2CZ6B

Complex of inactive fe-type nhase with cyclohexyl isocyanide
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title x-ray snap shots of inhibitor binding process in photo-reactive nitrile hydratase
rcsb
molecule tags Lyase
total genus 60
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2cz6B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cz6B02
2DXBA 2PUOB 2PU9B 3A8GB 3WVDB 2DD5A 4FM4B 2PVOB 4KT0E 2PVDB 1GXIE 2WSEE 3QZ9B 2CYZB 1UGPB 2CZ0B 4OB0B 2ZPHB 2DD4B 3X20B 4OB3B 2ZPGB 2D0QB 2DXCB 3WVEB 3LW5E 3X28B 5L8RE 4RKUE 2ZPEB 2WSCE 2CZ7B 2O01E 3HHTB 3VYHB 2ZZDB 2ZZDA 4ZGJB 2DD4A 1V29B 2ZPBB 3VYGB 3VYGA 3X25B 2DXCA 1PSEA 2AHJB 3X24B 4OB2B 2ZCFB 2CZ1B 1UGSB 4Y28E 3A8OB 4ZGDB 3A8MB 2WSFE 1QP2A 3A8HB 2ZPFB 1UGQB 3QYHB 1UGRB 3X26B 1DJ7B 1AHJB 2CZ6B 2ZPIB 3QXEB 4OB1B 2PVGB 3A8LB 2DD5B 3QZ5B 1QP3A 2QDYB 1JB0E 4ZGEB 4L6V5 1PSFA 4XK8E 2PUKB 1IREB 3QYGB 2DPPB 2DXBB
chains in the Genus database with same CATH superfamily
2CH4W 2AIRB 3MP1A 1PWTA 2MIOA 4F7UG 3M0QA 5LJ5f 2O88A 1VQNA 1PCXA 1W1FA 4FM4B 4JLIA 2KQWA 2LCLA 3C4SA 1HK9A 5LJ5h 1G3WA 1I1JA 2BZ8A 1Q7YC 2O9VA 2E64A 1TUCA 2W10A 2CP6A 2RJCA 4BCJB 2EQIA 2A3LA 4JS4A 2Z0WA 3JV3A 3KUFA 5CKFA 2R57A 4OB3B 1X69A 2IPOB 2EIFA 2F1LA 3ULRB 3BG3A 1VQ5A 3M54A 1YCSB 1M27C 1ZSZA 2GF7A 4KUDK 4E7JA 3M4YA 3NTIA 2DO3A 1YITT 4F7UE 4J9GA 5KE3A 2RHXA 5L8RE 4LDYA 1K4US 4RTUA 1RAEB 1KQSA 2CP0A 2D1XA 2BPMB 3QO3A 2KEAA 2KY9A 1QVFS 4GLKA 4DOWA 1UGVA 3INZA 3V8KA 1M3BA 1OU9A 1RLQC 3CCLQ 4OMLA 2DXCA 3X24B 1QWEA 2UZBB 1YIJA 2BKZB 3OS5A 2QQRA 1MMAA 4BCND 4CC4B 3CCLT 4EC8B 4XTXA 1UEBA 4C8QC 3VRZA 2GFAA 1LOJA 3D7SB 1E7PA 4MZPA 4C8QF 1IO6A 1D09B 2ZPIB 3CCUT 4X34A 1IHWA 2EJFA 3M03A 1AWOA 1I81A 2HBPA 3G4SA 3PTAA 1QP3A 1N5ZA 1M2VA 2HZYA 2F2WA 2DNUA 2GQVA 4LDWA 5LJ5j 4DA4A 2QTVA 4CRLB 1LCKA 1RI9A 3CCEQ 5EC7A 4L6V5 1WX6A 2KR6A 3RNJA 1Q81U 4FCYA 4M78A 2HSPA 1JSTB 2CP7A 1WYXA 3Q1JA 1UJYA 1C1AA 1ZBJA 3E9FA 3RERA 4HVWA 3JB9F 1OGUB 2L0AA 1UE9A 1YP5A 5IDPB 1F1BB 1W2BA 4PJMA 1Q86C 1QKXA 3I55Q 2EVRA 1K0XA 2JTFA 2VXFA 1VIFA 2PTKA 2RJEA 1ZA2B 2E1HA 1OPKA 3CCRQ 3I55T 4RTVA 2QQ9A 3EHRA 4HNVA 2K4YA 3BDLA 4AFSC 1D0YA 1BI3A 3G1JA 3X28B 1NYFA 3QYEA 5EFQB 2ECZA 1VQLA 1GUXA 2VXEA 2OTJA 2DEUA 3CCVA 4BCOB 4A53A 3BFMA 1OX9A 2JGZB 1BCOA 5DLQE 5HQ0B 1H641 2I40B 2KE9A 4CXAB 2LZ6B 3TNHB 1YHQA 3H0IA 8ATCB 2X3WD 2YRDA 1IHVA 3QUIA 3POMA 2QDLA 3VS4A 1K8AU 4M7AA 1HJDA 2OJ2A 3I35A 4FSXA 2RPNA 1E9HB 1K73R 3J7AF 1VQOQ 4MZTA 3RKXA 3O0GD 2JS0A 4N0AA 2LRQA 2DZ9A 2DL4A 3CXCS 4F7SB 3MY1B 3OBYA 3JCMb 1U06A 4IURA 2YLBA 2C5NB 2GQIA 4PJOG 1PHTA 1HD3A 4LN2A 4ME7A 4AKIA 3A8LB 3VUBA 4R56A 3QWXX 2QDYB 2HMAA 4XTZA 2ED0A 3MEWA 2P0QA 4EOLB 2F69A 3BHUB 1WPYA 4ELJA 3L42A 4EMGA 2G3RA 1NLPC 2VUBA 2AZVA 1N9SA 2NLUA 1XO2A 3M57A 3OMCA 2LX7A 5FLXE 3CCMA 2J05A 3JCMc 4JRQA 3M9QA 3EGUA 3NDQA 1WHHA 2E5QA 1BI1A 1NJIC 3BLRB 4PJOE 2WMBB 1RLPC 4M77F 4CFUD 1VYVA 3MEVA 1SSHA 2R5MA 2MI6A 4LE9A 2GTOA 4L59A 2E41A 1M3CA 2FB7A 2X3XD 2JW4A 3ZBDA 4MIMA 3MO8A 2CT3A 2ZPHB 2ZPGB 1BB9A 2EGAA 2X9HA 2FPFA 2RH2A 4JJBA 2LJ3A 4M78F 4E7SA 2RQRA 4FX3B 5ACBA 5KYUB 1KK7A 2EKHA 4M75A 3TU4K 3FJ5A 1KD1R 1RACB 2CZ7B 3TEEA 2J06A 1SHFA 4C0DB 4J9IA 1OYXA 4ZGJB 3VKGA 3OYEA 4CC7A 3I5SA 3QHWB 2A0FB 4EOQB 3VYGA 1VQ6Q 3X25B 1Y0MA 1TWBA 2F5TX 1NPRA 1JJ2A 1UTIA 4FYWB 2XDDA 4HT9A 4GLMA 1QVGP 3BW1A 2FEIA 2FZGB 2CZ1B 2COYA 3NGPA 3A8OB 4BE0A 1QP2A 4JRPA 3EFRA 2X51A 1H3HA 2L89A 4BB7A 2HL5C 4EC9B 4IIMA 4BY6C 1SRLA 1NE8A 5GANe 2JZ2A 1UECA 4YC3B 4LOCA 5C6SA 2C0TA 2QQAA 4RTXA 2QA4A 2YXYA 2K3XA 2E3IA 2LW4A 3G6EA 3TVTA 2BTTA 1PKSA 3CCJA 3DOGB 4X9DA 1BIBA 2XU8A 4D8KA 3U23A 3TW6A 2ROLA 2FL7A 1QVFA 1VQ9A 3JB9H 3G71A 5GAN6 2QGGA 1Q7YU 4RMOA 5GMKj 3RMSA 2PUOB 2RK1A 2AKLA 3A98A 2CP2A 3HP9A 4RCCA 1VQKA 5LL6S 2DD5A 2V8KA 4V2SA 3BG5A 2KRNA 1ENWA 1JXMA 1VQNQ 2HKQB 3EFOB 4PK4A 1UNHD 3O5ZA 3HTRA 2M02A 4II1A 4C92A 2IVWA 3PGGA 4E7ZA 5CR2A 3E19A 2WIHB 2CZ0B 4PJOB 1VQNT 1BI0A 1VQ8T 3EG0A 1AWXA 1A0NB 2C5XB 3OYCA 3EG1A 2EBPA 1VQ5Q 5GMKe 2DBKA 4A54A 2YUOA 3PT9A 2JNGA 3JCMd 3EH1A 3V7CA 1KQSP 3MP8A 2ZPEB 1KJWA 1RI0A 1RABB 3JCMg 4BDYA 5LQFB 4GBQA 1WGSA 5HBEB 3VYHB 3VJPA 4F7LB 1OI1A 2LT4A 3QKJA 5DY9A 2AKKA 4N4GA 2DMEA 4EIKA 4EOKB 3DDPB 3EG2A 2FO0A 1OEBA 4F7UF 3LGFA 5GAMe 5FGKB 4BI3A 1VQPA 3P8DA 1LVKA 2BUDA 1YIJQ 1M4ZA 2CSIA 5I2SA 4C5IA 2R5AA 3GIBA 2L3SA 5CKBA 1YI2A 1YIJT 4NS5A 1M5Q1 2W9FA 1UFFA 3QZ5B 1VYUA 3S3OA 2C5VB 5LJ3f 1JU5C 5GAOq 4JX4A 3G4SQ 3UA7A 4ELYC 4QQ6A 5LJ3h 2NUPB 2PK9B 4R0KA 3VU3C 2FHDA 2LVMA 3G4ST 1W2BS 4OGRB 2JM8A 1K1ZA 4LDUA 1Q86U 1X6OA 2AK5A 2M51A 2JUFA 2YLCA 5AT1B 4J6WA 2K5LA 1OL1B 4QVCA 2JTEA 3OW2S 5CO7A 4VUBA 2RHZA 4F6SB 2EPDA 1GRIA 1YJ9A 4LXCA 2PVOB 3HL8A 1B07A 4BE1A 1WHKA 1O9KB 4PLIA 3M0RA 5KYXA 1E6GA 2Y4YA 4BCKB 4I3ZB 4BY1X 3CXCA 1OV3A 2MOXA 3TNIB 2M0OA 3NTKA 1K73C 4YOZA 3UA6A 3VS7A 2XI9A 5A0DA 1U8RA 1WXTA 4EMKA 3EJ1B 3V7RA 3HFNA 4XU0A 4PKCC 4LUDA 4CRIA 3C0CA 2DYIA 1ZUKA 2IW6B 2EWNA 2FVUA 1X6BA 5HY6A 3ZFJA 3DB4A 2ABLA 2DVJA 2RI2A 1VQLQ 4ATOA 3CCQA 2OTJQ 4D8DA 2J6KA 3CCVQ 3DL1A 4ZN3A 5FWCA 1V29B 3TNWB 2JMAA 1YHQQ 2JT4A 3CCVT 2CP3A 3OSSC 1IB8A 2VV5A 5KCHA 1G3YA 2W99A 2C4GB 2KMTA 5L23A 4J9BA 4C8QA 1YHQT 3JSCA 2CH4A 1E7OA 3HPWA 2I0NA 4XTYA 3NPFA 4RTYA 2XDBA 1B7TA 3CC2A 5FU7B 1DJ7B 2FRWA 5EG2A 2CSQA 2CZ6B 1JQQA 1W6XA 2E70A 3BDUA 4BUGA 3VUZA 2DETA 4K11A 5GAOn 3META 2XIDA 2M1HA 3FJPA 1MMGA 2YUQA 2DFUA 3C94A 1AOJA 5DQWA 1GBQA 4M7AG 5IDNB 2RMOA 1MV3A 4B6MA 2CCIB 4N4IA 2V8JA 3M59A 4OMMA 1Q82R 4A4FA 1PKTA 3A8GB 2MMPA 3KHIA 2P4RA 1ZSZB 3CCMQ 2K5FA 3CMET 4E7IA 3M0PA 1K0SA 1JEGA 4OP0A 2K2MA 4BCPB 2IG0A 3JB9J 2E65A 1WIEA 1WFWA 1X6GA 1KC8U 2R7GA 4Z89A 5DQVA 2PHGA 1GFCA 3E1SA 4XQ3A 2OAWA 4PFPA 2WFYB 2BIVA 4PJOC 1ZUYA 2EYWA 2GNCA 3RBBB 5HK3A 2DXCB 3S3MA 2G9XB 1VQ4T 4KRTA 3EIDB 3M5AA 5GMKl 4Z6YA 3M0UA 2CCHB 1CKAA 3FC3A 1JJ2S 1JXOA 5CKHA 2WSCE 2EGCA 2NYSA 1RAAB 4IMYB 1ACMB 4AI6A 2DTOA 5KYWB 3MPUB 4QT7A 2XHCA 1ARKA 1TS9A 1XQHA 4C5HA 3CBOA 4EOPB 1YFNA 3QDFA 1UJ0A 1OIUB 4AG1C 3GLXA 1VQMA 3GOXA 2PK2A 3JCMJ 2MWPA 4CI0C 4M75G 1NLOC 3QIIA 3R6NA 1VOLA 2DILA 5KE2A 1JKWA 1QWFA 2KR3A 2DA9A 3OYYA 1FVVB 1AHJB 2NWMA 1PNJA 4RTZA 3OYMA 2AZSA 3EOCB 2J7IA 4OB1B 1VQ7A 2GBQA 1N8RR 1Y71A 1JB0E 4KGZB 2A08A 4ELLA 1LJOA 2QA4Q 3G6EQ 3SEMA 3I56A 4IUQA 1QVFP 3CMAA 4PLLA 2XICA 5IH2A 3CCJQ 1V1CA 1ZX6A 5I11A 1O75A 4M75E 4F17A 4LUEA 3L2RA 1IREB 4IIOA 4M77A 4FT4A 1VQ9Q 3DLMA 2LTOA 4IUTA 3G71Q 2JN0A 3TSZA 5GMKi 3T9NA 1WNLA 3FLGA 1ZUUA 2O2OA 2QG9B 3EG3A 3RKYA 2EUFA 3MKDA 1VQ9T 5CKEA 1OZ2A 1VQKQ 1OZ3A 3G71T 1Q95G 2M0YA 2KYMA 3H9NA 5D6WA 1TUDA 2L3RA 2C5OB 2X35A 1VQKT 3NFCA 3MHXA 3TSWA 2E4HA 4QW2A 4HNTA 3CCET 3A5ZB 1HXDA 1JO8A 3EGXA 1H27B 2VVKA 4M7AB 3SHWA 3OYLA 5KYYB 3BHTB 3QWLA 2DF6A 4CC2A 1FMVA 1J3TA 4YOSA 5FW9A 2BS2A 2DXUA 3EH2A 2D0NA 3EHQA 5CKDA 5LJ5e 4C92G 4DBFA 4ROEA 4HL4A 1G83A 3OW2A 2JTMA 3QBYA 1D1CA 2K57A 4A4HA 2MCNA 2VYTA 1UNLD 4PJOD 1G3NC 3CPWS 3CCRT 3HRTA 4M7DG 4MMLA 1UGSB 3VS2A 1VQPQ 4ZGDB 2NUTA 1U3OA 3EGDB 2ROTA 4C92E 3QXEB 1YI2Q 1MHNA 3J81E 