGFA 5CVIA 3JCMf 5FROA 2GFAA 3JSCA 4BE1A 1YI2T 3CCMA 4XAXB 4M78E 2P0QA 1YBYA 4BI8B 2DTOA 2GF7A 4C92G 4LOCA 2YLCA 4FM4B 4PLIA 3S3OA 1QVGA 2MF2A 3HO8A 4ZTJA 3J81E 3CCET 5DY9A 2XHCA 3A8HB 2M1HA 3ZBDA 3JCMW 3EAEA 4RCBA 3G4SA 4FT4A 2JTFA 5EG2A 5LJ3f 1EIFA 4M7DB 3OYNA 4R55A 1WPYA 1BI1A 3O8VA 3G7ZA 4F7UB 3QG1A 3L2QA 4FT2A 4EMKC 5GAN3 5J3BA 3CD6A 3MP1A 3RMSA 3JCMX 3FLGA 1M4ZA 2DXTA 4PJOF 3OYMA 3C12A 2EIFA 4PJOC 1JBMA 3N5BB 5GANh 1X01A 1KHIA 3GP8A 2JOYA 2XKOC 5LJ5d 1IZ6A 4M75E 2R5AA 1G3YA 1QVPA 3OYIA 4M77F 4JRPA 4BDZA 3EFSA 1VQ4A 1O9SA 3LH0A 4OP0A 1VQLA 4M77C 3HSBA 3BG5A 3CCLT 3NTKA 4X9CA 3JB9I 4JS4A 3EFRA 3H4CA 2OTLT 4AKHA 2LVMA 2NLUA 4M7AE 1KQ2A 5GAN5 5C6SA 2HD0A 4C5EA 2ZPGB 2LT4A 2P0KA 3C4SA 4N4HA 4XU1A 4BBRM 5CCAA 2LNVA 4XU0A 3DL1A 2DAQA 1VQMA 1QVGS 4EPCA 5GAMh 5GAN6 2EKOA 5FU7B 4ZGEB 5IN1A 4GY5A 4KT0E 2KDSA 5CKBA 5DLQE 2HQEA 1IREB 1B34B 1R8OB 2XG8D 1WQ7A 4C8QE 3CCQA 1N9RA 4ME7A 2P0PA 3TW6A 1OYXA 5GMKh 2I2LA 3QKJA 4JRKA 4EMKA 3JAME 4ZTFA 2VC8A 4QVZA 3TCJA 3HL8A 3V7SA 4A54A 1W4SA 2WACA 2EQMA 3GLXA 3OYEA 4M7DD 3A5ZB 1KG1A 5IAYA 2ZPEB 2LC4A 4ZGJB 3ASKA 2GFUA 5M9OA 2VXFA 4BI4A 4PJOA 3OYCA 4QQDA 2LDMA 2QQBA 4L5GA 5GAMf 1NJIC 4X34A 3CCMT 1KC8C 2DKGA 2DD5A 3CCRA 2RI3A 1BI2A 4J5YA 3VKGA 3RKYA 3PT9A 4JX6A 3M55A 3QYGB 2LX9A 4X9DA 3VV0A 2VGNA 4EDUA 4HNTA 1N6AA 5C0MA 1NJIU 1KD1C 2BS3A 2CGHA 4M77A 4NS5A 2R58A 3CBMA 4M7AB 1KC8U 1DJ7B 5GAN8 3FB9A 2O4XA 4Q5WA 1VQ5A 3CMAA 4BY6C 3E9GA 1MHNA 2EQUA 1PSEA 4C5HA 1FXXA 1XOVA 3OS5A 1KD1U 3X25B 2ZZDA 2R57A 3G4ST 1S72A 1ZQ1A 4EMGA 5I2SA 4JDSA 1Y96B 4PJOG 4C92E 2XDDA 3CC4A 4HKEA 4QQ6A 3PIPA 1OZ3A 3OYHA 1N8RC 1VQ8T 1Q81C 3CD6T 3VU3C 2DPPB 1SSFA 4C0FA 4C8QB 3M58A 4O6JA 5EJCA 1I4K1 4M77G 2PUOB 3OMGA 4N4GA 3X24B 3P8HA 2QDJA 3GNFB 4NL2A 2E10A 3PIOA 1N8RU 4BI3A 1Q81U 4OB1B 3SDZA 4A53A 1RI0A 4RG8A 4HLQA 2K3YA 1VQOA 1LJOA 2QA4A 2H3JA 3VYGA 3CMET 4J6YA 3QUIA 4IKFA 3T9NA 1WQWA 2WSCE 1UB4A 5GMKe 1Y7XA 4YTLA 3P8BB 3MO8A 1UGRB 1UGPB 4BB7A 2BKDN 3SD4A 3TREA 3M59A 2D9TA 2BUDA 2K2VA 2QQAA 5CKEA 4F7UF 3OYAA 4L6V5 4M7DC 5J39A 3V7CA 3X20B 3G71A 4NC6A 3E19A 1RL2A 1U1SA 3L2WA 1VQMT 2YRVA 2CZ1B 2BIVA 3S3NA 1VQPA 2WSEE 3FC3A 2QEXA 3QZ9B 3X26B 5CO7A 3CCST 2EYQA 2D0QB 1N27A 4B9XA 2E5QA 4C92B 3CBPA 1UGQB 1H641 3CCJA 4TVRA 3OW2A 2XU8A 5HY6A 5LJ5g 4J6WA 3KHIA 3SWNB 2DD4B 3LLRA 3CXCA 4BACA 3LWHA 1VQKA 2LCCA 2RHXA 4NOYA 3V8JA 3GOXA 2DZ9A 2F5KA 5LJ5j 2RK1A 5DLOA 5FRMA 1G3TA 2XD0A 2BS4A 1WJRA 3JCMd 4IUUA 3MEVA 5GMKm 3JCMV 5A2QE 2JNGA 2L89A 2KAFA 2M0OA 3H8ZA 1NZ9A 3CCRT 3BDLA 4C8QD 3INZA 4E7KA 3BG9A 1VQLT 2YLBA 2DXCB 1OI1A 4CI0C 1Q7YC 3HB9A 4IUPA 3H6ZA 2EWNA 5FU7C 4IUQA 2A3LA 4BE0A 4OGCA 1WGSA 4HCBA 1VQ5T 1Q82C 3CMAT 4J83A 4HL4A 4ELJA 5CKHA 1AHJB 4OVAA 3G6ET 3QXEB 1K9MC 4M7DA 4MDXA 1VQ7T 2K5IA 1Q7YU 2QQRA 3OB9A 5LJ3d 4F7UA 5KE2A 3E1SA 2HNIA 3HRSA 3SFMA 1S72T 1BI3A 1Q82U 2KVQG 4R56A 2YHTA 4LDWA 3CC4T 2DIQA 4MIMA 2E6ZA 2V8JA 3FRNA 3JB9D 2IG0A 1K9MU 1WJQA 3HPWA 4II1A 2KK4A 2OAUA 2EJFA 4FSXA 3VUBA 3DB4A 2KQWA 4GLKA 5CK9A 5GAN4 3JB9J 4XTVA 1XNIA 4RCCA 3S6WA 2PUKB 2G77A 5A0DA 3OYKA 1G5VA 3FIFA 3CCVA 2P4TA 4M78B 2EJ9A 2GQVA 5LJ5f 2RJDA 3OW2S 4PJOE 5GAOn 3NTHA 4BBSM 3HFNA 2MMPA 2D6FA 5D6XA 2A7YA 1U1TA 3P8DA 4JS5A 3BY7A 5L8RE 4C92D 1VQOT 2OTJT 3OYJA 2QA4T 4OB2B 2PU9B 2QQSA 3DLMA 5FU6B 2LTOA 1NE8A 3FDRA 3ZFJA 1YITA 1M5Q1 3QWLA 3VKIA 4M77E 3MEUA 1PSFA 5FLXE 4A4HA 2RJFA 3UT1A 4C5GA 1KQSA 3G71T 3BW1A 1VUBA 5D6WA 4XU3A 1WNLA 4LDUA 1E7PA 2G3RA 2CZ6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QYH B;  2CZ7 B;  1GXI E;  2O01 E;  3X28 B;  3A8M B;  2DPP B;  3LW5 E;  3VYH B;  3QZ5 B;  2PUO B;  1QP3 A;  3X24 B;  2ZPF B;  2ZCF B;  1UGS B;  4OB1 B;  2QDY B;  3VYG A;  1JB0 E;  4FM4 B;  2ZPB B;  2WSC E;  1UGR B;  1UGP B;  2CYZ B;  3A8H B;  4L6V 5;  3X20 B;  4Y28 E;  3A8G B;  2CZ1 B;  2WSE E;  3QZ9 B;  3X26 B;  2D0Q B;  2PVG B;  4ZGD B;  1UGQ B;  1QP2 A;  2DD4 B;  2CZ0 B;  4OB3 B;  3A8L B;  2DD5 B;  2ZZD A;  2ZPI B;  3VYG B;  2DXC B;  2ZPG B;  4OB0 B;  4RKU E;  1V29 B;  2DXB B;  2ZZD B;  3HHT B;  2ZPH B;  1AHJ B;  3QXE B;  4ZGE B;  4KT0 E;  1IRE B;  2PVO B;  2AHJ B;  2DD4 A;  2PUK B;  2ZPE B;  3WVE B;  4ZGJ B;  4XK8 E;  2DD5 A;  5L8R E;  3QYG B;  4OB2 B;  2PU9 B;  3WVD B;  1DJ7 B;  2DXC A;  3A8O B;  1PSF A;  1PSE A;  2PVD B;  2DXB A;  2WSF E;  3X25 B;  2CZ6 B; 
#chains in the Genus database with same CATH topology
