2CZ5A

Crystal structure of orotidine 5'-phosphate decarboxylase from pyrococcus horikoshii ot3
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
208
structure length
208
Chain Sequence
MIVLALDVYEGERAIKIAKSVKDYISMIKVNWPLILGSGVDIIRRLKEETGVEIIADLKLADIPNTNRLIARKVFGAGADYVIVHTFVGRDSVMAVKELGEIIMVVEMSHPGALEFINPLTDRFIEVANEIEPFGVIAPGTRPERIGYIRDRLKEGIKILAPGIGAQGGKAKDAVKAGADYIIVGRAIYNAPNPREAAKAIYDEIRGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of orotidine 5'-phosphate decarboxylase from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 75
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2cz5A00
3GDRA 4WY0A 3HG3A 2W0UA 3W23A 4MY9A 5HULA 1VS1A 3INPA 3NQEA 3FJLA 5K3VA 2QF7A 3QM3A 3CWOX 1LBFA 5I3KA 3KRZA 1JUEA 1A53A 1Z44A 3BGJA 1KA9F 1ZNNA 1Z48A 2V5BA 1HO4A 5T26A 1ZENA 3FIGA 3PAJA 1SW7A 1K3UA 3STFA 1DORA 2EF9A 4CCEA 1JCNA 3LX9A 4HKPA 4FNSA 1T99A 3DAQA 4JTIA 3DKLA 3GXNA 3FOKA 2OMAA 1TQJA 3HPZA 3GLCA 1G4SA 1O4UA 2JK2A 3NQFA 3FKKA 5FI8A 1Q6OA 3S6DA 2VFDA 1VQTA 3BLIA 4MZ1A 5CZSA 3Q94A 1H7RA 3BPWA 2BSLA 2ALDA 3JRKA 2Q3RA 3NQCA 3NEVA 1YTDA 4FX6M 4BR1A 4AXKA 3W7HA 5K9CA 1VJIA 4QITA 4NX0A 1AL7A 4A29A 1VGAA 1OG0A 3PUEA 4Y6GA 3G22A 1H7WA 2ZYFA 3LRMA 1QWGA 3NL5A 4O8RA 3EWZA 3PG9A 3L67A 2QKFA 2NUWA 4BF9A 1YTKA 4J9JA 1B3OA 2E5CA 1E51A 4LC8A 1EP1A 1CX9A 3PM6A 4HPXA 1X1ZA 1N55A 2A5HA 3EX1A 4FF7A 5D2VA 4BWLC 4JXCA 2C14A 3LHTA 4O28A 2J88A 3B0VC 3O1NA 4LS0A 4AWUA 3NQDA 4O17A 4CNNA 1EUAA 3IGXA 3GZ3A 1P1XA 2TMDA 4X3ZA 3W1LA 1OK4A 5CPOA 4PFMA 4JTEA 1LDCA 1X8FA 3MYOA 2OX1A 2E6YA 3HF3A 1FWRA 3A9IA 5CG7A 4O50A 3HPXA 1GZGA 2ABAA 3TFXA 3VCRA 3SW6A 1FWNA 1L2UA 4O0ZA 2NXGA 2FLIA 4RXFA 4WY0B 5DCBA 2NV2A 3N34A 5EY5A 2JKPA 5FEXA 1OX6A 4JYEA 2X30A 3ABQA 2PRMA 2VEIA 3BO9A 1L9WA 3L21A 1SW0A 3M41A 4XTIA 3UPBA 4K8EA 4WY0F 1G4PA 2J27A 3LB0A 1H5YA 4NT0A 2V8ZA 2WNQA 1HTIA 3W7OA 1ZY9A 4UNKA 1WAUA 1TPB1 1F6KA 1VYSX 3EXRA 3GK0A 4O1AA 1PS9A 1ZJIA 5K2ZA 4LV4A 3CEPA 1SO4A 5L9FA 3NQ6A 1H61A 4YXGA 3LCHA 1YXCA 1QCWA 1WDWA 4O1CA 2YYTA 1F76A 3QYQA 2XFWA 3W9ZA 3VFLA 4HNNA 5AC8A 1O5KA 4KFPA 3KVJA 4DBEA 3G24A 4CNPA 2QCNA 3TK7A 4EWND 3M1ZA 1LBLA 1QDSA 3LTPA 5EA9A 4P2VA 1TSIA 2ZZ7A 2ABBA 3EKZA 3R13A 2H3BA 5G5IA 2A0NA 1H7XA 4ZQRA 4HT3A 5DY3A 2V30A 3NQ8A 3UXAA 1OFEA 1IGSA 1LZOA 3RK8A 2V2DA 3G1SA 3HPSA 4HIBA 2ZRWA 5AHFA 5CZ0A 3VE7A 1KFEA 5KSWA 1ZHAA 3P74A 3GNNA 2XN2A 1EWDA 5K9DA 4DBDA 3DKJA 2VFEA 1A5CA 4UFKA 2VELA 2G97A 1QPOA 4UNLA 3RMJA 2F84A 4WOQA 4Y96A 3UXDA 2C19A 3W2KA 2Q8ZA 4GUJA 5G1YA 4TR9A 2C1HA 5D05A 1RR2A 4LRTA 4HSNA 3T55A 4W9TA 3TQVA 4KWWA 1EP2A 5G1TA 3U6WA 4FNTA 1JUKA 3O16A 3MJYA 2Y70A 3LGEA 3CU2A 3T7VA 1M5WA 5F4XA 3TMLA 1DJNA 1H7NA 1MEIA 4LS1A 1RQEA 1BEUA 5BRBA 1SFLA 4UFMA 3DFSA 1U83A 5DBTA 4ICNA 2V5LA 4U28A 5U7SA 1GVFA 3W1QA 3IVUA 5AHEA 1TCDA 3HIJA 1DQXA 4LWWA 2QCFA 4FNUA 4N6EA 5AYZA 3NM3A 4C1KA 5KITA 3P7YA 1FCUA 3W2JA 1FDJA 5AYXA 1NFBA 2Z2UA 1YDNA 3OBKA 3W1PA 5LGXA 5SWUA 3NQ2A 5IBXA 1B57A 1XKYA 4QIUA 3NL3A 2Y7DA 1OHLA 1DQWA 2C15A 2QEZA 3UY7A 1Q3NA 2QJIA 3FFSA 1G7UA 4IUOA 3QF0A 4O16A 1KTCA 3OHIA 4K7VA 3B4UA 3WK2A 1RQHA 2FIQA 2GJNA 1BWKA 3W85A 4UTWA 4QQ3A 4JX5A 1NF7A 2Z0IA 4JDYA 4UTTA 1H51A 1D3HA 4TMCA 2QCMA 4WXYA 3CHVA 5DCEA 2ZRXA 3TDFA 3IIVA 4ZMGA 1AK5A 3LHYA 2WOQA 2J6XA 1R30A 2Y6ZA 5EBUA 1XBVA 4CLMA 5D32A 4N4PA 3MYPA 2CZFA 3W3OA 2Y89A 5TQLA 3W7RA 1W0MA 1WOBA 2V81A 1RQBA 4NX5A 3L2IA 1K7FA 5EL1A 1K7XA 2P1FA 4M6PA 1P5BA 5U4NA 3PF3A 3TJLA 1S5TA 4MYXA 3CT7A 2ZRVA 1A5AA 4N9DA 5TIMA 2ZZ2A 2CLFA 4KKXA 1WBHA 1H50A 3M9YA 3B05A 3W1NA 3OVRA 2E6AA 3K30A 3P82A 2QUTA 5HNRA 3H55A 2VKZG 4LUIA 1ICSA 4WX2A 4S2CA 4DEFA 3UPWA 4L4MA 3W7QA 5CSSA 4JTHA 4WZHA 3W73A 1FXQA 1TPH1 2F7FA 1OX4B 5EYWA 4UTTC 2PRHA 1AG1O 4OT7A 3ELFA 3W7PA 2WPBA 5KINA 1Y0EA 4UTWC 1B4EA 2R8WA 1TPEA 4N2YA 4Z0SA 3RU6A 3W86A 4YCOA 1GVSA 3QQ1A 2GQ8A 4JIQA 2V0TA 4O19A 3NOEA 3H54A 2C3ZA 4JY9A 3G3DA 2HS6A 3MO7A 5CPLA 4N4QA 4FHAA 2J9ZA 3ATYA 3NXFA 1YDOA 2CLEA 3R8RA 4DPPA 3G8RA 4EIVA 4AWTA 3NAVA 2E1DA 3T4CA 4FNPA 3LHZA 4BI6A 2EAWA 1KM5A 3SZ8A 2X16A 2ZRUA 5EPDA 3W72A 3Q37A 3TR2A 2YFOA 3I7QA 4JDBA 3TUUA 3SFKA 2WV8A 4EF8A 1OF8A 4WUIA 3N9SA 3MP3A 3PWAA 1G4TA 1WBJA 1W54A 3R5EA 2I14A 5I3JA 1GG1A 4MJMA 5HINA 3O15A 3JS3A 1MEWA 1QPNA 1TPC1 2VEMA 3DFNA 4XKYB 2Q3OA 2QUUA 5AFDA 4GFSA 2ISSA 3A22A 1I2NA 4PC8A 5FF7A 3LRKA 1GPWA 1SU5A 3N3MA 3TC7A 3B8DA 4QAIA 4AAJA 4GUHA 3NL2A 1THFD 2WSRA 4GUFA 2CWNA 4WXZA 3KRUA 3QSRA 2TYSA 3OVQA 2DJXA 3KVLA 2DZWA 3EWBX 4ONVA 1FCVA 3EWXA 1YDVA 4KWVA 2DJLA 3LTSA 3TIMA 2G5WA 4GUIA 2JKEA 3WJXA 3W76A 4M7SA 2DZXA 3C0JA 4Z1AA 2GVJA 2ZQ0A 4JTJA 3E0IA 3F4WA 5D38A 3S8HA 1KM0A 4EVZA 2FB2A 5DXXA 3CLMA 3W83A 5IBXC 1P4CA 3EKLA 4QM1A 1TRDA 2V2HA 3CQ0A 1FY6A 4UTLA 2QCDA 3QPZA 1AMKA 2Y7EA 3PG8A 3W1RA 2KZHA 4KFOA 2O7QA 4D2JA 3ZFHA 1FDYA 4FX8A 3W7EA 2XN1A 2TPSA 4UFHA 4NNCA 1DJQA 2EHHA 5F4WA 3CM4A 1W37A 2Z6IA 2BX7A 3S1UA 3L0NA 2CLIA 3WK0A 5DLCA 4LS2A 5D30A 3S5ZA 3TSDA 4Z1DA 1EEPA 4NVTA 5CGQA 2A2IA 2E77A 3O6CA 3BV4A 1KBIA 3GYEA 4NXSA 3ZWSA 3L9CA 3PSWA 1YADA 5K4XA 1OYAA 4HNVA 2E6DA 1PHWA 4AHPA 2VXNA 1BKSA 4EF9A 2CLMA 4O13A 2B7NA 2B7QA 