2CZ6B

Complex of inactive fe-type nhase with cyclohexyl isocyanide
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title x-ray snap shots of inhibitor binding process in photo-reactive nitrile hydratase
rcsb
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 60
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2cz6B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cz6B02
2CZ7B 4L6V5 3X24B 3VYHB 4OB0B 1UGQB 2DXCB 4ZGEB 2AHJB 3WVDB 2ZPIB 3X20B 1IREB 2DD4A 2DD5A 3X26B 2ZPBB 3A8HB 4FM4B 3QZ5B 4OB1B 3QXEB 4ZGDB 4XK8E 2DD5B 2DD4B 4KT0E 3VYGB 4RKUE 2WSEE 5L8RE 1QP2A 3X28B 1QP3A 2ZZDB 4ZGJB 1DJ7B 2DXCA 2ZPEB 1UGRB 3HHTB 2ZZDA 2CZ0B 2DXBA 1GXIE 1V29B 3QZ9B 3VYGA 2WSFE 3A8OB 2QDYB 3QYGB 3X25B 2ZCFB 4OB3B 4Y28E 2DXBB 2ZPHB 3WVEB 2CZ1B 2PVDB 1PSEA 2PVGB 2CZ6B 3A8MB 3A8LB 1UGSB 2D0QB 2PU9B 1AHJB 2O01E 2PVOB 2DPPB 3A8GB 2CYZB 1JB0E 1PSFA 3LW5E 4OB2B 2ZPGB 2PUOB 3QYHB 2PUKB 2ZPFB 1UGPB 2WSCE
chains in the Genus database with same CATH superfamily
2P0PA 2RI3A 1MHNA 2DIGA 4J6WA 5GAOl 2FRWA 4MIMA 4EOSB 4RCBA 5GANf 1E6HA 4BBRM 1M1KC 1KC8R 1YJ9Q 4MMLA 4AFQC 5D6XA 4E7ZA 3UDCA 1HXDA 1BI2A 2QA4A 4JX6A 4F6WB 3OYJA 4FYYB 2K2MA 1WXTA 4C0FA 1NLPC 2DD5B 2LX9A 5J26A 2QQ9A 1YITA 1K9MC 2PZ1A 1F5QB 3JCMb 3AHUA 1GFDA 1YJWT 3LLRA 1OX9A 4FW1A 4BI4A 4X34A 2F5KA 4PJOE 2XKOC 1QVGP 3REBB 2QA4T 3HFOA 2LX7A 4CC2A 2FPEA 1K0XA 4HNTA 2E5KA 4KGXB 2RQUA 5FWCA 2P4TA 2WSFE 3E9FA 1TTHB 4AFUC 4IUTA 3NMZC 1GCPA 1R0BG 3EG9A 4A63B 3JB9D 5LL6S 8AT1B 1G2BA 5IHYA 3M58A 3CC4T 1QMCA 1K73C 1IZ6A 1M2VB 2LQKA 2CZ1B 3NTIA 4PFOA 3M4YA 4J5YA 1MV3A 2LP5A 4RTYA 4LNPA 4NC6A 2RJCA 3A1PA 1ZP2A 1OU9A 2C5XB 4EONB 3CCJT 3CD6Q 5CR2A 3LWHA 5CVIA 1RLQC 1YIJA 4KGZB 2C0TA 1M5Q1 4M7DF 1BCMA 2EWNA 2JGZB 1KQ2A 4CRIA 2COZA 4OMLA 3V8LA 1OU8A 1VQ7A 1P5EB 1MV0B 4J7FA 1SG5A 4NS5A 2QTXA 5HVYB 4PJOB 2AZVA 5CKBA 4OMMA 4FX3B 2K79A 1MMAA 1FX7A 1OX8A 2LC4A 3HFNA 1MMDA 2YUNA 4L59A 4M75D 1VQ9Q 3OYEA 1R0CB 