2CZ6B

Complex of inactive fe-type nhase with cyclohexyl isocyanide
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
212
structure length
212
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title x-ray snap shots of inhibitor binding process in photo-reactive nitrile hydratase
rcsb
molecule tags Lyase
total genus 60
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2cz6B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cz6B02
2CZ6B 3QZ9B 2ZZDA 1UGPB 1PSEA 1V29B 4OB2B 1UGQB 2DXCB 2ZPGB 3QYHB 3A8HB 3QXEB 3WVEB 2AHJB 3QZ5B 4OB0B 2ZCFB 1QP2A 2DXBB 2D0QB 1IREB 2DXCA 1QP3A 2CZ1B 2PVDB 2PVGB 2O01E 2DXBA 1JB0E 3A8OB 3X20B 2DD4A 2CZ7B 3HHTB 2WSCE 3A8GB 2DD4B 2ZPHB 2CYZB 3LW5E 4ZGJB 2ZPEB 4OB3B 3WVDB 1DJ7B 2WSFE 1GXIE 4XK8E 2PVOB 4ZGDB 2PU9B 3X26B 2ZPBB 4KT0E 3A8LB 3A8MB 1UGSB 2PUKB 2QDYB 2DPPB 4OB1B 3X28B 3VYGA 2ZPFB 2PUOB 1AHJB 2DD5A 5L8RE 2WSEE 4RKUE 4L6V5 3VYGB 3X25B 3VYHB 2ZZDB 3X24B 2DD5B 4ZGEB 3QYGB 2CZ0B 1PSFA 2ZPIB 4FM4B 4Y28E 1UGRB
chains in the Genus database with same CATH superfamily
4EIKA 2PQWA 3V8KA 2LQ8A 4KH1B 1K8AC 2ZAEA 3L42A 2ECZA 4A63B 1U5SA 3VS1A 1H4LD 1WXTA 3MIAB 3OY9A 3JCMd 5LJ5g 2CUBA 3A98A 5FLXE 2PHGA 2JJ9A 3TSZA 3GNFB 4EOLB 1ZUYA 1GBQA 1ZA1B 2FEIA 2ZCFB 4N4GA 4C8QA 5KYNA 3OYJA 3CCLT 3NHNA 5DQVA 2LZ6B 3EHQA 4ZN3A 1W6XA 1J3TA 5KYUB 4QKUA 1BKBA 1N9RA 2EJ9A 1EX4A 2A37A 4ZTFA 1M2OA 4QQ6A 3K7AM 1WYXA 2E3HA 4CFXB 3NDQA 1B3QA 4F7UG 3DLMA 2O9VA 1Y7XA 2X4XA 1MNEA 4C8QC 2W2HA 1XNIA 2CP3A 2DYIA 4D8DA 1ZSZA 1YIJQ 4OB3B 1W2BA 5KYYA 4AT1B 4OMOA 2P0QA 5CYIB 2D0NA 3L2UA 2SRCA 2KNBB 1PD1A 3THKA 5J39A 1KD1C 4M75A 1PHTA 2KMTA 5GANe 3V8LA 3CMEA 2I40B 4M7DG 2C5XB 2E64A 5LJ3f 1ZSZC 1NYGA 1JQQA 1UNHD 3OYHA 4Y72B 2CKKA 1O9KA 3LH5A 4LXCA 1MV0B 2XMFA 3OMCA 3QHWB 1M1GA 2XDDA 1IHVA 1N5ZA 1RACB 2NUPB 2QFZA 3R6OA 1BU2A 5FRMA 4NS5A 2W9FA 3BDLA 4XAXB 4MDXA 5CR2A 3VUZA 3DJBA 7AT1B 2WPAB 3CC2T 2KI7A 2XDPA 2X4JA 2CZ0B 4DOVA 1D3UB 1D3BB 1ZP2A 4BXXX 2LX9A 4DBRA 3M0UA 3ZBDA 3NPFA 2WMBB 2Y4XA 2RHXA 2IPOB 3BFMA 5J26A 4M7DB 4EMKA 1MMAA 1OV3A 1YJWA 1MMNA 4GLMA 2BKDN 4F16A 4LDVA 4FIBA 1BYMA 1WGSA 1FINB 3TNIB 4KUIA 1AWWA 4J6XA 5KYUA 1RI0A 3OYMA 4KGXB 1QP2A 3OYAA 4LDWA 3PFSA 5IN1A 2KRMA 2QEXQ 1I07A 1U06A 2BE7D 3SWNA 4BCKB 2L3QA 2QDJA 4J7FA 2JMCA 2XD0A 1Y96A 2LJ3A 4FW2A 2DXBA 1JB0E 4JDSA 4BB7A 4J9HA 2RI2A 2A08A 4OGCA 2YUOA 1Q82U 1X27A 5GAOp 3SB2A 4PK4A 2WSCE 3JB9J 3POMA 4C0ZA 1AOJA 4F04B 4E7SA 2RNAA 1WXUA 2K7AA 3TU4K 3G7ZA 2KRNA 1AWXA 2YLCA 4J9BA 2OAWA 3I56T 3SWNC 2JS2A 1NEBA 3EH1A 1YFNA 1QQJA 1X2KA 1OQKA 3CBMA 2I0NA 3M0SA 1GXIE 4QW2A 1F5QB 5IHYA 4F14A 2JT4A 2CSQA 3NGPA 1YP5A 2DL8A 4F7UA 3A8LB 1UGSB 5LJ3e 1E6HA 1JJ2S 2HKNA 2WHBB 4OMNA 1PD0A 2DLPA 2NUPA 2XIDA 2AZVA 4ROCA 1FWZA 3QHSA 5LMKB 4HKEA 5KYWB 2LCSA 3DDQB 3CCVT 1OULA 3M53A 2XKOC 2HQEA 2FPFA 2EGEA 2G3RA 3EG9B 2G6FX 2RK2A 2VVKA 3OB9A 4B6MA 5HCKA 2KR6A 1YHQA 2WEVB 3B57A 4RTWA 4QVDA 2DEUA 1VA7A 4KRCB 2E12A 3VU3C 3OYCA 1PSFA 4M7DA 2DX1A 4F7NB 3G71T 1AD5A 2QQ9A 2UZBB 4M75E 2X1NB 4FT4A 2W96A 5GAMj 3L2QA 4BACA 3M57A 1PSEA 3CXCS 4BCFB 2QQAA 1M90R 5GAN8 3EGDB 1A0NB 2RJFA 4RTTA 1QVFS 1VIFA 2KYMA 3META 1FMKA 4CFUD 4M7DC 1LVKA 1KC8U 2DTHA 3MEUA 3OYGA 2OTLT 1JU5C 4OMPA 1LNXA 2J6KA 3RDVA 3M54A 2O9SA 1T3SA 1W4SA 1RAAB 1NJIU 5GAN3 3FJPA 4BI3A 4IURA 2HSEB 2D6FA 2M1HA 5FU7B 2RA2A 1OKVB 3GTMS 1M1KC 2A36A 4XTYA 1YNZA 2OTJT 2UZDB 1M30A 3BLQB 2OX7A 4RTXA 1XJWB 2K4YA 2DO3A 4BCQB 4LOCA 1RAHB 4C5GA 2DFUA 1YJ9Q 2M51A 3A8GB 2I2LA 2G9XB 2DL7A 3OYIA 2KR3A 4OP0A 2HEQA 1X75C 2QQBA 3TCJA 4ELYC 5A0LA 2LP5A 4ANJA 3M4YA 3GPLA 1I1JA 3MP6A 3EH2A 1VQKT 5FW9A 3X26B 3PMIA 3RR6A 1K0XA 2VUBA 1YWPA 2AK5A 5ACBA 1IRXA 5I2SA 2P0PA 2VKNA 5KYWA 4AI6A 4BUGA 3TSWA 8ATCB 4F70B 2GGRA 3PIPA 3JB9F 3OYYA 1ARKA 4R0KA 3CCUT 2E6ZA 1AHJB 1Y0MA 4BDYA 1LCKA 1VQ7T 2UZLB 1UJ0A 4RKUE 1IGUA 1UTIA 1JBMA 1HYOA 3ASKA 3OYBA 4F17A 5HK0A 3JCMQ 2ROLA 3OYLA 5KE2A 2HNIA 1UECA 4F7UE 4YOSA 1R77A 2EIFA 4BY6C 1K9MU 3EGDA 4HNUA 1G3NC 3QUIA 1YITQ 2H3EB 4PLIA 1UGPB 3HZJA 3G6EQ 5GJVB 2O31A 3MEAA 5ICPB 2COWA 5GAMg 3ZL7C 4IUVA 1MNDA 1QCFA 3I55Q 1JKWA 2LQWA 1RI9A 2BIVA 1AVZC 1OI1A 3QYHB 2EBPA 3OW2S 1KSWA 1VQ4Q 2WJ9A 4OB0B 3HL8A 3MO8A 2KXDA 1IREB 2WACA 5IHNA 3GOXA 2E10A 3C4SA 4OMMA 3MEWA 4N0AA 1YIJA 1H641 3JRZA 1UGVA 2CSIA 4JRQA 1SEMA 3SFMA 1BCOA 1M3AA 4AG2C 2O01E 2RHZA 4PJOF 3BE3A 3VS6A 3CCVA 2K6DA 5GANj 5I21A 2DF6A 2GQIA 2RHIA 2DTIA 2YLBA 1VQMQ 4R55A 4XU2A 1I81A 2GCXA 4M75D 2E65A 1U1SA 1X69A 4D6WA 3MI9B 4N0AC 1GUXB 1IXDA 1Q95G 2LJ1A 3O5ZA 1LOJA 2LJ0A 4ZGJB 4HVWA 4C92G 2D8JA 2LC4A 4JPBW 1H8KA 1D0XA 2DNUA 1U1TA 4HCKA 1NBEB 3F5XB 4BCMB 1H1QB 2HL3A 2EPDA 1I5OB 4LE9A 3OSVA 4MZMA 1VQ8Q 2QDYB 2RJDA 4ZN1A 4ROEA 2HDAA 2WIHB 3G4ST 1ZHIA 4HCCA 2JOYA 1VQPQ 3EG2A 2JW4A 3TVTA 5KE3A 2E5KA 2DVEA 2ZZDB 3RERA 4KRDB 1Q7YU 4HA8A 4C92B 3X24B 5GMKm 2VC8A 4FYVB 4J6YA 2RF0A 3QWXX 1KHIA 4Z02A 2QEXA 2YRDA 3KHIA 3L2ZA 4PJMA 1NEGA 3CC4Q 1WIEA 1XQHA 1X01A 3JB9I 1TUDA 4ME7A 3JB9D 1LJOA 5GAN2 1T0HA 4M77A 4HT9A 1N8RU 3MJXA 5IXFA 4V2SA 3UT1A 3OA6A 3JCMh 1UNGD 2DL4A 4KH0B 4LDYA 4HXJA 1T3LA 5GAOq 1ZQ1A 2CP7A 3S3NA 1CKAA 1RAIB 1Q86U 3CCUA 1QW1A 2COZA 3MP8A 4M77C 1HSQA 3HKSA 3TNHB 3PGGA 3O0GD 5IHIA 2J6OA 5LJ3j 1GUXA 1AWJA 3JV3A 1VQ5A 3FDRA 3CMET 3EFOB 2LQNA 3RKXA 2X4YA 4M78F 3H4CA 1TH7A 3DDPB 2QTXA 1WHLA 3KFVA 5GANg 1WJSA 2FRYA 2CYZB 4OGRB 3FRNA 4JX5A 2RPNA 4OMLA 3WXMB 2R58A 4M7AE 4J5YA 4ESRA 1M9SA 1SRMA 1YI2T 4F6UB 4LD6A 1KQ2A 2JTFA 4KGZB 2IW9B 4J6WA 4M7AF 2DZCA 2P84A 1YJNQ 2YWWA 1S72Q 2JVVA 1FKMA 2QGSA 3C0CA 4C92A 2QAZA 3ULRB 3CCRQ 2DAQA 1SHGA 3J80E 5I2MA 2XHCA 4GLKA 2LX7A 3A5ZB 5D7UA 2QF7A 2RQWA 5KH6A 4ZGEB 2X4WA 1QMZB 5EJCA 1K8AU 5HBEB 2IN3A 1I5LA 4C92C 3TQ7P 3PO3S 2VXEA 2CCIB 2RJCA 5GAOm 1K73C 1C6VX 2DXCB 4J9IA 2DEQA 4DA4A 2CGHA 3EHRA 3MEVA 1K4US 1M3BA 2L5QA 3C95A 2XICA 3EGUA 2BZYA 4EC9B 3QZ5B 1YJ9A 3QWLA 3EAEA 3HO8A 3JCMf 5HQ0B 3GIBA 5CCAA 2CZ1B 3KXTA 1UE9A 5J3BA 1VQ6Q 1XOVA 5GAN4 1D0ZA 3EFOA 2DBKA 1PKDB 3DLLA 1HXDA 2VB6A 4IUTA 3N5BB 2MPXC 2CDTA 1SHFA 5IDNB 3VS4A 2K79A 1I4K1 3OYKA 4M77E 1PRLC 1VOLA 2LT4A 3SDZA 1KG1A 1BK2A 2H8HA 2C5OB 2RB6A 1T0JA 3PNWC 1GL5A 1JO8A 5LJ3g 4LDXA 4IIOA 1AZGB 1SSHA 1Z9ZA 2BE9B 3QDRB 2FG0A 4FYWB 1WZOA 2RK1A 5DY9A 3BG5A 2QA4Q 4Q5WA 3HP9A 1UDLA 4JRIA 1KD1U 3L2WA 3CMAQ 1YHQT 3AHUA 2NLUA 1C9BA 1JXOA 9ATCB 1PWTA 2PUKB 4J9GA 1PKTA 1QLYA 4RTUA 1X43A 4PLLA 1O75A 1QCOA 3X28B 4M78D 4A4KA 3BHUB 4BY1X 1YITA 2RQUA 2FZKB 2K5IA 4JZ3A 3M0RA 4AKGA 3PIOA 5C6SA 2JZ2A 4FU6A 4YTLA 2KDSA 2OJ2A 2JMAA 4BCND 3I55A 5HVYB 3BHVB 2NUTA 1JOWA 3QYGB 2BUDA 1VQ4A 1S1NA 5FU6C 3I35A 2VASA 2Z0WA 3FIFA 4EORB 1QVGS 2ZGWA 2PMIB 3UA6A 1O9SA 4M7AD 1WX6A 3E19A 5FWCA 4HCBA 3CCMQ 2MAMA 1K0SA 2VWFA 4PJOG 2AKKA 2ZPGB 3OBWA 1YI2A 2DVJA 2P4RA 1I8FA 2DILA 4DEXA 3CBPA 4RUGA 2KVQG 2CH4A 2ED1A 4X9DA 4E7LA 3V7SA 3CCJT 4YOOA 1OU8A 4C5HA 3HFNA 1SRLA 2K9GA 2L3SA 1Q81U 4BCIB 1IHWA 4XTXA 2QK0A 5LJ5d 1YCYA 3RGFB 3GNGA 2OAUA 1OX9A 2LDMA 3JCMX 5LJ3d 1P92A 3OYNA 1TU0B 4N4HA 4PKCC 8AT1B 2KMGA 3HPWA 3TEEA 1OOTA 1VQ8A 4II5B 4AFUC 