2CZ1B

Photo-activation state of fe-type nhase with n-ba in anaerobic condition
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title photo-activation state of Fe-type NHase with n-BA in anaerobic condition
rcsb
molecule tags Lyase
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2cz1B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cz1B02
4KT0E 1IREB 2ZPGB 2D0QB 2DXCA 3QXEB 2O01E 3A8LB 3WVEB 2PVDB 2WSEE 1V29B 2DXBA 1PSFA 4XK8E 3VYHB 2PVOB 4ZGEB 1UGRB 1AHJB 4OB1B 2PUOB 2PU9B 3HHTB 2ZPFB 2QDYB 3QZ5B 4ZGDB 4ZGJB 3A8HB 3VYGB 3X24B 4OB3B 2ZZDA 3X28B 3LW5E 4OB0B 2ZZDB 4FM4B 3QYGB 4Y28E 2ZCFB 3QYHB 2PUKB 1DJ7B 5L8RE 2DD5B 3VYGA 2DPPB 2AHJB 3A8GB 3QZ9B 4RKUE 2CZ6B 1UGQB 3A8MB 2ZPHB 3A8OB 2CYZB 1QP2A 2CZ7B 2ZPBB 2DD5A 2WSCE 1QP3A 1JB0E 1GXIE 2ZPIB 3X20B 3X25B 2DD4A 2DXCB 2ZPEB 4OB2B 2DD4B 2CZ0B 1UGSB 2PVGB 4L6V5 3WVDB 2CZ1B 1UGPB 1PSEA 2WSFE 2DXBB 3X26B
chains in the Genus database with same CATH superfamily
5ACBA 4JLIA 1KQSP 3G1JA 1JXMA 3E1SA 4PKCC 2JJ9A 3I5SA 4JRQA 2F5KA 1WFWA 1ZX6A 2V22B 4L5GA 3I5RA 1K8AC 1VQOQ 4C5HA 2DL3A 2BS2A 2FZGB 1VQLQ 1OIYB 2KSSA 2RJDA 4FIBA 3UF4A 2COYA 2QTVA 1K76A 1JJ2A 2CJMB 4CFUD 5KCOA 2PUOB 4C8QA 5GAN3 3JB9I 1GL5A 3LGLA 4A53A 4J6XA 2QYZA 4E7HA 2Y90A 3CC4T 4CI0C 3CMET 1G8XA 1T3SA 4RG2A 2BE9B 2OAWA 3J7AF 4Y92A 2FZKB 2OI3A 3META 1HXDA 3PFSA 1X27A 4M4ZA 4DA4A 4FYWB 2SEMA 4EOSB 5GANj 4EOOB 2JM8A 3CMAQ 3SEMA 2DBKA 4C8QC 3JB9G 4CC4B 3GTMS 2D8HA 2HBWA 1VQ7Q 4YTLA 4RMOA 2BZYA 3EGDA 4M78A 1P92A 1D3BA 2RQTA 2WMBB 4OMQA 1KK7A 3DKMA 1FVVB 2DD5B 1VQ9Q 1GUXB 1IGQA 3QZ9B 4LN2A 3TU4K 1VQ7A 2CZ6B 2X51A 3A8MB 1KSWA 4M7AF 3EGUA 5L2WB 5FGKB 2QASA 2BS4A 3M0SA 3E9FA 3VU3C 3CCLA 3M4YA 1KQSA 2BKDN 2F69A 5GANd 4A4HA 4F70B 4PLLA 1N8RC 2A0FB 3FDRA 3CCQT 4QKUA 4OGRB 4ZN1A 2RB6A 3NTHA 1GBRA 3H0IA 2HSPA 5D7UA 2E3HA 2GQVA 2LCLA 2SRCA 1KC8R 2HQEA 4LD9K 4BY6B 2K7AA 1MNEA 2CSIA 2B9RA 2NUZA 1TWBA 2EUFA 1WHHA 2CGHA 3OMCA 1M9SA 3MEWA 3INZA 3T9NA 2QQ8A 5L23A 3OYKA 4XTVA 3TW7A 3JB9H 2DA9A 3VS5A 2K2VA 2RI2A 4MZMA 2PVDB 4HVWA 5CO7A 4XK8E 3OSSC 1BI1A 2K3BA 5GAN6 5I22A 1E9HB 3G71A 5GANh 1UNHD 3QWLA 2EWNA 1I8FA 1MUZA 1MMGA 2YRCA 8AT1B 2MPXC 2RJCA 2O9SA 4E6RA 1WJSA 3EGDB 4M78B 5FW9A 4M7AD 2COZA 2AZSA 3L2QA 2HDAA 1AT1B 1MMNA 1YNZA 3QZ5B 2FL7A 4LDVA 3PIOA 2E5QA 2GF7A 4C8QE 2QEXQ 3X24B 1EIFA 3EGXA 3CCRT 3M55A 1VQ8T 2OAUA 2HKQB 2E5KA 4GBQA 1G3WA 4EOQB 2KXDA 2QFZA 4NS5A 3CCEA 3QUIA 2C06A 1BB9A 5CKHA 3MJXA 4FM4B 2DL4A 2B86A 1YJNQ 2LJ1A 2QEXA 2DBMA 4BCIB 1KXUA 2FB7A 4M7DD 3TQ7P 4JX6A 2XU8A 1GFCA 1OEBA 4M78E 4V2SA 3SDZA 2ZAEA 1FMKA 2I40B 1UGVA 1QKXA 3OYEA 2V1QA 2E65A 2GTJA 4G6LB 2YDLA 3I9QA 3IQLA 2FZCB 2LT4A 4D8DA 4J6YA 4II1A 4F6UB 4IKFA 1LJOA 2OTLA 1D0YA 3CCMT 2D1XA 1BI0A 4F7UA 4HCCA 3P8DA 2XHCA 4N0AC 2DLPA 3QHWB 3SHWA 4M7AC 1ENWA 2IVWA 1BK2A 4F7JB 2L0AA 4EORB 4M7DA 3L2RA 2QQRA 4QQ6A 4NSTB 1U5SA 2EKHA 4BCOB 4ELZC 1ABQA 4FU6A 2QQ9A 4BCFB 4EOIB 5DY9A 1VOMA 3ZL7C 3OY9A 2D0QB 2LQ8A 3V7RA 2PTKA 4BE2A 3RKXA 3B57A 3CCJQ 4M7DC 2BE7D 3I35A 5D6WA 2ABLA 3TN8B 1X6OA 3CCUT 5HVYB 4EMKB 2D6FA 4MIMA 2AKKA 4JJCA 1RAGB 3CCJA 4XU2A 2P4RA 3H41A 1HSQA 3SB2A 1M1KC 2WHBB 3A98A 4P5NA 3C95A 2YLBA 2G77A 1PKTA 4FYYB 2HMAA 1VQNA 1KD1R 3CC7T 4R56A 3DB4A 2A7YA 3PIPA 1LPLA 4BDZA 3CD6A 3OQ5A 3QWXX 3QYHB 1U1SA 3NPFA 4DOWA 1H641 4RCCA 1QVGS 3MI9B 4ME7A 4F14A 3HFOA 3LH5A 3PMIA 5AYFA 4IMYB 2EQMA 3HSBA 1WXBA 2MIOA 1ZQ1A 3JRZA 5KE3A 5D6YA 3OYBA 2IVXA 1QVFA 2K2MA 4DBFA 3LWHA 1M8VA 4DBHA 2RO0A 2LW4A 4JZ4A 2IW9B 5GAMf 4L59A 2OTJT 3UPUA 4BCHB 2KXCA 4AKHA 4EIKA 4JX4A 4TTHA 1VQMQ 2E10A 3EOCB 2E3IA 4LDYA 4BUGA 1YIJQ 3MP6A 2FEIA 4F7UE 1N9SA 2KT1A 5KYXB 4EOJB 2RQUA 4A4GA 5LJ5g 5LMKB 3MKDA 2A37A 2R5MA 2XMFA 2XD0A 2O4XB 1H27B 2ZPGB 2X3WD 1RLPC 1VYTA 3EIDB 2RF0A 4M7DE 5IXBA 2FO0A 2W99A 1M1FA 2CP3A 4JRIA 3DOGB 3JCMb 1M1KU 5IDPB 1RADB 1JKWA 2P0QA 3VS1A 1T3LA 1IO6A 3CCVQ 1X01A 4HCKA 1NG2A 1YBYA 5KYNA 2DXBA 2PMIB 1O9SA 3M0UA 2LCCA 4BXXX 3QWYA 3VKIA 3CPWP 3L2WA 1V1CA 4ZTJA 1KJWA 1I4K1 3RMQA 1VUBA 2CREA 1ACMB 2L89A 1KQSS 5HKCA 3CCVA 4MFEA 1SF9A 3TW6A 2KYMA 2VWFA 2CH4A 5D6XA 3FJPA 3HB9A 1PNJA 2I53A 2M0YA 2EW3A 2P4TA 4PJOB 4FW2A 4M75A 1GH6B 1I07A 4F6WB 1VQ5Q 3M57A 5DM7R 3MCAB 5IHYA 4N4HA 2BKZB 5A0GA 1K4US 1H28B 3G4ST 3JCMX 1A0NB 3HKSA 2L3SA 4GLKA 4HNTA 3HL8A 4PFZA 2I2LA 1OZ2A 5CQYA 1GFDA 1LVKA 2DK3A 5LJ3g 4IIOA 1E6HA 1Q7YC 1RAEB 1WJRA 3JV3A 1TOVA 4PLIA 2X3XD 3OBWA 2CYZB 1RAAB 3H0FA 4OGCA 3CXCP 3HP9A 3M0TA 3BE3A 2JN0A 3CBOA 1JSTB 1GRIA 1ZUYA 2EYXA 3U23A 3CCST 4C5GA 4OGEA 2GTOA 2M16A 2HCKA 2KVQG 4OMLA 1PD0A 4F16A 5GMKj 4J7FA 3I55T 4AFQC 3CPFA 5KYYB 2DKGA 2ZPEB 2HKNA 3OYLA 4QVZA 3H6ZA 1HYOA 4MZTA 1YHQQ 3RGFB 2LQNA 3CC4A 3CMEA 1WGSA 2DXBB 1H8KA 3DB3A 4LDUA 1OGUB 1IB8A 3MPUB 4IUVA 2QF7A 2W9ZA 2EIFA 3BLRB 1H26B 2EJ9A 5DLOA 4C92D 1TFBA 1S1NA 3ER0A 2R58A 2COWA 1H24B 3M0PA 1QCNA 5C0MA 1XO2A 4Z6YA 3BG5A 2FRWA 2KEAA 4Z02A 3JCMg 5FU6C 4DEYA 5LJ5e 1QLBA 2KROA 3C94A 1Y7XA 4YOSA 1WHLA 2VGNA 1VIEA 3HRTA 1YI2Q 4PJLA 2X4YA 2K3YA 1X75C 2W10A 5CQXA 1I5LA 4XTXA 1IZ6A 4EPCA 2L2PA 4LNPA 5IN1A 3SFMA 1KHIA 1Q7YU 1AZEA 1YITT 3H4CA 2JMAA 4RTXA 4M77G 3CC2T 1MMDA 1OL2B 3C4SA 1LCKA 2P0KA 4EDUA 1GBQA 2UUEB 3H0HA 1K9MR 5CEIB 4BI3A 4BCND 3CCQA 4YOZA 4AKIA 4Y28E 4M75E 5GAN7 2EJFA 1Q82R 2KRMA 1X2QA 4JLGA 1VA7A 2L8DA 2LX7A 4C5IA 4BE1A 4QT7A 4D6WA 1BCMA 3JB9F 2RQWA 2DIQA 5ICPB 1R0BG 2DZCA 4RTZA 1D0XA 3DLLA 1M90U 5KH6A 1UJ0A 5FLXE 2E1HA 2F2XA 3JB9J 2JZ2A 1N5ZA 1AWJA 2KK4A 4C92C 4BI8B 4MMKA 2RMOA 3LYIA 4CFVB 5EG2A 4JPBW 4QQGA 1RAHB 1Y07A 2OX7A 4PL6A 1H3ZA 3KHIA 2KY9A 4ZN3A 4R55A 1HJDA 1YN8A 2WACA 4AG2C 4X9DA 1VQ6Q 5AT1B 2AK5A 1FMWA 4MDXA 4M77B 1UGSB 2CP6A 2EFIA 4A63B 1M27C 2HSEB 3LWIA 4KUIA 3OYCA 4CRLB 1ZP2A 4KT0E 4AMCA 1RAFB 2QA4Q 3CCRA 4E7IA 4E7LA 4HVUA 4QVDA 1VQ8A 2DXCA 3FLGA 5GMKe 3MEAA 4Y72B 3QXEB 3G6ET 1UTIA 1SKUB 1S72Q 2YXYA 2Y4YA 5KYUA 1NJIC 2RM4A 2LNHB 2DXUA 1OPLA 3HO8A 1U1TA 3BG3A 1WJQA 5GMKl 5HNBB 3QYBA 2HQHA 2WEVB 3JCMe 4J9CA 4JJNK 1QVGA 3HRUA 2MWOA 4KULA 2G9XB 4BCJB 4K11A 2JMCA 4ZGDB 3ZFJA 1VQ4T 1UDLA 2RHUA 4IUPA 2IIMA 4R0KA 2G6FX 2CP2A 4BCMB 5IHNA 3CCMA 3EFRA 1BKBA 3O8VA 1B34A 2NUPB 1ZBJA 2JW4A 3BDUA 1DJ7B 3RERA 3EHRA 2VVKA 2DPPB 1BCOA 1QKWA 1VQKT 3ZBDA 3CBPA 2JTMA 4RKUE 4GY5A 1VINA 4DEXA 4DQ2A 2ZPHB 4N4IA 3OYIA 3M53A 2L3PA 2ESWA 1M5Q1 3SWNC 2DMEA 2CZ7B 1G3TA 4BCQD 1PG5B 1NE8A 3RIRA 2LP5A 4ZNXA 4HNVA 1ZUUA 2RPNA 1ZHIA 4C8QG 3CCLQ 2DXCB 3CCUA 2W2HA 5I11A 6AT1B 4EMGA 3AHUA 4YOOA 3NTKA 1NJIU 2C6TB 2RA2A 2CCHB 2E6NA 3OS1A 3QHRB 4XTUA 1RL2A 1QMZB 2MAMA 2LQWA 1ZSGA 3X26B 3GOXA 2EKOA 5A2QE 3OA6A 2RJFA 4RUGA 3CC7A 3RKWA 1K73R 2CT3A 4M78G 3JCMJ 2GNCA 1W2BP 3EHQA 3DTOA 3OYNA 5HBEB 1RABB 2QQBA 3EJ1B 4PJNA 2WIPB 2BIVA 2M51A 1K8AU 2XDBA 5DQVA 3WVEB 4FT2A 3E19A 1ZLMA 1RAIB 1UNGD 4LUDA 4J9EA 1RI0A 2PVOB 2CP7A 3H8ZA 1GY3B 1AHJB 2FRYA 1X6BA 4X34A 4A54A 1NPPA 4ROEA 2MI6A 1M30A 2X35A 1B34B 3QO3A 3L2ZA 4BCGB 3JCMW 2E6ZA 5GANf 4C8QB 1PD1A 3M0RA 1VIFA 4RTTA 3G71Q 1YJWT 2H3EB 1G3SA 2IW8B 2ROLA 1W6XA 4OMMA 5IXFA 4JZ3A 1KQ1A 1AVZC 