1M3AA 1FYNA 1S72A 4F14A 2RJDA 3NHNA 1MGQA 2LCSA 2ED0A 3VYHB 3EFRA 1QWEA 3OBYA 1TXQA 1O9KB 1W70A 4IIOA 1X43A 2BS2A 4R0KA 4BCJB 5FU6C 1B3QA 2DD5A 3ZBDA 4BACA 2X35A 3ZFJA 1X2KA 1KQ1A 5FWBA 4FSXA 3QXEB 2VB6A 4HL4A 4EMKA 5HBJB 1WHHA 2WSEE 4JJNK 4BCMB 1OKVB 3RGFB 2OAWA 2F2WA 1VQLT 4F7UE 2D1XA 3RESA 4YTLA 3JB9H 4ZNXA 1PM3A 1M2VA 1UGRB 2AKKA 2FL7A 5FU6B 5CCAA 2JOYA 4FW2A 3M0RA 1Q86U 1M1FA 1BU1A 4IKFA 2QXFA 1D0ZA 3JCMd 2QFZA 3ME9A 2CH4W 5FU7B 4IUPA 1ZA2B 4BY1X 4M77B 2YRVA 2P84A 3CCUA 4QVDA 3NGPA 5GAN6 3CCJQ 1Y57A 4F7UA 4IUVA 2PHGA 4CFMB 2VV5A 4F16A 3EGDB 1PSEA 5FRMA 2LCCA 2DMEA 3ASKA 3OSVA 4I3ZB 1VQKA 5GANe 4F70B 1YWPA 1T0HA 1VYUA 3A8GB 1NZ9A 1MMGA 3GOXA 3G6ET 3RKYA 3CPWS 1X6BA 3EHQA 4BD3A 1QVGS 3TNHB 2BTTA 4PL6A 1HSQA 1VQMA 3M5AA 3GNGA 1I5LA 1JJ2S 3OW2S 5CKDA 1YJWQ 2DJZA 2C5OB 4BDZA 2KROA 1UEBA 4M7AF 4QSHA 4FT4A 2ZPFB 3G4SA 2ATCB 1YJ9A 2LVMA 4MFEA 3M0UA 2DK3A 2JNGA 4RUGA 3CCRT 2EIFA 4M77E 4OMPA 4FYXB 3S3MA 2CZ7B 1KSWA 2J06A 2EUFA 1Y7XA 2XICA 5CAIA 2HL3A 3C94A 5EG2A 4C5GA 2HBPA 2NUZA 1YITQ 4KRTA 2LNVA 4RG2A 1AWOA 3POMA 1TOVA 2W0ZA 2W9ZA 1JXMA 4PJOC 2V1QA 2DILA 1YJ9T 4Y92A 2KMGA 3X26B 1V1CA 5LJ3f 1VQ8T 3EGXA 5GMKm 2DYIA 4JZ3A 3VYGB 3QKJA 3PIOA 2BIVA 3CMEA 4M78C 3QJ6A 1BB9A 2RPNA 1ACMB 3E1SA 1K9MU 5HK3A 1ZSZC 1OZ3A 5GMKl 1OKWB 2VUBA 5ACBA 1FMWA 3KUFA 2KXDA 2E6ZA 3KBGA 2HZYA 4J8OA 2FG0A 3VYGA 2ENMA 2MWPA 5GANj 4BCIB 2EAYA 1G3NC 2LDMA 2EQJA 4GBQA 1U1TA 4PJOA 1PCXA 2VXFA 1R8OB 1KIKA 1KHIA 2IW8B 4JLIA 1ZLMA 2PVGB 2D8HA 2L2PA 2QEXA 8ATCB 4BY7X 2H8HA 2NUTA 4RTWA 2ROTA 2CYZB 1QLBA 2V8IA 3CBMA 3THKA 5LJ5f 1RAEB 3M54A 1BI1A 2NUPA 4OB2B 5GMKj 1WHGA 4OMQA 4RMOA 3CCLT 2QEXT 1EZZB 1VQ6Q 3S6WA 5C0MA 4V2SA 4C92F 1FKMA 3GF5A 1AZGB 2CT4A 1N5ZA 1FXXA 4JJCA 2OTJT 2V8KA 3LQ5B 3META 1PC0A 2RF0A 4M7DG 1JSUB 1VQPQ 2IW6B 1UHCA 1ABOA 2CP0A 4M75A 2PJQA 4AKIA 3G33B 5AYFA 2XU8A 3CCMA 1KK7A 2PTKA 2RJEA 2BUDA 3TREA 4LDWA 5CKEA 3WXMB 2C5VB 1OV3A 5DLOA 1UE9A 4XTVA 