4PJOB 3CXCP 1RLQC 1VQPA 3FJ5A 2H3JA 1H3HA 2EYQA 2L3RA 2MF2A 1QVFP 4HL4A 3MCAB 4MZPA 2QGFB 3V7CA 4XK8E 3NFCA 2K3XA 2PU9B 1VYTA 2CS7A 4A4GA 5I5ZB 4J9DA 3T9NA 3E2UA 1BB9A 1C1AA 3G1JA 2F2WA 4AKIA 4EC8B 1NE8A 4MMLA 3VV0A 4E2FB 4M4ZA 3CC7Q 3LGFA 3GBQA 3CC4A 2KY9A 3MY1B 4JUVA 2FB7A 1VQ9Q 3HFOA 4C8QE 3JCMP 1H1PB 2DMEA 2HBWA 3VYHB 5HBJB 3IQLA 2JS0A 2YRCA 1QCNA 1VQNQ 1B34B 4M77D 3PMTA 2W9ZA 1F1BB 2VV5A 3H0HA 3PTAA 1N4MA 3OYEA 3H0IA 4CC3A 3A1PA 4C8QF 5C0MA 2DJQA 3QYBA 2CZ6B 3P8BB 1YIJT 2DM1A 5GAN6 3BW1A 2RN8A 2R7GA 1V29B 5CKDA 1Q82R 3MP1A 4F6SB 3GP8A 4A4FA 3HRTA 4CC2A 1D3BA 4LD9K 2WIPB 2Y90A 3EJ1B 3LWIA 4C5EA 3VUBA 3L2RA 5CO7A 5ECAA 3CCSQ 2PVDB 1M1KU 5FROA 4L5GA 2O4XB 3JSCA 5GAN7 1PM3A 3RESA 4PL6A 2YUQA 2RJEA 3VS2A 3JB9H 4JLIA 4M75F 1Z9QA 4R56A 1M90C 1WA7A 1CSKA 4JJDA 1YJNA 1S72A 4FCYA 1D0YA 1ABQA 4Y91A 4M78B 1UJYA 1P5EB 3OW2P 1DJ7B 1BIAA 2NWMA 3QYEA 1VIEA 1ZUUA 1BI1A 4NL2A 2L89A 2BZ8A 4C5IA 1TSFA 4XU0A 3M5AA 1VQOQ 4QQGA 3CCQQ 4CFVB 2J05A 1PCXA 2QEXT 1MHNA 1E7OA 3QBYA 3MPUB 3OMGA 4B9XA 4AFZC 1B34A 1M2VB 2PUOB 4J9EA 3CCJA 2YDLA 2CP2A 4HVUA 1JRIA 2WSEE 2E1HA 3CD6Q 4K11A 2Y4YA 4Y92A 2JGZB 1VOMA 5I11A 1OEBA 1WDXA 1KC8R 1LPLA 3NTHA 2PJQA 4BE0A 2KK4A 2X51A 2LTOA 3FEOA 1H26B 2DTOA 1R0CB 2E4HA 2ZPIB 4G6LB 2A28A 1NJIR 1HD3A 3EGXB 1VYWB 3EG9A 3QZ9B 1W2BS 3OS5A 1X6GA 1VQ6A 3M58A 2F5KA 5GAMh 2YRVA 1BCMA 4HNVA 4CC4B 2DRMA 6AT1B 1VQ5T 4PJNA 1K9AA 2UZEB 5FWBA 2BS3A 5A2QE 2QG9B 4J83A 4RG8A 2IW8B 3M4GA 4DEYA 2PK2A 1QWEA 4MZTA 5L23A 4C8QD 4J9FA 3OS2A 2PVGB 2QA4A 2R5MA 2LCLA 2JUFA 4NOYA 2E6NA 3CMAA 1E7PA 1OU9A 1WXBA 2EYWA 4BI4A 2RQTA 4F7UF 4HNTA 1ZBXA 5KCHA 1JSUB 1ZX6A 4CI0C 2BZXA 4FW1A 5DLOA 2QQSA 4FT2A 2D1XA 3OBYA 4KUDK 1OZ3A 4M7DE 2GTJA 3LQ5B 2V1QA 4BE1A 2B8AA 2R57A 3GLXA 2ZPBB 4Z89A 5GMKh 1TOVA 1K9MR 2GNCA 2E3IA 2GF7A 3BDUA 2LT1A 3DTOA 3P8HA 3CCEQ 5FU7C 5CEIB 4CFMB 1WFWA 4XU1A 3RMSA 1WJQA 5HBHB 3L2VA 2D8HA 1G3SA 5IF1B 2MOXA 2PZ1A 2J06A 3CCMA 2C0TA 5IH2A 3M59A 1JSTB 2C0OA 2WFYB 1GBRA 2DIQA 3S6WA 3BY7A 4IUQA 1RLPC 1YJ9T 5HKCA 4FL6A 3E9GA 1KIKA 2DERA 3CPWS 1VQLQ 1AEYA 4IMYB 1UGRB 1KHCA 1QKXA 1NG2A 2RQVA 4PJLA 1E9HB 2LRQA 1GY3B 2XU8A 1YJWQ 3ER0A 1KQ1A 3OQ5A 2LQKA 1EFNA 3F70A 2AKLA 4DBHA 1G2BA 4EOOB 2RH2A 1M4ZA 3BG3A 1IO6A 2YSQA 3BLHB 2D0QB 4CFUB 1WPYA 2KQWA 5GAMd 1PRMC 4CXAB 3EG3A 4ATOA 2ATCB 4BCHB 4RG2A 4EOIB 1ENWA 3QSUA 5CKFA 1WLPB 3KUFA 3SHWA 3M0PA 2KT8A 4JX4A 4MIMA 3QWYA 1H25B 2JM9A 4ORZA 5CQYA 1QMCA 2DRKA 3E1SA 1YITT 3CC7A 4EOKB 3LW5E 1D1AA 4RODA 2IIMA 3G6ET 2O2OA 3VKHA 1SKUB 2CP6A 2CCHB 1Q7YR 4DOWA 3URGA 3I55T 2ESWA 4OGEA 1VQNA 3FLGA 1NLOC 1NYFA 2JTEA 5CAIA 2EKHA 1VQ4T 2EYZA 4LDUA 1KXUA 2LW4A 1Q7YC 1BI0A 3FB9A 2FPDA 1RADB 2KGTA 5A0DA 5GJWB 3CCLQ 2NUZA 1N27A 1OI9B 1MMDA 5GAOl 1BI3A 1N8RR 5HK3A 2KEAA 4I3ZB 4HCZA 4EPCA 2C0IA 4RTYA 2CT4A 3I5SA 2FL7A 1OKWB 3QKJA 5FRNA 1TUCA 1GFCA 2M9UA 2I53A 3V7RA 1M8VA 3JCMg 3MY5B 3UWNA 1Q86R 3LX7A 2BS2A 4F7LB 2MYSA 1H1SB 1K73U 2ZZDA 4M7DD 2FHDA 1TXQA 3CCSA 3L1AA 1FXXA 5AT1B 4CC7A 3OS1A 1ZUKA 1BBZA 2HBPA 4M75G 1VQ8T 4C0GA 1VQPT 4AFQC 3JCMb 1JJ2A 1OL1B 2L2PA 1V76A 2XK0A 1QP3A 4KULA 1UFFA 2MK5A 2GFUA 1KQSS 1TS9A 2RD1A 4XTUA 3VS3A 4E7ZA 4EOMB 1PNJA 2KAFA 5LJ5h 4A4HA 4ELLA 2C6TB 2EFIA 2KYBA 3UF4A 5BNJB 3JCMW 5KYYB 2CZ7B 4E6RA 1U3OA 3EG1A 2CJMB 4D8KA 5LJ3h 3VRZA 2CREA 3CC2Q 3PVLA 2E5QA 3LGLA 3D7SB 2NYSA 4OR5B 3CC4T 4M75B 2DD4B 1G3WA 3UA7A 3H9NA 2ZPEB 4BCPB 1WJRA 1H1RB 2MMPA 3CD6A 3QPHA 2G77A 3CXCA 2HSPA 2YT6A 2QTVA 5CKEA 5GMKe 5GANd 3RKWA 3R6NA 4EDUA 4KT0E 1QVFA 1K8AR 2EQKA 2HQXA 2EUFA 3J7AF 3PVQA 3OS0A 1NM7A 3VJPA 5HY6A 3M0QA 3JB9G 1TFBA 1SF9A 3JCMV 5L2WB 2CP0A 3CBOA 3BLRB 3TW6A 1TG0A 3HRSA 4LUDA 1X2QA 5L8RE 3CQTA 4M77F 4XTVA 5IDPB 2J7IA 3FC3A 3QHRB 2LNHB 2CH4W 1WQ7A 4EMKB 2UUEB 4EOSB 4B9WA 3UPUA 4FM4B 2QGGA 5EFQB 3I56Q 3DOGB 4OMFB 4NC6A 4RTVA 4EMGA 2QI2A 1UGQB 3G6EA 3VKGA 3SWNB 3JCMJ 1JXMA 4MFDA 3MHXA 3JCMc 3ZFJA 4AMCA 1Y96B 1IB8A 2W10A 3SEMA 2DXBB 1YJNT 1S72T 2C06A 2DXCA 5CVIA 1B07A 1OYXA 1PKSA 1KD1R 1QVPA 2DXTA 3CCRT 3TW7A 3TREA 3DL1A 2QQRA 4ZNXA 3CCVQ 1X6OA 3QIIA 1JJ2P 1RAEB 2DE0X 2CP5A 4BCQD 4C92E 1W98B 1M3CA 5LJ5f 1TUGB 2DD4A 4PFZA 1GRIA 2K2VA 3JCMe 5GAOr 3QJYA 2A3LA 1VQMA 3CPFA 4Z6YA 2RI3A 3LWHA 5GAOn 3CCEA 1UHCA 3G71Q 3RBBB 5FGKB 5LQFB 4F7UB 2R5AA 4C92F 1H3ZA 5D6WA 2EVRA 4J8OA 1BU1A 2HD0A 3Q1JA 1WHJA 2F2XA 1OL2B 3EOCB 4BD3A 1G3YA 2PVOB 2MWOA 4M75C 2KBTA 1R8OB 1YBYA 2ABLA 4DBQA 4CFNB 2YUNA 3OW2A 1ZA2B 2EJFA 2WXVB 2AT1B 2FZCB 1VQLA 2A7YA 4QT7A 3PT9A 5I22A 4JLGA 2ZPFB 1VQ6T 2OTLQ 1R0BG 3M0TA 4KBMB 4EOJB 2BS4A 2QDLA 2DK3A 2C5NB 2HCKA 3VYGB 3I9QA 1WHMA 4IUUA 1H28B 2YXYA 1FX7A 1G83A 2OTJQ 1OGUB 5D6YA 2D9TA 4YOZA 4WCIA 1OIUB 3LH0A 2BKZB 1Q81R 1TD6A 2VXFA 1N6AA 1MGQA 4CRIA 4TTHA 2EQUA 4WTOB 2QA4T 4EMKC 3EIDB 1Q81C 3KBGA 1K1ZA 3CMAT 2M16A 1WHHA 1VQKQ 1RABB 2ROTA 3A8HB 4AKHA 1UHFA 4QSHA 3WVEB 4E7KA 2F2CA 2W0ZA 2LCCA 3V8JA 2MIOA 5D6XA 3REBB 3CPWA 1IZ6A 3BHTB 4OVAA 2RI5A 4DQ2A 4BI8B 2EYXA 3CCUQ 4CRLB 3SD4A 5KYXB 3CEYA 1WHGA 3DB4A 4FYXB 1VQ7Q 1VINA 5LJ5e 1GCQA 3DKMA 2FPEA 4OF1A 3HB9A 4E7HA 1VQ5Q 1M8MA 3X20B 3TN8B 1WI7A 2M0YA 1M90U 4QQDA 1W2BP 4M78G 3EFRA 3OYFA 1MUZA 3RKYA 1OX8A 1Q82C 5CKHA 1W1FA 2EQJA 4BBSM 2CUDA 2QYZA 2WMAB 4J7IA 1HK9A 1QWFA 3CCLA 4QVCA 5DQWA 2J6FA 2V8IA 2DL5A 4X1VA 3CCMT 1UUEA 2WSFE 1GCQC 4BCMD 4PJOA 3OYDA 4HVVA 4BY6B 3PE0A 2DIGA 2FYKA 4XTZA 1V1CA 4LN2A 3U23A 2JM8A 5IT9E 4A53A 4ELJA 2DPPB 4BBRM 2JXBA 4OB1B 1TWBA 2HL5C 3VYGA 1AZEA 4M7AG 3I5RA 5EG2A 5M9OA 5CIUA 2X3WD 4L6V5 4PJOC 2GQVA 3CCRA 2L8DA 3X25B 4C92D 2DYBA 2DETA 4MFEA 2YHTA 3H8ZA 5DLQE 4BCNB 4X9CA 1NPRA 2LNVA 4BCGB 1AT1B 3P8DA 1M1KR 2P4TA 4FYYB 3S3OA 2BPMB 4BCJB 1D1CA 3S3MA 2YUPA 3ME9A 1ZBJA 1MV3A 3EFSA 1UEBA 2GTOA 4M7AB 4JJCA 1VUBA 1SSFA 2SEMA 3QXEB 5KYXA 2MWPA 1M1FA 3M9QA 3CC2A 4GBQA 4KRTA 2CT3A 3G4SQ 1H92A 3RIRA 2EGAA 3CC7T 1KC8C 4Z88A 4RTZA 3ZEHA 4LUEA 1YN8A 1E6GA 1VQ9T 4QVZA 3QDFA 5CK9A 5GMKj 4JS5A 2KT1A 2E70A 4XU3A 3RUXA 3CPWP 1VQNT 3A8OB 1NJIC 4JRKA 2C4GB 4UN0A 2PNIA 3HHTB 4P5NA 1OZ2A 1EIFA 1PC0A 2DJZA 1HJDA 3NTKA 3GF5A 2EW3A 1IGQA 2O4XA 3LYIA 2RHUA 2ZPHB 4MDWA 1KQSA 1ZSGA 3WVDB 4BDZA 4M77G 2EYYA 4IKFA 1JEGA 2DZ9A 1UB4A 2DBMA 2DXUA 4RMOA 4M78A 2LVMA 1M27C 4FX3B 2KROA 4EOPB 1ZLMA 4MMKA 2DMOA 2L3PA 2EWNA 4BY7X 4FSSA 3VRYA 3CCST 4DBFA 2VGNA 3HRUA 3I56A 4F6WB 1KJWA 2M0OA 1RAGB 2JNGA 4AFSC 2M02A 1U8RA 4J9CA 4A4EA 2FVUA 4II1A 5GMKl 3C12A 4XQ3A 1M2VA 4M78C 4NL3A 4PJOE 1H24B 3CMEQ 4M77B 1WNLA 2IVWA 3C94A 1CKBA 1K76A 4M7AA 2EAYA 2FZGB 4M7DF 4N4IA 4BCOB 1GFDA 4A54A 2MI6A 5IXBA 2JTMA 3NMZC 2RO0A 4RCBA 1FYNA 5EC7A 1NLPC 2HAXA 2XI9A 1K9MC 4OB2B 2BTTA 2X3XD 2F5TX 3JAME 1ABOA 1MMGA 1YI2Q 2DL3A 3EGXA 2B9RA 2RQRA 3RNJA 3VKIA 1VQOT 2RHYA 1YWOA 2VYTA 2RMOA 2DA9A 3CCQT 4ZTJA 2AHJB 3BG9A 1BI2A 1FMVA 1SG5A 3E9FA 4PFPA 4ELZC 4M7AC 1XO2A 3G71A 3HBLA 4E7JA 2JN0A 1G8XA 2X9HA 3CD6T 1KK7A 3HSBA 3AT1B 3M55A 5CKBA 1QKWA 2PTKA 2HMAA 5GAMf 3QO3A 3UDCA 1Y57A 3OSSC 4FSXA 4O5VA 2V8JA 2AZSA 1B7TA 3VS5A 2FO0A 1AISB 1SPKA 4BE2A 2IG0A 1QVGA 2QASA 2OTLA 2EGCA 2XDBA 1WHKA 2FRWA 