2CZ6B

Complex of inactive fe-type nhase with cyclohexyl isocyanide
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
212
structure length
212
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title x-ray snap shots of inhibitor binding process in photo-reactive nitrile hydratase
rcsb
molecule tags Lyase
total genus 60
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2cz6B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cz6B02
4OB2B 2CZ0B 1UGRB 4RKUE 4ZGDB 2D0QB 3A8HB 1GXIE 4KT0E 2PVGB 4FM4B 1IREB 1QP2A 3A8OB 2QDYB 4L6V5 2DXCA 4Y28E 1PSEA 2DD5A 3WVDB 5L8RE 3QZ5B 3QYHB 3QXEB 2DD4A 4OB1B 2WSEE 2CYZB 2AHJB 3X20B 4OB0B 3X28B 3QYGB 2DPPB 2DXCB 1UGPB 1PSFA 3LW5E 2ZPGB 2DD5B 2ZZDA 2ZPIB 3A8LB 2DD4B 2CZ7B 2ZPFB 3A8GB 3VYGA 2PU9B 1JB0E 3X24B 2ZCFB 2PUOB 2DXBA 2O01E 2ZZDB 2PVDB 4ZGJB 4ZGEB 1AHJB 3QZ9B 2WSCE 3VYGB 1QP3A 2ZPHB 4XK8E 3VYHB 2PUKB 2DXBB 1V29B 2ZPBB 1UGSB 4OB3B 2CZ6B 2PVOB 2CZ1B 1UGQB 3HHTB 2WSFE 3X25B 3X26B 1DJ7B 2ZPEB 3A8MB 3WVEB
chains in the Genus database with same CATH superfamily
1VQ6T 3JCMP 1LVKA 2UZLB 1VQPQ 1PG5B 2DRKA 5J39A 3PNWC 3M56A 5LJ3f 5FRMA 2F2WA 3OYJA 2FVUA 1Q81U 4L5GA 2A7YA 2C0IA 3QWYA 1VQ7Q 5LJ3g 3HB9A 4C8QE 2AK5A 5KYYA 2I0NA 3JB9D 3EAEA 1WZOA 1M9SA 2DBMA 2I2LA 2QQAA 3M4GA 4C0DC 1ZSZC 2WJ9A 1SEMA 1QKWA 1Y96B 1RAFB 4XTUA 1QVGP 2YRVA 4DOWA 5ICPB 4VUBA 1ZQ1A 2OAUA 3BLRB 3SWNA 3M4YA 2HZYA 3NTKA 6AT1B 1X2KA 2CGHA 2DPPB 1OL1B 4EPCA 2VB6A 4C92D 2RI2A 5GAN2 2R7GA 2M0YA 4YC3B 3H0HA 1ZHIA 2ZGWA 4RG2A 4XTYA 1NG2A 1KQSP 5IDNB 2R5AA 4F17A 2ZPFB 1TUCA 2RMOA 3CPFA 2J6OA 2R5MA 1GUXB 1YFNA 1BI1A 2BPMB 1YWPA 2D8HA 2LNHB 1Z9QA 3FJ5A 4JDSA 5LJ5j 2LQNA 1KD1R 2DXBA 5FGKB 1Q82U 1YCSB 1H1QB 1AISB 1NLOC 4Y91A 4A63B 5KCOA 2LRQA 4PLLA 2V8KA 1FINB 4GLKA 2DTHA 5GANh 1KQ1A 5CIUA 1UFFA 4CRIA 2JS0A 2JTMA 1TXQA 4IUQA 4KGZB 1X6OA 4BDZA 4M77C 4ELLA 2C5NB 4LN2A 2QAZA 2VVKA 1X6BA 2PQWA 2XK0A 4ZTJA 3JSCA 5FW9A 3EG9A 5KYWA 5DQWA 4BCMB 1QLBA 2MWOA 1VIFA 2F1LA 1UGRB 2CP5A 3CCUT 4FYXB 1FX7A 1N6AA 1YITA 1ARKA 4LXCA 2BZ8A 1K73R 2IW9B 2O4XA 1AD5A 1PC0A 2EW3A 2MOXA 3K7AM 4Z6YA 4AG1C 5DM7R 2PK2A 2JGZB 3QDRB 4PFZA 3EGDA 4C8QG 3OQ5A 2IVXA 2B8AA 1E6GA 2LP5A 2KXDA 4J6WA 4PJMA 4M78D 4EMKA 1RLPC 3PMTA 1X6GA 2PHGA 3RKWA 3X20B 2ROTA 3BG9A 3N5BB 1VQPA 4R56A 3AHUA 4GLMA 2HDAA 5IAYA 3QYGB 2FPDA 4C5HA 2WPAB 5FU6B 3JCMW 1TOVA 2P0PA 3ASKA 4AT1B 2CH4A 1BBZA 5LJ5d 1VQ7A 3MY5B 2KI7A 2LDMA 2R58A 3CC4Q 1B34B 1VQKQ 2I53A 1MMNA 1H25B 3META 4CFUD 3KBGA 2AT1B 2L8DA 5J26A 5IH2A 1YITT 5I2SA 3CCVQ 1M1KR 2W2HA 5LJ5h 2W99A 3VS3A 4RG8A 3TNWB 1H641 2FRWA 1SF9A 3CPWA 1B7TA 1UDLA 4J9DA 4BCND 1BK2A 3EG0A 4CC2A 5CYIB 1JXMA 1V29B 5GAN8 4M7AF 1UGSB 2DXTA 3MHXA 4FT4A 1WQWA 1W1FA 3VJPA 2CZ1B 3LLRA 2M02A 3CCJQ 4C92C 1FMWA 2X4XA 4BCOB 5IT9E 2EQJA 1IHWA 4RTZA 2IW6B 4BB7A 3OYLA 2ZPEB 3V8JA 2MIOA 4P5NA 2J6FA 5D6XA 1VQ7T 2CKKA 4LD9K 5EFQB 3QHRB 1WI7A 3GBQA 3QIIA 1JJ2P 2DBKA 2BTTA 1WNLA 2EIFA 3OW2S 3FB9A 3BHUB 2W96A 5IHIA 2FZKB 1H1PB 3EGXA 2AKLA 1ZBJA 2COWA 2Z0WA 4DA4A 4FM4B 5CKDA 2WIPB 2KSSA 1FVVB 1QP2A 4AFUC 3R6OA 2RJDA 1OZ3A 1YJWQ 1OU8A 3URGA 2EBPA 5AT1B 1IB8A 1TH7A 5GANf 5M9OA 2WHBB 2EUFA 4CFXB 3MPUB 2O31A 2LT1A 3M0UA 5GANg 2E41A 1N8RR 5KYYB 4BCIB 2WSEE 2V8IA 2FHDA 1VIEA 1QWEA 4RMOA 4IKFA 1UE9A 2DTOA 2L3QA 4QVCA 1A0NB 1PSFA 2LT4A 3HRTA 4HVVA 1N5ZA 1YN8A 1JSTB 1VA7A 1BI3A 2DTIA 4FU6A 3MCAB 1VOLA 4AFZC 1NE8A 1WXBA 3ZFJA 1M3AA 1PRLC 1WJSA 3BY7A 3VS2A 3C4SA 3BFMA 4F14A 2RO0A 1PKSA 4JJCA 1OI9B 1WXUA 4PJOD 1FMKA 4XQ3A 4M77F 4ZNXA 4M7DA 3MP1A 2VWFA 5GJWB 1NPPA 2KBTA 1W98B 4XTXA 2X3XD 1YI2Q 4IUTA 2K3YA 1JU5C 1ZLMA 1OKVB 2NLUA 4M78C 2HCKA 3UF4A 2DXBB 1TWBA 2PNIA 3V8KA 2LW4A 3BE3A 4BE0A 1XJWB 2G9XB 2RJEA 4HXJA 3INZA 3L2QA 3SFMA 2AZSA 3KFVA 1VQKA 2COYA 1D09B 2RQWA 1PD1A 2MCNA 4BY7X 1T3SA 1M90C 4YOSA 2BIVA 3V8LA 2CZ0B 2YHTA 1TD6A 3CCVA 2DLPA 4OB2B 2EJFA 2FPFA 1SSFA 2XHCA 1QW1A 3JCMJ 3BG3A 2UZDB 1FYNA 1AWWA 2BUDA 1M1KU 4A4HA 1SSHA 3UPUA 1BIBA 4QQDA 5LJ5f 4BCFB 3VUBA 2C5VB 3CD6Q 2AIRB 5LJ5g 2A37A 3CCJA 2A0FB 2HD0A 1OPKA 2R57A 1KQ2A 4ANJA 2FG0A 1J3TA 3JAME 4NC6A 1XQHA 3M58A 1WJRA 7AT1B 1KG1A 1GCPA 1P5EB 4M75D 3CXCS 3CC4T 5CKHA 4D6WA 2FRYA 2EYQA 2WFYB 1VQKT 2LC4A 4B9XA 3EGDB 2YRDA 2COZA 5KCHA 3OW2P 3NHNA 3TW6A 2X4WA 1TUDA 3TSZA 1K9AA 4EMKB 2X9HA 4FYWB 4PJNA 3H41A 2D6FA 1KK7A 4NSTB 4RTWA 5CQXA 1RI0A 4QW2A 3SHWA 1NJIC 2RQRA 2RI3A 1YJWA 1RACB 3BW1A 1U1TA 4LD6A 4C5IA 3QUIA 2BZXA 4C92F 1D3BA 1AD6A 2RHXA 2HNIA 1S72Q 2DETA 3TU4K 4IMYB 1W2BA 5I22A 4F7LB 1ABOA 1WDXA 3GNFB 3DB4A 3I9QA 3UDCA 2V22B 3TREA 2DA9A 1UGQB 4JLIA 3X25B 3NFCA 2FZCB 4FSXA 4N0AC 1UECA 3JCMe 2M1HA 4CFMB 5IXFA 5FU6C 2RHZA 2YUNA 4M7AE 2F5KA 3RKXA 1YBYA 2UZBB 4RTVA 3ZBDA 4F7JB 1Q7YC 2RD1A 5CQYA 2OX7A 3DOGB 2YWWA 1YI2A 1CSKA 1NLPC 2DL7A 3V7RA 2X51A 1YJWT 1IHVA 3GPLA 1YIJQ 4Z02A 4MZTA 4JX5A 4KT0E 1NBEB 2BZYA 2DAQA 1NZ9A 3HP9A 1D0YA 1D0ZA 4AKGA 2CP7A 2FL7A 2DXCA 3MP8A 5DLQE 4CFVB 4QVDA 4BXXX 1Y07A 5GAMj 4BCQD 1BU2A 5LJ3e 3EGXB 2VXEA 2DVEA 1YNZA 4E7ZA 4F7UF 3J7AF 5CKBA 3CQTA 2VC8A 2E10A 2LCCA 4OB0B 3PGGA 3X28B 2LX7A 4C8QB 3H9NA 5CKFA 4ZN3A 3RERA 3U23A 2XDBA 5C6SA 4E7IA 3CCSQ 4NOYA 1VQ8Q 2OTLQ 2QQ9A 4BBSM 3GNGA 3MJXA 5DY9A 3FC3A 1VUBA 3OYFA 4M78F 2I40B 1HYOA 2H3EB 3CD6A 2DIGA 3JCMQ 1GFCA 2K79A 2X4JA 2GCXA 2CP3A 4DBHA 1B34A 4J9CA 2EYWA 3TVTA 3ER0A 3QPHA 4JRKA 1XTDA 4OGRB 4ORZA 2GFUA 3CXCP 3PE0A 1GRIA 3NTIA 8AT1B 4DBRA 4HVWA 4QQ6A 2MWPA 3PVLA 2CZ6B 2LJ0A 3JB9J 4HCZA 4MZPA 3E9FA 2JZ2A 1W6XA 2OI3A 4M77E 2WSFE 2XMFA 2CSQA 1BCOA 2QQBA 3FJPA 5CKEA 1K9MC 3DDQB 1XOVA 3OYHA 1VQ4Q 2XICA 1F1BB 2EQUA 3M0SA 3R6NA 3CCMQ 3O8VA 4EOJB 4F16A 2W0ZA 3SWNC 4BY6B 5GAOn 3M59A 4X34A 4M7AG 3CD6T 4II1A 2YLCA 3VS7A 4F6UB 3TNHB 3EHQA 2MMPA 3CPWS 1G2BA 2E3IA 5GMKe 1WXTA 1M2VB 2JM8A 2LVMA 4E7LA 4OMFB 5GAMd 3DTOA 2LJ1A 2HL3A 2DFUA 2KRSA 4J7FA 1T0JA 4JX4A 3UA7A 3A8OB 1IGQA 1EX4A 2LCSA 1PSEA 2DNUA 2RQVA 3CCQQ 2RJFA 2GFAA 5GAMh 3O0GD 5GAOp 5J3BA 1WFWA 3G7ZA 3HFNA 2CYZB 3KHIA 1C0MA 2LQWA 2QXFA 4XTZA 1ZUKA 2K5FA 3DJBA 5EC7A 2OJ2A 4A4FA 1RAGB 1IO6A 4X9CA 2X1NB 2VGMA 1VQ5Q 1YIJA 3A8LB 1Q86U 1UJ0A 1U3OA 4RTYA 5HKCA 2XI9A 3QBYA 1S72T 3C95A 2DIQA 2C0TA 2ABLA 3F5XB 1AHJB 2L3PA 1I5LA 4MMLA 4EOOB 1GFDA 3GIBA 4BCJB 2KY9A 1OV3A 1UB4A 3OB9A 3NTHA 2ZPBB 3ZEHA 4J9FA 1ZSGA 4C92E 1D3BB 4RCBA 4A4GA 1GBQA 3CCSA 4PNOA 1M90R 1VQ8A 2L2PA 2OTLA 2LTOA 4PJOF 3OS0A 4M7DD 2ATCB 1M4ZA 5IHKA 2YT6A 1BIAA 1K76A 4M77G 3H0FA 2BE9B 5FRNA 5HBEB 4EMKC 1QQJA 4TVRA 1YIJT 2P4TA 2MPXC 4N4IA 3TNIB 2L3RA 1Z9ZA 1R77A 3NPFA 4OF1A 4LOCA 1SG5A 1WHMA 2JMAA 1WQ7A 1K0SA 2C6TB 1ZUYA 1O75A 4OGEA 3VKIA 3HL8A 3G6EQ 1WLPB 4EIKA 4BCHB 5I21A 4ATOA 4PJJA 1QLYA 2KYMA 2KE9A 3LH5A 3BG5A 4MZMA 1QVGA 1H4LD 3HBLA 4HCBA 3FEOA 1VQ4A 5HBHB 2RPNA 2E64A 2DM1A 2A08A 2E6NA 2Y4YA 3QZ5B 2RA2A 3CCMA 2HQHA 3OMGA 1VQ8T 2OTLT 1M5Q1 4EOPB 4PK4A 1Q81C 5FROA 2DXCB 3CMAQ 1G3NC 2B86A 2E5QA 1LCKA 4F7UE 4BACA 2QYZA 5GANe 1SHGA 2SRCA 1NJIR 4J6XA 1LPLA 2HKQB 1G3TA 1K4US 3DB3A 5HBJB 2KRNA 1M3BA 1TTHB 2HQXA 2W9FA 4M75F 1LNXA 4RTXA 2EQMA 1RLQC 1JOWA 2E5KA 