2VB6A 2OTJA 4BB7A 5GAOq 3RBBB 3KXTA 3QYGB 1QCFA 3CPWS 4Z88A 2KI7A 2D8JA 3RMSA 4QSHA 4UN0A 1AOJA 2DRKA 3CCEQ 1D3BB 4MDWA 2XG8D 2E12A 3A8GB 3V7SA 5EC7A 1WHGA 3OYGA 4XTWA 3QBYA 2KAFA 2M0OA 5CK9A 1G5VA 2UZEB 3A8OB 2CT4A 2RNAA 1M3BA 1UUEA 2RJEA 4JRKA 3M59A 4O5VA 2W0ZA 3JCMQ 2LNVA 3L2VA 3VJPA 4QQDA 5CVIA 2O88A 2M02A 3TSZA 4KRDB 4LDXA 2WIHB 1N6AA 4J9FA 2B8AA 2IPOB 4J5YA 3I56T 2ZPIB 1PWTA 1N8RU 4JJBA 3UA6A 1VQPT 1W2BA 3NFCA 2CCIB 5KE2A 4RCBA 4ATOA 1M2OA 2EGEA 4RTVA 2OTLQ 4N0AA 2JS0A 1AWOA 1OQKA 3BHVB 4CC2A 3CXCS 2DIGA 4M7AA 2V8IA 4PJOF 1M2VA 2DRMA 3FB9A 2YUNA 4EC8B 1J3TA 1IXDA 4E7SA 3ASKA 2F1LA 1AD5A 3BW1A 4BCKB 4A4FA 3G4SA 2O2OA 3A8LB 1WXUA 2EQJA 4E7ZA 2CS7A 4MFDA 1PC0A 3VKGA 5LQFB 4PJMA 2K4YA 4ELYC 1UGRB 3CEYA 3QDFA 2V8KA 4AI6A 4LOCA 2MK5A 2FPDA 3BHUB 2DNUA 2ROTA 2QDYB 2C0OA 1KFZA 5I2MA 1VQOT 1BI3A 2P0PA 4RTYA 4F7UG 3R6NA 5GMKm 1VQLT 3N5BB 2E64A 3MP1A 4F7SB 3EGXB 3L42A 4JUVA 3J80E 1D1AA 4EOKB 2YUOA 1Q86C 3I55A 3REBB 1VQNQ 4M7DG 3QKJA 2LCSA 5CYIB 2NWMA 3CD6Q 4ROCA 1TUGB 3V7CA 1M1GA 3FIFA 1CKBA 3OW2P 3TVTA 2EGCA 2BZXA 3CMAT 3OB9A 5GAMg 4Q5WA 1M1KR 2MCNA 1JO8A 3FEOA 2LQKA 1WHKA 3FRNA 4JDSA 1O75A 2AKLA 2F5TX 1SSFA 3OYYA 2QGGA 3OYJA 3UT1A 2A3LA 1SHFA 4BACA 1CKAA 2EBPA 4LUEA 2RN8A 1FKMA 1VQ9T 2BTTA 4CFWB 2DD4A 4LD6A 2DJQA 4HL4A 2MOXA 1ABOA 4F7UB 2MMPA 3HRSA 2CZ0B 1TD6A 1BIBA 4E7JA 4X9CA 2EQKA 3NTIA 2EJGA 3F5XB 2W96A 4KGZB 3PGGA 1YITA 2CSQA 1MMAA 2MF2A 1Q81R 5CKBA 4M7DB 1IREB 1M3AA 2RHYA 2NYSA 2ED1A 2CH4W 2KNBB 1QLYA 3CC2A 1UHFA 5GAOl 3F70A 2O9VA 4M7AE 2O01E 2WFYB 2XDDA 1UJYA 4E7KA 1FX7A 2QTXA 2DVEA 4O6JA 4E47A 1D1CA 4PJOG 3P8HA 2KMTA 2M9UA 3MO8A 2GFUA 4XTYA 5LJ5j 2DEQA 2BS3A 4JX5A 1Q86U 3G7ZA 2XK0A 1EZZB 3THKA 3PO3S 5FRMA 1WYXA 1D3UB 2Y4XA 2LJ3A 3KUFA 2WJ9A 3PE0A 1OU8A 4HT9A 2KYBA 2AZVA 1XJWB 2ZZDA 1BBZA 3RR6A 2EGAA 2K5FA 2KE9A 2K3XA 3BLHB 2FYKA 3C0CA 4IIMA 1R0CB 5LL6S 1HD3A 3M03A 5IH2A 5LJ5d 2KRNA 1W98B 5HQ0B 4HT8A 4M77F 1G83A 2DMOA 3J81E 1IGUA 2MWPA 4AKGA 2CP5A 3HTRA 1WI7A 2P84A 3JAME 4YC3B 3O5ZA 2QEXT 1KQ2A 1OV3A 3FJ5A 1EX4A 3MEUA 4FYVB 2XI9A 4J9DA 3UDCA 1WDXA 3G6EA 1JBMA 3HZJA 1YJNT 5LJ3j 1BI2A 4FW1A 2WSCE 1X43A 1JEGA 1OL1B 1N4MA 4C0DC 4CFNB 2RHXA 5CKFA 4KGVB 1OZ3A 1ZBXA 5IDNB 4XU1A 2J6KA 2PVGB 2FVUA 4C5EA 4M75G 2RI5A 2HL3A 3MY5B 4RG8A 4EMHA 1NLPC 1VQ4A 5CR2A 5LJ5h 2KMGA 2QG9B 1I1JA 2CUDA 1PCXA 2QI2A 4II5B 3CC4Q 1SHGA 3CMEQ 1M3CA 4MZPA 4PK4A 1KG1A 5LJ3d 2C5VB 4A4EA 1OKWB 1EFNA 4VUBA 2Z0WA 3NMZC 3OYMA 4M77D 1UFFA 3EG2A 3VYHB 1IRXA 1M90R 1K0SA 1AD6A 2BUDA 2G3RA 3CPWA 5FU7C 1OPKA 3OYAA 4MMLA 1VQKA 1W1FA 1QQJA 2IG0A 5HK3A 1AISB 4NOYA 1WZOA 4I3ZB 1NYFA 1ZA1B 1R77A 3LX7A 1GCPA 2HZYA 1NM7A 3EG1A 1W2BS 4BBSM 3OYDA 2DE0X 4ELLA 3EAEA 1UEBA 4M75B 1SG5A 1FMVA 3REAB 1KHCA 2WXVB 1Y96A 1JRIA 1NPRA 1QMCA 2V1RA 3VS3A 4KRTA 4ESRA 1MGQA 3RUXA 4BI4A 5LJ3h 3CCQQ 2J6OA 2L5QA 5KCHA 2JTFA 4E2FB 2FHDA 3JCMd 1WQ7A 3CBMA 3CXCA 1AWWA 2EPDA 1D09B 2DJZA 1P5EB 1D1BA 1UHCA 2EYYA 2EYZA 4M77C 4C92A 1ZSZC 2E4HA 2DYIA 2NUTA 2D9TA 1K9AA 1GXIE 3R6OA 1H1SB 3X20B 3MEVA 1WQWA 2RK1A 1H25B 5GMKh 4X1VA 2C0IA 3D7SB 4C8QF 2QK0A 4F6SB 2WSFE 2K6DA 2ECZA 1YJWA 1ARKA 5LJ3e 2DYBA 1WHJA 2KDSA 5FU6B 1VQMT 3RDVA 1H1QB 3BY7A 4HA8A 1NLOC 3EG9A 4KRCB 3P8BB 1YIJT 2DTIA 3CCRQ 3JCMh 1VQ8Q 3LGFA 1H1PB 2DL7A 5CKDA 1G3YA 1YJ9T 4M78F 1WHMA 4KH1B 1JJ2P 5GAOm 1NBEB 2A36A 4Z8AA 1XTDA 3BFMA 2IN3A 3JCMV 1BU1A 2J7IA 5CCAA 1U3OA 1Y96B 3M58A 1XQHA 4AFSC 1OULA 3RNJA 3PVQA 1GCQA 5FRNA 5A0DA 2DM1A 1RUWA 3CCVT 4ELJA 5KYWA 1WXTA 4AT1B 1CSKA 1PM3A 3I56A 1VQPA 3JB9D 4JJDA 3TSWA 4RODA 1GCQC 2PJQA 2CUBA 4C92B 5FWBA 4PJJA 4AFZC 2YRDA 3CCMQ 3OS2A 2NUTB 1M8MA 1RLQC 2PQWA 1VQ5T 2RD1A 4C0FA 5J26A 1F1BB 2CP0A 1OIUB 2K5IA 1K8AR 2DZ9A 4EOLB 4C0ZA 5DQWA 4XU0A 3SWNA 3QHSA 4HLQA 1QP3A 5IT9E 3E9GA 1I5OB 4KGXB 1C9BA 4M78D 2HBPA 4C92E 1SPKA 2J06A 2JOYA 1B07A 3OW2S 3EG3A 3M56A 3EG9B 4BCNB 1MNDA 4BBRM 1YCSB 3CCUQ 1QW1A 4XU3A 1QWFA 2RHIA 4ANJA 1VQOA 3LLRA 2FPEA 1OKVB 2PK9B 2YUQA 5FROA 2K57A 2HQXA 1VQLA 5GAN2 2LX9A 2WPAB 1OI1A 2QXFA 4BY6C 5GAOr 1YHQT 4OP0A 1PKSA 3CC7Q 3HFNA 5GJWB 4KUDK 5EJCA 4EC9B 5KYWB 4OMNA 5KYUB 3A5ZB 4KBMB 4QW2A 5GANg 4XQ3A 4J8OA 4LE9A 3HHTB 2ZPFB 1I0CA 4IUUA 2QQAA 1UE9A 3GNFB 3CMAA 1LNXA 3OSVA 4J6WA 3VS4A 3PMTA 1UECA 1ZA2B 2RH2A 4OB3B 3GP8A 2UZDB 1N8RR 3X28B 3LW5E 4M78C 2L3RA 3VUZA 4IUQA 1IHVA 1B3QA 1VQ9A 3VS6A 1JQQA 1YI2T 1K73C 1G3NC 3O0GD 1OOTA 2QAZA 2DVJA 3MP8A 4PNOA 4F7UF 2W9FA 4DBQA 3OYFA 2OTJQ 3VYGA 4UC4A 1D0ZA 2WMAB 3SWNB 4PFPA 3JCMP 2H3JA 2DTHA 4OMPA 5EFQB 2C5OB 2C5XB 1KC8C 4M7DF 1R8OB 4PFOA 2PHGA 1QP2A 2LMJA 2VYTA 4AFUC 3ZEHA 3SD4A 3V8LA 1JB0E 2PZ1A 4A4KA 1RI9A 1E6GA 5GAN4 2R7GA 2CDTA 1TUCA 2JUFA 5IHIA 4CFUB 3AT1B 2CZ1B 3M54A 4HKEA 2KR3A 5A0LA 1BIAA 2MYSA 2HEQA 2BPMB 3JCMc 3TNHB 3DDPB 2C4GB 1VQ6T 3EH1A 2DX1A 4BE0A 4EMKA 1FWZA 1B7TA 3UA7A 4BCQB 1V29B 1PSFA 1TG0A 5HY6A 1AZGB 3EG0A 5IHKA 1K73U 1W70A 3G4SQ 1C0MA 1QWEA 1JU5C 2HNIA 4OVAA 4QVCA 2KQWA 2QA4T 4EONB 2D0NA 2F2VA 2F2CA 2O31A 2GQIA 2X4WA 4EMKC 1S72T 1M4ZA 3VYGB 1C6VX 1TUDA 1YJNA 5GANe 2EVRA 1KC8U 3S6WA 3NGPA 5IF1B 3GF5A 3VS7A 4F17A 1H4LD 2DAQA 3KFVA 1V76A 3V8JA 2VKNA 4F7LB 2E41A 1U8RA 2C0TA 4BCPB 2ZCFB 2JTEA 1T0HA 2YT6A 2YHTA 3CCSQ 2DEUA 2VASA 4M7AG 4RTWA 1H1RB 3L1AA 1WPYA 3A1PA 5I21A 4B6MA 2E70A 2JNGA 3PNWC 3GLXA 3I55Q 1TH7A 1UGQB 3VKHA 1UB4A 5HBHB 3CCSA 3MY1B 3VS0A 2GFAA 3JSCA 4OR5B 2J05A 1QVFP 9ATCB 4M6VA 4ZTFA 1VYUA 1X6GA 5HK0A 4B9XA 1H3HA 1Q86R 2EYQA 4XTZA 5GAMj 1I81A 2LDMA 5GAOn 5KYXA 3DLMA 4PJOD 2YLCA 1OYXA 4L6V5 3WVDB 1AWXA 1BU2A 1NEBA 1UGPB 3HBLA 1PHTA 1PSEA 4J9BA 2O4XA 3UATA 1VQ7T 2YRVA 2DETA 1YP5A 3ME9A 4FSSA 4M7AB 5GJVB 1KD1C 1M2VB 3CCLT 2VXEA 2JGZB 2V8JA 4M75F 1O9KA 3NHNA 3M9QA 1ZUKA 4JS5A 4NL2A 1YITQ 3WXMB 2XICA 1X69A 1AEYA 1IHWA 2DL5A 1FINB 1TSFA 3QYEA 3BDLA 2WSEE 3CC2Q 5GAMd 4ZGEB 2ZGWA 1X2KA 2LT1A 4WTOB 4IURA 2PU9B 3KBGA 2LC4A 3VS2A 1YCYA 5I5ZB 3BHTB 3OMGA 4PJOA 4FCYA 5HBJB 4KH0B 2VV5A 2EYWA 4ZGJB 3A8HB 3Q1JA 2RQRA 2X4XA 1WA7A 2DXTA 1Q81C 4CFXB 3VRYA 1PRMC 4CXAB 1VOLA 4J9HA 1VYVA 3OS0A 2LRQA 1JJ2S 4PJOC 2A08A 1T0JA 1W4SA 3QIIA 2DL8A 2RQVA 2PUKB 4JRPA 4RTUA 3S3NA 5L8RE 4DBRA 4IUTA 2IW6B 2HAXA 3G71T 3G33B 2RK2A 4OMFB 4N4GA 1MHNA 3PTAA 3OW2A 3MHXA 3EFOA 5HCKA 2FG0A 4FYXB 3M5AA 5GAMh 4NL3A 1YJ9Q 1VQMA 4EOMB 4JS4A 3RKYA 3EH2A 2VC8A 4M75D 1U06A 3TNIB 2PNIA 2ZPBB 2JS2A 4LXCA 2OJ2A 1QCOA 1FYNA 1JXOA 4FL6A 1YIJA 1PKDB 3CCET 3K7AM 1PRLC 5KYYA 3TEEA 2C5NB 5GAN5 1KD1U 2LTOA 3X25B 2XIDA 1RACB 3S3OA 1YJ9A 3G6EQ 5CAIA 2XDPA 2EAYA 1YFNA 1SRLA 1O9KB 2DD4B 3DDQB 1BYMA 4J9GA 2KR6A 2L3QA 3M4GA 1JSUB 3BG9A 3PVLA 1MV0B 1QVPA 4F04B 1SEMA 1TU0B 2YUPA 1WX6A 2K9GA 4CC3A 2ATCB 2HD0A 5LJ5f 1LOJA 1K0XA 1F5QB 5GAMe 2J6FA 2KBTA 1VQ4Q 2DTOA 2BZ8A 1G2BA 1TTHB 4OF1A 4Y91A 2OTLT 3FC3A 1Q81U 2LJ0A 1Q7YR 4C92F 2KGTA 2QDJA 2QDLA 2V26A 5ECAA 3QDRB 2DO3A 1VQ5A 4M75C 1NYGA 4FSXA 2VGMA 1HK9A 4BY7X 2UZLB 2YWWA 1NEGA 3GPLA 2GCXA 4C0GA 2GBQA 1VQKQ 7AT1B 4PJOE 3C12A 3EFOB 3DJBA 2RHZA 2CKKA 1SRMA 2ZZDB 3UWNA 2M1HA 4CC7A 2EQUA 1YWOA 1E7PA 4BD3A 2AHJB 5M9OA 1M90C 