5AYFA 4ZGDB 2L0AA 5IHKA 5GAN5 2HQHA 1UNLD 3A8MB 2OTJA 1KQSP 2K57A 2EJGA 5KCOA 1FMWA 4PJJA 5GANh 4IIMA 5LL6S 4EOQB 2COYA 2GFAA 1BIBA 1Y71A 4L59A 3QG1A 2ED0A 5A0GA 1VQ9A 4YC3B 2DKGA 4TVRA 2EQIA 1EZZB 4C0DB 1VQKA 4CFWB 1OPKA 2V8KA 2P0KA 1VYVA 2DD5B 2EKOA 2HZYA 4JRPA 4O6JA 4M6VA 2K5FA 2GBQA 1OPLA 3LLRA 1G5VA 4HT8A 2K5LA 4Z8AA 4C8QG 3H6ZA 4PFOA 4M78E 1X6BA 2V1RA 5LJ5j 5GMKi 3NTIA 1KFZA 2A0FB 3G33B 1RL2A 2E41A 3O8VA 1VQ7A 1W70A 1XTDA 1VYUA 4X34A 3VS0A 2QQ8A 4OMQA 4JJBA 4E47A 1NPPA 1YHQQ 4JX6A 1NZ9A 1GH6B 2C5VB 1N8RC 1VQMT 2O88A 2HKQB 3CCET 2EQMA 2KXCA 1AD6A 2K2MA 4RCCA 2F2VA 3M56A 3VS7A 2MCNA 3DB3A 5GAMe 2K3YA 2B86A 1FVVB 2AIRB 3QJ6A 4F7SB 1Q86C 4C8QB 1OIYB 4E7IA 2X35A 3H0FA 4PJOD 2PK9B 3TNWB 3H41A 2F1LA 1VQLT 1WQWA 2KE9A 1RUWA 1C0MA 1N9SA 1TTHB 4JJNK 1YJWT 1URCB 4AG1C 4IUPA 3UATA 2OI3A 4HLQA 1GCPA 5FU6B 4C0FA 4JS4A 4NSTB 1G3TA 1ZSZB 4GY5A 2LMJA 1H27B 3EG0A 1QVGP 3REAB 4KGVB 1M5Q1 1ACMB 1PG5B 3J81E 5HNBB 3RMQA 1YCSB 1QLBA 1K73R 1VQOA 3MKDA 3CCQA 4LNPA 2ENMA 2RM4A 3HTRA 5GANf 5CQXA 1Y07A 1UG1A 1I0CA 3INZA 4JZ4A 3CCJQ 2NUTB 2QXFA 5IAYA 5DM7R 2DD5A 2K3BA 1AWOA 2VGMA 1D09B 4UC4A 4F7JB 2IW6B 1D1BA 2F69A 2V26A 3M03A 4EONB 2KRSA 4PNOA 1O9KB 4WF2A 4EMHA 2V22B 4VUBA 2W99A 1RAFB 4XTWA 4C0DC 4Y28E 2KSSA 2IVXA 3G4SA 2XG8D
chains in the Genus database with same CATH topology
1MGQA 3QZ9B 1W2BS 1XQHA 2PQWA 1X01A 3OS5A 2LQ8A 3V8KA 4CRIA 1K8AC 2EQUA 3M58A 3L42A 3JB9I 4EMKC 2QEXA 2QA4T 4ME7A 3JB9D 2F5KA 1Q81C 3KBGA 1LJOA 5GAN2 5GAMh 4M77A 3CMAT 2M16A 2YRVA 4HT9A 4HNVA 3OY9A 3JCMd 1N8RU 1VQ5T 5LJ5g 5FLXE 3GNFB 2BS3A 5A2QE 3A8HB 4AKHA 4QSHA 3WVEB 4J83A 4E7KA 4V2SA 3UT1A 4RG8A 3OA6A 3JCMh 2LCCA 3V8JA 2ZCFB 4N4GA 5D6XA 3CPWA 3M4GA 1IZ6A 4C8QA 4LDYA 3OYJA 3CCLT 4OVAA 2RI5A 4DQ2A 4BI8B 4ZN3A 1ZQ1A 5GAOq 3S3NA 3SD4A 4MZTA 1Q86U 3CEYA 4C8QD 3CCUA 1QW1A 3OS2A 3DB4A 3MP8A 1BKBA 4M77C 1N9RA 2PVGB 2QA4A 2R5MA 2EJ9A 3HKSA 2LCLA 5LJ5e 2JUFA 3PGGA 3DKMA 4NOYA 4QQ6A 4ZTFA 2E6NA 3CMAA 4OF1A 1E7PA 3HB9A 4E7HA 5LJ3j 3X20B 1VQ5A 3FDRA 4BI4A 1M90U 4QQDA 4F7UF 3CMET 4F7UG 3RKXA 2X4YA 3DLMA 4HNTA 1ZBXA 4M78F 1Y7XA 2X4XA 3EFRA 4M78G 3H4CA 5KCHA 3RKYA 3OYFA 1Q82C 4C8QC 5CKHA 1TH7A 2QTXA 2EQJA 4CI0C 1XNIA 4BBSM 1WJSA 5GANg 5DLOA 2QQSA 4J7IA 1HK9A 3CCLA 4FT2A 2CYZB 4QVCA 2V8IA 3OBYA 4KUDK 3FRNA 4JX5A 4OB3B 1OZ3A 1W2BA 4M7DE 3CCMT 3WXMB 2R58A 2WSFE 4J5YA 4M7AE 2P0QA 1M9SA 3L2UA 4PJOA 3OYDA 4BE1A 1YI2T 2B8AA 2R57A 4LD6A 2JTFA 4BY6B 1KQ2A 2DIGA 3GLXA 2FYKA 2ZPBB 4XTZA 1YJ9A 5GMKh 5J39A 4J6WA 4M75A 2KMTA 1KD1C 5IT9E 5GANe 3V8LA 4A53A 3CMEA 4ELJA 3BDUA 2GF7A 2DPPB 2LT1A 3P8HA 4BBRM 4OB1B 3VYGA 4M7DG 4M7AF 5FU7C 2DZCA 4M7AG 2E64A 5LJ3f 2JVVA 4XU1A 1FKMA 5EG2A 5M9OA 3RMSA 5CIUA 1WJQA 4C92A 2CKKA 3OYHA 3L2VA 1G3SA 2DAQA 3OMCA 1M1GA 4L6V5 3J80E 2GQVA 2XDDA 3CCMA 3M59A 2L8DA 3X25B 5I2MA 4C92D 2XHCA 2QFZA 3R6OA 4GLKA 3CCRA 4NS5A 5FRMA 3A5ZB 3BDLA 4XAXB 2QF7A 4MDXA 4MFEA 2YHTA 3H8ZA 5KH6A 2DIQA 3VUZA 5DLQE 5CR2A 3S6WA 3BY7A 4ZGEB 2X4WA 4IUQA 1YJ9T 5HKCA 4FL6A 4X9CA 3CC2T 3E9GA 2XDPA 2X4JA 2CZ0B 5EJCA 1NPRA 2LNVA 3CPWS 4DOVA 3P8DA 1K8AU 1UGRB 1D3BB 1KHCA 2P4TA 1I5LA 2LX9A 3S3OA 4C92C 3ZBDA 2VXEA 3S3MA 2LRQA 3ME9A 2XU8A 2Y4XA 2RHXA 2RJCA 5GAOm 3BFMA 3EFSA 3ER0A 5J26A 4EMKA 1K73C 2DXCB 1KQ1A 1UEBA 1YJWA 4M7DB 4M7AB 2DEQA 3OQ5A 2BKDN 4DA4A 2CGHA 2LQKA 4LDVA 4FIBA 1BYMA 1VUBA 3MEVA 1SSFA 1WGSA 3F70A 4KUIA 2L5QA 3QXEB 3C95A 2XICA 2MWPA 4J6XA 1M1FA 3QZ5B 1RI0A 2RH2A 1M4ZA 3BG3A 1QP2A 3M9QA 4LDWA 3QWLA 3EAEA 2D0QB 3PFSA 3HO8A 3JCMf 5IN1A 3CC2A 3GIBA 3RIRA 5CCAA 1WPYA 2CZ1B 1KC8C 2KQWA 3CC7T 3KXTA 5GAMd 5J3BA 3SWNA 3ZEHA 1XOVA 5GAN4 1VQ9T 4ATOA 2QDJA 4J7FA 4QVZA 5CK9A 5GMKj 3DLLA 1HXDA 2XD0A 4IUTA 4RG2A 1Y96A 4JS5A 5CKFA 3QSUA 2E70A 3N5BB 3KUFA 4XU3A 3RUXA 2DXBA 1JB0E 4JDSA 1VQNT 3A8OB 1NJIC 4BB7A 4JRKA 4JX4A 2RI2A 4MIMA 4OGCA 1I4K1 1Q82U 3OYKA 4M77E 5GAOp 2LT4A 3SB2A 3SDZA 1KG1A 3HHTB 4P5NA 2WSCE 3JB9J 1OZ2A 1EIFA 4C0ZA 2DJZA 2RB6A 3PNWC 5CQYA 5LJ3g 3NTKA 3TU4K 3G7ZA 4LDXA 2YLCA 3GF5A 3E1SA 3I56T 2O4XA 3SWNC 3LYIA 1YITT 2RHUA 2ZPHB 4MDWA 3CC7A 3LW5E 1KQSA 3QDRB 3G6ET 3WVDB 3VKHA 3CBMA 2RK1A 4BDZA 5DY9A 3BG5A 1GXIE 4Q5WA 4DOWA 3HP9A 4JRIA 4M77G 3URGA 3I55T 1KD1U 4QW2A 4IKFA 3L2WA 2DZ9A 1YHQT 3AHUA 2NLUA 4OGEA 1UB4A 1VQNA 3FLGA 4F7UA 3A8LB 2DXUA 1UGSB 5CAIA 4RMOA 1VQ4T 4LDUA 2PUKB 4M78A 5LJ3e 2LVMA 1Q7YC 1JJ2S 4MMKA 4PLLA 1O75A 1BI0A 3X28B 3FB9A 2XIDA 5A0DA 4M78D 2EWNA 4A4KA 1FWZA 3QHSA 3CCST 1N27A 2VGNA 3HRUA 5GAOl 3I56A 1YITA 1BI3A 2M0OA 4HKEA 2K5IA 5HK3A 2JNGA 4HCZA 4EPCA 3CCVT 4AKGA 3M53A 3PIOA 5C6SA 1U8RA 2XKOC 2JZ2A 2HQEA 4FU6A 4YTLA 2KDSA 4A4EA 2G3RA 2FL7A 2RK2A 3OB9A 2FVUA 4II1A 3I55A 2KR6A 3QKJA 1YHQA 5GMKl 3C12A 4XQ3A 4QVDA 5FRNA 2E12A 4M78C 3VU3C 3QYGB 2M9UA 3V7RA 2BUDA 4NL3A 4PJOE 4M77B 3OYCA 1WNLA 1VQ4A 1M8VA 2IVWA 3C94A 1PSFA 3JCMg 3UWNA 4M7DA 5FU6C 3G71T 3LX7A 4M7AA 2EAYA 4M7DF 2BS2A 3FIFA 2QQ9A 4N4IA 4M75E 1QVGS 4A54A 2MI6A 4FT4A 5GAMj 2ZGWA 2JTMA 3L2QA 1K73U 2RO0A 2ZZDA 4RCBA 4BACA 4M7DD 1O9SA 2FHDA 4M7AD 3CCSA 2HAXA 3CC4A 2XI9A 3L1AA 3M57A 1K9MC 1PSEA 1FXXA 3E19A 3CXCS 4HCBA 4OB2B 2MAMA 2QQAA 2F5TX 4PJOG 3OS1A 3JAME 5GAN8 2ZPGB 3OBWA 2RJFA 2HBPA 1QVFS 1YI2A 1VIFA 3VKIA 1I8FA 2RHYA 2VYTA 4M75G 1VQOT 1VQ8T 3META 4C0GA 3CCQT 3CBPA 4ZTJA 2AHJB 3BG9A 2KVQG 1KC8U 4M7DC 1BI2A 3E9FA 2DTHA 3MEUA 4X9DA 4ELZC 3JCMb 1VQPT 4E7LA 1JJ2A 4M7AC 3V7SA 3OYGA 2XK0A 3CCJT 4C5HA 1QP3A 3HBLA 3G71A 3HFNA 4E7JA 4KULA 2OTLT 1LNXA 2GFUA 1Q81U 1KQSS 2JN0A 3M54A 4XTXA 5LJ5d 1YCYA 3CD6T 3HSBA 1W4SA 2RD1A 1NJIU 4XTUA 5GAN3 3GNGA 3FJPA 4BI3A 4IURA 2OAUA 3M55A 2D6FA 2KAFA 2M1HA 5CKBA 2LDMA 2RA2A 5FU7B 3JCMX 1M1KC 5LJ5h 5GAMf 3QO3A 4A4HA 5LJ3d 3UDCA 4XTYA 2EFIA 1P92A 2OTJT 3OSSC 3OYNA 4FSXA 4N4HA 3JCMW 4PKCC 2CZ7B 4O5VA 2KMGA 2DO3A 2K4YA 4LOCA 2V8JA 3HPWA 3TEEA 4C5GA 1VQ8A 4PJOB 5LJ3h 4BE2A 3A8GB 2I2LA 2E5QA 3LGLA 1VQPA 2IG0A 2H3JA 3CC4T 3OYIA 2EYQA 3OYMA 4M75B 2DD4B 1G3WA 1X75C 2L3RA 4OP0A 2QQBA 2MF2A 2OTLA 2XDBA 2ZPEB 3TCJA 4PJOC 4ELYC 5A0LA 3OYAA 1WJRA 2MMPA 3M4YA 3GPLA 3CD6A 4HL4A 3QPHA 5AYFA 2G77A 3MCAB 3MP6A 4MZPA 3CXCA 3V7CA 1VQKT 4XK8E 4ZGDB 2K3XA 3NFCA 2PU9B 3L2ZA 3X26B 3PMIA 2CS7A 5CKEA 4A4GA 5GMKe 2VUBA 3T9NA 5GAN5 5GANd 3RKWA 4EDUA 4KT0E 1QVFA 5I2SA 3A8MB 2P0PA 2EQKA 2OTJA 2HQXA 2K57A 4AKIA 2EJGA 1NE8A 4AI6A 4BUGA 5KCOA 4MMLA 3J7AF 3OS0A 5GANh 5LL6S 3VJPA 3VV0A 3PIPA 5HY6A 3OYYA 3JB9F 3JB9G 3CCUT 2GFAA 3JCMV 3LGFA 3CBOA 2KY9A 3TW6A 1BIBA 1AHJB 1Y71A 2E6ZA 3HRSA 4JUVA 4L59A 4BDYA 3QG1A 5L8RE 2FB7A 5A0GA 1VQ7T 3HFOA 4RKUE 4C8QE 3JCMP 1VQ9A 2DKGA 4M77F 4TVRA 3VYHB 1JBMA 4C0DB 4XTVA 1VQKA 3ASKA 3OYBA 3FC3A 1B34B 4M77D 2V8KA 2P0KA 2DD5B 2EKOA 3PMTA 4JRPA 5HK0A 3JCMQ 1WQ7A 4O6JA 2VV5A 4M6VA 4EMKB 3OYLA 3PTAA 2K5FA 3OYEA 4B9WA 5KE2A 2HNIA 3LLRA 1G5VA 4HT8A 3UPUA 4FM4B 2K5LA 4C8QF 4F7UE 5C0MA 4C8QG 2EIFA 3QYBA 4BY6C 3H6ZA 1K9MU 4HNUA 2CZ6B 3P8BB 4M78E 1YIJT 3QUIA 4OMFB 5GMKi 5LJ5j 5GAN6 3NTIA 4NC6A 4PLIA 3BW1A 4EMGA 1UGPB 2QI2A 3HZJA 1V29B 1RL2A 2E41A 3O8VA 1UGQB 5CKDA 3MEAA 1VQ7A 3G6EA 1XTDA 3MP1A 5GAMg 