2QUVA 3VNDA 2BXVA 2VOMA 3P60A 3EB2A 3O8AA 1P0KA 5F1VA 5FF3A 2JGQA 4M6VA 3PB2A 4OE7A 2Y85A 2ZZ6A 5AYYA 3IIZA 2A6LA 3IIXA 3ABRA 1F74A 3GIYA 3GXPA 1KV8A 5GVJA 4AB4A 5FESA 3FJ6A 3BLFA 1R2RA 4O4VA 4WQ6A 5HWJA 3UZ5A 1YXYA 3Q2DA 3M0ZA 4DO5A 1BWLA 4QNEA 1OFPA 3UWZA 1TTJA 4GJ1A 3E49A 1KFLA 3NA8A 3KXQA 4LU0A 2YYUA 2BWGA 4UC5A 3QMTA 1ME7A 2ZTJA 3C2EA 1LRNA 2Y62A 4OU1A 1GQNA 3KAOA 4JY8A 4LVGA 1OX5A 4CNOA 4UCGA 4K7YA 1Q6LA 2UV8G 2NLIA 1JCYA 1FUYA 3EWYA 3W88A 1WX0A 3WJWA 2V82A 3QZEA 5F2IA 3SGZA 4NJIA 3UWYA 1I8JA 1WA3A 5LZLA 3I65A 3GVGA 4JTUA 4O0KA 4A21A 3STEA 1OFAA 3IIPA 2I9EA 4MOZA 1FCQA 3A24A 4JS3A 1XFBA 4LT9A 5LHEA 3L5LA 2XN0A 3W7GA 3TXVA 4FIRA 3QH2A 1GYLA 1B9BA 2DZTA 2RH9A 3UNDA 1TPDA 1UB3A 1LOSA 1J2WA 3EX4A 4MYAA 1K03A 1S5VA 1Z42A 2GPTA 3NYZA 2VEPA 3QJAA 4IMEA 3CC1A 3MI3A 4QNWA 5F2MA 3LTYA 3R2GA 2TRSA 2Y7GA 3CIWA 4MPQA 1VRDA 1SO6A 4TX9A 1T8XA 3S5YA 4MZ8A 5DN1A 3N9RA 3W74A 1DKWA 3EXSA 2FTPA 3DZ1A 1K02A 1GTHA 1EA0A 4JD4A 3G3MA 1SR9A 2RHGA 1VPXA 3DFQA 1LP6A 4EOUA 4NJHA 3PC0A 1L6WA 5AB3A 3E02A 5A5WA 3PUDA 2ZZ4A 1YYAA 2H6RA 4YWIA 3TMQA 2H90A 4FB7A 3NG3A 1L6SA 4RZ6A 3TQ0A 3FYOA 4O4WA 1OX4A 3F03K 2X2GA 1VH7A 4XTDA 1O95A 3PSVA 2A7PA 2JGYA 3ABOA 4C1LA 4O14A 3L68A 3M16A 1C29A 4A2RA 4YCPA 1R47A 1X1OA 5H91A 1LTDA 4PL1A 3HGRA 4IXHA 2DORA 2DP3A 1XL9A 5DCDA 4K36A 4RR4A 5FF2A 4CCDA 1ICPA 3HJZA 1H60A 1IXPA 3NZ1A 4GWEA 1TTPA 1D9EA 1JCLA 3DXIA 2CZ5A 4LW7A 2GUUA 1C8VA 5E93A 1RPXA 1FX6A 3IV3A 3FEMA 2FB3A 4X9SA 4OQVA 3E96A 4XQ6A 1QO5A 1K8XA 5FF0A 5HMSA 3NQ7A 3KVMA 1JCXA 3A5FA 4GRSA 2YFNA 2GOUA 1F2JA 2RKXA 4FO4A 2B7OA 3MW7A 3NDOA 3LLFA 3M7WA 3VI2A 5LNRA 2X1TA 5HR6A 4LVDA 3H53A 2QDGA 4FXRA 2D73A 1NF0A 3WK3A 4WOZA 5J5DA 5A8GA 2YW3A 3C2RA 2QAFA 1GVOA 1KM1A 2CLOA 4AEOA 4NNBA 4HHPA 1OFRA 2WKJA 4NJKA 4RXGA 3V75A 3C61A 4JTKA 3PS7A 1RD5A 2YDAA 4ADTA 1O5XA 2VFGA 2A7NA 2QCDB 5C55A 4DF1A 5DELA 1F5ZA 3TROA 3EEGA 3MBDA 3PBYA 4MVAA 3W1XA 5LNSA 4L4LA 4MKNA 3TJXA 1VYPX 2Y61A 3N2MA 2YGYA 1EP3A 4AF0A 3L0GA 3O06A 3U2OA 1VR6A 3G1VA 1XDMA 1AW5A 4ZQPA 1I4NA 4RX0A 5E0KA 3SGUA 1OFOA 3G1HA 4R7JA 2Y63A 3TAOA 1PHQA 4PEKA 3C4UA 3LCLA 1W3NA 1OABA 3I6RA 2W6RA 1YPIA 1NAL1 4IQLA 5CPNA 4IPIA 1TJRA 3P5ZA 5AHIA 4DELA 3HGJA 1ADOA 2V2CA 3BG5A 3PBUA 2ZA2A 3C8FA 4Y90A 2QCEA 4UTJA 1M7PA 1ME9A 3C2VA 1UCWA 4JNMA 2E5DA 1QFEA 2QDHA 1KBJA 4QJ1A 1SUXA 1Z41A 2PURA 3T78A 1KLZA 1HG3A 3D0CA 3NPWA 4UFJA 1WV2A 4X22A 4UTIA 1D3GA 4XWUA 1KW1A 1DVJA 1VCVA 4FEZA 1GT8A 3BG3A 2JKAA 4Q32A 2NXIA 5F2GA 3M5VA 2OJPA 4WJEA 1TV7A 1TYGA 3TSMA 1LLWA 5HWMA 2WSYA 2OCZA 4CQ9A 3LM7A 2ISWA 3EX2A 4WD0A 3LV5A 2YCEA 3DI1A 3MHGA 3C52A 3IRDA 3G1FA 3NQMA 3RF9A 3LXCA 3AJXA 3UY8A 1L6YA 4LNYA 2RFGA 3W70A 3RFAA 1JVNA 3W7JA 1Q45A 3T40A 2CZDA 1ALDA 1TTIA 2R91A 4XUGA 3CEUA 5G4EA 3W87A 5IM51 3LBCA 3L66A 3G18A 4DO6A 5BOOA 3ZR4A 5AC6A 4RK8A 1JCJA 3V1PA 4Y8FA 1KTNA 1VHNA 4UMBA 3TX9A 2YW4A 2H8ZA 2DZUA 1PL9A 2PCQA 3TA6A 3CIXA 3S42A 4OWGA 4I7VA 4RLIA 2CLHA 2ZCGA 4NQ1A 4TU1A 1EPXA 1VC4A 2AAMA 5BNKA 3LDVA 5D2WA 3S1XA 3P81A 1SPQA 1PV8A 2H8XA 4GNJA 5FEPA 5AHNA 4JTGA 2C6QA 2J9YA 4NU7A 1EIXA 2R94A 1MZHA 4PH6A 3SJ3A 3TE9A 3WFAA 2VEKA 3RNDA 5KTLA 3JR2A 3R89A 3E12A 4NJGA 1NVMA 4Z0JA 5HUOA 3QW3A 1PE1A 2WNNA 3Q58A 4LVFA 1AL8A 1U5JA 4S1FA 4IXXA 1OFQA 4IPJA 3GXTA 2A7RA 1VZWA 2NV1A 3CWNA 3IEBA 5EKYA 4XBSA 5DY2A 5HWNA 4IX2A 1QO2A 1ZAHA 4M6QA 4O18A 1Q6RA 4TIMA 3UWVA 1FDZA 1OF6A 4MY1A 3VE9A 4TO8A 4IWWA 1A5BA 1FWSA 4ML9A 4LVAA 1EB3A 1FQ0A 1GWJA 4N6FA 6ALDA 3HGOA 1GEQA 1TPUA 1NSJA 3B06A 1J5TA 1SZEA 3AO0A 4CQAA 1CI1A 2FJKA 1TPVA 5AHLA 3G8EA 4ZVJA 1XI3A 1XBZA 2NUYA 4QSHA 3M5YA 2HMCA 3IGUA 1ZCOA 4JYFA 5ABTA 2ZFAA 4Z1CA 3BK0A 1T96A 4LY8A 5BMXA 1SZNA 2WNZA 3NO5A 3PY2A 5H2ZA 4ORMA 1QOQA 5D2XA 1FWWA 1SO3A 3TSBA 2VENA 1KFKA 1J4EA 3ABSA 4JR5A 4UTHA 2WQPA 2B7PA 3N2XA 4ZQOA 3A23A 2FQIA 4AVFA 1JJKA 2C0AA 5CZTA 2DZPA 3NQVA 4MFEA 1OFBA 4JTLA 3L0KA 3S1WA 3LBMA 1F7BA 3MHUA 2FPYA 4O11A 1KM4A 1MXSA 4O54A 4RZ4A 3NPUA 2X1RA 1EWEA 7TIMA 4N02A 5CKSA 5KMYA 1HUVA 3TW7A 4MJZA 1O94A 4O1DA 1H7PA 4DXVA 4UTKA 2P10A 3W7IA 1MSSA 5E1QA 3UWWA 1W5QA 2QCHA 1TV8A 1LOLA 1ZALA 5G4WA 2DZSA 1TQXA 3SR7A 5D02A 3TAKA 1I2QA 3W7KA 1H1YA 1UUOA 2EGZA 3W1TA 2DZVA 2YR1A 3MWAA 3HG5A 5HJLA 1G4EA 4MFDA 1R46A 3LHWA 4H4IA 5LNVA 3KHJA 5LNUA 1TMHA 3TFCA 1LROA 1IXOA 4UUIA 4HNUA 3GB6A 1ME8A 4YMZA 3DGRA 5FEZA 2NWSA 5D2YA 4ZQMA 5C6MA 5I3IA 2OT1A 2E6FA 3P61A 3B03A 1RVGA 5D04C 4O57A 2GVGA 2A6NA 1YXDA 2ZRYA 3YPIA 6TIMA 3I7RA 5D37A 3EX3A 3G0UA 1MEHA 3RLVA 1RZMA 5L6UA 4O10A 5DBUA 5C5YA 4DPQA 3PULA 3WJZA 3PR2A 3NZRA 4IX0A 2E09A 3W71A 5TBOA 2R14A 3KX6A 5I3HA 1JCMP 2QR6A 3W1AA 1OFDA 3LCWA 4X2RA 3B0UX 1SQ7A 4XBKA 1DHPA 3UWQA 4MIMA 1MO0A 8TIMA 1K7EA 1QR7A 3EWUA 1KTBA 4YLWA 4JTTA 2ZZ1A 4RV8A 3HB9A 3GKAA 3M43A 3A5VA 1A50A 2CLKA 4NZFA 3GKFA 3HG4A 3PVFA 2NWRA 1V5XA 2ZZ3A 4K39A 3SECA 4Z1BA 2ISVA 3BW3A 1H63A 4Q4KA 4QISA 4CQ8A 1GYNA 1LCOA 4O12A 2FPVA 1PCWA 1KM2A 3LCFA 3STCA 1PIIA 1A5SA 3GR7A 1JQXA 4OV4A 2H3DA 2YZRA 4U4MA 2QAPA 1WQ5A 1AW2A 1K8ZA 2EPHA 3M5ZA 4BI5A 4O15A 4E38A 3QEZA 1UBSA 4JICA 2B0MA 1RV8A 3MP4A 2VFIA 3NQAA 3PB0A 2ZA1A 2X1UA 1G67A 4LRSA 5F4SA 