4E47A 4E2FB 1MNDA 5J39A 1UDLA 4O5VA 3LH0A 4ZGEB 1B34A 2X4JA 4UC4A 4MFEA 2QI2A 4C0FA 4M7DE 3P8BB 4OGCA 4QQGA 4BDZA 5A0LA 4XTWA 2WJ9A 3QYGB 2GTJA 5FROA 1VQOT 2PU9B 5FU6C 2QF7A 1K73U 3OS2A 4DOVA 1WJQA 4OGEA 2KXDA 3EG9A 2JS2A 1RAHB 3REBB 4BBRM 4BBSM 2KMGA 1ZSZC 4M75B 3PMTA 3VRYA 1OKVB 1X2KA 3CXCP 1YJ9Q 2BS3A 4AT1B 1H25B 1M90R 4G6LB 4WTOB 5KH6A 5GJWB 1M1KR 4J9DA 4E6RA 5DM7R 4MDXA 1X43A 3GPLA 5FWBA 4ESRA 4Z02A 2V26A 3L2UA 2B86A 1VIEA 4J7IA 2KGTA 3CC4A 4L5GA 5I22A 2J6FA 4OMQA 2ENMA 2G6FX 2YRVA 2IW8B 4OMPA 1ZP2A 5I21A 2CP5A 2KRMA 1IRXA 2ZZDB 4F7UA 2RO0A 3JB9I 3CCQQ 3B57A 2CT4A 5FRMA 2LT1A 2DD4A 4EDUA 1C6VX 2WEVB 7AT1B 5GAN4 3PE0A 3I9QA 4D6WA 1KC8C 5IHYA 2EQUA 4OB2B 4J8OA 2DL3A 3LH5A 3H0HA 4Y28E 2L8DA 2VC8A 2X4XA 1GL5A 2ESWA 3QYBA 3TCJA 2RF0A 1UGQB 2K6DA 2LQNA 2H3EB 3FIFA 3CC2Q 3OYIA 3KFVA 1ZHIA 2DD5B 3UATA 1KD1U 3HFOA 4J5YA 4FU6A 4E7KA 1B3QA 2KT1A 3JCMf 4CFVB 5GANd 1VQ6T 4C92B 4LDXA 1QLBA 5GANg 3JCMh 3OYBA 1YITA 2L3PA 3H6ZA 4C8QG 2F2VA 1AISB 1Y96A 3THKA 2RQWA 2A36A 2HQEA 3M55A 2HDAA 2Y90A 4KRCB 2DXBB 1EFNA 1H24B 5CQYA 4ANJA 3CQTA 3L2QA 4FW2A 2KRSA 2W9ZA 3BG9A 4J83A 4JLGA 4M7DB 3CCSA 1NM7A 1S1NA 4LDVA 2V8IA 4LD9K 3OMGA 4ZTFA 4XU3A 1KHCA 2K79A 3QZ9B 3BLHB 2D8JA 4MFDA 2HEQA 4AFQC 1UGPB 1WHLA 2CS7A 4NOYA 4HCCA 2DERA 4HXJA 1SKUB 4IUUA 2FYKA 2VGMA 4NL2A 5IXBA 3VV0A 4CFMB 1X27A 3SWNB 1TOVA 2DL7A 1EZZB 1KFZA 1UHCA 1N9RA 3CCUA 2XMFA 3LW5E 3RR6A 2EYZA 2DX1A 4XTUA 4QVZA 4ZNXA 3JCMP 3UPUA 1H8KA 1OL2B 4OR5B 2IW9B 2E10A 3OB9A 2CUBA 3JCMQ 2CREA 2B8AA 3I5RA 4BCHB 4ORZA 1URCB 4BI4A 2JMCA 2KROA 3BY7A 5CQXA 5IXFA 1AWJA 1R0CB 1JOWA 1GCQC 2RI5A 3L2WA 1VQMQ 2L3QA 1T0HA 2EFIA 1TFBA 1JRIA 1VQ5T 1NEBA 5GAMd 2MF2A 2UUEB 2QQ8A 5GAMg 1HSQA 3ASKA 5CIUA 2CJMB 2LP5A 5CK9A 2V22B 1D3BA 2P0KA 4IUPA 1AZGB 5KYXB 4FYVB 1T3SA 3I56Q 2V1RA 1SSFA 3CMAQ 4PJLA 4J9CA 2AT1B 4JPBW 1YCYA 2LQ8A 3M0SA 4TVRA 4EMKB 1MNEA 4CFWB 1PD0A 1Z9ZA 2QYZA 3CPWA 2UZDB 1QKWA 2YUNA 1IGUA 2W0ZA 2IVXA 5A0GA 2WPAB 1BU1A 2K7AA 4NL3A 1KQ1A 4M75C 4CFNB 3OQ5A 1OQKA 1OOTA 4PJOA 3C95A 3PVLA 4YTLA 3X20B 1IZ6A 5HBHB 2FPEA 1LNXA 1K9MR 3CD6A 2E3HA 1I4K1 2LJ1A 4JRKA 4M77G 4YOOA 1YWPA 2LNHB 3CBPA 3VS0A 3WVEB 4Z8AA 2EYYA 1GY3B 1W4SA 1M8VA 1W2BP 2RHIA 4C8QB 1PD1A 4FT2A 1D1AA 3UWNA 3GF5A 2O01E 4MZMA 1KSWA 3OW2P 1YJNA 4BACA 2V1QA 3PIPA 4MMKA 3QDRB 2RJFA 4M78G 1G3TA 3HBLA 2JVVA 5KYNA 4ROCA 4LD6A 4M77E 3ZL7C 1PSEA 2K5IA 3E9GA 1MUZA 5GAOl 3RIRA 1I0CA 2D8HA 3OA6A 4F70B 2DIQA 5A2QE 4AG2C 1O9SA 2WSFE 4J7FA 2ED1A 1XTDA 9ATCB 4M7AD 1ZLMA 2PNIA 3FEOA 4AMCA 4BE2A 1M1KC 2HL3A 1Y07A 2DK3A 3OYAA 1M1GA 1JBMA 2KNBB 4C0DC 2PVGB 4M78E 5LMKB 2RNAA 3VS1A 1VQLT 1JSUB 2OTJT 1AEYA 4HCKA 3EAEA 2BE7D 5LJ3j 1ZQ1A 5IHNA 4Y92A 5HK0A 4A4EA 4J6YA 2EQJA 5IN1A 4F7NB 4C92C 4C5EA 4BCGB 2YT6A 2VB6A 2WACA 3MIAB 2MPXC 3MEAA 3BLQB 2DXTA 3QG1A 3OS0A 2HD0A 2FRYA 1SEMA 3SDZA 5GMKm 3L2VA 2HNIA 2OAUA 4M7DC 4A4KA 1SPKA 4C0ZA 2PVDB 1C0MA 3GTMS 1G3SA 3TQ7P 2DRMA 2QK0A 4BCFB 1P5EB 4BI8B 2DIGA 4J9HA 4RG8A 5LJ3e 5ECAA 1KD1C 1NJIR 1ZSGA 2D0QB 3CPFA 4EONB 4F6UB 4AFUC 4WF2A 1MV0B 2LCCA 2WXVB 3CC4Q 2QTXA 3EFSA 1Q82U 4RKUE 3SWNC 1WHGA 3VS5A 3CCMT 3SB2A 2G77A 1TUGB 2YWWA 3RKWA 4M7AE 1R77A 4M75D 1RL2A 4KGVB 4XU2A 3M0TA 3QHRB 1PRLC 1KQ2A 2O4XA 1V76A 4F14A 1PKDB 1TXQA 3QHSA 1F5QB 3GNGA 4PJOF 2DJZA 1WQ7A 2OTLA 4B9XA 1TSFA 1Y7XA 2WMAB 1EIFA 1FX7A 3A8HB 2ZPFB 1AZEA 1YN8A 2I2LA 2DMOA 4M77B 1UNGD 1QMZB 1FWZA 5HVYB 1H3ZA 5GAN2 4DBQA 2X1NB 2MWOA 1FMWA 1NG2A 4OF1A 1JJ2P 2LCSA 1M2VB 2R58A 1S72A 3VS6A 3PIOA 1VQ8A 1YNZA 1RAFB 1I07A 4BD3A 2DE0X 4EOJB 4O6JA 4LNPA 1PSFA 5IAYA 4M78B 4KBMB 3CEYA 5I5ZB 4XK8E 1H92A 1YITQ 2QEXA 4DEXA 1AD5A 2C06A 3RMQA 4X1VA 2D9TA 3EGXB 3UDCA 5KCOA 1VINA 2J6OA 4EMKC 3PNWC 4PNOA 4JZ3A 2CKKA 1GH6B 2FZKB 4FSSA 3MY5B 3CCSQ 1D0ZA 4KT0E 1VOMA 2WSEE 3JCMX 1FINB 2HKNA 1FKMA 2FZCB 5FRNA 4Y91A 3CCST 2I53A 1N8RU 1XJWB 3QJ6A 3JAME 2QA4T 3G6ET 2COZA 2D6FA 2RQTA 2VGNA 1SG5A 2L5QA 3VS3A 4C92D 3CCJT 2LQKA 3LYIA 1AT1B 5C0MA 2EGEA 5M9OA 3LGLA 4EMHA 3V7SA 2YHTA 2A37A 3CCUQ 2NUTB 2EKOA 1TG0A 2HQXA 1GUXB 4BY6B 2ZAEA 4M7DD 3S3NA 5D6XA 2B9RA 2VKNA 5KYWA 2O9SA 3PFSA 3P8HA 2YSQA 1D0XA 1OKWB 1Q81R 4KUIA 3VKHA 4DEYA 4BCMB 2BE9B 1WHMA 3JCMW 2CUDA 3M56A 1GCPA 3TREA 4MDWA 4JX6A 3SFMA 5LJ5d 4J6XA 1B34B 2C0IA 1UUEA 2RB6A 5LJ5g 4TTHA 3M53A 3REAB 1BKBA 4JX5A 2K2VA 2K3YA 4JUVA 3CC7A 3F70A 1UGRB 1TH7A 3ME9A 3KXTA 1X01A 1AVZC 1WXBA 4HT8A 2EQKA 3OYNA 5GAN7 4F04B 4BCQB 2RQUA 5D7UA 1H26B 3EG9B 4HVUA 3GP8A 1G8XA 5IHIA 2IN3A 1K9MC 1NPPA 4BCIB 3M58A 8AT1B 5ICPB 1ABQA 4ELZC 2DEQA 3OYJA 2YRCA 4QQDA 1OULA 2K9GA 1YJWA 3LWIA 5CYIB 1U1TA 3UT1A 2KAFA 3CPWP 1VQPT 1M2OA 2LJ0A 5FU7C 1G5VA 5J3BA 2DTHA 1LPLA 3L2ZA 2RHYA 1CSKA 2KT8A 2QQSA 2UZLB 4AKGA 4GY5A 1H1PB 1YI2T 3JRZA 2X4YA 1WDXA 1RAIB 1K8AR 4NSTB 5GAOp 2LMJA 3PVQA 4HCZA 4F7UB 6AT1B 2DD4B 4RCBA 3J80E 3R6OA 1K76A 1FMKA 2BS4A 2KBTA 3CD6Q 2ZGWA 2XG8D 3S6WA 1RUWA 2XK0A 5KYYA 5HNBB 5GANf 2DVEA 3CD6T 4C0GA 5GANh 1G2BA 2F2CA 5GAN5 1BCMA 4OMFB 4E7HA 1UG1A 2EYQA 4HVVA 1D3UB 5HKCA 2HSEB 1YJNQ 2MK5A 1YJ9T 2X4WA 3HRSA 3VYGB 2HCKA 1M90U 2QGFB 1GCQA 1WI7A 3PO3S 4PJNA 2DJQA 2AHJB 1YJNT 1M1KU 2H3JA 1SF9A 2EAYA 2ZCFB 3CMEA 3A8MB 2HQHA 3HRUA 1N6AA 1Y96B 2PMIB 3EGDA 1N27A 5EJCA 4C8QD 2KVQG 4BY7X 1X75C 1D1BA 3FRNA 4M77C 2RHUA 2WIPB 4ZN1A 1Q82C 1M1FA 5CVIA 3DKMA 4KH0B 4P5NA 1C9BA 1H28B 4OMNA 3CCQT 2PQWA 3RESA 3QSUA 4HCBA 1UB4A 1I8FA 2YDLA 1BIAA 2DRKA 1VQ4A 3RUXA 2PUKB 2DPPB 5GMKh 4M78C 2OI3A 2Y4XA 2DAQA 3OYDA 3JB9D 4XU1A 2KSSA 2E6NA 4M6VA 3E2UA 4EOSB 1E6HA 1ZBXA 5HCKA 1YBYA 4KH1B 3GNFB 1OI9B 3CC2T 3DDQB 1QVPA 3NMZC 3MCAB 1GXIE 4RTTA 5GANj 3KBGA 4C5GA 5L2WB 3IQLA 1QLYA 4JZ4A 5CAIA 1CKBA 5GAMf 1XNIA 3H4CA 4OB0B 1QVGS 1VA7A 3TN8B 5GAMh 3OYGA 2QDJA 2RQVA 3TW7A 2DM1A 4BCNB 1WLPB 2QASA 2EW3A 2LNVA 4PFZA 2M16A 3L1AA 5I2MA 3CBMA 2YUPA 3RGFB 2PJQA 2VWFA 2C6TB 1NEGA 2OX7A 4XTVA 2PZ1A 4DQ2A 2SRCA 4X9CA 5IHKA 2RD1A 3QJYA 1M8MA 3HZJA 1P92A 2HBWA 2KYBA 4J9FA 2DYBA 1VYWB 2EYXA 2ZZDA 3JB9G 4C8QE 1SRMA 3CCLA 1NYGA 1H4LD 4KULA 4N4HA 1D3BB 2DKGA 4JRIA 2P84A 1Z9QA 1Q7YR 1SHGA 4A4GA 2FPDA 4FYXB 5KYUA 2COWA 4NC6A 1RADB 1N8RC 2OTLQ 4M7AC 1T3LA 2MAMA 1H1QB 2KXCA 2XDPA 4PFOA 5CCAA 3DTOA 3X26B 4M7AF 2CGHA 5BNJB 1WZOA 2CDTA 4N0AC 1QCNA 4F16A 2OTLT 1W70A 3OBWA 4FL6A 4WCIA 4BXXX 5J26A 2DBMA 2SEMA 4JJNK 3AT1B 4CC3A 3CCEA 1H1RB 3SD4A 2E5KA 1S72Q 3LQ5B 1VQ8Q 1PM3A 1MMDA 4Q5WA 4A63B 4HNUA 1S72T 5GAMj 4QSHA 4HKEA 3JCMV 1KQSS 2M9UA 2NUZA 1VQMT 2DXBA 2QEXQ 3QPHA 3F5XB 1NBEB 3RDVA 1QW1A 2EJGA 4DBHA 4M7DA 1UHFA 2MYSA 1Q81C 4M77D 4FYYB 3OYKA 2GFUA 1H1SB 3H0FA 1VQ7Q 4RODA 3PMIA 2QEXT 3I55A 1M30A 2BZXA 1OX8A 1YWOA 1IGQA 2QAZA 1I5LA 2KDSA 1W98B 3NTHA 1VYTA 2JOYA 2EQMA 1VQ7T 3CCRA 5D6YA 4IKFA 2QGSA 1U1SA 2RK2A 2HAXA 2BKDN 2ATCB 5IF1B 3V8JA 3BE3A 2KI7A 2O31A 3JCMe 3MJXA 4AFZC 3I56T 4KGXB 2W2HA 3CMAT 4M78D 5GAOm 4DBRA 4JJCA 4RG2A 2RA2A 3SWNA 1QCOA 4B9WA 3EFOA 2F2XA 5HBJB 3FB9A 3MEUA 4CFXB 1BYMA 1NZ9A 3HHTB 4PJJA 4M75F 2XKOC 3OSVA 4IUVA 3VKIA 2C0OA 2JM9A 3FDRA 1FXXA 1Q86R 1AWWA 4F7JB 1VQOA 2QQBA 3OYFA 1KIKA 