3VKGA 4IUVA 4X34A 3GP8A 2QQ8A 4A4FA 3HRTA 3SWNB 4E47A 2BIVA 1NPPA 1D3BA 3JCMJ 4LD9K 4JX6A 4MFDA 1OI1A 3QYHB 3OW2S 1NZ9A 3MHXA 3JCMc 3ZFJA 2Y90A 1N8RC 1VQMT 1Y96B 2WJ9A 3CCET 4OB0B 3HL8A 2EQMA 3MO8A 2DXBB 4C5EA 3LWIA 1YJNT 1S72T 2C06A 1IREB 2DXCA 2WACA 3VUBA 5CVIA 3GOXA 2E10A 3C4SA 3L2RA 3MEWA 4RCCA 4N0AA 5CO7A 1OYXA 3M56A 1YIJA 2PVDB 1QVPA 2DXTA 1H641 3CCRT 3DB3A 3JRZA 5GAMe 1M1KU 3TW7A 2K3YA 3TREA 4JRQA 3DL1A 3SFMA 5FROA 2QQRA 3QJ6A 1X6OA 2O01E 2RHZA 4L5GA 4C8QB 1Q86C 3QIIA 4PJOF 3CCVA 2O4XB 3JSCA 5GAN7 3RESA 4C92E 4E7IA 5GANj 2X35A 4PL6A 2RJEA 5I21A 5LJ5f 4PJOD 2DD4A 3JB9H 2RHIA 2DTIA 2YLBA 4JLIA 4M75F 2K2VA 3JCMe 5GAOr 3QJYA 4R55A 1VQLT 2A3LA 1I81A 4XU2A 1WQWA 2GCXA 3CPFA 4R56A 1VQMA 4Z6YA 2RI3A 2E65A 4M75D 3LWHA 5GAOn 3CCEA 1M90C 1U1SA 1QVGA 1YJNA 4D6WA 1S72A 4N0AC 1N9SA 4F7UB 2R5AA 4Y91A 1LOJA 4ZGJB 4C92F 4M78B 4JJNK 1H3ZA 4C92G 5D6WA 1YJWT 1DJ7B 4IUPA 4J8OA 2HD0A 3Q1JA 2LC4A 4HLQA 1BIAA 5FU6B 4C0FA 4JS4A 3QYEA 1VIEA 4BD3A 1G3TA 1G3YA 2PVOB 1U1TA 1BI1A 2MWOA 4NL2A 2L89A 4M75C 1R8OB 4GY5A 1YBYA 4C5IA 1M5Q1 3OSVA 3J81E 4MZMA 4XU0A 3M5AA 2EJFA 3RMQA 3OW2A 2QDYB 2RJDA 1QLBA 4QQGA 4ZN1A 1VQOA 3G4ST 1ZHIA 2QEXT 3CCQA 1MHNA 2JOYA 1VQLA 2A7YA 4HCCA 3QBYA 2RM4A 3PT9A 4JLGA 5GANf 2ZPFB 3OMGA 5CQXA 1Y07A 3INZA 4B9XA 1VQ6T 1B34A 2PUOB 2QXFA 3CCJA 4KBMB 5IAYA 5DM7R 2DD5A 2BS4A 5KE3A 1JRIA 2DK3A 2WSEE 2E1HA 2VGMA 2Y4YA 3VYGB 4UC4A 4IUUA 2F69A 2DVEA 1FX7A 1VQ6A 2ZZDB 3RERA 1Q7YU 4HA8A 4C92B 3X24B 3NTHA 4PNOA 4WF2A 5D6YA 2D9TA 2VC8A 2KK4A 4EMHA 5GMKm 4BE0A 2LTOA 3FEOA 3LH0A 4J6YA 2DTOA 4VUBA 2ZPIB 1KHIA 1N6AA 2VXFA 4XTWA 2KSSA 4Y28E 4Z02A 4C0DC 3G4SA 3KHIA 2XG8D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZ6 B;  3QZ9 B;  2ZZD A;  1UGP B;  1PSE A;  1V29 B;  4OB2 B;  1UGQ B;  2DXC B;  2ZPG B;  3QYH B;  3A8H B;  3QXE B;  3WVE B;  2AHJ B;  3QZ5 B;  4OB0 B;  2ZCF B;  1QP2 A;  2DXB B;  2D0Q B;  1IRE B;  2DXC A;  1QP3 A;  2CZ1 B;  2PVD B;  2PVG B;  2O01 E;  2DXB A;  1JB0 E;  3A8O B;  3X20 B;  2DD4 A;  2CZ7 B;  3HHT B;  2WSC E;  3A8G B;  2DD4 B;  2ZPH B;  2CYZ B;  3LW5 E;  4ZGJ B;  2ZPE B;  4OB3 B;  3WVD B;  1DJ7 B;  2WSF E;  1GXI E;  4XK8 E;  2PVO B;  4ZGD B;  2PU9 B;  3X26 B;  2ZPB B;  4KT0 E;  3A8L B;  3A8M B;  1UGS B;  2PUK B;  2QDY B;  2DPP B;  4OB1 B;  3X28 B;  3VYG A;  2ZPF B;  2PUO B;  1AHJ B;  2DD5 A;  5L8R E;  2WSE E;  4RKU E;  4L6V 5;  3VYG B;  3X25 B;  3VYH B;  2ZZD B;  3X24 B;  2DD5 B;  4ZGE B;  3QYG B;  2CZ0 B;  1PSF A;  2ZPI B;  4FM4 B;  4Y28 E;  1UGR B; 
#chains in the Genus database with same CATH topology
 4EIK A;  2PQW A;  3V8K A;  2LQ8 A;  4KH1 B;  1K8A C;  2ZAE A;  3L42 A;  2ECZ A;  4A63 B;  1U5S A;  3VS1 A;  1H4L D;  1WXT A;  3MIA B;  3OY9 A;  3JCM d;  5LJ5 g;  2CUB A;  3A98 A;  5FLX E;  2PHG A;  2JJ9 A;  3TSZ A;  3GNF B;  4EOL B;  1ZUY A;  1GBQ A;  1ZA1 B;  2FEI A;  2ZCF B;  4N4G A;  4C8Q A;  5KYN A;  3OYJ A;  3CCL T;  3NHN A;  5DQV A;  2LZ6 B;  3EHQ A;  4ZN3 A;  1W6X A;  1J3T A;  5KYU B;  4QKU A;  1BKB A;  1N9R A;  2EJ9 A;  1EX4 A;  2A37 A;  4ZTF A;  1M2O A;  4QQ6 A;  3K7A M;  1WYX A;  2E3H A;  4CFX B;  3NDQ A;  1B3Q A;  4F7U G;  3DLM A;  2O9V A;  1Y7X A;  2X4X A;  1MNE A;  4C8Q C;  2W2H A;  1XNI A;  2CP3 A;  2DYI A;  4D8D A;  1ZSZ A;  1YIJ Q;  4OB3 B;  1W2B A;  5KYY A;  4AT1 B;  4OMO A;  2P0Q A;  5CYI B;  2D0N A;  3L2U A;  2SRC A;  2KNB B;  1PD1 A;  3THK A;  5J39 A;  1KD1 C;  4M75 A;  1PHT A;  2KMT A;  5GAN e;  3V8L A;  3CME A;  2I40 B;  4M7D G;  2C5X B;  2E64 A;  5LJ3 f;  1ZSZ C;  1NYG A;  1JQQ A;  1UNH D;  3OYH A;  4Y72 B;  2CKK A;  1O9K A;  3LH5 A;  4LXC A;  1MV0 B;  2XMF A;  3OMC A;  3QHW B;  1M1G A;  2XDD A;  1IHV A;  1N5Z A;  1RAC B;  2NUP B;  2QFZ A;  3R6O A;  1BU2 A;  5FRM A;  4NS5 A;  2W9F A;  3BDL A;  4XAX B;  4MDX A;  5CR2 A;  3VUZ A;  3DJB A;  7AT1 B;  2WPA B;  3CC2 T;  2KI7 A;  2XDP A;  2X4J A;  2CZ0 B;  4DOV A;  1D3U B;  1D3B B;  1ZP2 A;  4BXX X;  2LX9 A;  4DBR A;  3M0U A;  3ZBD A;  3NPF A;  2WMB B;  2Y4X A;  2RHX A;  2IPO B;  3BFM A;  5J26 A;  4M7D B;  4EMK A;  1MMA A;  1OV3 A;  1YJW A;  1MMN A;  4GLM A;  2BKD N;  4F16 A;  4LDV A;  4FIB A;  1BYM A;  1WGS A;  1FIN B;  3TNI B;  4KUI A;  1AWW A;  4J6X A;  5KYU A;  1RI0 A;  3OYM A;  4KGX B;  1QP2 A;  3OYA A;  4LDW A;  3PFS A;  5IN1 A;  2KRM A;  2QEX Q;  1I07 A;  1U06 A;  2BE7 D;  3SWN A;  4BCK B;  2L3Q A;  2QDJ A;  4J7F A;  2JMC A;  2XD0 A;  1Y96 A;  2LJ3 A;  4FW2 A;  2DXB A;  1JB0 E;  4JDS A;  4BB7 A;  4J9H A;  2RI2 A;  2A08 A;  4OGC A;  2YUO A;  1Q82 U;  1X27 A;  5GAO p;  3SB2 A;  4PK4 A;  2WSC E;  3JB9 J;  3POM A;  4C0Z A;  1AOJ A;  4F04 B;  4E7S A;  2RNA A;  1WXU A;  2K7A A;  3TU4 K;  3G7Z A;  2KRN A;  1AWX A;  2YLC A;  4J9B A;  2OAW A;  3I56 T;  3SWN C;  2JS2 A;  1NEB A;  3EH1 A;  1YFN A;  1QQJ A;  1X2K A;  1OQK A;  3CBM A;  2I0N A;  3M0S A;  1GXI E;  4QW2 A;  1F5Q B;  5IHY A;  4F14 A;  2JT4 A;  2CSQ A;  3NGP A;  1YP5 A;  2DL8 A;  4F7U A;  3A8L B;  1UGS B;  5LJ3 e;  1E6H A;  1JJ2 S;  2HKN A;  2WHB B;  4OMN A;  1PD0 A;  2DLP A;  2NUP A;  2XID A;  2AZV A;  4ROC A;  1FWZ A;  3QHS A;  5LMK B;  4HKE A;  5KYW B;  2LCS A;  3DDQ B;  3CCV T;  1OUL A;  3M53 A;  2XKO C;  2HQE A;  2FPF A;  2EGE A;  2G3R A;  3EG9 B;  2G6F X;  2RK2 A;  2VVK A;  3OB9 A;  4B6M A;  5HCK A;  2KR6 A;  1YHQ A;  2WEV B;  3B57 A;  4RTW A;  4QVD A;  2DEU A;  1VA7 A;  4KRC B;  2E12 A;  3VU3 C;  3OYC A;  1PSF A;  4M7D A;  2DX1 A;  4F7N B;  3G71 T;  1AD5 A;  2QQ9 A;  2UZB B;  4M75 E;  2X1N B;  4FT4 A;  2W96 A;  5GAM j;  3L2Q A;  4BAC A;  3M57 A;  1PSE A;  3CXC S;  4BCF B;  2QQA A;  1M90 R;  5GAN 8;  3EGD B;  1A0N B;  2RJF A;  4RTT A;  1QVF S;  1VIF A;  2KYM A;  3MET A;  1FMK A;  4CFU D;  4M7D C;  1LVK A;  1KC8 U;  2DTH A;  3MEU A;  3OYG A;  2OTL T;  1JU5 C;  4OMP A;  1LNX A;  2J6K A;  3RDV A;  3M54 A;  2O9S A;  1T3S A;  1W4S A;  1RAA B;  1NJI U;  5GAN 3;  3FJP A;  4BI3 A;  4IUR A;  2HSE B;  2D6F A;  2M1H A;  5FU7 B;  2RA2 A;  1OKV B;  3GTM S;  1M1K C;  2A36 A;  4XTY A;  1YNZ A;  2OTJ T;  2UZD B;  1M30 A;  3BLQ B;  2OX7 A;  4RTX A;  1XJW B;  2K4Y A;  2DO3 A;  4BCQ B;  4LOC A;  1RAH B;  4C5G A;  2DFU A;  1YJ9 Q;  2M51 A;  3A8G B;  2I2L A;  2G9X B;  2DL7 A;  3OYI A;  2KR3 A;  4OP0 A;  2HEQ A;  1X75 C;  2QQB A;  3TCJ A;  4ELY C;  5A0L A;  2LP5 A;  4ANJ A;  3M4Y A;  3GPL A;  1I1J A;  3MP6 A;  3EH2 A;  1VQK T;  5FW9 A;  3X26 B;  3PMI A;  3RR6 A;  1K0X A;  2VUB A;  1YWP A;  2AK5 A;  5ACB A;  1IRX A;  5I2S A;  2P0P A;  2VKN A;  5KYW A;  4AI6 A;  4BUG A;  3TSW A;  8ATC B;  4F70 B;  2GGR A;  3PIP A;  3JB9 F;  3OYY A;  1ARK A;  4R0K A;  3CCU T;  2E6Z A;  1AHJ B;  1Y0M A;  4BDY A;  1LCK A;  1VQ7 T;  2UZL B;  1UJ0 A;  4RKU E;  1IGU A;  1UTI A;  1JBM A;  1HYO A;  3ASK A;  3OYB A;  4F17 A;  5HK0 A;  3JCM Q;  2ROL A;  3OYL A;  5KE2 A;  2HNI A;  1UEC A;  4F7U E;  4YOS A;  1R77 A;  2EIF A;  4BY6 C;  1K9M U;  3EGD A;  4HNU A;  1G3N C;  3QUI A;  1YIT Q;  2H3E B;  4PLI A;  1UGP B;  3HZJ A;  3G6E Q;  5GJV