 2XID A;  1WYX A;  2QEX T;  4AKG A;  4C8Q C;  2LCL A;  4HVU A;  4WF2 A;  2QF7 A;  3GIB A;  1U3O A;  3GNG A;  3I55 A;  1QP3 A;  2FB7 A;  1RAF B;  1VQK T;  1WIE A;  3FJ5 A;  3QJY A;  1MMG A;  1NLO C;  1K8A U;  1D0X A;  4JZ3 A;  2V8I A;  3CPW A;  3REA B;  3OSV A;  3VS0 A;  2XDB A;  5GAM d;  3TQ7 P;  4XQ3 A;  2FZG B;  2E1H A;  3MET A;  2E64 A;  1VYU A;  2IW9 B;  2F69 A;  4M78 D;  3RKX A;  1NYF A;  4FU6 A;  2COY A;  3VS7 A;  2FHD A;  2DA9 A;  4RMO A;  2PK9 B;  2PVG B;  1D3B B;  4ZGD B;  4LD6 A;  1QVF A;  2D8H A;  2DVE A;  1D0Z A;  1H27 B;  2XI9 A;  4BCG B;  5HQ0 B;  3TW7 A;  3JCM g;  3QII A;  4LDX A;  2G9X B;  3O5Z A;  1BIB A;  1VQ9 A;  4M7D F;  4HNU A;  3LYI A;  3OSS C;  2WFY B;  2EQK A;  2M0Y A;  3DB3 A;  3SB2 A;  4KH0 B;  3CCQ Q;  4CC3 A;  2IW6 B;  4MZM A;  2KMT A;  1M1G A;  2GNC A;  4M75 D;  1Q86 U;  1YJW A;  2QQ9 A;  5GMK i;  3OY9 A;  2DEQ A;  2DYI A;  4N0A A;  2QAS A;  2RNA A;  4J9F A;  4P5N A;  1HXD A;  1B7T A;  2AT1 B;  1YJN Q;  4F70 B;  3J80 E;  4F7U E;  1QMC A;  2PVO B;  3JCM Q;  5DQV A;  1VQ5 Q;  2ED1 A;  2IW8 B;  2HQH A;  3ZEH A;  4F14 A;  1KC8 R;  3EG9 B;  3PMI A;  1SPK A;  4Z8A A;  5FU6 C;  2D1X A;  1VIF A;  5IT9 E;  3JB9 H;  3H0H A;  3M56 A;  3J7A F;  2VGM A;  3WVD B;  3AHU A;  2ESW A;  1S1N A;  1YP5 A;  3BDU A;  1M90 C;  3NFC A;  4RUG A;  2LMJ A;  2MWO A;  4VUB A;  2QGG A;  2PVD B;  1OQK A;  2I40 B;  3S3M A;  1VQO Q;  1FYN A;  4PJJ A;  4A4G A;  2JT4 A;  2HKN A;  2YUP A;  3UA6 A;  1BU1 A;  2KSS A;  2KEA A;  1YJ9 Q;  1GY3 B;  4F6S B;  3F5X B;  4JZ4 A;  4F7U G;  2DET A;  2GQI A;  3VS4 A;  3CCJ Q;  1U5S A;  1GFD A;  2F2V A;  3CME A;  1JEG A;  3HBL A;  3RGF B;  2HQX A;  4Y28 E;  4MZT A;  2HL3 A;  1G8X A;  5KYX A;  4Y91 A;  5GMK j;  5LJ3 e;  5GAN f;  5A0G A;  1O75 A;  1OV3 A;  1TUG B;  4J9G A;  1ZHI A;  3M0P A;  3QO3 A;  2WIP B;  3V7R A;  1T3S A;  1YI2 A;  3RDV A;  1U8R A;  3A8L B;  4C0Z A;  4E7I A;  5KYU B;  2C5V B;  1BYM A;  4CRL B;  2EQJ A;  4BCQ D;  4QKU A;  1OKV B;  3GF5 A;  4C92 F;  2GCX A;  5IF1 B;  2HBW A;  3OYG A;  3M54 A;  5HNB B;  3OS0 A;  3OYB A;  2ZZD B;  3D7S B;  4F6U B;  4QVD A;  1WXB A;  1I07 A;  4Z02 A;  1W98 B;  1YIT Q;  2EGA A;  1UJY A;  2BS2 A;  4FX3 B;  1LOJ A;  3CC2 Q;  2EBP A;  4NL3 A;  1D3B A;  4MML A;  2HAX A;  4II5 B;  5FRN A;  4CXA B;  1BU2 A;  3L1A A;  3OQ5 A;  1K0S A;  4RTY A;  4UN0 A;  3UWN A;  4XK8 E;  1BB9 A;  4DOV A;  2AIR B;  4F6W B;  5GAM e;  2RA2 A;  3VS5 A;  1G3W A;  2DYB A;  4LXC A;  4AFZ C;  1SG5 A;  2JXB A;  1RAD B;  1IRX A;  1GCQ A;  1JRI A;  3BLH B;  3JCM h;  4M7D E;  4EOM B;  1K73 C;  4Y92 A;  4F16 A;  2WSF E;  3EOC B;  3NHN A;  4LE9 A;  4XTU A;  4JUV A;  3SWN A;  2CUB A;  4KBM B;  2VXE A;  5I2M A;  2W9Z A;  3I56 T;  4JJC A;  1NEB A;  2DJZ A;  1Y0M A;  2K9G A;  4E7H A;  3JCM J;  3JCM f;  3EG9 A;  3M0R A;  3MJX A;  4XAX B;  1YBY A;  3S3O A;  4FM4 B;  3BLQ B;  4Y72 B;  2YDL A;  1X2Q A;  3CCE T;  2XHC A;  3ZBD A;  2FRW A;  1MV0 B;  4CFU D;  2FO0 A;  1M3B A;  2JTF A;  1WPY A;  1BI1 A;  3L2Q A;  2PHG A;  3QG1 A;  1NG2 A;  5J3B A;  3GBQ A;  3RMS A;  3FLG A;  1M4Z A;  2DXT A;  1SKU B;  4PJO F;  1TWB A;  3OYM A;  2UZB B;  2EIF A;  1GBR A;  1CKA A;  4GLM A;  5L23 A;  1T0H A;  1WHL A;  1QVP A;  1JKW A;  5EC7 A;  2M51 A;  3LH0 A;  3PE0 A;  4M77 C;  3HSB A;  2OJ2 A;  3BG5 A;  3A98 A;  2BE7 D;  4JS4 A;  5AT1 B;  4AKH A;  2LVM A;  3UF4 A;  5GAN 5;  1PHT A;  5C6S A;  2HD0 A;  2CT4 A;  2P0K A;  2FRY A;  4BBR M;  1LVK A;  4XU0 A;  3DL1 A;  1VQM A;  1AVZ C;  1HD3 A;  4Z89 A;  2BZX A;  4GY5 A;  4KT0 E;  2LJ3 A;  3CCM Q;  1IRE B;  1B07 A;  3CCQ A;  1WQ7 A;  4ME7 A;  5GMK h;  3TW6 A;  1TUC A;  4ZTF A;  2VC8 A;  3HL8 A;  1W4S A;  2WAC A;  4M7D D;  1KG1 A;  4PJO A;  3SEM A;  4KRC B;  1NJI C;  4L5G A;  4KH1 B;  4BCN B;  2H3E B;  2DKG A;  5KYU A;  3CCR A;  1BI2 A;  2CP0 A;  4JX6 A;  3M55 A;  4X9D A;  2CSQ A;  1VQL A;  1KC8 U;  1VQ8 Q;  3CD6 Q;  1VQ5 A;  2BPM B;  3E9G A;  1MHN A;  2KT8 A;  2EQU A;  1PSE A;  3EG3 A;  3X25 B;  2ZZD A;  5I2S A;  4C92 E;  1X69 A;  1YN8 A;  3CC4 A;  1MMA A;  2X1N B;  4QQ6 A;  3PIP A;  3VRZ A;  4EOI B;  1N8R C;  4ROD A;  1SSF A;  4C0F A;  4C8Q B;  4M77 G;  2PUO B;  1WDX A;  3GNF B;  4WTO B;  1QLY A;  3SDZ A;  1RI0 A;  2ECZ A;  2K3Y A;  1VQO A;  1X2K A;  3VYG A;  3C0C A;  4IKF A;  3T9N A;  2WSC E;  3P8B B;  1UGP B;  2BKD N;  1I5O B;  3M59 A;  5CKE A;  2K2V A;  3OYA A;  1WHJ A;  1FMK A;  2DBK A;  3U23 A;  4LN2 A;  2DMO A;  3QZ9 B;  3X26 B;  3PVQ A;  1NBE B;  3CCS T;  4B9X A;  3CCJ A;  5EFQ B;  2XU8 A;  5HY6 A;  4J6W A;  4EC9 B;  4JPB W;  4NOY A;  3EHQ A;  1VYV A;  5DLO A;  1PD0 A;  3G6E Q;  3JCM d;  3MEV A;  4B6M A;  2M0O A;  1NZ9 A;  5IHI A;  1G2B A;  1PKT A;  2DXC B;  1M3C A;  2ED0 A;  2A3L A;  1WGS A;  1Q82 C;  4J83 A;  4HL4 A;  5CKH A;  