3LGFA 4IIOA 3CCQA 4J9GA 5IXBA 3JB9G 3MKDA 2RN8A 2VV5A 1Y71A 3PTAA 2DEUA 2F2VA 2ZPHB 4M78E 2G77A 1QVPA 3EJ1B 3OYCA 1VQ9Q 4KULA 1AOJA 2E1HA 1VQ4T 2LJ3A 1OX8A 5GAMf 3RIRA 5D6WA 1E7OA 2C4GB 1W70A 5GMKl 5GMKm 1VQ5A 4E2FB 1JKWA 1QKXA 4QKUA 5GAMg 3MP6A 3H6ZA 4C8QC 3OYNA 4C92G 5A0GA 4OMLA 1Q7YR 3OY9A 4FT2A 3WVEB 3DKMA 4OMPA 2D8JA 3T9NA 4IUVA 4UC4A 2PJQA 4CC7A 3GOXA 4XU2A 4YTLA 2DYIA 2K5LA 2RNAA 4ZGDB 4Y72B 5IN1A 2JN0A 3CCQT 2RK2A 1VQPT 1OULA 2D0NA 4F7NB 1W2BS 3CCEQ 1G3WA 1KHCA 3OYMA 4J9BA 3GF5A 2FEIA 1JRIA 1WA7A 1UNLD 2DD5A 3WVDB 4MMKA 4HNVA 4BCMD 4M7DC 3M53A 3M9QA 1KD1U 4HNTA 3O5ZA 3I56Q 2PTKA 5A2QE 1SKUB 1BKBA 1PM3A 1AWOA 2CDTA 2WMBB 4B9WA 1H26B 3QHWB 2HSPA 1MNDA 2DXUA 2VASA 4O5VA 1U06A 4BY6C 3G6EA 5LMKB 4C8QA 2DL8A 3A98A 3A5ZB 2EPDA 1OEBA 4DEXA 4MDWA 3H0IA 2ED1A 4F7UG 4EOIB 1OI1A 2CP0A 1OU9A 4RODA 1GCQA 3B57A 2PVDB 1K8AR 4BCPB 4C0GA 1KC8R 5I5ZB 4KGVB 1F5QB 2WXVB 2JS2A 4UN0A 2CH4W 3I35A 2P0KA 1I8FA 2KT1A 3HRSA 4CC3A 3MEVA 2YUOA 2NUPB 1VYTA 1T3LA 1KFZA 1AZEA 4ME7A 4QVZA 3CMAA 1I1JA 2DEQA 1BYMA 2OAWA 2E65A 4M78G 4BCGB 1K73U 1K9MR 3HHTB 1I81A 4HL4A 5FU7B 1VQNQ 2UUEB 2YSQA 1DJ7B 2HL5C 5CAIA 2RB6A 4G6LB 3EFOB 3HO8A 1JXOA 3HKSA 4IURA 4ZN1A 5IF1B 1JJ2A 2JMCA 4KRTA 3G6ET 2YUQA 4EONB 4HCKA 5D7UA 2A3LA 4PJOE 4EDUA 5I11A 5GAN7 2XU8A 2NUTB 2QTVA 1U5SA 3HFOA 4IIMA 1VQ9A 1O9SA 2DMOA 1GXIE 1AEYA 4EMGA 2CT3A 3EIDB 1SRMA 3NGPA 3LH0A 2EAYA 4AFQC 1TU0B 1ZA1B 2KR6A 1PWTA 4PFPA 1M2VA 3P8HA 4LDYA 4M7AB 1HSQA 5DLOA 1G83A 2QDLA 3H8ZA 3QO3A 3CMAT 1D3UB 1NEGA 2HEQA 2XG8D 4ROCA 1QMCA 5C0MA 4J83A 4E7SA 2CREA 2L89A 3EGUA 4J6YA 1B3QA 4EC9B 2VYTA 3CC7Q 3M5AA 2DF6A 2DVJA 1KXUA 2O88A 1AZGB 1MV0B 2KXCA 3CBPA 2CZ7B 1OIUB 4OMMA 5I2MA 1R8OB 1X43A 4CC4B 5GAOr 3PFSA 2QEXQ 4E47A 3CCEA 2J05A 3I55Q 4F70B 2KRMA 1VQ9T 4D8DA 4CFWB 3M03A 1BI2A 3VU3C 1RADB 1OIYB 1VOMA 3S3MA 1E6HA 1TUGB 4RTUA 2W9ZA 3EOCB 5GAN3 3CCRQ 2FB7A 1KSWA 2W10A 4KRCB 3CCVT 3TW7A 1PHTA 3I56A 4M75E 2KMGA 2JW4A 2EYYA 2JUFA 3JCMV 1YJNQ 4J9EA 4KUIA 3BLQB 5KE2A 3OYGA 2JVVA 4HCCA 2RHYA 2QA4Q 4ZTFA 4GY5A 5GMKi 2C5OB 2A28A 2C5XB 3UWNA 4C5EA 1OZ2A 1PD0A 4JX6A 3CCJT 4JZ3A 2K7AA 2VUBA 4EORB 1C6VX 4PFOA 2WIHB 4A4EA 3CCET 3LWIA 4RKUE 1N8RU 4JZ4A 2IPOB 2ZAEA 2LCLA 4M7DF 5KYNA 3LYIA 3OBYA 4M77B 2YRCA 1K8AU 1KC8U 3SDZA 4PJOG 2PVGB 4FW2A 1M3CA 1H92A 2F2CA 3OYYA 1VQNA 1VYWB 4JJDA 3I56T 4Y28E 5ECAA 2M16A 1NEBA 4ESRA 3DLMA 3BLHB 3QDFA 5KE3A 3ZL7C 1VINA 4OB1B 3C12A 3LX7A 5GAOq 3G4SQ 1EZZB 4EOLB 3L2UA 2O9SA 2LMJA 3QHSA 3QYEA 4D8KA 1YHQQ 2DD5B 4XAXB 1OGUB 2DK3A 4FL6A 1X27A 3MEWA 3JCMc 2YDLA 2HAXA 1QVFA 4J9IA 1HXDA 4ROEA 2PUOB 3VS6A 1BU1A 1G5VA 4V2SA 5GAOl 3HTRA 1D1BA 2V8JA 1VQLQ 1TS9A 2B9RA 1B07A 1QVGS 1KJWA 1EIFA 2XIDA 4KH0B 2M0OA 3HZJA 1QMZB 1VQNT 2QQ8A 4JUVA 4LDUA 3P8BB 2NUZA 3M0RA 2PVOB 2K3BA 3CC7A 4E6RA 1YI2T 2DL5A 4M75G 5GAN6 2KGTA 5EJCA 3CCLQ 2CT4A 1N9SA 2QGFB 2F5TX 1H8KA 2QEXA 2GF7A 2P4RA 2DE0X 2Y4XA 3I55A 3E2UA 4EC8B 3SD4A 8ATCB 2LQ8A 3DDPB 2DL4A 3CCRA 5DQVA 1D0XA 4C92B 4YOZA 3L2RA 2EKOA 1MUZA 1E7PA 4EMHA 1CKAA 2MI6A 3VKGA 1YJNA 1UUEA 1NM7A 1R0CB 4RCCA 2L0AA 2K9GA 3EG1A 2RQTA 2L3SA 2RM4A 2QA4A 5L8RE 3CC7T 3QXEB 5FU7C 1LJOA 3NMZC 4R55A 2MAMA 1FMVA 4GBQA 3MI9B 1M1FA 3RBBB 2EVRA 3QJYA 2IG0A 2QEXT 4OMOA 1WHHA 1JO8A 2GQVA 3LW5E 1OX9A 3I55T 2NYSA 2QI2A 2KDSA 4XTWA 2ZZDA 2CUBA 2QK0A 2V1RA 1MGQA 3D7SB 4KGXB 1XNIA 3M57A 3TCJA 1S1NA 4ELJA 4LE9A 5A0DA 3CCRT 4M6VA 1ENWA 2KROA 3VS4A 1ACMB 2KQWA 1ABQA 2EYZA 3CXCA 4FCYA 1U8RA 3QZ9B 1N27A 2CSIA 1VQMQ 4Z88A 1IGUA 4M7AC 2IW8B 2DZ9A 4C8QD 2JT4A 3G4SA 3TQ7P 2QQSA 5CK9A 4MDXA 4X9DA 2AKKA 4F7UB 2QA4T 1M2OA 3BDLA 3HRUA 3MEUA 1YHQA 5GAN5 2C06A 2NUPA 2J06A 4N4HA 4M75A 3KXTA 2KNBB 4RUGA 2OTJQ 4NL3A 1PNJA 3SB2A 2PMIB 2IVWA 3CC2Q 3TSWA 1UHFA 3HPWA 5FLXE 3OSSC 3L2ZA 4BUGA 3Q1JA 1H1RB 1UJYA 1VQLA 4M78B 1G3SA 3EFOA 2LNVA 1N9RA 4HT8A 5GAMe 2K57A 3RDVA 1GBRA 4I3ZB 5HY6A 1UG1A 2WACA 2BS3A 3CBOA 3A8HB 1MMDA 5FWCA 1BB9A 4WTOB 3G71Q 4OP0A 1RUWA 4DBQA 2HBPA 1GL5A 4J5YA 2NUTA 1I0CA 2ECZA 3E1SA 3VS1A 3G4ST 4HNUA 4CFUB 3CCLA 2EGEA 2P84A 4M7DE 3CCUA 1RAHB 2SEMA 4BDYA 1ZBXA 1YHQT 4OMNA 5GANd 4J9HA 3QYHB 4M7AA 4XTVA 3PO3S 1UNGD 4BCNB 1JJ2S 2D1XA 3EG3A 3RR6A 2ZPGB 2K4YA 2KT8A 1UTIA 3RNJA 1X2QA 2C0OA 1VQLT 1Q95G 4NL2A 4CXAB 3JV3A 4JRPA 1NPRA 1HK9A 1WJQA 4WCIA 1ZSZA 1H1SB 1OKWB 1JB0E 2QG9B 2X4YA 2EQKA 4Q5WA 3CCST 3BDUA 1OYXA 3JB9H 4EOMB 4ZGEB 2YXYA 3TN8B 2KR3A 3I5SA 1VQOQ 1KQSA 4PJLA 3OBWA 1BI0A 1UHCA 3CPWP 3OMCA 5CO7A 5L2WB 2K6DA 3CCLT 5HK0A 4PL6A 3MO8A 1X01A 1NYGA 1SRLA 1SPKA 1YP5A 2EGAA 2X35A 3HSBA 1Y0MA 1Q86C 1D1AA 5IHNA 3PIOA 4EOQB 3JRZA 3X26B 2E12A 3EFSA 4A54A 1H3ZA 1RAIB 2RH2A 2QGGA 3VS0A 4YOOA 4PLIA 3C94A 1JBMA 2EGCA 5IDPB 3IQLA 4FYVB 1WGSA 3SEMA 4O6JA 4AMCA 3GP8A 1URCB 2F2XA 4F6SB 3VS5A 3CMEQ 5CVIA 2VGNA 1VQMA 4F7SB 1G8XA 3PMIA 3CCMT 4FW1A 3C0CA 4B6MA 4AFSC 2FZGB 4JS5A 3A1PA 3OS5A 5KYUB 4BBRM 1VYUA 3M0QA 1Q82C 1IREB 2MK5A 3J80E 4M77A 4DBFA 1PKTA 4KRDB 2YUPA 2LX9A 3FDRA 2OTJA 4TTHA 3REBB 4LDWA 1GCQC 3CC2A 2ROLA 2KAFA 2MYSA 9ATCB 2D9TA 4PJOB 2DILA 2AHJB 4M7DG 1SHFA 4QQGA 2ENMA 1JSUB 3E19A 3BHVB 4KUDK 1H3HA 2CCIB 4OMQA 3OYBA 2DJQA 3G71A 2PK9B 2M51A 2DERA 4KH1B 3VYGA 3QWXX 1OL2B 1EFNA 3M0PA 1N4MA 4OVAA 1VQMT 4C0FA 2ESWA 1M90U 1NYFA 1AWXA 2IIMA 1VQ5T 2O01E 2ZZDB 5LJ5e 1FXXA 3QSUA 2CCHB 3OYDA 1TFBA 2BKDN 2WSCE 2RK1A 2DJZA 4LUDA 2BS4A 1WPYA 2M9UA 3F70A 1O9KA 2DYBA 3OS1A 2PUKB 3VKHA 1C9BA 1YWOA 2OTJT 4OB3B 5CEIB 2GTOA 3CC2T 3OS2A 4L59A 3OYAA 1V76A 2CJMB 1IXDA 2FYKA 2HKNA 4AKHA 3H4CA 2F69A 3OA6A 1LOJA 2E3HA 2JM9A 4A4KA 2QGSA 4MFEA 1AWJA 1M27C 3DL1A 4DEYA 1H28B 2MF2A 5AYFA 5HK3A 1QVFS 3AT1B 1KIKA 3G71T 1YJ9Q 4DOVA 1V1CA 4M75B 3JCMb 4AG2C 4II5B 3BHTB 1VQOA 2CP2A 3MIAB 1XO2A 5L23A 3CBMA 2QFZA 5HQ0B 3TEEA 3PT9A 2DX1A 2LZ6B 2P0QA 2AZVA 2PZ1A 4DQ2A 4C92A 3QWLA 1X69A 4HLQA 2H3JA 3SWNB 3UA6A 1NJIU 2CS7A 5CR2A 2NWMA 2GTJA 3QYBA 1MHNA 2O2OA 4F6WB 4HA8A 2DD4A 4BI3A 3JB9I 4FX3B 4LDXA 1RL2A 5KH6A 3V7CA 3ME9A 2JOYA 1RABB 1RI9A 1QCNA 4PKCC 1I4K1 1M30A 2JTFA 3CMEA 2J7IA 4IUPA 5LJ3j 1Y7XA 1PRMC 4AKIA 2EJ9A 4F04B 3FLGA 3L2WA 2EJGA 1RAEB 2DO3A 4NS5A 1P92A 2PU9B 4E7KA 5KYXA 4Y92A 1VQOT 3X24B 2GGRA 2XDDA 4BY1X 3CC4A 2G6FX 2XKOC 2J6KA 5LQFB 4EOSB 1UNHD 4Z8AA 4ZGJB 1KD1C 1JEGA 1CKBA 2H8HA 2DMEA 1Q7YU 3PVQA 2E6ZA 3LGLA 2IN3A 4LUEA 2KEAA 2QTXA 4C0DB 3RKYA 4WF2A 4MIMA 1GH6B 1ZSZB 3VV0A 1BCMA 1W2BP 3L2VA 5IHYA 1HD3A 2QASA 4C5GA 2HMAA 3MY1B 4R0KA 4E7HA 4F7UA 5GJVB 3EG9B 4OR5B 5KYWB 1MNEA 4A53A 4KBMB 3S6WA 3J81E 5D6YA 3CMET 2L5QA 2JXBA 2E70A 2GNCA 2K5IA 4BCQB 1WHJA 4C8QF 2EWNA 3OYIA 1X75C 3JCMd 2EKHA 4RTTA 2O4XB 2CP6A 4EOKB 4XU3A 3QJ6A 1I5OB 2LQKA 1FKMA 1VYVA 4MFDA 4J7IA 4BI4A 3RGFB 2QQRA 1Y96A 3M55A 1VQ6Q 1Y57A 4M78A 3EFRA 3JCMh 2WEVB 5CCAA 3JB9F 1K73C 1W4SA 4JRIA 2RHUA 2K3XA 3V7SA 4XU0A 2QDYB 4ELYC 4L6V5 3E9GA 1G3YA 5LL6S 2ED0A 3JCMX 2GBQA 1YCYA 3QG1A 3UATA 5BNJB 4BI8B 3EHRA 1QVFP 5GMKj 3RMSA 1M1GA 3G33B 2KK4A 5LJ3d 1UEBA 1GUXA 1YJ9A 4XU1A 5EG2A 2EFIA 1UGPB 1M8MA 3G1JA 4E7JA 2K2MA 4CFNB 1C1AA 1OOTA 2ZPIB 4BCKB 3S3NA 2BS2A 2JTEA 2WMAB 