2CCHB 1WA7A 2W10A 4GLKA 3GNFB 4CC3A 4C0ZA 1QVFS 1XNIA 1DJ7B 3QSUA 2YWWA 3I5SA 3H6ZA 5IN1A 5CQYA 2ESWA 1SHGA 4KH0B 2CJMB 4EC9B 5LJ3d 4AKGA 2BZ8A 1YJNT 4IIMA 3CMAT 2BZYA 3CCEA 3BY7A 5I2MA 3HL8A 1E7PA 2MPXC 3QZ9B 1JU5C 3VRZA 1M4ZA 3VS2A 1IO6A 2EYZA 1VQ6A 4J9CA 2ZCFB 2ABLA 5L2WB 2JTEA 3LH5A 1YHQA 1NLOC 3EOCB 3VS4A 4M75F 4PK4A 5I5ZB 3C95A 3G7ZA 4M7AE 4M78B 2KVQG 1VA7A 2JS2A 3NTKA 1O9KA 4NOYA 4F7NB 5L23A 4FYWB 1ZSGA 3OSSC 1VUBA 3BHUB 2F69A 4QKUA 1K0SA 2L3PA 3CCLA 2DPPB 5CKHA 1H92A 1QKXA 3BDLA 5C6SA 3G4SQ 1GUXA 1OPKA 1UJ0A 2EJGA 4AI6A 1K76A 4A4EA 4ELLA 4F7UB 2RNAA 4RTXA 4OGRB 2J6KA 3BLHB 3VKGA 2M51A 2X1NB 3M0TA 3OYLA 1ZUUA 4BBSM 2PUKB 2X3XD 3G6EQ 2CREA 4BCQD 4PJOD 5GMKh 4N4GA 2FZKB 3CC4Q 2RI2A 3L2UA 1Q81C 4UN0A 3CCEQ 5HBHB 2DIQA 3BW1A 2R57A 3FB9A 1AISB 3OS2A 3CCVQ 1JJ2P 1C6VX 2IN3A 1SPKA 1QCNA 1H1QB 3V8KA 1HYOA 3RR6A 5LJ5g 1ARKA 2X4JA 4QQGA 1IB8A 4A4GA 1G5VA 4F7JB 4M78G 4XK8E 2PK2A 1PWTA 4KT0E 3CCET 4C0DC 1AVZC 2EYQA 3HRTA 4F04B 3CCLQ 2LMJA 2BS3A 2DJQA 5GANh 4AFSC 1BIBA 4JX5A 4M78A 3I35A 4LN2A 4RTUA 3JCMQ 2F2XA 1M9SA 4ZN1A 1S72T 2HDAA 2AK5A 2NYSA 4KUIA 2QQBA 4JRQA 1BBZA 2JTMA 3H0IA 1OEBA 2RHUA 1NPPA 9ATCB 3I56A 4PNOA 2W9FA 3UA6A 4FYVB 5GMKi 3G6EA 4M7AD 3J80E 1O75A 2HNIA 2HKNA 1M1GA 5GAOm 1G8XA 4HCCA 1IHVA 5EJCA 2HSEB 3O8VA 1XOVA 4WTOB 3OYMA 4RCCA 3A5ZB 3N5BB 2O2OA 4PJOG 5DQVA 4OMNA 2O01E 2JMCA 2FRYA 1PD0A 3I55T 1RAIB 1HK9A 1WJQA 2CP2A 2DTHA 4QVCA 1WLPB 1HJDA 1VQ4Q 1MNDA 4ME7A 3QYEA 5FROA 4EOIB 4DOVA 2K2VA 1VYWB 2KYBA 4OVAA 1VQ5Q 1YI2A 2EKOA 2I40B 1UB4A 3CCMQ 1UECA 2VVKA 4OMOA 4TTHA 4BCFB 4Z89A 3OYBA 3RNJA 1IGQA 1TG0A 2Y90A 2MOXA 5GAMd 3VRYA 3I56Q 3CCQT 2K3YA 1CKAA 3ZL7C 4JUVA 2KQWA 1I1JA 4XAXB 3E19A 3VS7A 5LJ5h 4BI3A 5GAMe 4C8QE 4JX4A 4M77D 3DDPB 1ABQA 3MP1A 2EQKA 5IHKA 1E9HB 4HNUA 2VASA 1W1FA 3QDFA 2DEUA 5GAOp 1C0MA 2KDSA 1FMKA 2E3HA 4CFWB 1E7OA 2KT8A 2EGAA 4HT8A 2RI5A 1YHQQ 1BU2A 3MEUA 1KQSP 4ROEA 2MYSA 3CPWA 2GFAA 3MY5B 1K73R 2DZCA 