1C6V X;  2K5I A;  1ZSG A;  4E6R A;  1Q7Y U;  1OI9 B;  1S72 T;  3SFM A;  2DF6 A;  2DIQ A;  2NWM A;  3FRN A;  2V8J A;  2IG0 A;  1KFZ A;  3DDP B;  2KK4 A;  2OAU A;  1RAA B;  2KYM A;  2KQW A;  2CP2 A;  2SEM A;  3OYK A;  1M2V B;  3FIF A;  5LJ5 f;  3OW2 S;  4PJO E;  2CSI A;  4C92 D;  3OYJ A;  4EOO B;  3DLM A;  1YIT A;  2QQS A;  5FU6 B;  1NE8 A;  2L3S A;  4AFS C;  2A28 A;  5FLX E;  4A4H A;  2RJF A;  4C5G A;  3BW1 A;  1VUB A;  1VQK Q;  4LDU A;  4QW2 A;  2G3R A;  3OMG A;  2LQ8 A;  1OU8 A;  1TU0 B;  3MHX A;  4E47 A;  5DM7 R;  2GTJ A;  1OGU B;  2K3X A;  4DQ2 A;  2YUN A;  3M53 A;  2O2O A;  3LGL A;  3RES A;  4BE2 A;  3L2U A;  1VQN A;  1AWX A;  2CDT A;  5GAO m;  1P92 A;  4CC2 A;  2EYW A;  3C95 A;  4DOW A;  3EH2 A;  4QSH A;  4EMK B;  3JCM b;  4ATO A;  1BBZ A;  2JZ2 A;  1UHF A;  1UGS B;  2D8J A;  1KK7 A;  2RH2 A;  4O5V A;  5J26 A;  3PMT A;  3E9F A;  4AMC A;  1IGQ A;  1M9S A;  5HKC A;  2CP5 A;  4Z88 A;  2X35 A;  3FJP A;  1TSF A;  2NYS A;  5CKD A;  2IPO B;  2X4W A;  1XO2 A;  4BCO B;  1IXD A;  3ER0 A;  4JRI A;  1LNX A;  1KQS S;  1N4M A;  3EFO A;  1QP2 A;  3MCA B;  2V26 A;  1EX4 A;  4OMN A;  4C8Q A;  1VQ4 T;  2KMG A;  4XTX A;  1I1J A;  1W1F A;  4BDY A;  5L2W B;  5GMK l;  2NUP A;  5CQX A;  3CCV T;  2VYT A;  5KYN A;  3MPU B;  2V1R A;  1OZ2 A;  2ZPI B;  2RJC A;  4KRD B;  1UNL D;  2HBP A;  1K0X A;  4EOJ B;  3L2V A;  4CC4 B;  4OB0 B;  4K11 A;  4ZN3 A;  2DXB B;  1GH6 B;  3HHT B;  4UC4 A;  4LDY A;  4XTZ A;  4D8D A;  2I53 A;  1UGV A;  4M7A D;  1FWZ A;  5IHN A;  4PJO D;  2RD1 A;  1UNH D;  2PTK A;  5I21 A;  3Q1J A;  2JN0 A;  3PNW C;  1W2B S;  2FEI A;  2ZAE A;  3RER A;  4OMQ A;  4KUL A;  2CP3 A;  1YHQ A;  4M78 C;  2DTI A;  4J7I A;  4BCP B;  1RUW A;  3I55 T;  1ZA2 B;  2IN3 A;  1M3A A;  1KD1 R;  2RHY A;  1D1C A;  2M16 A;  1N9S A;  2LQW A;  2LT1 A;  3RR6 A;  3CC7 A;  2MAM A;  2K5L A;  2K57 A;  4CFN B;  1SEM A;  2DXC A;  4HT8 A;  3A8O B;  2W9F A;  4ROE A;  1WHK A;  4ELZ C;  5GAN g;  2Y90 A;  2HSE B;  4F04 B;  5CKF A;  5GAN j;  2JGZ B;  2LRQ A;  4RTW A;  5GAO q;  4M75 C;  2KRS A;  3G71 Q;  3OYY A;  2WJ9 A;  2RB6 A;  1VQ8 A;  4FSS A;  2OAW A;  2WXV B;  1Z9Z A;  2DL7 A;  1AWJ A;  4JX4 A;  1M2V A;  3EID B;  2B86 A;  1C0M A;  4A4F A;  3JCM e;  4YOO A;  1VQ9 T;  3EJ1 B;  2FZK B;  2X4X A;  3HKS A;  4HXJ A;  1G83 A;  3EH1 A;  3UDC A;  2CYZ B;  3L2R A;  4OGE A;  1YJW T;  2PQW A;  2EJG A;  1IO6 A;  3OBW A;  2P4R A;  1JJ2 S;  4IUT A;  4M78 G;  1WLP B;  2JM8 A;  2V1Q A;  3DKM A;  3CPW P;  3QWY A;  4BY1 X;  4ELY C;  4BY7 X;  2RK2 A;  5IHK A;  3QHR B;  2MPX C;  5LMK B;  5GAN 2;  1PC0 A;  1XTD A;  1O9K B;  2QXF A;  4M77 B;  3BE3 A;  5AYF A;  2KYB A;  2O4X B;  4RKU E;  2J6O A;  3VUZ A;  4JJN K;  2CP7 A;  2JS2 A;  4M75 G;  3QJ6 A;  1KXU A;  2JJ9 A;  1QVF P;  2XK0 A;  3M0Q A;  1WA7 A;  4QQG A;  3G6E A;  2RM4 A;  1M1K C;  1IHW A;  2ROL A;  5CR2 A;  4F7S B;  9ATC B;  4A4K A;  1M8V A;  2MIO A;  1CSK A;  3LQ5 B;  1PD1 A;  1TFB A;  3L42 A;  1I5L A;  4LUE A;  1AD5 A;  5CAI A;  2X4Y A;  3KXT A;  1UHC A;  3CCL A;  4ZN1 A;  2CH4 A;  2OTL A;  2RJE A;  4C8Q G;  1J3T A;  3CCU Q;  4HNV A;  1AD6 A;  2OI3 A;  2CP6 A;  4BCI B;  4J9D A;  2C0T A;  1I8F A;  4BCK B;  2DXB A;  5IH2 A;  5HK0 A;  1MMN A;  1X6O A;  1GXI E;  1KHC A;  2E6N A;  1RAB B;  4YC3 B;  3PGG A;  3OBY A;  3X28 B;  3QSU A;  5LL6 S;  4EOP B;  1BKB A;  4BCJ B;  2QFZ A;  4JX5 A;  2L5Q A;  2MYS A;  3LW5 E;  3RIR A;  2EAY A;  2KNB B;  1EZZ B;  1OOT A;  1RAI B;  3LGF A;  2QYZ A;  2HMA A;  4J9I A;  1OIY B;  3JSC A;  2DER A;  1YI2 T;  1ZUU A;  1PNJ A;  2GGR A;  1SHF A;  2GF7 A;  2DIL A;  2YLC A;  2EUF A;  2YUQ A;  3A8H B;  2F1L A;  4PJN A;  2X51 A;  3JCM W;  3EAE A;  3NGP A;  3G4S A;  5GJW B;  5EG2 A;  4R55 A;  4KGZ B;  2RF0 A;  4EMK C;  5IDN B;  2QTV A;  5LQF B;  1JBM A;  3N5B B;  5GAN h;  2L3Q A;  4OMP A;  4OMO A;  3GP8 A;  2XKO C;  1IZ6 A;  1OEB A;  3M0S A;  3OYI A;  4M77 F;  1BK2 A;  4DBR A;  2R7G A;  3NTK A;  3JB9 I;  3EFR A;  1SHG A;  2LT4 A;  2VAS A;  4XU1 A;  2X3W D;  2DE0 X;  4KGX B;  1D1A A;  1QVG S;  4EPC A;  5GAN 6;  5ICP B;  2KDS A;  3ULR B;  1Z9Q A;  1B34 B;  2DEU A;  1B3Q A;  2I2L A;  1ZX6 A;  4OGR B;  1SF9 A;  1Q7Y R;  3OYE A;  5IAY A;  2ZPE B;  4ZGJ B;  2VXF A;  1JOW A;  3MKD A;  1PCX A;  2DRK A;  2QQB A;  4X34 A;  1M90 R;  3O0G D;  3VKG A;  1O9K A;  2LX9 A;  2VGN A;  1N6A A;  5CEI B;  2BS3 A;  4M77 A;  4NS5 A;  4M7A B;  4TTH A;  1YIJ Q;  3FB9 A;  2O4X A;  3CMA A;  4C5H A;  1OU9 A;  1WHH A;  2W2H A;  1KD1 U;  1RAE B;  2R57 A;  1ENW A;  1ZQ1 A;  4EMG A;  2YUO A;  2ROT A;  4HVV A;  