1GOXA 4AF0B 4RKAA 3NQGA 2G96A 3DBPA 3MMTA 1F73A 1SZGA 4XZ9A 3QRHA 3IIOA 4NXKA 4I9AA 3W84A 5CSRA 3KOFA 3NL6A 3FKRA 3MI6A 1XBYA 3MI2A 2E68A 3EX6A 3HG2A 5AN7A 5HR7A 2LLEA 3DHDA 1ZAIA 1DOSA 2CU0A 2OZ0A 3THAA 5LSMA 4UMCA 3M47A 4N9BA 1WOAA 5LHFA 2ATMA 4POCA 2DU2A 4CCCA 4NZJA 2EKCA 3U8GA 1N8FA 3LV6A 1VCFA 1R2TA 4M5PA 5AHMA 4ZQCA 1JQVA 1FWTA 1VYRA 3BW2A 1OYCA 3DI0A 1I45A 2IQTA 1HFBA 4AWSA 1KM6A 2CLLA 2HTMA 1XC4A 3C56A 3QQ0A 1OK6A 3MUXA 3OEXA 2AGKA 4O1BA 3ANYA 3PUOA 1KM3A 1TRIA 3WJYA 3QPYA 4K38A 4Z08A 2BTMA 1G69A 4K6AA 1TO3A 3B04A 1YLVA 4ALDA 3W2UA 1C9DA 1F05A 5BW6A 1T0OA 1HL2A 4MLRA 1G7VA 2YPIA 4FNQA 1IIHA 3W6YA 3LCIA 1KLYA 4KFNA 4AHOA 3QC3A 1VCGA 4H3DA 2C16A 2GQ9A 4O52A 4JTSA 2QCCA 2P0OA 3F1QA 4FXSA 4MUZA 3OG3A 4IMGA 3W7DA 3QW4B 4LOCA 3W22A 3LI0A 1LM1A 1VHCA 3W2LA 5LKYA 3HQ1A 5BMWA 4I7UA 2HS8A 1CW2A 1IXNA 3KVKA 1WYIA 2J24A 3UYCA 3VKJA 1FCBA 3QMSA 1LRQA 5MHBA 3IVTA 3BVJA 1QOPA 4IMFA 2W79A 1B4KA 3ZWTA 2CFFA 2CZEA 1N7KA 1W56A 3HGSA 3MBFA 1SO5A 3E9AA 3FA5A 3A21A 3C6CA 2GQAA 4LUJA 2TSYA 3PBVA 4IOTA 5F1UA 1I2RA 4RZ5A 1GG0A 2A4AA 1PVNA 2I1OA 2X1SA 3OIXA 4AHQA 4ADSA 4E2BA 4JGDA 3THQA 2WSQA 1LOQA 3SSJA 4PTNA 2VFHA 3G0XA 1W3TA 4M7TA 1I2OA 3LHVA 1XCFA 3NR0A 2NX9A 1VLIA 2PC4A 3TW6A 1GTEA 3NGJA 3W75A 2ZA3A 1TIMA 3LRLA 2G95A 4UMAA 1IF2A 2C18A 5D33A 4GBUA 4BK9A 1G6CA 3F4NA 1FXPA 3WK1A 3FS2A 2A85A 3WJSA 1SFJA 5LGZA 3S5NA 3BARA 1XDLA 4JX6A 2ATSA 2A1YA 3HO8A 1OJXA 4JTFA 1LLZA 4HNTA 1ONRA 2VC6A 3GNDA 3P62A 3S5OA 1W5OA 3PBWA 5C2XA 3DENA 5J5RA 3DFTA 3O6DA 4NUWA 2RDTA 3S0CA 3LCXA 2B4GA 4UFLA 5AOUA 2QCGA 1JRBA 1TPWA 3ZS4A 4NJJA 5KZMA 1UJPA 3P67A 3FLUA 1QPRA 3CTLA 5I3FA 3FYPA 4P61A 3UZJA 1VLWA 3NVTA 1ZFJA 1KFBA 4I7WA 3DFPA 1F6PA 3ATZA 3SI9A 5CPMA 1W5MA 3LHUA 3O07A 1BTMA 4RJEA 4A3UA 3P5YA 3L5AA 3TV8A 1TPFA 2Z6JA 3LLDA 2Z1BA 3O6YX 1IXQA 1PCKA 3SY5A 1KFJA 2J9XA 3G1DA 1X6UA 1DV7A 1W3IA 5K9XA 4MZYA 4N9CA 3LXAA 3GAKA 3LERA 1KV5A 2JBMA 1OVDA 3P84A 4R34A 4JEQA 3NPVA 4FIQA 1KFCA 4OGZA 3KFTA 4IJBA 2ZDRA 3O63A 3W7MA 5D2TA 1TV5A 3GDTA 3P8JA 2ZRZA 3G1YA 5HQEA 4GC4A 4OBTA 3W07A 4LVBA 4DO4A 1EUNA 4H6KA 1V7YA 2A21A 4JX4A 3CB8A 3W7NA 4K37A 1SSDA 2NZLA 4XKYA 4DF0A 2RDWA 4IMDA 4UFIA 3W1UA 4ZZ9A 3M6YA 4LTSA 5C54A 4JN6A 2PRLA 1XXXA 3OVPA 1HO1A 1QPQA 2YX0A 1X7FA 3TKFA 4HPJA 4TMBA 4E0CA 3TCEA 3P80A 1Q6QA 3C2FA 5AC7A 1M7OA 3BGGA 1LRTA 3LXBA 2NX1A 2RDUA 3GDMA 3NM1A 1ICQA 4R33A 4Q33A 1SW3A 1XUUA 1P0NA 5D03A 3TC6A 3S9YA 1H62A 3SIZA 2QJHA 3TNOA 3N19B 3G1AA 1H7OA 3B0PA 5DXYA 3T44A 3LOTA 4UXDA 2YSWA 3USBA 3KRSA 3C3NA 4ZL1A 1W5NA 3NNTA 3LCGA 2QCLA 3NPXA 1W5PA 4S2BA 1TB3A 3CPRA 1K8YA 1QMLA 2NXHA 2AQWA 3O05A 3W7LA 3BW4A 3W1MA 4UR7A 5I3GA 3EXTA 1LYXA 1ML1A 5KZEA 3W7CA 4UIOA 1YTEA 2Y88A 3MP5A 2Y7FA 4FNRA 3N14A 2WJZA 1GVQA 3N73A 3I7SA 5G2HA 3QSTA 4DF2A 3S1VA 4N9EA 3I68A 3UWUA 3HMJG 1LORA 3UQNA 1QNVA 4JIPA 4OHQA 1AW1A 4A2SA 2O7SA 1R2SA 3HBLA 3MHFA 5G2IA 4HSOA 4IGHA 4UTUA 3HOJA 2ZZ5A 3DH7A 1SSGA 4LV9A 4K8HA 1S3HA 4O53A 3R12A 5F2LA 4G1KA 4B5NA 1IIGA 5CZJA 3G0SA 3W2NA 4HN4A 4OV9A 3LI1A 1WXJA 1W31A 4PCFA 4BWLA 3G1XA 2NUXA 3DU0A 2QJGA 2GJLA 1TREA 4GXMA 1DL3A 2Q8LA 3BG9A 4AH7A 1JUBA 4Y9AA 4ORIA 4MY8A 5G2WA 1S5WA 1TJPA 1TTQA 2WO5A 1DBTA 3TH6A 5FF4A 3STGA 3GR8A 3L65A 4MLJA 3DFOA 1XM3A 5K7JA 1JRCA 1W1ZA 3QMRA 2FDSA 4PODA 1H1ZA 3RLUA 5D09A 2ZBTA 3GDLA 4UTMA 3M44A 1M6JA 4LC6A 5K4ZA 3L5MA 4PA8A 1XUZA 5KZDA 3EWWA 1FBAA 1UUMA 3GDKA 4AMAA 3BLEA 4IMCA 2V9DA 1W8SA 4JYDA 1O60A 4E2DA 5FEWA 3C2OA 1JR1A 2VFFA 4PL2A 2BLEA 2NX3A 1SZFA 2PE4A 5HUPA 2HSAA 3GAYA 3M5XA 3IGSA 3UD6A 4R53A 1GJPA 2FPTA 5EMUA 4ADUA 2OT0A 4BFAA 3TU9A 1LBMA 3TQKA 3W2MA 1UASA 1YPFA 1I2PA 4YL2A 2ZTKA 4DQWA 1XBXA 3DHFA 1EX5A 1ZAJA 3QFEA 2C13A 3GX9A 2BZNA 4BI7A 3P8IA 4ZQNA 4A22A 1JULA 3OA3A 2GVLA 1QAPA 1GVRA 2YXGA 3IVSA 4RCXA 3TXZA 4FX7A 4NNAA 1NEYA 2CW6A 4UR8A 4GUGA 1OYBA 4GE8A 4M19A 2E5BA 2FFCA 5LNWA
chains in the Genus database with same CATH superfamily
3VINA 3QTGA 3W01A 1H09A 2WLYA 2QF7A 3TYCA 3CWOX 1CLKA 3KRZA 3BGJA 3GH5A 1B30A 1JGMA 1HO4A 1XRFA 2Q09A 3FIGA 2PDHA 1SW7A 2ESCA 2EF9A 2R1PA 2Z2BA 4AQLA 3DAQA 5ECVA 1NARA 1TQJA 4AYGA 3LMYA 5FI8A 3PJTA 1H0GA 4MZ1A 3Q94A 2ALDA 2Q3RA 3VM5A 3CIVA 4WDWA 3W7HA 2OZ3A 5K9CA 1JYWA 1WXZA 4GG9A 4LY4A 1WUEA 1VGAA 2PS2A 4RNJA 1XH0A 3P3BA 3HU7A 3LRMA 3NL5A 2NUWA 1UROA 2PLJA 1TWIA 1YBQA 1EP1A 3LBOA 3I4EA 3PM6A 1X1ZA 4WHBA 4G2DA 3EX1A 5D2VA 2C14A 3LHTA 5BU9A 1VP5A 3CL8A 2OKOA 3EMCA 1UWSA 1P1XA 5CPOA 4PFMA 1QW8A 2AL2B 1OG6A 1X8FA 3MYOA 2OX1A 1IGWA 5I02A 3F5KA 5CG7A 4EPEC 1OC6A 4J3WA 1B9ZA 1IWPA 4B4FA 2VRJA 5XIMA 5HATA 4WY0B 1XP3A 1N82A 4DYJA 2NV2A 3WUGA 4Z2IA 4JYEA 1BSLA 1XH1A 2WNWA 4U10A 4X63A 5FJRA 3M41A 4XTIA 1KBBA 3KLLA 4K8EA 1E9IA 3PZQA 2J27A 4NT0A 2V8ZA 4BEUA 1A4LA 3L7RA 1ZY9A 4UNKA 1WAUA 1TPB1 4DO7A 3N12A 3CPGA 3EXRA 5A1AA 3IGHX 1PS9A 1FRBA 3FHQA 1ZJIA 5EBAA 1T41A 5K2ZA 2J8TA 4DYKA 5DMLA 4HU8A 1XQLA 1GOQA 5L9FA 4PCNA 3NQ6A 3VOIA 1H61A 4YXGA 3LCHA 3AUJA 3E6EA 3VIFA 2Z4GA 1F76A 2HBVA 3QYQA 1P43A 2C79A 5AC8A 5BXSA 3KVJA 4FXFA 4MB3A 2GDUA 1LBLA 3BLPX 3PNZA 3GG1A 4JTCA 1N8IA 1PKYA 4EACA 2J25A 5G5IA 1H7XA 2QT3A 4HT3A 4C6JA 