1BBZA 3HB9A 1K9MU 2E12A 2A28A 1FYNA 2DLPA 3QYHB 2RJDA 4R55A 4CFUB 3CC7Q 2RI3A 1K8AC 2W96A 3H41A 1KXUA 2VASA 4RTWA 3V8LA 2QFZA 3CC7T 1MGQA 3QWYA 1Y57A 1TD6A 2LX9A 4JS5A 4FIBA 4EOOB 4FW1A 4BCMD 2A7YA 2P4TA 2BZYA 5IT9E 4J9EA 3URGA 4Z88A 1OIYB 1M90C 1OPLA 1WQWA 1YJWQ 5GAN8 2LQWA 1GBRA 2L2PA 3OYHA 4Y72B 1QMCA 1MMNA 4XAXB 3WVDB 1PC0A 2LDMA 4OVAA 1YJWT 2F5KA 1PRMC 3ER0A 1M9SA 4OMOA 1BU2A 1R8OB 3WXMB 4BCQD 2NUPA 1WA7A 3DB3A 2CYZB 4EOIB 2DZCA 1RAGB 1QCFA 1TTHB 4II5B 1EX4A 1GFDA 2GCXA 1I5OB 1IXDA 3C12A 4PL6A 2E6ZA 1QQJA 3G7ZA 1OU8A 1TU0B 4M4ZA 2O4XB 1X2QA 3DLLA 4C92F 4E7LA 3LWHA 3HSBA 2RM4A 3O8VA 4JDSA 1BK2A 4RUGA 1PG5B 5GAOr 5LJ3d 1KG1A 3N5BB 5LJ3g 2LC4A 5AYFA 1WJRA 2K3BA 1O9KA 2WHBB 3HKSA 3DJBA 3MI9B 4EORB 1AD6A 4KRDB 1BI2A 1ABOA 4M7DF 2UZEB 4EOMB 4EPCA 4ZTJA 1WHJA 3UF4A 5DLOA 3A1PA 4F6WB 1ZA1B 2H8HA 1VQ6A 1XOVA 2ZPBB 3K7AM 2P0PA 1N4MA 1WXUA 2DTIA 2GGRA 3ZEHA 4QKUA 3MP6A 4UN0A 3BHVB 2DL8A 2XD0A 2JXBA 1NJIU 1QVGA 3AHUA 3CMEQ 3OS1A 4HLQA 5FU6B 2KK4A 3G33B 2EJ9A 3CC4T 2IIMA 1KHIA 3HO8A 1KC8R 4HA8A 5GJVB 4AKHA 3LLRA 1K9AA 2FG0A 5CEIB 1HYOA 1U5SA 2JJ9A 3LX7A 3OY9A 1VUBA 1T0JA 2DL5A 1M3AA 1WJSA 2QXFA 3M4GA 3H8ZA 1R0BG 2RN8A 3NHNA 4QVDA 1VQ4Q 3GBQA 5GAN3 4JJDA
chains in the Genus database with same CATH topology
1VQPT 2JUFA 5CQYA 2YLCA 3MP1A 5FU7C 4J6WA 2K5LA 5J3BA 4QVCA 3L2QA 1G5VA 4F7UG 3OW2S 2DTHA 3BG9A 3L2ZA 4J83A 4JLGA 5CO7A 4M7DB 4VUBA 5LJ5f 3CCSA 2RHZA 2RHYA 1VQNA 2QQSA 1YJ9A 4AKGA 4FM4B 2PVOB 3HL8A 4LDVA 2V8IA 4JLIA 4BE1A 2KQWA 2LCLA 3C4SA 1HK9A 3OMGA 4GY5A 1G3WA 4PLIA 4XU3A 5LJ5h 4ZTFA 1YI2T 1KHCA 1Q7YC 3JRZA 2Y4YA 2E64A 3QZ9B 2X4YA 3CXCA 4MFDA 2RJCA 5GAOp 1UGPB 2M0OA 3NTKA 2A3LA 2CS7A 4NOYA 4JS4A 1K73C 4HCZA 4F7UB 3KUFA 4HCCA 5CKFA 2R57A 2DD4B 2XI9A 5A0DA 4RCBA 4OB3B 1U8RA 2EIFA 4EMKA 3J80E 3R6OA 4IUUA 3BG3A 2BS4A 2FYKA 3HFNA 2VGMA 3M54A 4XU0A 3V7RA 1VQ5A 2ZGWA 4NL2A 2GF7A 4KUDK 4PKCC 2XG8D 4CRIA 3S6WA 4E7JA 3M4YA 3NTIA 2DO3A 3VV0A 4BI8B 3SWNB 1YITT 4F7UE 2XK0A 5KE3A 2EWNA 5GANf 1N9RA 3CCUA 2FVUA 3LW5E 2RHXA 2DVEA 5HY6A 5L8RE 4LDYA 3ZFJA 3DB4A 3CD6T 4C0GA 5GANh 4XTUA 4QVZA 3JCMP 2RI2A 3UPUA 1KQSA 5GAN5 3QO3A 4OMFB 3CCQA 4E7HA 4ATOA 2E10A 2EYQA 3OB9A 5HKCA 3DL1A 1YJ9T 2KY9A 1QVFS 3JCMQ 4ZN3A 4GLKA 2B8AA 4DOWA 3INZA 2X4WA 3V8KA 1V29B 3HRSA 3VYGB 4BI4A 1M90U 3BY7A 5CQXA 3CCVT 2DXCA 2AHJB 3OSSC 2VV5A 5KCHA 1YJNT 3X24B 1M1KU 1G3YA 2H3JA 2RI5A 3L2WA 1YIJA 3OS5A 2EAYA 2KMTA 2ZCFB 2QQRA 4C8QA 3CCLT 1YHQT 3JSCA 3CMEA 3A8MB 2EFIA 3HPWA 1JRIA 4XTXA 4XTYA 3HRUA 1UEBA 1VQ5T 1N6AA 1Y96B 2XDBA 4C8QC 3CC2A 5FU7B 2GFAA 5GAMd 1N27A 2MF2A 1DJ7B 1LOJA 2QQ8A 5EJCA 1E7PA 5EG2A 4C8QD 2KVQG 5GAMg 2CZ6B 4MZPA 4C8QF 1X75C 2E70A 3BDUA 2ZPIB 3FRNA 4BUGA 3CCUT 4M77C 3ASKA 5CIUA 4X34A 2EJFA 2RHUA 4ZN1A 3VUZA 1Q82C 1M1FA 1I81A 2HBPA 5CVIA 3G4SA 5CK9A 3PTAA 3DKMA 1D3BA 1QP3A 3META 2P0KA 2XIDA 5GAOn 2GQVA 4P5NA 2M1HA 4IUPA 4LDWA 3FJPA 3CCQT 2PQWA 5LJ5j 4DA4A 3RESA 3C94A 3QSUA 4HCBA 4L6V5 4M7AG 1UB4A 2KR6A 1I8FA 1Q81U 1BIAA 1SSFA 1VQ4A 4M78A 4N4IA 1YCYA 2LQ8A 2V8JA 3M59A 2PUKB 3Q1JA 3RUXA 4TVRA 4A4FA 2DPPB 4EMKB 4M78C 5GMKh 2Y4XA 2DAQA 3E9FA 3RERA 3A8GB 2MMPA 3KHIA 4XU1A 3OYDA 2KSSA 3CPWA 3JB9D 2E6NA 4M6VA 3JB9F 2K5FA 3CMET 1ZBXA 4E7IA 4OP0A 1YBYA 2IG0A 5A0GA 3JB9J 3GNFB 3CC2T 2E65A 1QVPA 3MCAB 4NL3A 1W2BA 1GXIE 1KQ1A 1Q86C 5GANj 4M75C 3KBGA 4C5GA 3OQ5A 1KC8U 2JTFA 2VXFA 5CAIA 5GAMf 1XNIA 3H4CA 1VIFA 4OB0B 1QVGS 3E1SA 4PJOA 4XQ3A 3C95A 2RJEA 5GAMh 2E1HA 3X20B 2QDJA 4YTLA 3OYGA 1IZ6A 3I55T 3TW7A 1LNXA 3CD6A 2BIVA 2QQ9A 4PJOC 1I4K1 2LNVA 4HNVA 4JRKA 4M77G 2M16A 3L1AA 2K4YA 5I2MA 5HK3A 4LD9K 3BDLA 2DXCB 3CBMA 3CBPA 3WVEB 3S3MA 1BI3A 1VQ4T 1W4SA 1M8VA 3M5AA 2RHIA 5GMKl 4Z6YA 4XTVA 4C8QB 4DQ2A 3X28B 4X9CA 4FT2A 3FC3A 3UWNA 1JJ2S 3GF5A 2RD1A 3QYEA 3QJYA 3HZJA 1P92A 2WSCE 5CKHA 1VQLA 2O01E 2VXEA 2OTJA 3CCVA 4MZMA 4A53A 3BFMA 2DTOA 4AI6A 1YJNA 4BACA 3PIPA 2ZZDA 4MMKA 3QDRB 5DLQE 3JB9G 2XHCA 4C8QE 2RJFA 3CCMA 1H641 4M78G 3CCLA 1YHQA 1G3TA 1XQHA 4KULA 4N4HA 4C5HA 3CBOA 3HBLA 2JVVA 1D3BB 2DKGA 4JRIA 4LD6A 3QUIA 4M77E 1PSEA 2K5IA 3E9GA 1K8AU 4A4GA 3GLXA 5GAOl 3RIRA 3GOXA 1VQMA 4M7AA 4FSXA 4NC6A 3J7AF 1N8RC 3OA6A 3JCMJ 2DIQA 2MWPA 4CI0C 5A2QE 4M7AC 1O9SA 2WSFE 4J7FA 4M75G 3QIIA 4MZTA 3RKXA 2MAMA 1XTDA 4N0AA 2LRQA 4M7AD 2XDPA 5CCAA 5KE2A 2DZ9A 4M7AF 3X26B 3CXCS 3FEOA 2CGHA 3OYYA 4BE2A 3OBYA 3JCMb 1QVFA 1AHJB 4IURA 4N0AC 2YLBA 1M1KC 2OTLT 3OYMA 1Y07A 2DK3A 3OBWA 3OYAA 4FL6A 4PJOG 4OB1B 1M1GA 1JBMA 4C0DC 2PVGB 4M78E 4ME7A 4AKIA 1VQ7A 3A8LB 3VUBA 1VQLT 5J26A 1Y71A 4R56A 1YJWT 2QDYB 4XTZA 2OTJT 4JJNK 3MEWA 1JB0E 2P0QA 3EAEA 3CCEA 3SD4A 2F69A 1LJOA 5LJ3j 1ZQ1A 1WPYA 4ELJA 3I56A 1KQSS 4IUQA 5HK0A 3CMAA 4PLLA 2XICA 3L42A 4EMGA 2G3RA 4A4EA 4J6YA 2VUBA 4Q5WA 2EQJA 5IN1A 1O75A 4M75E 1N9SA 4HNUA 3L2RA 4C92C 4C5EA 1S72T 1IREB 2NLUA 5GAMj 3M57A 4FT4A 4QSHA 3OMCA 4HKEA 4M77A 2WACA 3DLMA 2LTOA 3JCMV 2M9UA 4IUTA 3JCMc 5FLXE 2JN0A 2DXBA 3M9QA 4JRQA 1VQMT 3QPHA 5GMKi 3T9NA 3MEAA 1WNLA 3FLGA 2E5QA 2DXTA 3QG1A 3RKYA 1QW1A 1BI1A 2EJGA 2HD0A 3OS0A 1NJIC 4M7DA 4PJOE 1Q81C 4M77D 5CKEA 1VQ9T 3OYKA 1OZ2A 2GFUA 4M77F 3SDZA 5GMKm 3L2VA 1OZ3A 3G71T 2QEXT 2HNIA 2OAUA 3PMIA 3I55A 4M7DC 4A4KA 3MEVA 4C0ZA 2PVDB 2R5MA 5D6WA 1I5LA 2MI6A 2L3RA 2KDSA 1G3SA 2X35A 4L59A 2E41A 2FB7A 3NTHA 2JOYA 1VQKT 2EQMA 3NFCA 2DIGA 5D6YA 3MHXA 2RK2A 4MIMA 1U1SA 4RG8A 2BKDN 3MO8A 2ZPHB 3ZBDA 4QW2A 4HNTA 5LJ3e 1KD1C 2HAXA 3CCET 3V8JA 3A5ZB 2ZPGB 1HXDA 3JCMe 3I56T 2RH2A 3CMAT 2D0QB 4M78D 4M78F 3CPFA 5GAOm 4RG2A 2RA2A 4M7AB 3SWNA 3OYLA 4WF2A 3QWLA 2LCCA 3TU4K 4M75A 2QTXA 3EFSA 1Q82U 4RKUE 3SWNC 4B9WA 3CCMT 3SB2A 2G77A 3FB9A 2CZ7B 3TEEA 3RKWA 3MEUA 1BYMA 1NZ9A 2BS2A 2DXUA 3HHTB 4M7AE 4M75D 5CKDA 4C0DB 4IKFA 4M75F 5LJ5e 1OYXA 4C92G 4HL4A 1RL2A 3OW2A 2JTMA 4ZGJB 3QBYA 2XKOC 3VKGA 3OYEA 2K57A 3OSVA 4IUVA 4XU2A 4A4HA 3VKIA 1KQ2A 2O4XA 3VYGA 3X25B 2VYTA 2F5TX 3FDRA 1NPRA 1JJ2A 1FXXA 3QHSA 4PJOD 3GNGA 4HT9A 4PJOF 2XDDA 3CPWS 2DJZA 1WQ7A 3CCRT 1VQOA 3BW1A 2OTLA 2QQBA 3HRTA 4M7DG 2CZ1B 4MMLA 1UGSB 4B9XA 3OYFA 1Y7XA 3A8OB 4ZGDB 3HB9A 1EIFA 4BE0A 1K9MU 1FX7A 1QP2A 4JRPA 3EFRA 2E12A 3A8HB 2ZPFB 2L89A 4BB7A 2RJDA 3QYHB 2I2LA 4M77B 1FWZA 4R55A 2RI3A 4BY6C 5GAN2 1K8AC 1H3ZA 1NE8A 4C92E 3QXEB 5GANe 1MHNA 2MWOA 3J81E 2JZ2A 3V8LA 4E47A 4LOCA 5C6SA 4OF1A 2QQAA 5J39A 2R58A 1S72A 2QFZA 3CC7T 2QA4A 1MGQA 2K3XA 3PIOA 3G6EA 4O5VA 1VQ8A 3LH0A 4ZGEB 1B34A 2X4JA 3CCJA 2LX9A 4JS5A 4FIBA 4UC4A 4BD3A 4X9DA 1BIBA 2XU8A 4MFEA 2A7YA 2P4TA 3TW6A 2QI2A 4O6JA 4C0FA 4M7DE 1PSFA 3P8BB 4OGCA 4QQGA 2FL7A 5IAYA 4M78B 4KBMB 3URGA 3CEYA 5A0LA 4BDZA 4XTWA 1VQ9A 2WJ9A 4XK8E 3JB9H 1M90C 3QYGB 1WQWA 3G71A 2QEXA 5GAN6 5GAN8 1Q7YU 4RMOA 5GMKj 3RMSA 5FROA 2C06A 3RMQA 1VQOT 3OYHA 2PUOB 2D9TA 2PU9B 2RK1A 5FU6C 3UDCA 4XAXB 2QF7A 5KCOA 1K73U 3OS2A 3WVDB 3HP9A 1WJQA 3PNWC 4OGEA 4PNOA 4RCCA 5LL6S 4DOVA 2CKKA 1VQKA 5IT9E 2LDMA 4OVAA 2DD5A 4BBRM 2V8KA 2F5KA 4BBSM 4EMKC 2KMGA 3BG5A 4M75B 3ER0A 4V2SA 3PMTA 1M9SA 4KT0E 2BS3A 1R8OB 3WXMB 2WSEE 3JCMX 4II1A 4C92A 2IVWA 3DB3A 3PGGA 