1UUE A;  1VQ6 Q;  1CKB A;  3MIA B;  1OZ3 A;  4CFW B;  4X1V A;  2LZ6 B;  2YSQ A;  4ELL A;  3VU3 C;  2WHB B;  2GTO A;  2LP5 A;  3P8H A;  2QDJ A;  1K76 A;  3PIO A;  4BI3 A;  1Q81 U;  4OB1 B;  1ACM B;  2A0F B;  4A53 A;  1VA7 A;  2QA4 A;  1MV3 A;  3QDF A;  1WQW A;  3M03 A;  1MND A;  1Y7X A;  3CCS Q;  3EG2 A;  1MUZ A;  3TRE A;  2QQA A;  2BE9 B;  1K1Z A;  2RQR A;  4LNP A;  4M7D C;  3V7C A;  3X20 B;  3G71 A;  1H3H A;  5ECA A;  1RL2 A;  2C6T B;  3L2W A;  1VQM T;  1OX8 A;  1VQP A;  3TN8 B;  4RTV A;  5FW9 A;  2EYQ A;  2E5Q A;  1H64 1;  3I5S A;  3OW2 A;  5LJ5 g;  4A63 B;  3CXC A;  2DD4 B;  3LLR A;  2EKH A;  2RHX A;  2K7A A;  2C0O A;  1VYW B;  5LJ5 j;  1N5Z A;  1WJR A;  1D1B A;  5A2Q E;  2G6F X;  2JNG A;  2KAF A;  3H8Z A;  4E7S A;  1S72 Q;  4CFM B;  2HL5 C;  3I5R A;  3CCR T;  3BG9 A;  1VQL T;  2YLB A;  1OI1 A;  5FU7 C;  4JJB A;  2KE9 A;  4HCB A;  1VQ5 T;  1H28 B;  1AHJ B;  1VQ7 T;  2L3P A;  1FMW A;  2QQR A;  2KI7 A;  2HNI A;  2X3X D;  2DLP A;  6AT1 B;  3CC4 T;  4LDW A;  1R77 A;  4MIM A;  1K9M U;  1WJQ A;  1T0J A;  2EYZ A;  4ORZ A;  2H8H A;  3JB9 J;  4XTV A;  4RCC A;  3S6W A;  2PUK B;  5A0D A;  2DM1 A;  1G5V A;  4M78 B;  3VS2 A;  2D6F A;  3NTH A;  2MMP A;  2A7Y A;  1VQO T;  2OTJ T;  2LTO A;  1M5Q 1;  4M77 E;  2ABL A;  1PSF A;  1EFN A;  2HDA A;  1KQS A;  1WNL A;  3BHU B;  4PJM A;  1UJ0 A;  4PLI A;  4EOL B;  5GAN d;  4EIK A;  2DBM A;  1H24 B;  2J05 A;  1Y57 A;  2IVX A;  1B34 A;  3CBO A;  1VYT A;  2EGE A;  1K8A C;  4M75 B;  3CCU A;  3OYL A;  1YJN A;  4DBF A;  1WX6 A;  2ZPF B;  4BCH B;  1SRM A;  5KCH A;  3EG0 A;  2RI2 A;  3OS1 A;  3JCM P;  4E7L A;  1HK9 A;  2K79 A;  2L3R A;  2WIH B;  4HCZ A;  4R0K A;  1HJD A;  3REB B;  1QQJ A;  1D0Y A;  5KYW B;  2HZY A;  5CQY A;  4HCC A;  3A8G B;  1TOV A;  1K4U S;  1VQ4 Q;  2J7I A;  2KY9 A;  2V22 B;  4XTY A;  1W2B A;  4KRT A;  2CKK A;  2MWP A;  2I0N A;  3SHW A;  4Z6Y A;  4C92 C;  3CCV Q;  4QVC A;  2NUZ A;  2E12 A;  2RMO A;  4IUR A;  3L2Z A;  2F2X A;  3C94 A;  2ZGW A;  1BCM A;  1OL2 B;  4OF1 A;  4FYY B;  1M1F A;  2RI5 A;  1Q86 C;  1ZSZ C;  2V8K A;  2CT3 A;  2F2W A;  4FYW B;  2FYK A;  2RHI A;  1M2O A;  3VRY A;  3QDR B;  5FWB A;  3LH5 A;  1YJ9 A;  1GL5 A;  2Y4Y A;  1X27 A;  2LCS A;  2K3B A;  4BD3 A;  1VIE A;  5GAO r;  2YWW A;  1YWO A;  1MNE A;  4FW1 A;  1QW1 A;  2MCN A;  3VKH A;  1PRL C;  3I55 Q;  3PO3 S;  3URG A;  3CPF A;  5KE3 A;  3BG3 A;  2GBQ A;  5IDP B;  1ABQ A;  3EGU A;  2FZC B;  4M78 F;  2EYY A;  1HSQ A;  1VQN T;  2DD4 A;  1WFW A;  1RAC B;  3GPL A;  2D0N A;  2QGS A;  2EGC A;  2HKQ B;  3PVL A;  2RPN A;  3LWI A;  2BZ8 A;  5LJ5 h;  8AT1 B;  2B9R A;  3OYD A;  2A08 A;  1JJ2 A;  2W0Z A;  2QQ8 A;  2DL3 A;  2CJM B;  3JCM c;  2M9U A;  3OYF A;  2QTX A;  2E4H A;  1N8R R;  3QYH B;  2DTH A;  2CZ7 B;  1M90 U;  1W6X A;  2O01 E;  4M75 F;  1VQ9 Q;  4F7J B;  3HRT A;  2RHZ A;  4BCQ B;  3UA7 A;  1WI7 A;  2DO3 A;  5D6Y A;  2EPD A;  3TU4 K;  3CXC S;  1YIJ A;  3VS6 A;  2QG9 B;  1PRM C;  1I81 A;  4M7A C;  1YJW Q;  2KR6 A;  2COZ A;  2QEX Q;  2VKN A;  4M78 A;  3CC2 A;  1C9B A;  2CH4 W;  4C0G A;  1ZBJ A;  2KRO A;  3UPU A;  4RG2 A;  1VQ6 A;  2DRM A;  2DK3 A;  5DQW A;  2XDP A;  2DNU A;  4C8Q F;  2A37 A;  2KXD A;  3M4Y A;  1AIS B;  3HFO A;  3K7A M;  3UAT A;  3GTM S;  1WHG A;  2EW3 A;  3M9Q A;  4XTW A;  2WMB B;  2F2C A;  3CCS A;  1YCS B;  1V76 A;  1BI0 A;  1QMZ B;  4M75 A;  4FL6 A;  1YHQ T;  2LNH B;  1M8M A;  4F7L B;  4J9H A;  3ME9 A;  4AI6 A;  4IMY B;  2DD5 B;  1FX7 A;  4FIB A;  1M30 A;  3BHT B;  4IIO A;  2BZY A;  2JVV A;  4E7Z A;  4N4I A;  1PM3 A;  1Q82 R;  3H0F A;  3CC7 T;  1F1B B;  3V8L A;  1PWT A;  4JRQ A;  2ZPH B;  5GAN e;  4CC7 A;  2VUB A;  1IGU A;  3OA6 A;  2KT1 A;  4HA8 A;  4M7A G;  3R6N A;  4CFU B;  2RO0 A;  3G1J A;  1OUL A;  4XU2 A;  1MMD A;  4PKC C;  4C5I A;  2C5O B;  1QWE A;  4CFX B;  3JRZ A;  5IXF A;  1WJS A;  2LQN A;  1A0N B;  2DME A;  4BCF B;  2LW4 A;  2C06 A;  3KUF A;  3FEO A;  1JXO A;  1YI2 Q;  1X43 A;  1WXT A;  4KUD K;  1K73 U;  3M4G A;  4V2S A;  3MY1 B;  1AWW A;  3JB9 G;  4C0D C;  4BCM D;  2YRC A;  1OPL A;  2DIG A;  4NST B;  2C5X B;  3QZ5 B;  2MI6 A;  3TVT A;  1SSH A;  5CVI A;  5FRO A;  3CCM A;  1VOM A;  4M78 E;  2DTO A;  1QVG A;  2MF2 A;  4ZTJ A;  2AZS A;  1R0B G;  3BHV B;  1Q81 R;  1UFF A;  2QAZ A;  4ROC A;  4M7D B;  1NEG A;  3OYN A;  4FT2 A;  4AT1 B;  1RAG B;  2FG0 A;  3CD6 A;  3JCM X;  3MY5 B;  1TUD A;  3C12 A;  2P84 A;  5FWC A;  4F17 A;  4AG1 C;  1X01 A;  5LJ5 d;  4M75 E;  4BDZ A;  1VQ4 A;  3EFS A;  4OP0 A;  2AKL A;  3CCL T;  3EGD B;  4X9C A;  2KGT A;  2RQU A;  3H4C A;  2OTL