3RUXA 5LJ3h 4OGCA 2DKGA 3A8GB 4M4ZA 1MV3A 4M7AD 1PCXA 4JS4A 4LNPA 2X3WD 1WHGA 4BE1A 1K9MU 2ZCFB 3OYKA 1Q81R 1TG0A 3GTMS 1MMAA 1ZA2B 4JRQA 1PKDB 3OW2A 1M1KC 1I07A 4FIBA 5A0LA 2HBWA 1E9HB 2RI5A 1WYXA 2JJ9A 3VYGB 1QCOA 2YLBA 4XK8E 1R0BG 2BKZB 1Q86R 2V1QA 2A36A 2GQIA 1QWFA 5GAN4 3PIPA 4PJOC 4FSSA 2HSEB 3P8DA 2EYXA 1AVZC 1HJDA 1FWZA 2XDPA 1YJ9T 2KVQG 2JNGA 5GAOm 1O9KB 1IZ6A 3ULRB 3POMA 3FIFA 4CRLB 4K11A 3DLLA 1WHKA 3A8MB 2HQEA 3M54A 3RMQA 1GY3B 2O9VA 4JPBW 1IRXA 5FWBA 2RF0A 4HKEA 4JJBA 3RESA 2VKNA 1MMGA 3REAB 3FRNA 2D0QB 1KQSS 5HNBB 1Q82R 1K1ZA 4C0ZA 1H27B 1JQQA 1T0HA 5ACBA 4AI6A 2G3RA 3CCUQ 2CUDA 3VRYA 1ZUUA 1OPLA 2Y90A 4JLGA 3M0TA 1ZX6A 3OSVA 3QKJA 4N0AA 4QT7A 4JJNK 3VUZA 2FO0A 5KYUA 2QF7A 1RAAB 2RJCA 1KHIA 2RQUA 4ELZC 4LDVA 5GMKh 2E4HA 2KYBA 3VRZA 5HVYB 3EG2A 1N8RC 1M8VA 4BE2A 2EQIA 1UGVA 4HT9A 3EH2A 4M77D 4PJOA 3GLXA 3CEYA 1K8AC 4QSHA 1KC8C 1VQ6A 2FPEA 3LQ5B 1AT1B 4HVUA 3UT1A 1QCFA 2DD4B 2UZEB 4M75C 3L42A 1TSFA 1WIEA 2DRMA 3I5RA 4FYYB 4M7DB 4BD3A 5HCKA 2XD0A 2V26A 3OYEA 3MEAA 2KMTA 3NDQA 1WX6A 3JCMf 2QDJA 4Z89A 2DL3A 2VXFA 1YITQ 5GANj 1U1SA 4IUUA 1QP3A 3JCMg 2BE7D 3VYHB 5KYXB 4CI0C 3THKA 3EH1A 2DZCA 3S3OA 1WHLA 1S72A 3WXMB 1K0XA 2K2VA 3L1AA 4X1VA 2RHIA 3KUFA 1H24B 1ZP2A 4J8OA 1OQKA 3LWHA 4N4GA 1D1CA 1YJNT
chains in the Genus database with same CATH topology
1VQ6T 1YBYA 3JCMP 4IURA 3ZBDA 1WGSA 4ZN1A 1JJ2A 1Q7YC 3G6ET 2RD1A 5CQYA 5J39A 3PNWC 3M56A 4O6JA 5LJ3f 5FRMA 3OYJA 2A3LA 3GP8A 4PJOE 2FVUA 4EDUA 1Q81U 1YI2A 5CVIA 2VGNA 4L5GA 3V7RA 2A7YA 1VQMA 1YJWT 5GAN7 2XU8A 3HFOA 3PMIA 5LJ3g 3GPLA 3CCMT 3HB9A 1VQ9A 1O9SA 1GXIE 4Z02A 4EMGA 4MZTA 4JX5A 4KT0E 4C8QE 4JS5A 3LH0A 3JB9D 2EAYA 2DAQA 3OS5A 2KR6A 4BBRM 1M9SA 2I2LA 1IREB 2QQAA 3EAEA 3M4GA 4C0DC 1NZ9A 3J80E 4M77A 3HP9A 2WJ9A 3P8HA 4LDYA 4AKGA 2FL7A 3MP8A 2DXCA 5DLQE 4M7AB 5DLOA 3FDRA 1Y96B 2LX9A 3H8ZA 4XTUA 4QVDA 1Y07A 5GAMj 2OTJA 3QO3A 4LDWA 5LJ3e 2YRVA 3CC2A 2VXEA 4DOWA 3CMAT 2DVEA 2KAFA 4VUBA 4F7UF 3J7AF 1ZQ1A 5CKBA 2XG8D 2OAUA 2D9TA 4PJOB 3SWNA 3M4YA 2VC8A 5C0MA 2E10A 4J83A 3NTKA 2AHJB 2LCCA 4M7DG 4OB0B 4QQGA 3PGGA 3X28B 3E19A 2CGHA 2DPPB 2L89A 4EPCA 4KUDK 4C92D 2RI2A 5GAN2 4C8QB 4J6YA 1ZHIA 2ZGWA 2VYTA 4RG2A 4XTYA 5CKFA 4ZN3A 3RERA 2XDBA 5C6SA 4E7IA 3M5AA 3OYBA 4NOYA 3G71A 2QQ9A 2R5AA 4BBSM 5I2MA 3CBPA 2CZ7B 2ZPFB 3GNGA 5GAOr 1R8OB 3CPFA 2R5MA 3PFSA 5DY9A 1VUBA 3VYGA 3OYFA 3FC3A 4M78F 4E47A 1BI1A 3CD6A 3CCEA 2DIGA 3JCMQ 4OVAA 4JDSA 5LJ5j 1VQMT 2X4JA 2GCXA 2DXBA 4C0FA 1B34A 1VQ9T 1Q82U 1M90U 1VQ5T 2O01E 1BI2A 3VU3C 2ZZDB 5LJ5e 1FXXA 3ER0A 3S3MA 3QSUA 3QPHA 4JRKA 4Y91A 3OYDA 1XTDA 5GAN3 2BKDN 2WSCE 2GFUA 2LRQA 4PLLA 5KCOA 2RK1A 2FB7A 2DJZA 2BS4A 2V8KA 3NTIA 1WPYA 2DTHA 2M9UA 3TW7A 1KQ1A 3F70A 4GLKA 4QQ6A 5CIUA 5GANh 3I56A 2MWPA 3OS1A 4M75E 2PUKB 4CRIA 3VKHA 2KMGA 2OTJT 2JTMA 4OB3B 2CZ6B 3CC2T 3JB9J 3OS2A 4HCZA 4L59A 2JUFA 4IUQA 4MZPA 3OYAA 3JCMV 3E9FA 2JZ2A 4M77E 2FYKA 2WSFE 4KUIA 4LDXA 2QQBA 1X6OA 3FJPA 4BDZA 4AKHA 4M77C 3H4CA 2F69A 3OA6A 5KE2A 3OYGA 2JVVA 5CKEA 1LOJA 4HCCA 1K9MC 1XOVA 2RHYA 4A4KA 3OYHA 4ZTFA 4GY5A 2PQWA 2XICA 4MFEA 2XK0A 5GMKi 4ZTJA 3JSCA 3UWNA 2EQUA 3DL1A 4C5EA 2MF2A 5AYFA 1OZ2A 5HK3A 1QVFS 4JX6A 3O8VA 3CCJT 1QLBA 3SWNC 3G71T 2MWOA 2VUBA 1VIFA 4DOVA 1UGRB 4BY6B 5GAOn 3M59A 4M75B 4X34A 3JCMb 3CCUT 1FX7A 4M7AG 4A4EA 1N6AA 3CD6T 3CCET 1YITA 3LWIA 1VQOA 4II1A 2YLCA 4RKUE 1N8RU 2MMPA 2LCLA 4M7DF 3CBMA 3LYIA 3OBYA 4M77B 3CPWS 2QFZA 2O4XA 4E7LA 5GMKe 2LVMA 3TEEA 1KC8U 1K8AU 3SDZA 3PT9A 4OMFB 4PJOG 2PVGB 5GAMd 4Z6YA 2P0QA 4DQ2A 4J7FA 3OYYA 5DM7R 4C92A 4JX4A 3A8OB 3QWLA 3QDRB 1VQNA 4C8QG 3I56T 3OQ5A 4HLQA 2H3JA 4Y28E 1PSEA 3SWNB 2M16A 1NJIU 2CS7A 2RJFA 2GFAA 2B8AA 3DLMA 5CR2A 5GAMh 5J3BA 5GAOp 4J6WA 3QYBA 1MHNA 5KE3A 4M78D 3G7ZA 4EMKA 4HA8A 2DD4A 3C12A 4OB1B 3PMTA 4BI3A 3JB9I 3HFNA 3LX7A 5GAOq 2CYZB 1RL2A 3RKWA 3KHIA 3X20B 3V7CA 5KH6A 3ME9A 3BG9A 2JOYA 3N5BB 3L2UA 4R56A 1VQPA 3AHUA 5IAYA 2QXFA 4XTZA 3QYGB 4C5HA 2K5FA 3QYEA 3QHSA 4PKCC 1I4K1 2JTFA 4A4FA 5FU6B 3CMEA 3JCMW 2P0PA 3ASKA 2DD5B 4XAXB 5LJ5d 2DK3A 1VQ7A 4X9CA 4FL6A 2VGMA 2LDMA 2R58A 3MEWA 4IUPA 1Y7XA 5LJ3j 1YIJA 3A8LB 3JCMc 2EJ9A 4AKIA 1B34B 1Q86U 2HAXA 3FLGA 3L2WA 2EJGA 5HKCA 2DO3A 3KBGA 1P92A 2PU9B 3META 1HXDA 2L8DA 2XI9A 3QBYA 4NS5A 5J26A 5I2SA 3X24B 1VQOT 2XDDA 1S72T 2PUOB 3C95A 2DIQA 3CC4A 5LJ5h 2XKOC 1G5VA 4V2SA 5GAOl 2V8JA 4RG8A 4ZGJB 1KD1C 1H641 1QVGS 1AHJB 1EIFA 1I5LA 2XIDA 4MMLA 1Q7YU 2M0OA 2E6ZA 3LGLA 3HZJA 3CPWA 2QTXA 4C0DB 3RKYA 1VQNT 4WF2A 2QQ8A 4MIMA 4JUVA 3GIBA 2KY9A 4LDUA 1UB4A 3OB9A 3P8BB 3VV0A 1V29B 3NTHA 2ZPBB 5GAN8 1UGSB 2DXTA 3MHXA 4FT4A 3ZEHA 1WQWA 4M7AF 3VJPA 3L2VA 2PVOB 2CZ1B 4C92E 3CC7A 3LLRA 4C5GA 1D3BB 1YI2T 4RCBA 4A4GA 4M75G 3CCSA 4C92C 4PNOA 4E7HA 1VQ8A 2OTLA 2LTOA 2X4XA 4PJOF 5EJCA 4F7UA 5GAN6 3OS0A 4M7DD 1N9SA 2F5TX 2EQJA 5IT9E 1M4ZA 4A53A 2QEXA 1BIAA 2GF7A 4KBMB 4M77G 3S6WA 3J81E 4BB7A 5D6YA 3OYLA 2ZPEB 2L5QA 2Y4XA 3V8JA 3CMET 4P5NA 2E70A 5D6XA 3I55A 2K5IA 5FRNA 4C8QF 1VQ7T 2EWNA 4EMKC 3SD4A 2CKKA 3OYIA 1X75C 4TVRA 3JCMd 1YIJT 2P4TA 1YITT 4LD9K 4N4IA 2L3RA 2LQ8A 2O4XB 3QIIA 4XU3A 3QJ6A 2LQKA 4OF1A 1FKMA 4LOCA 4MFDA 1WNLA 2EIFA 4J7IA 1WQ7A 4BI4A 3CCRA 3OW2S 2QQRA 1Y96A 3FB9A 3M55A 1O75A 4OGEA 4M78A 3EFRA 4C92B 3L2RA 3VKIA 3JCMh 3HL8A 5CCAA 2EKOA 3JB9F 4DA4A 1K73C 1E7PA 5I21A 4EMHA 1W4SA 4ATOA 4FM4B 5CKDA 2MI6A 2KSSA 4JRIA 3VKGA 1YJNA 2RHUA 1QP2A 2K3XA 3R6OA 3V7SA 2RJDA 1OZ3A 4RCCA 2QDYB 4XU0A 3URGA 4ELYC 1TH7A 4L6V5 3BG5A 3E9GA 5M9OA 1G3YA 4MZMA 3HBLA 5LL6S 5GANf 1QVGA 4HCBA 3FEOA 2RM4A 3JCMX 1VQ4A 2QA4A 1YCYA 3QG1A 2E64A 4BI8B 2E6NA 2Y4YA 2LT1A 5L8RE 3CC7T 5GANg 3QZ5B 2E41A 3QXEB 5FU7C 1LJOA 5GMKj 3RMSA 4R55A 1M1GA 2RA2A 2MAMA 2KK4A 3CCMA 2WSEE 2V8IA 3OMGA 1M1FA 1M5Q1 1UEBA 5LJ3d 2FHDA 1YJ9A 1VIEA 1VQ8T 2OTLT 1Q81C 5FROA 3QJYA 4XU1A 4RMOA 4IKFA 2IG0A 2QEXT 5EG2A 2DTOA 2DXCB 2EFIA 1UGPB 2GQVA 4QVCA 1PSFA 2LT4A 3HRTA 3LW5E 4E7JA 3I55T 2QI2A 2KDSA 4XTWA 2ZZDA 2E5QA 2ZPIB 1BI3A 3S3NA 4F7UE 2DTIA 1MGQA 3MCAB 2BS2A 4FU6A 1NE8A 3RUXA 5GANe 4BACA 5LJ3h 4J6XA 4OGCA 3ZFJA 1XNIA 2DKGA 3A8GB 3M57A 3TCJA 1G3TA 1WJSA 3BY7A 4M7AD 3DB3A 4ELJA 4JS4A 5A0DA 2HQXA 3CCRT 4M6VA 3C4SA 4M75F 1LNXA 2ZCFB 3BFMA 3OYKA 4BE1A 1K9MU 2RO0A 2EQMA 2KQWA 3LGFA 3CCQA 4PJOD 4XQ3A 4JRQA 4M77F 3OW2A 1M1KC 4M7DA 3MP1A 3JB9G 1NPPA 3CXCA 4FIBA 1U8RA 4XTXA 5A0LA 3QZ9B 2RI5A 2VV5A 1N27A 1Y71A 4IUTA 3VYGB 3PTAA 1QVFA 2K3YA 4M7AC 2ZPHB 4M78E 2G77A 1QVPA 2YLBA 2DZ9A 4XK8E 4C8QD 3OYCA 3G4SA 4KULA 2NLUA 2E1HA 2QQSA 4M78C 5CK9A 2DXBB 4MDXA 4X9DA 3V8KA 4F7UB 1VQ4T 2QA4T 5GAN4 3BDLA 3HRUA 3MEUA 5GAMf 3PIPA 1YHQA 3RIRA 4BE0A 4PJOC 5D6WA 3P8DA 5GMKl 5GMKm 5GAN5 4E7KA 2C06A 4N4HA 2RJEA 1VQ5A 1FWZA 2XDPA 4M75A 3KXTA 3INZA 3L2QA 3SFMA 1YJ9T 2KVQG 2JNGA 5GAMg 5GAOm 3MP6A 1VQKA 3H6ZA 1IZ6A 4NL3A 3SB2A 4C8QC 2IVWA 3OYNA 4C92G 5A0GA 3FIFA 1M90C 2BIVA 3HPWA 3OY9A 3DLLA 3V8LA 3OSSC 2CZ0B 2HQEA 3A8MB 3WVEB 2YHTA 3L2ZA 3M54A 4FT2A 3CCVA 1Q82C 3DKMA 4OB2B 2EJFA 3RMQA 4BUGA 3T9NA 4IUVA 3Q1JA 4UC4A 1VQLA 4M78B 1G3SA 1SSFA 2XHCA 1QW1A 2LNVA 