2CYZB 2DZCA 5KH6A 1FKMA 5CR2A 3E19A 5FRNA 2CZ0B 4Y91A 3CCST 5DM7R 1VQNT 1N8RU 2GCXA 4MDXA 1BI0A 4PJOB 3QJ6A 3C12A 4PL6A 3JAME 2E6ZA 3G6ET 4Z02A 3GPLA 2QA4T 1VQ8T 3G7ZA 2D6FA 2VGNA 2L5QA 2O4XB 4C92D 3CCJT 3DLLA 3OYCA 4C92F 3L2UA 2LQKA 4E7LA 3LWHA 3HSBA 1VIEA 4J7IA 2RM4A 3LYIA 3O8VA 4JDSA 5C0MA 3CC4A 5M9OA 5GAOr 5LJ3d 4L5GA 5GMKe 3LGLA 4EMHA 1KG1A 4A54A 3N5BB 5LJ3g 3PT9A 2LC4A 2YHTA 3V7SA 2JNGA 5AYFA 1WJRA 3V7CA 3JCMd 3MP8A 2YRVA 2ZPEB 2EKOA 3HKSA 1RI0A 2HQXA 5I21A 3JCMg 4BY6B 4BDYA 4M7DD 1BI2A 3S3NA 5D6XA 4M7DF 4EPCA 1VQ7T 4ZTJA 3CCRA 1WGSA 3VYHB 2ZZDB 3VJPA 4F7UA 3PFSA 2RO0A 5DLOA 3JB9I 3P8HA 5FRMA 2LT1A 2DD4A 4EDUA 1VQ6A 1OI1A 1XOVA 2LT4A 3QKJA 4KUIA 5DY9A 3VKHA 2ZPBB 4N4GA 2P0PA 5GAN4 4D6WA 3JCMW 3M56A 2DTIA 3TREA 4MDWA 1KC8C 4JX6A 3ZEHA 3SFMA 2EQUA 3LGFA 4F7UF 4J6XA 5GAMe 1B34B 4OB2B 3MP6A 4BI3A 5LJ5d 4J8OA 2RB6A 1VQPA 5LJ5g 3P8DA 2XD0A 2BUDA 3M53A 4Y28E 1NJIU 2L8DA 1QVGA 3AHUA 2VC8A 1M4ZA 2X4XA 5I2SA 4C5IA 3QYBA 2R5AA 1BKBA 3TCJA 4JX5A 2K2VA 1UGQB 2K3YA 4JUVA 3GIBA 3OS1A 3CC7A 4HLQA 3F70A 5FU6B 2KK4A 1UGRB 1TH7A 3ME9A 3KXTA 5CKBA 2EJ9A 3CC4T 1YI2A 1KHIA 3FIFA 3HO8A 1YIJT 1X01A 4NS5A 3OYIA 1M5Q1 4HA8A 2EQKA 3OYNA 4HT8A 5GAN7 4AKHA 1ZHIA 3GP8A 3S3OA 2DD5B 3QZ5B 3LLRA 1KD1U 1K9MC 5LJ3f 3HFOA 4JX4A 3LX7A 4J5YA 5GAOq 4FU6A 1NPPA 4ELYC 4QQ6A 3OY9A 4E7KA 1VUBA 5LJ3h 3JCMf 3M58A 5GANd 1WJSA 2QXFA 4ELZC 1VQ6T 2DEQA 4C92B 3OYJA 4LDXA 3M4GA 1QLBA 3H8ZA 3JCMh 5GANg 3OYBA 4QQDA 1YITA 3VU3C 2FHDA 2LVMA 3H6ZA 4C8QG 3G4ST 1YJWA 1W2BS 4QVDA 3LWIA 1Y96A 4LDUA 1U1TA 2HQEA 3M55A 5GAN3 3UT1A 1Q86U 2KAFA 2Y90A 1X6OA 2DXBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXB A;  2PUO B;  2PU9 B;  3A8G B;  3WVD B;  2DD5 A;  4FM4 B;  2PVO B;  4KT0 E;  2PVD B;  1GXI E;  2WSE E;  3QZ9 B;  2CYZ B;  1UGP B;  2CZ0 B;  4OB0 B;  2ZPH B;  2DD4 B;  3X20 B;  4OB3 B;  2ZPG B;  2D0Q B;  2DXC B;  3WVE B;  3LW5 E;  3X28 B;  5L8R E;  4RKU E;  2ZPE B;  2WSC E;  2CZ7 B;  2O01 E;  3HHT B;  3VYH B;  2ZZD B;  2ZZD A;  4ZGJ B;  2DD4 A;  1V29 B;  2ZPB B;  3VYG B;  3VYG A;  3X25 B;  2DXC A;  1PSE A;  2AHJ B;  3X24 B;  4OB2 B;  2ZCF B;  2CZ1 B;  1UGS B;  4Y28 E;  3A8O B;  4ZGD B;  3A8M B;  2WSF E;  1QP2 A;  3A8H B;  2ZPF B;  1UGQ B;  3QYH B;  1UGR B;  3X26 B;  1DJ7 B;  1AHJ B;  2CZ6 B;  2ZPI B;  3QXE B;  4OB1 B;  2PVG B;  3A8L B;  2DD5 B;  3QZ5 B;  1QP3 A;  2QDY B;  1JB0 E;  4ZGE B;  4L6V 5;  1PSF A;  4XK8 E;  2PUK B;  1IRE B;  3QYG B;  2DPP B;  2DXB B; 
#chains in the Genus database with same CATH topology
 2CH4 W;  2AIR B;  3MP1 A;  1PWT A;  2MIO A;  4F7U G;  3M0Q A;  5LJ5 f;  2O88 A;  1VQN A;  1PCX A;  1W1F A;  4FM4 B;  4JLI A;  2KQW A;  2LCL A;  3C4S A;  1HK9 A;  5LJ5 h;  1G3W A;  1I1J A;  2BZ8 A;  1Q7Y C;  2O9V A;  2E64 A;  1TUC A;  2W10 A;  2CP6 A;  2RJC A;  4BCJ B;  2EQI A;  2A3L A;  4JS4 A;  2Z0W A;  3JV3 A;  3KUF A;  5CKF A;  2R57 A;  4OB3 B;  1X69 A;  2IPO B;  2EIF A;  2F1L A;  3ULR B;  3BG3 A;  1VQ5 A;  3M54 A;  1YCS B;  1M27 C;  1ZSZ A;  2GF7 A;  4KUD K;  4E7J A;  3M4Y A;  3NTI A;  2DO3 A;  1YIT T;  4F7U E;  4J9G A;  5KE3 A;  2RHX A;  5L8R E;  4LDY A;  1K4U S;  4RTU A;  1RAE B;  1KQS A;  2CP0 A;  2D1X A;  2BPM B;  3QO3 A;  2KEA A;  2KY9 A;  1QVF S;  4GLK A;  4DOW A;  1UGV A;  3INZ A;  3V8K A;  1M3B A;  1OU9 A;  1RLQ C;  3CCL Q;  4OML A;  2DXC A;  3X24 B;  1QWE A;  2UZB B;  1YIJ A;  2BKZ B;  3OS5 A;  2QQR A;  1MMA A;  4BCN D;  4CC4 B;  3CCL T;  4EC8 B;  4XTX A;  1UEB A;  4C8Q C;  3VRZ A;  2GFA A;  1LOJ A;  3D7S B;  1E7P A;  4MZP A;  4C8Q F;  1IO6 A;  1D09 B;  2ZPI B;  3CCU T;  4X34 A;  1IHW A;  2EJF A;  3M03 A;  1AWO A;  1I81 A;  2HBP A;  3G4S A;  3PTA A;  1QP3 A;  1N5Z A;  1M2V A;  2HZY A;  2F2W A;  2DNU A;  2GQV A;  4LDW A;  5LJ5 j;  4DA4 A;  2QTV A;  4CRL B;  1LCK A;  1RI9 A;  3CCE Q;  5EC7 A;  4L6V 5;  1WX6 A;  2KR6 A;  3RNJ A;  1Q81 U;  4FCY A;  4M78 A;  2HSP A;  1JST B;  2CP7 A;  1WYX A;  3Q1J A;  1UJY A;  1C1A A;  1ZBJ A;  3E9F A;  3RER A;  4HVW A;  3JB9 F;  1OGU B;  2L0A A;  1UE9 A;  1YP5 A;  5IDP B;  1F1B B;  1W2B A;  4PJM A;  1Q86 C;  1QKX A;  3I55 Q;  2EVR A;  1K0X A;  2JTF A;  2VXF A;  1VIF A;  2PTK A;  2RJE A;  1ZA2 B;  2E1H A;  1OPK A;  3CCR Q;  3I55 T;  4RTV A;  2QQ9 A;  3EHR A;  4HNV A;  2K4Y A;  3BDL A;  4AFS C;  1D0Y A;  1BI3 A;  3G1J A;  3X28 B;  1NYF A;  3QYE A;  5EFQ B;  2ECZ A;  1VQL A;  1GUX A;  2VXE A;  2OTJ A;  2DEU A;  3CCV A;  4BCO B;  4A53 A;  3BFM A;  1OX9 A;  2JGZ B;  1BCO A;  5DLQ E;  5HQ0 B;  1H64 1;  2I40 B;  2KE9 A;  4CXA B;  2LZ6 B;  3TNH B;  1YHQ A;  3H0I A;  8ATC B;  2X3W D;  2YRD A;  1IHV A;  3QUI A;  3POM A;  2QDL A;  3VS4 A;  1K8A U;  4M7A A;  1HJD A;  2OJ2 A;  3I35 A;  4FSX A;  2RPN A;  1E9H B;  1K73 R;  3J7A F;  1VQO Q;  4MZT A;  3RKX A;  3O0G D;  2JS0 A;  4N0A A;  2LRQ A;  2DZ9 A;  2DL4 A;  3CXC S;  4F7S B;  3MY1 B;  3OBY A;  3JCM b;  1U06 A;  4IUR A;  2YLB A;  2C5N B;  2GQI A;  4PJO G;  1PHT A;  1HD3 A;  4LN2 A;  4ME7 A;  4AKI A;  3A8L B;  3VUB A;  4R56 A;  3QWX X;  2QDY B;  2HMA A;  4XTZ A;  2ED0 A;  3MEW A;  2P0Q A;  4EOL B;  2F69 A;  3BHU B;  1WPY A;  4ELJ A;  3L42 A;  4EMG A;  2G3R A;  1NLP C;  2VUB A;  2AZV A;  1N9S A;  2NLU A;  1XO2 A;  3M57 A;  3OMC A;  2LX7 A;  5FLX E;  3CCM A;  2J05 A;  3JCM c;  4JRQ A;  3M9Q A;  3EGU A;  3NDQ A;  1WHH A;  2E5Q A;  1BI1 A;  1NJI C;  3BLR B;  4PJO E;  2WMB B;  1RLP C;  4M77 F;  4CFU D;  1VYV A;  3MEV A;  1SSH A;  2R5M A;  2MI6 A;  4LE9 A;  2GTO A;  4L59 A;  2E41 A;  1M3C A;  2FB7 A;  2X3X D;  2JW4 A;  3ZBD A;  4MIM A;  3MO8 A;  2CT3 A;  2ZPH B;  2ZPG B;  1BB9 A;  2EGA A;  2X9H A;  2FPF A;  2RH2 A;  4JJB A;  2LJ3 A;  4M78 F;  4E7S A;  2RQR A;  4FX3 B;  5ACB A;  5KYU B;  1KK7 A;  2EKH A;  4M75 A;  3TU4 K;  3FJ5 A;  1KD1 R;  1RAC B;  2CZ7 B;  3TEE A;  2J06 A;  1SHF A;  4C0D B;  4J9I A;  1OYX A;  4ZGJ B;  3VKG A;  3OYE A;  4CC7 A;  3I5S A;  3QHW B;  2A0F B;  4EOQ B;  3VYG A;  1VQ6 Q;  3X25 B;  1Y0M A;  1TWB A;  2F5T X;  1NPR A;  1JJ2 A;  1UTI A;  4FYW B;  2XDD A;  4HT9 A;  4GLM A;  1QVG P;  3BW1 A;  2FEI A;  2FZG B;  2CZ1 B;  2COY A;  3NGP A;  3A8O B;  4BE0 A;  1QP2 A;  4JRP A;  3EFR A;  2X51 A;  1H3H A;  2L89 A;  4BB7 A;  2HL5 C;  4EC9 B;  4IIM A;  4BY6 C;  1SRL A;  1NE8 A;  5GAN e;  2JZ2 A;  1UEC A;  4YC3 B;  4LOC A;  5C6S A;  2C0T A;  2QQA A;  4RTX A;  2QA4 A;  2YXY A;  2K3X A;  2E3I A;  2LW4 A;  3G6E A;  3TVT A;  2BTT A;  1PKS A;  3CCJ A;  3DOG B;  4X9D A;  1BIB A;  2XU8 A;  4D8K A;  3U23 A;  3TW6 A;  2ROL A;  2FL7 A;  1QVF A;  1VQ9 A;  3JB9 H;  3G71 A;  5GAN 6;  2QGG A;  1Q7Y U;  4RMO A;  5GMK j;  3RMS A;  2PUO B;  2RK1 A;  2AKL A;  3A98 A;  2CP2 A;  3HP9 A;  4RCC A;  1VQK A;  5LL6 S;  2DD5 A;  2V8K A;  4V2S A;  3BG5 A;  2KRN A;  1ENW A;  1JXM A;  1VQN Q;  2HKQ B;  3EFO B;  4PK4 A;  1UNH D;  3O5Z A;  3HTR A;  2M02 A;  4II1 A;  4C92 A;  2IVW A;  3PGG A;  4E7Z A;  5CR2 A;  3E19 A;  2WIH B;  2CZ0 B;  4PJO B;  1VQN T;  1BI0 A;  1VQ8 T;  3EG0 A;  1AWX A;  1A0N B;  