T;  1QWF A;  1TG0 A;  1KQ2 A;  2CCH B;  2ZPG B;  3C4S A;  4N4H A;  5CCA A;  2LNV A;  3H0I A;  2JM9 A;  1H4L D;  3VS1 A;  5FGK B;  2EKO A;  5FU7 B;  4ZGE B;  3B57 A;  1GFC A;  5KYX B;  5DLQ E;  4C8Q E;  2XG8 D;  2VWF A;  1N9R A;  2P0P A;  4JRK A;  4EMK A;  2AZV A;  4EOQ B;  1OX9 A;  3I35 A;  4A54 A;  2EVR A;  2KBT A;  3ASK A;  2WPA B;  4BI4 A;  3OYC A;  2LDM A;  1K9M R;  2RQT A;  1KC8 C;  2DD5 A;  2RI3 A;  3QYG B;  3VV0 A;  4EDU A;  1NJI U;  3H9N A;  1Q95 G;  1DJ7 B;  5GAN 8;  4BY6 C;  2EQI A;  1FXX A;  1XOV A;  5IHY A;  1KIK A;  4YOS A;  3G4S T;  4JDS A;  5BNJ B;  1Y96 B;  2K6D A;  1K9A A;  4HKE A;  1FVV B;  3RBB B;  3OYH A;  1X6B A;  3M58 A;  4O6J A;  5EJC A;  2RQV A;  1H8K A;  2WEV B;  2A36 A;  1N8R U;  4HLQ A;  1VQM Q;  1LJO A;  2FPF A;  3CME T;  2DJQ A;  3QUI A;  3I56 Q;  5GMK e;  3QHW B;  4G6L B;  3I9Q A;  3MO8 A;  4BB7 A;  3SD4 A;  2BUD A;  3TNH B;  4L6V 5;  4NC6 A;  3E19 A;  4AG2 C;  5GJV B;  2SRC A;  4BCN D;  1U1S A;  2CZ1 B;  2WSE E;  3FC3 A;  2QEX A;  4JJD A;  3CCE Q;  1LCK A;  1N27 A;  4C92 B;  5HBJ B;  2KRN A;  4IIM A;  2YXY A;  1D09 B;  3CCR Q;  4TVR A;  4BAC A;  3SWN B;  1VQL Q;  1VQK A;  3V8J A;  3GOX A;  2ENM A;  2DZ9 A;  2DL8 A;  2F5K A;  2RK1 A;  5FRM A;  1G3T A;  2BS4 A;  5GMK m;  1VQ7 Q;  3JCM V;  1QCF A;  1H92 A;  2L89 A;  1ZSZ B;  3AT1 B;  5HVY B;  2CRE A;  3CC4 Q;  4C8Q D;  5KYY B;  4E7K A;  4CI0 C;  1Q7Y C;  3HB9 A;  1ZUY A;  1H25 B;  2EWN A;  2Z0W A;  3H6Z A;  4IUQ A;  4OGC A;  4CFV B;  1M1K R;  3CMA T;  1IB8 A;  4ELJ A;  3QXE B;  2O9S A;  2MOX A;  4AFU C;  4M7D A;  3OB9 A;  5KE2 A;  3E1S A;  3HRS A;  1WHM A;  1BI3 A;  1Q82 U;  2KVQ G;  2E6Z A;  2OTJ Q;  4II1 A;  2EJF A;  3VUB A;  1NLP C;  5CK9 A;  2G77 A;  4RTU A;  2QGF B;  2EJ9 A;  2RJD A;  5GAO n;  2YRD A;  3KFV A;  5D6X A;  4JS5 A;  1U1T A;  3P8D A;  5L8R E;  3EGD A;  2QA4 T;  2PU9 B;  3ZFJ A;  2JW4 A;  3FDR A;  4FW2 A;  3QWL A;  2W99 A;  3DJB A;  1H1S B;  1AZG B;  2C4G B;  3G71 T;  1GCP A;  2CZ6 B;  4F7N B;  4J9B A;  5GAO p;  2KRM A;  1VQP T;  1AWO A;  2Y4X A;  1AOJ A;  5HK3 A;  3QYB A;  2W96 A;  3QYE A;  1OPK A;  1JU5 C;  1H1R B;  1UEB A;  3VYH B;  2IVW A;  2O88 A;  1UG1 A;  1URC B;  1TH7 A;  5LJ5 e;  1JSU B;  5CYI B;  1NPP A;  2ZCF B;  1KSW A;  3H41 A;  4D6W A;  4BUG A;  1JB0 E;  4BXX X;  4PJO B;  4RTT A;  2ZPB B;  4J9E A;  4N0A C;  1QKX A;  5D7U A;  4DBH A;  2EYX A;  3PTA A;  1G3N C;  2J6K A;  1OIU B;  3PFS A;  1BCO A;  2XMF A;  3IQL A;  1X6G A;  5I5Z B;  4ESR A;  4BCM B;  2IIM A;  1VOL A;  4JLG A;  4J6X A;  4MFD A;  2F5T X;  5KCO A;  1Y96 A;  2UZL B;  3CEY A;  3HTR A;  1PKD B;  1YFN A;  2BTT A;  2FVU A;  2E3I A;  1Y71 A;  4M6V A;  4E2F B;  1H26 B;  1MGQ A;  4OB3 B;  3R6O A;  1QCN A;  2HCK A;  2FPD A;  2PMI B;  4PLL A;  4HVW A;  4EOK B;  2AKK A;  3HP9 A;  3VYG B;  1NPR A;  2RN8 A;  1UEC A;  2QI2 A;  3CPW S;  1YWP A;  2K4Y A;  1V29 B;  7AT1 B;  4OML A;  1VQN Q;  5LJ3 g;  2L2P A;  3QPH A;  3OW2 P;  1X75 C;  3CCQ T;  3CXC P;  2E41 A;  3OMC A;  3M5A A;  1UTI A;  3F70 A;  5LJ3 j;  1D3U B;  4AKI A;  2L8D A;  4C92 A;  2AHJ B;  2DFU A;  1H1P B;  1XQH A;  3E2U A;  4DA4 A;  3KBG A;  2DZC A;  3CCU T;  1QLB A;  2C5N B;  1YJN T;  1TS9 A;  1QVF S;  1ZLM A;  1FIN B;  1IHV A;  2ATC B;  1TTH B;  2R5M A;  3V8K A;  1ZSZ A;  4EOS B;  5KYY A;  3NTI A;  1ARK A;  4ANJ A;  3MP8 A;  1E6H A;  2VB6 A;  4OMM A;  5CIU A;  3DOG B;  2FL7 A;  1Y07 A;  4A4E A;  1AEY A;  4MZP A;  4LD9 K;  5GAO l;  3MP6 A;  4KUI A;  2C0I A;  4C0D B;  3DTO A;  4M7A F;  2B8A A;  4M7D G;  1K73 R;  3NDQ A;  4MFE A;  4PL6 A;  4PFZ A;  1ZBX A;  4DBQ A;  5GAM g;  2QDY B;  4LDV A;  1BIA A;  2O9V A;  2LQK A;  2K5F A;  2CS7 A;  2JTM A;  3RMQ A;  1KQS P;  5GAM j;  1YJ9 T;  4FYX B;  5A0L A;  3MEA A;  1YHQ Q;  3DLL A;  2LX7 A;  4YOZ A;  3CCJ T;  1RLQ C;  2UZE B;  3I56 A;  3POM A;  1U06 A;  1GUX B;  3WXM B;  4HT9 A;  4CRI A;  3JB9 F;  4GBQ A;  4L59 A;  3TEE A;  3CC7 Q;  2JUF A;  3LX7 A;  1OKW B;  2CZ0 B;  3MEW A;  5KH6 A;  3HZJ A;  3BFM A;  2J6F A;  2E70 A;  1P5E B;  1C1A A;  1GCQ C;  5GAN 7;  4M7A A;  4B9W A;  2DXU A;  3CCE A;  1W2B P;  2DL4 A;  1TXQ A;  1H3Z A;  1OL1 B;  1HYO A;  1JST B;  1E6G A;  2XIC A;  3SWN C;  1FKM A;  2KR3 A;  2X4J A;  2JTE A;  2RHU A;  3QHS A;  3RKW A;  5I11 A;  1G3S A;  1VQ7 A;  4MDW A;  1ZUK A;  3M57 A;  2MK5 A;  2NUT B;  3OS2 A;  4EMH A;  2VVK A;  4E7J A;  2KXC A;  1NYG A;  3HRU A;  4MMK A;  3EFO B;  1KQ1 A;  1M1K U;  3WVE B;  3TSZ A;  4DEY A;  4OMF B;  1YIJ T;  2HSP A;  3THK A;  3QBY A;  2EFI A;  1T3L A;  4IUV A;  2WMA B;  2J06 A;  4J7F