1EOMA 3KBVA 1TVLA 1IGSA 1HJSA 2ZXAA 4KCUA 4YVXA 2PTDA 1DE5A 2Z7GA 3RK8A 2V2DA 4H9YA 2OYKA 5AHFA 5CZ0A 1KFEA 3GUWA 5JU6A 4N0RA 5IFPA 3SCNA 1EWDA 4M1BA 4MNLA 2KX9A 3TNBA 3OBEA 2VFEA 2DVTA 1R7AA 3WD3A 1QPOA 1HX0A 2E1WA 2F84A 1B3ZA 4KCVA 4DVOA 3UXDA 2FGLA 1ISYA 2C1HA 2BOEX 1RR2A 3FXYA 1HF6A 4HSNA 2HK1A 1B90A 1E4NA 3TQVA 4KWWA 1OCJA 3U6WA 3WLNA 5BXTA 2PC8A 1CGTA 4DXXA 1BYAA 3CU2A 2TAAA 4W7VA 1ZL1A 5F4XA 1CLXA 3TMLA 3HMCA 3IWPA 5BRBA 3LN3A 3B8IA 4LPCA 4V28A 2R1LA 4ZTYA 3UU0A 1R3WA 3IVUA 1LF1A 4JHZA 2VWTA 3GFXA 4GVGA 5E6YA 5AYZA 1Q65A 1F3EA 4C1KA 5KITA 1OCBA 4A05A 2I9UA 2Z2UA 3OBKA 3HTWA 3W1PA 1BXNA 3S6OA 4G9PA 2E8YA 1B57A 1NFGA 2L5HA 1XKYA 4QIUA 3NL3A 1DQWA 3T05A 1Q3NA 1JPKA 4XSMA 4JHMA 4O16A 1JNDA 3B4UA 2FIQA 3W85A 4UTWA 2WHJA 2RAGA 1AQHA 3WLTA 4GKTA 4UTTA 4CD6A 3TYAA 2CERA 1E5JA 4C6NA 4TMCA 4GVFA 1MWOA 5AYBA 1AK5A 2WOQA 1WDPA 1XBVA 2A3LA 5D32A 4KRTA 2XFYA 4CNSA 3W3OA 2BB0A 3B9AA 1NFPA 3W7RA 1W0MA 3L2IA 5EL1A 4NZ3A 3AISA 3THUA 1S5TA 1E15A 1ECQA 1VFUA 4WDXA 3BMXA 1UH2A 2ZRVA 1A5AA 5TIMA 2ZZ2A 2IKGA 4XKMA 4D6CA 4B5XA 4GGHA 3K30A 3P82A 2PZNA 3H55A 4U2YA 1ICSA 1OC5A 4S2CA 4V15A 3WUFA 3W7QA 3AMDA 3FK4A 3CUXA 4IZGA 3R43A 3AOFA 3OLDA 1DWIM 5EYWA 4AD3A 3W7PA 2WPBA 5KINA 4GZ7A 1I60A 2CITA 1GVSA 1OBAA 1XIJA 2D0FA 1XLMA 2J9ZA 1YDOA 1X97A 1PYFA 4DPPA 1UR3M 3G8RA 3BL3A 4AWTA 2E1DA 3T4CA 3LHZA 4FNPA 5HA7A 2EAWA 1KM5A 3KHDA 4H8HA 1XYAA 1JDDA 2X16A 5HXMA 3Q37A 1KCKA 3TR2A 2DUXA 4GMEA 4E8CA 3CZJA 1V3KA 3FDKA 2HV5A 1W54A 3R5EA 4F79A 5HK4A 1GNXA 3O15A 1GHSA 5MKGA 1QPNA 1KGWA 2ZX7A 5C9RA 1IEIA 3GYCA 4KRZA 2J7GA 3MMWA 5AFDA 1H41A 4PC8A 1DHKA 4WJ8A 5FF7A 3ARVA 1SU5A 4IP4A 3N3MA 3KCLA 3B8DA 3EBVA 3GC4A 1EDQA 1GOKA 3ANVA 3F2DA 3MO4A 5D9PA 1QATA 5XINA 1RBLA 3EWBX 3S9ZA 1FCVA 1W17A 2DJLA 2CZVA 3TIMA 1LQ0A 3UWEA 2I5QA 2JKEA 2J62A 1SZRA 3OPSA 1IZKA 4RDWA 1LG2A 2GVJA 1Z6KA 4IQJA 4S39A 3E0IA 3F4WA 4QS5A 5D38A 1JF6A 1PX8A 4U3AA 4ACYA 1S2TA 2FB2A 5DXXA 3W83A 3GVVA 1P4CA 2HK0A 7TAAA 1ZS2A 4QM1A 3CQ0A 4UTLA 2QCDA 4ZB5A 1UWRA 1KRCC 1BD0A 1JYXA 1V3HA 2TPSA 4US6A 3PUGA 3QGVA 2EHHA 1ISWA 2PLCA 1JYNA 3PZUA 2PGRA 3IK4A 4TX8A 3MT1A 5GNZA 1O7AA 5DLCA 4Q7BA 2D24A 5D30A 3KWSA 2HJPA 3MUCA 3UESA 3XIMA 5IHRA 1ZLPA 3EOUA 4GC3A 3GYEA 3B8WA 3L9CA 4IL2A 2WJFA 5A3HA 4MGGA 3D3AA 4LXFA 4AHPA 4UCFA 2VXNA 1J79A 2Y2WA 3BAYA 4KT2A 2B7QA 3WNNA 3VNDA 2VOMA 4JL1A 3UR5A 1V03A 2ZX6A 2YLAA 4NF7A 5FF3A 2ZZ6A 2FZ8A 4INFA 4KPLA 3IIXA 1BYBA 3CL7A 2XVPA 3GXPA 2QULA 3RU8X 1BPLB 1GQIA 4P8UA 5GVJA 4YN5A 3UGRA 4AB4A 3M46A 2C8NA 2X42A 4D6FA 3M0ZA 4DO5A 3CUZA 4QNEA 2VDHA 1DWHM 4UTFA 1OD0A 3E49A 4Y2WA 3VKKA 3QMTA 4UZSA 3N2OA 2PP1A 1Q5MA 1LUCA 3FDGA 2OO6A 2DIEA 4CU7A 5JUVA 4XIAA 1F3XA 4LVGA 4GQBA 1OX5A 4C6BA 1JCTA 2VZUA 4UCGA 1Q6LA 1QWKA 2UV8G 2NLIA 3E0WA 4L6HA 1BG4A 1WX0A 3L4WA 2V82A 1V6TA 3SGZA 4B2DA 4LAUA 3RR4A 3CUIA 3GVGA 2VGGA 3VNMA 4O0KA 4A21A 3STEA 1EPVA 2EJAA 3IIPA 1POKA 3R79A 3PWIA 3CYVA 4MAZA 1XLKA 3TXVA 3Q65A 4U31A 3QY7A 4AG0A 1WP6A 1EKOA 1Q13A 1RD6A 4KF1A 3S1GA 2ACUA 1K03A 1Z42A 2GPTA 4PRTA 2Z26A 1EYWA 3QZAA 1DEDA 1JD7A 1SM9A 3MI3A 5F2MA 4HZ6A 2RUSA 1KRAC 2TRSA 2GSHA 4Z2JA 3AU2A 3S5YA 5DN1A 1ZBKA 5JH2A 3E3HA 3D46A 2ZUUA 3W74A 3N4EA 1DKWA 4FOKA 4GBDA 4JD4A 5E70A 1SR9A 4FS9A 4RL3A 3DFQA 1FH9A 1LP6A 4EOUA 4XO6A 1E0VA 4NJHA 3PZ9A 2DH2A 5AB3A 4JCLA 8A3HA 4IFKB 5I3DA 6XIAA 1RALA 4QR6A 1S2UA 2E4TA 2H90A 3NG3A 4JIHA 3TZNA 1UPPA 1NWUA 3SEPA 3WQWA 1EQCA 2YOCA 2PEVA 1VH7A 4F48A 1CXKA 2DUAA 1ZBCA 3PSVA 2A7PA 2EPLX 2JGYA 4O14A 3L68A 1C9WA 2PODA 1RLDA 3HGRA 4DM2A 4K36A 4CCDA 4WRHA 3HJZA 3ARSA 1D7KA 3R94A 1GPFA 2ACRA 4C60A 2CZ5A 4LW7A 5E93A 4MB4A 3RLGA 1FX6A 3FEMA 1EC7A 1C93A 1TWWA 1P7TB 3WD1A 3E96A 4XQ6A 1XQKA 1QO5A 3IUDA 3OVGA 4KERA 1JCXA 1YE4A 3M4HA 1UR4A 3URQA 3NDOA 5LNRA 3M7WA 2JQXA 4NKCA 3IJLA 2EKGA 2QDGA 4BKNA 2D73A 3BXWA 3H7RA 3BICA 4PMUA 4KEUA 4AD0A 4NJKA 1V51A 3V75A 4FOUA 4LCRA 4YIWA 2VFGA 2QCDB 2IXUA 3E0LA 2GGIA 3W1XA 3PBYA 4BHYA 4JOMA 4MVAA 5LNSA 1W6TA 2E8ZA 5FIPA 3WYZA 5CJMA 2OWXA 2Y61A 3N2MA 2YGYA 3V16A 4AF0A 3L0GA 3U2OA 1XDMA 5E0KA 3SGUA 4ZXOA 3N9KA 2J13A 4Q8NA 1W3NA 3QOMA 3VU2A 2BP1A 4C6KA 5AHIA 3QHMA 3KTCA 1ADOA 1AQ0A 4QDPA 1R9YA 1JF5A 2XU2A 1ME9A 2OTDA 3C2VA 1UCWA 4H00A 2E5DA 2QDHA 3W4RA 5CCZA 4QJ1A 3NZGA 4QLJA 5KEZA 1HG3A 4UFJA 1WV2A 2GDQA 4X22A 4UTIA 4XWUA 2C0HA 3EPOA 3ECQA 3OZPA 3N18A 4S38A 2NT0A 2NXIA 4H9TA 4AZHA 3AIUA 4B5TA 3SUSA 3EB3A 4X0VA 2OJPA 1MUCA 2VC9A 3R11A 4JL2A 3WG6A 5JMUA 3OQEA 1LLWA 4AX7A 2OCZA 3ZT7A 1RY8A 3H2NA 1KCXA 1FWIC 2ZX9A 3RF9A 3LXCA 4W4QA 4GXWA 4CVWA 3G77A 4JKLA 2VOTA 5EMKA 2PGWA 3PPFA 2R91A 1NU5A 2IPWA 1JFXA 4DO6A 2J7FA 1K9TA 3ANUA 3AHYA 3A9BA 1S2CA 4Y8FA 2QPSA 1XIEA 8RUCA 1KO0A 3EOOA 3BJTA 1J0ZA 4YU1A 1Z3NA 3R1ZA 2ACSA 3IJ7A 2J74A 2W9MA 2CLHA 4NQ1A 1EPXA 1VC4A 4UQAA 5BNKA 3RITA 5D2WA 3S1XA 1SPQA 1GHRA 3UCDA 1EJ7L 2V5JA 1R85A 2Y0FA 3VOFA 2CYGA 3WFAA 4OJYA 2PSNA 9XIAA 1M3UA 4NJGA 1NVMA 4G8TA 3SCQA 3QW3A 1OCQA 2WNNA 2QDEA 2V5KA 1AL8A 4S1FA 1OFQA 5C7VA 4MG4A 3GXTA 2NV1A 4C6EA 5CQ1A 4IX2A 2PWVA 3ZSSA 4GZEA 3EYPA 5EB8A 3WN6A 3NUKA 3VDAA 4MY1A 3VE9A 4JKKA 4HD5A 4XD4A 1UWAA 2D2JA 5LA0A 