2C5X B;  3OYC A;  3EG1 A;  2EBP A;  1VQ5 Q;  5GMK e;  2DBK A;  4A54 A;  2YUO A;  3PT9 A;  2JNG A;  3JCM d;  3EH1 A;  3V7C A;  1KQS P;  3MP8 A;  2ZPE B;  1KJW A;  1RI0 A;  1RAB B;  3JCM g;  4BDY A;  5LQF B;  4GBQ A;  1WGS A;  5HBE B;  3VYH B;  3VJP A;  4F7L B;  1OI1 A;  2LT4 A;  3QKJ A;  5DY9 A;  2AKK A;  4N4G A;  2DME A;  4EIK A;  4EOK B;  3DDP B;  3EG2 A;  2FO0 A;  1OEB A;  4F7U F;  3LGF A;  5GAM e;  5FGK B;  4BI3 A;  1VQP A;  3P8D A;  1LVK A;  2BUD A;  1YIJ Q;  1M4Z A;  2CSI A;  5I2S A;  4C5I A;  2R5A A;  3GIB A;  2L3S A;  5CKB A;  1YI2 A;  1YIJ T;  4NS5 A;  1M5Q 1;  2W9F A;  1UFF A;  3QZ5 B;  1VYU A;  3S3O A;  2C5V B;  5LJ3 f;  1JU5 C;  5GAO q;  4JX4 A;  3G4S Q;  3UA7 A;  4ELY C;  4QQ6 A;  5LJ3 h;  2NUP B;  2PK9 B;  4R0K A;  3VU3 C;  2FHD A;  2LVM A;  3G4S T;  1W2B S;  4OGR B;  2JM8 A;  1K1Z A;  4LDU A;  1Q86 U;  1X6O A;  2AK5 A;  2M51 A;  2JUF A;  2YLC A;  5AT1 B;  4J6W A;  2K5L A;  1OL1 B;  4QVC A;  2JTE A;  3OW2 S;  5CO7 A;  4VUB A;  2RHZ A;  4F6S B;  2EPD A;  1GRI A;  1YJ9 A;  4LXC A;  2PVO B;  3HL8 A;  1B07 A;  4BE1 A;  1WHK A;  1O9K B;  4PLI A;  3M0R A;  5KYX A;  1E6G A;  2Y4Y A;  4BCK B;  4I3Z B;  4BY1 X;  3CXC A;  1OV3 A;  2MOX A;  3TNI B;  2M0O A;  3NTK A;  1K73 C;  4YOZ A;  3UA6 A;  3VS7 A;  2XI9 A;  5A0D A;  1U8R A;  1WXT A;  4EMK A;  3EJ1 B;  3V7R A;  3HFN A;  4XU0 A;  4PKC C;  4LUD A;  4CRI A;  3C0C A;  2DYI A;  1ZUK A;  2IW6 B;  2EWN A;  2FVU A;  1X6B A;  5HY6 A;  3ZFJ A;  3DB4 A;  2ABL A;  2DVJ A;  2RI2 A;  1VQL Q;  4ATO A;  3CCQ A;  2OTJ Q;  4D8D A;  2J6K A;  3CCV Q;  3DL1 A;  4ZN3 A;  5FWC A;  1V29 B;  3TNW B;  2JMA A;  1YHQ Q;  2JT4 A;  3CCV T;  2CP3 A;  3OSS C;  1IB8 A;  2VV5 A;  5KCH A;  1G3Y A;  2W99 A;  2C4G B;  2KMT A;  5L23 A;  4J9B A;  4C8Q A;  1YHQ T;  3JSC A;  2CH4 A;  1E7O A;  3HPW A;  2I0N A;  4XTY A;  3NPF A;  4RTY A;  2XDB A;  1B7T A;  3CC2 A;  5FU7 B;  1DJ7 B;  2FRW A;  5EG2 A;  2CSQ A;  2CZ6 B;  1JQQ A;  1W6X A;  2E70 A;  3BDU A;  4BUG A;  3VUZ A;  2DET A;  4K11 A;  5GAO n;  3MET A;  2XID A;  2M1H A;  3FJP A;  1MMG A;  2YUQ A;  2DFU A;  3C94 A;  1AOJ A;  5DQW A;  1GBQ A;  4M7A G;  5IDN B;  2RMO A;  1MV3 A;  4B6M A;  2CCI B;  4N4I A;  2V8J A;  3M59 A;  4OMM A;  1Q82 R;  4A4F A;  1PKT A;  3A8G B;  2MMP A;  3KHI A;  2P4R A;  1ZSZ B;  3CCM Q;  2K5F A;  3CME T;  4E7I A;  3M0P A;  1K0S A;  1JEG A;  4OP0 A;  2K2M A;  4BCP B;  2IG0 A;  3JB9 J;  2E65 A;  1WIE A;  1WFW A;  1X6G A;  1KC8 U;  2R7G A;  4Z89 A;  5DQV A;  2PHG A;  1GFC A;  3E1S A;  4XQ3 A;  2OAW A;  4PFP A;  2WFY B;  2BIV A;  4PJO C;  1ZUY A;  2EYW A;  2GNC A;  3RBB B;  5HK3 A;  2DXC B;  3S3M A;  2G9X B;  1VQ4 T;  4KRT A;  3EID B;  3M5A A;  5GMK l;  4Z6Y A;  3M0U A;  2CCH B;  1CKA A;  3FC3 A;  1JJ2 S;  1JXO A;  5CKH A;  2WSC E;  2EGC A;  2NYS A;  1RAA B;  4IMY B;  1ACM B;  4AI6 A;  2DTO A;  5KYW B;  3MPU B;  4QT7 A;  2XHC A;  1ARK A;  1TS9 A;  1XQH A;  4C5H A;  3CBO A;  4EOP B;  1YFN A;  3QDF A;  1UJ0 A;  1OIU B;  4AG1 C;  3GLX A;  1VQM A;  3GOX A;  2PK2 A;  3JCM J;  2MWP A;  4CI0 C;  4M75 G;  1NLO C;  3QII A;  3R6N A;  1VOL A;  2DIL A;  5KE2 A;  1JKW A;  1QWF A;  2KR3 A;  2DA9 A;  3OYY A;  1FVV B;  1AHJ B;  2NWM A;  1PNJ A;  4RTZ A;  3OYM A;  2AZS A;  3EOC B;  2J7I A;  4OB1 B;  1VQ7 A;  2GBQ A;  1N8R R;  1Y71 A;  1JB0 E;  4KGZ B;  2A08 A;  4ELL A;  1LJO A;  2QA4 Q;  3G6E Q;  3SEM A;  3I56 A;  4IUQ A;  1QVF P;  3CMA A;  4PLL A;  2XIC A;  5IH2 A;  3CCJ Q;  1V1C A;  1ZX6 A;  5I11 A;  1O75 A;  4M75 E;  4F17 A;  4LUE A;  3L2R A;  1IRE B;  4IIO A;  4M77 A;  4FT4 A;  1VQ9 Q;  3DLM A;  2LTO A;  4IUT A;  3G71 Q;  2JN0 A;  3TSZ A;  5GMK i;  3T9N A;  1WNL A;  3FLG A;  1ZUU A;  2O2O A;  2QG9 B;  3EG3 A;  3RKY A;  2EUF A;  3MKD A;  1VQ9 T;  5CKE A;  1OZ2 A;  1VQK Q;  1OZ3 A;  3G71 T;  1Q95 G;  2M0Y A;  2KYM A;  3H9N A;  5D6W A;  1TUD A;  2L3R A;  2C5O B;  2X35 A;  1VQK T;  3NFC A;  3MHX A;  3TSW A;  2E4H A;  4QW2 A;  4HNT A;  3CCE T;  3A5Z B;  1HXD A;  1JO8 A;  3EGX A;  1H27 B;  2VVK A;  4M7A B;  3SHW A;  3OYL A;  5KYY B;  3BHT B;  3QWL A;  2DF6 A;  4CC2 A;  1FMV A;  1J3T A;  4YOS A;  5FW9 A;  2BS2 A;  2DXU A;  3EH2 A;  2D0N A;  3EHQ A;  5CKD A;  5LJ5 e;  4C92 G;  4DBF A;  4ROE A;  4HL4 A;  1G83 A;  3OW2 A;  2JTM A;  3QBY A;  1D1C A;  2K57 A;  4A4H A;  2MCN A;  2VYT A;  1UNL D;  4PJO D;  1G3N C;  3CPW S;  3CCR T;  3HRT A;  4M7D G;  4MML A;  1UGS B;  3VS2 A;  1VQP Q;  4ZGD B;  2NUT A;  1U3O A;  3EGD B;  2ROT A;  4C92 E;  3QXE B;  1YI2 Q;  1MHN A;  3J81 E;  4E47 A;  4E2F B;  1MND A;  5J39 A;  1UDL A;  4O5V A;  3LH0 A;  4ZGE B;  1B34 A;  2X4J A;  4UC4 A;  4MFE A;  2QI2 A;  4C0F A;  4M7D E;  3P8B B;  4OGC A;  4QQG A;  4BDZ A;  5A0L A;  4XTW A;  2WJ9 A;  3QYG B;  2GTJ A;  5FRO A;  1VQO T;  2PU9 B;  5FU6 C;  2QF7 A;  1K73 U;  3OS2 A;  4DOV A;  1WJQ A;  4OGE A;  2KXD A;  3EG9 A;  2JS2 A;  1RAH B;  3REB B;  4BBR M;  4BBS M;  2KMG A;  1ZSZ C;  4M75 B;  3PMT A;  3VRY A;  1OKV B;  1X2K A;  3CXC P;  1YJ9 Q;  2BS3 A;  4AT1 B;  1H25 B;  1M90 R;  4G6L B;  4WTO B;  5KH6 A;  5GJW B;  1M1K R;  4J9D A;  4E6R A;  5DM7 R;  4MDX A;  1X43 A;  3GPL A;  5FWB A;  4ESR A;  4Z02 A;  2V26 A;  3L2U A;  2B86 A;  1VIE A;  4J7I A;  2KGT A;  3CC4 A;  4L5G A;  5I22 A;  2J6F A;  4OMQ A;  2ENM A;  2G6F X;  2YRV A;  2IW8 B;  4OMP A;  1ZP2 A;  5I21 A;  2CP5 A;  2KRM A;  1IRX A;  2ZZD B;  4F7U A;  2RO0 A;  3JB9 I;  3CCQ Q;  3B57 A;  2CT4 A;  5FRM A;  2LT1 A;  2DD4 A;  4EDU A;  1C6V X;  2WEV B;  7AT1 B;  5GAN 4;  3PE0 A;  3I9Q A;  4D6W A;  1KC8 C;  5IHY A;  2EQU A;  4OB2 B;  4J8O A;  2DL3 A;  3LH5 A;  3H0H A;  4Y28 E;  2L8D A;  2VC8 A;  2X4X A;  1GL5 A;  2ESW A;  3QYB A;  3TCJ A;  2RF0 A;  1UGQ B;  2K6D A;  2LQN A;  2H3E B;  3FIF A;  3CC2 Q;  3OYI A;  3KFV A;  1ZHI A;  2DD5 B;  3UAT A;  1KD1 U;  3HFO A;  4J5Y A;  4FU6 A;  4E7K A;  1B3Q A;  2KT1 A;  3JCM f;  4CFV B;  5GAN d;  1VQ6 T;  4C92 B;  4LDX A;  1QLB A;  5GAN g;  3JCM h;  3OYB A;  1YIT A;  2L3P A;  3H6Z A;  4C8Q G;  2F2V A;  1AIS B;  1Y96 A;  3THK A;  2RQW A;  2A36 A;  2HQE A;  3M55 A;  2HDA A;  2Y90 A;  4KRC B;  2DXB B;  1EFN A;  1H24 B;  5CQY A;  4ANJ A;  3CQT A;  3L2Q A;  4FW2 A;  2KRS A;  2W9Z A;  3BG9 A;  4J83 A;  4JLG A;  4M7D B;  3CCS A;  1NM7 A;  1S1N A;  4LDV A;  2V8I A;  4LD9 K;  3OMG A;  4ZTF A;  4XU3 A;  1KHC A;  2K79 A;  3QZ9 B;  3BLH B;  2D8J A;  4MFD A;  2HEQ A;  4AFQ C;  1UGP B;  1WHL A;  2CS7 A;  4NOY A;  4HCC A;  2DER A;  4HXJ A;  1SKU B;  4IUU A;  2FYK A;  2VGM A;  4NL2 A;  5IXB A;  3VV0 A;  4CFM B;  1X27 A;  3SWN B;  1TOV A;  2DL7 A;  1EZZ B;  1KFZ A;  1UHC A;  1N9R A;  3CCU A;  2XMF A;  3LW5 E;  3RR6 A;  2EYZ A;  2DX1 A;  4XTU A;  4QVZ A;  4ZNX A;  3JCM P;  3UPU A;  1H8K A;  1OL2 B;  4OR5 B;  2IW9 B;  2E10 A;  3OB9 A;  2CUB A;  3JCM Q;  2CRE A;  2B8A A;  3I5R A;  4BCH B;  4ORZ A;  1URC B;  4BI4 A;  2JMC A;  2KRO A;  3BY7 A;  5CQX A;  5IXF A;  1AWJ A;  1R0C B;  1JOW A;  1GCQ C;  2RI5 A;  3L2W A;  