A;  3VS3 A;  1YIT T;  1AT1 B;  2VV5 A;  4J8O A;  3CC2 T;  4PNO A;  2NUP B;  3RUX A;  1VQ6 T;  3VJP A;  2OTJ A;  1YCY A;  1E9H B;  4WCI A;  4EON B;  4BY6 B;  1M27 C;  1NJI R;  1VIN A;  1K8A R;  4M77 D;  5IXB A;  4JLI A;  3A8M B;  1ABO A;  2E65 A;  4FCY A;  1JQQ A;  5LJ3 h;  4PJL A;  2E3H A;  2GFA A;  1GBQ A;  4BE1 A;  1JJ2 P;  2YT6 A;  2P0Q A;  4BI8 B;  3A1P A;  3DDQ B;  2CUD A;  4C92 G;  4LOC A;  1ZA1 B;  3HO8 A;  3EGX B;  3J81 E;  5DY9 A;  2M1H A;  4QT7 A;  2OX7 A;  4RCB A;  4FT4 A;  5LJ3 f;  1EIF A;  3O8V A;  3G7Z A;  4F7U B;  2E5K A;  5GAN 3;  4M4Z A;  3CCL Q;  4PFO A;  3MP1 A;  1I0C A;  2OTL Q;  4PJO C;  5I22 A;  1Q86 R;  1KHI A;  2JOY A;  2R5A A;  1G3Y A;  4JRP A;  1O9S A;  1AZE A;  1UDL A;  5HBE B;  4AFQ C;  2NLU A;  4M7A E;  3G33 B;  3QWX X;  4C5E A;  3RNJ A;  4LUD A;  2DAQ A;  5GAM h;  5IN1 A;  1WZO A;  2JMA A;  2QDL A;  4PFP A;  5CKB A;  5HBH B;  2HQE A;  1R8O B;  2DL5 A;  1OYX A;  3QKJ A;  3JAM E;  5HCK A;  1GUX A;  2CCI B;  1UE9 A;  2JMC A;  4QVZ A;  3TCJ A;  2UUE B;  3V7S A;  3GLX A;  2EQM A;  4OR5 B;  2PNI A;  3A5Z B;  2LC4 A;  4ZNX A;  5M9O A;  2GFU A;  1F5Q B;  2DVJ A;  4QQD A;  5GAM f;  1R0C B;  3G4S Q;  1NM7 A;  3CCM T;  3TNI B;  4J5Y A;  5KYW A;  3RKY A;  3PT9 A;  3TSW A;  5C0M A;  1QCO A;  4HNT A;  1KD1 C;  2CGH A;  4I3Z B;  2R58 A;  3CBM A;  2FPE A;  4Q5W A;  4HCK A;  3EG1 A;  3OS5 A;  1S72 A;  1ZP2 A;  4PJO G;  2XDD A;  4EC8 B;  3CME Q;  2NUT A;  2X9H A;  1Q81 C;  1VQ8 T;  3CD6 T;  2DPP B;  1I4K 1;  4N4G A;  3X24 B;  1KJW A;  4NL2 A;  1YNZ A;  2E10 A;  1E7O A;  8ATC B;  4RG8 A;  1RLP C;  2LJ1 A;  2H3J A;  1TD6 A;  4J6Y A;  1RAH B;  4DEX A;  1UB4 A;  2QK0 A;  4RTX A;  4YTL A;  1RI9 A;  1UGR B;  2D9T A;  1JXM A;  4F7U F;  1WXU A;  5J39 A;  4D8K A;  2L0A A;  2COW A;  1W70 A;  2YRV A;  2BIV A;  3S3N A;  2PJQ A;  1QKW A;  3CQT A;  5CO7 A;  2D0Q B;  1V1C A;  1UGQ B;  3CBP A;  3NMZ C;  4PK4 A;  3KHI A;  2W10 A;  1XJW B;  3LWH A;  2LCC A;  2RQW A;  2AK5 A;  2K2M A;  1QVG P;  2JS0 A;  5ACB A;  3CMA Q;  2XD0 A;  1PG5 B;  1FMV A;  4IUU A;  1H1Q B;  2BKZ B;  3MI9 B;  3M0T A;  3BDL A;  1GRI A;  3INZ A;  2HEQ A;  3EGX A;  4IUP A;  4BE0 A;  2UZD B;  1LPL A;  3JV3 A;  4RTZ A;  3M0U A;  4MDX A;  1K9M C;  3NPF A;  3G6E T;  4OVA A;  4EOR B;  3EHR A;  4J9C A;  5LJ3 d;  4F7U A;  4R56 A;  2YHT A;  3JB9 D;  1SRL A;  2QA4 Q;  3HPW A;  2PZ1 A;  4FSX A;  3DB4 A;  4GLK A;  2M02 A;  3BLR B;  5GAN 4;  2PK2 A;  1XNI A;  3TNW B;  3CCV A;  1JO8 A;  2P4T A;  2GQV A;  2O31 A;  4BBS M;  3HFN A;  3BY7 A;  2LJ0 A;  1VQP Q;  4OB2 B;  4FYV B;  2DX1 A;  3VKI A;  3ZL7 C;  4KGV B;  3MEU A;  1UNG D;  1PKS A;  3UT1 A;  5D6W A;  4XU3 A;  1E7P A; 
#chains in the Genus database with same CATH homology
 5GAN d;  2LQ8 A;  2XID A;  4E47 A;  3MHX A;  5DM7 R;  5GAO p;  1VQP T;  2Y4X A;  2QEX T;  4AKG A;  2K3X A;  4C8Q C;  4DQ2 A;  5HK3 A;  3M53 A;  3QYB A;  2LCL A;  3LGL A;  1B34 A;  3CBO A;  4WF2 A;  3QYE A;  2QF7 A;  3RES A;  4BE2 A;  3GIB A;  3L2U A;  1VQN A;  1UEB A;  3VYH B;  1P92 A;  2IVW A;  3GNG A;  5GAO m;  4M75 B;  3CCU A;  1K8A C;  3I55 A;  1TH7 A;  3C95 A;  4DOW A;  1QP3 A;  5LJ5 e;  2FB7 A;  3OYL A;  1YJN A;  1VQK T;  4QSH A;  4EMK B;  3JCM b;  4ATO A;  3QJY A;  1NPP A;  2JZ2 A;  2ZPF B;  2ZCF B;  1UGS B;  3OS1 A;  5KCH A;  3JCM P;  2RI2 A;  1K8A U;  4D6W A;  4BUG A;  4E7L A;  1HK9 A;  2L3R A;  2V8I A;  3CPW A;  1JB0 E;  3OSV A;  2XDB A;  2RH2 A;  5GAM d;  4O5V A;  4PJO B;  4HCZ A;  2ZPB B;  4XQ3 A;  4N0A C;  5J26 A;  2E1H A;  3PMT A;  3E9F A;  1M9S A;  5HKC A;  3PTA A;  3MET A;  2E64 A;  5CQY A;  3PFS A;  2X35 A;  2F69 A;  3FJP A;  4HCC A;  3A8G B;  4M78 D;  4XTY A;  2KY9 A;  3RKX A;  5CKD A;  2X4W A;  4FU6 A;  1W2B A;  2CKK A;  2FHD A;  2MWP A;  4JLG A;  4J6X A;  4MFD A;  2F5T X;  4Z6Y A;  4C92 C;  5KCO A;  4RMO A;  3ER0 A;  4JRI A;  1Y96 A;  3CEY A;  1LNX A;  4QVC A;  1KQS S;  2PVG B;  2E12 A;  1D3B B;  4ZGD B;  3L2Z A;  2FVU A;  4IUR A;  4LD6 A;  1QP2 A;  1QVF A;  2DVE A;  3MCA B;  3C94 A;  1Y71 A;  4M6V A;  2ZGW A;  2XI9 A;  4C8Q A;  1VQ4 T;  2KMG A;  4XTX A;  3TW7 A;  4OF1 A;  1MGQ A;  3JCM g;  4BDY A;  3QII A;  4LDX A;  4OB3 B;  1M1F A;  5GMK l;  1VQ9 A;  1BIB A;  2RI5 A;  3R6O A;  2V8K A;  5CQX A;  4HNU A;  2VYT A;  3LYI A;  3CCV T;  3OSS C;  1Q86 C;  2FYK A;  2RHI A;  1OZ2 A;  2ZPI B;  2EQK A;  3DB3 A;  2RJC A;  4PLL A;  3QDR B;  3SB2 A;  2HBP A;  4MZM A;  3HP9 A;  2KMT A;  1M1G A;  2Y4Y A;  3VYG B;  4M75 D;  1NPR A;  4OB0 B;  4BD3 A;  1VIE A;  3L2V A;  1Q86 U;  4ZN3 A;  1YJW A;  2QI2 A;  2QQ9 