B;  2O31 A;  3MEA A;  5ICP B;  2COW A;  5GAM g;  3ZL7 C;  4IUV A;  1MND A;  1QCF A;  3I55 Q;  1JKW A;  2LQW A;  1RI9 A;  2BIV A;  1AVZ C;  1OI1 A;  3QYH B;  2EBP A;  3OW2 S;  1KSW A;  1VQ4 Q;  2WJ9 A;  4OB0 B;  3HL8 A;  3MO8 A;  2KXD A;  1IRE B;  2WAC A;  5IHN A;  3GOX A;  2E10 A;  3C4S A;  4OMM A;  3MEW A;  4N0A A;  1YIJ A;  1H64 1;  3JRZ A;  1UGV A;  2CSI A;  4JRQ A;  1SEM A;  3SFM A;  1BCO A;  1M3A A;  4AG2 C;  2O01 E;  2RHZ A;  4PJO F;  3BE3 A;  3VS6 A;  3CCV A;  2K6D A;  5GAN j;  5I21 A;  2DF6 A;  2GQI A;  2RHI A;  2DTI A;  2YLB A;  1VQM Q;  4R55 A;  4XU2 A;  1I81 A;  2GCX A;  4M75 D;  2E65 A;  1U1S A;  1X69 A;  4D6W A;  3MI9 B;  4N0A C;  1GUX B;  1IXD A;  1Q95 G;  2LJ1 A;  3O5Z A;  1LOJ A;  2LJ0 A;  4ZGJ B;  4HVW A;  4C92 G;  2D8J A;  2LC4 A;  4JPB W;  1H8K A;  1D0X A;  2DNU A;  1U1T A;  4HCK A;  1NBE B;  3F5X B;  4BCM B;  1H1Q B;  2HL3 A;  2EPD A;  1I5O B;  4LE9 A;  3OSV A;  4MZM A;  1VQ8 Q;  2QDY B;  2RJD A;  4ZN1 A;  4ROE A;  2HDA A;  2WIH B;  3G4S T;  1ZHI A;  4HCC A;  2JOY A;  1VQP Q;  3EG2 A;  2JW4 A;  3TVT A;  5KE3 A;  2E5K A;  2DVE A;  2ZZD B;  3RER A;  4KRD B;  1Q7Y U;  4HA8 A;  4C92 B;  3X24 B;  5GMK m;  2VC8 A;  4FYV B;  4J6Y A;  2RF0 A;  3QWX X;  1KHI A;  4Z02 A;  2QEX A;  2YRD A;  3KHI A;  3L2Z A;  4PJM A;  1NEG A;  3CC4 Q;  1WIE A;  1XQH A;  1X01 A;  3JB9 I;  1TUD A;  4ME7 A;  3JB9 D;  1LJO A;  5GAN 2;  1T0H A;  4M77 A;  4HT9 A;  1N8R U;  3MJX A;  5IXF A;  4V2S A;  3UT1 A;  3OA6 A;  3JCM h;  1UNG D;  2DL4 A;  4KH0 B;  4LDY A;  4HXJ A;  1T3L A;  5GAO q;  1ZQ1 A;  2CP7 A;  3S3N A;  1CKA A;  1RAI B;  1Q86 U;  3CCU A;  1QW1 A;  2COZ A;  3MP8 A;  4M77 C;  1HSQ A;  3HKS A;  3TNH B;  3PGG A;  3O0G D;  5IHI A;  2J6O A;  5LJ3 j;  1GUX A;  1AWJ A;  3JV3 A;  1VQ5 A;  3FDR A;  3CME T;  3EFO B;  2LQN A;  3RKX A;  2X4Y A;  4M78 F;  3H4C A;  1TH7 A;  3DDP B;  2QTX A;  1WHL A;  3KFV A;  5GAN g;  1WJS A;  2FRY A;  2CYZ B;  4OGR B;  3FRN A;  4JX5 A;  2RPN A;  4OML A;  3WXM B;  2R58 A;  4M7A E;  4J5Y A;  4ESR A;  1M9S A;  1SRM A;  1YI2 T;  4F6U B;  4LD6 A;  1KQ2 A;  2JTF A;  4KGZ B;  2IW9 B;  4J6W A;  4M7A F;  2DZC A;  2P84 A;  1YJN Q;  2YWW A;  1S72 Q;  2JVV A;  1FKM A;  2QGS A;  3C0C A;  4C92 A;  2QAZ A;  3ULR B;  3CCR Q;  2DAQ A;  1SHG A;  3J80 E;  5I2M A;  2XHC A;  4GLK A;  2LX7 A;  3A5Z B;  5D7U A;  2QF7 A;  2RQW A;  5KH6 A;  4ZGE B;  2X4W A;  1QMZ B;  5EJC A;  1K8A U;  5HBE B;  2IN3 A;  1I5L A;  4C92 C;  3TQ7 P;  3PO3 S;  2VXE A;  2CCI B;  2RJC A;  5GAO m;  1K73 C;  1C6V X;  2DXC B;  4J9I A;  2DEQ A;  4DA4 A;  2CGH A;  3EHR A;  3MEV A;  1K4U S;  1M3B A;  2L5Q A;  3C95 A;  2XIC A;  3EGU A;  2BZY A;  4EC9 B;  3QZ5 B;  1YJ9 A;  3QWL A;  3EAE A;  3HO8 A;  3JCM f;  5HQ0 B;  3GIB A;  5CCA A;  2CZ1 B;  3KXT A;  1UE9 A;  5J3B A;  1VQ6 Q;  1XOV A;  5GAN 4;  1D0Z A;  3EFO A;  2DBK A;  1PKD B;  3DLL A;  1HXD A;  2VB6 A;  4IUT A;  3N5B B;  2MPX C;  2CDT A;  1SHF A;  5IDN B;  3VS4 A;  2K79 A;  1I4K 1;  3OYK A;  4M77 E;  1PRL C;  1VOL A;  2LT4 A;  3SDZ A;  1KG1 A;  1BK2 A;  2H8H A;  2C5O B;  2RB6 A;  1T0J A;  3PNW C;  1GL5 A;  1JO8 A;  5LJ3 g;  4LDX A;  4IIO A;  1AZG B;  1SSH A;  1Z9Z A;  2BE9 B;  3QDR B;  2FG0 A;  4FYW B;  1WZO A;  2RK1 A;  5DY9 A;  3BG5 A;  2QA4 Q;  4Q5W A;  3HP9 A;  1UDL A;  4JRI A;  1KD1 U;  3L2W A;  3CMA Q;  1YHQ T;  3AHU A;  2NLU A;  1C9B A;  1JXO A;  9ATC B;  1PWT A;  2PUK B;  4J9G A;  1PKT A;  1QLY A;  4RTU A;  1X43 A;  4PLL A;  1O75 A;  1QCO A;  3X28 B;  4M78 D;  4A4K A;  3BHU B;  4BY1 X;  1YIT A;  2RQU A;  2FZK B;  2K5I A;  4JZ3 A;  3M0R A;  4AKG A;  3PIO A;  5C6S A;  2JZ2 A;  4FU6 A;  4YTL A;  2KDS A;  2OJ2 A;  2JMA A;  4BCN D;  3I55 A;  5HVY B;  3BHV B;  2NUT A;  1JOW A;  3QYG B;  2BUD A;  1VQ4 A;  1S1N A;  5FU6 C;  3I35 A;  2VAS A;  2Z0W A;  3FIF A;  4EOR B;  1QVG S;  2ZGW A;  2PMI B;  3UA6 A;  1O9S A;  4M7A D;  1WX6 A;  3E19 A;  5FWC A;  4HCB A;  3CCM Q;  2MAM A;  1K0S A;  2VWF A;  4PJO G;  2AKK A;  2ZPG B;  3OBW A;  1YI2 A;  2DVJ A;  2P4R A;  1I8F A;  2DIL A;  4DEX A;  3CBP A;  4RUG A;  2KVQ G;  2CH4 A;  2ED1 A;  4X9D A;  4E7L A;  3V7S A;  3CCJ T;  4YOO A;  1OU8 A;  4C5H A;  3HFN A;  1SRL A;  2K9G A;  2L3S A;  1Q81 U;  4BCI B;  1IHW A;  4XTX A;  2QK0 A;  5LJ5 d;  1YCY A;  3RGF B;  3GNG A;  2OAU A;  1OX9 A;  2LDM A;  3JCM X;  5LJ3 d;  1P92 A;  3OYN A;  1TU0 B;  4N4H A;  4PKC C;  8AT1 B;  2KMG A;  3HPW A;  3TEE A;  1OOT A;  1VQ8 A;  4II5 B;  4AFU C;  4PJO B;  3CXC P;  1RLQ C;  1VQP A;  3FJ5 A;  2H3J A;  1H3H A;  2EYQ A;  2L3R A;  2MF2 A;  1QVF P;  4HL4 A;  3MCA B;  4MZP A;  2QGF B;  3V7C A;  4XK8 E;  3NFC A;  2K3X A;  2PU9 B;  1VYT A;  2CS7 A;  4A4G A;  5I5Z B;  4J9D A;  3T9N A;  3E2U A;  1BB9 A;  1C1A A;  3G1J A;  2F2W A;  4AKI A;  4EC8 B;  1NE8 A;  4MML A;  3VV0 A;  4E2F B;  4M4Z A;  3CC7 Q;  3LGF A;  3GBQ A;  3CC4 A;  2KY9 A;  3MY1 B;  4JUV A;  2FB7 A;  1VQ9 Q;  3HFO A;  4C8Q E;  3JCM P;  1H1P B;  2DME A;  2HBW A;  3VYH B;  5HBJ B;  3IQL A;  2JS0 A;  2YRC A;  1QCN A;  1VQN Q;  1B34 B;  4M77 D;  3PMT A;  2W9Z A;  1F1B B;  2VV5 A;  3H0H A;  3PTA A;  1N4M A;  3OYE A;  3H0I A;  4CC3 A;  3A1P A;  4C8Q F;  5C0M A;  2DJQ A;  3QYB A;  2CZ6 B;  3P8B B;  1YIJ T;  2DM1 A;  5GAN 6;  3BW1 A;  2RN8 A;  2R7G A;  1V29 B;  5CKD A;  1Q82 R;  3MP1 A;  4F6S B;  3GP8 A;  4A4F A;  3HRT A;  4CC2 A;  1D3B A;  4LD9 K;  2WIP B;  2Y90 A;  3EJ1 B;  3LWI A;  4C5E A;  3VUB A;  3L2R A;  5CO7 A;  5ECA A;  3CCS Q;  2PVD B;  1M1K U;  5FRO A;  4L5G A;  2O4X B;  3JSC A;  5GAN 7;  1PM3 A;  3RES A;  4PL6 A;  2YUQ A;  2RJE A;  3VS2 A;  3JB9 H;  4JLI A;  4M75 F;  1Z9Q A;  4R56 A;  1M90 C;  1WA7 A;  1CSK A;  4JJD A;  1YJN A;  1S72 A;  4FCY A;  1D0Y A;  1ABQ A;  4Y91 A;  4M78 B;  1UJY A;  1P5E B;  3OW2 P;  1DJ7 B;  1BIA A;  2NWM A;  3QYE A;  1VIE A;  1ZUU A;  1BI1 A;  4NL2 A;  2L89 A;  2BZ8 A;  4C5I A;  1TSF A;  4XU0 A;  3M5A A;  1VQO Q;  4QQG A;  3CCQ Q;  4CFV B;  2J05 A;  1PCX A;  2QEX T;  1MHN A;  1E7O A;  3QBY A;  3MPU B;  3OMG A;  4B9X A;  4AFZ C;  1B34 A;  1M2V B;  2PUO B;  4J9E A;  3CCJ A;  2YDL A;  2CP2 A;  4HVU A;  1JRI A;  2WSE E;  2E1H A;  3CD6 Q;  4K11 A;  2Y4Y A;  4Y92 A;  2JGZ B;  1VOM A;  5I11 A;  1OEB A;  1WDX A;  1KC8 R;  1LPL A;  3NTH A;  2PJQ A;  4BE0 A;  2KK4 A;  2X51 A;  2LTO A;  3FEO A;  1H26 B;  2DTO A;  1R0C B;  2E4H A;  2ZPI B;  4G6L B;  2A28 A;  1NJI R;  1HD3 A;  3EGX B;  1VYW B;  3EG9 A;  3QZ9 B;  1W2B S;  3OS5 A;  1X6G A;  1VQ6 A;  3M58 A;  2F5K A;  5GAM h;  2YRV A;  1BCM A;  4HNV A;  4CC4 B;  2DRM A;  6AT1 B;  1VQ5 T;  4PJN A;  1K9A A;  2UZE B;  5FWB A;  2BS3 A;  5A2Q E;  2QG9 B;  4J83 A;  4RG8 A;  2IW8 B;  3M4G A;  4DEY A;  2PK2 A;  1QWE A;  4MZT A;  5L23 A;  4C8Q D;  4J9F A;  3OS2 A;  2PVG B;  2QA4 A;  2R5M A;  2LCL A;  2JUF A;  4NOY A;  2E6N A;  3CMA A;  1E7P A;  1OU9 A;  1WXB A;  2EYW A;  4BI4 A;  2RQT A;  4F7U F;  4HNT A;  1ZBX A;  5KCH A;  1JSU B;  1ZX6 A;  4CI0 C;  2BZX A;  4FW1 A;  5DLO A;  2QQS A;  