4AG1C 4OMOA 3CCJT 4J83A 5CIUA 4HCZA 3OBYA 2ED0A 5LJ3f 4TVRA 3LH0A 2K5LA 1MV3A 4C0DB 4B9WA 3LQ5B 1VQNT 2R5AA 3ULRB 4HCBA 3L2UA 1H92A 1C1AA 1YHQA 4HNUA 3CD6T 3RESA 5C6SA 3QJYA 4NC6A 2PK2A 4M77A 1URCB 4DOVA 1ZSZA 3EFSA 4LDWA 1JOWA 1Z9ZA 5J39A 3NDQA 4HVVA 1N27A 2UZBB 3TREA 4J7IA 4EOPB 3V8KA 2AIRB 3PT9A 4BCMD 2LVMA 1Y71A 1K1ZA 1OX9A 5BNJB 2GGRA 2X1NB 5FU7B 1YI2A 1YJWQ 2JT4A 2VUBA 3VUBA 1K9MC 4D8KA 3VV0A 4GLMA 3BLQB 1N9RA 2AT1B 1Q95G 4F7NB 1WLPB 4WF2A 1Q82C 4HXJA 3H9NA 1OI9B 2YSQA 5GAN8 1YWPA 3TCJA 3HPWA 3QJ6A 2VXFA 3JCMf 3GNGA 3DL1A 4OB1B 3QG1A 3QPHA 3POMA 3E2UA 2KRSA 3OYHA 5FWCA 4FX3B 1QVGP 3QSUA 2HL5C 4C92G 1UG1A 4BY1X 1OU9A 2F2WA 2XKOC 1SSHA 1XNIA 4CFMB 2FPFA 2NUPA 1KIKA 2NLUA 4J9IA 4BDYA 1WIEA 4OB0B 2QQSA 4FT4A 2JVVA 1TS9A 2X4JA 5CKEA 3OS5A 1XOVA 1Y0MA 3TNWB 3I56Q 1Y57A 3VRZA 2X9HA 1UNLD 8ATCB 1VQPQ 1FXXA 2QGFB 3URGA 2JXBA 5GAOp 4Z89A 2EQIA 3GBQA 1ZSZB 5GMKi 2K79A 5IAYA 2ENMA 2DILA 3S3MA 2QGSA 1NJIR 1VQ6A 2DERA 5J3BA 2DD5A 2RI3A 4WCIA 2R57A 3M0QA 1GUXA 2JM9A 3MIAB 1TXQA 5DLQE 4C8QD 2LZ6B 4ORZA 1NZ9A 2DF6A 2I0NA 1K9MU 2KT8A 2A28A 2QA4A 4OB2B 4XAXB 1WNLA 3GIBA 2DFUA 1Q82U 1E7OA 3CQTA 1Z9QA 2H8HA 1OX8A 4M77E 1VYWB 5I2SA 1S72A 4CRIA 1QVFS
chains in the Genus database with same CATH topology
4LDUA 2MF2A 4M7DB 4JLIA 4IUVA 5CKBA 2QF7A 1IREB 1BIAA 2EIFA 1KD1U 2RHYA 3CD6T 2EJ9A 3E1SA 5DLOA 3CC2A 4PKCC 3JCMc 5GAOl 3F70A 4JRQA 2F5KA 4M7AE 1VQ6T 2O01E 4C92D 3ER0A 2XDDA 2R58A 4E7KA 1FX7A 5C0MA 2QTXA 4L5GA 2DVEA 4O6JA 4E47A 4PJOG 4Z6YA 3BG5A 3JCMg 4Z02A 3P8HA 4C5HA 5FU6C 5LJ5e 2KMTA 2M9UA 3MO8A 4EMKA 2BS2A 4BE0A 1FWZA 1QLBA 2GFUA 4XTYA 2KSSA 3C94A 1Y7XA 5LJ5j 2RJDA 1V29B 4FIBA 1PSFA 2DEQA 2BS3A 5HY6A 2VGNA 1JJ2A 1VIEA 4JX5A 3HRTA 1K73U 5KCOA 2X4YA 2HNIA 4OVAA 2PUOB 3G7ZA 2KQWA 2XK0A 4C8QA 4QVCA 2K3YA 5GAN3 1X75C 5CQXA 3JB9I 2QA4T 1I5LA 4XTXA 3LGLA 4A53A 4J6XA 4E7HA 1IZ6A 4EPCA 2Y90A 3CC4T 5FRMA 4CI0C 5IN1A 3CMET 3SFMA 2Y4XA 1KHIA 4RG2A 2X4WA 2WJ9A 3KUFA 4EMKC 1S72T 1M4ZA 1Q7YU 1YITT 3J7AF 4HT9A 3H4CA 3VYGB 1YJNA 5GANe 3META 1HXDA 1KC8U 3PFSA 3S6WA 2ZZDA 3GF5A 4DA4A 4M77G 4LD9K 3CC2T 5GANj 2K5FA 4C8QC 2DAQA 3JB9G 3C4SA 2P0KA 4EDUA 3V8JA 2K3XA 4BI3A 2FYKA 2E41A 3CCQA 1U8RA 4Y28E 4AKIA 2ZCFB 4YTLA 4RMOA 5LL6S 4M75E 5GAN7 2YHTA 2EJFA 1P92A 4M78A 1D3BA 2XDBA 5LJ5d 4JLGA 4HT8A 4M77F 2L8DA 4M7AG 4C5IA 4BE1A 3J81E 3DKMA 2MWPA 2DD5B 3L1AA 4AKGA 1WPYA 4D6WA 5I21A 3JB9F 2DIQA 2E70A 2JNGA 3PNWC 3GLXA 3JAME 2DZCA 2QEXT 3QZ9B 3DLLA 3TU4K 1VQ7A 1M90U 1TH7A 2CZ6B 1UGQB 5KH6A 3A8MB 3VKHA 1KQ2A 5FLXE 1UB4A 3CCSA 2E1HA 3JB9J 3MEUA 2JZ2A 2KK4A 4M7AF 4C92C 2XI9A 4BI8B 3UDCA 2GFAA 3JSCA 2BS4A 3VU3C 3E9FA 3G6EA 3CCLA 3M4YA 4MMKA 1JBMA 3HZJA 1YJNT 3LYIA 1KQSA 5EG2A 4M6VA 4QQGA 2BKDN 2F69A 5GANd 4ZTFA 5LJ3j 4A4HA 1Y07A 1BI2A 5HK0A 4PLLA 4PL6A 4B9XA 2WSCE 1H3ZA 1N8RC 3KHIA 2KY9A 4ZN3A 4R55A 2EYQA 3FDRA 3CCQT 4C0DC 2WACA 2RHXA 5CKFA 4X9DA 4XTZA 5GAMj 1I81A 1OZ3A 2LDMA 5GAOn 4ZN1A 1ZBXA 2RB6A 3DLMA 3NTHA 4XU1A 4MDXA 4M77B 4PJOD 1UGSB 2EFIA 2PVGB 2YLCA 1OYXA 4L6V5 3WVDB 2FVUA 4C5EA 4M75G 2RI5A 1UGPB 3HBLA 1PSEA 2GQVA 2LCLA 2O4XA 2HQEA 4RG8A 4EMHA 1VQ7T 2YRVA 4BY6B 3LWIA 1VQ4A 4KUIA 5CR2A 3OYCA 5LJ5h 2KMGA 4KT0E 3ME9A 3CCRA 4E7IA 4E7LA 2QI2A 4QVDA 1VQ8A 4M7AB 2DXCA 3FLGA 5GMKe 1KD1C 3MEAA 2CGHA 3OMCA 1M9SA 3MEWA 3QXEB 2VXEA 3INZA 2V8JA 4M75F 2QQ8A 3T9NA 3G6ET 3CCLT 3M9QA 4MZPA 1KG1A 3OYKA 4JS5A 5LJ3d 4NL2A 4XTVA 3WXMB 4A4EA 2Y4YA 3TW7A 2XICA 3JB9H 1NJIC 2RM4A 2K2VA 2DXUA 2RI2A 4MZMA 2PVDB 4VUBA 5CO7A 3QYEA 3BDLA 2WSEE 4M77D 3HO8A 3OSSC 4XK8E 1BI1A 3OYMA 3VYHB 5GAMd 5GAN6 4ZGEB 1U1TA 2BUDA 2G3RA 2ZGWA 3CPWA 3G71A 5FU7C 3OYAA 4MMLA 3BG3A 1VQKA 1WJQA 5GMKl 2LT1A 5GANh 3QWLA 2EWNA 4IURA 2IG0A 1I8FA 2PU9B 3QYBA 4NOYA 5HK3A 3KBGA 2LC4A 2RJCA 1WJSA 1YCYA 3JCMe 4JJNK 4M78B 1QVGA 3HRUA 2MWOA 3OMGA 4PJOA 4KULA 4M7AD 3L2QA 2VV5A 3LX7A 4LDVA 3PIOA 3QZ5B 4ZGDB 2FL7A 3ZFJA 1VQ4T 4ZGJB 2RHUA 2E5QA 4IUPA 3A8HB 2GF7A 3Q1JA 4C8QE 1W2BS 3X24B 1EIFA 4BBSM 3M55A 3CCRT 1VQ8T 3OYDA 2X4XA 2OAUA 2DXTA 1G3WA 1Q81C 2QFZA 3EAEA 4NS5A 3CCEA 1UEBA 4M75B 3QUIA 2C06A 5CKHA 3CCMA 1QVFS 3EFRA 2LRQA 4FM4B 3OS0A 1BKBA 1KHCA 3O8VA 1B34A 1JJ2S 4PJOC 1Y96A 3QIIA 1W4SA 2QEXA 1JRIA 1NPRA 2PUKB 3BDUA 4JRPA 1DJ7B 3S3NA 5L8RE 3RERA 2FB7A 4M7DD 4IUTA 1MGQA 2HAXA 2DPPB 3RUXA 3G71T 4JX6A 4BI4A 2RK2A 5LJ3h 2XU8A 4OMFB 1VQKT 4N4GA 3ZBDA 3CBPA 1MHNA 4M78E 2JTMA 2L5QA 4GY5A 4RKUE 5KCHA 3PTAA 3OW2A 3MHXA 4V2SA 2JTFA 3SDZA 4DQ2A 2ZPHB 2FHDA 4N4IA 3OYIA 3JCMd 3CCMT 3M5AA 3M53A 1WQ7A 5GAMh 4NL3A 1M5Q1 3CBMA 3SWNC 3CXCA 1VQMA 3OYEA 2DJZA 4JS4A 2CZ7B 3RKYA 1G3TA 2VC8A 4M75D 2ZPBB 1NE8A 2E65A 3RIRA 4HNVA 4M77C 4C92A 4FL6A 1YIJA 2LT4A 4J6YA 4II1A 3CCET 1LJOA 4IKFA 2OTLA 2D9TA 1ZHIA 1GXIE 3TEEA 3R6OA 4C8QG 1BI0A 4F7UA 2LTOA 5GAN5 3X20B 3X25B 2XIDA 3MEVA 3P8DA 3S3OA 1YJ9A 2DXCB 2XHCA 3CCUA 5CAIA 1WQWA 4N0AC 4EMGA 2XDPA 2EAYA 3AHUA 2RK1A 3NTKA 1NJIU 4M7AC 2IVWA 2DD4B 1BYMA 5GMKh 2RA2A 2KR6A 4M7DA 2E6NA 3M4GA 4C8QF 3OS1A 3L2RA 2QQRA 3BG9A 1RL2A 4QQ6A 4XTUA 2MAMA 2WSFE 4ELZC 1YJWA 3GOXA 3X26B 4FU6A 5LJ3e 1QVPA 2EKOA 2QQ9A 5DY9A 5A2QE 2RJFA 3OA6A 2KDSA 3OY9A 5FU6B 3CC7A 2D0QB 3RKWA 2LQ8A 1VQMT 3V7RA 2HD0A 4M78G 5LJ5f 4BE2A 1LOJA 5GAMe 3BY7A 3JCMJ 4HA8A 3RKXA 3OYNA 2DTOA 4M7DC 3P8BB 1YIJT 2DTIA 2QQBA 5D6WA 3JCMh 2BIVA 3LGFA 4OF1A 4Y91A 4FT2A 3WVEB 1K8AU 5CKDA 3E19A 3FC3A 1Q81U 2OTLT 1G3YA 4C92F 1RI0A 4M78F 1X6OA 2PVOB 3CCUT 1YJ9T 3H8ZA 2QDJA 4EMKB 5GAOm 1AHJB 2D6FA 4MIMA 4X34A 4A54A 1NPPA 1XTDA 2MI6A 3BFMA 3CCJA 3QDRB 3JCMV 2X35A 4XU2A 1B34B 2DO3A 1VQ5A 3QO3A 3L2ZA 5CCAA 4M75C 1Y96B 3M58A 4FSXA 1XQHA 2VGMA 1HK9A 3JCMW 2E6ZA 5GANf 4C8QB 3SB2A 3GPLA 2GCXA 1VIFA 1M1KC 1YJWT 4P5NA 4C0GA 5FRNA 5A0DA 3C95A 2YLBA 2G77A 3CCVT 1VQNA 1G3SA 4ELJA 3CC7T 4R56A 3DB4A 2A7YA 4PJOE 1KQ1A 3PIPA 2OTJA 3C12A 4BB7A 4BDZA 2RHZA 5GAOq 2CKKA 3OQ5A 3I56A 3CD6A 2ZZDB 3KXTA 1VQPA 3QYGB 3JB9D 3UWNA 3CPWS 2M1HA 3QYHB 2EQUA 3RMSA 4QSHA 1E7PA 1U1SA 4BD3A 4DOWA 1H641 4C92B 4RCCA 1QVGS 1D3BB 2AHJB 3OS2A 4MDWA 2XG8D 5M9OA 1M90C 2E12A 3A8GB 4ME7A 3V7SA 3CCJT 3HFOA 3PMIA 4J83A 5CIUA 4HCZA 5AYFA 3OYGA 2PQWA 4XTWA 3QBYA 2EQMA 2KAFA 2M0OA 2RD1A 3OBYA 4C0FA 5CK9A 1VQ5T 3A8OB 5LJ3f 1G5VA 4TVRA 5J26A 3HSBA 3LH0A 2RJEA 1ZQ1A 3JRZA 3M59A 4JRKA 4O5VA 5KE3A 5D6YA 2K5LA 2LNVA 3JCMQ 3OYBA 2K5IA 3L2VA 1QVFA 3VJPA 4C0DB 4B9WA 3LWHA 4QQDA 5CVIA 2DZ9A 1VQNT 2R5AA 4C0ZA 4HCBA 1M8VA 3L2UA 2RO0A 5GAMf 4L59A 4LDXA 4XU0A 3SWNA 3QHSA 1YHQA 1N6AA 2OTJT 4HNUA 4HLQA 2B8AA 1QP3A 3UPUA 3RESA 3E9GA 4J5YA 4AKHA 3I56T 2ZPIB 4JX4A 5C6SA 3QJYA 4NC6A 1VQPT 1N8RU 1W2BA 3NFCA 4M78D 4M77A 2E10A 2HBPA 5KE2A 4RCBA 4C92E 4DOVA 2JOYA 3EFSA 4LDYA 4BUGA 4ATOA 4LDWA 3OW2S 3M56A 3MP6A 5J39A 1N27A 4F7UE 4BBRM 4N0AA 1N9SA 3TREA 4J7IA 3CXCS 4A4GA 3V8KA 3PT9A 2DIGA 4M7AA 1QW1A 5LJ5g 4XU3A 2RHIA 2V8IA 4PJOF 2R5MA 2LVMA 1VQOA 3LLRA 1Y71A 2XD0A 2O4XB 2ZPGB 5FROA 3FB9A 1VQLA 2K57A 2HQXA 5GAN2 4M7DE 3ASKA 1M1FA 3BW1A 2LX9A 4JRIA 3JCMb 1OI1A 2QXFA 1M1KU 4BY6C 5GAOr 5FU7B 4A4FA 1YI2A 2P0QA 2VUBA 3VUBA 3G4SA 