2CZ5A

Crystal structure of orotidine 5'-phosphate decarboxylase from pyrococcus horikoshii ot3
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
208
structure length
208
Chain Sequence
MIVLALDVYEGERAIKIAKSVKDYISMIKVNWPLILGSGVDIIRRLKEETGVEIIADLKLADIPNTNRLIARKVFGAGADYVIVHTFVGRDSVMAVKELGEIIMVVEMSHPGALEFINPLTDRFIEVANEIEPFGVIAPGTRPERIGYIRDRLKEGIKILAPGIGAQGGKAKDAVKAGADYIIVGRAIYNAPNPREAAKAIYDEIRGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal structure of orotidine 5'-phosphate decarboxylase from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Lyase
total genus 75
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2cz5A00
3NQ7A 4OU1A 1NEYA 2Y62A 3LCFA 5BW6A 1S5WA 2EF9A 1OFOA 2R14A 4IMGA 4GUIA 5L6UA 3W85A 4GXMA 1OVDA 4HN4A 5AHNA 3S6DA 3FJ6A 4HIBA 1UBSA 3GLCA 3LLFA 3RNDA 4M7TA 4UTMA 5K4ZA 2TPSA 4C1KA 2ATSA 1TQJA 4O0KA 3W7GA 1ZFJA 1ME7A 1U5JA 1X8FA 2BZNA 3G1AA 2Y7GA 2ISWA 3LXAA 1AW2A 2Y63A 2NWSA 4RZ5A 1W3TA 1MO0A 1XBZA 3RK8A 3LRMA 2GJLA 1MEIA 1SFLA 4AXKA 5F2LA 4LY8A 3KRZA 4O14A 4O19A 2QUUA 3CPRA 3QSRA 1ME8A 1CW2A 3UD6A 4WY0B 4Z1CA 2ISSA 3TMQA 1FX6A 1JCNA 4IPIA 5C54A 4O1DA 3W7PA 4MUZA 3KXQA 2YYTA 4JTGA 3OA3A 6TIMA 1M7PA 2F84A 2CLKA 2V81A 3TC7A 1I2OA 1KV5A 1RQBA 4KFPA 1EA0A 3NNTA 3F4WA 2VEPA 4FNRA 1IIHA 4BWLA 2V82A 3W7HA 3E02A 1X1OA 3WK0A 1B4KA 4GC4A 3MP5A 3IVUA 2ZZ7A 5EY5A 3T55A 3MP4A 4K7YA 1I2PA 4PCFA 5CZSA 2QCCA 3L5LA 5I3KA 1KFJA 1P0KA 3ABOA 3PB0A 5H91A 2OX1A 5F2MA 3GDKA 4ADUA 3L21A 3NQ2A 4CQAA 1EP2A 3W1MA 2FQIA 3C52A 4GFSA 1LDCA 1GVRA 2CZ5A 1OHLA 4O54A 4QNWA 3F4NA 2ZRVA 2QAPA 4TR9A 2E68A 1Q45A 2V30A 1OK6A 1OG0A 4CNOA 3MBFA 3N3MA 2BLEA 2HS8A 3TR2A 1TQXA 1SW0A 4XWUA 3STGA 2TRSA 3NQGA 2B0MA 4DEFA 3PSWA 3W7QA 2X1SA 4ORMA 4DQWA 2J27A 4R34A 3HMJG 4N4QA 3TSMA 1YTEA 3EWBX 3RFAA 3UWWA 3A23A 3LI1A 5CG7A 5D30A 5BNKA 4O57A 4EF8A 4UCGA 2HS6A 2AQWA 4O8RA 1OYCA 3CLMA 3AO0A 1SPQA 4H6KA 1Z44A 2NUYA 4WX2A 3EX6A 1K8XA 3QRHA 2WJZA 4LVAA 2QR6A 1LOQA 3G0XA 3S1WA 3O63A 4DF1A 1TPVA 1QNVA 1HTIA 3S1UA 1RQEA 4JIQA 1WOAA 3TFCA 3W1XA 2RH9A 2E6AA 2YFNA 3KOFA 4E2BA 5CPLA 3NQ8A 3PVFA 1KFBA 1TTQA 4YLWA 4I7WA 1DHPA 1VC4A 2GUUA 2D73A 1F73A 1EPXA 3L68A 1XDLA 3W74A 5FF0A 3GKAA 1VYPX 3STCA 4Y96A 2BTMA 4WUIA 1XM3A 1BKSA 1EP1A 2C16A 3OVPA 1GJPA 1ZCOA 5I3HA 4Q33A 4GRSA 4O1AA 4CCEA 1DJNA 4MZ1A 1LOLA 1L6SA 1AMKA 5EMUA 4JNMA 5A8GA 2Y61A 1SU5A 4OWGA 2A6LA 2VENA 1YDOA 3E0IA 3HQ1A 3IIVA 2A1YA 1A5CA 3IVTA 4JTSA 1KM1A 3EX2A 3A5FA 4N4PA 3TMLA 3WJSA 3ZS4A 1HO1A 5HWMA 5E93A 3UPBA 3W2JA 4DBDA 2PRLA 4ZQNA 4ZZ9A 4KFNA 3NQCA 3EKZA 1IF2A 2I1OA 8TIMA 4RLIA 2A0NA 1YXCA 1X7FA 2EHHA 5D2WA 4FB7A 4O1BA 1PVNA 3ATZA 4JGDA 1AG1O 4HPJA 3N9RA 4BR1A 1B4EA 1O5KA 3GNDA 4Z0SA 1OFPA 4FX6M 3TSDA 3PBUA 1AW1A 1TRDA 5AN7A 3NR0A 4L4LA 4JXCA 1XBYA 1L9WA 3HGSA 4N9EA 4QIUA 1H51A 1TTIA 3G1DA 4FNTA 3B8DA 2O7QA 2FB3A 3SY5A 4KWVA 3QYQA 3E12A 3EWUA 3STFA 3P61A 1WYIA 3CIWA 4IGHA 2H3DA 4UXDA 1QOQA 4XKYB 5D03A 1KBIA 3HG3A 4QM1A 3QJAA 1UJPA 2W0UA 2ZA3A 3N14A 1OFQA 3V75A 3LBCA 4Q4KA 3VCRA 3UWUA 4YWIA 4AF0B 4YL2A 1LP6A 4NZJA 3P74A 3H55A 4BWLC 3L66A 2ZRWA 2NXGA 3C4UA 5J5DA 3O07A 4AHOA 1FY6A 1TPDA 5BMWA 4K7VA 2DZXA 1LBMA 2H3BA 3CWNA 1YPFA 1MSSA 4UMAA 2OCZA 2YPIA 4N9BA 4A2SA 3NQFA 3PF3A 5F2GA 1GPWA 1VCVA 2F7FA 4FXRA 2FB2A 2ZRZA 4HSOA 2YXGA 3A21A 5F4XA 3O06A 4GUGA 4UFMA 4XBKA 1G4SA 1GWJA 2C14A 1JCXA 4XTIA 2G95A 4GUHA 1WAUA 2OJPA 1F6PA 2ABBA 3LHTA 3SW6A 1FXQA 1LROA 4XUGA 4GUJA 4QQ3A 5D04C 4LV9A 3B0UX 4JTLA 1FCBA 2YZRA 4ZQPA 3NPVA 3M47A 2CZEA 3JS3A 2P10A 3FKRA 4R53A 1KFKA 4BI5A 5KINA 3KRSA 2VXNA 3CB8A 3S5OA 2VFIA 3FIGA 2OMAA 1TTPA 3G8EA 3GR7A 3HPXA 1TSIA 2CZFA 4C1LA 3W6YA 1I2QA 1ZY9A 1ZENA 3NL6A 3LV5A 5K9CA 2Q3RA 4RZ4A 4UFKA 2JKEA 5H2ZA 2NLIA 1TV5A 3TXVA 1RZMA 1I2RA 3W2MA 5KZDA 3UWZA 4NT0A 4NZFA 2QDHA 1JJKA 1CI1A 3R2GA 2RDUA 1KLYA 2NUXA 3W2NA 3EB2A 1QOPA 5CZJA 1N7KA 4MIMA 4RJEA 4UTJA 1BEUA 1KM4A 2DZWA 1QR7A 3LHWA 3I6RA 3GDLA 4AWUA 5G2WA 3NGJA 1OX5A 1WX0A 5FEWA 3GDRA 1ZAHA 2DJXA 4B5NA 3B06A 4IPJA 2VKZG 2ZBTA 3LX9A 1Q3NA 3N2XA 3W7NA 4JICA 5AC6A 1TIMA 4LVGA 5KTLA 4LRTA 3GXNA 3VKJA 3LHZA 1R2SA 3KAOA 2ZZ6A 5DXYA 2FDSA 4QAIA 4FIRA 3CWOX 1CX9A 2JKPA 3NQEA 5I3GA 4IWWA 4UMCA 1FCUA 1G4EA 4GNJA 4UTUA 2YR1A 4FO4A 1FDZA 2C6QA 2V0TA 3PBWA 1G4TA 3LXBA 4FXSA 5CPOA 2Y70A 5AHMA 3DAQA 3NQ6A 3P84A 3M5XA 3SR7A 4O15A 1S5VA 1XFBA 3NQMA 5EKYA 4UR8A 3L0GA 2J9XA 3R8RA 1XBXA 1R46A 1SO4A 4RZ6A 2G96A 4UTHA 2WO5A 4FNPA 5FEZA 1Q6QA 1F7BA 2GOUA 4IJBA 3TAOA 1EP3A 1TO3A 3MHUA 4KFOA 4BI7A 1OYAA 2X1UA 3HPZA 5LNRA 3NQAA 3IIXA 3LTSA 1F2JA 3UZJA 2OT0A 1QPOA 4CLMA 1M7OA 1NAL1 1PCWA 2A7NA 3UY8A 3LBMA 3HO8A 2CLMA 4NXSA 5CPNA 2I9EA 3CC1A 3ZR4A 5BMXA 1DBTA 2CZDA 3MI3A 1UASA 3TSBA 4R33A 1VPXA 3PM6A 4AEOA 1F74A 1ZHAA 4PFMA 1PCKA 4MY9A 3QQ0A 3DFOA 1W31A 2CLFA 4AHQA 4UIOA 3P5YA 3GR8A 3P82A 3W1TA 2ZQ0A 3OVQA 3R5EA 3TX9A 3FLUA 2E5CA 5FF7A 3N34A 1L6WA 3O8AA 5KZMA 5E0KA 3PBYA 3TUUA 4ZL1A 2PURA 1QPRA 4UMBA 1GYLA 4W9TA 4K6AA 1LYXA 3MP3A 3G0SA 2CLIA 1LOSA 3GZ3A 4JTUA 3VI2A 3HF3A 4OQVA 3TNOA 3I65A 4O10A 3GVGA 4Y8FA 3ZWSA 3ANYA 3A5VA 3W75A 1XUUA 3O1NA 1H63A 4JTEA 2O7SA 3W23A 3NEVA 