3WMLA 1EB3A 1FQ0A 4ZOEA 2YL8A 5M2FX 2HXTA 1TUXA 3DEQA 1ESWA 3MC5A 5EMMA 1HJQA 4IJCA 1TPVA 2WLZA 1XBZA 2NUYA 4QSHA 3M5YA 4QX4A 2HMCA 1ZCOA 3TYZA 4JYFA 5ABTA 3KE0A 2WZEA 3V18A 4HZMA 4LY8A 4H7VA 1GVEA 2WNZA 1RXOB 3BTNA 2HCVA 3NO5A 3DUGA 3FEQA 3M0HA 5D2XA 1KFKA 3WLQA 3CLWA 4AY8A 4GQQA 2G3IA 2WQPA 2H9AB 4HCLA 2SFPA 1J96A 4AVFA 5CZTA 1OFBA 3L0KA 1CBGA 5I79A 1OGBA 1KM4A 3AC0A 3ZLGA 5E9XA 1EZ2A 2IUZA 4RZ4A 3NPUA 2X1RA 1EWEA 3CS2A 7TIMA 4U33A 2AQVA 2J77A 1V0KA 1FWCC 4MJ2A 1O66A 3VDHA 4DXVA 1VEPA 2O55A 3T8LA 1FHUA 2OLHA 3W7IA 3PHAA 2CPUA 4FLRA 3ZVHA 4KCTA 3SR7A 5FJUA 1QI3A 3W7KA 2JF7A 3BDKA 3CHCA 2YR1A 3FXGA 2P8CA 3CZKA 4ZCWA 4HBKA 3LHWA 1TMHA 4PUWA 1O5QA 4J5NA 1TJ1A 1IXOA 2G4FA 4NZ1A 1GOWA 1UWIA 2Z29A 4AC1X 4QCEA 4YNGA 3BAXA 1WZAA 1EHNA 3JU2A 1OCNA 1EJTC 4K68A 4GQRA 2ZXDA 1YXDA 3AIRA 1DJHA 2PDNA 4H2HA 3RLVA 1RZMA 4O10A 4GQGA 2WCSA 5C5YA 2FMNA 1XRVA 2OVLA 2I57A 4NRRA 3PULA 3PR2A 3NZRA 3G2GA 4ROQA 1ADSA 1B54A 5T91A 2D0GA 2R14A 3UF9A 4XX6A 5I3HA 1JCMP 4HPGA 3W1AA 1OFDA 5FD0A 2W4XA 3MSDA 4AU0A 4XBKA 5I23A 5M5DA 1OY0A 4J28A 1YPXA 1QR7A 1VJZA 1NM9A 1OZMA 2IW0A 3GKAA 3HM7A 4AFYA 3GKFA 4DJEC 1JXKA 2BVWA 1UKQA 3PVFA 2ZZ3A 3TEVA 3SECA 1P6CA 1E1FA 3BW3A 4Q4KA 1XLLA 2HDJA 3CZEA 2WVTA 1UUQA 2WZHA 3LCFA 2XWEA 4L9XA 4W5UA 3GR7A 4MMWA 4B4HA 1WKDA 2DQWA 2H3DA 2QAPA 1WQ5A 4LB4A 4GFIA 5G1MA 1AW2A 1K8ZA 4E38A 5AKQA 2VUNA 2QF8A 2B0MA 4GJIA 1PDZA 1U30A 2V67A 3F5JA 4GYKA 3ID7A 4PTMA 4RKAA 4AMCA 1F73A 4F8XA 2DGAA 4I9AA 1J2BA 5CSRA 3NL6A 1IR1A 3E0FA 2INFA 3FKRA 1CEOA 1P0DA 1YNYA 3SQLA 3DHDA 4FLQA 1P0BA 2REQA 3WNPA 4UQBA 2DU2A 3GY1A 3G6LA 2FFIA 1R2TA 3ZMRA 2GK1B 5AHMA 1TMQA 3KCOA 1E70M 5EFDA 1S38A 1B1YA 3O2LA 3V1HA 1OYCA 2IMRA 2DY3A 1ZBWA 1HFBA 4AWSA 3C56A 3MVTA 2FVKA 3OEXA 1HGWA 3ANYA 1SJAA 3NDYA 3MJMA 1C7SA 1T8QA 3LU2A 3SRFA 1G69A 4GIEA 4NAEA 1TJ0A 2PTXA 4B16A 1FWEC 1C9DA 1F05A 3N3TA 4K8GA 3O3RA 4KQNA 3K5XA 2YXOA 4JAWA 1Q2RA 2YPIA 1VFHA 1A3XA 1ZJAA 1JZ3A 1AJ0A 3QC3A 1XPYA 4XZMX 5BZAA 4C6DA 3B4YA 1W9VA 1YNPA 4QSFA 1V02A 4ZBCA 3HQ1A 5JBFA 3I4KA 1BXBA 2GJRA 3IK2A 4BS0A 5IDZA 3VKJA 1FCBA 3QVQA 1UWTA 5MHBA 1QOPA 1B4KA 2CZEA 3CASA 2BVYA 5C8BB 1DE6A 3E9AA 3A21A 2GQAA 3L4XA 1XF0A 4IOTA 3WDJA 1NDYA 3B9DA 4XZNX 2QZRA 5CGMA 4RZ5A 4AHQA 1BG9A 3WD4A 2R24A 4E2BA 1W3TA 1B3YA 1H5VA 2VZSA 3MS8A 4V1YA 4E6MA 3GU1A 3T2PA 3VABA 4YPJA 3LRLA 1TELA 2RDXA 1IF2A 2C18A 3L2LA 1H2JA 3E2QA 1AQFA 3F4NA 4PEEA 1K1DA 4HYWA 4MTVA 2PU0A 3FS2A 3ZR5A 3WJSA 3BARA 3VIPA 4PE8A 3HO8A 1OJXA 3VDCA 3GNDA 3PTDA 1W5OA 2D0HA 4E5TA 3S0CA 4UFLA 2QGYA 1JRBA 4HGXA 3P67A 3TN3A 1UH4A 2VI0A 3NJ3A 3UZJA 1HKJA 3VD5A 1ZFJA 3MUY1 1F6PA 5EU9A 2QS8A 2QYGA 3EPMA 3CAKA 1CXLA 5FCZA 2C1GA 2YDQA 4A3UA 2PDUA 3L5AA 3FGCB 3RM4A 2Z1BA 2PWEA 3TONA 2X0YA 3SY5A 2J9XA 5I03A 1EQPA 1Q8JA 1HVXA 3LXAA 3LERA 3T08A 3GFYA 1UD3A 2C71A 4JEQA 4L7ZA 1KFCA 2E67A 4OGZA 2WAGA 5D2TA 2VQUA 4YTRA 3KOZA 4YHEA 1DXIA 4HCDA 4K37A 1OIFA 2QV5A 4ZZ9A 4GZIA 2GGGA 1XYBA 2YX0A 2P8BA 3ITOA 3TKFA 4BCEA 3TCEA 3VA8A 5ABFA 5AC7A 2J75A 4ML4A 1XDJA 2O56A 3R10A 1TIWA 3BAKA 3RMEA 1ICQA 4Q33A 3TC6A 5CC7A 3SIZA 1H7OA 1OIMA 4BEQA 2WC4A 2VYOA 3LOTA 3GTIA 4UXDA 2YSWA 4QCFA 3GUGA 3USBA 3ARZA 3C3NA 3NNTA 3K4WA 3W28A 1QASA 4BQ5A 1TB3A 1QMLA 4JKMA 1E56A 1PUDA 1SJDA 3VD7A 3BW4A 4OOUA 1YTEA 4ZE4A 1KCLA 3MP5A 1K70A 5G2HA 4DF2A 1XYLA 5ENLA 4DBWA 3UWUA 3UQNA 4WKAA 4ECLA 1AW1A 4CCZA 1MDLA 5I24A 5FJTA 1CGVA 1NQKA 4K8HA 4M56A 4HOWA 3R12A 1TUFA 2XH4A 5F2LA 3EA3A 1LL7A 3AXHA 5CZJA 2I56A 1W3KA 3OZOA 2VD8A 3G0SA 3W2NA 4HN4A 1W31A 2Y5SA 3ITTA 4PCPA 1TX2A 1VFOA 3G1XA 3UZZA 3DU0A 1AH3A 4DWSD 4GXMA 4A35A 4AY7A 2PDBA 2Q8LA 4L9ZA 2WK2A 1JUBA 5J8LA 2DSKA 2VD9A 1DTNA 2XM2A 1L0PA 1VBGA 4HA1A 5K7JA 1XRSA 1W1ZA 5D09A 2ZBTA 1J5SA 1MVYA 3M44A 3APTA 1M6JA 1E6NA 1POJA 5DEZA 1G9HA 1XUZA 1HKKA 5KZDA 3EWWA 1GYMA 4QJ4B 4AMAA 5H8MA 3A3WA 2ZUVA 3WBYA 3BLEA 4I9MA 5ABHA 1O60A 4PMNA 2D1ZA 2VFFA 2BLEA 3H8AA 2NX3A 1SZFA 3OG2A 3ZJ8A 3BURA 4DJDD 3UD6A 1OT1A 5CJ5A 4PN2A 5EMUA 5BU6A 4ADUA 4ZSUA 2OT0A 2A3HA 3N6JA 3CH0A 1F3WA 2OWWA 1LBMA 2XIIA 3LG3A 1I2PA 1H1NA 4DQWA 1ZAJA 3U0HA 2VJXA 2G3JA 2QW5A 3QFEA 3WO8A 3B8TA 3GX9A 1ITQA 4W8AA 3GW0A 3DYOA 2YXGA 5JIPA 4F66A 3GSMA 3GNOA 2V63A 1KNWA 1GQLA 1X38A 1IZCA 2E5BA 3GDRA 4WY0A 4MY9A 2CCRA 5HULA 4BZYA 3INPA 4U3CA 1UR8A 1LBFA 5I3KA 1M53A 4MNKA 3VNYA 1ZNNA 4NG3A 3W53A 1Z48A 2V5BA 1VFTA 5T26A 3S46A 3FVMA 1K3UA 3DKLA 3VOGA 2DVUA 3CZLA 2X2YA 4IFRA 3GLCA 3KLKA 3NQFA 1Q6OA 1US0A 5A6BD 2VFDA 1VQTA 1FVPA 3BLIA 1XG3A 3B3DA 3LLXA 4F0MA 3BPWA 3A47A 3JRKA 3VTRA 3BCDA 1YTDA 1CGYA 1Y5WA 4Z42C 2HROA 1S1PA 4QITA 2FZ9A 5E9AA 2X41A 4KMQA 4KWOA 1K6WA 3EA2A 2G8ZA 3E5PA 3SCTA 5A6MA 3GBEA 4O8RA 1XRTA 2XVLA 1GORA 3QHNA 4LC8A 4PUUA 1KWGA 1N55A 3R7MA 2A5HA 4BWLC 1BVWA 2DQXA 3QKEA 2YDSA 4LS0A 3WENA 2Z00A 4H9MA 3N11A 4O17A 1EUAA 4H8UA 1XIGA 2TMDA 3NCOA 2XIJA 1W1VA 4PMDA 5LXEA 4H8NA 3SFWA 1A49A 1FWRA 3CHEA 3A9IA 2PWGA 3SBFA 4O50A 3HPXA 3TFXA 4E3TA 4TXEA 3SW6A 1F8IA 1UZHA 2AKMA 4GY1A 1XIDA 3PZIA 5B80A 3MQTA 2WM0A 2VZVA 3WQVA 1OSEA 1CDGA 2JKPA 1QHZA 3OZMA 5I6SA 2X30A 2YCLA 1A5LC 1L6FA 4AX6A 1PIGA 2VEIA 4WY0F 3VD9A 