3JCMJ 3GOXA 3BG3A 1N9RA 4XU2A 4HT8A 4YTLA 4HKEA 2K57A 2BUDA 3RESA 5GAMe 2K5LA 1M1KU 5HY6A 3RKXA 4A4HA 2WACA 4ZGDB 2BS3A 3FRNA 2D0QB 3A8HB 3CBOA 3UPUA 1KQSS 1BIBA 4QQDA 5LJ5f 5IN1A 2JN0A 4OP0A 3CCQT 2RK2A 1VQPT 4C0ZA 3VUBA 2HBPA 4AI6A 2G3RA 1W2BS 4J5YA 1G3WA 1KHCA 3OYMA 2Y90A 4JLGA 5LJ5g 3CCJA 3GF5A 3OSVA 3QKJA 2HD0A 3E1SA 2R57A 4N0AA 3G4ST 3VUZA 4HNUA 4JJNK 1KQ2A 1JRIA 3CCLA 3JAME 4M7DE 3CCUA 4NC6A 1XQHA 2DD5A 3WVDB 3M58A 2QF7A 4HNVA 1WJRA 2RJCA 4MMKA 1KHIA 4BDYA 1ZBXA 1YHQT 4M7DC 5GANd 1KG1A 3M53A 4ELZC 3QYHB 4M7AA 3M9QA 1KD1U 4LDVA 4HNTA 4M75D 5GMKh 3CXCS 4XTVA 3CC4T 5CKHA 4D6WA 2EYQA 5A2QE 1VQKT 1N8RC 2LC4A 4B9XA 1M8VA 1BKBA 4BE2A 1JJ2S 5KCHA 4HT9A 4M77D 4B9WA 4PJOA 3GLXA 3CEYA 1K8AC 4QSHA 1KC8C 2ZPGB 3TW6A 1VQ6A 2X4WA 2K4YA 2DXUA 3UT1A 4EMKB 4O5VA 3CCVT 1VQLT 4BY6C 2DD4B 4NL2A 3G6EA 4C8QA 4M75C 4JRPA 1NPRA 3L42A 2D6FA 1HK9A 1WJQA 3A5ZB 1JB0E 5CQXA 1RI0A 4QW2A 4MDWA 4BD3A 1NJIC 2X4YA 4M7DB 2XD0A 2EQKA 4F7UG 2RI3A 1YJWA 1OI1A 3OYEA 3BW1A 1U1TA 4LD6A 3MEAA 4Q5WA 4C5IA 2KMTA 3CCST 3QUIA 3BDUA 2PVDB 1OYXA 4C0GA 4C92F 3JCMf 3JB9H 2QDJA 1D3BA 4ZGEB 2VXFA 2RHXA 2HNIA 5GANj 2P0KA 1KQSA 3OBWA 1BI0A 1I8FA 1U1SA 3HRSA 4IUUA 1QP3A 5FLXE 3MEVA 3JCMg 3TU4K 3VYHB 3OMCA 5CO7A 3CCLT 4CI0C 5HK0A 1W2BA 4ME7A 4PL6A 4QVZA 3MO8A 1X01A 2DZCA 3DB4A 3GNFB 3CMAA 2DEQA 3UDCA 3S3OA 1BYMA 3HSBA 2X35A 2E65A 4M78G 1S72A 3TREA 1K73U 1UGQB 3HHTB 1I81A 4JLIA 4HL4A 3WXMB 1Q86C 2K2VA 3L1AA 5FU7B 3X25B 3PIOA 3NFCA 3JRZA 3X26B 2RHIA 3KUFA 1DJ7B 5CAIA 4FSXA 4N0AC 2E12A 3EFSA 4A54A 1H3ZA 3JCMe 4J8OA 2RB6A 2M1HA 2RH2A 3LWHA 4N4GA 5FU6C 2RHZA 4PLIA 3C94A 1JBMA 3HO8A 4M7AE 1YJNT 3HKSA 2F5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OB2 B;  2CZ0 B;  1UGR B;  4RKU E;  4ZGD B;  2D0Q B;  3A8H B;  1GXI E;  4KT0 E;  2PVG B;  4FM4 B;  1IRE B;  1QP2 A;  3A8O B;  2QDY B;  4L6V 5;  2DXC A;  4Y28 E;  1PSE A;  2DD5 A;  3WVD B;  5L8R E;  3QZ5 B;  3QYH B;  3QXE B;  2DD4 A;  4OB1 B;  2WSE E;  2CYZ B;  2AHJ B;  3X20 B;  4OB0 B;  3X28 B;  3QYG B;  2DPP B;  2DXC B;  1UGP B;  1PSF A;  3LW5 E;  2ZPG B;  2DD5 B;  2ZZD A;  2ZPI B;  3A8L B;  2DD4 B;  2CZ7 B;  2ZPF B;  3A8G B;  3VYG A;  2PU9 B;  1JB0 E;  3X24 B;  2ZCF B;  2PUO B;  2DXB A;  2O01 E;  2ZZD B;  2PVD B;  4ZGJ B;  4ZGE B;  1AHJ B;  3QZ9 B;  2WSC E;  3VYG B;  1QP3 A;  2ZPH B;  4XK8 E;  3VYH B;  2PUK B;  2DXB B;  1V29 B;  2ZPB B;  1UGS B;  4OB3 B;  2CZ6 B;  2PVO B;  2CZ1 B;  1UGQ B;  3HHT B;  2WSF E;  3X25 B;  3X26 B;  1DJ7 B;  2ZPE B;  3A8M B;  3WVE B; 
#chains in the Genus database with same CATH topology
 1VQ6 T;  3JCM P;  1LVK A;  2UZL B;  1VQP Q;  1PG5 B;  2DRK A;  5J39 A;  3PNW C;  3M56 A;  5LJ3 f;  5FRM A;  2F2W A;  3OYJ A;  2FVU A;  1Q81 U;  4L5G A;  2A7Y A;  2C0I A;  3QWY A;  1VQ7 Q;  5LJ3 g;  3HB9 A;  4C8Q E;  2AK5 A;  5KYY A;  2I0N A;  3JB9 D;  3EAE A;  1WZO A;  1M9S A;  2DBM A;  2I2L A;  2QQA A;  3M4G A;  4C0D C;  1ZSZ C;  2WJ9 A;  1SEM A;  1QKW A;  1Y96 B;  1RAF B;  4XTU A;  1QVG P;  2YRV A;  4DOW A;  5ICP B;  4VUB A;  1ZQ1 A;  2OAU A;  3BLR B;  3SWN A;  3M4Y A;  2HZY A;  3NTK A;  6AT1 B;  1X2K A;  2CGH A;  2DPP B;  1OL1 B;  4EPC A;  2VB6 A;  4C92 D;  2RI2 A;  5GAN 2;  2R7G A;  2M0Y A;  4YC3 B;  3H0H A;  1ZHI A;  2ZGW A;  4RG2 A;  4XTY A;  1NG2 A;  1KQS P;  5IDN B;  2R5A A;  4F17 A;  2ZPF B;  1TUC A;  2RMO A;  3CPF A;  2J6O A;  2R5M A;  1GUX B;  1YFN A;  1BI1 A;  2BPM B;  1YWP A;  2D8H A;  2LNH B;  1Z9Q A;  3FJ5 A;  4JDS A;  5LJ5 j;  2LQN A;  1KD1 R;  2DXB A;  5FGK B;  1Q82 U;  1YCS B;  1H1Q B;  1AIS B;  1NLO C;  4Y91 A;  4A63 B;  5KCO A;  2LRQ A;  4PLL A;  2V8K A;  1FIN B;  4GLK A;  2DTH A;  5GAN h;  1KQ1 A;  5CIU A;  1UFF A;  4CRI A;  2JS0 A;  2JTM A;  1TXQ A;  4IUQ A;  4KGZ B;  1X6O A;  4BDZ A;  4M77 C;  4ELL A;  2C5N B;  4LN2 A;  2QAZ A;  2VVK A;  1X6B A;  2PQW A;  2XK0 A;  4ZTJ A;  3JSC A;  5FW9 A;  3EG9 A;  5KYW A;  5DQW A;  4BCM B;  1QLB A;  2MWO A;  1VIF A;  2F1L A;  1UGR B;  2CP5 A;  3CCU T;  4FYX B;  1FX7 A;  1N6A A;  1YIT A;  1ARK A;  4LXC A;  2BZ8 A;  1K73 R;  2IW9 B;  2O4X A;  1AD5 A;  1PC0 A;  2EW3 A;  2MOX A;  3K7A M;  4Z6Y A;  4AG1 C;  5DM7 R;  2PK2 A;  2JGZ B;  3QDR B;  4PFZ A;  3EGD A;  4C8Q G;  3OQ5 A;  2IVX A;  2B8A A;  1E6G A;  2LP5 A;  2KXD A;  4J6W A;  4PJM A;  4M78 D;  4EMK A;  1RLP C;  3PMT A;  1X6G A;  2PHG A;  3RKW A;  3X20 B;  2ROT A;  3BG9 A;  3N5B B;  1VQP A;  4R56 A;  3AHU A;  4GLM A;  2HDA A;  5IAY A;  3QYG B;  2FPD A;  4C5H A;  2WPA B;  5FU6 B;  3JCM W;  1TOV A;  2P0P A;  3ASK A;  4AT1 B;  2CH4 A;  1BBZ A;  5LJ5 d;  1VQ7 A;  3MY5 B;  2KI7 A;  2LDM A;  2R58 A;  3CC4 Q;  1B34 B;  1VQK Q;  2I53 A;  1MMN A;  1H25 B;  3MET A;  4CFU D;  3KBG A;  2AT1 B;  2L8D A;  5J26 A;  5IH2 A;  1YIT T;  5I2S A;  3CCV Q;  1M1K R;  2W2H A;  5LJ5 h;  2W99 A;  3VS3 A;  4RG8 A;  3TNW B;  1H64 1;  2FRW A;  1SF9 A;  3CPW A;  1B7T A;  1UDL A;  4J9D A;  4BCN D;  1BK2 A;  3EG0 A;  4CC2 A;  5CYI B;  1JXM A;  1V29 B;  5GAN 8;  4M7A F;  1UGS B;  2DXT A;  3MHX A;  4FT4 A;  1WQW A;  1W1F A;  3VJP A;  2CZ1 B;  3LLR A;  2M02 A;  3CCJ Q;  4C92 C;  1FMW A;  2X4X A;  4BCO B;  5IT9 E;  2EQJ A;  1IHW A;  4RTZ A;  2IW6 B;  4BB7 A;  3OYL A;  2ZPE B;  3V8J A;  2MIO A;  4P5N A;  2J6F A;  5D6X A;  1VQ7 T;  2CKK A;  4LD9 K;  5EFQ B;  3QHR B;  1WI7 A;  3GBQ A;  3QII A;  1JJ2 P;  2DBK A;  2BTT A;  1WNL A;  2EIF A;  3OW2 S;  3FB9 A;  3BHU B;  2W96 A;  5IHI A;  2FZK B;  1H1P B;  3EGX A;  2AKL A;  1ZBJ A;  2COW A;  2Z0W A;  4DA4 A;  4FM4 B;  5CKD A;  2WIP B;  2KSS A;  1FVV B;  1QP2 A;  4AFU C;  3R6O A;  2RJD A;  1OZ3 A;  1YJW Q;  1OU8 A;  3URG A;  2EBP A;  5AT1 B;  1IB8 A;  1TH7 A;  5GAN f;  5M9O A;  2WHB B;  2EUF A;  4CFX B;  3MPU B;  2O31 A;  2LT1 A;  3M0U A;  5GAN g;  2E41 A;  1N8R R;  5KYY B;  4BCI B;  2WSE E;  2V8I A;  2FHD A;  1VIE A;  1QWE A;  4RMO A;  4IKF A;  1UE9 A;  2DTO A;  2L3Q A;  4QVC A;  1A0N B;  1PSF A;  2LT4 A;  3HRT A;  4HVV A;  1N5Z A;  1YN8 A;  1JST B;  1VA7 A;  1BI3 A;  2DTI A;  4FU6 A;  3MCA B;  1VOL A;  4AFZ C;  1NE8 A;  1WXB A;  3ZFJ A;  1M3A A;  1PRL C;  1WJS A;  3BY7 A;  3VS2 A;  3C4S A;  3BFM A;  4F14 A;  2RO0 A;  1PKS A;  4JJC A;  1OI9 B;  1WXU A;  4PJO D;  1FMK A;  4XQ3 A;  4M77 F;  4ZNX A;  4M7D A;  3MP1 A;  2VWF A;  5GJW B;  1NPP A;  2KBT A;  1W98 B;  4XTX A;  2X3X D;  1YI2 Q;  4IUT A;  2K3Y A;  1JU5 C;  1ZLM A;  1OKV B;  2NLU A;  4M78 C;  2HCK A;  3UF4 A;  2DXB B;  1TWB A;  2PNI A;  3V8K A;  2LW4 A;  3BE3 A;  4BE0 A;  1XJW B;  2G9X B;  2RJE A;  4HXJ A;  3INZ A;  3L2Q A;  3SFM A;  2AZS A;  3KFV A;  1VQK A;  2COY A;  1D09 B;  2RQW A;  1PD1 A;  2MCN A;  4BY7 X;  1T3S A;  1M90 C;  4YOS A;  2BIV A;  3V8L A;  2CZ0 B;  2YHT A;  1TD6 A;  3CCV A;  2DLP A;  4OB2 B;  2EJF A;  2FPF A;  1SSF A;  2XHC A;  1QW1 A;  3JCM J;  3BG3 A;  2UZD B;  1FYN A;  1AWW A;  2BUD A;  1M1K U;  4A4H A;  1SSH A;  3UPU A;  1BIB A;  4QQD A;  5LJ5 f;  4BCF B;  3VUB A;  2C5V B;  3CD6 Q;  2AIR B;  5LJ5 g;  2A37 A;  3CCJ A;  2A0F