3EG1A 2C0OA 3H9NA 4BE0A 4KULA 1WYXA 1X2QA 2QQAA 1VQ8Q 3QJYA 2XG8D 1B34A 1K8AC 4BCKB 2Y4XA 4LD6A 1VYTA 4Z02A 2JM8A 2CP5A 4X1VA 3VS0A 3BG9A 1QLYA 2EJFA 4M75C 2XDBA 3H0HA 1LVKA 1MNEA 5HKCA 1Q7YC 1GH6B 4C0GA 1SF9A 1D0YA 4E47A 3CC7Q 2DKGA 3EFSA 2OJ2A 4PJJA 5GAOq 2YUPA 2L89A 1PNJA 2DLPA 1PD1A 1WXBA 2X9HA 2GF7A 1RAAB 1U06A 2L3QA 3JCMh 1Z9QA 1K9MR 1SSFA 1PSFA 4XU2A 3CCSQ 4M75B 3JCMc 4HT9A 3RERA 2IVXA 4ELJA 1PG5B 5D6WA 4CFXB 2DX1A 2PUOB 3HO8A 2CUBA 2O4XA 4BCOB 4F6SB 5IH2A 2WPAB 1X6GA 5IXFA 2C06A 1U8RA 4ELZC 5LJ5d 3H4CA 5GAN2 1WXUA 4FCYA 2BKZB 4PJNA 4QVZA 5CIUA 3R6NA 3PTAA 1H25B 3QBYA 3DL1A 1WFWA 1Y0MA 2K4YA 2AIRB 2FZCB 2A3LA 1K73U 4HCZA 3S3NA 1EIFA 2FZGB 2CP7A 5I11A 2UZDB 1VQ8A 2ECZA 4M78E 2CKKA 1QKWA 1H28B 4ZGEB 2RO0A 1VQ9T 1TU0B 1YJNA 2QQ8A 1AWJA 2ZPBB 1M8VA 1YITT 4OB1B 1CKBA 3VS3A 2HMAA 4MDXA 3CC7A 1YNZA 3LYIA 2JS0A 1VQ6T 3X28B 3D7SB 1QP3A 1YHQT 4M77G 2HAXA 5FRNA 2H3EB 1QVFA 5CEIB 4N4HA 3HHTB 1I8FA 2I0NA 4O6JA 4LDYA 3PFSA 4XU1A 2CZ0B 2NLUA 1LOJA 2CDTA 2HL5C 1VQNT 3F70A 3L2WA 2QAZA 2JVVA 5LJ3h 2QDYB 2LJ1A 2RQTA 3UWNA 1ZX6A 3TSZA 1QMZB 1AT1B 1N9SA 2FPDA 2HBWA 3NFCA 3CCRQ 1UFFA 3GPLA 4KUDK 2UZEB 2K5LA 1VQNQ 2O31A 2AKLA 3JV3A 1K8AR 1TH7A 2DRMA 1F1BB 1UGSB 3UT1A 1IXDA 3KHIA 2GCXA 2RA2A 1WJSA 3PMIA 3EGUA 1RLPC 2IPOB 1VQ5A 1D0XA 1YI2Q 1OYXA 2DBKA 4E6RA 3FC3A 1B7TA 4IURA 1S1NA 2LW4A 1AD5A 1RACB 1X75C 1KFZA 4DBQA 5BNJB 3MKDA 5GMKe 2RD1A 1UUEA 2VGNA 4BUGA 4BCNB 1QCOA 2KK4A 4LOCA 4PLIA 1U1SA 1YBYA 1KJWA 3V7RA 4HCBA 1VINA 4JRKA 5EC7A 3SD4A 3EG2A 5KYYA 3TN8B 2E10A 4E7IA 5LJ3j 3FIFA 1M90R 4DBHA 4MDWA 3PO3S 4CI0C 4XTXA 5GAOn 3ULRB 3WVDB 1H26B 1BYMA 2HQEA 3BLRB 3RMQA 4JPBW 1WZOA 2CCIB 3MCAB 2F5TX 2DL5A 2A0FB 2BPMB 3EG0A 3SWNA 1UJYA 3JCMJ 2WIPB 5DQWA 4RKUE 2YXYA 1GY3B 1MUZA 1LCKA 1VQNA 1P92A 2CGHA 3DLMA 3TEEA 3DKMA 2ZPEB 3MP8A 2KNBB 4DOWA 4EMKC 5FU7C 4CC4B 2B9RA 4IUQA 4RTZA 3ZEHA 1ZQ1A 3QHWB 4YOZA 1UDLA 4C8QC 2R5AA 5IHNA 5A2QE 3I55A 1HD3A 4BCPB 2QG9B 