A;  5GMK i;  2DEQ A;  3OY9 A;  3CPW S;  2K4Y A;  1V29 B;  5GAO r;  1YJ9 A;  4N0A A;  2DXB B;  1QW1 A;  3VKH A;  4P5N A;  3HHT B;  5LJ3 g;  4UC4 A;  4LDY A;  4XTZ A;  1HXD A;  3URG A;  3QPH A;  4M7A D;  1FWZ A;  1X75 C;  3CPF A;  4PJO D;  2RD1 A;  5KE3 A;  3J80 E;  3CCQ T;  2E41 A;  3OMC A;  5I21 A;  3BG3 A;  2JN0 A;  3Q1J A;  4F7U E;  3M5A A;  3F70 A;  5LJ3 j;  3PNW C;  4AKI A;  2L8D A;  2PVO B;  3JCM Q;  1W2B S;  3RER A;  4C92 A;  2AHJ B;  4KUL A;  4M78 F;  1XQH A;  1YHQ A;  4M78 C;  4DA4 A;  3ZEH A;  2DTI A;  1VQN T;  2DD4 A;  4J7I A;  3KBG A;  2DZC A;  3CCU T;  1QLB A;  3I55 T;  3GPL A;  3PMI A;  1YJN T;  1QVF S;  2RHY A;  5FU6 C;  2M16 A;  1N9S A;  2LT1 A;  2R5M A;  3V8K A;  3LWI A;  1VIF A;  5LJ5 h;  3CC7 A;  5IT9 E;  2MAM A;  3JB9 H;  3M56 A;  3J7A F;  2K5L A;  2VGM A;  3WVD B;  3OYD A;  2K57 A;  3AHU A;  3BDU A;  2DXC A;  1JJ2 A;  4HT8 A;  3A8O B;  1M90 C;  2QQ8 A;  3NTI A;  3NFC A;  3MP8 A;  2MWO A;  4VUB A;  4ELZ C;  2PVD B;  5GAN g;  3JCM c;  3S3M A;  2M9U A;  2Y90 A;  3OYF A;  2QTX A;  3QYH B;  2DTH A;  2CZ7 B;  5CIU A;  1M90 U;  5CKF A;  2O01 E;  5GAN j;  4M75 F;  2LRQ A;  4M7D F;  2FL7 A;  1Y07 A;  5GAO q;  4A4E A;  4M75 C;  3HRT A;  4MZP A;  4A4G A;  4LD9 K;  5GAO l;  3MP6 A;  2RHZ A;  2DO3 A;  4KUI A;  3OYY A;  5D6Y A;  3TU4 K;  4C0D B;  2WJ9 A;  3CXC S;  2KSS A;  2RB6 A;  1YIJ A;  2B8A A;  1VQ8 A;  4M7A F;  4M7D G;  1I81 A;  4M7A C;  4F7U G;  2KR6 A;  4JX4 A;  4MFE A;  4PL6 A;  4A4F A;  3JCM e;  1ZBX A;  4M78 A;  5GAM g;  2QDY B;  4LDV A;  1BIA A;  3CC2 A;  2LQK A;  1VQ9 T;  2K5F A;  2CS7 A;  2X4X A;  2JTM A;  4C0G A;  3HKS A;  3UPU A;  4RG2 A;  1VQ6 A;  3RMQ A;  5GAM j;  3CME A;  3UDC A;  2DK3 A;  2XDP A;  2CYZ B;  3HBL A;  3L2R A;  1YJ9 T;  2HQX A;  4OGE A;  4Y28 E;  4MZT A;  2PQW A;  4C8Q F;  1YJW T;  2EJG A;  5A0L A;  3MEA A;  3OBW A;  3DLL A;  4Y91 A;  5GMK j;  5LJ3 e;  3M4Y A;  1JJ2 S;  3HFO A;  5GAN f;  3CCJ T;  4IUT A;  4M78 G;  5A0G A;  1O75 A;  3M9Q A;  4XTW A;  3I56 A;  1ZHI A;  3QO3 A;  3CCS A;  3WXM B;  4HT9 A;  4CRI A;  3JB9 F;  3DKM A;  4L59 A;  3TEE A;  1BI0 A;  4M75 A;  2JUF A;  4FL6 A;  3V7R A;  1YI2 A;  3LX7 A;  1U8R A;  1YHQ T;  4ELY C;  2CZ0 B;  3MEW A;  2RK2 A;  3A8L B;  5KH6 A;  3HZJ A;  4C0Z A;  4E7I A;  3ME9 A;  4AI6 A;  3BFM A;  2DD5 B;  5GAN 2;  1FX7 A;  1XTD A;  4FIB A;  2E70 A;  5GAN 7;  1BYM A;  2EQJ A;  4M7A A;  2QXF A;  2JVV A;  4B9W A;  2DXU A;  4N4I A;  3CCE A;  4M77 B;  3GF5 A;  5AYF A;  4C92 F;  3CC7 T;  4QW2 A;  2O4X B;  2GCX A;  3V8L A;  4RKU E;  3OYG A;  1H3Z A;  3M54 A;  2XIC A;  3VUZ A;  3OS0 A;  2ZZD B;  3OYB A;  4JJN K;  4JRQ A;  2ZPH B;  1FKM A;  2X4J A;  3QJ6 A;  4M75 G;  3SWN C;  5GAN e;  4QVD A;  2XK0 A;  2RHU A;  2VUB A;  4QQG A;  3G6E A;  4Z02 A;  3QHS A;  3RKW A;  2RM4 A;  1G3S A;  1M1K C;  4MDW A;  3OA6 A;  1VQ7 A;  3M57 A;  2BS2 A;  1LOJ A;  3OS2 A;  4HA8 A;  5CR2 A;  4NL3 A;  4M7A G;  4EMH A;  1D3B A;  4MML A;  4A4K A;  1M8V A;  4E7J A;  2HAX A;  3HRU A;  4MMK A;  1KQ1 A;  1M1K U;  5FRN A;  3L1A A;  3L42 A;  1I5L A;  3WVE B;  3OQ5 A;  1YIJ T;  4OMF B;  3UWN A;  3QBY A;  2EFI A;  2RO0 A;  2X4Y A;  4IUV A;  4XK8 E;  5CAI A;  4ZN1 A;  3KXT A;  3CCL A;  4J7F A;  4DOV A;  1YIT T;  4XU2 A;  4PKC C;  2OTL A;  4C5I A;  5GAM e;  2RA2 A;  2VV5 A;  1G3W A;  2RJE A;  4J8O A;  3CC2 T;  4PNO A;  3JRZ A;  3RUX A;  4C8Q G;  1VQ6 T;  3VJP A;  2OTJ A;  4HNV A;  1YCY A;  1WJS A;  1JRI A;  3JCM h;  4M7D E;  1K73 C;  1I8F A;  2DXB A;  2WSF E;  2C06 A;  3KUF A;  5HK0 A;  3FEO A;  4BY6 B;  1X6O A;  1GXI E;  4XTU A;  1KHC A;  2E6N A;  4JUV A;  4KUD K;  1K73 U;  3PGG A;  3M4G A;  3OBY A;  3X28 B;  4M77 D;  3QSU A;  4V2S A;  3SWN A;  5LL6 S;  3JB9 G;  4C0D C;  4JLI A;  4KBM B;  1BKB A;  2VXE A;  3A8M B;  2QFZ A;  5I2M A;  4JX5 A;  2L5Q A;  3I56 T;  2DJZ A;  2E65 A;  3LW5 E;  4E7H A;  2DIG A;  3RIR A;  3JCM J;  2EAY A;  3QZ5 B;  2MI6 A;  5LJ3 h;  3LGF A;  5CVI A;  3JCM f;  5FRO A;  2GFA A;  3JSC A;  4BE1 A;  1YI2 T;  3CCM A;  4XAX B;  4M78 E;  2P0Q A;  1YBY A;  4BI8 B;  2DTO A;  2GF7 A;  4C92 G;  4LOC A;  2YLC A;  4FM4 B;  4PLI A;  3S3O A;  1QVG A;  2MF2 A;  3HO8 A;  4ZTJ A;  3J81 E;  3CCE T;  5DY9 A;  2XHC A;  3A8H B;  2M1H A;  3ZBD A;  3JCM W;  3EAE A;  4RCB A;  3G4S A;  4FT4 A;  2JTF A;  5EG2 A;  5LJ3 f;  1EIF A;  4M7D B;  3OYN A;  4R55 A;  1WPY A;  1BI1 A;  3O8V A;  3G7Z A;  4F7U B;  3QG1 A;  3L2Q A;  4FT2 A;  4EMK C;  5GAN 3;  5J3B A;  3CD6 A;  3MP1 A;  3RMS A;  3JCM X;  3FLG A;  1M4Z A;  2DXT A;  4PJO F;  3OYM A;  3C12 A;  2EIF A;  4PJO