B;  2HD0 A;  1OPK A;  2R57 A;  1KQ2 A;  4ANJ A;  2FG0 A;  1J3T A;  3JAM E;  4NC6 A;  1XQH A;  3M58 A;  1WJR A;  7AT1 B;  1KG1 A;  1GCP A;  1P5E B;  4M75 D;  3CXC S;  3CC4 T;  5CKH A;  4D6W A;  2FRY A;  2EYQ A;  2WFY B;  1VQK T;  2LC4 A;  4B9X A;  3EGD B;  2YRD A;  2COZ A;  5KCH A;  3OW2 P;  3NHN A;  3TW6 A;  2X4W A;  1TUD A;  3TSZ A;  1K9A A;  4EMK B;  2X9H A;  4FYW B;  4PJN A;  3H41 A;  2D6F A;  1KK7 A;  4NST B;  4RTW A;  5CQX A;  1RI0 A;  4QW2 A;  3SHW A;  1NJI C;  2RQR A;  2RI3 A;  1YJW A;  1RAC B;  3BW1 A;  1U1T A;  4LD6 A;  4C5I A;  3QUI A;  2BZX A;  4C92 F;  1D3B A;  1AD6 A;  2RHX A;  2HNI A;  1S72 Q;  2DET A;  3TU4 K;  4IMY B;  1W2B A;  5I22 A;  4F7L B;  1ABO A;  1WDX A;  3GNF B;  3DB4 A;  3I9Q A;  3UDC A;  2V22 B;  3TRE A;  2DA9 A;  1UGQ B;  4JLI A;  3X25 B;  3NFC A;  2FZC B;  4FSX A;  4N0A C;  1UEC A;  3JCM e;  2M1H A;  4CFM B;  5IXF A;  5FU6 C;  2RHZ A;  2YUN A;  4M7A E;  2F5K A;  3RKX A;  1YBY A;  2UZB B;  4RTV A;  3ZBD A;  4F7J B;  1Q7Y C;  2RD1 A;  5CQY A;  2OX7 A;  3DOG B;  2YWW A;  1YI2 A;  1CSK A;  1NLP C;  2DL7 A;  3V7R A;  2X51 A;  1YJW T;  1IHV A;  3GPL A;  1YIJ Q;  4Z02 A;  4MZT A;  4JX5 A;  4KT0 E;  1NBE B;  2BZY A;  2DAQ A;  1NZ9 A;  3HP9 A;  1D0Y A;  1D0Z A;  4AKG A;  2CP7 A;  2FL7 A;  2DXC A;  3MP8 A;  5DLQ E;  4CFV B;  4QVD A;  4BXX X;  1Y07 A;  5GAM j;  4BCQ D;  1BU2 A;  5LJ3 e;  3EGX B;  2VXE A;  2DVE A;  1YNZ A;  4E7Z A;  4F7U F;  3J7A F;  5CKB A;  3CQT A;  2VC8 A;  2E10 A;  2LCC A;  4OB0 B;  3PGG A;  3X28 B;  2LX7 A;  4C8Q B;  3H9N A;  5CKF A;  4ZN3 A;  3RER A;  3U23 A;  2XDB A;  5C6S A;  4E7I A;  3CCS Q;  4NOY A;  1VQ8 Q;  2OTL Q;  2QQ9 A;  4BBS M;  3GNG A;  3MJX A;  5DY9 A;  3FC3 A;  1VUB A;  3OYF A;  4M78 F;  2I40 B;  1HYO A;  2H3E B;  3CD6 A;  2DIG A;  3JCM Q;  1GFC A;  2K79 A;  2X4J A;  2GCX A;  2CP3 A;  4DBH A;  1B34 A;  4J9C A;  2EYW A;  3TVT A;  3ER0 A;  3QPH A;  4JRK A;  1XTD A;  4OGR B;  4ORZ A;  2GFU A;  3CXC P;  3PE0 A;  1GRI A;  3NTI A;  8AT1 B;  4DBR A;  4HVW A;  4QQ6 A;  2MWP A;  3PVL A;  2CZ6 B;  2LJ0 A;  3JB9 J;  4HCZ A;  4MZP A;  3E9F A;  2JZ2 A;  1W6X A;  2OI3 A;  4M77 E;  2WSF E;  2XMF A;  2CSQ A;  1BCO A;  2QQB A;  3FJP A;  5CKE A;  1K9M C;  3DDQ B;  1XOV A;  3OYH A;  1VQ4 Q;  2XIC A;  1F1B B;  2EQU A;  3M0S A;  3R6N A;  3CCM Q;  3O8V A;  4EOJ B;  4F16 A;  2W0Z A;  3SWN C;  4BY6 B;  5GAO n;  3M59 A;  4X34 A;  4M7A G;  3CD6 T;  4II1 A;  2YLC A;  3VS7 A;  4F6U B;  3TNH B;  3EHQ A;  2MMP A;  3CPW S;  1G2B A;  2E3I A;  5GMK e;  1WXT A;  1M2V B;  2JM8 A;  2LVM A;  4E7L A;  4OMF B;  5GAM d;  3DTO A;  2LJ1 A;  2HL3 A;  2DFU A;  2KRS A;  4J7F A;  1T0J A;  4JX4 A;  3UA7 A;  3A8O B;  1IGQ A;  1EX4 A;  2LCS A;  1PSE A;  2DNU A;  2RQV A;  3CCQ Q;  2RJF A;  2GFA A;  5GAM h;  3O0G D;  5GAO p;  5J3B A;  1WFW A;  3G7Z A;  3HFN A;  2CYZ B;  3KHI A;  1C0M A;  2LQW A;  2QXF A;  4XTZ A;  1ZUK A;  2K5F A;  3DJB A;  5EC7 A;  2OJ2 A;  4A4F A;  1RAG B;  1IO6 A;  4X9C A;  2X1N B;  2VGM A;  1VQ5 Q;  1YIJ A;  3A8L B;  1Q86 U;  1UJ0 A;  1U3O A;  4RTY A;  5HKC A;  2XI9 A;  3QBY A;  1S72 T;  3C95 A;  2DIQ A;  2C0T A;  2ABL A;  3F5X B;  1AHJ B;  2L3P A;  1I5L A;  4MML A;  4EOO B;  1GFD A;  3GIB A;  4BCJ B;  2KY9 A;  1OV3 A;  1UB4 A;  3OB9 A;  3NTH A;  2ZPB B;  3ZEH A;  4J9F A;  1ZSG A;  4C92 E;  1D3B B;  4RCB A;  4A4G A;  1GBQ A;  3CCS A;  4PNO A;  1M90 R;  1VQ8 A;  2L2P A;  2OTL A;  2LTO A;  4PJO F;  3OS0 A;  4M7D D;  2ATC B;  1M4Z A;  5IHK A;  2YT6 A;  1BIA A;  1K76 A;  4M77 G;  3H0F A;  2BE9 B;  5FRN A;  5HBE B;  4EMK C;  1QQJ A;  4TVR A;  1YIJ T;  2P4T A;  2MPX C;  4N4I A;  3TNI B;  2L3R A;  1Z9Z A;  1R77 A;  3NPF A;  4OF1 A;  4LOC A;  1SG5 A;  1WHM A;  2JMA A;  1WQ7 A;  1K0S A;  2C6T B;  1ZUY A;  1O75 A;  4OGE A;  3VKI A;  3HL8 A;  3G6E Q;  1WLP B;  4EIK A;  4BCH B;  5I21 A;  4ATO A;  4PJJ A;  1QLY A;  2KYM A;  2KE9 A;  3LH5 A;  3BG5 A;  4MZM A;  1QVG A;  1H4L D;  3HBL A;  4HCB A;  3FEO A;  1VQ4 A;  5HBH B;  2RPN A;  2E64 A;  2DM1 A;  2A08 A;  2E6N A;  2Y4Y A;  3QZ5 B;  2RA2 A;  3CCM A;  2HQH A;  3OMG A;  1VQ8 T;  2OTL T;  1M5Q 1;  4EOP B;  4PK4 A;  1Q81 C;  5FRO A;  2DXC B;  3CMA Q;  1G3N C;  2B86 A;  2E5Q A;  1LCK A;  4F7U E;  4BAC A;  2QYZ A;  5GAN e;  1SHG A;  2SRC A;  1NJI R;  4J6X A;  1LPL A;  2HKQ B;  1G3T A;  1K4U S;  3DB3 A;  5HBJ B;  2KRN A;  1M3B A;  1TTH B;  2HQX A;  2W9F A;  4M75 F;  1LNX A;  4RTX A;  2EQM A;  1RLQ C;  1JOW A;  2E5K A;  3LGF A;  4IIO A;  3CCQ A;  4J9G A;  5IXB A;  3JB9 G;  3MKD A;  2RN8 A;  2VV5 A;  1Y71 A;  3PTA A;  2DEU A;  2F2V A;  2ZPH B;  4M78 E;  2G77 A;  1QVP A;  3EJ1 B;  3OYC A;  1VQ9 Q;  4KUL A;  1AOJ A;  2E1H A;  1VQ4 T;  2LJ3 A;  1OX8 A;  5GAM f;  3RIR A;  5D6W A;  1E7O A;  2C4G B;  1W70 A;  5GMK l;  5GMK m;  1VQ5 A;  4E2F B;  1JKW A;  1QKX A;  4QKU A;  5GAM g;  3MP6 A;  3H6Z A;  4C8Q C;  3OYN A;  4C92 G;  5A0G A;  4OML A;  1Q7Y R;  3OY9 A;  4FT2 A;  3WVE B;  3DKM A;  4OMP A;  2D8J A;  3T9N A;  4IUV A;  4UC4 A;  2PJQ A;  4CC7 A;  3GOX A;  4XU2 A;  4YTL A;  2DYI A;  2K5L A;  2RNA A;  4ZGD B;  4Y72 B;  5IN1 A;  2JN0 A;  3CCQ T;  2RK2 A;  1VQP T;  1OUL A;  2D0N A;  4F7N B;  1W2B S;  3CCE Q;  1G3W A;  1KHC A;  3OYM A;  4J9B A;  3GF5 A;  2FEI A;  1JRI A;  1WA7 A;  1UNL D;  2DD5 A;  3WVD B;  4MMK A;  4HNV A;  4BCM D;  4M7D C;  3M53 A;  3M9Q A;  1KD1 U;  4HNT A;  3O5Z A;  3I56 Q;  2PTK A;  5A2Q E;  1SKU B;  1BKB A;  1PM3 A;  1AWO A;  2CDT A;  2WMB B;  4B9W A;  1H26 B;  3QHW B;  2HSP A;  1MND A;  2DXU A;  2VAS A;  4O5V A;  1U06 A;  4BY6 C;  3G6E A;  5LMK B;  4C8Q A;  2DL8 A;  3A98 A;  3A5Z B;  2EPD A;  1OEB A;  4DEX A;  4MDW A;  3H0I A;  2ED1 A;  4F7U G;  4EOI B;  1OI1 A;  2CP0 A;  1OU9 A;  4ROD A;  1GCQ A;  3B57 A;  2PVD B;  1K8A R;  4BCP B;  4C0G A;  1KC8 R;  5I5Z B;  4KGV B;  1F5Q B;  2WXV B;  2JS2 A;  4UN0 A;  2CH4 W;  3I35 A;  2P0K A;  1I8F A;  2KT1 A;  3HRS A;  4CC3 A;  3MEV A;  2YUO A;  2NUP B;  1VYT A;  1T3L A;  1KFZ A;  1AZE A;  4ME7 A;  4QVZ A;  3CMA A;  1I1J A;  2DEQ A;  1BYM A;  2OAW A;  2E65 A;  4M78 G;  4BCG B;  1K73 U;  1K9M R;  3HHT B;  1I81 A;  4HL4 A;  5FU7 B;  1VQN Q;  2UUE B;  2YSQ A;  1DJ7 B;  2HL5 C;  5CAI A;  2RB6 A;  4G6L B;  3EFO B;  3HO8 A;  1JXO A;  3HKS A;  4IUR A;  4ZN1 A;  5IF1 B;  1JJ2 A;  2JMC A;  4KRT A;  3G6E T;  2YUQ A;  4EON B;  4HCK A;  5D7U A;  2A3L A;  4PJO E;  4EDU A;  5I11 A;  5GAN 7;  2XU8 A;  2NUT B;  2QTV A;  1U5S A;  3HFO A;  4IIM A;  1VQ9 A;  1O9S A;  2DMO A;  1GXI E;  1AEY A;  4EMG A;  2CT3 A;  3EID B;  1SRM A;  3NGP A;  3LH0 A;  2EAY A;  4AFQ C;  1TU0 B;  1ZA1 B;  2KR6 A;  1PWT A;  4PFP A;  1M2V A;  3P8H A;  4LDY A;  4M7A B;  1HSQ A;  5DLO A;  1G83 A;  2QDL A;  3H8Z A;  3QO3 A;  3CMA T;  1D3U B;  1NEG A;  2HEQ A;  2XG8 D;  4ROC A;  1QMC A;  5C0M A;  4J83 A;  4E7S A;  2CRE A;  2L89 A;  3EGU A;  4J6Y A;  1B3Q A;  4EC9 B;  2VYT A;  3CC7 Q;  3M5A A;  2DF6 A;  2DVJ A;  1KXU A;  2O88 A;  1AZG B;  1MV0 B;  2KXC A;  3CBP