3A8LB 2EQJA 1K9MC 3VV0A 2CS7A 1YHQT 4OP0A 4MFDA 1X01A 4KUDK 3HFNA 3VKGA 1N9RA 1YBYA 5EJCA 4WF2A 2DXBA 1Q82C 5GAN8 1O9SA 4HCCA 2LCCA 3A5ZB 4KBMB 3TCJA 3VKIA 4QW2A 2K4YA 4ELYC 3L2WA 4ZTJA 1UGRB 3CEYA 3HPWA 3QJ6A 2VXFA 3JCMf 5GANg 4XQ3A 1I4K1 3GNGA 3DL1A 4OB1B 2V8KA 3QG1A 3QPHA 3RMQA 1VUBA 4AI6A 4J8OA 2L89A 4LOCA 3OYHA 1KQSS 5HKCA 3CCVA 3HHTB 2ZPFB 4MFEA 4IUUA 2QQAA 3TW6A 3GNFB 1LNXA 3CMAA 3QSUA 3OSVA 2QDYB 4J6WA 5D6XA 4C92G 3FJPA 3HB9A 3PMTA 2RH2A 5I2MA 2P4TA 2XKOC 1BI3A 2P0PA 1VQOT 4OB3B 4M75A 4F7UG 3GP8A 4PJOB 1XNIA 5GMKm 1VQLT 3X28B 3LW5E 3N5BB 2L3RA 4M78C 2E64A 4IUQA 3M57A 3VUZA 2NLUA 5DM7R 3MP1A 4BDYA 3MCAB 1S72A 3L42A 1VQ9A 4OB0B 2QQSA 4FT4A 4JUVA 2JVVA 4N4HA 3J80E 5A0GA 1YI2T 1K73C 3G4ST 3JCMX 2X4JA 3HKSA 4GLKA 3MP8A 5CKEA 1Q86C 4HNTA 3OS5A 3I55A 4M7DG 3HL8A 1XOVA 4PNOA 4F7UF 2I2LA 1OZ2A 3QKJA 1Q86U 3OYFA 5CQYA 3VYGA 2DK3A 4UC4A 5LJ3g 3SWNB 3JCMP 1Q7YC 2H3JA 2DTHA 1WJRA 3V7CA 1FXXA 4PLIA 1M1GA 3FIFA 3URGA 3OBWA 4M7DF 1KC8C 5GAOp 3CMAT 3OB9A 5GAMg 4Q5WA 2CYZB 3FEOA 2LQKA 3FRNA 4JDSA 5GMKi 1O75A 5IAYA 1R8OB 4OGCA 2F5TX 1QP2A 1SSFA 3HP9A 3OYYA 3S3MA 1K8AC 2VYTA 2JN0A 3CBOA 3OYJA 3UT1A 3CCST 2A3LA 1VQ6A 4C5GA 4OGEA 5J3BA 4BACA 2DD5A 2RI3A 2M16A 2R57A 1FKMA 3ZEHA 1VQ9T 2KVQG 3SD4A 3V8LA 1JB0E 5GMKj 4J7FA 2DD4A 4A4KA 5DLQE 3I55T 4C8QD 4LD6A 3CPFA 4HL4A 1NZ9A 2ZPEB 2DKGA 4F7UB 1K9MU 3OYLA 4QVZA 2MMPA 3HRSA 2QA4A 4OB2B 3H6ZA 4XAXB 2CZ0B 1BIBA 1WNLA 5GAN4 4MZTA 4X9CA 2EQKA 2JUFA 3NTIA 4E7JA 5IT9E 3GIBA 2EJGA 4CRIA 1Q82U 3CC4A 2CZ1B 3M54A 4HKEA 3CMEA 4M77E 5I2SA 1WGSA 3PGGA 2DXBB 5A0LA 3DB3A 1YITA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KT0 E;  1IRE B;  2ZPG B;  2D0Q B;  2DXC A;  3QXE B;  2O01 E;  3A8L B;  3WVE B;  2PVD B;  2WSE E;  1V29 B;  2DXB A;  1PSF A;  4XK8 E;  3VYH B;  2PVO B;  4ZGE B;  1UGR B;  1AHJ B;  4OB1 B;  2PUO B;  2PU9 B;  3HHT B;  2ZPF B;  2QDY B;  3QZ5 B;  4ZGD B;  4ZGJ B;  3A8H B;  3VYG B;  3X24 B;  4OB3 B;  2ZZD A;  3X28 B;  3LW5 E;  4OB0 B;  2ZZD B;  4FM4 B;  3QYG B;  4Y28 E;  2ZCF B;  3QYH B;  2PUK B;  1DJ7 B;  5L8R E;  2DD5 B;  3VYG A;  2DPP B;  2AHJ B;  3A8G B;  3QZ9 B;  4RKU E;  2CZ6 B;  1UGQ B;  3A8M B;  2ZPH B;  3A8O B;  2CYZ B;  1QP2 A;  2CZ7 B;  2ZPB B;  2DD5 A;  2WSC E;  1QP3 A;  1JB0 E;  1GXI E;  2ZPI B;  3X20 B;  3X25 B;  2DD4 A;  2DXC B;  2ZPE B;  4OB2 B;  2DD4 B;  2CZ0 B;  1UGS B;  2PVG B;  4L6V 5;  3WVD B;  2CZ1 B;  1UGP B;  1PSE A;  2WSF E;  2DXB B;  3X26 B; 
#chains in the Genus database with same CATH topology
 5ACB A;  4JLI A;  1KQS P;  3G1J A;  1JXM A;  3E1S A;  4PKC C;  2JJ9 A;  3I5S A;  4JRQ A;  2F5K A;  1WFW A;  1ZX6 A;  2V22 B;  4L5G A;  3I5R A;  1K8A C;  1VQO Q;  4C5H A;  2DL3 A;  2BS2 A;  2FZG B;  1VQL Q;  1OIY B;  2KSS A;  2RJD A;  4FIB A;  3UF4 A;  2COY A;  2QTV A;  1K76 A;  1JJ2 A;  2CJM B;  4CFU D;  5KCO A;  2PUO B;  4C8Q A;  5GAN 3;  3JB9 I;  1GL5 A;  3LGL A;  4A53 A;  4J6X A;  2QYZ A;  4E7H A;  2Y90 A;  3CC4 T;  4CI0 C;  3CME T;  1G8X A;  1T3S A;  4RG2 A;  2BE9 B;  2OAW A;  3J7A F;  4Y92 A;  2FZK B;  2OI3 A;  3MET A;  1HXD A;  3PFS A;  1X27 A;  4M4Z A;  4DA4 A;  4FYW B;  2SEM A;  4EOS B;  5GAN j;  4EOO B;  2JM8 A;  3CMA Q;  3SEM A;  2DBK A;  4C8Q C;  3JB9 G;  4CC4 B;  3GTM S;  2D8H A;  2HBW A;  1VQ7 Q;  4YTL A;  4RMO A;  2BZY A;  3EGD A;  4M78 A;  1P92 A;  1D3B A;  2RQT A;  2WMB B;  4OMQ A;  1KK7 A;  3DKM A;  1FVV B;  2DD5 B;  1VQ9 Q;  1GUX B;  1IGQ A;  3QZ9 B;  4LN2 A;  3TU4 K;  1VQ7 A;  2CZ6 B;  2X51 A;  3A8M B;  1KSW A;  4M7A F;  3EGU A;  5L2W B;  5FGK B;  2QAS A;  2BS4 A;  3M0S A;  3E9F A;  3VU3 C;  3CCL A;  3M4Y A;  1KQS A;  2BKD N;  2F69 A;  5GAN d;  4A4H A;  4F70 B;  4PLL A;  1N8R C;  2A0F B;  3FDR A;  3CCQ T;  4QKU A;  4OGR B;  4ZN1 A;  2RB6 A;  3NTH A;  1GBR A;  3H0I A;  2HSP A;  5D7U A;  2E3H A;  2GQV A;  2LCL A;  2SRC A;  1KC8 R;  2HQE A;  4LD9 K;  4BY6 B;  2K7A A;  1MNE A;  2CSI A;  2B9R A;  2NUZ A;  1TWB A;  2EUF A;  1WHH A;  2CGH A;  3OMC A;  1M9S A;  3MEW A;  3INZ A;  3T9N A;  2QQ8 A;  5L23 A;  3OYK A;  4XTV A;  3TW7 A;  3JB9 H;  2DA9 A;  3VS5 A;  2K2V A;  2RI2 A;  4MZM A;  2PVD B;  4HVW A;  5CO7 A;  4XK8 E;  3OSS C;  1BI1 A;  2K3B A;  5GAN 6;  5I22 A;  1E9H B;  3G71 A;  5GAN h;  1UNH D;  3QWL A;  2EWN A;  1I8F A;  1MUZ A;  1MMG A;  2YRC A;  8AT1 B;  2MPX C;  2RJC A;  2O9S A;  4E6R A;  1WJS A;  3EGD B;  4M78 B;  5FW9 A;  4M7A D;  2COZ A;  2AZS A;  3L2Q A;  2HDA A;  1AT1 B;  1MMN A;  1YNZ A;  3QZ5 B;  2FL7 A;  4LDV A;  3PIO A;  2E5Q A;  2GF7 A;  4C8Q E;  2QEX Q;  3X24 B;  1EIF A;  3EGX A;  3CCR T;  3M55 A;  1VQ8 T;  2OAU A;  2HKQ B;  2E5K A;  4GBQ A;  1G3W A;  4EOQ B;  2KXD A;  2QFZ A;  4NS5 A;  3CCE A;  3QUI A;  2C06 A;  1BB9 A;  5CKH A;  3MJX A;  4FM4 B;  2DL4 A;  2B86 A;  1YJN Q;  2LJ1 A;  2QEX A;  2DBM A;  4BCI B;  1KXU A;  2FB7 A;  4M7D D;  3TQ7 P;  4JX6 A;  2XU8 A;  1GFC A;  1OEB A;  4M78 E;  4V2S A;  3SDZ A;  2ZAE A;  1FMK A;  2I40 B;  1UGV A;  1QKX A;  3OYE A;  2V1Q A;  2E65 A;  2GTJ A;  4G6L B;  2YDL A;  3I9Q A;  3IQL A;  2FZC B;  2LT4 A;  4D8D A;  4J6Y A;  4II1 A;  4F6U B;  4IKF A;  1LJO A;  2OTL A;  1D0Y A;  3CCM T;  2D1X A;  1BI0 A;  4F7U A;  4HCC A;  3P8D A;  2XHC A;  4N0A C;  2DLP A;  3QHW B;  3SHW A;  4M7A C;  1ENW A;  2IVW A;  1BK2 A;  4F7J B;  2L0A A;  4EOR B;  4M7D A;  3L2R A;  2QQR A;  4QQ6 A;  4NST B;  1U5S A;  2EKH A;  4BCO B;  4ELZ C;  1ABQ A;  4FU6 A;  2QQ9 A;  4BCF B;  4EOI B;  5DY9 A;  1VOM A;  3ZL7 C;  3OY9 A;  2D0Q B;  2LQ8 A;  3V7R A;  2PTK A;  4BE2 A;  3RKX A;  3B57 A;  3CCJ Q;  4M7D C;  2BE7 D;  3I35 A;  5D6W A;  2ABL A;  3TN8 B;  1X6O A;  3CCU T;  5HVY B;  4EMK B;  2D6F A;  4MIM A;  2AKK A;  4JJC A;  1RAG B;  3CCJ A;  4XU2 A;  2P4R A;  3H41 A;  1HSQ A;  3SB2 A;  1M1K C;  2WHB B;  3A98 A;  4P5N A;  3C95 A;  2YLB A;  2G77 A;  1PKT A;  4FYY B;  2HMA A;  1VQN A;  1KD1 R;  3CC7 T;  4R56 A;  3DB4 A;  2A7Y A;  3PIP A;  1LPL A;  4BDZ A;  3CD6 A;  3OQ5 A;  3QWX X;  3QYH B;  1U1S A;  3NPF A;  4DOW A;  1H64 1;  4RCC A;  1QVG S;  3MI9 B;  4ME7 A;  4F14 A;  3HFO A;  3LH5 A;  3PMI A;  5AYF A;  4IMY B;  2EQM A;  3HSB A;  1WXB A;  2MIO A;  1ZQ1 A;  3JRZ A;  5KE3 A;  5D6Y A;  3OYB A;  2IVX A;  1QVF A;  2K2M A;  4DBF A;  3LWH A;  1M8V A;  4DBH A;  2RO0 A;  2LW4 A;  4JZ4 A;  2IW9 B;  5GAM f;  4L59 A;  2OTJ T;  3UPU A;  4BCH B;  2KXC A;  4AKH A;  4EIK A;  4JX4 A;  4TTH A;  1VQM Q;  2E10 A;  3EOC B;  2E3I A;  4LDY A;  4BUG A;  1YIJ Q;  3MP6 A;  2FEI A;  4F7U E;  1N9S A;  2KT1 A;  5KYX B;  4EOJ B;  2RQU A;  4A4G A;  5LJ5 g;  5LMK B;  3MKD A;  2A37 A;  2R5M A;  2XMF A;  2XD0 A;  2O4X B;  1H27 B;  2ZPG B;  2X3W D;  1RLP C;  1VYT A;  3EID B;  2RF0 A;  4M7D E;  5IXB A;  2FO0 A;  2W99 A;  1M1F A;  2CP3 A;  4JRI A;  3DOG B;  3JCM b;  1M1K U;  5IDP B;  1RAD B;  1JKW A;  2P0Q A;  3VS1 A;  1T3L A;  1IO6 A;  3CCV Q;  1X01 A;  4HCK A;  1NG2 A;  1YBY A;  5KYN A;  2DXB A;  2PMI B;  1O9S A;  3M0U A;  2LCC A;  4BXX X;  3QWY A;  3VKI A;  3CPW