3TE9A 1FCQA 1GTEA 4D2JA 3P8IA 3IIZA 1YTDA 3TA6A 4HKPA 4K39A 5AC8A 3THQA 2C19A 4EIVA 3VE9A 4E2DA 1KM5A 2E5BA 3G1YA 4O11A 1OX6A 3A9IA 2A4AA 4FEZA 1Q6OA 1R30A 1O5XA 3DH7A 5DBTA 2WSYA 3W7IA 1W5MA 3NPXA 1QCWA 1SW7A 1QMLA 5LNWA 1JR1A 5LHFA 1JULA 1RPXA 3BG5A 3PULA 2HTMA 3TXZA 4BK9A 4JX6A 3P60A 1TPB1 3FA5A 1KM2A 4RXGA 1Q6RA 3Q58A 3DI0A 4FIQA 3D0CA 1D3HA 1XL9A 1H1ZA 4JIPA 3PY2A 1JCMP 1JUKA 2PRMA 2NX9A 3DFQA 1G67A 1A53A 3INPA 1QAPA 1GG1A 1O4UA 3LV6A 1NVMA 2YX0A 4MZ8A 5L9FA 2G5WA 3UXAA 3P8JA 1DV7A 3WFAA 1VGAA 2QEZA 1TYGA 1TJRA 2XN0A 2RHGA 1PV8A 3GIYA 3S9YA 3G1FA 1WOBA 3E9AA 1H7NA 3NAVA 3NA8A 3UYCA 1EWDA 3EX3A 3UWQA 3UQNA 5AHFA 1LTDA 4KKXA 3NZ1A 3PG8A 2QCDA 1GZGA 2C13A 1OK4A 3HGRA 5AYZA 3CHVA 3W7CA 3S8HA 4FX7A 3HIJA 2GVGA 2VFHA 1FQ0A 5I3FA 1L2UA 1AW5A 1K8YA 3RLUA 1K03A 2ZA1A 3W7LA 4O1CA 4UNKA 3W87A 1G6CA 3B03A 3GDTA 3W76A 3T4CA 2AAMA 2Y7DA 5CPMA 4N9DA 2CLEA 4HPXA 3MI6A 3DBPA 2PRHA 4LUJA 3TDFA 5LNUA 1VR6A 2QCMA 3UWYA 1YDNA 4AWSA 4WOZA 1FBAA 5HQEA 3BW4A 1F6KA 3UZ5A 3OHIA 2X2GA 3M6YA 3MO7A 1VS1A 3FYOA 2ZRYA 5LSMA 5E1QA 4TO8A 1VH7A 3ZFHA 5AOUA 3P7YA 2W79A 3BW3A 3BG3A 1GOXA 4JYDA 3CIXA 2E1DA 1QPNA 1OX4B 4UTLA 1KM0A 3PB2A 3BW2A 4ZQRA 1TPWA 1DJQA 2WNZA 4JTIA 4EOUA 4EVZA 4FNSA 5HWNA 3QFEA 3GNNA 4GE8A 3BLIA 2VEKA 1H7WA 1WBJA 1EWEA 2VELA 2ZZ3A 2WPBA 1MEHA 4A3UA 1TCDA 3M44A 2E09A 4TIMA 3NPWA 1PS9A 3S0CA 4WY0A 3WK3A 2ATMA 1LCOA 4O50A 5HMSA 2WV8A 1J2WA 1B3OA 5KZEA 5FEPA 4IMEA 4DBEA 4HT3A 4MY1A 4NJHA 3USBA 3W22A 1UB3A 3QPYA 2GJNA 2Y85A 4G1KA 5F4SA 3TQ0A 1GTHA 4YMZA 1KW1A 3M5VA 2E6YA 3F03K 1GVOA 1PHWA 2EAWA 3QEZA 4QSHA 3TW7A 1LBLA 3L2IA 1HG3A 2G97A 3NL2A 3DI1A 2DZVA 4Y9AA 5I3JA 4IMCA 2VFEA 3W1PA 1OFRA 4AWTA 4MYAA 3W2LA 4HSNA 3EEGA 1SQ7A 2QJIA 2RFGA 2ZFAA 2VFFA 4O17A 3KVLA 1KTBA 3M9YA 5TIMA 3FYPA 3PSVA 2ZDRA 1R2RA 3UY7A 5J5RA 1MEWA 5KITA 3HGJA 3W1AA 4DF2A 3P67A 5DXXA 4O18A 3TKFA 4EWND 4E38A 2VFDA 4AH7A 1VCFA 3FOKA 3M41A 3LCLA 3G3MA 2VEIA 3MYPA 3KRUA 1K3UA 3NVTA 1FUYA 3EX1A 4P2VA 1W0MA 2Z1BA 3GKFA 5C5YA 5G2HA 3KVMA 4X9SA 2YW4A 4M7SA 1TPEA 1LRNA 4DF0A 2JBMA 4Q32A 4M6QA 4WD0A 1T8XA 3C2RA 2R94A 2A7PA 3LDVA 3M16A 3DFNA 3WK2A 2WNNA 4XBSA 1MXSA 5D02A 5FESA 2J9ZA 1AL7A 1HFBA 1ZNNA 4NX0A 2GPTA 2B7PA 3EXTA 4DO6A 1SO5A 5AB3A 3HGOA 2QUTA 5DBUA 5D2YA 2NX1A 4LS0A 4Z08A 3W2UA 2QCGA 4JN6A 1XKYA 1BTMA 1FWTA 3M5YA 3O16A 3B0VC 2GQAA 4S2BA 2NXIA 3I7RA 1THFD 3GX9A 3LI0A 5G4EA 1KTCA 3G24A 2NWRA 3HJZA 4LT9A 3N19B 3NXFA 3MW7A 3W1UA 2ZYFA 3EWZA 4CQ8A 1DVJA 1XDMA 3SGZA 3MI2A 2V2CA 2WQPA 4IQLA 3GAYA 1H60A 3MWAA 3PWAA 5AFDA 4JTKA 5LHEA 4PODA 3SECA 1R2TA 2BSLA 3QF0A 5BOOA 5EA9A 1BWLA 2QCHA 1JUEA 3OEXA 4U28A 1OFBA 1TPFA 2V2HA 4JEQA 4FF7A 3C2EA 2UV8G 3S1XA 3FEMA 2CFFA 4JR5A 2V5LA 4ADTA 3QQ1A 4FX8A 3CEPA 5DCBA 3C0JA 4I7VA 4WXZA 4ZQCA 3JRKA 3W7MA 3SFKA 3MMTA 4AB4A 4RXFA 3RLVA 3OIXA 1SZFA 4YCPA 1G4PA 2H8ZA 5ABTA 2ZZ1A 3BGJA 1GG0A 4A29A 1SZNA 3G18A 1C29A 2NUWA 3VFLA 5LZLA 2V5BA 4K8EA 3QW4B 3N73A 3TROA 1PE1A 3G0UA 3TJLA 1WDWA 2VC6A 1RD5A 1QPQA 1VCGA 3WJYA 3E49A 4HHPA 4MJMA 1A5SA 2PCQA 3IGXA 1FXPA 2PC4A 4ADSA 4OV9A 1VRDA 3LHVA 4HNUA 2FJKA 1OF8A 3BV4A 2FPYA 3M1ZA 3TQVA 3NPUA 1SUXA 3I7QA 3W7RA 2V9DA 4PA8A 1E51A 3W84A 5DY2A 2BWGA 1DQXA 3EWYA 2EGZA 5DELA 7TIMA 4ICNA 3HG2A 3B4UA 1ZAIA 1KFEA 1EB3A 4OV4A 2H8XA 3TIMA 2ALDA 4YCOA 1VJIA 2Z6IA 4XKYA 1YXDA 1VLWA 3NM1A 5EL1A 1GVQA 3SZ8A 1OJXA 1O94A 4NX5A 3L65A 1IXQA 1KBJA 3NQDA 3DGRA 5C2XA 1W5QA 1QFEA 4LNYA 3A22A 5D38A 4AF0A 1Q6LA 2WSQA 1DL3A 4UC5A 5IBXA 5HR7A 5AYYA 2B7NA 4ORIA 1LLWA 2YFOA 1GEQA 5CGQA 3S1VA 3WK1A 1RR2A 3I68A 4AAJA 4NNCA 5T26A 1NSJA 1ZAJA 4I9AA 3TU9A 3OBKA 5AHIA 3QMRA 1I4NA 1JQXA 3PUDA 3NG3A 3RF9A 4LS1A 4Y6GA 2DU2A 3KVKA 5K9DA 1TPC1 1ZALA 1PL9A 3L67A 2BX7A 4UUIA 1GQNA 3C8FA 2C3ZA 4DELA 5K2ZA 4UFHA 4CNPA 1VHCA 4RKAA 2FFCA 1H61A 1WBHA 3SSJA 2Y6ZA 3RU6A 3IIOA 4K36A 1H5YA 1TTJA 4PL1A 1V5XA 2A21A 3GYEA 2ZRXA 4N9CA 1W1ZA 3W07A 1SZGA 1H62A 2EKCA 1H7RA 3S5ZA 3C56A 4AMAA 3M0ZA 3LCXA 4IX0A 3A24A 1P5BA 3P5ZA 1S3HA 1KM6A 4QNEA 5D2XA 1IXPA 1GYNA 4EF9A 3GXPA 1W5NA 3AJXA 4PEKA 1KFCA 4O0ZA 1Z48A 2WNQA 5U7SA 3GK0A 3NOEA 1SSGA 5G4WA 2NX3A 2X30A 2JKAA 3UNDA 1FWSA 5AHLA 4O53A 3QMSA 5D33A 4HNVA 3PBVA 4PL2A 1G69A 3BPWA 3QH2A 4JS3A 3SJ3A 1I2NA 2CLHA 4LU0A 2GVJA 1XXXA 3JR2A 3O6YX 1JUBA 3EXSA 3TC6A 4JY8A 3LRKA 2E5DA 2R91A 2QCFA 3O6CA 2DZSA 3WJXA 4Y90A 4MFEA 1QO5A 3TW6A 3HBLA 5LNVA 1YLVA 4XQ6A 1ONRA 1UCWA 2OT1A 2C0AA 1T0OA 2QCDB 3N2MA 5D2TA 2ZTKA 1XUZA 3C2OA 4MPQA 1QO2A 4N6EA 2X1RA 4QISA 1IXOA 5HUOA 5IM51 3G1VA 3W71A 3PAJA 4UTTA 4M6PA 3LLDA 4NNAA 4O12A 5BRBA 3C61A 1JQVA 1W54A 3IIPA 4E0CA 3Q37A 3TQKA 2QAFA 1F76A 2R8WA 4NUWA 3UXDA 1YYAA 3FFSA 3G1XA 4ALDA 3B04A 2RDWA 5CZ0A 1HL2A 2WKJA 3EX4A 4JTTA 4WXYA 1LRTA 5HR6A 1RV8A 2J24A 5LGZA 4O4VA 3LHYA 3NL3A 3W7DA 2VFGA 3SI9A 1EX5A 3LCWA 5DLCA 4ZVJA 3DKJA 1SO6A 4S1FA 1NF7A 2E77A 3T40A 1NF0A 4DO5A 2ZZ4A 5D2VA 1ALDA 4K38A 2FPTA 4O16A 3NQVA 5FI8A 1IGSA 1LLZA 1IXNA 4UTWA 3HOJA 1F05A 1WXJA 4LTSA 4JD4A 3FS2A 3OG3A 1VLIA 4RR4A 2PE4A 5K3VA 3FKKA 4TX9A 3VE7A 4NU7A 4NNBA 2J9YA 4LV4A 4NXKA 5AC7A 3G1SA 1H7OA 1YDVA 2W6RA 2YW3A 3DFPA 3HPSA 3L0NA 3WJWA 