A;  2CZ7 B;  1OIU B;  4OMM A;  5I2M A;  1R8O B;  1X43 A;  4CC4 B;  5GAO r;  3PFS A;  2QEX Q;  4E47 A;  3CCE A;  2J05 A;  3I55 Q;  4F70 B;  2KRM A;  1VQ9 T;  4D8D A;  4CFW B;  3M03 A;  1BI2 A;  3VU3 C;  1RAD B;  1OIY B;  1VOM A;  3S3M A;  1E6H A;  1TUG B;  4RTU A;  2W9Z A;  3EOC B;  5GAN 3;  3CCR Q;  2FB7 A;  1KSW A;  2W10 A;  4KRC B;  3CCV T;  3TW7 A;  1PHT A;  3I56 A;  4M75 E;  2KMG A;  2JW4 A;  2EYY A;  2JUF A;  3JCM V;  1YJN Q;  4J9E A;  4KUI A;  3BLQ B;  5KE2 A;  3OYG A;  2JVV A;  4HCC A;  2RHY A;  2QA4 Q;  4ZTF A;  4GY5 A;  5GMK i;  2C5O B;  2A28 A;  2C5X B;  3UWN A;  4C5E A;  1OZ2 A;  1PD0 A;  4JX6 A;  3CCJ T;  4JZ3 A;  2K7A A;  2VUB A;  4EOR B;  1C6V X;  4PFO A;  2WIH B;  4A4E A;  3CCE T;  3LWI A;  4RKU E;  1N8R U;  4JZ4 A;  2IPO B;  2ZAE A;  2LCL A;  4M7D F;  5KYN A;  3LYI A;  3OBY A;  4M77 B;  2YRC A;  1K8A U;  1KC8 U;  3SDZ A;  4PJO G;  2PVG B;  4FW2 A;  1M3C A;  1H92 A;  2F2C A;  3OYY A;  1VQN A;  1VYW B;  4JJD A;  3I56 T;  4Y28 E;  5ECA A;  2M16 A;  1NEB A;  4ESR A;  3DLM A;  3BLH B;  3QDF A;  5KE3 A;  3ZL7 C;  1VIN A;  4OB1 B;  3C12 A;  3LX7 A;  5GAO q;  3G4S Q;  1EZZ B;  4EOL B;  3L2U A;  2O9S A;  2LMJ A;  3QHS A;  3QYE A;  4D8K A;  1YHQ Q;  2DD5 B;  4XAX B;  1OGU B;  2DK3 A;  4FL6 A;  1X27 A;  3MEW A;  3JCM c;  2YDL A;  2HAX A;  1QVF A;  4J9I A;  1HXD A;  4ROE A;  2PUO B;  3VS6 A;  1BU1 A;  1G5V A;  4V2S A;  5GAO l;  3HTR A;  1D1B A;  2V8J A;  1VQL Q;  1TS9 A;  2B9R A;  1B07 A;  1QVG S;  1KJW A;  1EIF A;  2XID A;  4KH0 B;  2M0O A;  3HZJ A;  1QMZ B;  1VQN T;  2QQ8 A;  4JUV A;  4LDU A;  3P8B B;  2NUZ A;  3M0R A;  2PVO B;  2K3B A;  3CC7 A;  4E6R A;  1YI2 T;  2DL5 A;  4M75 G;  5GAN 6;  2KGT A;  5EJC A;  3CCL Q;  2CT4 A;  1N9S A;  2QGF B;  2F5T X;  1H8K A;  2QEX A;  2GF7 A;  2P4R A;  2DE0 X;  2Y4X A;  3I55 A;  3E2U A;  4EC8 B;  3SD4 A;  8ATC B;  2LQ8 A;  3DDP B;  2DL4 A;  3CCR A;  5DQV A;  1D0X A;  4C92 B;  4YOZ A;  3L2R A;  2EKO A;  1MUZ A;  1E7P A;  4EMH A;  1CKA A;  2MI6 A;  3VKG A;  1YJN A;  1UUE A;  1NM7 A;  1R0C B;  4RCC A;  2L0A A;  2K9G A;  3EG1 A;  2RQT A;  2L3S A;  2RM4 A;  2QA4 A;  5L8R E;  3CC7 T;  3QXE B;  5FU7 C;  1LJO A;  3NMZ C;  4R55 A;  2MAM A;  1FMV A;  4GBQ A;  3MI9 B;  1M1F A;  3RBB B;  2EVR A;  3QJY A;  2IG0 A;  2QEX T;  4OMO A;  1WHH A;  1JO8 A;  2GQV A;  3LW5 E;  1OX9 A;  3I55 T;  2NYS A;  2QI2 A;  2KDS A;  4XTW A;  2ZZD A;  2CUB A;  2QK0 A;  2V1R A;  1MGQ A;  3D7S B;  4KGX B;  1XNI A;  3M57 A;  3TCJ A;  1S1N A;  4ELJ A;  4LE9 A;  5A0D A;  3CCR T;  4M6V A;  1ENW A;  2KRO A;  3VS4 A;  1ACM B;  2KQW A;  1ABQ A;  2EYZ A;  3CXC A;  4FCY A;  1U8R A;  3QZ9 B;  1N27 A;  2CSI A;  1VQM Q;  4Z88 A;  1IGU A;  4M7A C;  2IW8 B;  2DZ9 A;  4C8Q D;  2JT4 A;  3G4S A;  3TQ7 P;  2QQS A;  5CK9 A;  4MDX A;  4X9D A;  2AKK A;  4F7U B;  2QA4 T;  1M2O A;  3BDL A;  3HRU A;  3MEU A;  1YHQ A;  5GAN 5;  2C06 A;  2NUP A;  2J06 A;  4N4H A;  4M75 A;  3KXT A;  2KNB B;  4RUG A;  2OTJ Q;  4NL3 A;  1PNJ A;  3SB2 A;  2PMI B;  2IVW A;  3CC2 Q;  3TSW A;  1UHF A;  3HPW A;  5FLX E;  3OSS C;  3L2Z A;  4BUG A;  3Q1J A;  1H1R B;  1UJY A;  1VQL A;  4M78 B;  1G3S A;  3EFO A;  2LNV A;  1N9R A;  4HT8 A;  5GAM e;  2K57 A;  3RDV A;  1GBR A;  4I3Z B;  5HY6 A;  1UG1 A;  2WAC A;  2BS3 A;  3CBO A;  3A8H B;  1MMD A;  5FWC A;  1BB9 A;  4WTO B;  3G71 Q;  4OP0 A;  1RUW A;  4DBQ A;  2HBP A;  1GL5 A;  4J5Y A;  2NUT A;  1I0C A;  2ECZ A;  3E1S A;  3VS1 A;  3G4S T;  4HNU A;  4CFU B;  3CCL A;  2EGE A;  2P84 A;  4M7D E;  3CCU A;  1RAH B;  2SEM A;  4BDY A;  1ZBX A;  1YHQ T;  4OMN A;  5GAN d;  4J9H A;  3QYH B;  4M7A A;  4XTV A;  3PO3 S;  1UNG D;  4BCN B;  1JJ2 S;  2D1X A;  3EG3 A;  3RR6 A;  2ZPG B;  2K4Y A;  2KT8 A;  1UTI A;  3RNJ A;  1X2Q A;  2C0O A;  1VQL T;  1Q95 G;  4NL2 A;  4CXA B;  3JV3 A;  4JRP A;  1NPR A;  1HK9 A;  1WJQ A;  4WCI A;  1ZSZ A;  1H1S B;  1OKW B;  1JB0 E;  2QG9 B;  2X4Y A;  2EQK A;  4Q5W A;  3CCS T;  3BDU A;  1OYX A;  3JB9 H;  4EOM B;  4ZGE B;  2YXY A;  3TN8 B;  2KR3 A;  3I5S A;  1VQO Q;  1KQS A;  4PJL A;  3OBW A;  1BI0 A;  1UHC A;  3CPW P;  3OMC A;  5CO7 A;  5L2W B;  2K6D A;  3CCL T;  5HK0 A;  4PL6 A;  3MO8 A;  1X01 A;  1NYG A;  1SRL A;  1SPK A;  1YP5 A;  2EGA A;  2X35 A;  3HSB A;  1Y0M A;  1Q86 C;  1D1A A;  5IHN A;  3PIO A;  4EOQ B;  3JRZ A;  3X26 B;  2E12 A;  3EFS A;  4A54 A;  1H3Z A;  1RAI B;  2RH2 A;  2QGG A;  3VS0 A;  4YOO A;  4PLI A;  3C94 A;  1JBM A;  2EGC A;  5IDP B;  3IQL A;  4FYV B;  1WGS A;  3SEM A;  4O6J A;  4AMC A;  3GP8 A;  1URC B;  2F2X A;  4F6S B;  3VS5 A;  3CME Q;  5CVI A;  2VGN A;  1VQM A;  4F7S B;  1G8X A;  3PMI A;  3CCM T;  4FW1 A;  3C0C A;  4B6M A;  4AFS C;  2FZG B;  4JS5 A;  3A1P A;  3OS5 A;  5KYU B;  4BBR M;  1VYU A;  3M0Q A;  1Q82 C;  1IRE B;  2MK5 A;  3J80 E;  4M77 A;  4DBF A;  1PKT A;  4KRD B;  2YUP A;  2LX9 A;  3FDR A;  2OTJ A;  4TTH A;  3REB B;  4LDW A;  1GCQ C;  3CC2 A;  2ROL A;  2KAF A;  2MYS A;  9ATC B;  2D9T A;  4PJO B;  2DIL A;  2AHJ B;  4M7D G;  1SHF A;  4QQG A;  2ENM A;  1JSU B;  3E19 A;  3BHV B;  4KUD K;  1H3H A;  2CCI B;  4OMQ A;  3OYB A;  2DJQ A;  3G71 A;  2PK9 B;  2M51 A;  2DER A;  4KH1 B;  3VYG A;  3QWX X;  1OL2 B;  1EFN A;  3M0P A;  1N4M A;  4OVA A;  1VQM T;  4C0F A;  2ESW A;  1M90 U;  1NYF A;  1AWX A;  2IIM A;  1VQ5 T;  2O01 E;  2ZZD B;  5LJ5 e;  1FXX A;  3QSU A;  2CCH B;  3OYD A;  1TFB A;  2BKD N;  2WSC E;  2RK1 A;  2DJZ A;  4LUD A;  2BS4 A;  1WPY A;  2M9U A;  3F70 A;  1O9K A;  2DYB A;  3OS1 A;  2PUK B;  3VKH A;  1C9B A;  1YWO A;  2OTJ T;  4OB3 B;  5CEI B;  2GTO A;  3CC2 T;  3OS2 A;  4L59 A;  3OYA A;  1V76 A;  2CJM B;  1IXD A;  2FYK A;  2HKN A;  4AKH A;  3H4C A;  2F69 A;  3OA6 A;  1LOJ A;  2E3H A;  2JM9 A;  4A4K A;  2QGS A;  4MFE A;  1AWJ A;  1M27 C;  3DL1 A;  4DEY A;  1H28 B;  2MF2 A;  5AYF A;  5HK3 A;  1QVF S;  3AT1 B;  1KIK A;  3G71 T;  1YJ9 Q;  4DOV A;  1V1C A;  4M75 B;  3JCM b;  4AG2 C;  4II5 B;  3BHT B;  1VQO A;  2CP2 A;  3MIA B;  1XO2 A;  5L23 A;  3CBM A;  2QFZ A;  5HQ0 B;  3TEE A;  3PT9 A;  2DX1 A;  2LZ6 B;  2P0Q A;  2AZV A;  2PZ1 A;  4DQ2 A;  4C92 A;  3QWL A;  1X69 A;  4HLQ A;  2H3J A;  3SWN B;  3UA6 A;  1NJI U;  2CS7 A;  5CR2 A;  2NWM A;  2GTJ A;  3QYB A;  1MHN A;  2O2O A;  4F6W B;  4HA8 A;  2DD4 A;  4BI3 A;  3JB9 I;  4FX3 B;  4LDX A;  1RL2 A;  5KH6 A;  3V7C A;  3ME9 A;  2JOY A;  1RAB B;  1RI9 A;  1QCN A;  4PKC C;  1I4K 1;  1M30 A;  2JTF A;  3CME A;  2J7I A;  4IUP A;  5LJ3 j;  1Y7X A;  1PRM C;  4AKI A;  2EJ9 A;  4F04 B;  3FLG A;  3L2W A;  2EJG A;  1RAE B;  2DO3 A;  4NS5 A;  1P92 A;  2PU9 B;  4E7K A;  5KYX A;  4Y92 A;  1VQO T;  3X24 B;  2GGR A;  2XDD A;  4BY1 X;  3CC4 A;  2G6F X;  2XKO C;  2J6K A;  5LQF B;  4EOS B;  1UNH D;  4Z8A A;  4ZGJ B;  1KD1 C;  1JEG A;  1CKB A;  2H8H A;  2DME A;  1Q7Y U;  3PVQ A;  2E6Z A;  3LGL A;  2IN3 A;  4LUE A;  2KEA A;  2QTX A;  4C0D B;  3RKY A;  4WF2 A;  4MIM A;  1GH6 B;  1ZSZ B;  3VV0 A;  1BCM A;  1W2B P;  3L2V A;  5IHY A;  1HD3 A;  2QAS A;  4C5G A;  