4FT2 A;  2D1X A;  3OBY A;  4KUD K;  1OZ3 A;  4M7D E;  2GTJ A;  3LQ5 B;  2V1Q A;  4BE1 A;  2B8A A;  2R57 A;  3GLX A;  2ZPB B;  4Z89 A;  5GMK h;  1TOV A;  1K9M R;  2GNC A;  2E3I A;  2GF7 A;  3BDU A;  2LT1 A;  3DTO A;  3P8H A;  3CCE Q;  5FU7 C;  5CEI B;  4CFM B;  1WFW A;  4XU1 A;  3RMS A;  1WJQ A;  5HBH B;  3L2V A;  2D8H A;  1G3S A;  5IF1 B;  2MOX A;  2PZ1 A;  2J06 A;  3CCM A;  2C0T A;  5IH2 A;  3M59 A;  1JST B;  2C0O A;  2WFY B;  1GBR A;  2DIQ A;  3S6W A;  3BY7 A;  4IUQ A;  1RLP C;  1YJ9 T;  5HKC A;  4FL6 A;  3E9G A;  1KIK A;  2DER A;  3CPW S;  1VQL Q;  1AEY A;  4IMY B;  1UGR B;  1KHC A;  1QKX A;  1NG2 A;  2RQV A;  4PJL A;  1E9H B;  2LRQ A;  1GY3 B;  2XU8 A;  1YJW Q;  3ER0 A;  1KQ1 A;  3OQ5 A;  2LQK A;  1EFN A;  3F70 A;  2AKL A;  4DBH A;  1G2B A;  4EOO B;  2RH2 A;  1M4Z A;  3BG3 A;  1IO6 A;  2YSQ A;  3BLH B;  2D0Q B;  4CFU B;  1WPY A;  2KQW A;  5GAM d;  1PRM C;  4CXA B;  3EG3 A;  4ATO A;  2ATC B;  4BCH B;  4RG2 A;  4EOI B;  1ENW A;  3QSU A;  5CKF A;  1WLP B;  3KUF A;  3SHW A;  3M0P A;  2KT8 A;  4JX4 A;  4MIM A;  3QWY A;  1H25 B;  2JM9 A;  4ORZ A;  5CQY A;  1QMC A;  2DRK A;  3E1S A;  1YIT T;  3CC7 A;  4EOK B;  3LW5 E;  1D1A A;  4ROD A;  2IIM A;  3G6E T;  2O2O A;  3VKH A;  1SKU B;  2CP6 A;  2CCH B;  1Q7Y R;  4DOW A;  3URG A;  3I55 T;  2ESW A;  4OGE A;  1VQN A;  3FLG A;  1NLO C;  1NYF A;  2JTE A;  5CAI A;  2EKH A;  1VQ4 T;  2EYZ A;  4LDU A;  1KXU A;  2LW4 A;  1Q7Y C;  1BI0 A;  3FB9 A;  2FPD A;  1RAD B;  2KGT A;  5A0D A;  5GJW B;  3CCL Q;  2NUZ A;  1N27 A;  1OI9 B;  1MMD A;  5GAO l;  1BI3 A;  1N8R R;  5HK3 A;  2KEA A;  4I3Z B;  4HCZ A;  4EPC A;  2C0I A;  4RTY A;  2CT4 A;  3I5S A;  2FL7 A;  1OKW B;  3QKJ A;  5FRN A;  1TUC A;  1GFC A;  2M9U A;  2I53 A;  3V7R A;  1M8V A;  3JCM g;  3MY5 B;  3UWN A;  1Q86 R;  3LX7 A;  2BS2 A;  4F7L B;  2MYS A;  1H1S B;  1K73 U;  2ZZD A;  4M7D D;  2FHD A;  1TXQ A;  3CCS A;  3L1A A;  1FXX A;  5AT1 B;  4CC7 A;  3OS1 A;  1ZUK A;  1BBZ A;  2HBP A;  4M75 G;  1VQ8 T;  4C0G A;  1VQP T;  4AFQ C;  3JCM b;  1JJ2 A;  1OL1 B;  2L2P A;  1V76 A;  2XK0 A;  1QP3 A;  4KUL A;  1UFF A;  2MK5 A;  2GFU A;  1KQS S;  1TS9 A;  2RD1 A;  4XTU A;  3VS3 A;  4E7Z A;  4EOM B;  1PNJ A;  2KAF A;  5LJ5 h;  4A4H A;  4ELL A;  2C6T B;  2EFI A;  2KYB A;  3UF4 A;  5BNJ B;  3JCM W;  5KYY B;  2CZ7 B;  4E6R A;  1U3O A;  3EG1 A;  2CJM B;  4D8K A;  5LJ3 h;  3VRZ A;  2CRE A;  3CC2 Q;  3PVL A;  2E5Q A;  3LGL A;  3D7S B;  2NYS A;  4OR5 B;  3CC4 T;  4M75 B;  2DD4 B;  1G3W A;  3UA7 A;  3H9N A;  2ZPE B;  4BCP B;  1WJR A;  1H1R B;  2MMP A;  3CD6 A;  3QPH A;  2G77 A;  3CXC A;  2HSP A;  2YT6 A;  2QTV A;  5CKE A;  5GMK e;  5GAN d;  3RKW A;  3R6N A;  4EDU A;  4KT0 E;  1QVF A;  1K8A R;  2EQK A;  2HQX A;  2EUF A;  3J7A F;  3PVQ A;  3OS0 A;  1NM7 A;  3VJP A;  5HY6 A;  3M0Q A;  3JB9 G;  1TFB A;  1SF9 A;  3JCM V;  5L2W B;  2CP0 A;  3CBO A;  3BLR B;  3TW6 A;  1TG0 A;  3HRS A;  4LUD A;  1X2Q A;  5L8R E;  3CQT A;  4M77 F;  4XTV A;  5IDP B;  2J7I A;  3FC3 A;  3QHR B;  2LNH B;  2CH4 W;  1WQ7 A;  4EMK B;  2UUE B;  4EOS B;  4B9W A;  3UPU A;  4FM4 B;  2QGG A;  5EFQ B;  3I56 Q;  3DOG B;  4OMF B;  4NC6 A;  4RTV A;  4EMG A;  2QI2 A;  1UGQ B;  3G6E A;  3VKG A;  3SWN B;  3JCM J;  1JXM A;  4MFD A;  3MHX A;  3JCM c;  3ZFJ A;  4AMC A;  1Y96 B;  1IB8 A;  2W10 A;  3SEM A;  2DXB B;  1YJN T;  1S72 T;  2C06 A;  2DXC A;  5CVI A;  1B07 A;  1OYX A;  1PKS A;  1KD1 R;  1QVP A;  2DXT A;  3CCR T;  3TW7 A;  3TRE A;  3DL1 A;  2QQR A;  4ZNX A;  3CCV Q;  1X6O A;  3QII A;  1JJ2 P;  1RAE B;  2DE0 X;  2CP5 A;  4BCQ D;  4C92 E;  1W98 B;  1M3C A;  5LJ5 f;  1TUG B;  2DD4 A;  4PFZ A;  1GRI A;  2K2V A;  3JCM e;  5GAO r;  3QJY A;  2A3L A;  1VQM A;  3CPF A;  4Z6Y A;  2RI3 A;  3LWH A;  5GAO n;  3CCE A;  1UHC A;  3G71 Q;  3RBB B;  5FGK B;  5LQF B;  4F7U B;  2R5A A;  4C92 F;  1H3Z A;  5D6W A;  2EVR A;  4J8O A;  1BU1 A;  2HD0 A;  3Q1J A;  1WHJ A;  2F2X A;  1OL2 B;  3EOC B;  4BD3 A;  1G3Y A;  2PVO B;  2MWO A;  4M75 C;  2KBT A;  1R8O B;  1YBY A;  2ABL A;  4DBQ A;  4CFN B;  2YUN A;  3OW2 A;  1ZA2 B;  2EJF A;  2WXV B;  2AT1 B;  2FZC B;  1VQL A;  2A7Y A;  4QT7 A;  3PT9 A;  5I22 A;  4JLG A;  2ZPF B;  1VQ6 T;  2OTL Q;  1R0B G;  3M0T A;  4KBM B;  4EOJ B;  2BS4 A;  2QDL A;  2DK3 A;  2C5N B;  2HCK A;  3VYG B;  3I9Q A;  1WHM A;  4IUU A;  1H28 B;  2YXY A;  1FX7 A;  1G83 A;  2OTJ Q;  1OGU B;  5D6Y A;  2D9T A;  4YOZ A;  4WCI A;  1OIU B;  3LH0 A;  2BKZ B;  1Q81 R;  1TD6 A;  2VXF A;  1N6A A;  1MGQ A;  4CRI A;  4TTH A;  2EQU A;  4WTO B;  2QA4 T;  4EMK C;  3EID B;  1Q81 C;  3KBG A;  1K1Z A;  3CMA T;  2M16 A;  1WHH A;  1VQK Q;  1RAB B;  2ROT A;  3A8H B;  4AKH A;  1UHF A;  4QSH A;  3WVE B;  4E7K A;  2F2C A;  2W0Z A;  2LCC A;  3V8J A;  2MIO A;  5D6X A;  3REB B;  3CPW A;  1IZ6 A;  3BHT B;  4OVA A;  2RI5 A;  4DQ2 A;  4BI8 B;  2EYX A;  3CCU Q;  4CRL B;  3SD4 A;  5KYX B;  3CEY A;  1WHG A;  3DB4 A;  4FYX B;  1VQ7 Q;  1VIN A;  5LJ5 e;  1GCQ A;  3DKM A;  2FPE A;  4OF1 A;  3HB9 A;  4E7H A;  1VQ5 Q;  1M8M A;  3X20 B;  3TN8 B;  1WI7 A;  2M0Y A;  1M90 U;  4QQD A;  1W2B P;  4M78 G;  3EFR A;  3OYF A;  1MUZ A;  3RKY A;  1OX8 A;  1Q82 C;  5CKH A;  1W1F A;  2EQJ A;  4BBS M;  2CUD A;  2QYZ A;  2WMA B;  4J7I A;  1HK9 A;  1QWF A;  3CCL A;  4QVC A;  5DQW A;  2J6F A;  2V8I A;  2DL5 A;  4X1V A;  3CCM T;  1UUE A;  2WSF E;  1GCQ C;  4BCM D;  4PJO A;  3OYD A;  4HVV A;  4BY6 B;  3PE0 A;  2DIG A;  2FYK A;  4XTZ A;  1V1C A;  4LN2 A;  3U23 A;  2JM8 A;  5IT9 E;  4A53 A;  4ELJ A;  2DPP B;  4BBR M;  2JXB A;  4OB1 B;  1TWB A;  2HL5 C;  3VYG A;  1AZE A;  4M7A G;  3I5R A;  5EG2 A;  5M9O A;  5CIU A;  2X3W D;  4L6V 5;  4PJO C;  2GQV A;  3CCR A;  2L8D A;  3X25 B;  4C92 D;  2DYB A;  2DET A;  4MFE A;  2YHT A;  3H8Z A;  5DLQ E;  4BCN B;  4X9C A;  1NPR A;  2LNV A;  4BCG B;  1AT1 B;  3P8D A;  1M1K R;  2P4T A;  4FYY B;  3S3O A;  2BPM B;  4BCJ B;  1D1C A;  3S3M A;  2YUP A;  3ME9 A;  1ZBJ A;  1MV3 A;  3EFS A;  1UEB A;  2GTO A;  4M7A B;  4JJC A;  1VUB A;  1SSF A;  2SEM A;  3QXE B;  5KYX A;  2MWP A;  1M1F A;  3M9Q A;  3CC2 A;  4GBQ A;  4KRT A;  2CT3 A;  3G4S Q;  1H92 A;  3RIR A;  2EGA A;  3CC7 T;  1KC8 C;  4Z88 A;  4RTZ A;  3ZEH A;  4LUE A;  1YN8 A;  1E6G A;  1VQ9 T;  4QVZ A;  3QDF A;  5CK9 A;  5GMK j;  4JS5 A;  2KT1 A;  2E70 A;  4XU3 A;  3RUX A;  3CPW P;  1VQN T;  3A8O B;  1NJI C;  4JRK A;  2C4G B;  4UN0 A;  2PNI A;  3HHT B;  4P5N A;  1OZ2 A;  1EIF A;  1PC0 A;  2DJZ A;  1HJD A;  3NTK A;  3GF5 A;  2EW3 A;  1IGQ A;  2O4X A;  3LYI A;  2RHU A;  2ZPH B;  4MDW A;  1KQS A;  1ZSG A;  3WVD B;  4BDZ A;  4M77 G;  2EYY A;  4IKF A;  1JEG A;  2DZ9 A;  1UB4 A;  2DBM A;  2DXU A;  4RMO A;  4M78 A;  2LVM A;  1M27 C;  4FX3 B;  2KRO A;  4EOP B;  1ZLM A;  4MMK A;  2DMO A;  2L3P A;  2EWN A;  4BY7 X;  4FSS A;  3VRY A;  3CCS T;  4DBF A;  2VGN A;  3HRU A;  3I56 A;  4F6W B;  1KJW A;  2M0O A;  1RAG B;  2JNG A;  4AFS C;  2M02 A;  1U8R A;  4J9C A;  4A4E A;  2FVU A;  4II1 A;  5GMK l;  3C12 A;  