C;  1JBM A;  3N5B B;  5GAN h;  1X01 A;  1KHI A;  3GP8 A;  2JOY A;  2XKO C;  5LJ5 d;  1IZ6 A;  4M75 E;  2R5A A;  1G3Y A;  1QVP A;  3OYI A;  4M77 F;  4JRP A;  4BDZ A;  3EFS A;  1VQ4 A;  1O9S A;  3LH0 A;  4OP0 A;  1VQL A;  4M77 C;  3HSB A;  3BG5 A;  3CCL T;  3NTK A;  4X9C A;  3JB9 I;  4JS4 A;  3EFR A;  3H4C A;  2OTL T;  4AKH A;  2LVM A;  2NLU A;  4M7A E;  1KQ2 A;  5GAN 5;  5C6S A;  2HD0 A;  4C5E A;  2ZPG B;  2LT4 A;  2P0K A;  3C4S A;  4N4H A;  4XU1 A;  4BBR M;  5CCA A;  2LNV A;  4XU0 A;  3DL1 A;  2DAQ A;  1VQM A;  1QVG S;  4EPC A;  5GAM h;  5GAN 6;  2EKO A;  5FU7 B;  4ZGE B;  5IN1 A;  4GY5 A;  4KT0 E;  2KDS A;  5CKB A;  5DLQ E;  2HQE A;  1IRE B;  1B34 B;  1R8O B;  2XG8 D;  1WQ7 A;  4C8Q E;  3CCQ A;  1N9R A;  4ME7 A;  2P0P A;  3TW6 A;  1OYX A;  5GMK h;  2I2L A;  3QKJ A;  4JRK A;  4EMK A;  3JAM E;  4ZTF A;  2VC8 A;  4QVZ A;  3TCJ A;  3HL8 A;  3V7S A;  4A54 A;  1W4S A;  2WAC A;  2EQM A;  3GLX A;  3OYE A;  4M7D D;  3A5Z B;  1KG1 A;  5IAY A;  2ZPE B;  2LC4 A;  4ZGJ B;  3ASK A;  2GFU A;  5M9O A;  2VXF A;  4BI4 A;  4PJO A;  3OYC A;  4QQD A;  2LDM A;  2QQB A;  4L5G A;  5GAM f;  1NJI C;  4X34 A;  3CCM T;  1KC8 C;  2DKG A;  2DD5 A;  3CCR A;  2RI3 A;  1BI2 A;  4J5Y A;  3VKG A;  3RKY A;  3PT9 A;  4JX6 A;  3M55 A;  3QYG B;  2LX9 A;  4X9D A;  3VV0 A;  2VGN A;  4EDU A;  4HNT A;  1N6A A;  5C0M A;  1NJI U;  1KD1 C;  2BS3 A;  2CGH A;  4M77 A;  4NS5 A;  2R58 A;  3CBM A;  4M7A B;  1KC8 U;  1DJ7 B;  5GAN 8;  3FB9 A;  2O4X A;  4Q5W A;  1VQ5 A;  3CMA A;  4BY6 C;  3E9G A;  1MHN A;  2EQU A;  1PSE A;  4C5H A;  1FXX A;  1XOV A;  3OS5 A;  1KD1 U;  3X25 B;  2ZZD A;  2R57 A;  3G4S T;  1S72 A;  1ZQ1 A;  4EMG A;  5I2S A;  4JDS A;  1Y96 B;  4PJO G;  4C92 E;  2XDD A;  3CC4 A;  4HKE A;  4QQ6 A;  3PIP A;  1OZ3 A;  3OYH A;  1N8R C;  1VQ8 T;  1Q81 C;  3CD6 T;  3VU3 C;  2DPP B;  1SSF A;  4C0F A;  4C8Q B;  3M58 A;  4O6J A;  5EJC A;  1I4K 1;  4M77 G;  2PUO B;  3OMG A;  4N4G A;  3X24 B;  3P8H A;  2QDJ A;  3GNF B;  4NL2 A;  2E10 A;  3PIO A;  1N8R U;  4BI3 A;  1Q81 U;  4OB1 B;  3SDZ A;  4A53 A;  1RI0 A;  4RG8 A;  4HLQ A;  2K3Y A;  1VQO A;  1LJO A;  2QA4 A;  2H3J A;  3VYG A;  3CME T;  4J6Y A;  3QUI A;  4IKF A;  3T9N A;  1WQW A;  2WSC E;  1UB4 A;  5GMK e;  1Y7X A;  4YTL A;  3P8B B;  3MO8 A;  1UGR B;  1UGP B;  4BB7 A;  2BKD N;  3SD4 A;  3TRE A;  3M59 A;  2D9T A;  2BUD A;  2K2V A;  2QQA A;  5CKE A;  4F7U F;  3OYA A;  4L6V 5;  4M7D C;  5J39 A;  3V7C A;  3X20 B;  3G71 A;  4NC6 A;  3E19 A;  1RL2 A;  1U1S A;  3L2W A;  1VQM T;  2YRV A;  2CZ1 B;  2BIV A;  3S3N A;  1VQP A;  2WSE E;  3FC3 A;  2QEX A;  3QZ9 B;  3X26 B;  5CO7 A;  3CCS T;  2EYQ A;  2D0Q B;  1N27 A;  4B9X A;  2E5Q A;  4C92 B;  3CBP A;  1UGQ B;  1H64 1;  3CCJ A;  4TVR A;  3OW2 A;  2XU8 A;  5HY6 A;  5LJ5 g;  4J6W A;  3KHI A;  3SWN B;  2DD4 B;  3LLR A;  3CXC A;  4BAC A;  3LWH A;  1VQK A;  2LCC A;  2RHX A;  4NOY A;  3V8J A;  3GOX A;  2DZ9 A;  2F5K A;  5LJ5 j;  2RK1 A;  5DLO A;  5FRM A;  1G3T A;  2XD0 A;  2BS4 A;  1WJR A;  3JCM d;  4IUU A;  3MEV A;  5GMK m;  3JCM V;  5A2Q E;  2JNG A;  2L89 A;  2KAF A;  2M0O A;  3H8Z A;  1NZ9 A;  3CCR T;  3BDL A;  4C8Q D;  3INZ A;  4E7K A;  3BG9 A;  1VQL T;  2YLB A;  2DXC B;  1OI1 A;  4CI0 C;  1Q7Y C;  3HB9 A;  4IUP A;  3H6Z A;  2EWN A;  5FU7 C;  4IUQ A;  2A3L A;  4BE0 A;  4OGC A;  1WGS A;  4HCB A;  1VQ5 T;  1Q82 C;  3CMA T;  4J83 A;  4HL4 A;  4ELJ A;  5CKH A;  1AHJ B;  4OVA A;  3G6E T;  3QXE B;  1K9M C;  4M7D A;  4MDX A;  1VQ7 T;  2K5I A;  1Q7Y U;  2QQR A;  3OB9 A;  5LJ3 d;  4F7U A;  5KE2 A;  3E1S A;  2HNI A;  3HRS A;  3SFM A;  1S72 T;  1BI3 A;  1Q82 U;  2KVQ G;  4R56 A;  2YHT A;  4LDW A;  3CC4 T;  2DIQ A;  4MIM A;  2E6Z A;  2V8J A;  3FRN A;  3JB9 D;  2IG0 A;  1K9M U;  1WJQ A;  3HPW A;  4II1 A;  2KK4 A;  2OAU A;  2EJF A;  4FSX A;  3VUB A;  3DB4 A;  2KQW A;  4GLK A;  5CK9 A;  5GAN 4;  3JB9 J;  4XTV A;  1XNI A;  4RCC A;  3S6W A;  2PUK B;  2G77 A;  5A0D A;  3OYK A;  1G5V A;  3FIF A;  3CCV A;  2P4T A;  4M78 B;  2EJ9 A;  2GQV A;  5LJ5 f;  2RJD A;  3OW2 S;  4PJO E;  5GAO n;  3NTH A;  4BBS M;  3HFN A;  2MMP A;  2D6F A;  5D6X A;  2A7Y A;  1U1T A;  3P8D A;  4JS5 A;  3BY7 A;  5L8R E;  4C92 D;  1VQO T;  2OTJ T;  3OYJ A;  2QA4 T;  4OB2 B;  2PU9 B;  2QQS A;  3DLM A;  5FU6 B;  2LTO A;  1NE8 A;  3FDR A;  3ZFJ A;  1YIT A;  1M5Q 1;  3QWL A;  3VKI A;  4M77 E;  3MEU A;  1PSF A;  5FLX E;  4A4H A;  2RJF A;  3UT1 A;  4C5G A;  1KQS A;  3G71 T;  3BW1 A;  1VUB A;  5D6W A;  4XU3 A;  1WNL A;  4LDU A;  1E7P A;  2G3R A;  2CZ6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...