P;  3L2W A;  1V1C A;  4ZTJ A;  1KJW A;  1I4K 1;  3RMQ A;  1VUB A;  2CRE A;  1ACM B;  2L89 A;  1KQS S;  5HKC A;  3CCV A;  4MFE A;  1SF9 A;  3TW6 A;  2KYM A;  2VWF A;  2CH4 A;  5D6X A;  3FJP A;  3HB9 A;  1PNJ A;  2I53 A;  2M0Y A;  2EW3 A;  2P4T A;  4PJO B;  4FW2 A;  4M75 A;  1GH6 B;  1I07 A;  4F6W B;  1VQ5 Q;  3M57 A;  5DM7 R;  3MCA B;  5IHY A;  4N4H A;  2BKZ B;  5A0G A;  1K4U S;  1H28 B;  3G4S T;  3JCM X;  1A0N B;  3HKS A;  2L3S A;  4GLK A;  4HNT A;  3HL8 A;  4PFZ A;  2I2L A;  1OZ2 A;  5CQY A;  1GFD A;  1LVK A;  2DK3 A;  5LJ3 g;  4IIO A;  1E6H A;  1Q7Y C;  1RAE B;  1WJR A;  3JV3 A;  1TOV A;  4PLI A;  2X3X D;  3OBW A;  2CYZ B;  1RAA B;  3H0F A;  4OGC A;  3CXC P;  3HP9 A;  3M0T A;  3BE3 A;  2JN0 A;  3CBO A;  1JST B;  1GRI A;  1ZUY A;  2EYX A;  3U23 A;  3CCS T;  4C5G A;  4OGE A;  2GTO A;  2M16 A;  2HCK A;  2KVQ G;  4OML A;  1PD0 A;  4F16 A;  5GMK j;  4J7F A;  3I55 T;  4AFQ C;  3CPF A;  5KYY B;  2DKG A;  2ZPE B;  2HKN A;  3OYL A;  4QVZ A;  3H6Z A;  1HYO A;  4MZT A;  1YHQ Q;  3RGF B;  2LQN A;  3CC4 A;  3CME A;  1WGS A;  2DXB B;  1H8K A;  3DB3 A;  4LDU A;  1OGU B;  1IB8 A;  3MPU B;  4IUV A;  2QF7 A;  2W9Z A;  2EIF A;  3BLR B;  1H26 B;  2EJ9 A;  5DLO A;  4C92 D;  1TFB A;  1S1N A;  3ER0 A;  2R58 A;  2COW A;  1H24 B;  3M0P A;  1QCN A;  5C0M A;  1XO2 A;  4Z6Y A;  3BG5 A;  2FRW A;  2KEA A;  4Z02 A;  3JCM g;  5FU6 C;  4DEY A;  5LJ5 e;  1QLB A;  2KRO A;  3C94 A;  1Y7X A;  4YOS A;  1WHL A;  2VGN A;  1VIE A;  3HRT A;  1YI2 Q;  4PJL A;  2X4Y A;  2K3Y A;  1X75 C;  2W10 A;  5CQX A;  1I5L A;  4XTX A;  1IZ6 A;  4EPC A;  2L2P A;  4LNP A;  5IN1 A;  3SFM A;  1KHI A;  1Q7Y U;  1AZE A;  1YIT T;  3H4C A;  2JMA A;  4RTX A;  4M77 G;  3CC2 T;  1MMD A;  1OL2 B;  3C4S A;  1LCK A;  2P0K A;  4EDU A;  1GBQ A;  2UUE B;  3H0H A;  1K9M R;  5CEI B;  4BI3 A;  4BCN D;  3CCQ A;  4YOZ A;  4AKI A;  4Y28 E;  4M75 E;  5GAN 7;  2EJF A;  1Q82 R;  2KRM A;  1X2Q A;  4JLG A;  1VA7 A;  2L8D A;  2LX7 A;  4C5I A;  4BE1 A;  4QT7 A;  4D6W A;  1BCM A;  3JB9 F;  2RQW A;  2DIQ A;  5ICP B;  1R0B G;  2DZC A;  4RTZ A;  1D0X A;  3DLL A;  1M90 U;  5KH6 A;  1UJ0 A;  5FLX E;  2E1H A;  2F2X A;  3JB9 J;  2JZ2 A;  1N5Z A;  1AWJ A;  2KK4 A;  4C92 C;  4BI8 B;  4MMK A;  2RMO A;  3LYI A;  4CFV B;  5EG2 A;  4JPB W;  4QQG A;  1RAH B;  1Y07 A;  2OX7 A;  4PL6 A;  1H3Z A;  3KHI A;  2KY9 A;  4ZN3 A;  4R55 A;  1HJD A;  1YN8 A;  2WAC A;  4AG2 C;  4X9D A;  1VQ6 Q;  5AT1 B;  2AK5 A;  1FMW A;  4MDX A;  4M77 B;  1UGS B;  2CP6 A;  2EFI A;  4A63 B;  1M27 C;  2HSE B;  3LWI A;  4KUI A;  3OYC A;  4CRL B;  1ZP2 A;  4KT0 E;  4AMC A;  1RAF B;  2QA4 Q;  3CCR A;  4E7I A;  4E7L A;  4HVU A;  4QVD A;  1VQ8 A;  2DXC A;  3FLG A;  5GMK e;  3MEA A;  4Y72 B;  3QXE B;  3G6E T;  1UTI A;  1SKU B;  1S72 Q;  2YXY A;  2Y4Y A;  5KYU A;  1NJI C;  2RM4 A;  2LNH B;  2DXU A;  1OPL A;  3HO8 A;  1U1T A;  3BG3 A;  1WJQ A;  5GMK l;  5HNB B;  3QYB A;  2HQH A;  2WEV B;  3JCM e;  4J9C A;  4JJN K;  1QVG A;  3HRU A;  2MWO A;  4KUL A;  2G9X B;  4BCJ B;  4K11 A;  2JMC A;  4ZGD B;  3ZFJ A;  1VQ4 T;  1UDL A;  2RHU A;  4IUP A;  2IIM A;  4R0K A;  2G6F X;  2CP2 A;  4BCM B;  5IHN A;  3CCM A;  3EFR A;  1BKB A;  3O8V A;  1B34 A;  2NUP B;  1ZBJ A;  2JW4 A;  3BDU A;  1DJ7 B;  3RER A;  3EHR A;  2VVK A;  2DPP B;  1BCO A;  1QKW A;  1VQK T;  3ZBD A;  3CBP A;  2JTM A;  4RKU E;  4GY5 A;  1VIN A;  4DEX A;  4DQ2 A;  2ZPH B;  4N4I A;  3OYI A;  3M53 A;  2L3P A;  2ESW A;  1M5Q 1;  3SWN C;  2DME A;  2CZ7 B;  1G3T A;  4BCQ D;  1PG5 B;  1NE8 A;  3RIR A;  2LP5 A;  4ZNX A;  4HNV A;  1ZUU A;  2RPN A;  1ZHI A;  4C8Q G;  3CCL Q;  2DXC B;  3CCU A;  2W2H A;  5I11 A;  6AT1 B;  4EMG A;  3AHU A;  4YOO A;  3NTK A;  1NJI U;  2C6T B;  2RA2 A;  2CCH B;  2E6N A;  3OS1 A;  3QHR B;  4XTU A;  1RL2 A;  1QMZ B;  2MAM A;  2LQW A;  1ZSG A;  3X26 B;  3GOX A;  2EKO A;  5A2Q E;  3OA6 A;  2RJF A;  4RUG A;  3CC7 A;  3RKW A;  1K73 R;  2CT3 A;  4M78 G;  3JCM J;  2GNC A;  1W2B P;  3EHQ A;  3DTO A;  3OYN A;  5HBE B;  1RAB B;  2QQB A;  3EJ1 B;  4PJN A;  2WIP B;  2BIV A;  2M51 A;  1K8A U;  2XDB A;  5DQV A;  3WVE B;  4FT2 A;  3E19 A;  1ZLM A;  1RAI B;  1UNG D;  4LUD A;  4J9E A;  1RI0 A;  2PVO B;  2CP7 A;  3H8Z A;  1GY3 B;  1AHJ B;  2FRY A;  1X6B A;  4X34 A;  4A54 A;  1NPP A;  4ROE A;  2MI6 A;  1M30 A;  2X35 A;  1B34 B;  3QO3 A;  3L2Z A;  4BCG B;  3JCM W;  2E6Z A;  5GAN f;  4C8Q B;  1PD1 A;  3M0R A;  1VIF A;  4RTT A;  3G71 Q;  1YJW T;  2H3E B;  1G3S A;  2IW8 B;  2ROL A;  1W6X A;  4OMM A;  5IXF A;  4JZ3 A;  1KQ1 A;  1AVZ C;  2VB6 A;  2OTJ A;  4BB7 A;  5GAO q;  3RBB B;  3KXT A;  3QYG B;  1QCF A;  3CPW S;  4Z88 A;  2KI7 A;  2D8J A;  3RMS A;  4QSH A;  4UN0 A;  1AOJ A;  2DRK A;  3CCE Q;  1D3B B;  4MDW A;  2XG8 D;  2E12 A;  3A8G B;  3V7S A;  5EC7 A;  1WHG A;  3OYG A;  4XTW A;  3QBY A;  2KAF A;  2M0O A;  5CK9 A;  1G5V A;  2UZE B;  3A8O B;  2CT4 A;  2RNA A;  1M3B A;  1UUE A;  2RJE A;  4JRK A;  3M59 A;  4O5V A;  2W0Z A;  3JCM Q;  2LNV A;  3L2V A;  3VJP A;  4QQD A;  5CVI A;  2O88 A;  2M02 A;  3TSZ A;  4KRD B;  4LDX A;  2WIH B;  1N6A A;  4J9F A;  2B8A A;  2IPO B;  4J5Y A;  3I56 T;  2ZPI B;  1PWT A;  1N8R U;  4JJB A;  3UA6 A;  1VQP T;  1W2B A;  3NFC A;  2CCI B;  5KE2 A;  4RCB A;  4ATO A;  1M2O A;  2EGE A;  4RTV A;  2OTL Q;  4N0A A;  2JS0 A;  1AWO A;  1OQK A;  3BHV B;  4CC2 A;  3CXC S;  2DIG A;  4M7A A;  2V8I A;  4PJO F;  1M2V A;  2DRM A;  3FB9 A;  2YUN A;  4EC8 B;  1J3T A;  1IXD A;  4E7S A;  3ASK A;  2F1L A;  1AD5 A;  3BW1 A;  4BCK B;  4A4F A;  3G4S A;  2O2O A;  3A8L B;  1WXU A;  2EQJ A;  4E7Z A;  2CS7 A;  4MFD A;  1PC0 A;  3VKG A;  5LQF B;  4PJM A;  2K4Y A;  4ELY C;  1UGR B;  3CEY A;  3QDF A;  2V8K A;  4AI6 A;  4LOC A;  2MK5 A;  2FPD A;  3BHU B;  2DNU A;  2ROT A;  2QDY B;  2C0O A;  1KFZ A;  5I2M A;  1VQO T;  1BI3 A;  2P0P A;  4RTY A;  4F7U G;  3R6N A;  5GMK m;  1VQL T;  3N5B B;  2E64 A;  3MP1 A;  4F7S B;  3EGX B;  3L42 A;  4JUV A;  3J80 E;  1D1A A;  4EOK B;  2YUO A;  1Q86 C;  3I55 A;  3REB B;  1VQN Q;  4M7D G;  3QKJ A;  2LCS A;  5CYI B;  2NWM A;  3CD6 Q;  4ROC A;  1TUG B;  3V7C A;  1M1G A;  3FIF A;  1CKB A;  3OW2 P;  3TVT A;  2EGC A;  2BZX A;  3CMA T;  3OB9 A;  5GAM g;  4Q5W A;  1M1K R;  2MCN A;  1JO8 A;  3FEO A;  2LQK A;  1WHK A;  3FRN A;  4JDS A;  1O75 A;  2AKL A;  2F5T X;  1SSF A;  3OYY A;  2QGG A;  3OYJ A;  3UT1 A;  2A3L A;  1SHF A;  4BAC A;  1CKA A;  2EBP A;  4LUE A;  2RN8 A;  1FKM A;  1VQ9 T;  2BTT A;  4CFW B;  2DD4 A;  4LD6 A;  2DJQ A;  4HL4 A;  2MOX A;  1ABO A;  4F7U B;  2MMP A;  3HRS A;  2CZ0 B;  1TD6 A;  1BIB A;  4E7J A;  4X9C A;  2EQK A;  3NTI A;  2EJG A;  3F5X B;  2W96 A;  4KGZ B;  3PGG A;  1YIT A;  2CSQ A;  1MMA A;  2MF2 A;  1Q81 R;  5CKB A;  4M7D B;  1IRE B;  1M3A A;  2RHY A;  2NYS A;  2ED1 A;  2CH4 W;  2KNB B;  1QLY A;  3CC2 A;  1UHF A;  5GAO l;  3F70 A;  2O9V A;  4M7A E;  2O01 E;  2WFY B;  2XDD A;  1UJY A;  4E7K A;  1FX7 A;  2QTX A;  2DVE A;  4O6J A;  4E47 A;  1D1C A;  4PJO G;  3P8H