1E1CB 1H5YA 1E6QM 4D6GA 2UWFA 4K1GA 3N4AA 1HTIA 3EGJA 4GY7A 2DZAA 1F6KA 2ZUTA 3WH8A 1HJUA 5MKGB 1QNRA 4PZVA 4LV4A 4YJ5A 4PTVA 3EDJA 3SCVA 3WNOA 4H9UA 1QCWA 4J2MA 4MDOA 3T81A 1XSIA 3UJRA 4RPPA 3W9ZA 3VFLA 1O5KA 4KFPA 2VR2A 4QAWA 2WMJA 3KOWA 3G24A 3L4ZA 4JTQA 2QCNA 1MI3A 4I5XA 3M1ZA 3P93A 5EA9A 1VFSA 3CT2A 1JZ4A 3R13A 2H3BA 3TR9A 4Y9MA 3MSRA 3WQFA 5DY3A 3BV7A 2X0SA 1TKKA 4OFCA 3E2RA 1DIEA 4NL1A 4Q22A 1LZOA 3MWCA 5LIYX 3PTMA 3HPSA 1UKPA 4QLLA 2ZRWA 5AZ0A 3AROA 3VE7A 2WHLA 4H9VA 3P74A 3XISA 2XN2A 3OLEA 3FAWA 4Y9NA 1J10A 3C0LA 4Z2GA 1ISVA 1VAHA 3A64A 2VEFA 1A5CA 2G97A 4GLEA 4UOQA 1UKSA 3RMJA 4XSLA 4N7QA 4Y96A 5A8OA 3DYMA 4GUJA 2C7FA 5GNYA 2HXUA 4LRTA 4ZO7A 1HP5A 3WQDA 3F4DA 4HHMA 3LS9A 5G1TA 4FNTA 2BY0A 4TV5A 4Q8VA 1JUKA 1HKMA 3O16A 3MJYA 2Y70A 3LGEA 4K2SA 4LUSA 4HOXA 4IICA 4XAZA 2BDQA 2ZUNA 4C6FA 4LQ1A 2IKHA 1DJNA 1H7NA 1PPIA 2BGNE 1UW9A 4UFMA 3DFSA 4H7ZA 5DBTA 3UP8A 4ICNA 2C91A 4CEXC 1TCDA 3HIJA 4FNUA 3NM3A 4IGNA 3UR7A 1FCUA 2GSEA 4NY2A 3W2JA 1FDJA 5AYXA 2WSPA 2RGLA 1U5VA 3DX5A 1RP8A 1N8WA 1ZP3A 4CD5A 3CZ8A 1BKHA 4IUOA 3UZYA 1VD6A 4AD2A 3MCMA 4KBXA 1PB0A 1JPDX 4QS6A 3AS3A 3WNKA 1EFZA 4QQ3A 3CH9A 1UOKA 2Z0IA 5B7ZA 1H51A 1RJRA 1TV3A 2XH7A 2QCMA 5DCEA 3TYUA 1D8CA 3IIVA 1HGYA 4OECA 2RGMA 1UWUA 1R30A 2ZIDA 4DLMA 1V0NA 5EBUA 4N4PA 3RJYA 5D9MA 3BLOA 4LH8A 5TQLA 4TX6A 4IJRA 1WOBA 1EC8A 4XVDA 2OQHA 4NI3A 5I77A 4GIRA 5U4NA 3PF3A 4Q6JA 3T2OA 4RE2A 1G01A 4MYXA 3BJFA 3AS0A 1FH7A 4F40A 2X09A 1NP0A 4C7GA 2YA0A 4KKXA 3M9YA 4OVXA 1R9XA 3W1NA 4ZSTA 4CNUA 3UPWA 4NZ4A 1BVNP 4JTHA 1PKNA 4WZHA 5CSSA 2J66A 2HVNA 4GOAA 1TPH1 3H4WA 3GFZA 3R8GA 4WKHA 1AG1O 4RV3A 1WZLA 1Y0EA 2P88A 1B4EA 4N2YA 3RU6A 2Z1XA 4JIQA 4O19A 3NOEA 4DJDA 3EOEA 2REQB 4OTKA 2QHAA 4PFHA 2OXNA 1QHOA 3W26A 2G4JA 1ONEA 5F7UA 3GW3A 4BI6A 5BYWA 3FSUA 4D8LA 4OUIA 4E3VA 3W72A 2OOFA 2VO5A 4G1NA 3U9IA 1WE5A 2OZTA 3TUUA 2WV8A 4BJHA 1VIWA 4EF8A 2WHMA 3N13A 2AQOA 1MUWA 3M07A 9XIMA 2CKSA 5HINA 1EXPA 3LZ3A 1MEWA 5A6SA 1JPMA 4GH1A 4D71A 4XKYB 4HK6A 2ISSA 3VXGA 1I2NA 3WQCA 2D2GA 1DWFM 2A3AA 4NYYA 4QAIA 4AAJA 2HRWA 1THFD 4QHRA 4GUFA 3UCQA 3V3WA 1NDVA 3QSRA 1WNOA 1Z89A 4IGMA 3ZVIA 3GDBA 2DJXA 4I5UA 1CNVA 2PB1A 4L61A 2PP3A 2PAJA 4AIUA 3LTSA 4GUIA 1RUSA 5A6JA 5IFTA 4CU8A 3C0JA 1N2VA 3K46A 3WBAA 3GXFA 1KGUA 1R3QA 3VC5A 1AJ2A 4LB3A 1DQUA 4AZ6A 3EKLA 4EK7A 3OLIA 1EJUC 5I5RA 2XFFA 4Q8QA 1PO9A 1EX1A 5FJIA 4D6DA 2GQ3A 4ZB0A 3IAQA 1AMKA 1EHAA 4JQ2A 2WJEA 4KFOA 1UOZA 3ZFHA 4RDVA 4IIGA 1QI5A 1X98A 1J8VA 1DJQA 3BH4A 3S1UA 3VX0A 3VKCA 1YIXA 2G41A 3S5ZA 3TSDA 4Z1DA 3RRXA 4H6RA 4N42A 4G5DA 1EEPA 2OLAA 4NVTA 2W3ZA 2FYMA 3NSXA 4F4RA 2PDIA 5CGQA 1XGZA 5AVNA 4L64A 3WF0A 3BV4A 2VZTA 4NXSA 4B90A 4NZ5A 1OYAA 4HNVA 3AUOA 3EDEA 3UZXA 1FWGC 4O13A 3QV6A 3I6EA 3LA4A 1TZZA 2QJJA 3EB2A 3O8AA 4PULA 1Y7VA 1S39A 1P0KA 1W3HA 2X40A 2JGQA 3PB2A 2J6VA 3GIYA 4JTRA 3A13A 1K9DA 3CWHA 1KV8A 3KS5A 4GCXA 3FJ6A 4IMAA 1CGXA 4C6OA 2UBPC 1R2RA 3QPEA 4WQ6A 3VPLA 1J9YA 1M01A 4F0LA 1QI2A 1RJQA 3LZ5A 1NDZA 1NOFA 3NA8A 4EXQA 4LU0A 4E4PA 3NEHA 4JFUA 1TWZA 1W3JA 3PPHA 3WH7A 1J12A 2MNRA 2NSXA 4JY8A 2VRKA 3WLMA 4B92A 3CQJA 4HP5A 3WQEA 1UIPA 4K7YA 1SGJA 1JCYA 3W88A 3KW3A 3QZEA 1PDYA 5F2IA 4F2TA 5DFAA 2P3ZA 3HQOA 3UWYA 1I8JA 3VIJA 1U1JA 4C7DA 4R7OA 5LZLA 3WFLA 4R3UA 1OFAA 2I9EA 4MOZA 3O0FA 4JS3A 4LT9A 3O0KA 2DT3A 3C2YA 3GS6A 3T1GA 5AC5A 3GXIA 2CWXA 1K9FA 3QH2A 1GYLA 3EEZA 2FGBA 3UNDA 2DV0A 1DWGM 3EDFA 5FAGA 4HMCA 3NYZA 3MUZ1 2PLKA 2A3CA 2I5IA 2Y7GA 1SJCA 1YE6A 2O0TA 4MPQA 1Q6FA 1VBRA 1VRDA 4TX9A 1XISA 1BWVA 4E4UA 1A5KC 4TTGA 3DFHA 1BGAA 3EWCA 3WDHA 1TX0A 1CWYA 2DSUA 2RHGA 4KEZA 3VFCA 3AALA 5BOEA 3S2CA 1FKXA 1YYAA 2H6RA 3ITYA 4PTXA 3AJ7A 1L6SA 1HJWA 3UCCA 1B31A 1I1XA 4PBGA 1O95A 3I3BA 4QG8A 1W9DM 4C1LA 3M16A 1C29A 3ITGA 1X1OA 4IXHA 2PGFA 4ZGYA 2DORA 1AD4A 2FH8A 1EIBA 2YCKX 4C6QA 2CBVA 1HQTA 2BBFA 3WSUA 5H8PA 4GWEA 1AVAA 1TTPA 1FFQA 3CO8A 3FSTA 3SQSA 3VIGA 1E40A 1Y5XA 3IV3A 3N6HA 4YYFA 4A8LA 3B8VA 2PDFA 1SJBA 4C1NA 3E38A 2PBGA 2VCBA 3T0BA 4TVUA 5HMSA 1TMLA 3VNKA 3KVMA 1UC5A 1Y65A 5XIAA 2GOUA 1F2JA 2J7DA 2RKXA 3PBMA 4FO4A 1WDDA 2B7OA 3K13A 3VI2A 3CV1A 4LVDA 2PDXA 3H53A 3UR8A 1OB0A 4FXRA 2VMFA 1NF0A 3EAUA 3WK3A 5A8GA 3KP0A 3SCWA 2YW3A 3TA9A 1J0IA 1GVOA 1E43A 3GQYA 1OFRA 1UJQA 2WKJA 1JI2A 3C61A 3QKZA 4KWUA 4FA3A 2YDAA 2XG9A 4ADTA 5FL0A 5C55A 3A4JA 3LNPA 4QROA 4D9PA 4ZR8A 1R5YA 3HV9A 1XYZA 2JFEX 5A6BA 1W2PA 1G1YA 1VR6A 1AW5A 2VHLA 4R7JA 3CV6A 2ACQA 4TOQA 3C4UA 1PTGA 3I6RA 2EPMX 4EP8C 2W6RA 2POTA 1YPIA 2DW7A 4IQLA 5CPNA 1TJRA 3P5ZA 1UPMB 4R27A 4DELA 4ZFCA 1S2AA 2NSOA 4NI8A 2GVYA 4GH3A 3C8FA 4LGXA 4Y90A 2QCEA 1M7PA 3HZ3A 1QFEA 1KBJA 1XSJA 1SUXA 1O6IA 3NPWA 2VRQA 2OWCA 1UG6A 1MNSA 3ENLA 4DJEA 1GT8A 3BG3A 2JKAA 4Q4PA 4PUNA 4AIBA 1KKRA 3AZTA 2VX4A 4NIRA 2NQZA 1W1YA 2X0HA 2WSYA 3E1F1 1XICA 4MWAB 4WD0A 3LV5A 4H1ZA 1FP8A 3PWGA 3MHGA 3C52A 3IRDA 3AJXA 3UY8A 4EKJA 3RCMA 3I3EA 2PWUA 2RFGA 4YTQA 2CZDA 1ALDA 1TTIA 3CEUA 3LPPA 2YDRA 1LWIA 1QK0A 3UYIA 4YHGA 1Q2SA 3AMKA 3G18A 4YVVA 9RUBA 4RK8A 1JZ8A 2A3BA 1JCJA 1GGOA 3BLLA 4Q4QA 2Z1WA 4RW5A 1BLIA 1VHNA 4UMBA 3R0KA 3TX9A 1AA1B 2H8ZA 3JW7A 1GW9A 