1VQM Q;  2L3Q A;  1T0H A;  2EFI A;  1TFB A;  1JRI A;  1VQ5 T;  1NEB A;  5GAM d;  2MF2 A;  2UUE B;  2QQ8 A;  5GAM g;  1HSQ A;  3ASK A;  5CIU A;  2CJM B;  2LP5 A;  5CK9 A;  2V22 B;  1D3B A;  2P0K A;  4IUP A;  1AZG B;  5KYX B;  4FYV B;  1T3S A;  3I56 Q;  2V1R A;  1SSF A;  3CMA Q;  4PJL A;  4J9C A;  2AT1 B;  4JPB W;  1YCY A;  2LQ8 A;  3M0S A;  4TVR A;  4EMK B;  1MNE A;  4CFW B;  1PD0 A;  1Z9Z A;  2QYZ A;  3CPW A;  2UZD B;  1QKW A;  2YUN A;  1IGU A;  2W0Z A;  2IVX A;  5A0G A;  2WPA B;  1BU1 A;  2K7A A;  4NL3 A;  1KQ1 A;  4M75 C;  4CFN B;  3OQ5 A;  1OQK A;  1OOT A;  4PJO A;  3C95 A;  3PVL A;  4YTL A;  3X20 B;  1IZ6 A;  5HBH B;  2FPE A;  1LNX A;  1K9M R;  3CD6 A;  2E3H A;  1I4K 1;  2LJ1 A;  4JRK A;  4M77 G;  4YOO A;  1YWP A;  2LNH B;  3CBP A;  3VS0 A;  3WVE B;  4Z8A A;  2EYY A;  1GY3 B;  1W4S A;  1M8V A;  1W2B P;  2RHI A;  4C8Q B;  1PD1 A;  4FT2 A;  1D1A A;  3UWN A;  3GF5 A;  2O01 E;  4MZM A;  1KSW A;  3OW2 P;  1YJN A;  4BAC A;  2V1Q A;  3PIP A;  4MMK A;  3QDR B;  2RJF A;  4M78 G;  1G3T A;  3HBL A;  2JVV A;  5KYN A;  4ROC A;  4LD6 A;  4M77 E;  3ZL7 C;  1PSE A;  2K5I A;  3E9G A;  1MUZ A;  5GAO l;  3RIR A;  1I0C A;  2D8H A;  3OA6 A;  4F70 B;  2DIQ A;  5A2Q E;  4AG2 C;  1O9S A;  2WSF E;  4J7F A;  2ED1 A;  1XTD A;  9ATC B;  4M7A D;  1ZLM A;  2PNI A;  3FEO A;  4AMC A;  4BE2 A;  1M1K C;  2HL3 A;  1Y07 A;  2DK3 A;  3OYA A;  1M1G A;  1JBM A;  2KNB B;  4C0D C;  2PVG B;  4M78 E;  5LMK B;  2RNA A;  3VS1 A;  1VQL T;  1JSU B;  2OTJ T;  1AEY A;  4HCK A;  3EAE A;  2BE7 D;  5LJ3 j;  1ZQ1 A;  5IHN A;  4Y92 A;  5HK0 A;  4A4E A;  4J6Y A;  2EQJ A;  5IN1 A;  4F7N B;  4C92 C;  4C5E A;  4BCG B;  2YT6 A;  2VB6 A;  2WAC A;  3MIA B;  2MPX C;  3MEA A;  3BLQ B;  2DXT A;  3QG1 A;  3OS0 A;  2HD0 A;  2FRY A;  1SEM A;  3SDZ A;  5GMK m;  3L2V A;  2HNI A;  2OAU A;  4M7D C;  4A4K A;  1SPK A;  4C0Z A;  2PVD B;  1C0M A;  3GTM S;  1G3S A;  3TQ7 P;  2DRM A;  2QK0 A;  4BCF B;  1P5E B;  4BI8 B;  2DIG A;  4J9H A;  4RG8 A;  5LJ3 e;  5ECA A;  1KD1 C;  1NJI R;  1ZSG A;  2D0Q B;  3CPF A;  4EON B;  4F6U B;  4AFU C;  4WF2 A;  1MV0 B;  2LCC A;  2WXV B;  3CC4 Q;  2QTX A;  3EFS A;  1Q82 U;  4RKU E;  3SWN C;  1WHG A;  3VS5 A;  3CCM T;  3SB2 A;  2G77 A;  1TUG B;  2YWW A;  3RKW A;  4M7A E;  1R77 A;  4M75 D;  1RL2 A;  4KGV B;  4XU2 A;  3M0T A;  3QHR B;  1PRL C;  1KQ2 A;  2O4X A;  1V76 A;  4F14 A;  1PKD B;  1TXQ A;  3QHS A;  1F5Q B;  3GNG A;  4PJO F;  2DJZ A;  1WQ7 A;  2OTL A;  4B9X A;  1TSF A;  1Y7X A;  2WMA B;  1EIF A;  1FX7 A;  3A8H B;  2ZPF B;  1AZE A;  1YN8 A;  2I2L A;  2DMO A;  4M77 B;  1UNG D;  1QMZ B;  1FWZ A;  5HVY B;  1H3Z A;  5GAN 2;  4DBQ A;  2X1N B;  2MWO A;  1FMW A;  1NG2 A;  4OF1 A;  1JJ2 P;  2LCS A;  1M2V B;  2R58 A;  1S72 A;  3VS6 A;  3PIO A;  1VQ8 A;  1YNZ A;  1RAF B;  1I07 A;  4BD3 A;  2DE0 X;  4EOJ B;  4O6J A;  4LNP A;  1PSF A;  5IAY A;  4M78 B;  4KBM B;  3CEY A;  5I5Z B;  4XK8 E;  1H92 A;  1YIT Q;  2QEX A;  4DEX A;  1AD5 A;  2C06 A;  3RMQ A;  4X1V A;  2D9T A;  3EGX B;  3UDC A;  5KCO A;  1VIN A;  2J6O A;  4EMK C;  3PNW C;  4PNO A;  4JZ3 A;  2CKK A;  1GH6 B;  2FZK B;  4FSS A;  3MY5 B;  3CCS Q;  1D0Z A;  4KT0 E;  1VOM A;  2WSE E;  3JCM X;  1FIN B;  2HKN A;  1FKM A;  2FZC B;  5FRN A;  4Y91 A;  3CCS T;  2I53 A;  1N8R U;  1XJW B;  3QJ6 A;  3JAM E;  2QA4 T;  3G6E T;  2COZ A;  2D6F A;  2RQT A;  2VGN A;  1SG5 A;  2L5Q A;  3VS3 A;  4C92 D;  3CCJ T;  2LQK A;  3LYI A;  1AT1 B;  5C0M A;  2EGE A;  5M9O A;  3LGL A;  4EMH A;  3V7S A;  2YHT A;  2A37 A;  3CCU Q;  2NUT B;  2EKO A;  1TG0 A;  2HQX A;  1GUX B;  4BY6 B;  2ZAE A;  4M7D D;  3S3N A;  5D6X A;  2B9R A;  2VKN A;  5KYW A;  2O9S A;  3PFS A;  3P8H A;  2YSQ A;  1D0X A;  1OKW B;  1Q81 R;  4KUI A;  3VKH A;  4DEY A;  4BCM B;  2BE9 B;  1WHM A;  3JCM W;  2CUD A;  3M56 A;  1GCP A;  3TRE A;  4MDW A;  4JX6 A;  3SFM A;  5LJ5 d;  4J6X A;  1B34 B;  2C0I A;  1UUE A;  2RB6 A;  5LJ5 g;  4TTH A;  3M53 A;  3REA B;  1BKB A;  4JX5 A;  2K2V A;  2K3Y A;  4JUV A;  3CC7 A;  3F70 A;  1UGR B;  1TH7 A;  3ME9 A;  3KXT A;  1X01 A;  1AVZ C;  1WXB A;  4HT8 A;  2EQK A;  3OYN A;  5GAN 7;  4F04 B;  4BCQ B;  2RQU A;  5D7U A;  1H26 B;  3EG9 B;  4HVU A;  3GP8 A;  1G8X A;  5IHI A;  2IN3 A;  1K9M C;  1NPP A;  4BCI B;  3M58 A;  8AT1 B;  5ICP B;  1ABQ A;  4ELZ C;  2DEQ A;  3OYJ A;  2YRC A;  4QQD A;  1OUL A;  2K9G A;  1YJW A;  3LWI A;  5CYI B;  1U1T A;  3UT1 A;  2KAF A;  3CPW P;  1VQP T;  1M2O A;  2LJ0 A;  5FU7 C;  1G5V A;  5J3B A;  2DTH A;  1LPL A;  3L2Z A;  2RHY A;  1CSK A;  2KT8 A;  2QQS A;  2UZL B;  4AKG A;  4GY5 A;  1H1P B;  1YI2 T;  3JRZ A;  2X4Y A;  1WDX A;  1RAI B;  1K8A R;  4NST B;  5GAO p;  2LMJ A;  3PVQ A;  4HCZ A;  4F7U B;  6AT1 B;  2DD4 B;  4RCB A;  3J80 E;  3R6O A;  1K76 A;  1FMK A;  2BS4 A;  2KBT A;  3CD6 Q;  2ZGW A;  2XG8 D;  3S6W A;  1RUW A;  2XK0 A;  5KYY A;  5HNB B;  5GAN f;  2DVE A;  3CD6 T;  4C0G A;  5GAN h;  1G2B A;  2F2C A;  5GAN 5;  1BCM A;  4OMF B;  4E7H A;  1UG1 A;  2EYQ A;  4HVV A;  1D3U B;  5HKC A;  2HSE B;  1YJN Q;  2MK5 A;  1YJ9 T;  2X4W A;  3HRS A;  3VYG B;  2HCK A;  1M90 U;  2QGF B;  1GCQ A;  1WI7 A;  3PO3 S;  4PJN A;  2DJQ A;  2AHJ B;  1YJN T;  1M1K U;  2H3J A;  1SF9 A;  2EAY A;  2ZCF B;  3CME A;  3A8M B;  2HQH A;  3HRU A;  1N6A A;  1Y96 B;  2PMI B;  3EGD A;  1N27 A;  5EJC A;  4C8Q D;  2KVQ G;  4BY7 X;  1X75 C;  1D1B A;  3FRN A;  4M77 C;  2RHU A;  2WIP B;  4ZN1 A;  1Q82 C;  1M1F A;  5CVI A;  3DKM A;  4KH0 B;  4P5N A;  1C9B A;  1H28 B;  4OMN A;  3CCQ T;  2PQW A;  3RES A;  3QSU A;  4HCB A;  1UB4 A;  1I8F A;  2YDL A;  1BIA A;  2DRK A;  1VQ4 A;  3RUX A;  2PUK B;  2DPP B;  5GMK h;  4M78 C;  2OI3 A;  2Y4X A;  2DAQ A;  3OYD A;  3JB9 D;  4XU1 A;  2KSS A;  2E6N A;  4M6V A;  3E2U A;  4EOS B;  1E6H A;  1ZBX A;  5HCK A;  1YBY A;  4KH1 B;  3GNF B;  1OI9 B;  3CC2 T;  3DDQ B;  1QVP A;  3NMZ C;  3MCA B;  1GXI E;  4RTT A;  5GAN j;  3KBG A;  4C5G A;  5L2W B;  3IQL A;  1QLY A;  4JZ4 A;  5CAI A;  1CKB A;  5GAM f;  1XNI A;  3H4C A;  4OB0 B;  1QVG S;  1VA7 A;  3TN8 B;  5GAM h;  3OYG A;  2QDJ A;  2RQV A;  3TW7 A;  2DM1 A;  4BCN B;  1WLP B;  2QAS A;  2EW3 A;  2LNV A;  4PFZ A;  2M16 A;  3L1A A;  5I2M A;  3CBM A;  2YUP A;  3RGF B;  2PJQ A;  2VWF A;  2C6T B;  1NEG A;  2OX7 A;  4XTV A;  2PZ1 A;  4DQ2 A;  2SRC A;  4X9C A;  5IHK A;  2RD1 A;  3QJY A;  1M8M A;  3HZJ A;  1P92 A;  2HBW A;  2KYB A;  4J9F A;  2DYB A;  1VYW B;  2EYX A;  2ZZD A;  3JB9 G;  4C8Q E;  1SRM A;  3CCL A;  1NYG A;  1H4L D;  4KUL A;  4N4H A;  1D3B B;  2DKG A;  4JRI A;  2P84 A;  1Z9Q A;  1Q7Y R;  1SHG A;  4A4G A;  2FPD A;  4FYX B;  5KYU A;  2COW A;  4NC6 A;  1RAD B;  1N8R C;  2OTL Q;  4M7A C;  1T3L A;  2MAM A;  1H1Q B;  2KXC A;  2XDP A;  4PFO A;  5CCA A;  3DTO A;  3X26 B;  4M7A F;  2CGH A;  5BNJ B;  1WZO A;  2CDT A;  4N0A C;  1QCN A;  4F16 A;  2OTL T;  1W70 A;  3OBW A;  4FL6 A;  4WCI A;  4BXX X;  5J26 A;  2DBM A;  2SEM A;  4JJN K;  3AT1 B;  4CC3 A;  3CCE A;  1H1R B;  3SD4 A;  2E5K A;  1S72 