2HMA A;  3MY1 B;  4R0K A;  4E7H A;  4F7U A;  5GJV B;  3EG9 B;  4OR5 B;  5KYW B;  1MNE A;  4A53 A;  4KBM B;  3S6W A;  3J81 E;  5D6Y A;  3CME T;  2L5Q A;  2JXB A;  2E70 A;  2GNC A;  2K5I A;  4BCQ B;  1WHJ A;  4C8Q F;  2EWN A;  3OYI A;  1X75 C;  3JCM d;  2EKH A;  4RTT A;  2O4X B;  2CP6 A;  4EOK B;  4XU3 A;  3QJ6 A;  1I5O B;  2LQK A;  1FKM A;  1VYV A;  4MFD A;  4J7I A;  4BI4 A;  3RGF B;  2QQR A;  1Y96 A;  3M55 A;  1VQ6 Q;  1Y57 A;  4M78 A;  3EFR A;  3JCM h;  2WEV B;  5CCA A;  3JB9 F;  1K73 C;  1W4S A;  4JRI A;  2RHU A;  2K3X A;  3V7S A;  4XU0 A;  2QDY B;  4ELY C;  4L6V 5;  3E9G A;  1G3Y A;  5LL6 S;  2ED0 A;  3JCM X;  2GBQ A;  1YCY A;  3QG1 A;  3UAT A;  5BNJ B;  4BI8 B;  3EHR A;  1QVF P;  5GMK j;  3RMS A;  1M1G A;  3G33 B;  2KK4 A;  5LJ3 d;  1UEB A;  1GUX A;  1YJ9 A;  4XU1 A;  5EG2 A;  2EFI A;  1UGP B;  1M8M A;  3G1J A;  4E7J A;  2K2M A;  4CFN B;  1C1A A;  1OOT A;  2ZPI B;  4BCK B;  3S3N A;  2BS2 A;  2JTE A;  2WMA B;  3RUX A;  5LJ3 h;  4OGC A;  2DKG A;  3A8G B;  4M4Z A;  1MV3 A;  4M7A D;  1PCX A;  4JS4 A;  4LNP A;  2X3W D;  1WHG A;  4BE1 A;  1K9M U;  2ZCF B;  3OYK A;  1Q81 R;  1TG0 A;  3GTM S;  1MMA A;  1ZA2 B;  4JRQ A;  1PKD B;  3OW2 A;  1M1K C;  1I07 A;  4FIB A;  5A0L A;  2HBW A;  1E9H B;  2RI5 A;  1WYX A;  2JJ9 A;  3VYG B;  1QCO A;  2YLB A;  4XK8 E;  1R0B G;  2BKZ B;  1Q86 R;  2V1Q A;  2A36 A;  2GQI A;  1QWF A;  5GAN 4;  3PIP A;  4PJO C;  4FSS A;  2HSE B;  3P8D A;  2EYX A;  1AVZ C;  1HJD A;  1FWZ A;  2XDP A;  1YJ9 T;  2KVQ G;  2JNG A;  5GAO m;  1O9K B;  1IZ6 A;  3ULR B;  3POM A;  3FIF A;  4CRL B;  4K11 A;  3DLL A;  1WHK A;  3A8M B;  2HQE A;  3M54 A;  3RMQ A;  1GY3 B;  2O9V A;  4JPB W;  1IRX A;  5FWB A;  2RF0 A;  4HKE A;  4JJB A;  3RES A;  2VKN A;  1MMG A;  3REA B;  3FRN A;  2D0Q B;  1KQS S;  5HNB B;  1Q82 R;  1K1Z A;  4C0Z A;  1H27 B;  1JQQ A;  1T0H A;  5ACB A;  4AI6 A;  2G3R A;  3CCU Q;  2CUD A;  3VRY A;  1ZUU A;  1OPL A;  2Y90 A;  4JLG A;  3M0T A;  1ZX6 A;  3OSV A;  3QKJ A;  4N0A A;  4QT7 A;  4JJN K;  3VUZ A;  2FO0 A;  5KYU A;  2QF7 A;  1RAA B;  2RJC A;  1KHI A;  2RQU A;  4ELZ C;  4LDV A;  5GMK h;  2E4H A;  2KYB A;  3VRZ A;  5HVY B;  3EG2 A;  1N8R C;  1M8V A;  4BE2 A;  2EQI A;  1UGV A;  4HT9 A;  3EH2 A;  4M77 D;  4PJO A;  3GLX A;  3CEY A;  1K8A C;  4QSH A;  1KC8 C;  1VQ6 A;  2FPE A;  3LQ5 B;  1AT1 B;  4HVU A;  3UT1 A;  1QCF A;  2DD4 B;  2UZE B;  4M75 C;  3L42 A;  1TSF A;  1WIE A;  2DRM A;  3I5R A;  4FYY B;  4M7D B;  4BD3 A;  5HCK A;  2XD0 A;  2V26 A;  3OYE A;  3MEA A;  2KMT A;  3NDQ A;  1WX6 A;  3JCM f;  2QDJ A;  4Z89 A;  2DL3 A;  2VXF A;  1YIT Q;  5GAN j;  1U1S A;  4IUU A;  1QP3 A;  3JCM g;  2BE7 D;  3VYH B;  5KYX B;  4CI0 C;  3THK A;  3EH1 A;  2DZC A;  3S3O A;  1WHL A;  1S72 A;  3WXM B;  1K0X A;  2K2V A;  3L1A A;  4X1V A;  2RHI A;  3KUF A;  1H24 B;  1ZP2 A;  4J8O A;  1OQK A;  3LWH A;  4N4G A;  1D1C A;  1YJN T; 
#chains in the Genus database with same CATH homology
 1VQ6 T;  1YBY A;  3JCM P;  4IUR A;  3ZBD A;  1WGS A;  4ZN1 A;  1JJ2 A;  1Q7Y C;  3G6E T;  2RD1 A;  5CQY A;  5J39 A;  3PNW C;  3M56 A;  4O6J A;  5LJ3 f;  5FRM A;  3OYJ A;  2A3L A;  3GP8 A;  4PJO E;  2FVU A;  4EDU A;  1Q81 U;  1YI2 A;  5CVI A;  2VGN A;  4L5G A;  3V7R A;  2A7Y A;  1VQM A;  1YJW T;  5GAN 7;  2XU8 A;  3HFO A;  3PMI A;  5LJ3 g;  3GPL A;  3CCM T;  3HB9 A;  1VQ9 A;  1O9S A;  1GXI E;  4Z02 A;  4EMG A;  4MZT A;  4JX5 A;  4KT0 E;  4C8Q E;  4JS5 A;  3LH0 A;  3JB9 D;  2EAY A;  2DAQ A;  3OS5 A;  2KR6 A;  4BBR M;  1M9S A;  2I2L A;  1IRE B;  2QQA A;  3EAE A;  3M4G A;  4C0D C;  1NZ9 A;  3J80 E;  4M77 A;  3HP9 A;  2WJ9 A;  3P8H A;  4LDY A;  4AKG A;  2FL7 A;  3MP8 A;  2DXC A;  5DLQ E;  4M7A B;  5DLO A;  3FDR A;  1Y96 B;  2LX9 A;  3H8Z A;  4XTU A;  4QVD A;  1Y07 A;  5GAM j;  2OTJ A;  3QO3 A;  4LDW A;  5LJ3 e;  2YRV A;  3CC2 A;  2VXE A;  4DOW A;  3CMA T;  2DVE A;  2KAF A;  4VUB A;  4F7U F;  3J7A F;  1ZQ1 A;  5CKB A;  2XG8 D;  2OAU A;  2D9T A;  4PJO B;  3SWN A;  3M4Y A;  2VC8 A;  5C0M A;  2E10 A;  4J83 A;  3NTK A;  2AHJ B;  2LCC A;  4M7D G;  4OB0 B;  4QQG A;  3PGG A;  3X28 B;  3E19 A;  2CGH A;  2DPP B;  2L89 A;  4EPC A;  4KUD K;  4C92 D;  2RI2 A;  5GAN 2;  4C8Q B;  4J6Y A;  1ZHI A;  2ZGW A;  2VYT A;  4RG2 A;  4XTY A;  5CKF A;  4ZN3 A;  3RER A;  2XDB A;  5C6S A;  4E7I A;  3M5A A;  3OYB A;  4NOY A;  3G71 A;  2QQ9 A;  2R5A A;  4BBS M;  5I2M A;  3CBP A;  2CZ7 B;  2ZPF B;  3GNG A;  5GAO r;  1R8O B;  3CPF A;  2R5M A;  3PFS A;  5DY9 A;  1VUB A;  3VYG A;  3OYF A;  3FC3 A;  4M78 F;  4E47 A;  1BI1 A;  3CD6 A;  3CCE A;  2DIG A;  3JCM Q;  4OVA A;  4JDS A;  5LJ5 j;  1VQM T;  2X4J A;  2GCX A;  2DXB A;  4C0F A;  1B34 A;  1VQ9 T;  1Q82 U;  1M90 U;  1VQ5 T;  2O01 E;  1BI2 A;  3VU3 C;  2ZZD B;  5LJ5 e;  1FXX A;  3ER0 A;  3S3M A;  3QSU A;  3QPH A;  4JRK A;  4Y91 A;  3OYD A;  1XTD A;  5GAN 3;  2BKD N;  2WSC E;  2GFU A;  2LRQ A;  4PLL A;  5KCO A;  2RK1 A;  2FB7 A;  2DJZ A;  2BS4 A;  2V8K A;  3NTI A;  1WPY A;  2DTH A;  2M9U A;  3TW7 A;  1KQ1 A;  3F70 A;  4GLK A;  4QQ6 A;  5CIU A;  5GAN h;  3I56 A;  2MWP A;  3OS1 A;  4M75 E;  2PUK B;  4CRI A;  3VKH A;  2KMG A;  2OTJ T;  2JTM A;  4OB3 B;  2CZ6 B;  3CC2 T;  3JB9 J;  3OS2 A;  4HCZ A;  4L59 A;  2JUF A;  4IUQ A;  4MZP A;  3OYA A;  3JCM V;  3E9F A;  2JZ2 A;  4M77 E;  2FYK A;  2WSF E;  4KUI A;  4LDX A;  2QQB A;  1X6O A;  3FJP A;  4BDZ A;  4AKH A;  4M77 C;  3H4C A;  2F69 A;  3OA6 A;  5KE2 A;  3OYG A;  2JVV A;  5CKE A;  1LOJ A;  4HCC A;  1K9M C;  1XOV A;  2RHY A;  4A4K A;  3OYH A;  4ZTF A;  4GY5 A;  2PQW A;  2XIC A;  4MFE A;  2XK0 A;  5GMK i;  4ZTJ A;  3JSC A;  3UWN A;  2EQU A;  3DL1 A;  4C5E A;  2MF2 A;  5AYF A;  1OZ2 A;  5HK3 A;  1QVF S;  4JX6 A;  3O8V A;  3CCJ T;  1QLB A;  3SWN C;  3G71 T;  2MWO A;  2VUB A;  1VIF A;  4DOV A;  1UGR B;  4BY6 B;  5GAO n;  3M59 A;  4M75 B;  4X34 A;  3JCM b;  3CCU T;  1FX7 A;  4M7A G;  4A4E A;  1N6A A;  3CD6 T;  3CCE T;  1YIT A;  3LWI A;  1VQO A;  4II1 A;  2YLC A;  4RKU E;  1N8R U;  2MMP A;  2LCL A;  4M7D F;  3CBM A;  3LYI A;  3OBY A;  4M77 B;  3CPW S;  2QFZ A;  2O4X A;  4E7L A;  5GMK e;  2LVM A;  3TEE A;  1KC8 U;  1K8A U;  3SDZ A;  3PT9 A;  4OMF B;  4PJO G;  2PVG B;  5GAM d;  4Z6Y A;  2P0Q A;  4DQ2 A;  4J7F A;  3OYY A;  5DM7 R;  4C92 A;  4JX4 A;  3A8O B;  3QWL A;  3QDR B;  1VQN A;  4C8Q G;  3I56 T;  3OQ5 A;  4HLQ A;  2H3J A;  4Y28 E;  1PSE A;  3SWN B;  2M16 A;  1NJI U;  2CS7 A;  2RJF A;  2GFA A;  2B8A A;  3DLM A;  5CR2 A;  5GAM h;  5J3B A;  5GAO p;  4J6W A;  3QYB A;  1MHN A;  5KE3 A;  4M78 D;  3G7Z A;  4EMK A;  4HA8 A;  2DD4 A;  3C12 A;  4OB1 B;  3PMT A;  4BI3 A;  3JB9 I;  3HFN A;  3LX7 A;  5GAO q;  2CYZ B;  1RL2 A;  3RKW A;  3KHI A;  3X20 B;  3V7C A;  5KH6 A;  3ME9 A;  3BG9 A;  2JOY A;  3N5B B;  3L2U A;  4R56 A;  1VQP A;  3AHU A;  5IAY A;  2QXF A;  4XTZ A;  3QYG B;  4C5H A;  2K5F A;  3QYE A;  3QHS A;  4PKC C;  1I4K 1;  2JTF A;  4A4F A;  5FU6 B;  3CME A;  3JCM W;  2P0P A;  3ASK A;  2DD5 B;  4XAX B;  5LJ5 d;  