2DZUA 5F1UA 4WJEA 3BO9A 3T44A 4PH6A 1XI3A 3C6CA 1M6JA 3PS7A 2ZZ5A 4AVFA 1IIGA 2P0OA 5K7JA 1W8SA 3LGEA 2QUVA 2ZA2A 2J88A 4NVTA 3G8RA 3H54A 3IV3A 5IBXC 5CKSA 1MZHA 1OYBA 5EBUA 1TPH1 1VYSX 3CT7A 5MHBA 3W7OA 4O52A 2Q8LA 4WQ6A 3W86A 3LCGA 4RX0A 1HO4A 1G7VA 3NZRA 4IX2A 3NYZA 3MYOA 3W9ZA 1M5WA 5CSRA 2CU0A 4H3DA 2NZLA 3IGUA 2XFWA 5EYWA 1S5TA 4BF9A 1A5BA 2Q8ZA 4LRSA 4HNTA 1XBVA 3LCIA 3QPZA 3THAA 3ABQA 1H1YA 2XN2A 4NJGA 3TV8A 2E6DA 5CZTA 4TMBA 3LXCA 3ATYA 2HMCA 1J4EA 3CTLA 4AHPA 4MFDA 4OHQA 1FWWA 3NL5A 3W7KA 1O60A 4QITA 3HG5A 2EPHA 4WOQA 2GVLA 3BARA 5F1VA 3DXIA 2Z0IA 4GBUA 2X1TA 1FCVA 1L6YA 3PC0A 3DZ1A 4POCA 1Z42A 1OFAA 3W73A 2XN1A 5AHEA 1B9BA 5SWUA 4OBTA 1ZJIA 1VZWA 2YCEA 4IMDA 5D37A 5G1TA 5D09A 1TV8A 1RVGA 3LTYA 3YPIA 1LORA 3K30A 2QCLA 3TAKA 1D3GA 2WSRA 2YSWA 1TMHA 1GVSA 5DN1A 2CWNA 4N6FA 4KWWA 3BLEA 2TYSA 3MBDA 2JK2A 1J5TA 3L9CA 2BXVA 4O13A 3PR2A 4UTIA 1JRCA 1TREA 1N55A 2RKXA 3C3NA 1K02A 2CW6A 2Y7EA 3QW3A 3O15A 4GWEA 4IOTA 2DORA 1SO3A 4DXVA 4X2RA 4NJJA 1SW3A 5I3IA 2ABAA 1FDYA 3W72A 2I14A 4N2YA 4OT7A 1BWKA 1PIIA 3DFSA 3EWXA 1P0NA 3W3OA 4UTKA 2LLEA 3I7SA 2GQ8A 1QWGA 3MUXA 5AYXA 3FJLA 1AL8A 1W56A 4BFAA 2ZCGA 1KTNA 3EWWA 5FF4A 4YXGA 3N9SA 1DKWA 2H6RA 3M5ZA 3CM4A 4U4MA 3NM3A 3QSTA 1WV2A 3MHFA 4LC6A 2ZZ2A 3CQ0A 4N02A 1JRBA 1VYRA 1H7PA 4UTTC 3W88A 3LB0A 1OFDA 2RDTA 4QJ1A 2CLOA 1VHNA 1TJPA 3KFTA 3M43A 5D32A 4R7JA 4GJ1A 2FTPA 5F2IA 1ML1A 1ICQA 3B0PA 3DU0A 3W1LA 4DO4A 1H50A 3BVJA 2V2DA 3M7WA 3QC3A 1YPIA 3R13A 1K7EA 2X16A 4MLRA 2QCEA 3HB9A 4LC8A 2Z2UA 5HINA 4FNQA 2QJHA 3ABRA 1OABA 4A2RA 1P1XA 1I8JA 4LVBA 3W70A 2ZTJA 4J9JA 5HULA 3KVJA 1W5PA 2NV2A 5C55A 4JTFA 1G7UA 3L0KA 4WY0F 3LM7A 4ZMGA 4A21A 4NJIA 4PC8A 4CNNA 3STEA 4LW7A 2VEMA 3GB6A 3O05A 1OX4A 3G22A 4JDBA 2ZRUA 1FDJA 2NXHA 3C2FA 3TCEA 3OVRA 4UTWC 4TU1A 2J6XA 2C18A 2P1FA 3BLFA 3KHJA 1K7XA 3LRLA 2DJLA 1KA9F 4JYEA 5G1YA 2TSYA 3QMTA 4UFIA 1DOSA 1C8VA 1W37A 1JCJA 1X6UA 3Q2DA 5LNSA 4JTHA 4NJKA 1AK5A 5HUPA 1EUAA 3TJXA 1W5OA 2YYUA 3CEUA 3O6DA 4LS2A 2A5HA 1KFLA 3IGSA 4MOZA 3LTPA 4CCDA 1JCYA 5K9XA 3W1RA 1EUNA 1Y0EA 3Q94A 1JVNA 4M6VA 5D05A 1C9DA 3S5YA 1TPUA 2QJGA 1VQTA 2GQ9A 5KSWA 3GDMA 3E96A 1DQWA 1ADOA 3EKLA 5K4XA 1GT8A 2QDGA 3HG4A 2FIQA 4M5PA 4ZQMA 4BI6A 1SSDA 1YADA 3W83A 1B57A 3CU2A 2HSAA 3R12A 2JGYA 2C15A 1YXYA 4MKNA 3BG9A 4LWWA 4DPPA 3S5NA 5DCEA 4NQ1A 4L4MA 3NO5A 3TH6A 3BGGA 3SGUA 1WA3A 3U2OA 4MYXA 1DORA 4I7UA 4MY8A 4X3ZA 1R47A 5G2IA 3U6WA 1K7FA 1WQ5A 1EEPA 3P62A 1XCFA 4JX5A 1V7YA 3DHDA 2YDAA 3G3DA 4LUIA 4MJZA 4IUOA 2DP3A 3B05A 1I45A 4P61A 1TRIA 3W7JA 1N8FA 3S42A 3IVSA 3PUOA 3LHUA 2Z6JA 3NDOA 2Y89A 4ONVA 2OZ0A 2QF7A 3VNDA 4FNUA 1P4CA 1HUVA 2Q3OA 1TV7A 3MJYA 4LVDA 1KV8A 1UUMA 3TFXA 3QZEA 4JYFA 1T96A 3W1QA 4OE7A 4UFJA 2QCNA 2TMDA 2AGKA 3ELFA 1NFBA 2WOQA 5FF2A 2A6NA 2FLIA 5G5IA 1YTKA 5C6MA 1GVFA 3P80A 1LZOA 2B4GA 4ZQOA 1QDSA 1O95A 1LM1A 3PG9A 2NV1A 1SR9A 1OF6A 2DZPA 2Y7FA 1SFJA 2CLLA 3P81A 4UFLA 1X1ZA 1UUOA 4XZ9A 3W1NA 3WJZA 5A5WA 5GVJA 4OGZA 1ME9A 3C2VA 4DPQA 1JCLA 4H4IA 5LKYA 1SZEA 3DHFA 4M19A 3L5AA 4CQ9A 1KM3A 4WZHA 4O28A 3BK0A 4UR7A 3UWVA 4IXHA 5HJLA 2B7QA 3RMJA 1LRQA 4S2CA 3KX6A 5HWJA 2VOMA 1KLZA 5DY3A 2JGQA 2A7RA 1D9EA 5FEXA 4XTDA 4CCCA 1EIXA 2QKFA 3LCHA 2DZTA 1F5ZA 4O4WA 3T78A 3DKLA 1W3IA 3MHGA 1W3NA 1A5AA 6ALDA 3QM3A 1K8ZA 2IQTA 4HNNA 2YGYA 3W7EA 5EPDA 1ICSA 4IMFA 4ML9A 2C1HA 4Z0JA 4RK8A 3GXTA 4Z1AA 3IRDA 5TBOA 2Y88A 1U83A 1OFEA 4Z1DA 3UPWA 3U8GA 5TQLA 1H7XA 2FPVA 4JTJA 4RV8A 4UNLA 2A85A 3W2KA 4JDYA 5KMYA 3ABSA 5CSSA 5DCDA 4LVFA 1RQHA 3R89A 1Z41A 5U4NA 1ICPA 3GAKA 3LOTA 2H90A 4Z1BA 5FF3A 3V1PA 4K37A 4MVAA 3EXRA 3LERA 1FWRA 4LOCA 1FWNA 1T99A 1PHQA 3IEBA 4K8HA 4IXXA 2B7OA 3H53A 4PTNA 3F1QA 4GUFA 1A50A 1LBFA 3DENA 5HNRA 3T7VA 2V8ZA 3G1HA 4A22A 3PUEA 4MLJA 4X22A 3ZWTA 3TK7A 4JX4A 1XC4A 3DFTA 4FHAA 2A2IA 5LGXA 4MZYA 3SIZA 3L5MA 2E6FA 1TB3A 4JY9A 2ISVA 4RCXA 2KZHA 5F4WA 4TMCA
chains in the Genus database with same CATH superfamily
3QHNA 3NQ7A 1NEYA 4AG0A 4C1NA 3LCFA 1BF2A 4ZOCA 5B80A 3NFUA 1UH4A 4YJ5A 4ZB2A 2A3BA 2X1IA 4GXMA 1EJWC 5AHNA 1OCJA 3ANUA 4FI4A 4PCSA 4EKJA 1A0EA 3E1F1 3ITGA 4KEVA 4PMJA 4JHOA 4KF1A 4AIBA 1AH4A 3G1AA 1BKHA 1AW2A 1SMAA 3G77A 1UZDA 3TW9A 3RK8A 4P7RA 3KLKA 4JN7A 2DDXA 1MEIA 3D3FA 2J62A 3M0LA 1TZ9A 2QUUA 4DUOA 3QSRA 4LYQA 1SR0A 1LG1A 1CW2A 3OYZA 4QGCA 4WY0B 4Q3MA 2ISSA 3TMQA 1FX6A 2ZDSA 2PLCA 4O1DA 4NG3A 3VZYA 3H6OA 3KXQA 1TR9A 1M7PA 2CLKA 5FACA 4KFPA 3MCOA 3CZJA 3S2MA 1EA0A 2VEPA 3AMCA 1IIHA 2YL6A 4XBJA 4NASA 3E02A 3W7HA 5JVLA 1W3LA 3MP5A 4GC4A 4B3LA 2ZZ7A 5EY5A 3AJ7A 2QT3A 3MP4A 4K7YA 4MHBA 4PCFA 2PDPA 4GYPA 1P0KA 2VVSA 3GDKA 1HJUA 1P6WA 1XYFA 3W1MA 2FQIA 2O55A 2X42A 4GFSA 1NARA 4QNWA 3F4NA 2ZRVA 1VD6A 4TR9A 4P7LA 2E68A 1Q45A 2V30A 3MC5A 1OK6A 4ACZA 2DSUA 2BLEA 3CYJA 1SW0A 1LT7A 3RR4A 2H9AA 1BXCA 3VOHA 2NT0A 4DEFA 1UKOA 3PSWA 1S5NA 2Y4SA 3C5QA 4DQWA 5HANA 1E6PA 4R34A 4N4QA 1YTEA 3N3TA 3A23A 5LIWX 4O57A 4J3XA 1EJSC 4WKAA 2P50A 2WHLA 4NI3A 4DHGA 4R5EA 1OYCA 3CLMA 2JEQA 2NUYA 1M03A 4WX2A 1HKMA 3R1ZA 5H1WA 2QR6A 1RP9A 3CMGA 1QNVA 1EH9A 1EOKA 1WOAA 3TFCA 2RH9A 1P0BA 4E2BA 3GD6A 1KFBA 2INFA 1VC4A 