A;  2KMT A;  2M9U A;  3MO8 A;  2GFU A;  4XTY A;  5LJ5 j;  2DEQ A;  2BS3 A;  4JX5 A;  1Q86 U;  3G7Z A;  2XK0 A;  1EZZ B;  3THK A;  3PO3 S;  5FRM A;  1WYX A;  1D3U B;  2Y4X A;  2LJ3 A;  3KUF A;  2WJ9 A;  3PE0 A;  1OU8 A;  4HT9 A;  2KYB A;  2AZV A;  1XJW B;  2ZZD A;  1BBZ A;  3RR6 A;  2EGA A;  2K5F A;  2KE9 A;  2K3X A;  3BLH B;  2FYK A;  3C0C A;  4IIM A;  1R0C B;  5LL6 S;  1HD3 A;  3M03 A;  5IH2 A;  5LJ5 d;  2KRN A;  1W98 B;  5HQ0 B;  4HT8 A;  4M77 F;  1G83 A;  2DMO A;  3J81 E;  1IGU A;  2MWP A;  4AKG A;  2CP5 A;  3HTR A;  1WI7 A;  2P84 A;  3JAM E;  4YC3 B;  3O5Z A;  2QEX T;  1KQ2 A;  1OV3 A;  3FJ5 A;  1EX4 A;  3MEU A;  4FYV B;  2XI9 A;  4J9D A;  3UDC A;  1WDX A;  3G6E A;  1JBM A;  3HZJ A;  1YJN T;  5LJ3 j;  1BI2 A;  4FW1 A;  2WSC E;  1X43 A;  1JEG A;  1OL1 B;  1N4M A;  4C0D C;  4CFN B;  2RHX A;  5CKF A;  4KGV B;  1OZ3 A;  1ZBX A;  5IDN B;  4XU1 A;  2J6K A;  2PVG B;  2FVU A;  4C5E A;  4M75 G;  2RI5 A;  2HL3 A;  3MY5 B;  4RG8 A;  4EMH A;  1NLP C;  1VQ4 A;  5CR2 A;  5LJ5 h;  2KMG A;  2QG9 B;  1I1J A;  2CUD A;  1PCX A;  2QI2 A;  4II5 B;  3CC4 Q;  1SHG A;  3CME Q;  1M3C A;  4MZP A;  4PK4 A;  1KG1 A;  5LJ3 d;  2C5V B;  4A4E A;  1OKW B;  1EFN A;  4VUB A;  2Z0W A;  3NMZ C;  3OYM A;  4M77 D;  1UFF A;  3EG2 A;  3VYH B;  1IRX A;  1M90 R;  1K0S A;  1AD6 A;  2BUD A;  2G3R A;  3CPW A;  5FU7 C;  1OPK A;  3OYA A;  4MML A;  1VQK A;  1W1F A;  1QQJ A;  2IG0 A;  5HK3 A;  1AIS B;  4NOY A;  1WZO A;  4I3Z B;  1NYF A;  1ZA1 B;  1R77 A;  3LX7 A;  1GCP A;  2HZY A;  1NM7 A;  3EG1 A;  1W2B S;  4BBS M;  3OYD A;  2DE0 X;  4ELL A;  3EAE A;  1UEB A;  4M75 B;  1SG5 A;  1FMV A;  3REA B;  1KHC A;  2WXV B;  1Y96 A;  1JRI A;  1NPR A;  1QMC A;  2V1R A;  3VS3 A;  4KRT A;  4ESR A;  1MGQ A;  3RUX A;  4BI4 A;  5LJ3 h;  3CCQ Q;  2J6O A;  2L5Q A;  5KCH A;  2JTF A;  4E2F B;  2FHD A;  3JCM d;  1WQ7 A;  3CBM A;  3CXC A;  1AWW A;  2EPD A;  1D09 B;  2DJZ A;  1P5E B;  1D1B A;  1UHC A;  2EYY A;  2EYZ A;  4M77 C;  4C92 A;  1ZSZ C;  2E4H A;  2DYI A;  2NUT A;  2D9T A;  1K9A A;  1GXI E;  3R6O A;  1H1S B;  3X20 B;  3MEV A;  1WQW A;  2RK1 A;  1H25 B;  5GMK h;  4X1V A;  2C0I A;  3D7S B;  4C8Q F;  2QK0 A;  4F6S B;  2WSF E;  2K6D A;  2ECZ A;  1YJW A;  1ARK A;  5LJ3 e;  2DYB A;  1WHJ A;  2KDS A;  5FU6 B;  1VQM T;  3RDV A;  1H1Q B;  3BY7 A;  4HA8 A;  1NLO C;  3EG9 A;  4KRC B;  3P8B B;  1YIJ T;  2DTI A;  3CCR Q;  3JCM h;  1VQ8 Q;  3LGF A;  1H1P B;  2DL7 A;  5CKD A;  1G3Y A;  1YJ9 T;  4M78 F;  1WHM A;  4KH1 B;  1JJ2 P;  5GAO m;  1NBE B;  2A36 A;  4Z8A A;  1XTD A;  3BFM A;  2IN3 A;  3JCM V;  1BU1 A;  2J7I A;  5CCA A;  1U3O A;  1Y96 B;  3M58 A;  1XQH A;  4AFS C;  1OUL A;  3RNJ A;  3PVQ A;  1GCQ A;  5FRN A;  5A0D A;  2DM1 A;  1RUW A;  3CCV T;  4ELJ A;  5KYW A;  1WXT A;  4AT1 B;  1CSK A;  1PM3 A;  3I56 A;  1VQP A;  3JB9 D;  4JJD A;  3TSW A;  4ROD A;  1GCQ C;  2PJQ A;  2CUB A;  4C92 B;  5FWB A;  4PJJ A;  4AFZ C;  2YRD A;  3CCM Q;  3OS2 A;  2NUT B;  1M8M A;  1RLQ C;  2PQW A;  1VQ5 T;  2RD1 A;  4C0F A;  5J26 A;  1F1B B;  2CP0 A;  1OIU B;  2K5I A;  1K8A R;  2DZ9 A;  4EOL B;  4C0Z A;  5DQW A;  4XU0 A;  3SWN A;  3QHS A;  4HLQ A;  1QP3 A;  5IT9 E;  3E9G A;  1I5O B;  4KGX B;  1C9B A;  4M78 D;  2HBP A;  4C92 E;  1SPK A;  2J06 A;  2JOY A;  1B07 A;  3OW2 S;  3EG3 A;  3M56 A;  3EG9 B;  4BCN B;  1MND A;  4BBR M;  1YCS B;  3CCU Q;  1QW1 A;  4XU3 A;  1QWF A;  2RHI A;  4ANJ A;  1VQO A;  3LLR A;  2FPE A;  1OKV B;  2PK9 B;  2YUQ A;  5FRO A;  2K57 A;  2HQX A;  1VQL A;  5GAN 2;  2LX9 A;  2WPA B;  1OI1 A;  2QXF A;  4BY6 C;  5GAO r;  1YHQ T;  4OP0 A;  1PKS A;  3CC7 Q;  3HFN A;  5GJW B;  4KUD K;  5EJC A;  4EC9 B;  5KYW B;  4OMN A;  5KYU B;  3A5Z B;  4KBM B;  4QW2 A;  5GAN g;  4XQ3 A;  4J8O A;  4LE9 A;  3HHT B;  2ZPF B;  1I0C A;  4IUU A;  2QQA A;  1UE9 A;  3GNF B;  3CMA A;  1LNX A;  3OSV A;  4J6W A;  3VS4 A;  3PMT A;  1UEC A;  1ZA2 B;  2RH2 A;  4OB3 B;  3GP8 A;  2UZD B;  1N8R R;  3X28 B;  3LW5 E;  4M78 C;  2L3R A;  3VUZ A;  4IUQ A;  1IHV A;  1B3Q A;  1VQ9 A;  3VS6 A;  1JQQ A;  1YI2 T;  1K73 C;  1G3N C;  3O0G D;  1OOT A;  2QAZ A;  2DVJ A;  3MP8 A;  4PNO A;  4F7U F;  2W9F A;  4DBQ A;  3OYF A;  2OTJ Q;  3VYG A;  4UC4 A;  1D0Z A;  2WMA B;  3SWN B;  4PFP A;  3JCM P;  2H3J A;  2DTH A;  4OMP A;  5EFQ B;  2C5O B;  2C5X B;  1KC8 C;  4M7D F;  1R8O B;  4PFO A;  2PHG A;  1QP2 A;  2LMJ A;  2VYT A;  4AFU C;  3ZEH A;  3SD4 A;  3V8L A;  1JB0 E;  2PZ1 A;  4A4K A;  1RI9 A;  1E6G A;  5GAN 4;  2R7G A;  2CDT A;  1TUC A;  2JUF A;  5IHI A;  4CFU B;  3AT1 B;  2CZ1 B;  3M54 A;  4HKE A;  2KR3 A;  5A0L A;  1BIA A;  2MYS A;  2HEQ A;  2BPM B;  3JCM c;  3TNH B;  3DDP B;  2C4G B;  1VQ6 T;  3EH1 A;  2DX1 A;  4BE0 A;  4EMK A;  1FWZ A;  1B7T A;  3UA7 A;  4BCQ B;  1V29 B;  1PSF A;  1TG0 A;  5HY6 A;  1AZG B;  3EG0 A;  5IHK A;  1K73 U;  1W70 A;  3G4S Q;  1C0M A;  1QWE A;  1JU5 C;  2HNI A;  4OVA A;  4QVC A;  2KQW A;  2QA4 T;  4EON B;  2D0N A;  2F2V A;  2F2C A;  2O31 A;  2GQI A;  2X4W A;  4EMK C;  1S72 T;  1M4Z A;  3VYG B;  1C6V X;  1TUD A;  1YJN A;  5GAN e;  2EVR A;  1KC8 U;  3S6W A;  3NGP A;  5IF1 B;  3GF5 A;  3VS7 A;  4F17 A;  1H4L D;  2DAQ A;  3KFV A;  1V76 A;  3V8J A;  2VKN A;  4F7L B;  2E41 A;  1U8R A;  2C0T A;  4BCP B;  2ZCF B;  2JTE A;  1T0H A;  2YT6 A;  2YHT A;  3CCS Q;  2DEU A;  2VAS A;  4M7A G;  4RTW A;  1H1R B;  3L1A A;  1WPY A;  3A1P A;  5I21 A;  4B6M A;  2E70 A;  2JNG A;  3PNW C;  3GLX A;  3I55 Q;  1TH7 A;  1UGQ B;  3VKH A;  1UB4 A;  5HBH B;  3CCS A;  3MY1 B;  3VS0 A;  2GFA A;  3JSC A;  4OR5 B;  2J05 A;  1QVF P;  9ATC B;  4M6V A;  4ZTF A;  1VYU A;  1X6G A;  5HK0 A;  4B9X A;  1H3H A;  1Q86 R;  2EYQ A;  4XTZ A;  5GAM j;  1I81 A;  2LDM A;  5GAO n;  5KYX A;  3DLM A;  4PJO D;  2YLC A;  1OYX A;  4L6V 5;  3WVD B;  1AWX A;  1BU2 A;  1NEB A;  1UGP B;  3HBL A;  1PHT A;  1PSE A;  4J9B A;  2O4X A;  3UAT A;  1VQ7 T;  2YRV A;  2DET A;  1YP5 A;  3ME9 A;  4FSS A;  4M7A B;  5GJV B;  1KD1 C;  1M2V B;  3CCL T;  2VXE A;  2JGZ B;  2V8J A;  4M75 F;  1O9K A;  3NHN A;  3M9Q A;  1ZUK A;  4JS5 A;  4NL2 A;  1YIT Q;  3WXM B;  2XIC A;  1X69 A;  1AEY A;  1IHW A;  2DL5 A;  1FIN B;  1TSF A;  3QYE A;  3BDL A;  2WSE E;  3CC2 Q;  5GAM d;  4ZGE B;  2ZGW A;  1X2K A;  2LT1 A;  4WTO B;  4IUR A;  2PU9 B;  3KBG A;  2LC4 A;  3VS2 A;  1YCY A;  5I5Z B;  3BHT B;  3OMG A;  4PJO A;  4FCY A;  5HBJ B;  4KH0 B;  2VV5 A;  2EYW A;  4ZGJ B;  3A8H B;  3Q1J A;  2RQR A;  2X4X A;  1WA7 A;  2DXT A;  1Q81 C;  4CFX B;  3VRY A;  1PRM C;  4CXA B;  1VOL A;  4J9H A;  1VYV A;  3OS0 A;  2LRQ A;  1JJ2 S;  4PJO C;  2A08 A;  1T0J A;  1W4S A;  3QII A;  2DL8 A;  2RQV A;  2PUK B;  4JRP A;  4RTU A;  3S3N A;  5L8R E;  4DBR A;  4IUT A;  2IW6 B;  2HAX A;  3G71 T;  3G33 B;  2RK2 A;  4OMF B;  4N4G A;  1MHN A;  3PTA A;  3OW2 A;  3MHX A;  3EFO A;  5HCK A;  2FG0 A;  4FYX B;  3M5A A;  5GAM h;  4NL3 A;  1YJ9 Q;  1VQM A;  4EOM B;  4JS4 A;  3RKY A;  3EH2 A;  2VC8 A;  4M75 D;  1U06 A;  3TNI B;  2PNI A;  2ZPB