1US3A 3VDGA 2BOFX 4ATLA 2VGBA 1QW7A 5CGTA 4LF1A 1PL9A 4MKVA 3CIXA 1LG1A 4OWGA 1M41A 1P7TA 4RDYA 5TAOA 3VX1A 1XLDA 4MPKA 4UWMA 4TU1A 4CKQA 5JIWA 4QRNA 4UOJA 2GUYA 1KBLA 2VR5A 1A80A 4XBJA 3ZVHB 1M7XA 1MZHA 1REQA 5M03A 3PZMA 3TE9A 2VEKA 2ONEA 3JR2A 1R38A 3R89A 4A3QA 1OGGA 1PE1A 4FP1A 4Q8WA 2C1IA 3Q58A 1U5JA 1CXEA 2FMOA 4MADA 1VZWA 5EKYA 1LL6A 3WQOA 4B5VA 2WMKA 4EX4A 2PD5A 4O18A 4NRSA 4UQCA 3AFBA 1UWQA 5JH1A 4KGLA 4J27A 3UWVA 2HQAA 5TF0A 2R1KA 4JFTA 1FWSA 3PZOA 1MFVA 4WSKA 4LVAA 3WUEA 4P7OA 4HPHA 3GTNA 4N6FA 3AS2A 3I6TA 1SR0A 2VTFA 3H7UA 3A12A 1Q4NX 1NSJA 4DUXA 3BC9A 1UC4A 1XV8A 3B06A 1J5TA 1SZEA 3AO0A 4CQAA 4BY3A 3RUBL 2FJKA 4FXJA 3BMVA 4JQ3A 2ZFAA 4S3DA 2XH2A 1C3FA 4UQDA 1T96A 5BMXA 3QC0A 1TVNA 5H2ZA 4ZO8A 4HK7A 1SO3A 1B2YA 3LYEA 7REQB 1EXBA 3W00A 1M04A 4QE1A 1ZCCA 2QPXA 4QG6A 4H2CA 1OGSA 5FJOA 3NQVA 4MFEA 4JTLA 1PJ9A 1Q6DA 2OGYA 1F7BA 1C90A 2V38A 4O11A 1MXSA 1XLAA 3KCJA 3IS4A 3RRAA 5CKSA 5KMYA 1HUVA 1TG7A 4DNMA 2P10A 2BHZA 1MSSA 3UWWA 2O9OA 1ZB5A 1E3XA 1LOLA 3CMFA 4G7FA 2EGZA 3W1TA 2DZVA 3MWAA 3ARXA 1CGUA 1IT8A 2ZC8A 4MFDA 4H4IA 3WBXA 3U3HA 4ILSA 3TFCA 3ARQA 1LROA 1VJSA 4QE5A 1ZRQA 4CNTA 4UUIA 3VGHA 4HNUA 1A3WA 4QJ3B 5TNVA 5I3IA 1UQZA 2I16A 3B03A 1RVGA 2ALRA 3MKVA 1FHDA 2ICSA 4AW7A 2BV9A 3MMDA 4O57A 2GVGA 4Q7IA 2A6NA 4A8RA 4GYPA 3YPIA 6TIMA 3I7RA 5D37A 2EG7A 4HSHA 5FJJA 3G0UA 3VDBA 1MEHA 1CENA 5CPQA 1E5NA 1H4PA 2O92A 3C0QA 1X8CA 4L6OA 2ZKMX 2QGHA 3W71A 3RM8A 5TBOA 1LL4A 2WZMA 2QR6A 2Z2AA 3B9OA 3LCWA 1V02E 3OTRA 1SQ7A 2PDQA 1DHPA 3UWQA 1M9HA 5HQMA 1VFFA 4LJ3A 3VUSA 8TIMA 3DECA 3SY1A 4TV6A 3TYBA 4JTTA 2ZUSA 3HB9A 3D6NA 3M43A 3FAXA 4HMDA 4MNMA 1LT8A 3VK5A 3BCJA 3WCZA 4K39A 3K8LA 2ISVA 3AZRA 1LCOA 1EJVC 3ITVA 2P5NA 2I17A 5LA1A 2PFHA 1JQXA 3OO2A 4U4MA 4MWAC 1WZMA 2EPHA 1QXLA 3RCNA 1JZ6A 3CJPA 4O15A 3MMUA 2A79A 4URIA 3QEZA 5LYRA 5C9WA 3KBSA 2Z1SA 1PX4A 1BVZA 3FGCA 4M0XA 5CJNA 1MNZA 3PB0A 3TWAA 3ZLHA 1H11A 2X1UA 4LRSA 1GOXA 3ZXWA 3WDIA 3AMLA 1SZGA 4V2XA 3PZTA 3IIOA 4NXKA 1MUMA 2Y8UA 3W84A 3PPGA 3KOFA 3AYVA 3APGA 3MI2A 2GWGA 2WC3A 3VIIA 5AN7A 1VPYA 5HR7A 2LLEA 1F9CA 4JNZA 2CU0A 2EPOA 5LSMA 2ZUWA 3M47A 1WOAA 3FJ4A 4POCA 4NZJA 3U8GA 1BXCA 4M5PA 4ZQCA 1WPCA 3DI0A 3LQLA 2EPKX 4WDUA 2F2KA 1UR1A 1KM6A 4XISA 2HTMA 1XC4A 3WLPA 1PIFA 3SCSA 8XIAA 4LNCA 1CB2A 1OK6A 3PUOA 4H04A 1IZJA 3QPYA 4CUCA 2G0WA 4K38A 4DWSB 2BTMA 3GVQA 4R9OA 2QMKA 3B04A 4PCSA 3WQ6A 4HA4A 3TLQA 2Z1VA 3B8UA 3WEMA 2HEJA 1T0OA 4B15A 2YJQA 3K4AA 1G7VA 4D6JA 3CHDA 3DN5A 1IIHA 3W6YA 3H2MA 1OINA 3UVIA 5T8GA 3E74A 3QZ6A 4KFNA 4AHOA 5HQLA 3M0IA 3SRKA 5I06A 2VCCA 3CAQA 3F1QA 1AMYA 3EDKA 3KOXA 4IIHA 2R1MA 3MCOA 3DBNA 3OG3A 3PN8A 3W7DA 2ZUMA 1MW2A 1PX3A 3TTEA 4LOCA 1FWDC 4JFVA 4Y9OA 5BMWA 3TCSA 2HS8A 1GONA 3GIQA 1PZ1A 3U2EA 3UXLA 3KDNA 2Y5EA 1RA5A 2CXEA 2W79A 1UMLA 2BODX 4HU4A 4NAFB 1QPKA 3RPDA 1N7KA 1W56A 4MWAD 1SO5A 2WVVB 1UHVA 1DTUA 3FA5A 1FFRA 3UJFA 4M8UA 2AKZA 3GHTA 2WHKA 4LCQA 3MSGA 1QI4A 6CGTA 5F1UA 4PUKA 1MW3A 2BOGX 4J35A 3EWDA 1PVNA 3CNYA 3Q67A 2WSQA 2VFHA 1T6MA 3MANA 3R0UA 1I2OA 1GEHA 3M0MA 5HMEA 3F2BA 2PC4A 5H1WA 1KRMA 2ZADA 2ISDA 3MVIA 2G95A 1XG4A 1FXPA 3WK1A 3WQGA 1SFJA 3S5NA 1XDLA 4JX6A 1C92A 3UETA 2ATSA 1K4GA 4H6QA 2A1YA 4RNIA 4JTFA 3WF2A 4CU6A 4FF5A 3WNMA 3E5BA 1W32A 3WH6A 5J5RA 4D72A 1UZDA 3H24A 2O9RA 2YIHA 4M3PA 3LCXA 2QUNA 5AOUA 4QDMA 2QCGA 4NJJA 1LUCB 5KZMA 4O1FA 5HDRA 2EQDA 3FLUA 1QPRA 2OFJA 1DPMA 5I3FA 4P61A 2PWFA 4HJFA 3SIMA 5CPMA 1W5MA 4RJEA 2BXYA 3P5YA 3TV8A 3LLDA 1GZJA 2PBOA 3Q45A 4DXKA 1JIBA 2WQDA 1IXQA 1PCKA 3G1DA 1XKJA 4GCAA 4HU3A 5K9XA 4N9CA 1KRBC 5C9ZA 1RHCA 1OVDA 3P84A 4R34A 4V27A 4LFYA 3D3FA 1LWJA 4B91A 2PDYA 4PB4A 1V6UA 1VFLA 3KFTA 3QV9A 4IJBA 1YEYA 1TV5A 2CESA 3GDTA 1GJUA 3P8JA 2ZRZA 4GC4A 3W07A 3TN4A 4JX4A 4C6IA 1IHIA 1JPHA 4DF0A 4IMDA 4QP0A 4LTSA 4JN6A 5A2AA 1HO1A 5IOBA 4JZ5A 3NO3A 4HPJA 2J79A 4TMBA 3W82A 4S3EA 6XIMA 1IEXA 3BGGA 3S47A 4IM4A 3LXBA 5LA2A 2RDUA 2FZDA 1SW3A 3L4VA 3UG3A 2QJHA 3TNOA 4H19A 3B0PA 3T44A 3MV11 3WKZA 1YHTA 1KFWA 4WR3A 4KIRA 2RJHA 1L2QA 3TTSA 2PDLA 2WPGA 3LCGA 2PU1A 2QCLA 3V35A 1W5PA 4S2BA 3CPRA 1K8YA 2AQWA 3H26A 1XCXA 3W7LA 3W1MA 2Y5JA 3EXTA 1I9CB 1ML1A 3CMGA 3AMCA 2Y88A 3S3GA 2PDKA 2WJZA 3N14A 5CAKA 3I7SA 4HHLA 4AIOA 1LORA 2ZVIA 4JIPA 1G5AA 2V6AA 2O7SA 2XISA 3HOJA 1SSGA 4AISA 1S3HA 4O53A 4GZJA 4G1KA 3CYJA 2QXWA 4RUBA 4RDZA 5M3WA 3H70A 2D3LA 3ITLA 2GJXB 4OV9A 1KD0A 1R3TA 3PPCA 2GJLA 1TREA 1DL3A 4AZCA 1X39A 4AH7A 1YBQB 4LBSA 3U57A 1TJPA 1TTQA 3QBUA 1J01A 3QQWA 5FF4A 3STGA 1J11A 4GY0A 1KXQA 3L65A 4MLJA 3DFOA 4P5UA 1PYMA 1JRCA 3CMJA 1D2KA 4PODA 2V3FA 4ZA0A 1VPQA 3RGTA 3GDLA 4UTMA 3HPAA 1YX1A 3OB8A 4V1XA 5GQBA 5K4ZA 3L5MA 1GKPA 4PA8A 4QE4A 3CUHA 3GDKA 4G7EA 1XLGA 3AWOA 1YW1A 2V9DA 1BF2A 4XAGA 3SDOA 3T0CA 3IJQA 4IISA 2Z28A 3RPMA 5LXXA 5HUPA 3NO1A 3IGSA 1VIZA 2WZIA 4R53A 2NVDA 1H3GA 5BWFA 2OU4A 3AIQA 4MM1A 2OR2A 3TU9A 1XLFA 5E5CA 1UP2A 2J7EA 3TQKA 1WKYA 2W61A 5BCAA 3N17A 3SGGA 3PK7A 3VCCA 4DN1A 4F3HA 4CD8A 1JULA 3OA3A 1P6WA 4NNAA 3W6LA 4X61A 2CW6A 2PUZA 4PMXA 3UVAA 4WSHA 1MDRA 1OD8A 4GE8A 1EDGA 2FFCA 3UNTA 5LNWA 1AZ1A 5J04A 2W0UA 3W23A 4XD5A 