Q;  3LQ5 B;  1VQ8 Q;  1PM3 A;  1MMD A;  4Q5W A;  4A63 B;  4HNU A;  1S72 T;  5GAM j;  4QSH A;  4HKE A;  3JCM V;  1KQS S;  2M9U A;  2NUZ A;  1VQM T;  2DXB A;  2QEX Q;  3QPH A;  3F5X B;  1NBE B;  3RDV A;  1QW1 A;  2EJG A;  4DBH A;  4M7D A;  1UHF A;  2MYS A;  1Q81 C;  4M77 D;  4FYY B;  3OYK A;  2GFU A;  1H1S B;  3H0F A;  1VQ7 Q;  4ROD A;  3PMI A;  2QEX T;  3I55 A;  1M30 A;  2BZX A;  1OX8 A;  1YWO A;  1IGQ A;  2QAZ A;  1I5L A;  2KDS A;  1W98 B;  3NTH A;  1VYT A;  2JOY A;  2EQM A;  1VQ7 T;  3CCR A;  5D6Y A;  4IKF A;  2QGS A;  1U1S A;  2RK2 A;  2HAX A;  2BKD N;  2ATC B;  5IF1 B;  3V8J A;  3BE3 A;  2KI7 A;  2O31 A;  3JCM e;  3MJX A;  4AFZ C;  3I56 T;  4KGX B;  2W2H A;  3CMA T;  4M78 D;  5GAO m;  4DBR A;  4JJC A;  4RG2 A;  2RA2 A;  3SWN A;  1QCO A;  4B9W A;  3EFO A;  2F2X A;  5HBJ B;  3FB9 A;  3MEU A;  4CFX B;  1BYM A;  1NZ9 A;  3HHT B;  4PJJ A;  4M75 F;  2XKO C;  3OSV A;  4IUV A;  3VKI A;  2C0O A;  2JM9 A;  3FDR A;  1FXX A;  1Q86 R;  1AWW A;  4F7J B;  1VQO A;  2QQB A;  3OYF A;  1KIK A;  1BBZ A;  3HB9 A;  1K9M U;  2E12 A;  2A28 A;  1FYN A;  2DLP A;  3QYH B;  2RJD A;  4R55 A;  4CFU B;  3CC7 Q;  2RI3 A;  1K8A C;  2W96 A;  3H41 A;  1KXU A;  2VAS A;  4RTW A;  3V8L A;  2QFZ A;  3CC7 T;  1MGQ A;  3QWY A;  1Y57 A;  1TD6 A;  2LX9 A;  4JS5 A;  4FIB A;  4EOO B;  4FW1 A;  4BCM D;  2A7Y A;  2P4T A;  2BZY A;  5IT9 E;  4J9E A;  3URG A;  4Z88 A;  1OIY B;  1M90 C;  1OPL A;  1WQW A;  1YJW Q;  5GAN 8;  2LQW A;  1GBR A;  2L2P A;  3OYH A;  4Y72 B;  1QMC A;  1MMN A;  4XAX B;  3WVD B;  1PC0 A;  2LDM A;  4OVA A;  1YJW T;  2F5K A;  1PRM C;  3ER0 A;  1M9S A;  4OMO A;  1BU2 A;  1R8O B;  3WXM B;  4BCQ D;  2NUP A;  1WA7 A;  3DB3 A;  2CYZ B;  4EOI B;  2DZC A;  1RAG B;  1QCF A;  1TTH B;  4II5 B;  1EX4 A;  1GFD A;  2GCX A;  1I5O B;  1IXD A;  3C12 A;  4PL6 A;  2E6Z A;  1QQJ A;  3G7Z A;  1OU8 A;  1TU0 B;  4M4Z A;  2O4X B;  1X2Q A;  3DLL A;  4C92 F;  4E7L A;  3LWH A;  3HSB A;  2RM4 A;  3O8V A;  4JDS A;  1BK2 A;  4RUG A;  1PG5 B;  5GAO r;  5LJ3 d;  1KG1 A;  3N5B B;  5LJ3 g;  2LC4 A;  5AYF A;  1WJR A;  2K3B A;  1O9K A;  2WHB B;  3HKS A;  3DJB A;  3MI9 B;  4EOR B;  1AD6 A;  4KRD B;  1BI2 A;  1ABO A;  4M7D F;  2UZE B;  4EOM B;  4EPC A;  4ZTJ A;  1WHJ A;  3UF4 A;  5DLO A;  3A1P A;  4F6W B;  1ZA1 B;  2H8H A;  1VQ6 A;  1XOV A;  2ZPB B;  3K7A M;  2P0P A;  1N4M A;  1WXU A;  2DTI A;  2GGR A;  3ZEH A;  4QKU A;  3MP6 A;  4UN0 A;  3BHV B;  2DL8 A;  2XD0 A;  2JXB A;  1NJI U;  1QVG A;  3AHU A;  3CME Q;  3OS1 A;  4HLQ A;  5FU6 B;  2KK4 A;  3G33 B;  2EJ9 A;  3CC4 T;  2IIM A;  1KHI A;  3HO8 A;  1KC8 R;  4HA8 A;  5GJV B;  4AKH A;  3LLR A;  1K9A A;  2FG0 A;  5CEI B;  1HYO A;  1U5S A;  2JJ9 A;  3LX7 A;  3OY9 A;  1VUB A;  1T0J A;  2DL5 A;  1M3A A;  1WJS A;  2QXF A;  3M4G A;  3H8Z A;  1R0B G;  2RN8 A;  3NHN A;  4QVD A;  1VQ4 Q;  3GBQ A;  5GAN 3;  4JJD A; 
#chains in the Genus database with same CATH homology
 1VQP T;  2JUF A;  5CQY A;  2YLC A;  3MP1 A;  5FU7 C;  4J6W A;  2K5L A;  5J3B A;  4QVC A;  3L2Q A;  1G5V A;  4F7U G;  3OW2 S;  2DTH A;  3BG9 A;  3L2Z A;  4J83 A;  4JLG A;  5CO7 A;  4M7D B;  4VUB A;  5LJ5 f;  3CCS A;  2RHZ A;  2RHY A;  1VQN A;  2QQS A;  1YJ9 A;  4AKG A;  4FM4 B;  2PVO B;  3HL8 A;  4LDV A;  2V8I A;  4JLI A;  4BE1 A;  2KQW A;  2LCL A;  3C4S A;  1HK9 A;  3OMG A;  4GY5 A;  1G3W A;  4PLI A;  4XU3 A;  5LJ5 h;  4ZTF A;  1YI2 T;  1KHC A;  1Q7Y C;  3JRZ A;  2Y4Y A;  2E64 A;  3QZ9 B;  2X4Y A;  3CXC A;  4MFD A;  2RJC A;  5GAO p;  1UGP B;  2M0O A;  3NTK A;  2A3L A;  2CS7 A;  4NOY A;  4JS4 A;  1K73 C;  4HCZ A;  4F7U B;  3KUF A;  4HCC A;  5CKF A;  2R57 A;  2DD4 B;  2XI9 A;  5A0D A;  4RCB A;  4OB3 B;  1U8R A;  2EIF A;  4EMK A;  3J80 E;  3R6O A;  4IUU A;  3BG3 A;  2BS4 A;  2FYK A;  3HFN A;  2VGM A;  3M54 A;  4XU0 A;  3V7R A;  1VQ5 A;  2ZGW A;  4NL2 A;  2GF7 A;  4KUD K;  4PKC C;  2XG8 D;  4CRI A;  3S6W A;  4E7J A;  3M4Y A;  3NTI A;  2DO3 A;  3VV0 A;  4BI8 B;  3SWN B;  1YIT T;  4F7U E;  2XK0 A;  5KE3 A;  2EWN A;  5GAN f;  1N9R A;  3CCU A;  2FVU A;  3LW5 E;  2RHX A;  2DVE A;  5HY6 A;  5L8R E;  4LDY A;  3ZFJ A;  3DB4 A;  3CD6 T;  4C0G A;  5GAN h;  4XTU A;  4QVZ A;  3JCM P;  2RI2 A;  3UPU A;  1KQS A;  5GAN 5;  3QO3 A;  4OMF B;  3CCQ A;  4E7H A;  4ATO A;  2E10 A;  2EYQ A;  3OB9 A;  5HKC A;  3DL1 A;  1YJ9 T;  2KY9 A;  1QVF S;  3JCM Q;  4ZN3 A;  4GLK A;  2B8A A;  4DOW A;  3INZ A;  2X4W A;  3V8K A;  1V29 B;  3HRS A;  3VYG B;  4BI4 A;  1M90 U;  3BY7 A;  5CQX A;  3CCV T;  2DXC A;  2AHJ B;  3OSS C;  2VV5 A;  5KCH A;  1YJN T;  3X24 B;  1M1K U;  1G3Y A;  2H3J A;  2RI5 A;  3L2W A;  1YIJ A;  3OS5 A;  2EAY A;  2KMT A;  2ZCF B;  2QQR A;  4C8Q A;  3CCL T;  1YHQ T;  3JSC A;  3CME A;  3A8M B;  2EFI A;  3HPW A;  1JRI A;  4XTX A;  4XTY A;  3HRU A;  1UEB A;  1VQ5 T;  1N6A A;  1Y96 B;  2XDB A;  4C8Q C;  3CC2 A;  5FU7 B;  2GFA A;  5GAM d;  1N27 A;  2MF2 A;  1DJ7 B;  1LOJ A;  2QQ8 A;  5EJC A;  1E7P A;  5EG2 A;  4C8Q D;  2KVQ G;  5GAM g;  2CZ6 B;  4MZP A;  4C8Q F;  1X75 C;  2E70 A;  3BDU A;  2ZPI B;  3FRN A;  4BUG A;  3CCU T;  4M77 C;  3ASK A;  5CIU A;  4X34 A;  2EJF A;  2RHU A;  4ZN1 A;  3VUZ A;  1Q82 C;  1M1F A;  1I81 A;  2HBP A;  5CVI A;  3G4S A;  5CK9 A;  3PTA A;  3DKM A;  1D3B A;  1QP3 A;  3MET A;  2P0K A;  2XID A;  5GAO n;  2GQV A;  4P5N A;  2M1H A;  4IUP A;  4LDW A;  3FJP A;  3CCQ T;  2PQW A;  5LJ5 j;  4DA4 A;  3RES A;  3C94 A;  3QSU A;  4HCB A;  4L6V 5;  4M7A G;  1UB4 A;  2KR6 A;  1I8F A;  1Q81 U;  1BIA A;  1SSF A;  1VQ4 A;  4M78 A;  4N4I A;  1YCY A;  2LQ8 A;  2V8J A;  3M59 A;  2PUK B;  3Q1J A;  3RUX A;  4TVR A;  4A4F A;  2DPP B;  4EMK B;  4M78 C;  5GMK h;  2Y4X A;  2DAQ A;  3E9F A;  3RER A;  3A8G B;  2MMP A;  3KHI A;  4XU1 A;  3OYD A;  2KSS A;  3CPW A;  3JB9 D;  2E6N A;  4M6V A;  3JB9 F;  2K5F A;  3CME T;  1ZBX A;  4E7I A;  4OP0 A;  1YBY A;  2IG0 A;  5A0G A;  3JB9 J;  3GNF B;  3CC2 T;  2E65 A;  1QVP A;  3MCA B;  4NL3 A;  1W2B A;  1GXI E;  1KQ1 A;  1Q86 C;  5GAN j;  4M75 C;  3KBG A;  4C5G A;  3OQ5 A;  1KC8 U;  2JTF A;  2VXF A;  5CAI A;  5GAM f;  1XNI A;  3H4C A;  1VIF A;  4OB0 B;  1QVG S;  3E1S A;  4PJO A;  4XQ3 A;  3C95 A;  2RJE A;  5GAM h;  2E1H A;  3X20 B;  2QDJ A;  4YTL A;  3OYG A;  1IZ6 A;  3I55 T;  3TW7 A;  1LNX A;  3CD6 A;  2BIV A;  2QQ9 A;  4PJO C;  1I4K 1;  2LNV A;  4HNV A;  4JRK A;  4M77 G;  2M16 A;  3L1A A;  2K4Y A;  5I2M A;  5HK3 A;  4LD9 K;  3BDL A;  2DXC B;  3CBM A;  3CBP A;  3WVE B;  3S3M A;  1BI3 A;  1VQ4 T;  1W4S A;  1M8V A;  3M5A A;  2RHI A;  5GMK l;  4Z6Y A;  4XTV A;  4C8Q B;  4DQ2 A;  3X28 B;  4X9C A;  4FT2 A;  3FC3 A;  3UWN A;  1JJ2 S;  3GF5 A;  2RD1 A;  3QYE A;  3QJY A;  3HZJ A;  1P92 A;  2WSC E;  5CKH A;  1VQL A;  2O01 E;  2VXE A;  2OTJ A;  3CCV A;  4MZM A;  4A53 A;  3BFM A;  2DTO A;  4AI6 A;  1YJN A;  4BAC A;  3PIP A;  2ZZD A;  4MMK A;  3QDR B;  5DLQ E;  3JB9 G;  2XHC A;  4C8Q E;  2RJF A;  3CCM A;  1H64 1;  4M78 G;  3CCL A;  1YHQ A;  1G3T A;  1XQH A;  4KUL A;  4N4H