B;  2JS2 A;  4LXC A;  2OJ2 A;  1QCO A;  1FYN A;  1JXO A;  4FL6 A;  1YIJ A;  1PKD B;  3CCE T;  3K7A M;  1PRL C;  5KYY A;  3TEE A;  2C5N B;  5GAN 5;  1KD1 U;  2LTO A;  3X25 B;  2XID A;  1RAC B;  3S3O A;  1YJ9 A;  3G6E Q;  5CAI A;  2XDP A;  2EAY A;  1YFN A;  1SRL A;  1O9K B;  2DD4 B;  3DDQ B;  1BYM A;  4J9G A;  2KR6 A;  2L3Q A;  3M4G A;  1JSU B;  3BG9 A;  3PVL A;  1MV0 B;  1QVP A;  4F04 B;  1SEM A;  1TU0 B;  2YUP A;  1WX6 A;  2K9G A;  4CC3 A;  2ATC B;  2HD0 A;  5LJ5 f;  1LOJ A;  1K0X A;  1F5Q B;  5GAM e;  2J6F A;  2KBT A;  1VQ4 Q;  2DTO A;  2BZ8 A;  1G2B A;  1TTH B;  4OF1 A;  4Y91 A;  2OTL T;  3FC3 A;  1Q81 U;  2LJ0 A;  1Q7Y R;  4C92 F;  2KGT A;  2QDJ A;  2QDL A;  2V26 A;  5ECA A;  3QDR B;  2DO3 A;  1VQ5 A;  4M75 C;  1NYG A;  4FSX A;  2VGM A;  1HK9 A;  4BY7 X;  2UZL B;  2YWW A;  1NEG A;  3GPL A;  2GCX A;  4C0G A;  2GBQ A;  1VQK Q;  7AT1 B;  4PJO E;  3C12 A;  3EFO B;  3DJB A;  2RHZ A;  2CKK A;  1SRM A;  2ZZD B;  3UWN A;  2M1H A;  4CC7 A;  2EQU A;  1YWO A;  1E7P A;  4BD3 A;  2AHJ B;  5M9O A;  1M90 C;  4AG1 C;  4OMO A;  3CCJ T;  4J83 A;  5CIU A;  4HCZ A;  3OBY A;  2ED0 A;  5LJ3 f;  4TVR A;  3LH0 A;  2K5L A;  1MV3 A;  4C0D B;  4B9W A;  3LQ5 B;  1VQN T;  2R5A A;  3ULR B;  4HCB A;  3L2U A;  1H92 A;  1C1A A;  1YHQ A;  4HNU A;  3CD6 T;  3RES A;  5C6S A;  3QJY A;  4NC6 A;  2PK2 A;  4M77 A;  1URC B;  4DOV A;  1ZSZ A;  3EFS A;  4LDW A;  1JOW A;  1Z9Z A;  5J39 A;  3NDQ A;  4HVV A;  1N27 A;  2UZB B;  3TRE A;  4J7I A;  4EOP B;  3V8K A;  2AIR B;  3PT9 A;  4BCM D;  2LVM A;  1Y71 A;  1K1Z A;  1OX9 A;  5BNJ B;  2GGR A;  2X1N B;  5FU7 B;  1YI2 A;  1YJW Q;  2JT4 A;  2VUB A;  3VUB A;  1K9M C;  4D8K A;  3VV0 A;  4GLM A;  3BLQ B;  1N9R A;  2AT1 B;  1Q95 G;  4F7N B;  1WLP B;  4WF2 A;  1Q82 C;  4HXJ A;  3H9N A;  1OI9 B;  2YSQ A;  5GAN 8;  1YWP A;  3TCJ A;  3HPW A;  3QJ6 A;  2VXF A;  3JCM f;  3GNG A;  3DL1 A;  4OB1 B;  3QG1 A;  3QPH A;  3POM A;  3E2U A;  2KRS A;  3OYH A;  5FWC A;  4FX3 B;  1QVG P;  3QSU A;  2HL5 C;  4C92 G;  1UG1 A;  4BY1 X;  1OU9 A;  2F2W A;  2XKO C;  1SSH A;  1XNI A;  4CFM B;  2FPF A;  2NUP A;  1KIK A;  2NLU A;  4J9I A;  4BDY A;  1WIE A;  4OB0 B;  2QQS A;  4FT4 A;  2JVV A;  1TS9 A;  2X4J A;  5CKE A;  3OS5 A;  1XOV A;  1Y0M A;  3TNW B;  3I56 Q;  1Y57 A;  3VRZ A;  2X9H A;  1UNL D;  8ATC B;  1VQP Q;  1FXX A;  2QGF B;  3URG A;  2JXB A;  5GAO p;  4Z89 A;  2EQI A;  3GBQ A;  1ZSZ B;  5GMK i;  2K79 A;  5IAY A;  2ENM A;  2DIL A;  3S3M A;  2QGS A;  1NJI R;  1VQ6 A;  2DER A;  5J3B A;  2DD5 A;  2RI3 A;  4WCI A;  2R57 A;  3M0Q A;  1GUX A;  2JM9 A;  3MIA B;  1TXQ A;  5DLQ E;  4C8Q D;  2LZ6 B;  4ORZ A;  1NZ9 A;  2DF6 A;  2I0N A;  1K9M U;  2KT8 A;  2A28 A;  2QA4 A;  4OB2 B;  4XAX B;  1WNL A;  3GIB A;  2DFU A;  1Q82 U;  1E7O A;  3CQT A;  1Z9Q A;  2H8H A;  1OX8 A;  4M77 E;  1VYW B;  5I2S A;  1S72 A;  4CRI A;  1QVF S; 
#chains in the Genus database with same CATH homology
 4LDU A;  2MF2 A;  4M7D B;  4JLI A;  4IUV A;  5CKB A;  2QF7 A;  1IRE B;  1BIA A;  2EIF A;  1KD1 U;  2RHY A;  3CD6 T;  2EJ9 A;  3E1S A;  5DLO A;  3CC2 A;  4PKC C;  3JCM c;  5GAO l;  3F70 A;  4JRQ A;  2F5K A;  4M7A E;  1VQ6 T;  2O01 E;  4C92 D;  3ER0 A;  2XDD A;  2R58 A;  4E7K A;  1FX7 A;  5C0M A;  2QTX A;  4L5G A;  2DVE A;  4O6J A;  4E47 A;  4PJO G;  4Z6Y A;  3BG5 A;  3JCM g;  4Z02 A;  3P8H A;  4C5H A;  5FU6 C;  5LJ5 e;  2KMT A;  2M9U A;  3MO8 A;  4EMK A;  2BS2 A;  4BE0 A;  1FWZ A;  1QLB A;  2GFU A;  4XTY A;  2KSS A;  3C94 A;  1Y7X A;  5LJ5 j;  2RJD A;  1V29 B;  4FIB A;  1PSF A;  2DEQ A;  2BS3 A;  5HY6 A;  2VGN A;  1JJ2 A;  1VIE A;  4JX5 A;  3HRT A;  1K73 U;  5KCO A;  2X4Y A;  2HNI A;  4OVA A;  2PUO B;  3G7Z A;  2KQW A;  2XK0 A;  4C8Q A;  4QVC A;  2K3Y A;  5GAN 3;  1X75 C;  5CQX A;  3JB9 I;  2QA4 T;  1I5L A;  4XTX A;  3LGL A;  4A53 A;  4J6X A;  4E7H A;  1IZ6 A;  4EPC A;  2Y90 A;  3CC4 T;  5FRM A;  4CI0 C;  5IN1 A;  3CME T;  3SFM A;  2Y4X A;  1KHI A;  4RG2 A;  2X4W A;  2WJ9 A;  3KUF A;  4EMK C;  1S72 T;  1M4Z A;  1Q7Y U;  1YIT T;  3J7A F;  4HT9 A;  3H4C A;  3VYG B;  1YJN A;  5GAN e;  3MET A;  1HXD A;  1KC8 U;  3PFS A;  3S6W A;  2ZZD A;  3GF5 A;  4DA4 A;  4M77 G;  4LD9 K;  3CC2 T;  5GAN j;  2K5F A;  4C8Q C;  2DAQ A;  3JB9 G;  3C4S A;  2P0K A;  4EDU A;  3V8J A;  2K3X A;  4BI3 A;  2FYK A;  2E41 A;  3CCQ A;  1U8R A;  4Y28 E;  4AKI A;  2ZCF B;  4YTL A;  4RMO A;  5LL6 S;  4M75 E;  5GAN 7;  2YHT A;  2EJF A;  1P92 A;  4M78 A;  1D3B A;  2XDB A;  5LJ5 d;  4JLG A;  4HT8 A;  4M77 F;  2L8D A;  4M7A G;  4C5I A;  4BE1 A;  3J81 E;  3DKM A;  2MWP A;  2DD5 B;  3L1A A;  4AKG A;  1WPY A;  4D6W A;  5I21 A;  3JB9 F;  2DIQ A;  2E70 A;  2JNG A;  3PNW C;  3GLX A;  3JAM E;  2DZC A;  2QEX T;  3QZ9 B;  3DLL A;  3TU4 K;  1VQ7 A;  1M90 U;  1TH7 A;  2CZ6 B;  1UGQ B;  5KH6 A;  3A8M B;  3VKH A;  1KQ2 A;  5FLX E;  1UB4 A;  3CCS A;  2E1H A;  3JB9 J;  3MEU A;  2JZ2 A;  2KK4 A;  4M7A F;  4C92 C;  2XI9 A;  4BI8 B;  3UDC A;  2GFA A;  3JSC A;  2BS4 A;  3VU3 C;  3E9F A;  3G6E A;  3CCL A;  3M4Y A;  4MMK A;  1JBM A;  3HZJ A;  1YJN T;  3LYI A;  1KQS A;  5EG2 A;  4M6V A;  4QQG A;  2BKD N;  2F69 A;  5GAN d;  4ZTF A;  5LJ3 j;  4A4H A;  1Y07 A;  1BI2 A;  5HK0 A;  4PLL A;  4PL6 A;  4B9X A;  2WSC E;  1H3Z A;  1N8R C;  3KHI A;  2KY9 A;  4ZN3 A;  4R55 A;  2EYQ A;  3FDR A;  3CCQ T;  4C0D C;  2WAC A;  2RHX A;  5CKF A;  4X9D A;  4XTZ A;  5GAM j;  1I81 A;  1OZ3 A;  2LDM A;  5GAO n;  4ZN1 A;  1ZBX A;  2RB6 A;  3DLM A;  3NTH A;  4XU1 A;  4MDX A;  4M77 B;  4PJO D;  1UGS B;  2EFI A;  2PVG B;  2YLC A;  1OYX A;  4L6V 5;  3WVD B;  2FVU A;  4C5E A;  4M75 G;  2RI5 A;  1UGP B;  3HBL A;  1PSE A;  2GQV A;  2LCL A;  2O4X A;  2HQE A;  4RG8 A;  4EMH A;  1VQ7 T;  2YRV A;  4BY6 B;  3LWI A;  1VQ4 A;  4KUI A;  5CR2 A;  3OYC A;  5LJ5 h;  2KMG A;  4KT0 E;  3ME9 A;  3CCR A;  4E7I A;  4E7L A;  2QI2 A;  4QVD A;  1VQ8 A;  4M7A B;  2DXC A;  3FLG A;  5GMK e;  1KD1 C;  3MEA A;  2CGH A;  3OMC A;  1M9S A;  3MEW A;  3QXE B;  2VXE A;  3INZ A;  2V8J A;  4M75 F;  2QQ8 A;  3T9N A;  3G6E T;  3CCL T;  3M9Q A;  4MZP A;  1KG1 A;  3OYK A;  4JS5 A;  5LJ3 d;  4NL2 A;  4XTV A;  3WXM B;  4A4E A;  2Y4Y A;  3TW7 A;  2XIC A;  3JB9 H;  1NJI C;  2RM4 A;  2K2V A;  2DXU A;  2RI2 A;  4MZM A;  2PVD B;  4VUB A;  5CO7 A;  3QYE A;  3BDL A;  2WSE E;  4M77 D;  3HO8 A;  3OSS C;  4XK8 E;  1BI1 A;  3OYM A;  3VYH B;  5GAM d;  5GAN 6;  4ZGE B;  1U1T A;  2BUD A;  2G3R A;  2ZGW A;  3CPW A;  3G71 A;  5FU7 C;  3OYA A;  4MML A;  3BG3 A;  1VQK A;  1WJQ A;  5GMK l;  2LT1 A;  5GAN h;  3QWL A;  2EWN A;  4IUR A;  2IG0 A;  1I8F A;  2PU9 B;  3QYB A;  4NOY A;  5HK3 A;  3KBG A;  2LC4 A;  2RJC A;  1WJS A;  1YCY A;  3JCM e;  4JJN K;  4M78 B;  1QVG A;  3HRU A;  2MWO A;  3OMG A;  4PJO A;  4KUL A;  4M7A D;  3L2Q A;  2VV5 A;  3LX7 A;  4LDV A;  3PIO A;  3QZ5 B;  4ZGD B;  2FL7 A;  3ZFJ A;  1VQ4 T;  4ZGJ B;  2RHU A;  2E5Q A;  4IUP A;  3A8H B;  2GF7 A;  3Q1J A;  4C8Q E;  1W2B S;  3X24 B;  1EIF A;  4BBS M;  3M55 