3VCNA 1BLIA 4DBSA 3CBWA 3F5JA 4M6UA 1VYPX 4NZCA 4GNKB 2PWVA 3O3RA 1O66A 1XM3A 2V6AA 2EG7A 3ABXA 3QV7A 4KEMA 4Y9NA 4GRSA 2GJXB 1DJNA 1L6SA 4JZ5A 1AMKA 2WB5A 2A6LA 3G5EA 3E0IA 1CLKA 1M9HA 3EX2A 4KH2A 3NWRA 3OGVA 1DIEA 1E70M 1F3WA 3WJSA 1HXJA 1EGZA 4DRSA 5E93A 3UPBA 3RX2A 1IHIA 3WLLA 2FGBA 3W2JA 3PFRA 2PRLA 4CN4A 4ZQNA 3KBWA 5A2CA 4U3CA 3NQCA 4C6QA 8TIMA 4RLIA 4R88A 1YXCA 2EHHA 5D2WA 4O1BA 3SIMA 1XLHA 2Z27A 3TJIA 3C8NA 3AI0A 3N9RA 4BR1A 1B4EA 3FVMA 1DJZA 5CQ1A 1OFPA 3UCCA 4F2BA 2CPUA 3W38A 3I3DA 4C6LA 2OZ8A 1L9WA 3N15A 4P8WA 3EPNA 5DMLA 1TTIA 4HK5A 1L2QA 3BURA 3HV8A 2O7QA 1ENUA 2TODA 3I6EA 1W3JA 3SY5A 4KWVA 3E12A 2YBVA 1QW9A 2PZ0A 3P61A 2H3DA 1V6WA 1OFQA 3TN3A 3PBGA 4Q4KA 1E9IA 5DT5A 4IPNB 1LP6A 1O5QA 4GGHA 2ZX8A 2OYLA 3T08A 3VKAA 3ZVHB 2DSZA 4AHOA 1TPDA 3B9NA 3II1A 4NSBA 3E2VA 4GYPC 4I5XA 4DJDA 3CWNA 1EJRC 1MSSA 5A6MA 3RLGA 1K6WA 1XRVA 4A2SA 3NQFA 5F2GA 1ZS2A 4QLKA 2EXOA 1DPMA 3A21A 3O06A 3M64A 2DT0A 4GQRA 4UFMA 3GVRA 4JFTA 4PMZA 4BZYA 1F6PA 4QJ4B 3QOKA 3VNIA 4CCZA 4QQ3A 1J11A 3B0UX 3L4ZA 3IARA 4J3TA 4WK9A 4PMDA 4Z2IA 1IR1A 4RDYA 1EKOA 3OO2A 2CZEA 3JS3A 2P10A 3FKRA 5KINA 1KFKA 1QW8A 4NI8A 3G1RA 3S5OA 2OMAA 1TTPA 3ZOAA 3HPXA 1JZ7A 4YN5A 3E2QA 4NZ4A 1I2QA 1ZY9A 2SFPA 3N12A 1U1HA 3NL6A 4RZ4A 2QVNA 4F0MA 1PKLA 1JPIA 1P0DA 1RZMA 4E2VA 4OBSA 2WSPA 1XJBA 5KZDA 4NT0A 3BLDA 1JJKA 1CI1A 4S3FA 2WNWA 2QYGA 1W91A 2DSWA 5BWFA 2RDUA 2YXXA 4J27A 1LF1A 2YLLA 5IRPA 1QOPA 2J7GA 2O9TA 5CZJA 4Q8PA 1J0KA 2XHYA 4MIMA 3WLNA 4FLQA 7REQA 1PIFA 3LHWA 2EQDA 3GDLA 1UKSA 1WX0A 2ZBTA 3N2XA 2XWDA 1HJWA 1CXLA 2WC4A 1J93A 4WSKA 3PZOA 2DVXA 1R2SA 1Y8BA 2ZZ6A 2GK1B 4F4RA 4KQNA 1CX9A 2JKPA 2O9RA 1OD0A 4IWWA 4UMCA 1FCUA 1UC5A 1UR4A 4HN8A 3CAQA 2Z1VA 1FDZA 2D2JA 5ECVA 2VC9A 1E4LA 1QI4A 4M8UA 3ENLA 3UXKA 4W8LA 3M5XA 1F61A 4O15A 1XFBA 3NQMA 1D8WA 1A0DA 3H7VA 4GH1A 2YA0A 1R46A 1SO4A 2G96A 3OP2A 4UTHA 1W9VA 3MVTA 5FEZA 1Q6QA 3EMQA 1LUCB 3HU7A 3SM0A 4IT1A 5HATA 1TO3A 4YVVA 3TOYA 4KFOA 1EZ2A 2X1UA 1OIFA 1VFSA 3UZJA 3RRAA 1XKJA 3MPGA 1BGGA 2A7NA 4Q8VA 4GC3A 4PCNA 4W5ZA 1VEMA 4A8IA 3C86A 3CC1A 4IL0A 2WVVA 5EFFA 1ZBCA 1DBTA 3RUBL 3MZNA 1BVWA 2HPIA 1OC7A 3TSBA 4DJEC 1J8VA 1TMQA 3PM6A 3K8LA 3OLIA 1JCTA 2QIIA 4OIFA 4YTQA 4PFMA 1TV2A 3GXMA 3QQ0A 2CLFA 3TONA 4REQB 2C7FA 4R9XA 3GR8A 3W1TA 2AQVA 5D8WA 3P2VA 2PDMA 3WLHA 1HF6A 1L6WA 5KZMA 3NJ3A 2GDQA 4NAFA 1GOIA 4AZCB 1R8LA 1V3KA 1S2TA 1QPRA 4UMBA 1G1YA 3WBXA 3MP3A 1XFCA 4YYCA 3I65A 3RILA 5H8UA 4HOWA 9XIAA 4DJDC 4Y8FA 3A5VA 3AAMA 4Z17A 4RL3A 1ITUA 3K5XA 4HMEA 1RA0A 1V0MA 3P8IA 1NELA 2PZNA 3AIBA 5AC8A 1XHGA 4EIVA 3TTYA 1KM5A 2E5BA 1I60A 1JDFA 1Z6KA 1Q6OA 4C6MA 1XX1A 3H7RA 4JCLA 1W5MA 4QS5A 3OJGA 3NPXA 1I9CB 1FWCC 1SW7A 4R7OA 3TYZA 3U7VA 1B3VA 3EAUA 3ITCA 4HZ6A 5LHFA 1RPXA 3AYSA 3BG5A 3QPEA 4DWSB 2VUYA 3P60A 2WWDA 1EEXA 5A95A 1AQFA 1QI0A 1VBGA 1KM2A 4B9YA 4IGNA 2PDLA 4LAMA 4AZGA 1FKXA 2OLSA 1EGMA 1KFWA 4GFIA 1XL9A 2OEMA 1JUKA 2PRMA 3MKVA 2V5CA 1G67A 3INPA 3HMCA 3WLQA 1R3WA 3MB9A 3FA3A 1GG1A 4XZHA 2G0WA 3BJSA 3UXAA 4B16A 3WFAA 2QEZA 1TYGA 4U10A 2RHGA 3GIYA 2ISDA 3NAVA 3VPLA 3H7UA 3GVWA 3KZSA 3CO4A 1EBGA 4PULA 3T6CA 1GNXA 3NZ1A 1HQTA 2VWTA 2QCDA 1GZGA 2C13A 1G0CA 3HGRA 3CHVA 2XTKA 3S8HA 4NL1A 2GVGA 2IPJA 1FQ0A 5I3FA 1UUQA 4O1CA 4UNKA 5MKGB 1MQPA 1VRXA 3NQBA 5REQB 4GI9A 3UXIA 3WF2A 5CPMA 4C6NA 1XINA 4HPXA 4UZSA 3DBPA 3TDFA 3M07A 2YB1A 1VR6A 3UWYA 4HD5A 4AZBA 1IWAA 4WOZA 1FBAA 3OHIA 4B3ZA 3MO7A 3K46A 1KQYA 1JL8A 3GFZA 3PPGA 3VIIA 1NQKA 2QUNA 4Q4PA 1E3XA 2FDMA 4JYDA 2G4JA 1QPNA 3PNUA 2HDJA 4UTLA 4LF2A 4BEUA 3CGTA 4IPPA 2EPOA 1DJQA 2P88A 4JIEA 4EOUA 1MDRA 3T81A 4D71A 3GNNA 3UJEA 1GKPA 1LWJA 1EWEA 4C6DA 3MY9A 3NYDA 3N17A 2AGTA 2L5HA 1B2YA 1PS9A 3S0CA 5J8LA 3WK3A 4O50A 4KETA 1UWRA 3BCJA 3GTXA 2CIPA 4PMXA 4MY1A 4MWAA 1F6YA 4NJHA 1P48A 3QPYA 1ZJAA 4WDUA 4YMZA 3QZAA 1EQPA 3M5VA 1O5RA 4B5UA 1GVOA 1PHWA 3A47A 3QEZA 4QSHA 3TW7A 3AIQA 3UWEA 2QPXA 2YCLB 3UZZA 4Y9AA 4OECA 4KEUA 5PTDA 1OFRA 4AWTA 5M5DA 2UY2A 4MYAA 2HVMA 3ARVA 5D4YA 3M9YA 5TIMA 3PSVA 3CPGA 2GZXA 1MEWA 4O18A 1PKYA 4D6EA 2VFDA 4HA3A 3MYPA 2VEIA 1J0JA 1GOKA 1DWGM 3W00A 1BRLB 3SCOA 4M7SA 3AHVA 1LRNA 2JBMA 4B91A 2FVKA 4ZE4A 1JDEA 1JFHA 3R8GA 3C2RA 1WZKA 3SCNA 3WK2A 5TAOA 2J9ZA 3WQOA 5DMYA 1AL7A 1HFBA 3WD2A 2VUNA 1ZNNA 4NX0A 4X2PA 4DJED 1HVXA 4OTKA 4JEJA 5AB3A 3SCWA 2QUTA 5DBUA 5D2YA 2MNRA 4LS0A 1DJYA 4CD7A 3PZ9A 1BTMA 1FWTA 1BTCA 3DECA 2ACUA 3QKEA 1XS2A 3B0VC 5FJTA 4EPKA 3WDRA 1QI2A 3Q4DA 5KEZA 3I7RA 2ZUVA 4GY0A 3IACA 1JD7A 5G4EA 4NKCA 1KTCA 4LT9A 3N19B 2BXYA 4X0NA 1DVJA 1XDMA 3H12A 3SGZA 1R7AA 3EBVA 3URNA 3BQ6A 3SUVA 2V2CA 3GAYA 5AFDA 3ZM8A 5LHEA 4PODA 1WXZA 3SECA 1BWLA 1HL8A 5FSEC 1CGYA 1JUEA 3VDBA 2P5NA 1W1IE 4MJ2A 1JZ4A 1JGMA 3FEMA 2CFFA 4GKTA 4PMRA 1XR2A 4YWSA 2X0HA 4AY7A 3AYRA 4I7VA 3G2GA 3W7MA 4QLLA 3MMTA 4RZBA 4RXFA 3RLVA 3TN5A 4YCPA 2PGFA 3M0VA 3N2OA 1AJ2A 2H8ZA 1SZNA 4KWOA 3G18A 2NUWA 4KERA 4GHRA 2VL4A 4EK7A 1VB9A 3CL6A 2YA2A 4ERIA 4GCXA 4PUDA 3E49A 3UXLA 4MJMA 2WVTA 1RUSA 3VIHA 1KC7A 2PC4A 4I5RA 2FJKA 3M1ZA 3S47A 3W7RA 1E51A 1DQXA 2J47A 5IHSA 4ICNA 1JDAA 3EB4A 1SJAA 3KWXA 1ZAIA 1KFEA 1FHDA 3ORWA 