4XQ3 A;  1M2V A;  4M78 C;  4NL3 A;  4PJO E;  1H24 B;  3CME Q;  4M77 B;  1WNL A;  2IVW A;  3C94 A;  1CKB A;  1K76 A;  4M7A A;  2EAY A;  2FZG B;  4M7D F;  4N4I A;  4BCO B;  1GFD A;  4A54 A;  2MI6 A;  5IXB A;  2JTM A;  3NMZ C;  2RO0 A;  4RCB A;  1FYN A;  5EC7 A;  1NLP C;  2HAX A;  2XI9 A;  1K9M C;  4OB2 B;  2BTT A;  2X3X D;  2F5T X;  3JAM E;  1ABO A;  1MMG A;  1YI2 Q;  2DL3 A;  3EGX A;  2B9R A;  2RQR A;  3RNJ A;  3VKI A;  1VQO T;  2RHY A;  1YWO A;  2VYT A;  2RMO A;  2DA9 A;  3CCQ T;  4ZTJ A;  2AHJ B;  3BG9 A;  1BI2 A;  1FMV A;  1SG5 A;  3E9F A;  4PFP A;  4ELZ C;  4M7A C;  1XO2 A;  3G71 A;  3HBL A;  4E7J A;  2JN0 A;  1G8X A;  2X9H A;  3CD6 T;  1KK7 A;  3HSB A;  3AT1 B;  3M55 A;  5CKB A;  1QKW A;  2PTK A;  2HMA A;  5GAM f;  3QO3 A;  3UDC A;  1Y57 A;  3OSS C;  4FSX A;  4O5V A;  2V8J A;  2AZS A;  1B7T A;  3VS5 A;  2FO0 A;  1AIS B;  1SPK A;  4BE2 A;  2IG0 A;  1QVG A;  2QAS A;  2OTL A;  2EGC A;  2XDB A;  1WHK A;  2FRW A;  5AYF A;  4ZGD B;  2L0A A;  5IHK A;  5GAN 5;  2HQH A;  1UNL D;  3A8M B;  2OTJ A;  1KQS P;  2K57 A;  2EJG A;  5KCO A;  1FMW A;  4PJJ A;  5GAN h;  4IIM A;  5LL6 S;  4EOQ B;  2COY A;  2GFA A;  1BIB A;  1Y71 A;  4L59 A;  3QG1 A;  2ED0 A;  5A0G A;  1VQ9 A;  4YC3 B;  2DKG A;  4TVR A;  2EQI A;  1EZZ B;  4C0D B;  1VQK A;  4CFW B;  1OPK A;  2V8K A;  2P0K A;  1VYV A;  2DD5 B;  2EKO A;  2HZY A;  4JRP A;  4O6J A;  4M6V A;  2K5F A;  2GBQ A;  1OPL A;  3LLR A;  1G5V A;  4HT8 A;  2K5L A;  4Z8A A;  4C8Q G;  3H6Z A;  4PFO A;  4M78 E;  1X6B A;  2V1R A;  5LJ5 j;  5GMK i;  3NTI A;  1KFZ A;  2A0F B;  3G33 B;  1RL2 A;  2E41 A;  3O8V A;  1VQ7 A;  1W70 A;  1XTD A;  1VYU A;  4X34 A;  3VS0 A;  2QQ8 A;  4OMQ A;  4JJB A;  4E47 A;  1NPP A;  1YHQ Q;  4JX6 A;  1NZ9 A;  1GH6 B;  2C5V B;  1N8R C;  1VQM T;  2O88 A;  2HKQ B;  3CCE T;  2EQM A;  2KXC A;  1AD6 A;  2K2M A;  4RCC A;  2F2V A;  3M56 A;  3VS7 A;  2MCN A;  3DB3 A;  5GAM e;  2K3Y A;  2B86 A;  1FVV B;  2AIR B;  3QJ6 A;  4F7S B;  1Q86 C;  4C8Q B;  1OIY B;  4E7I A;  2X35 A;  3H0F A;  4PJO D;  2PK9 B;  3TNW B;  3H41 A;  2F1L A;  1VQL T;  1WQW A;  2KE9 A;  1RUW A;  1C0M A;  1N9S A;  1TTH B;  4JJN K;  1YJW T;  1URC B;  4AG1 C;  4IUP A;  3UAT A;  2OI3 A;  4HLQ A;  1GCP A;  5FU6 B;  4C0F A;  4JS4 A;  4NST B;  1G3T A;  1ZSZ B;  4GY5 A;  2LMJ A;  1H27 B;  3EG0 A;  1QVG P;  3REA B;  4KGV B;  1M5Q 1;  1ACM B;  1PG5 B;  3J81 E;  5HNB B;  3RMQ A;  1YCS B;  1QLB A;  1K73 R;  1VQO A;  3MKD A;  3CCQ A;  4LNP A;  2ENM A;  2RM4 A;  3HTR A;  5GAN f;  5CQX A;  1Y07 A;  1UG1 A;  1I0C A;  3INZ A;  4JZ4 A;  3CCJ Q;  2NUT B;  2QXF A;  5IAY A;  5DM7 R;  2DD5 A;  2K3B A;  1AWO A;  2VGM A;  1D09 B;  4UC4 A;  4F7J B;  2IW6 B;  1D1B A;  2F69 A;  2V26 A;  3M03 A;  4EON B;  2KRS A;  4PNO A;  1O9K B;  4WF2 A;  4EMH A;  2V22 B;  4VUB A;  2W99 A;  1RAF B;  4XTW A;  4C0D C;  4Y28 E;  2KSS A;  2IVX A;  3G4S A;  2XG8 D; 
#chains in the Genus database with same CATH homology
 1MGQ A;  3QZ9 B;  1W2B S;  1XQH A;  2PQW A;  1X01 A;  3OS5 A;  2LQ8 A;  3V8K A;  4CRI A;  1K8A C;  2EQU A;  3M58 A;  3L42 A;  3JB9 I;  4EMK C;  2QEX A;  2QA4 T;  4ME7 A;  3JB9 D;  2F5K A;  1Q81 C;  3KBG A;  1LJO A;  5GAN 2;  5GAM h;  4M77 A;  3CMA T;  2M16 A;  2YRV A;  4HT9 A;  4HNV A;  3OY9 A;  3JCM d;  1N8R U;  1VQ5 T;  5LJ5 g;  5FLX E;  3GNF B;  2BS3 A;  5A2Q E;  3A8H B;  4AKH A;  4QSH A;  3WVE B;  4J83 A;  4E7K A;  4V2S A;  3UT1 A;  4RG8 A;  3OA6 A;  3JCM h;  2LCC A;  3V8J A;  2ZCF B;  4N4G A;  5D6X A;  3CPW A;  3M4G A;  1IZ6 A;  4C8Q A;  4LDY A;  3OYJ A;  3CCL T;  4OVA A;  2RI5 A;  4DQ2 A;  4BI8 B;  4ZN3 A;  1ZQ1 A;  5GAO q;  3S3N A;  3SD4 A;  4MZT A;  1Q86 U;  3CEY A;  4C8Q D;  3CCU A;  1QW1 A;  3OS2 A;  3DB4 A;  3MP8 A;  1BKB A;  4M77 C;  1N9R A;  2PVG B;  2QA4 A;  2R5M A;  2EJ9 A;  3HKS A;  2LCL A;  5LJ5 e;  2JUF A;  3PGG A;  3DKM A;  4NOY A;  4QQ6 A;  4ZTF A;  2E6N A;  3CMA A;  4OF1 A;  1E7P A;  3HB9 A;  4E7H A;  5LJ3 j;  3X20 B;  1VQ5 A;  3FDR A;  4BI4 A;  1M90 U;  4QQD A;  4F7U F;  3CME T;  4F7U G;  3RKX A;  2X4Y A;  3DLM A;  4HNT A;  1ZBX A;  4M78 F;  1Y7X A;  2X4X A;  3EFR A;  4M78 G;  3H4C A;  5KCH A;  3RKY A;  3OYF A;  1Q82 C;  4C8Q C;  5CKH A;  1TH7 A;  2QTX A;  2EQJ A;  4CI0 C;  1XNI A;  4BBS M;  1WJS A;  5GAN g;  5DLO A;  2QQS A;  4J7I A;  1HK9 A;  3CCL A;  4FT2 A;  2CYZ B;  4QVC A;  2V8I A;  3OBY A;  4KUD K;  3FRN A;  4JX5 A;  4OB3 B;  1OZ3 A;  1W2B A;  4M7D E;  3CCM T;  3WXM B;  2R58 A;  2WSF E;  4J5Y A;  4M7A E;  2P0Q A;  1M9S A;  3L2U A;  4PJO A;  3OYD A;  4BE1 A;  1YI2 T;  2B8A A;  2R57 A;  4LD6 A;  2JTF A;  4BY6 B;  1KQ2 A;  2DIG A;  3GLX A;  2FYK A;  2ZPB B;  4XTZ A;  1YJ9 A;  5GMK h;  5J39 A;  4J6W A;  4M75 A;  2KMT A;  1KD1 C;  5IT9 E;  5GAN e;  3V8L A;  4A53 A;  3CME A;  4ELJ A;  3BDU A;  2GF7 A;  2DPP B;  2LT1 A;  3P8H A;  4BBR M;  4OB1 B;  3VYG A;  4M7D G;  4M7A F;  5FU7 C;  2DZC A;  4M7A G;  2E64 A;  5LJ3 f;  2JVV A;  4XU1 A;  1FKM A;  5EG2 A;  5M9O A;  3RMS A;  5CIU A;  1WJQ A;  4C92 A;  2CKK A;  3OYH A;  3L2V A;  1G3S A;  2DAQ A;  3OMC A;  1M1G A;  4L6V 5;  3J80 E;  2GQV A;  2XDD A;  3CCM A;  3M59 A;  2L8D A;  3X25 B;  5I2M A;  4C92 D;  2XHC A;  2QFZ A;  3R6O A;  4GLK A;  3CCR A;  4NS5 A;  5FRM A;  3A5Z B;  3BDL A;  4XAX B;  2QF7 A;  4MDX A;  4MFE A;  2YHT A;  3H8Z A;  5KH6 A;  2DIQ A;  3VUZ A;  5DLQ E;  5CR2 A;  3S6W A;  3BY7 A;  4ZGE B;  2X4W A;  4IUQ A;  1YJ9 T;  5HKC A;  4FL6 A;  4X9C A;  3CC2 T;  3E9G A;  2XDP A;  2X4J A;  2CZ0 B;  5EJC A;  1NPR A;  2LNV A;  3CPW S;  4DOV A;  3P8D A;  1K8A U;  1UGR B;  1D3B B;  1KHC A;  2P4T A;  1I5L A;  2LX9 A;  3S3O A;  4C92 C;  3ZBD A;  2VXE A;  3S3M A;  2LRQ A;  3ME9 A;  2XU8 A;  2Y4X A;  2RHX A;  2RJC A;  5GAO m;  3BFM A;  3EFS A;  3ER0 A;  5J26 A;  4EMK A;  1K73 C;  2DXC B;  1KQ1 A;  1UEB A;  1YJW A;  4M7D B;  4M7A B;  2DEQ A;  3OQ5 A;  2BKD N;  4DA4 A;  2CGH A;  2LQK A;  4LDV A;  4FIB A;  1BYM A;  1VUB A;  3MEV A;  1SSF A;  1WGS A;  3F70 A;  4KUI A;  2L5Q A;  3QXE B;  3C95 A;  2XIC A;  2MWP A;  4J6X A;  1M1F A;  3QZ5 B;  1RI0 A;  2RH2 A;  1M4Z A;  3BG3 A;  1QP2 A;  3M9Q A;  4LDW A;  3QWL A;  3EAE A;  2D0Q B;  3PFS A;  3HO8 A;  3JCM f;  5IN1 A;  3CC2 A;  3GIB A;  3RIR A;  5CCA A;  1WPY A;  2CZ1 B;  1KC8 C;  2KQW A;  3CC7 T;  3KXT A;  5GAM d;  5J3B A;  3SWN A;  3ZEH A;  1XOV A;  5GAN 4;  1VQ9 T;  4ATO A;  2QDJ A;  4J7F A;  4QVZ A;  5CK9 A;  5GMK j;  3DLL A;  1HXD A;  2XD0 A;  4IUT A;  4RG2 A;  1Y96 A;  4JS5 A;  5CKF A;  3QSU A;  2E70 A;  3N5B B;  3KUF A;  4XU3 A;  3RUX A;  2DXB A;  1JB0 E;  4JDS A;  1VQN T;  3A8O B;  1NJI C;  4BB7 A;  4JRK A;  4JX4 A;  2RI2 A;  4MIM A;  4OGC A;  1I4K 1;  1Q82 U;  3OYK A;  4M77 E;  5GAO p;  2LT4 A;  3SB2 A;  3SDZ A;  1KG1 A;  3HHT B;  4P5N A;  2WSC E;  3JB9 J;  1OZ2 A;  1EIF A;  4C0Z A;  2DJZ A;  2RB6 A;  3PNW C;  5CQY A;  5LJ3 g;  3NTK A;  3TU4 K;  3G7Z A;  4LDX A;  2YLC A;  3GF5 A;  3E1S A;  3I56 T;  2O4X A;  3SWN C;  3LYI A;  1YIT T;  2RHU A;  2ZPH