A;  3CCR T;  1VQ8 T;  3OYD A;  2X4X A;  2OAU A;  2DXT A;  1G3W A;  1Q81 C;  2QFZ A;  3EAE A;  4NS5 A;  3CCE A;  1UEB A;  4M75 B;  3QUI A;  2C06 A;  5CKH A;  3CCM A;  1QVF S;  3EFR A;  2LRQ A;  4FM4 B;  3OS0 A;  1BKB A;  1KHC A;  3O8V A;  1B34 A;  1JJ2 S;  4PJO C;  1Y96 A;  3QII A;  1W4S A;  2QEX A;  1JRI A;  1NPR A;  2PUK B;  3BDU A;  4JRP A;  1DJ7 B;  3S3N A;  5L8R E;  3RER A;  2FB7 A;  4M7D D;  4IUT A;  1MGQ A;  2HAX A;  2DPP B;  3RUX A;  3G71 T;  4JX6 A;  4BI4 A;  2RK2 A;  5LJ3 h;  2XU8 A;  4OMF B;  1VQK T;  4N4G A;  3ZBD A;  3CBP A;  1MHN A;  4M78 E;  2JTM A;  2L5Q A;  4GY5 A;  4RKU E;  5KCH A;  3PTA A;  3OW2 A;  3MHX A;  4V2S A;  2JTF A;  3SDZ A;  4DQ2 A;  2ZPH B;  2FHD A;  4N4I A;  3OYI A;  3JCM d;  3CCM T;  3M5A A;  3M53 A;  1WQ7 A;  5GAM h;  4NL3 A;  1M5Q 1;  3CBM A;  3SWN C;  3CXC A;  1VQM A;  3OYE A;  2DJZ A;  4JS4 A;  2CZ7 B;  3RKY A;  1G3T A;  2VC8 A;  4M75 D;  2ZPB B;  1NE8 A;  2E65 A;  3RIR A;  4HNV A;  4M77 C;  4C92 A;  4FL6 A;  1YIJ A;  2LT4 A;  4J6Y A;  4II1 A;  3CCE T;  1LJO A;  4IKF A;  2OTL A;  2D9T A;  1ZHI A;  1GXI E;  3TEE A;  3R6O A;  4C8Q G;  1BI0 A;  4F7U A;  2LTO A;  5GAN 5;  3X20 B;  3X25 B;  2XID A;  3MEV A;  3P8D A;  3S3O A;  1YJ9 A;  2DXC B;  2XHC A;  3CCU A;  5CAI A;  1WQW A;  4N0A C;  4EMG A;  2XDP A;  2EAY A;  3AHU A;  2RK1 A;  3NTK A;  1NJI U;  4M7A C;  2IVW A;  2DD4 B;  1BYM A;  5GMK h;  2RA2 A;  2KR6 A;  4M7D A;  2E6N A;  3M4G A;  4C8Q F;  3OS1 A;  3L2R A;  2QQR A;  3BG9 A;  1RL2 A;  4QQ6 A;  4XTU A;  2MAM A;  2WSF E;  4ELZ C;  1YJW A;  3GOX A;  3X26 B;  4FU6 A;  5LJ3 e;  1QVP A;  2EKO A;  2QQ9 A;  5DY9 A;  5A2Q E;  2RJF A;  3OA6 A;  2KDS A;  3OY9 A;  5FU6 B;  3CC7 A;  2D0Q B;  3RKW A;  2LQ8 A;  1VQM T;  3V7R A;  2HD0 A;  4M78 G;  5LJ5 f;  4BE2 A;  1LOJ A;  5GAM e;  3BY7 A;  3JCM J;  4HA8 A;  3RKX A;  3OYN A;  2DTO A;  4M7D C;  3P8B B;  1YIJ T;  2DTI A;  2QQB A;  5D6W A;  3JCM h;  2BIV A;  3LGF A;  4OF1 A;  4Y91 A;  4FT2 A;  3WVE B;  1K8A U;  5CKD A;  3E19 A;  3FC3 A;  1Q81 U;  2OTL T;  1G3Y A;  4C92 F;  1RI0 A;  4M78 F;  1X6O A;  2PVO B;  3CCU T;  1YJ9 T;  3H8Z A;  2QDJ A;  4EMK B;  5GAO m;  1AHJ B;  2D6F A;  4MIM A;  4X34 A;  4A54 A;  1NPP A;  1XTD A;  2MI6 A;  3BFM A;  3CCJ A;  3QDR B;  3JCM V;  2X35 A;  4XU2 A;  1B34 B;  2DO3 A;  1VQ5 A;  3QO3 A;  3L2Z A;  5CCA A;  4M75 C;  1Y96 B;  3M58 A;  4FSX A;  1XQH A;  2VGM A;  1HK9 A;  3JCM W;  2E6Z A;  5GAN f;  4C8Q B;  3SB2 A;  3GPL A;  2GCX A;  1VIF A;  1M1K C;  1YJW T;  4P5N A;  4C0G A;  5FRN A;  5A0D A;  3C95 A;  2YLB A;  2G77 A;  3CCV T;  1VQN A;  1G3S A;  4ELJ A;  3CC7 T;  4R56 A;  3DB4 A;  2A7Y A;  4PJO E;  1KQ1 A;  3PIP A;  2OTJ A;  3C12 A;  4BB7 A;  4BDZ A;  2RHZ A;  5GAO q;  2CKK A;  3OQ5 A;  3I56 A;  3CD6 A;  2ZZD B;  3KXT A;  1VQP A;  3QYG B;  3JB9 D;  3UWN A;  3CPW S;  2M1H A;  3QYH B;  2EQU A;  3RMS A;  4QSH A;  1E7P A;  1U1S A;  4BD3 A;  4DOW A;  1H64 1;  4C92 B;  4RCC A;  1QVG S;  1D3B B;  2AHJ B;  3OS2 A;  4MDW A;  2XG8 D;  5M9O A;  1M90 C;  2E12 A;  3A8G B;  4ME7 A;  3V7S A;  3CCJ T;  3HFO A;  3PMI A;  4J83 A;  5CIU A;  4HCZ A;  5AYF A;  3OYG A;  2PQW A;  4XTW A;  3QBY A;  2EQM A;  2KAF A;  2M0O A;  2RD1 A;  3OBY A;  4C0F A;  5CK9 A;  1VQ5 T;  3A8O B;  5LJ3 f;  1G5V A;  4TVR A;  5J26 A;  3HSB A;  3LH0 A;  2RJE A;  1ZQ1 A;  3JRZ A;  3M59 A;  4JRK A;  4O5V A;  5KE3 A;  5D6Y A;  2K5L A;  2LNV A;  3JCM Q;  3OYB A;  2K5I A;  3L2V A;  1QVF A;  3VJP A;  4C0D B;  4B9W A;  3LWH A;  4QQD A;  5CVI A;  2DZ9 A;  1VQN T;  2R5A A;  4C0Z A;  4HCB A;  1M8V A;  3L2U A;  2RO0 A;  5GAM f;  4L59 A;  4LDX A;  4XU0 A;  3SWN A;  3QHS A;  1YHQ A;  1N6A A;  2OTJ T;  4HNU A;  4HLQ A;  2B8A A;  1QP3 A;  3UPU A;  3RES A;  3E9G A;  4J5Y A;  4AKH A;  3I56 T;  2ZPI B;  4JX4 A;  5C6S A;  3QJY A;  4NC6 A;  1VQP T;  1N8R U;  1W2B A;  3NFC A;  4M78 D;  4M77 A;  2E10 A;  2HBP A;  5KE2 A;  4RCB A;  4C92 E;  4DOV A;  2JOY A;  3EFS A;  4LDY A;  4BUG A;  4ATO A;  4LDW A;  3OW2 S;  3M56 A;  3MP6 A;  5J39 A;  1N27 A;  4F7U E;  4BBR M;  4N0A A;  1N9S A;  3TRE A;  4J7I A;  3CXC S;  4A4G A;  3V8K A;  3PT9 A;  2DIG A;  4M7A A;  1QW1 A;  5LJ5 g;  4XU3 A;  2RHI A;  2V8I A;  4PJO F;  2R5M A;  2LVM A;  1VQO A;  3LLR A;  1Y71 A;  2XD0 A;  2O4X B;  2ZPG B;  5FRO A;  3FB9 A;  1VQL A;  2K57 A;  2HQX A;  5GAN 2;  4M7D E;  3ASK A;  1M1F A;  3BW1 A;  2LX9 A;  4JRI A;  3JCM b;  1OI1 A;  2QXF A;  1M1K U;  4BY6 C;  5GAO r;  5FU7 B;  4A4F A;  1YI2 A;  2P0Q A;  2VUB A;  3VUB A;  3G4S A;  3A8L B;  2EQJ A;  1K9M C;  3VV0 A;  2CS7 A;  1YHQ T;  4OP0 A;  4MFD A;  1X01 A;  4KUD K;  3HFN A;  3VKG A;  1N9R A;  1YBY A;  5EJC A;  4WF2 A;  2DXB A;  1Q82 C;  5GAN 8;  1O9S A;  4HCC A;  2LCC A;  3A5Z B;  4KBM B;  3TCJ A;  3VKI A;  4QW2 A;  2K4Y A;  4ELY C;  3L2W A;  4ZTJ A;  1UGR B;  3CEY A;  3HPW A;  3QJ6 A;  2VXF A;  3JCM f;  5GAN g;  4XQ3 A;  1I4K 1;  3GNG A;  3DL1 A;  4OB1 B;  2V8K A;  3QG1 A;  3QPH A;  3RMQ A;  1VUB A;  4AI6 A;  4J8O A;  2L89 A;  4LOC A;  3OYH A;  1KQS S;  5HKC A;  3CCV A;  3HHT B;  2ZPF B;  4MFE A;  4IUU A;  2QQA A;  3TW6 A;  3GNF B;  1LNX A;  3CMA A;  3QSU A;  3OSV A;  2QDY B;  4J6W A;  5D6X A;  4C92 G;  3FJP A;  3HB9 A;  3PMT A;  2RH2 A;  5I2M A;  2P4T A;  2XKO C;  1BI3 A;  2P0P A;  1VQO T;  4OB3 B;  4M75 A;  4F7U G;  3GP8 A;  4PJO B;  1XNI A;  5GMK m;  1VQL T;  3X28 B;  3LW5 E;  3N5B B;  2L3R A;  4M78 C;  2E64 A;  4IUQ A;  3M57 A;  3VUZ A;  2NLU A;  5DM7 R;  3MP1 A;  4BDY A;  3MCA B;  1S72 A;  3L42 A;  1VQ9 A;  4OB0 B;  2QQS A;  4FT4 A;  4JUV A;  2JVV A;  4N4H A;  3J80 E;  5A0G A;  1YI2 T;  1K73 C;  3G4S T;  3JCM X;  2X4J A;  3HKS A;  4GLK A;  3MP8 A;  5CKE A;  1Q86 C;  4HNT A;  3OS5 A;  3I55 A;  4M7D G;  3HL8 A;  1XOV A;  4PNO A;  4F7U F;  2I2L A;  1OZ2 A;  3QKJ A;  1Q86 U;  3OYF A;  5CQY A;  3VYG A;  2DK3 A;  4UC4 A;  5LJ3 g;  3SWN B;  3JCM P;  1Q7Y C;  2H3J A;  2DTH A;  1WJR A;  3V7C A;  1FXX A;  4PLI A;  1M1G A;  3FIF A;  3URG A;  3OBW A;  4M7D F;  1KC8 C;  5GAO p;  3CMA T;  3OB9 A;  5GAM g;  4Q5W A;  2CYZ B;  3FEO A;  2LQK A;  3FRN A;  4JDS A;  5GMK i;  1O75 A;  5IAY A;  1R8O B;  4OGC A;  2F5T X;  1QP2 A;  1SSF A;  3HP9 A;  3OYY A;  3S3M A;  1K8A C;  2VYT A;  2JN0 A;  3CBO A;  3OYJ A;  3UT1 A;  3CCS T;  2A3L A;  1VQ6 A;  4C5G A;  4OGE A;  5J3B A;  4BAC A;  2DD5 A;  2RI3 A;  2M16 A;  2R57 A;  1FKM A;  3ZEH A;  1VQ9 T;  2KVQ G;  3SD4 A;  3V8L A;  1JB0 E;  5GMK j;  4J7F A;  2DD4 A;  4A4K A;  5DLQ E;  3I55 T;  4C8Q D;  4LD6 A;  3CPF A;  4HL4 A;  1NZ9 A;  2ZPE B;  2DKG A;  4F7U B;  1K9M U;  3OYL A;  4QVZ A;  2MMP A;  3HRS A;  2QA4 A;  4OB2 B;  3H6Z A;  4XAX B;  2CZ0 B;  1BIB A;  1WNL A;  5GAN 4;  4MZT A;  4X9C A;  2EQK A;  2JUF A;  3NTI A;  4E7J A;  5IT9 E;  3GIB A;  2EJG A;  4CRI A;  1Q82 U;  3CC4 A;  2CZ1 B;  3M54 A;  4HKE A;  3CME A;  4M77 E;  5I2S A;  1WGS A;  3PGG A;  2DXB B;  5A0L A;  3DB3 A;  1YIT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...