1O1HA 5HANA 3NQEA 1ZPTA 3FJLA 3QM3A 1A53A 1Z44A 3HQPA 1KA9F 2BMBA 4J7RA 3PAJA 1DORA 1E9ZB 4L56A 4HKPA 1XSKA 1T99A 4JTIA 3GXNA 3FOKA 4GJJA 1G4SA 1O4UA 3QLDA 2GFTA 3S6DA 1EJWC 1O68A 2AMXA 1W9BM 2OX4A 1H7RA 2BSLA 3ZO9A 1DXFA 1NH6A 4EPKA 1NP2A 4AXKA 4ES4A 4CN4A 4IG2A 4NX0A 1AL7A 3HFTA 4LSBA 4A29A 5GJPA 1OG0A 2ADAA 3UG5A 5DANA 1D8WA 4O0QA 4Y6GA 1UD2A 5KETA 1H7WA 2ZYFA 2E9MA 3EWZA 3L67A 2QKFA 2IXVA 4BF9A 1YTKA 1B3OA 2NVCA 4LBRA 4ICCX 1CX9A 2NT1A 4HPXA 1UD8A 3GM8A 4KWSA 5AYIA 3AS1A 4JXCA 5B7YA 5HJYA 3W25A 4O28A 1XYFA 3O1NA 3KS6A 1XH2A 3KBJA 2FJUB 3NQDA 1TA3B 3IGXA 4BQ4A 4X3ZA 3MSYA 3LGGA 4OIFA 5PTDA 3W38A 3R58A 1LDCA 3AIVA 2NW0A 4LAKA 3URAA 2E6YA 3HF3A 3VCRA 4H7CA 1L2UA 2FLIA 5FJPA 1ITXA 1PWMA 2IS7A 3AHXA 5CBJA 1IR2A 4DZHA 3N34A 2WXDM 5FEXA 3GTXA 4DJFC 5I09A 3F7JA 3EKGA 1R9ZA 2VC5A 3ABQA 2PRMA 2VNCA 3BO9A 1L9WA 1BTCA 1SW0A 3EOLA 3UPBA 4M82A 1F6YA 3COTA 4Q4SA 2WNQA 3LGDA 3SQMA 4AZ5A 1VYSX 3GK0A 4O1AA 3TTQA 1HL9A 1XLHA 2AMGA 3CEPA 3SRHA 3SCRA 3SURA 4XZIA 4DRSA 1SO4A 3GE7A 2D3NA 1DIDA 1YXCA 4NAEB 1WDWA 4O1CA 2YYTA 3W29A 3RX2A 4DWSA 3VCNA 2JALA 3T42A 1UD4A 1TCMA 2CETA 2A3EA 3VIHA 3TP4A 4ICMA 3WZ0E 4ZTXA 1VBUA 2FTWA 4GGBA 3T0TA 4ERGA 4P2VA 1TSIA 3EKZA 2ON3A 2A0NA 2WCAA 4ZQRA 3W6MA 4L9YA 4DJFA 3LUTA 1DIOA 3AXMA 4D6HA 1KXTA 4HTBA 2XSXA 5CPSA 3VAVA 4FI4A 1ZHAA 2ZXBA 5DF0A 1P48A 5K9DA 1W9PA 4UFKA 2VELA 1M7JA 4AD4A 1IYXA 2ZVRA 3K1GA 4FAMA 4EAYA 3GIPA 3C5QA 2C19A 1V77A 3W2KA 2Q8ZA 5G1YA 4TR9A 4P7LA 5D05A 3T55A 4LAMA 3B8SA 3GHRA 3DOPA 4HNCA 3LK6A 1EP2A 3N25A 2J8FA 3RILA 2VVSA 1RAKA 4OBSA 1M5WA 1JFHA 2W92A 1NY1A 5EMLA 1MEIA 4LS1A 1RQEA 1CLVA 3DESA 2MANA 4Q8UA 1U83A 1GVFA 3W1QA 5AHEA 5JQ9A 1JD9A 1DQXA 2QCFA 3GNPA 1PAMA 4WGXA 3H23A 1E0XA 1PWLA 1NFBA 1UYQA 3AIEA 1TWSA 3LEPA 3MU7A 3NQ2A 1AH0A 2VURA 1FWFC 4XZLX 1OHLA 3UY7A 2PA6A 1G7UA 3QF0A 1KTCA 4DJFD 5DO8A 5GJMA 4FR6A 1RQHA 3BQ6A 4JX5A 1NF7A 3WQ4A 2XH0A 4JDYA 1W9XA 1Q7ZA 4L6DA 1J18A 5BXPA 4IUGA 3CHVA 2ZRXA 4JNYA 4ZMGA 1E6PA 3UG4A 1YKWA 5H6HA 1ECEA 2Y6ZA 4CLMA 1JG9A 1V79A 2CZFA 2YB4A 3VKDA 4GX9A 2QPUA 2VM8A 1RQBA 2Q6ZA 2P1FA 4M6PA 1P5BA 2JE8A 3TJLA 2HNEA 2VWSA 4W85A 4GIAA 4I8YA 3CUGA 1H50A 3B05A 3WDPP 2POZA 2E6AA 2QUTA 2VKZG 3QV8A 7ODCA 1UD6A 1DJYA 4DEFA 2CNCA 2QJMA 3QLLA 4L4MA 5I78A 3FJNA 3QY8A 3W73A 1FXQA 5HBFA 3VGGA 1OX4B 3BAIA 4UTTC 4XD6A 1X7IA 4OT7A 2OYLA 2R8WA 1TPEA 4Z0SA 4IIFA 4YCOA 5E0FA 3QQ1A 2GQ8A 5E0CA 2E0PA 2F9RA 3IPWA 1A4MA 3UEQA 3H54A 4P8XA 2HS6A 3TN5A 5CPLA 7REQA 4N4QA 4WCJA 3ATYA 1A5MC 2CLEA 1D7FA 4EIVA 3DCPA 4F9JA 4D8ZA 3C8NA 3AAMA 3O6AA 2FHBA 4J40A 2ZRUA 1R8LA 4RNFA 2H9AA 2YFOA 4WF7A 3SFKA 5CSUA 2JF6A 4WUIA 3MP3A 3WDRA 4FLOA 1TZ7A 3GNRA 2I14A 3WLSA 4IQDA 3JS3A 4BQ2A 1XX1A 5HNTA 4B3LA 3GR4A 4GYPC 3DFNA 1E55A 2VX6A 2NVAA 2CBUA 4QG9A 2QUUA 1PTAA 3RO6A 3A22A 7A3HA 1JL8A 3RDKA 5I2UA 3KTSA 3L4UA 3U7VA 1XR2A 2ASHA 4PRWA 4U5IA 3ZOAA 4GABA 4GUHA 4ERAA 2I7GA 2WSRA 2CWNA 2ZE0A 4KEMA 3OVQA 3N1AA 3U5UA 2DZWA 4IT1A 1HL8A 2CHOA 3WF3A 1YDVA 4KWVA 5KZ6A 2G5WA 3VC6A 1FKWA 1XS2A 3SJNA 3WJXA 4P8VA 3WL0A 1EJXC 1UR2A 4M7SA 1MMFA 2HZGA 4Z1AA 2DW6A 2ZQ0A 4KS0A 4JTJA 1MW1A 1CPUA 1KM0A 1I6NA 1BYDA 3EB4A 5IBXC 1TRDA 2V2HA 3QPZA 2Y7EA 3PG8A 1PXGA 2KZHA 2O7QA 3FA3A 1FDYA 3W7EA 3R6IA 2XN1A 2XVKA 4NNCA 4HZ8A 3CM4A 4LBUA 2WVSA 4JEJA 2CLIA 3WK0A 4LS2A 4DX3A 4LUYA 3ZJ6A 4AY1A 4UQEA 5C70A 3S4TA 4GO9A 2A2IA 1RJPA 2E77A 2IPGA 3PJWA 3O6CA 3ZWSA 3PSWA 4PMYA 2P50A 1XGEA 3GVRA 1WDQA 5HMFA 4KGJA 4EF9A 3TZFA 4QJ5B 1LWHA 2XGBA 3TJ4A 1G94A 2QUVA 4J4KA 3WF4A 2BXVA 3P60A 2NQ9A 4W5ZA 5F1VA 1ZSXA 4IPLA 4WK9A 4OE7A 2Y85A 1RVKA 1KQZA 3IIZA 4GVHA 2A6LA 3SN4A 4AZIA 4WDTA 4FLSA 4RE4A 5FESA 4IPNB 1SMAA 3BLFA 1GOOA 1XD1A 4P7QA 1XYCA 4B9ZA 4QLKA 2PDGA 2WMIB 5HWJA 3UZ5A 1YXYA 3Q2DA 3QN3A 1OFPA 2YXXA 2Q01A 1RK5A 3H2FA 3UWZA 4IH3A 1KFLA 3DC8A 3KXQA 4G56A 1ME7A 2OODA 3S2NA 1E4IA 2Y62A 3KL3A 4OU1A 2WB5A 1C8YA 1GQNA 3KAOA 3ES8A 2WVUA 3ARRA 1TR1A 4CNOA 3A3HA 4E2OA 2IPFA 1AODA 3A4XA 3KP1A 2AGTA 1WA3A 3H6OA 2O9TA 3I65A 4M81A 4JTUA 3PBGA 3KOYA 1E0UA 4PB5A 2DT2A 2YCJA 1FCQA 5LHEA 3L5LA 1ZGDA 4FIRA 1B9BA 2DZTA 1TPDA 4M80A 4ZENA 1LOSA 1ZTVA 5IXEA 3EX4A 4MYAA 1S5VA 2BHYA 4M51A 3T07A 3QJAA 4HU0A 4IMEA 3CC1A 4L4OA 2WWCA 3IJIA 3R2GA 4ATWA 1T8XA 4KW2A 1TV2A 3EXSA 2FTPA 1GTHA 1I75A 3M0LA 1VPXA 3TTOA 3AHVA 5A6AA 3NXLA 1FOBA 4IGSA 5CAHA 3UPMA 3E02A 5A5WA 4PMJA 3PUDA 1V7AA 4YWIA 3TMQA 1JZ7A 1JGIA 4Z2HA 3UR2A 1XLIA 1L8NA 5CLTA 4DBSA 4RNHA 5HPOA 2XJ7A 3CBWA 4XTDA 4ZO6A 2PZ0A 1EA9C 1PTDA 5C9XA 3ZIZA 1XLEA 3DC0A 2XINA 5DQPA 2OO0A 1XIIA 2QMJA 4YCPA 1R47A 4D1IA 1LTDA 5A8MA 4PL1A 3QV7A 1EL3A 1XL9A 2DP3A 4RR4A 1KC7A 5FF2A 1ICPA 1H60A 3JUGA 3Q4DA 4V33A 1E6RA 1UH3A 3DXIA 1C8VA 4MF4A 5DRIA 3KUMA 4YTSA 1SYTA 4X9SA 2V3GA 2VGIA 1K8XA 2YKKA 4MHBA 4J3XA 4TTUA 3A5FA 2YFNA 2FZMA 2YL6A 5E6ZA 1U2YA 3MW7A 1US2A 3LLFA 5HR6A 2QVNA 2IQDA 3ICJA 3L4YA 5A6TC 2UY3A 2YZ5A 1JEZA 4RZBA 7PTDA 3DYPA 3GH4A 1HIZA 3C2RA 4RE3A 2PDWA 1KM1A 2CLOA 4NNBA 2P76A 3S2LA 1ZU8A 4CQDA 4W87A 5M17A 1WXYA 2BG5A 3PS7A 2HPIA 1O5XA 4XK2A 2A7NA 4DF1A 1F5ZA 3EEGA 3MBDA 4L4LA 1VYPX 5A69A 1ZZMA 2WWDA 3O06A 2QVHA 3QGAC 1I4NA 4RX0