A;  4C5H A;  3CBO A;  3HBL A;  2JVV A;  1D3B B;  2DKG A;  4JRI A;  4LD6 A;  3QUI A;  4M77 E;  1PSE A;  2K5I A;  3E9G A;  1K8A U;  4A4G A;  3GLX A;  5GAO l;  3RIR A;  3GOX A;  1VQM A;  4M7A A;  4FSX A;  4NC6 A;  3J7A F;  1N8R C;  3OA6 A;  3JCM J;  2DIQ A;  2MWP A;  4CI0 C;  5A2Q E;  4M7A C;  1O9S A;  2WSF E;  4J7F A;  4M75 G;  3QII A;  4MZT A;  3RKX A;  2MAM A;  1XTD A;  4N0A A;  2LRQ A;  4M7A D;  2XDP A;  5CCA A;  5KE2 A;  2DZ9 A;  4M7A F;  3X26 B;  3CXC S;  3FEO A;  2CGH A;  3OYY A;  4BE2 A;  3OBY A;  3JCM b;  1QVF A;  1AHJ B;  4IUR A;  4N0A C;  2YLB A;  1M1K C;  2OTL T;  3OYM A;  1Y07 A;  2DK3 A;  3OBW A;  3OYA A;  4FL6 A;  4PJO G;  4OB1 B;  1M1G A;  1JBM A;  4C0D C;  2PVG B;  4M78 E;  4ME7 A;  4AKI A;  1VQ7 A;  3A8L B;  3VUB A;  1VQL T;  5J26 A;  1Y71 A;  4R56 A;  1YJW T;  2QDY B;  4XTZ A;  2OTJ T;  4JJN K;  3MEW A;  1JB0 E;  2P0Q A;  3EAE A;  3CCE A;  3SD4 A;  2F69 A;  1LJO A;  5LJ3 j;  1ZQ1 A;  1WPY A;  4ELJ A;  3I56 A;  1KQS S;  4IUQ A;  5HK0 A;  3CMA A;  4PLL A;  2XIC A;  3L42 A;  4EMG A;  2G3R A;  4A4E A;  4J6Y A;  2VUB A;  4Q5W A;  2EQJ A;  5IN1 A;  1O75 A;  4M75 E;  1N9S A;  4HNU A;  3L2R A;  4C92 C;  4C5E A;  1S72 T;  1IRE B;  2NLU A;  5GAM j;  3M57 A;  4FT4 A;  4QSH A;  3OMC A;  4HKE A;  4M77 A;  2WAC A;  3DLM A;  2LTO A;  3JCM V;  2M9U A;  4IUT A;  3JCM c;  5FLX E;  2JN0 A;  2DXB A;  3M9Q A;  4JRQ A;  1VQM T;  3QPH A;  5GMK i;  3T9N A;  3MEA A;  1WNL A;  3FLG A;  2E5Q A;  2DXT A;  3QG1 A;  3RKY A;  1QW1 A;  1BI1 A;  2EJG A;  2HD0 A;  3OS0 A;  1NJI C;  4M7D A;  4PJO E;  1Q81 C;  4M77 D;  5CKE A;  1VQ9 T;  3OYK A;  1OZ2 A;  2GFU A;  4M77 F;  3SDZ A;  5GMK m;  3L2V A;  1OZ3 A;  3G71 T;  2QEX T;  2HNI A;  2OAU A;  3PMI A;  3I55 A;  4M7D C;  4A4K A;  3MEV A;  4C0Z A;  2PVD B;  2R5M A;  5D6W A;  1I5L A;  2MI6 A;  2L3R A;  2KDS A;  1G3S A;  2X35 A;  4L59 A;  2E41 A;  2FB7 A;  3NTH A;  2JOY A;  1VQK T;  2EQM A;  3NFC A;  2DIG A;  5D6Y A;  3MHX A;  2RK2 A;  4MIM A;  1U1S A;  4RG8 A;  2BKD N;  3MO8 A;  2ZPH B;  3ZBD A;  4QW2 A;  4HNT A;  5LJ3 e;  1KD1 C;  2HAX A;  3CCE T;  3V8J A;  3A5Z B;  2ZPG B;  1HXD A;  3JCM e;  3I56 T;  2RH2 A;  3CMA T;  2D0Q B;  4M78 D;  4M78 F;  3CPF A;  5GAO m;  4RG2 A;  2RA2 A;  4M7A B;  3SWN A;  3OYL A;  4WF2 A;  3QWL A;  2LCC A;  3TU4 K;  4M75 A;  2QTX A;  3EFS A;  1Q82 U;  4RKU E;  3SWN C;  4B9W A;  3CCM T;  3SB2 A;  2G77 A;  3FB9 A;  2CZ7 B;  3TEE A;  3RKW A;  3MEU A;  1BYM A;  1NZ9 A;  2BS2 A;  2DXU A;  3HHT B;  4M7A E;  4M75 D;  5CKD A;  4C0D B;  4IKF A;  4M75 F;  5LJ5 e;  1OYX A;  4C92 G;  4HL4 A;  1RL2 A;  3OW2 A;  2JTM A;  4ZGJ B;  3QBY A;  2XKO C;  3VKG A;  3OYE A;  2K57 A;  3OSV A;  4IUV A;  4XU2 A;  4A4H A;  3VKI A;  1KQ2 A;  2O4X A;  3VYG A;  3X25 B;  2VYT A;  2F5T X;  3FDR A;  1NPR A;  1JJ2 A;  1FXX A;  3QHS A;  4PJO D;  3GNG A;  4HT9 A;  4PJO F;  2XDD A;  3CPW S;  2DJZ A;  1WQ7 A;  3CCR T;  1VQO A;  3BW1 A;  2OTL A;  2QQB A;  3HRT A;  4M7D G;  2CZ1 B;  4MML A;  1UGS B;  4B9X A;  3OYF A;  1Y7X A;  3A8O B;  4ZGD B;  3HB9 A;  1EIF A;  4BE0 A;  1K9M U;  1FX7 A;  1QP2 A;  4JRP A;  3EFR A;  2E12 A;  3A8H B;  2ZPF B;  2L89 A;  4BB7 A;  2RJD A;  3QYH B;  2I2L A;  4M77 B;  1FWZ A;  4R55 A;  2RI3 A;  4BY6 C;  5GAN 2;  1K8A C;  1H3Z A;  1NE8 A;  4C92 E;  3QXE B;  5GAN e;  1MHN A;  2MWO A;  3J81 E;  2JZ2 A;  3V8L A;  4E47 A;  4LOC A;  5C6S A;  4OF1 A;  2QQA A;  5J39 A;  2R58 A;  1S72 A;  2QFZ A;  3CC7 T;  2QA4 A;  1MGQ A;  2K3X A;  3PIO A;  3G6E A;  4O5V A;  1VQ8 A;  3LH0 A;  4ZGE B;  1B34 A;  2X4J A;  3CCJ A;  2LX9 A;  4JS5 A;  4FIB A;  4UC4 A;  4BD3 A;  4X9D A;  1BIB A;  2XU8 A;  4MFE A;  2A7Y A;  2P4T A;  3TW6 A;  2QI2 A;  4O6J A;  4C0F A;  4M7D E;  1PSF A;  3P8B B;  4OGC A;  4QQG A;  2FL7 A;  5IAY A;  4M78 B;  4KBM B;  3URG A;  3CEY A;  5A0L A;  4BDZ A;  4XTW A;  1VQ9 A;  2WJ9 A;  4XK8 E;  3JB9 H;  1M90 C;  3QYG B;  1WQW A;  3G71 A;  2QEX A;  5GAN 6;  5GAN 8;  1Q7Y U;  4RMO A;  5GMK j;  3RMS A;  5FRO A;  2C06 A;  3RMQ A;  1VQO T;  3OYH A;  2PUO B;  2D9T A;  2PU9 B;  2RK1 A;  5FU6 C;  3UDC A;  4XAX B;  2QF7 A;  5KCO A;  1K73 U;  3OS2 A;  3WVD B;  3HP9 A;  1WJQ A;  3PNW C;  4OGE A;  4PNO A;  4RCC A;  5LL6 S;  4DOV A;  2CKK A;  1VQK A;  5IT9 E;  2LDM A;  4OVA A;  2DD5 A;  4BBR M;  2V8K A;  2F5K A;  4BBS M;  4EMK C;  2KMG A;  3BG5 A;  4M75 B;  3ER0 A;  4V2S A;  3PMT A;  1M9S A;  4KT0 E;  2BS3 A;  1R8O B;  3WXM B;  2WSE E;  3JCM X;  4II1 A;  4C92 A;  2IVW A;  3DB3 A;  3PGG A;  2CYZ B;  2DZC A;  5KH6 A;  1FKM A;  5CR2 A;  3E19 A;  5FRN A;  2CZ0 B;  4Y91 A;  3CCS T;  5DM7 R;  1VQN T;  1N8R U;  2GCX A;  4MDX A;  1BI0 A;  4PJO B;  3QJ6 A;  3C12 A;  4PL6 A;  3JAM E;  2E6Z A;  3G6E T;  4Z02 A;  3GPL A;  2QA4 T;  1VQ8 T;  3G7Z A;  2D6F A;  2VGN A;  2L5Q A;  2O4X B;  4C92 D;  3CCJ T;  3DLL A;  3OYC A;  4C92 F;  3L2U A;  2LQK A;  4E7L A;  3LWH A;  3HSB A;  1VIE A;  4J7I A;  2RM4 A;  3LYI A;  3O8V A;  4JDS A;  5C0M A;  3CC4 A;  5M9O A;  5GAO r;  5LJ3 d;  4L5G A;  5GMK e;  3LGL A;  4EMH A;  1KG1 A;  4A54 A;  3N5B B;  5LJ3 g;  3PT9 A;  2LC4 A;  2YHT A;  3V7S A;  2JNG A;  5AYF A;  1WJR A;  3V7C A;  3JCM d;  3MP8 A;  2YRV A;  2ZPE B;  2EKO A;  3HKS A;  1RI0 A;  2HQX A;  5I21 A;  3JCM g;  4BY6 B;  4BDY A;  4M7D D;  1BI2 A;  3S3N A;  5D6X A;  4M7D F;  4EPC A;  1VQ7 T;  4ZTJ A;  3CCR A;  1WGS A;  3VYH B;  2ZZD B;  3VJP A;  4F7U A;  3PFS A;  2RO0 A;  5DLO A;  3JB9 I;  3P8H A;  5FRM A;  2LT1 A;  2DD4 A;  4EDU A;  1VQ6 A;  1OI1 A;  1XOV A;  2LT4 A;  3QKJ A;  4KUI A;  5DY9 A;  3VKH A;  2ZPB B;  4N4G A;  2P0P A;  5GAN 4;  4D6W A;  3JCM W;  3M56 A;  2DTI A;  3TRE A;  4MDW A;  1KC8 C;  4JX6 A;  3ZEH A;  3SFM A;  2EQU A;  3LGF A;  4F7U F;  4J6X A;  5GAM e;  1B34 B;  4OB2 B;  3MP6 A;  4BI3 A;  5LJ5 d;  4J8O A;  2RB6 A;  1VQP A;  5LJ5 g;  3P8D A;  2XD0 A;  2BUD A;  3M53 A;  4Y28 E;  1NJI U;  2L8D A;  1QVG A;  3AHU A;  2VC8 A;  1M4Z A;  2X4X A;  5I2S A;  4C5I A;  3QYB A;  2R5A A;  1BKB A;  3TCJ A;  4JX5 A;  2K2V A;  1UGQ B;  2K3Y A;  4JUV A;  3GIB A;  3OS1 A;  3CC7 A;  4HLQ A;  3F70 A;  5FU6 B;  2KK4 A;  1UGR B;  1TH7 A;  3ME9 A;  3KXT A;  5CKB A;  2EJ9 A;  3CC4 T;  1YI2 A;  1KHI A;  3FIF A;  3HO8 A;  1YIJ T;  1X01 A;  4NS5 A;  3OYI A;  1M5Q 1;  4HA8 A;  2EQK A;  3OYN A;  4HT8 A;  5GAN 7;  4AKH A;  1ZHI A;  3GP8 A;  3S3O A;  2DD5 B;  3QZ5 B;  3LLR A;  1KD1 U;  1K9M C;  5LJ3 f;  3HFO A;  4JX4 A;  3LX7 A;  4J5Y A;  5GAO q;  4FU6 A;  1NPP A;  4ELY C;  4QQ6 A;  3OY9 A;  4E7K A;  1VUB A;  5LJ3 h;  3JCM f;  3M58 A;  5GAN d;  1WJS A;  2QXF A;  4ELZ C;  1VQ6 T;  2DEQ A;  4C92 B;  3OYJ A;  4LDX A;  3M4G A;  1QLB A;  3H8Z A;  3JCM h;  5GAN g;  3OYB A;  4QQD A;  1YIT A;  3VU3 C;  2FHD A;  2LVM A;  3H6Z A;  4C8Q G;  3G4S T;  1YJW A;  1W2B S;  4QVD A;  3LWI A;  1Y96 A;  4LDU A;  1U1T A;  2HQE A;  3M55 A;  5GAN 3;  3UT1 A;  1Q86 U;  2KAF A;  2Y90 A;  1X6O A;  2DXB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...