2DK3 A;  1VQ7 A;  4X9C A;  4FL6 A;  2VGM A;  2LDM A;  2R58 A;  3MEW A;  4IUP A;  1Y7X A;  5LJ3 j;  1YIJ A;  3A8L B;  3JCM c;  2EJ9 A;  4AKI A;  1B34 B;  1Q86 U;  2HAX A;  3FLG A;  3L2W A;  2EJG A;  5HKC A;  2DO3 A;  3KBG A;  1P92 A;  2PU9 B;  3MET A;  1HXD A;  2L8D A;  2XI9 A;  3QBY A;  4NS5 A;  5J26 A;  5I2S A;  3X24 B;  1VQO T;  2XDD A;  1S72 T;  2PUO B;  3C95 A;  2DIQ A;  3CC4 A;  5LJ5 h;  2XKO C;  1G5V A;  4V2S A;  5GAO l;  2V8J A;  4RG8 A;  4ZGJ B;  1KD1 C;  1H64 1;  1QVG S;  1AHJ B;  1EIF A;  1I5L A;  2XID A;  4MML A;  1Q7Y U;  2M0O A;  2E6Z A;  3LGL A;  3HZJ A;  3CPW A;  2QTX A;  4C0D B;  3RKY A;  1VQN T;  4WF2 A;  2QQ8 A;  4MIM A;  4JUV A;  3GIB A;  2KY9 A;  4LDU A;  1UB4 A;  3OB9 A;  3P8B B;  3VV0 A;  1V29 B;  3NTH A;  2ZPB B;  5GAN 8;  1UGS B;  2DXT A;  3MHX A;  4FT4 A;  3ZEH A;  1WQW A;  4M7A F;  3VJP A;  3L2V A;  2PVO B;  2CZ1 B;  4C92 E;  3CC7 A;  3LLR A;  4C5G A;  1D3B B;  1YI2 T;  4RCB A;  4A4G A;  4M75 G;  3CCS A;  4C92 C;  4PNO A;  4E7H A;  1VQ8 A;  2OTL A;  2LTO A;  2X4X A;  4PJO F;  5EJC A;  4F7U A;  5GAN 6;  3OS0 A;  4M7D D;  1N9S A;  2F5T X;  2EQJ A;  5IT9 E;  1M4Z A;  4A53 A;  2QEX A;  1BIA A;  2GF7 A;  4KBM B;  4M77 G;  3S6W A;  3J81 E;  4BB7 A;  5D6Y A;  3OYL A;  2ZPE B;  2L5Q A;  2Y4X A;  3V8J A;  3CME T;  4P5N A;  2E70 A;  5D6X A;  3I55 A;  2K5I A;  5FRN A;  4C8Q F;  1VQ7 T;  2EWN A;  4EMK C;  3SD4 A;  2CKK A;  3OYI A;  1X75 C;  4TVR A;  3JCM d;  1YIJ T;  2P4T A;  1YIT T;  4LD9 K;  4N4I A;  2L3R A;  2LQ8 A;  2O4X B;  3QII A;  4XU3 A;  3QJ6 A;  2LQK A;  4OF1 A;  1FKM A;  4LOC A;  4MFD A;  1WNL A;  2EIF A;  4J7I A;  1WQ7 A;  4BI4 A;  3CCR A;  3OW2 S;  2QQR A;  1Y96 A;  3FB9 A;  3M55 A;  1O75 A;  4OGE A;  4M78 A;  3EFR A;  4C92 B;  3L2R A;  3VKI A;  3JCM h;  3HL8 A;  5CCA A;  2EKO A;  3JB9 F;  4DA4 A;  1K73 C;  1E7P A;  5I21 A;  4EMH A;  1W4S A;  4ATO A;  4FM4 B;  5CKD A;  2MI6 A;  2KSS A;  4JRI A;  3VKG A;  1YJN A;  2RHU A;  1QP2 A;  2K3X A;  3R6O A;  3V7S A;  2RJD A;  1OZ3 A;  4RCC A;  2QDY B;  4XU0 A;  3URG A;  4ELY C;  1TH7 A;  4L6V 5;  3BG5 A;  3E9G A;  5M9O A;  1G3Y A;  4MZM A;  3HBL A;  5LL6 S;  5GAN f;  1QVG A;  4HCB A;  3FEO A;  2RM4 A;  3JCM X;  1VQ4 A;  2QA4 A;  1YCY A;  3QG1 A;  2E64 A;  4BI8 B;  2E6N A;  2Y4Y A;  2LT1 A;  5L8R E;  3CC7 T;  5GAN g;  3QZ5 B;  2E41 A;  3QXE B;  5FU7 C;  1LJO A;  5GMK j;  3RMS A;  4R55 A;  1M1G A;  2RA2 A;  2MAM A;  2KK4 A;  3CCM A;  2WSE E;  2V8I A;  3OMG A;  1M1F A;  1M5Q 1;  1UEB A;  5LJ3 d;  2FHD A;  1YJ9 A;  1VIE A;  1VQ8 T;  2OTL T;  1Q81 C;  5FRO A;  3QJY A;  4XU1 A;  4RMO A;  4IKF A;  2IG0 A;  2QEX T;  5EG2 A;  2DTO A;  2DXC B;  2EFI A;  1UGP B;  2GQV A;  4QVC A;  1PSF A;  2LT4 A;  3HRT A;  3LW5 E;  4E7J A;  3I55 T;  2QI2 A;  2KDS A;  4XTW A;  2ZZD A;  2E5Q A;  2ZPI B;  1BI3 A;  3S3N A;  4F7U E;  2DTI A;  1MGQ A;  3MCA B;  2BS2 A;  4FU6 A;  1NE8 A;  3RUX A;  5GAN e;  4BAC A;  5LJ3 h;  4J6X A;  4OGC A;  3ZFJ A;  1XNI A;  2DKG A;  3A8G B;  3M57 A;  3TCJ A;  1G3T A;  1WJS A;  3BY7 A;  4M7A D;  3DB3 A;  4ELJ A;  4JS4 A;  5A0D A;  2HQX A;  3CCR T;  4M6V A;  3C4S A;  4M75 F;  1LNX A;  2ZCF B;  3BFM A;  3OYK A;  4BE1 A;  1K9M U;  2RO0 A;  2EQM A;  2KQW A;  3LGF A;  3CCQ A;  4PJO D;  4XQ3 A;  4JRQ A;  4M77 F;  3OW2 A;  1M1K C;  4M7D A;  3MP1 A;  3JB9 G;  1NPP A;  3CXC A;  4FIB A;  1U8R A;  4XTX A;  5A0L A;  3QZ9 B;  2RI5 A;  2VV5 A;  1N27 A;  1Y71 A;  4IUT A;  3VYG B;  3PTA A;  1QVF A;  2K3Y A;  4M7A C;  2ZPH B;  4M78 E;  2G77 A;  1QVP A;  2YLB A;  2DZ9 A;  4XK8 E;  4C8Q D;  3OYC A;  3G4S A;  4KUL A;  2NLU A;  2E1H A;  2QQS A;  4M78 C;  5CK9 A;  2DXB B;  4MDX A;  4X9D A;  3V8K A;  4F7U B;  1VQ4 T;  2QA4 T;  5GAN 4;  3BDL A;  3HRU A;  3MEU A;  5GAM f;  3PIP A;  1YHQ A;  3RIR A;  4BE0 A;  4PJO C;  5D6W A;  3P8D A;  5GMK l;  5GMK m;  5GAN 5;  4E7K A;  2C06 A;  4N4H A;  2RJE A;  1VQ5 A;  1FWZ A;  2XDP A;  4M75 A;  3KXT A;  3INZ A;  3L2Q A;  3SFM A;  1YJ9 T;  2KVQ G;  2JNG A;  5GAM g;  5GAO m;  3MP6 A;  1VQK A;  3H6Z A;  1IZ6 A;  4NL3 A;  3SB2 A;  4C8Q C;  2IVW A;  3OYN A;  4C92 G;  5A0G A;  3FIF A;  1M90 C;  2BIV A;  3HPW A;  3OY9 A;  3DLL A;  3V8L A;  3OSS C;  2CZ0 B;  2HQE A;  3A8M B;  3WVE B;  2YHT A;  3L2Z A;  3M54 A;  4FT2 A;  3CCV A;  1Q82 C;  3DKM A;  4OB2 B;  2EJF A;  3RMQ A;  4BUG A;  3T9N A;  4IUV A;  3Q1J A;  4UC4 A;  1VQL A;  4M78 B;  1G3S A;  1SSF A;  2XHC A;  1QW1 A;  2LNV A;  3JCM J;  3GOX A;  3BG3 A;  1N9R A;  4XU2 A;  4HT8 A;  4YTL A;  4HKE A;  2K57 A;  2BUD A;  3RES A;  5GAM e;  2K5L A;  1M1K U;  5HY6 A;  3RKX A;  4A4H A;  2WAC A;  4ZGD B;  2BS3 A;  3FRN A;  2D0Q B;  3A8H B;  3CBO A;  3UPU A;  1KQS S;  1BIB A;  4QQD A;  5LJ5 f;  5IN1 A;  2JN0 A;  4OP0 A;  3CCQ T;  2RK2 A;  1VQP T;  4C0Z A;  3VUB A;  2HBP A;  4AI6 A;  2G3R A;  1W2B S;  4J5Y A;  1G3W A;  1KHC A;  3OYM A;  2Y90 A;  4JLG A;  5LJ5 g;  3CCJ A;  3GF5 A;  3OSV A;  3QKJ A;  2HD0 A;  3E1S A;  2R57 A;  4N0A A;  3G4S T;  3VUZ A;  4HNU A;  4JJN K;  1KQ2 A;  1JRI A;  3CCL A;  3JAM E;  4M7D E;  3CCU A;  4NC6 A;  1XQH A;  2DD5 A;  3WVD B;  3M58 A;  2QF7 A;  4HNV A;  1WJR A;  2RJC A;  4MMK A;  1KHI A;  4BDY A;  1ZBX A;  1YHQ T;  4M7D C;  5GAN d;  1KG1 A;  3M53 A;  4ELZ C;  3QYH B;  4M7A A;  3M9Q A;  1KD1 U;  4LDV A;  4HNT A;  4M75 D;  5GMK h;  3CXC S;  4XTV A;  3CC4 T;  5CKH A;  4D6W A;  2EYQ A;  5A2Q E;  1VQK T;  1N8R C;  2LC4 A;  4B9X A;  1M8V A;  1BKB A;  4BE2 A;  1JJ2 S;  5KCH A;  4HT9 A;  4M77 D;  4B9W A;  4PJO A;  3GLX A;  3CEY A;  1K8A C;  4QSH A;  1KC8 C;  2ZPG B;  3TW6 A;  1VQ6 A;  2X4W A;  2K4Y A;  2DXU A;  3UT1 A;  4EMK B;  4O5V A;  3CCV T;  1VQL T;  4BY6 C;  2DD4 B;  4NL2 A;  3G6E A;  4C8Q A;  4M75 C;  4JRP A;  1NPR A;  3L42 A;  2D6F A;  1HK9 A;  1WJQ A;  3A5Z B;  1JB0 E;  5CQX A;  1RI0 A;  4QW2 A;  4MDW A;  4BD3 A;  1NJI C;  2X4Y A;  4M7D B;  2XD0 A;  2EQK A;  4F7U G;  2RI3 A;  1YJW A;  1OI1 A;  3OYE A;  3BW1 A;  1U1T A;  4LD6 A;  3MEA A;  4Q5W A;  4C5I A;  2KMT A;  3CCS T;  3QUI A;  3BDU A;  2PVD B;  1OYX A;  4C0G A;  4C92 F;  3JCM f;  3JB9 H;  2QDJ A;  1D3B A;  4ZGE B;  2VXF A;  2RHX A;  2HNI A;  5GAN j;  2P0K A;  1KQS A;  3OBW A;  1BI0 A;  1I8F A;  1U1S A;  3HRS A;  4IUU A;  1QP3 A;  5FLX E;  3MEV A;  3JCM g;  3TU4 K;  3VYH B;  3OMC A;  5CO7 A;  3CCL T;  4CI0 C;  5HK0 A;  1W2B A;  4ME7 A;  4PL6 A;  4QVZ A;  3MO8 A;  1X01 A;  2DZC A;  3DB4 A;  3GNF B;  3CMA A;  2DEQ A;  3UDC A;  3S3O A;  1BYM A;  3HSB A;  2X35 A;  2E65 A;  4M78 G;  1S72 A;  3TRE A;  1K73 U;  1UGQ B;  3HHT B;  1I81 A;  4JLI A;  4HL4 A;  3WXM B;  1Q86 C;  2K2V A;  3L1A A;  5FU7 B;  3X25 B;  3PIO A;  3NFC A;  3JRZ A;  3X26 B;  2RHI A;  3KUF A;  1DJ7 B;  5CAI A;  4FSX A;  4N0A C;  2E12 A;  3EFS A;  4A54 A;  1H3Z A;  3JCM e;  4J8O A;  2RB6 A;  2M1H A;  2RH2 A;  3LWH A;  4N4G A;  5FU6 C;  2RHZ A;  4PLI A;  3C94 A;  1JBM A;  3HO8 A;  4M7A E;  1YJN T;  3HKS A;  2F5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...