4YCOA 1VJIA 2Z6IA 4QJ3B 3NM1A 3VDCA 4S3KA 1KR1A 3L65A 4MWAC 3RRXA 4ATLA 3WMBA 4B9ZA 1QFEA 4LNYA 1Q6LA 4CN1A 1A3XA 1JDCA 3KCOA 4ORIA 2V69A 5C9XA 2C1IA 4XD3A 3E0VA 1NSJA 2REQA 4MNJA 1P7TA 1UQYA 3IPWA 2DEPA 3OBKA 5JQ9A 5AHIA 3J7HA 1I4NA 2W66A 4MJ4A 3RF9A 1HKJA 3KVKA 1PL9A 2WZMA 3ABZA 4XAZA 1JDDA 1JIBA 3UFYA 4AC7C 1GQNA 5BRQA 2JE8A 2C3ZA 1RPKA 1VFUA 2NLYA 4UFHA 1YNQA 1W1VA 1VHCA 1X39A 3F2DA 2FFCA 1DE6A 2E0PA 2Z28A 5CC6A 1XYCA 1RJPA 2P3EA 3KHDA 4IH3A 3IJLA 1O12A 1XCXA 3W07A 1SZGA 1H62A 1H7RA 3M0ZA 4IX0A 3BTNA 4HU4A 2J7BA 1S3HA 1U22A 1EGVA 1ECQA 3URQA 1KM6A 3CV6A 3WUGA 3BL3A 1IXPA 1YHTA 3KE0A 3GXPA 1GHSA 4HJWA 3N9KA 3NSMA 2WNQA 2I56A 3MS8A 4I5UA 3CMFA 3GC5A 4D8AA 3BOLA 3N6QA 4GQGA 2JKAA 4O53A 3QMSA 4GI8A 1FWJC 4HNVA 3PBVA 4PL2A 3CHFA 2NVDA 3SUWA 4F48A 3O6YX 5D9PA 4NILA 2R91A 1S3TC 3OYXA 3UR7A 1DTUA 2DZSA 4HK6A 2PDXA 3HBLA 1YLVA 4XQ6A 1UH2A 1ONRA 2OT1A 3WBWA 5FJOA 4GYKA 1VIZA 4X60A 2ZTKA 1XUZA 4MPQA 1V3HA 5HUOA 4GIEA 3EDDA 3G1VA 3B9DA 3U9IA 4ACZB 3PAJA 4LJ3A 3ZO9A 4LAUA 3RMEA 1DEDA 2H9AB 1JQVA 1W54A 3TQKA 1X8CA 4MKSA 1XDJA 3CUGA 1EJXC 1YE4A 4FMVA 3FFSA 3G1XA 4CQCA 3KL3A 3EX4A 1Y5WA 2QPUA 4GIYA 2J24A 3GHUA 1EX5A 3LCWA 1WKFA 4FXJA 1NF0A 4DO5A 4GI6A 4B92A 3NQVA 3RCMA 1IGSA 1PKMA 3HOJA 5CG0A 3F5LA 4LTSA 4IIDA 2JIEA 4D1JA 1NWUA 4NNBA 1EDQA 2IPWA 2ON3A 2D3LA 3G1SA 1TFVA 1IQ8A 1WKEA 2DZUA 3DC8A 3WELA 4F0KA 3BO9A 2E9MA 1PUDA 1XI3A 3C6CA 2E1WA 4LEFA 4AVFA 4H9XA 2P0OA 2E67A 3LGEA 2QUVA 1M68A 3H54A 3MKCA 3ARTA 1RAKA 5D9OA 4ZSTA 1US0A 2VQTA 1R85A 5EBUA 4O52A 2P3ZA 1VBRA 1BYCA 1JZ6A 1M5WA 3GWQA 1S5TA 1QNQA 2Y5EA 1XYZA 3A12A 3ARYA 1BD0A 1F3XA 2QQ6A 3AUJA 1UD2A 4S3CA 5HA7A 1XLFA 4FA3A 4C6CA 1C93A 4MFDA 2BOEX 4OHQA 3AS1A 3E6EA 2MANA 1O60A 4CD6A 4X61A 3OLDA 1YX1A 1L6YA 1HKWA 2EBNA 3QTPA 2PP0A 4LXFA 4B4HA 2HE5A 2YCEA 3H23A 2PDUA 1LWHA 2ZX6A 1UOZA 1CGXA 5I5RA 2VHLA 1TV8A 1PX8A 3LTYA 1E1EA 4ICMA 2BVWA 1D3GA 1RCXB 3P0WA 1TMHA 2FZBA 4N6FA 4HCDA 4D6FA 3LMZA 2TYSA 4RDZA 4ZXLA 4ERAA 3K4WA 4W84A 2GDVA 3H2AA 3PR2A 4UTIA 2RKXA 2QS8A 1ZUAX 1OT1A 3EDKA 3U2EA 8XIAA 3O15A 1YMYA 3BLKA 2WZHA 2X7VA 4C6OA 2ZUMA 5I3IA 1E1CA 3UT0A 4GQBA 1FDYA 3FJNA 3N2TA 1BWKA 4C6BA 2PLKA 1PIIA 4B2DD 1MFUA 3W3OA 1Q85A 1R3RA 5AYXA 1D3CA 3SUUA 4Q7NA 3BJTA 2ZCGA 1QK2A 1MUMA 3N9SA 1DKWA 4DI8A 1RBLA 4XB3A 1E0TA 1XLLA 1V4YA 3QSTA 4LC6A 3SRDA 3LB0A 1V0NA 2RDTA 4QJ1A 3LSBA 3KBNA 1ISVA 3LPFA 5D32A 3M43A 2FTPA 1RHCA 1ML1A 2J4GA 1ICQA 4IP5A 1H50A 3M7WA 3R13A 1YPIA 3I6TA 2QCEA 3VDGA 3PK7A 1KCKA 3WDHA 1GKQA 5HINA 4PRTA 2QJHA 5LXEA 3W70A 3PANA 4J9JA 1W5PA 2D2GA 2NV2A 2Q71A 8RUCA 3DYOA 5C55A 1E6NA 5GPRA 1G7UA 3ID7A 4NAEA 2VR2A 3L0KA 4JIRA 4LB4A 1OGGA 1PWLA 3VCCA 4CNNA 1J2BA 3STEA 1SYTA 1XIBA 1YNPA 2ZRUA 3TCEA 2R1PA 4J3UA 2C18A 2P1FA 3KHJA 4QE1A 2WW5A 1FTXA 3LRLA 1VENA 3ES7A 2GUYA 4NHVA 4DIAA 3RCNA 3VD5A 4BA0A 4FOJA 1UPMB 3MKKA 4NJKA 4FLRA 2WKLA 4H00A 1UROA 1VIWA 3CEUA 4LS2A 2A5HA 2WLZA 1JZ2A 1CGVA 3NDYA 1JCYA 4WDWA 3W1RA 3AALA 4CD4A 3KOXA 1LLOA 1VQTA 3CB3A 4GMEA 4Q4RA 1Q7ZA 3BOXA 3VNYA 3EKLA 3GIQA 4XZLX 4M5PA 2IS7A 2XH7A 4ZQMA 3GW0A 4P8VA 3W83A 3QR3A 2Q6ZA 3CU2A 3ZR5A 1W9DM 4DPPA 2GYIA 4NQ1A 4L4MA 3NO5A 1TELA 3UVIA 4QEHA 4X3ZA 1BYDA 3V36A 5HDRA 2Q09A 2OG9A 8XIMA 1EEPA 3RX4A 2INZA 4OKDA 3UZXA 4OFCA 2ACSA 2I17A 5M1TA 3VM7A 2DP3A 2G8ZA 2WVVB 3B05A 4L6OA 4P61A 1V7AA 3U7BA 1E0UA 4F0LA 3GUGA 3S42A 3PUOA 5IDIA 3LHUA 3M0HA 2YL8A 2E3ZA 2PC8A 4MMWA 1K8CA 3CAVA 2ZVIA 1DWAM 2Y89A 1CNVA 4C5YA 4DM2A 1TVLA 4ONVA 2OZ0A 5DO8A 1P4CA 1HUVA 4GX9A 3WD4A 3CHEA 2PTYA 5D9MA 1DHKA 2PI6A 4GIAA 4PMQA 4UOZA 3W1QA 4MB3A 2AGKA 4I6VA 2FH8A 4HU0A 4J2PA 2FLIA 3KTSA 1GVFA 2D24A 3P80A 5FA5A 3WMSA 4ZQOA 2B4GA 3T0CA 2VX6A 4MB5A 2KX9A 1SR9A 2YCKX 4FSAA 3E0FA 3UZWA 2YL5A 2EKGA 2WHJA 3V35A 4IF2A 2VR5A 2QPSA 3ARSA 1A47A 1ME9A 1JXJA 4H4IA 5I0DA 1SZEA 3DHFA 1FH7A 3L5AA 1IZKA 4D72A 4CQ9A 1KM3A 4O28A 3BK0A 4UR7A 3MJMA 4IXHA 2B7QA 1LRQA 2UY5A 4PTWA 2VOMA 3GH4A 2WCGA 1TMLA 5DY3A 5FEXA 4JFSA 2Z25A 3WCZA 3BZGA 4U2ZA 1XIDA 5T9BG 4R27A 2R1KA 3E0LA 2OOGA 4DY1A 3GTHA 4GQ0A 1K8ZA 3A4WA 3W7EA 4ML9A 1U1UA 4Z0JA 1HT6A 4GK8A 5TBOA 2Y88A 3GR4A 2YXOA 3VNMA 1WDQA 3DCPA 3ARUA 2GFTA 4UNLA 2CEQA 1J79A 2P8BA 4JDYA 5KMYA 2BVTA 1QHPA 3CK5A 4I9JA 4FR1A 3BUVA 2VX7A 1PSCA 4UBPC 4KW2A 3QV6A 3OLEA 5FF3A 4K37A 4MVAA 3WL1A 3LERA 4LOCA 1T99A 3ZSSA 1ADSA 3KWSA 3H53A 1H2JA 1FVPA 2X05A 1E43A 3DENA 3VC6A 3UETA 3NSXA 3SB0A 5M3WA 3SBFA 3I4EA 3T7VA 4Y8EA 2CBUA 2VI0A 4A22A 4ZO6A 2VGFA 3PUEA 1VAHA 3TK7A 4G56A 2IKGA 3LA4A 5LGXA 2A2IA 4JY9A 2ISVA 4J35A 3SY1A 3GZAA 4YNGA 3CO8A 1H3GA 1E9LA 4OU1A 4D6GA 4LUSB 1R0MA 2R14A 4AMCA 1MI3A 3W85A 2OKOA 1K9DA 3FJ6A 4H7ZA 1S5MA 1UBSA 3RNDA 4M7TA 4UTMA 5K4ZA 2TPSA 1TQJA 3W7GA 4FLOA 3DEQA 1X8FA 2WZIA 2Y63A 2NW0A 3URAA 4KGLA 4RZ5A 5C8BB 1MO0A 3SJNA 2GQ3A 2VYOA 2XSAA 4E6MA 1XPGA 1DYSA 1WKYA 5F2LA 3KRZA 5JIPA 3H2EA 3CPRA 3BDKA 2UY3A 1ME8A 4DYKA 3FK4A 3AMDA 1JCNA 4IPIA 5C54A 1RA5A 2YYTA 1JFXA 4JTGA 3OA3A 6TIMA 2V81A 1Y5XA 4QJ5B 1TJ0A 4MWAB 3VOGA 1U5HA 1XYBA 2W4XA 1HL9A 1S1PA 2EPKX 2EG8A 1X1OA 3R25A 3WK0A 5DRIA 3T55A 1I2PA 5CZSA 3GC2A 2QCCA 3UNTA 4C91A 1L6GA 1F3TA 1NDZA 