B;  4MDW A;  3CC7 A;  3LW5 E;  1KQS A;  3QDR B;  3G6E T;  3WVD B;  3VKH A;  3CBM A;  2RK1 A;  4BDZ A;  5DY9 A;  3BG5 A;  1GXI E;  4Q5W A;  4DOW A;  3HP9 A;  4JRI A;  4M77 G;  3URG A;  3I55 T;  1KD1 U;  4QW2 A;  4IKF A;  3L2W A;  2DZ9 A;  1YHQ T;  3AHU A;  2NLU A;  4OGE A;  1UB4 A;  1VQN A;  3FLG A;  4F7U A;  3A8L B;  2DXU A;  1UGS B;  5CAI A;  4RMO A;  1VQ4 T;  4LDU A;  2PUK B;  4M78 A;  5LJ3 e;  2LVM A;  1Q7Y C;  1JJ2 S;  4MMK A;  4PLL A;  1O75 A;  1BI0 A;  3X28 B;  3FB9 A;  2XID A;  5A0D A;  4M78 D;  2EWN A;  4A4K A;  1FWZ A;  3QHS A;  3CCS T;  1N27 A;  2VGN A;  3HRU A;  5GAO l;  3I56 A;  1YIT A;  1BI3 A;  2M0O A;  4HKE A;  2K5I A;  5HK3 A;  2JNG A;  4HCZ A;  4EPC A;  3CCV T;  4AKG A;  3M53 A;  3PIO A;  5C6S A;  1U8R A;  2XKO C;  2JZ2 A;  2HQE A;  4FU6 A;  4YTL A;  2KDS A;  4A4E A;  2G3R A;  2FL7 A;  2RK2 A;  3OB9 A;  2FVU A;  4II1 A;  3I55 A;  2KR6 A;  3QKJ A;  1YHQ A;  5GMK l;  3C12 A;  4XQ3 A;  4QVD A;  5FRN A;  2E12 A;  4M78 C;  3VU3 C;  3QYG B;  2M9U A;  3V7R A;  2BUD A;  4NL3 A;  4PJO E;  4M77 B;  3OYC A;  1WNL A;  1VQ4 A;  1M8V A;  2IVW A;  3C94 A;  1PSF A;  3JCM g;  3UWN A;  4M7D A;  5FU6 C;  3G71 T;  3LX7 A;  4M7A A;  2EAY A;  4M7D F;  2BS2 A;  3FIF A;  2QQ9 A;  4N4I A;  4M75 E;  1QVG S;  4A54 A;  2MI6 A;  4FT4 A;  5GAM j;  2ZGW A;  2JTM A;  3L2Q A;  1K73 U;  2RO0 A;  2ZZD A;  4RCB A;  4BAC A;  4M7D D;  1O9S A;  2FHD A;  4M7A D;  3CCS A;  2HAX A;  3CC4 A;  2XI9 A;  3L1A A;  3M57 A;  1K9M C;  1PSE A;  1FXX A;  3E19 A;  3CXC S;  4HCB A;  4OB2 B;  2MAM A;  2QQA A;  2F5T X;  4PJO G;  3OS1 A;  3JAM E;  5GAN 8;  2ZPG B;  3OBW A;  2RJF A;  2HBP A;  1QVF S;  1YI2 A;  1VIF A;  3VKI A;  1I8F A;  2RHY A;  2VYT A;  4M75 G;  1VQO T;  1VQ8 T;  3MET A;  4C0G A;  3CCQ T;  3CBP A;  4ZTJ A;  2AHJ B;  3BG9 A;  2KVQ G;  1KC8 U;  4M7D C;  1BI2 A;  3E9F A;  2DTH A;  3MEU A;  4X9D A;  4ELZ C;  3JCM b;  1VQP T;  4E7L A;  1JJ2 A;  4M7A C;  3V7S A;  3OYG A;  2XK0 A;  3CCJ T;  4C5H A;  1QP3 A;  3HBL A;  3G71 A;  3HFN A;  4E7J A;  4KUL A;  2OTL T;  1LNX A;  2GFU A;  1Q81 U;  1KQS S;  2JN0 A;  3M54 A;  4XTX A;  5LJ5 d;  1YCY A;  3CD6 T;  3HSB A;  1W4S A;  2RD1 A;  1NJI U;  4XTU A;  5GAN 3;  3GNG A;  3FJP A;  4BI3 A;  4IUR A;  2OAU A;  3M55 A;  2D6F A;  2KAF A;  2M1H A;  5CKB A;  2LDM A;  2RA2 A;  5FU7 B;  3JCM X;  1M1K C;  5LJ5 h;  5GAM f;  3QO3 A;  4A4H A;  5LJ3 d;  3UDC A;  4XTY A;  2EFI A;  1P92 A;  2OTJ T;  3OSS C;  3OYN A;  4FSX A;  4N4H A;  3JCM W;  4PKC C;  2CZ7 B;  4O5V A;  2KMG A;  2DO3 A;  2K4Y A;  4LOC A;  2V8J A;  3HPW A;  3TEE A;  4C5G A;  1VQ8 A;  4PJO B;  5LJ3 h;  4BE2 A;  3A8G B;  2I2L A;  2E5Q A;  3LGL A;  1VQP A;  2IG0 A;  2H3J A;  3CC4 T;  3OYI A;  2EYQ A;  3OYM A;  4M75 B;  2DD4 B;  1G3W A;  1X75 C;  2L3R A;  4OP0 A;  2QQB A;  2MF2 A;  2OTL A;  2XDB A;  2ZPE B;  3TCJ A;  4PJO C;  4ELY C;  5A0L A;  3OYA A;  1WJR A;  2MMP A;  3M4Y A;  3GPL A;  3CD6 A;  4HL4 A;  3QPH A;  5AYF A;  2G77 A;  3MCA B;  3MP6 A;  4MZP A;  3CXC A;  3V7C A;  1VQK T;  4XK8 E;  4ZGD B;  2K3X A;  3NFC A;  2PU9 B;  3L2Z A;  3X26 B;  3PMI A;  2CS7 A;  5CKE A;  4A4G A;  5GMK e;  2VUB A;  3T9N A;  5GAN 5;  5GAN d;  3RKW A;  4EDU A;  4KT0 E;  1QVF A;  5I2S A;  3A8M B;  2P0P A;  2EQK A;  2OTJ A;  2HQX A;  2K57 A;  4AKI A;  2EJG A;  1NE8 A;  4AI6 A;  4BUG A;  5KCO A;  4MML A;  3J7A F;  3OS0 A;  5GAN h;  5LL6 S;  3VJP A;  3VV0 A;  3PIP A;  5HY6 A;  3OYY A;  3JB9 F;  3JB9 G;  3CCU T;  2GFA A;  3JCM V;  3LGF A;  3CBO A;  2KY9 A;  3TW6 A;  1BIB A;  1AHJ B;  1Y71 A;  2E6Z A;  3HRS A;  4JUV A;  4L59 A;  4BDY A;  3QG1 A;  5L8R E;  2FB7 A;  5A0G A;  1VQ7 T;  3HFO A;  4RKU E;  4C8Q E;  3JCM P;  1VQ9 A;  2DKG A;  4M77 F;  4TVR A;  3VYH B;  1JBM A;  4C0D B;  4XTV A;  1VQK A;  3ASK A;  3OYB A;  3FC3 A;  1B34 B;  4M77 D;  2V8K A;  2P0K A;  2DD5 B;  2EKO A;  3PMT A;  4JRP A;  5HK0 A;  3JCM Q;  1WQ7 A;  4O6J A;  2VV5 A;  4M6V A;  4EMK B;  3OYL A;  3PTA A;  2K5F A;  3OYE A;  4B9W A;  5KE2 A;  2HNI A;  3LLR A;  1G5V A;  4HT8 A;  3UPU A;  4FM4 B;  2K5L A;  4C8Q F;  4F7U E;  5C0M A;  4C8Q G;  2EIF A;  3QYB A;  4BY6 C;  3H6Z A;  1K9M U;  4HNU A;  2CZ6 B;  3P8B B;  4M78 E;  1YIJ T;  3QUI A;  4OMF B;  5GMK i;  5LJ5 j;  5GAN 6;  3NTI A;  4NC6 A;  4PLI A;  3BW1 A;  4EMG A;  1UGP B;  2QI2 A;  3HZJ A;  1V29 B;  1RL2 A;  2E41 A;  3O8V A;  1UGQ B;  5CKD A;  3MEA A;  1VQ7 A;  3G6E A;  1XTD A;  3MP1 A;  5GAM g;  3VKG A;  4IUV A;  4X34 A;  3GP8 A;  2QQ8 A;  4A4F A;  3HRT A;  3SWN B;  4E47 A;  2BIV A;  1NPP A;  1D3B A;  3JCM J;  4LD9 K;  4JX6 A;  4MFD A;  1OI1 A;  3QYH B;  3OW2 S;  1NZ9 A;  3MHX A;  3JCM c;  3ZFJ A;  2Y90 A;  1N8R C;  1VQM T;  1Y96 B;  2WJ9 A;  3CCE T;  4OB0 B;  3HL8 A;  2EQM A;  3MO8 A;  2DXB B;  4C5E A;  3LWI A;  1YJN T;  1S72 T;  2C06 A;  1IRE B;  2DXC A;  2WAC A;  3VUB A;  5CVI A;  3GOX A;  2E10 A;  3C4S A;  3L2R A;  3MEW A;  4RCC A;  4N0A A;  5CO7 A;  1OYX A;  3M56 A;  1YIJ A;  2PVD B;  1QVP A;  2DXT A;  1H64 1;  3CCR T;  3DB3 A;  3JRZ A;  5GAM e;  1M1K U;  3TW7 A;  2K3Y A;  3TRE A;  4JRQ A;  3DL1 A;  3SFM A;  5FRO A;  2QQR A;  3QJ6 A;  1X6O A;  2O01 E;  2RHZ A;  4L5G A;  4C8Q B;  1Q86 C;  3QII A;  4PJO F;  3CCV A;  2O4X B;  3JSC A;  5GAN 7;  3RES A;  4C92 E;  4E7I A;  5GAN j;  2X35 A;  4PL6 A;  2RJE A;  5I21 A;  5LJ5 f;  4PJO D;  2DD4 A;  3JB9 H;  2RHI A;  2DTI A;  2YLB A;  4JLI A;  4M75 F;  2K2V A;  3JCM e;  5GAO r;  3QJY A;  4R55 A;  1VQL T;  2A3L A;  1I81 A;  4XU2 A;  1WQW A;  2GCX A;  3CPF A;  4R56 A;  1VQM A;  4Z6Y A;  2RI3 A;  2E65 A;  4M75 D;  3LWH A;  5GAO n;  3CCE A;  1M90 C;  1U1S A;  1QVG A;  1YJN A;  4D6W A;  1S72 A;  4N0A C;  1N9S A;  4F7U B;  2R5A A;  4Y91 A;  1LOJ A;  4ZGJ B;  4C92 F;  4M78 B;  4JJN K;  1H3Z A;  4C92 G;  5D6W A;  1YJW T;  1DJ7 B;  4IUP A;  4J8O A;  2HD0 A;  3Q1J A;  2LC4 A;  4HLQ A;  1BIA A;  5FU6 B;  4C0F A;  4JS4 A;  3QYE A;  1VIE A;  4BD3 A;  1G3T A;  1G3Y A;  2PVO B;  1U1T A;  1BI1 A;  2MWO A;  4NL2 A;  2L89 A;  4M75 C;  1R8O B;  4GY5 A;  1YBY A;  4C5I A;  1M5Q 1;  3OSV A;  3J81 E;  4MZM A;  4XU0 A;  3M5A A;  2EJF A;  3RMQ A;  3OW2 A;  2QDY B;  2RJD A;  1QLB A;  4QQG A;  4ZN1 A;  1VQO A;  3G4S T;  1ZHI A;  2QEX T;  3CCQ A;  1MHN A;  2JOY A;  1VQL A;  2A7Y A;  4HCC A;  3QBY A;  2RM4 A;  3PT9 A;  4JLG A;  5GAN f;  2ZPF B;  3OMG A;  5CQX A;  1Y07 A;  3INZ A;  4B9X A;  1VQ6 T;  1B34 A;  2PUO B;  2QXF A;  3CCJ A;  4KBM B;  5IAY A;  5DM7 R;  2DD5 A;  2BS4 A;  5KE3 A;  1JRI A;  2DK3 A;  2WSE E;  2E1H A;  2VGM A;  2Y4Y A;  3VYG B;  4UC4 A;  4IUU A;  2F69 A;  2DVE A;  1FX7 A;  1VQ6 A;  2ZZD B;  3RER A;  1Q7Y U;  4HA8 A;  4C92 B;  3X24 B;  3NTH A;  4PNO A;  4WF2 A;  5D6Y A;  2D9T A;  2VC8 A;  2KK4 A;  4EMH A;  5GMK m;  4BE0 A;  2LTO A;  3FEO A;  3LH0 A;  4J6Y A;  2DTO A;  4VUB A;  2ZPI B;  1KHI A;  1N6A A;  2VXF A;  4XTW A;  2KSS A;  4Y28 E;  4Z02 A;  4C0D C;  3G4S A;  3KHI A;  2XG8 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...