1B9ZA 5I3KA 2HVOA 3DG7A 3LM3A 2OX1A 4GKLA 5ABHA 2WMKA 4GZIA 3PHAA 4ADUA 1QNOA 1WCGA 1TIWA 1DWHM 3NQ2A 4EPDC 4CQAA 1EP2A 5CCZA 3CHDA 1IV8A 1GVRA 4QQUA 2XVPA 3VD3A 4N7QA 5A6BA 4NZ3A 4J7RA 4CNOA 3IK2A 3TR2A 1DXIA 4IHCA 4XWUA 2TRSA 3NQGA 5LYRA 1ELSA 2B0MA 2VURA 1EA9C 3W7QA 3WENA 3UF9A 2ZWZA 3P14A 5AY7A 3HMJG 3RFAA 4LAZA 4ZFCA 4LCRA 3FYYA 4EF8A 2JEPA 1XIHA 9CGTA 4UCGA 2HS6A 4DX3A 2AQWA 1UA3A 4QROA 4O8RA 5LIKX 3AO0A 1SPQA 4F79A 2ANUA 3EX6A 2WJZA 3QC0A 4TVDA 5CPTA 5E6ZA 3VO0A 3G0XA 1B3XA 3O63A 4DF1A 3S1UA 1RQEA 2Y8UA 1IEWA 4JIQA 2Y8VA 4XD5A 3W1XA 2E6AA 1UMLA 3THDA 3AIEA 3NQ8A 1DJHA 3EGJA 2GUUA 5AVHA 4V27A 3KZPA 2RGLA 3HQPA 1EPXA 2WYSA 1GHRA 5FF0A 1TWWA 2J77A 3GKAA 1JZ3A 4JFUA 1WE5A 1A3WA 3STCA 1PIGA 3DN5A 2YCIX 4DYEA 4J1OA 4WUIA 1NIUA 4H9ZA 3RPTA 2AAAA 4LYRA 2RUSA 1GJPA 5I3HA 2PPGA 1V77A 3U3HA 4O1AA 3T4WA 1LOLA 4PUNA 4EANA 3KP1A 1ECEA 3MZ2A 1YDOA 2Z4GA 4UQCA 5A8PA 3T1GA 3T8LA 3ZS4A 1HO1A 5HWMA 4MAZA 4DBDA 1OADA 3BICA 2X09A 1C92A 1QNSA 1VP5A 1PX4A 3UG3A 2A0NA 1X7FA 4FB7A 1PVNA 4JGDA 1IEIA 2WLYA 2F8QA 1XLAA 2V5KA 2HJPA 3UESA 3H22A 4B4FA 5DFAA 4XUYA 3TSDA 3PBUA 2CZVA 1AW1A 1F9CA 4JXCA 2QLYA 4N9EA 4C6EA 1N8WA 2QV4A 4A3RA 4C7FA 4Z2LA 2PDFA 1EIBA 3L2MA 3EWUA 4TX6A 4J28A 1WYIA 3KOZA 1J6OA 4XZNX 4UXDA 2A3AA 2BB0A 1KBIA 3UU0A 1E0WA 3VD7A 3GSMA 1EPVA 2HROA 3FHQA 3GM8A 3VCRA 2Z26A 1TE6A 1Z69A 4YWIA 1PTDA 4YL2A 2NSOA 2QV5A 1EO5A 4E8GA 1VBJA 5I23A 3C4UA 2REQB 2H3BA 4DNHA 1Q2RA 1TR1A 1OIMA 4N9BA 2VT0A 3PF3A 1GPWA 4W7UA 2FB2A 3Q67A 2YXGA 1F8MA 4XBKA 3O0FA 3GU2A 3BSHA 3VX1A 4HCLA 2C14A 2I5IA 3WLKX 4H01A 1ZQ5A 3SW6A 4AIOA 4LCQA 3LGGA 3UGRA 4HOZA 3WNNA 1ZTVA 4XUGA 3VX0A 2VGGA 5BYWA 4W93A 2D0FA 4JTLA 1FCBA 3LN3A 1X38A 5BXSA 2ZICA 1BHGA 2VXNA 3CB8A 3QGKC 3FIGA 3LLXA 1I0DA 3GR7A 1SGJA 4C1LA 1WUFA 3NGFA 2E25A 4GISA 3GY1A 4QAWA 5HMFA 5K9CA 4UFKA 2JKEA 3RLHA 2XFFA 5GNYA 1JI2A 3JU2A 1CPUA 5HPOA 1RK5A 3NDZA 1E15A 3JW7A 3IJ8A 3HFTA 3MSDA 4DWDA 3WO8A 3FEQA 4LUYA 1LL4A 1EJUC 2NUXA 1F4AA 3C0LA 2D69A 4RJEA 4UTJA 1BEUA 2DZWA 3UA3A 1B31A 4AWUA 2Y2WA 1OX5A 3TVAA 3KLLA 5FEWA 3BAYA 4IPJA 1V08A 2Z2BA 1OC6A 3G6MA 5I78A 5AC6A 2MUCA 2GL5A 4LRTA 3GXNA 2XVKA 2ZE3A 4PSRA 4AW7A 3LHZA 3KAOA 2PTZA 4G5DA 5AYIA 4AQLA 3MUIA 3TLQA 5I3GA 4GNJA 2FZDA 4UTUA 2ZE0A 2WSKA 3CZEA 2V0TA 3PBWA 2PS2A 3HPAA 4W87A 3DAQA 2VP8A 1OD8A 5HQMA 3NQ6A 2VRKA 3BMVA 3SGGA 2DFAA 4UR8A 3L0GA 1XBXA 4OUIA 1V3IA 1R7OA 3VIJA 4G8TA 1JPHA 1H09A 4RUBA 1GKRA 2AQOA 1E6XM 5LNRA 3N13A 3LTSA 5HBFA 4AVOA 4AYSA 4CLMA 4DNMA 3OZPA 1M7OA 1NAL1 2GGIA 3IJ6A 4JPGA 3UY8A 2DUAA 1K6AA 3OA5A 3TQPA 5CPNA 3H4GA 3ZR4A 2CZDA 1OGBA 5E0CA 5IOBA 2OQLA 3KDNA 2CHOA 1F74A 1PCKA 4AHQA 3DFOA 1W31A 3CH0A 4UIOA 2YJQA 3FJ4A 4F0RA 3OVQA 3TX9A 4XD4A 4OOZA 1W2VA 4C7DA 4ENLA 3TUUA 1YDYA 6CGTA 4ZL1A 7CGTA 2PURA 1GYLA 4W9TA 1LYXA 1FWFC 2CLIA 1LOSA 3KBVA 3GZ3A 3I3BA 3HF3A 3TNOA 3W01A 3GG8A 3ANYA 1XUUA 1V02A 4BQ4A 4US6A 3D5HA 5E0FA 3VIPA 2VCAA 2QJJA 1XSKA 3NEVA 3TE9A 2BNJA 4A8RA 1GTEA 1W8GA 4D2JA 2NVCA 2I16A 2GLKA 1PZ0A 4HKPA 4KGJA 3RDKA 2UBPC 3VE9A 4MNKA 3VINA 1GPFA 1PO9A 4M3PA 3TYCA 1OX6A 3A9IA 4LSBA 2A4AA 4HYVA 3TNBA 3KBMA 1O5XA 3DH7A 4A8NA 4F3HA 1KRBC 3OZYA 1BSLA 4L65A 4H6QA 3EA1A 1K4GA 3AOFA 3WEZA 3U2CA 1J0YA 4S3DA 4KRUA 2HXUA 4A4AA 4BK9A 5E6YA 2HTMA 4W85A 4JX6A 1AMYA 4FPSA 4W89A 1PDYA 4XZIA 5EB8A 2ZX5A 4Q7BA 3CMJA 3XISA 1A53A 1NVMA 2WHKA 1E3ZA 5B7ZA 4MZ8A 5D9NA 3ARXA 1P0EA 2G5WA 1QBAA 1KXQA 2VWSA 3CASA 1TJRA 1PV8A 4I9TA 3G1FA 1MW3A 3UBPC 4KCTA 1EWDA 1FRBA 5IFPA 5HMDA 4ZCWA 2P8CA 5FIPA 3CUXA 3NO3A 1B3WA 5AHFA 4DJFA 4KKXA 3NZGA 3PG8A 1OK4A 5AYZA 3RYSA 3W7CA 3WYZA 4AZ6A 5BROA 1E0VA 2VFHA 2CKSA 3OBEA 3MUY1 4KBXA 1AW5A 1S2CA 3CV7A 1BYBA 2XFYA 2ZA1A 4P7QA 3IRSA 3F4VA 2G3FA 4L80A 1BF6A 2AAMA 2Y7DA 3RO8A 3MI6A 1E5NA 1XLMA 4LUJA 2ZUNA 1J5SA 4GIRA 1YDNA 4AWSA 5HQEA 3BW4A 3QBUA 1F6KA 1U33A 2X2GA 2VDGA 3M0YA 4D6JA 2ACQA 3FYOA 1OM0A 4NAEB 1QOXA 1G5AA 3LNPA 3QN3A 4KCUA 4TO8A 3ZFHA 4QCFA 3P3BA 2IUZA 5AOUA 3P7YA 3WNPA 2XVLA 3BW3A 3BG3A 3N4AA 2E1DA 1UMYA 1UHVA 2NQZA 4MUPA 4PTXA 3PB2A 1ZJHA 4ZQRA 2G41A 1KWGA 2HV5A 3N2BA 2FMNA 1F07A 2J7EA 3QFEA 4GE8A 1MNSA 2PEVA 2VEKA 3LS9A 1H7WA 1V0LA 1TCDA 2Q02A 2UWFA 3BCFA 5HMEA 3GXDA 4Y9PA 1A4MA 1B3OA 5KZEA 5FEPA 1S2WA 3VABA 4IMEA 4HT3A 1LQ0A 2W9MA 3W22A 2Q01A 4GD0A 5F4SA 4J3SA 1GTHA 2E6YA 3CJPA 4XK2A 4KEZA 2PFHA 2PTDA 2EPLX 1VEOA 3CH9A 4E8DA 1O1HA 2G97A 3NL2A 4PTVA 3UP8A 3R58A 5I3JA 3N1AA 3AS2A 1XLDA 2VFEA 3W1PA 1UKQA 3VMOA 3W2LA 2VD9A 4X9YA 2F6KA 2FZMA 3URBA 4D8LA 2V38A 3R10A 4AZHA 2E9BA 1EBHA 1KTBA 2AMXA 1R86A 3MV01 5AC4A 2ZDRA 2AL2A 2WVSA 4JQAA 5KITA 3HGJA 4PUUA 3W1AA 5DXXA 4EWND 4E38A 4AH7A 4RPQA 3OB8A 3LCLA 3SCSA 3G3MA 1FUYA 1CBGA 1RVKA 1W0MA 2Z1BA 5C5YA 3KVMA 4X9SA 2YW4A 3B3DA 3BAKA 1WDRA 3P6LA 4FZIA 1P6CA 4M6QA 4GVHA 5DRCA 1ODUA 1H41A 5CAKA 4WEVX 3LDVA 1EYWA 1RBAA 3M16A 3WLIA 1E4IA 4JKMA 2WNNA 4XBSA 3TZFA 5FESA 3ZT7A 4DBWA 5A6SA 1G9HA 2B7PA 4PYSA 3EXTA 4DO6A 2KAUC 1KCZA 1DIKA 3UGVA 2YL9A 3WY1A 4Z08A 4JN6A 1XKYA 4H83A 3ANVA 2V67A 3M5YA 4PBEA 3O16A 4QG9A 1A4LA 4C6KA 2DT2A 4CN6A 4CQDA 1ISZA 2OX4A 4JKLA 4GACA 1T7LA 3NXFA 3MW7A 3W1UA 2ZYFA 3EWZA 2Z1WA 3MI2A 2WM1A 5C9WA 4C90A 2WQPA 4I9MA 3D47A 1GORA 4YPJA 3P93A 4JQ2A 4AIUA 1V3MA 1R2TA 2BSLA 5BOOA 5EA9A 4TV6A 3GVQA 4DJFC 1JNEA 1OFBA 2V2HA 3GFYA 1OZMA 2UV8G 1R38A 3AMKA 4JR5A 3W24A 3KS5A 4FOUA 4QCEA 3SEPA 4LCSA 2BMBA 3PBMA 2PDWA 3OIXA 3PP7A 4IFKA 3BGJA 1GG0A 2X41A 5LZLA 2W63A 2PDYA 1XH1A 4S23A 3BMXA 1VKFA 5E09A 4HK7A 1WDWA 2VC6A 1QPQA 1DQUA 4B5VA 2A3LA 4G1NA 1A5SA 3IGXA 4ADSA 1UZ4A 4A35A 4F66A 5C71A 1Z3NA 2W91A 2FTYA 3TJ4A 3B8TA 3LENA 2V9DA 3FGCA 4PA8A 3EWYA 2XPKA 3WUBA 3LZ5A 2W92A 4BY3A 2OLHA 5A1AA 2DSKA 5EGRA 3PJWA 5F7UA 3UW6A 2ALDA 2O92A 1JF6A 4ZFMA 5EL1A 3AUOA 1GVQA 1OJXA 3PZGA 1O94A 4NX5A 4S39A 1YE6A 2Z1XA 3AXXA 3DGRA 1XD1A 5C2XA 3TCSA 5D38A 4AF0A 2WAGA 1EO7A 5HR7A 2FVMA 1E1FA 5IBXA 2OU4A 5AYYA 2B7NA 1JG9A 4GYJA 2YFOA 4G2DA 3WK1A 3CUHA 4Y2WA 2NV9A 5T26A 3T9PA 2VX4A 1FFQA 3B0XA 3S3GA 1EC8A 4JQ1A 6PTDA 1UG6A 1K77A 4JNYA 2DH3A 5I79A 1HNYA 2D2HA 2YLAA 1J0IA 2Y5JA 2DU2A 4Y6GA 4UOQA 1TPC1 2GGGA 4I8YA 2X0YA 4H9TA 4IIHA 4TQTA 3QHMA 5K2ZA 4P8UA 3S9IA 2YOCA 3R4IA 4CNPA 1FHVA 1H61A 3SSJA 1Q6DA 3AXHA 4EXAA 2GGHA 5I7GA 1A0CA 1EJVC 1V5XA 3WLSA 1ZBKA 4Q4MA 1CZ1A 3GYEA 3WF4A 1NDVA 3WLJA 3S5ZA 1V6XA 1OCQA 3CYVA 3LCXA 5I24A 2IKIA 1P5BA 2O4MA 3CV1A 3VDHA 3QR0A 1C8XA 4QNEA 4EF9A 3THUA 1W5NA 4GINA 4JTDA 1SSGA 1OY0A 3U5UA 2X30A 5AHLA 5D33A 2HWGA 5E9XA 2FJUB 2QNEA 4WRHA 1UIOA 1ZBWA 3JR2A 5GQBA 3W28A 4EXQA 1JUBA 3EXSA 2PA6A 3THCA 2PU1A 4QR6A 2E5DA 3GNOA 3D6NA 3WH7A 3SQMA 3O6CA 4MFEA 1QO5A 3BOFA 3IAPA 2VGIA 2C0AA 3RJYA 5JBDA 2VZVA 5T91A 3B97A 2X1RA 2XH4A 5LIUX 1IXOA 5HJYA 3SY8A 3T09A 1CB7B 4UTTA 3H4XA 3F2BA 3LLDA 4NNAA 3TTOA 2GVYA 1TUXA 3VNKA 3ZXWA 2XIQA 2CHNA 3Q37A 2PWEA 1M3UA 1EDGA 4NUWA 2VZSA 2DUZA 3WEOA 3EA3A 4KWUA 2NQLA 3B04A 2XWEA 5CZ0A 1HL2A 1NH6A 5C2CA 4WXYA 1ISWA 5HR6A 4HYRA 4H19A 3AIVA 3V5CA 3W7DA 2AKMA 1CENA 4K8GA 3FW6A 4KCVA 5DLCA 3DBNA 5I07A 2E77A 3T40A 5D2VA 1ALDA 3DX5A 3F4DA 4K2SA 4K38A 2HISA 1SFTA 4O16A 4PN2A 1DTNA 4L7ZA 3V3WA 4HPNA 1F05A 5FOOA 1WXJA 1Z9AA 3VGEA 3MCNA 3R0DA 2DQXA 5K3VA 3BAXA 2J9YA 2Z1SA 4LV4A 3QZ6A 1Z89A 3NXLA 1MW2A 1HVQA 3AYVA 4Z42C 1YDVA 2W6RA 1TWZA 1W1TA 5FJUA 3WJWA 4WJEA 2EG6A 2Z1KA 3T44A 3B40A 3PS7A 2PWFA 2ZZ5A 1V3JA 1IIGA 5DT7A 5HNNA 5IBXC 2JFEX 2OO0A 3GG0A 2E4TA 2Q8LA 3REQA 3BJFA 4RX0A 5XIMA 1G7VA 1M7JA 2D1ZA 3NZRA 1PJ9A 5CSRA 2XFWA 4U5IA 4CVWA 3UJSA 1EQCA 4HNTA 3LCIA 5H8MA 4NJGA 2B31A 3PN8A 4MNLA 2QULA 4ZOAA 5CZTA 1FWDC 1HKKA 4AD2A 1M04A 4TMBA 3LXCA 4AHPA 3BXWA 3NL5A 3V5FA 1NOUA 3BARA 1XSJA 5KZ6A 3DXIA 2Z0IA 4JQ3A 8A3HA 3WBEA 2X1TA 1FCVA 4ZODA 3U57A 3W73A 2NT1A 2VO5A 5AHEA 3SDOA 1RXOB 1C9WA 4Y9MA 2VRQA 3VIKA 2PODA 3BCDA 5D37A 5G1TA 1UP3A 4IP7A 3N4EA 3YPIA 1LORA 2WXDM 2CERA 5HK4A 5DN1A 3PWIA 1M7XA 5IHRA 1J5TA 3L9CA 3LMYA 4DWSD 1JRCA 1N55A 3RCYA 1IYXA 3OHMB 3GFXA 2CW6A 2EJAA 2Y7EA 3QW3A 4IOTA 1FA2A 2WVUA 1VPQA 5EBAA 2PDHA 1XIJA 4L5ZA 3M7SA 3FDGA 1E6SM 2PTWA 3M0XA 3LPOA 1C90A 1LWIA 1P0NA 1QNPA 3PZUA 4PMNA 2GQ8A 4J3ZA 4XZWA 3MUXA 3RAOA 5MF5A 3FJLA 1XD0A 2E28A 1AL8A 3EWWA 4L9YA 1EC7A 3PJTA 2PBOA 3NM3A 2ZZ2A 1GEHA 3O0KA 3CQ0A 1H7PA 4UTTC 4XAYA 3VGGA 2CLOA 1WNOA 2Z2AA 1VHNA 4GJ1A 2ZVRA 3B0PA 4XD6A 3BVJA 4EACA 3H2CA 3IAQA 2E8YA 2PWHA 5CGTA 2ESCA 5JIWA 3QGVA 4FNQA 3CQHA 3SRHA 1P1XA 4UNIA 4PMYA 2ZTJA 3GE7A 1GCYA 3KVJA 4LYPA 3K13A 4WY0F 1Q13A 1YRRA 4ZMGA 1GOWA 5HNTA 3BLLA 4PC8A 4BF7A 4HPGA 4C60A 1Q4WA 4JDBA 5I06A 1OX4A 3G22A 2XM2A 4JQ4A 2NXHA 2YA1A 5EMMA 3RGTA 4V33A 3GG7A 1K7XA 2DJLA 6XIAA 1KA9F 3B4YA 3WD0A 1W9BM 3P0XA 1R87A 4DUXA 1EF2A 1EHNA 1ZJBA 1AK5A 4YTRA 3RX3A 4UQAA 4W88A 3TJXA 1AA1B 1JYNA 2D0GA 5BU9A 4GVIA 2XSXA 1GYMA 3B9OA 4DXXA 3IGSA 4MOZA 1KBBA 3LG3A 3BMWA 4CCDA 3JZUA 4Z2HA 3S5YA 1TPUA 4ZR8A 4DYJA 4A05A 5CEWA 1BG9A 2V3EA 3HG4A 1K1DA 5AZ0A 1SSDA 3OGSA 1B57A 2V3DA 4ZENA 1CXEA 1GQKA 5FJJA 2C15A 1YXYA 4ZOBA 3S5NA 1W6TA 2CESA 5AKQA 1WA3A 3KW3A 1R47A 4LBUA 4L9XA 5G2IA 3U6WA 3AC0A 2WZTA 2ZADA 4XAFA 1WQ5A 3GC4A 3P62A 4QBXA 1V7YA 3EEZA 3G3DA 3MUZ1 2GSEA 4LUIA 4MJZA 4LNCA 4H6RA 1K4HA 5HAOA 3VIGA 1ONEA 3SFWA 3B9AA 2WBGA 3QR1A 1Q65A 2PDGA 4E4FA 3AU6A 3ZJKA 5AECA 4S3JA 3L4UA 1GONA 2BS9A 2VCBA 3VOJA 5ABFA 2Q3OA 2Y1HA 2BBFA 1B90A 1KV8A 4JYFA 4N0RA 2TMDA 2NQ5A 2ALRA 4HMNA 3N04A 5A8QA 4HA4A 2A6NA 5G5IA 1YTKA 1CECA 3MU7A 4CUCA 3WLMA 5CH9A 2OO6A 4ECLA 4Y7EA 2NV1A 1OF6A 1CB2A 1HJQA 1X1ZA 4FP1A 4XZ9A 3W1NA 2DIJA 1TCMA 3O2LA 1L8NA 4MB1A 4IISA 4OGZA 3C2VA 4PUEA 4DPQA 1JCLA 2HXTA 5LKYA 4M19A 2ZUUA 1XG4A 2YBUA 3OGRA 5LA2A 4FALA 3RMJA 1M41A 1RCOB 4HZ8A 4S2CA 4IJRA 3BANA 1DXEA 3APGA 4CGTA 4Q4QA 1I0BA 1CXIA 2QHAA 2JGQA 2BY1A 4XTDA 4Z2GA 1VFOA 2DZTA 3PTDA 1HJVA 2ASHA 1W3IA 3MHGA 5C0QA 4O0QA 4AZ5A 2CXEA 1HIZA 4G7EA 1RY8A 4MPKA 1XIMA 3VUPA 3EWDA 2IQTA 3NURA 4MG4A 2QJNA 3FSUA 1ICSA 4IMFA 3WDPP 4YTUA 1Z8AA 2C1HA 4XO7A 1W1PA 4C5ZA 3GXTA 4Z1AA 2PWGA 2GGEA 4Z1DA 3U8GA 4US5A 5TQLA 1H7XA 3KOWA 2PD9A 5EMLA 4RV8A 2A85A 2UY4A 2DQWA 1FWHC 2R24A 2XIIA 5IXEA 2DPEA 3R0KA 5DCDA 2C8NA 3F4CA 4PUJA 4LVFA 3R89A 3WG6A 5U4NA 2VMFA 3V4BA 3GTNA 1QWKA 2FTWA 3ITTA 2PMQA 1FWRA 4C65A 1FWNA 5ECUA 3H2OA 4IXXA 3WKZA 3R43A 4PTNA 3WUEA 4MKVA 1WZAA 3KUMA 3WF3A 1I6NA 4DZHA 3ZWTA 2P0IA 4JX4A 3QV8A 1XC4A 4FHAA 3VOIA 3L5MA 3CAKA 3LD5A 1BVZA 3GBDA 1TB3A 2PDNA 2BY3A 2V3GA 3RR1A 2KZHA 3HQNA 1XG3A 5BXTA 2QZRA 2Y62A 3WLRA 1J9YA 2V3FA 1KR0A 5JMUA 1S5WA 4HBKA 1VBUA 1J12A 1LUCA 4IMGA 2C0HA 4HN4A 4H41A 4RPPA 1MYRA 3GLCA 3LLFA 3SAZA 1J18A 2ATSA 1F8IA 2OZ3A 1ZFJA 2QUMA 3E38A 2BZNA 3W6LA 2Y7GA 2XH2A 1X7IA 4BF5A 4ZO9A 1ZU8A 1W3TA 4Q8QA 1HJXA 1CIUA 4IJCA 4EAMA 4ATWA 1JD9A 1C8YA 3A6OA 1Q8AA 4JBRA 1Q7MA 3UD6A 1MFVA 4Z1CA 3KCLA 2F84A 1I2OA 4RE4A 1J96A 1RQBA 3NNTA 1LQ2A 4WJXA 3K8MA 1B4KA 4UOJA 3IVUA 2WKGA 3ME3A 2IPFA 3LU2A 2PF8A 3PB0A 5H91A 1Q6CA 1SJBA 1XLIA 3NO1A 1XH0A 3VKCA 1EF3A 3C52A 2IQ0A 1LDCA 2AL2B 2CZ5A 1OHLA 4O54A 3EZ4A 2ZX7A 3AXKA 1Y5VA 1UZ1A 3FV9A 4GX8A 4AUBA 2WQDA 3N3MA 3BWWA 4ROPA 3EPOA 4D9PA 4AD3A 4KESA 3VZXA 2VNCA 1D7FA 5BXPA 4EAYA 2J27A 4M80A 3T2PA 5BOEA 3AHYA 3LI1A 5CG7A 5D30A 5BNKA 1HW6A 2CXGA 2XIMA 4IIEA 1KXVA 1L8PA 2BP1A 3EOUA 3WEMA 5I2UA 4CQBA 3POHA 3S1WA 1TPVA 3O7UA 1HTIA 1B0IA 1YKWA 2QGYA 4M81A 5JXQA 3KOFA 1AVAA 3KTCA 5CPLA 1UR2A 3L4XA 5EMYA 1TTQA 4YLWA 2HEJA 4I7WA 1DHPA 2D73A 3ARQA 1C7SA 2YDSA 3L68A 3A9BA 4Q4OA 3WH5A 1XDLA 4FS9A 3ZVIA 3OZMA 3AIUA 4HMDA 4Y96A 2BTMA 4CNUA 1BKSA 2C16A 4DLMA 3OVPA 1ZCOA 1V0KA 4ICCX 2DH2A 1EOMA 3BH4A 3GH7A 5A3HA 4CCEA 3NZPA 4MZ1A 2G4FA 3QV9A 4JNMA 5A8GA 2DT3A 2A1YA 4OVXA 3UR8A 3UA4A 4DAIA 4JTSA 4RV3A 1Y7VA 4JN8A 2Y24A 1EFZA 2XFRA 4N4PA 3PFMA 1GGOA 4Q6XA 3TMLA 2ICSA 1H0IA 5REQA 2J6VA 4XAPA 2I1OA 3WDIA 4ZA0A 4CNTA 3W53A 4UQBA 1AG1O 3T0AA 4HU3A 4HPJA 1D2KA 1REQA 4JIIX 1LG2A 1QT1A 3LYEA 3BQ5A 4FX6M 1I1WA 3VUSA 1TRDA 1ODZA 3T2QA 4HJFA 4H1ZA 2Y8KA 3HGSA 4QS6A 4QIUA 1JEZA 1H51A 3FSTA 3FGCB 3WF1A 3AHZA 1KXHA 3G1DA 3WDJA 4FNTA 2FB3A 3OPSA 2C79A 3QYQA 4AYGA 3WH9A 4QE5A 2XZ7A 3CIWA 4IIFA 3USZA 3ZSTA 2XZ9A 3HG3A 1YEYA 1V79A 1AQ0A 1PTGA 4QM1A 5CPSA 1GUVA 5DMMA 3H2MA 2W0UA 2ZA3A 3N14A 5A2AA 3V75A 1SMDA 3LBCA 4TXEA 1ZB5A 2IW0A 3UWUA 2BASA 4AF0B 4WDTA 6A3HA 1AH3A 4NZJA 3P74A 2IPGA 3H55A 1E6ZA 4NZ1A 2ZRWA 2A79A 5CJNA 3VGFA 1LJYA 5J5DA 1FY6A 1HX0A 4K7VA 1EXBA 2Z29A 2DZXA 1LBMA 2GSJA 4CVUA 4RW3A 2OSWA 2OCZA 2FZNA 5GJNA 2XDFA 2YCLA 2YPIA 4XZMX 4DJDD 3NEHA 2F7FA 4WSHA 2ZRZA 4HSOA 5F4XA 4GXWA 4GUGA 1G4SA 1JCXA 4WKFA 4XTIA 2ABBA 4DZAA 3ZLHA 1CXFA 1FXQA 4NYUA 4AEFA 1MMFA 4GUJA 5D04C 4LV9A 1B5TA 1A5OC 1NP0A 3NPVA 2VZUA 4ZQPA 4BI5A 3UCDA 3KRSA 4DLFA 4NF7A 1YIXA 3G8EA 1TSIA 2PDKA 3PTQA 3W6YA 2W3ZA 3FA4A 1Q6EA 3SADA 1IGWA 3CAWA 4XIAA 4S3EA 1TV5A 3TXVA 1I2RA 3PAOA 2V5DA 1HZYA 3AIWA 3S2CA 5C7VA 4NZFA 2QDHA 3U4FA 3CZ8A 4ASTA 1Q6FA 3KS6A 1Q5MA 4MSSA 1KRAC 1RD6A 2ZKMX 5C7HA 4L56A 1BAGA 3EB2A 1N7KA 1RBOB 4IL2A 1XSIA 4J4KA 3NZQA 1KM4A 5FAJA 2WMIA 1QR7A 4AX6A 1X98A 3I6RA 5DQPA 5G2WA 2D23A 2E9LA 3GDRA 4LH8A 1ZAHA 2DJXA 4UQ9A 4B5NA 3B06A 2VKZG 2FZ9A 1Q3NA 3V7PA 4D6IA 2J8GA 3W7NA 1TIMA 4LVGA 3SCRA 1QASA 5KTLA 1V51A 1CT5A 1MWOA 2OSXA 2FDSA 2XSBA 2I7GA 2XINA 3ALGA 3VOFA 1J01A 4OUEA 3S2NA 4FO4A 2OGYA 2C6QA 1BFNA 2Y5SA 2Y70A 2ZC8A 3CUJA 3LPGA 2ZXDA 2C1GA 5EKYA 5E70A 1UD5A 4C1NB 1NP2A 3ITVA 1X1NA 2EJ1A 2JIWA 3I4KA 2WO5A 5FSDC 4ATDA 1F7BA 1F4HA 3C2YA 3S4TA 4GJJA 2WHMA 1EP3A 4K1GA 3MA8A 2J25A 1R9YA 4FF5A 4BI7A 2GDUA 4MWAE 3HPZA 3NQAA 3IIXA 2QW5A 2YZ5A 2OT0A 1QPOA 4V1YA 1Q8JA 5GJPA 5EFDA 3HO8A 2CLMA 3CPUA 3M0KA 5BMXA 4US5D 3MI3A 1UASA 3WQWA 3NSNA 4R33A 3TYUA 4H9VA 5DX7A 3VD4A 4HP5A 3CUFA 5LXXA 2DGAA 1W9PA 2ZXBA 3HM7A 5CBJA 1O6IA 1E9ZB 3O8AA 1VFMA 2DW7A 5FL0A 3PBYA 2RDXA 3EKGA 1KWKA 4UCFA 4IFRA 4K6AA 3AFBA 3REQB 1XC6A 2I57A 3GVGA 3ZWSA 2ZC1A 3ZLFA 3DIPA 4H2HA 3O1NA 2QF8A 3W23A 2O7SA 4F9JA 4F8XA 3F5KA 1YBQA 3IIZA 3THQA 3VKDA 2C19A 3UR5A 4UZUA 4PRRA 1NU5A 3CTTA 1UD6A 4UB9A 5FJIA 1U1JA 4FEZA 2VJXA 1R30A 3DYMA 5DBTA 3UYIA 2WSYA 3W02A 4IP4A 1Q4NX 4BHYA 1QMLA 4ES4A 5LNWA 3EDJA 3H4WA 2WWCA 4JNZA 1JULA 4F0HA 3PULA 1GOMA 1CWYA 1TPB1 1XLEA 3CZGA 2XM1A 4RXGA 1Q6RA 3DI0A 4FIQA 1V3LA 3KM8A 4MGGA 1D3HA 4W7WA 1BSIA 3PY2A 4IICA 2NX9A 1U5VA 1UR1A 3S9ZA 1QAPA 3BLOA 2IMRA 2CITA 4HVXA 3AIRA 4J2MA 3SO7A 3V0SA 2YX0A 2Z7GA 5L9FA 1HKIA 1JZ5A 3WQCA 4XG1A 3T0BA 5H8PA 2OELA 1A5MC 2XN0A 2WC7A 2ZUTA 3EOLA 1WOBA 3E9AA 1H7NA 1T6MA 3EX3A 2FHBA 4B15A 3S83A 2QIWA 3QGAC 1LTDA 3AS3A 2WANA 1GZ1A 1VFLA 5E5CA 4JCMA 5A94A 4FX7A 4BQ5A 3RJXA 3CWHA 2BHYA 2X7WA 2VQUA 3FAWA 3ARWA 1K03A 3W7LA 3CUIA 3AZSA 3B03A 3GDTA 3KCJA 3VNZA 3T4CA 3MWCA 4MADA 3MV11 1ZCCA 1NDWA 2AL1A 4V28A 1V6VA 5JUVA 2CLEA 2PRHA 3B8WA 3U5YA 4HHHA 4KRTA 5FJRA 1FKWA 4PB4A 4F2UA 4M82A 2Z7KA 3E0WA 3FN9A 3MT1A 4DB7A 3ITXA 3JVAA 3KBSA 3B9EA 3VMNA 4H7CA 4F40A 2JALA 3CIXA 4HHMA 2J7CA 1E55A 1OX4B 3BAWA 4WVXA 3R94A 3RIKA 3KRBA 3AZRA 1Q63A 5HWNA 2NSXA 2FHFA 2ZZ3A 2WPBA 4GNVA 4A3UA 3GHRA 4TIMA 2E09A 3NPWA 4JTRA 3AMGA 1X6LA 4E5TA 2ATMA 3MDUA 2WV8A 3M0MA 4QLJA 3QY6A 4G7FA 3M6DA 4HU8A 1R3QA 1O7AA 4G1KA 3TQ0A 4WKHA 4MWAD 3DG6A 1ISYA 2NQJA 1HGYA 1FWIC 5BXRA 2EAWA 3H24A 2ZX9A 1B1YA 3L2IA 2VEGA 2DZVA 3W82A 2WMJA 1E9YB 2BVYA 4GY7A 1OWQA 1SQ7A 2ZFAA 3QVQA 2QDEA 4O17A 1QRQA 2IKJA 3AWNA 3KVLA 3M0IA 3FYPA 2ZIDA 4DF2A 3P67A 4K3ZA 3GG1A 2O9OA 5C9UA 3M41A 2WMGA 3EX1A 4P2VA 4ZO7A 4K68A 5EU9A 5G2HA 1TA3A 1TPEA 4DF0A 1PAMA 4Q32A