1Q82U 3CQTA 2VYTA 3BG5A 1OI1A 3CCVT 3F5XB 4N0AA 1D1AA 4JZ4A 4EMHA 1K4US 2KMTA 1QCFA 2QI2A 2W96A 1Z9ZA 1T3LA 4Z88A 5LJ5j 1ZHIA 5IXBA 4XTYA 5CQXA 1N4MA 3OS1A 3PIPA 1NBEB 2LRQA 3CXCS 4CFUD 4C8QB 2JZ2A 3HRUA 3CCJA 2RK1A 2GBQA 2UZBB 3SFMA 5GAN3 3MJXA 1RAFB 2KAFA 4JRPA 2AT1B 1NYFA 1RL2A 2RHZA 1SEMA 3RDVA 1VQKQ 3EHRA 2W2HA 1N8RC 3M0QA 2OTLQ 1N6AA 1OL2B 3RUXA 2DF6A 3DJBA 3EH1A 2HQXA 2I2LA 4QQ6A 2K3BA 4FSSA 2JJ9A 4G6LB 4X9DA 4BDYA 1VQMQ 2KRSA 1OPLA 4VUBA 4HXJA 2X51A 3HTRA 1FINB 2EQUA 5ECAA 5KYYB 2QTVA 1VQOT 4F7UF 2MCNA 2ROLA 1UG1A 4KH1B 3GIBA 5GAMf 3JB9J 2YLCA 1M90C 3UPUA 3OYGA 2UZLB 3CMET 2K6DA 3GLXA 4AT1B 4E7SA 1WNLA 3A98A 4LXCA 3CC2T 1W98B 2EYXA 4C92G 1YN8A 3MEVA 4PLLA 4F17A 1GFCA 3QYBA 1NG2A 4R56A 1S72Q 3TVTA 2B8AA 2ZZDA 4HNVA 5GAN4 4M78F 1QVFP 1D3BB 4PKCC 2X4YA 3S3OA 3CMAA 3LGLA 3EAEA 4ESRA 3CD6T 1K8AU 4PJOF 4RTVA 3L1AA 2J6OA 1LNXA 3M56A 3LX7A 4XTWA 1N9RA 1C1AA 2ED1A 2ZPHB 2KI7A 4YOOA 1H8KA 5KYNA 1FWZA 4E7KA 2YUOA 2JMAA 4EOPB 1WQWA 2KRMA 2YSQA 4BE1A 4M7DB 2W99A 3CEYA 3MPUB 2KEAA 2EW3A 3HRSA 4J9IA 2CS7A 2G3RA 1W2BP 4EMKB 2PVOB 2KRNA 2V8JA 3NPFA 4F6UB 1T3SA 4ROCA 4HA8A 4ZN3A 1JB0E 4LUDA 2I53A 3G71Q 3VKHA 3HZJA 2DVJA 2QA4Q 2LTOA 2JW4A 3RMSA 2BE9B 1ZBJA 3INZA 2FHDA 1RAHB 1H1SB 2RQVA 3SB2A 2RHYA 3PE0A 7AT1B 1I07A 3EFOA 3CCUQ 2VXEA 2GTJA 4WF2A 1KD1U 3HPWA 1XO2A 3PNWC 4E7JA 3OB9A 3KFVA 1AWXA 3L42A 1YWOA 3G1JA 4J9DA 2DXCB 1NEBA 3VJPA 3M9QA 3OA6A 3MY1B 1OIYB 4M7AA 2EPDA 1TSFA 4MZTA 2XIDA 2E6NA 1WGSA 4Y72B 2DL8A 3UA7A 3TCJA 1VYVA 2HD0A 5I21A 3PMTA 1YJWA 4F7UG 3OY9A 2X3WD 4IUUA 4B6MA 4L5GA 2JUFA 3CD6A 3PT9A 3CPWP 5GAN7 2DL4A 4Z8AA 1YIJQ 1Q81U 2K3XA 5IF1B 5HY6A 3CBPA 3G71A 1VQ7Q 1VIFA 4LDUA 1O9SA 4FIBA 3DB4A 3BFMA 3EJ1B 1TUCA 1PKDB 1YCSB 2QK0A 3VS6A 2YUQA 3FJPA 4J9GA 5J39A 3OYKA 1W4SA 3A8MB 3P8DA 3V7SA 2QGSA 3EGXB 3M03A 2EVRA 2R7GA 2KXCA 4K11A 1Q7YR 2A28A 4O5VA 2DTOA 1VQ7T 1GRIA 2M9UA 2KE9A 1G3SA 4C5HA 4BI8B 1ZSZB 2VC8A 2KYMA 4Z6YA 4EC8B 1JBMA 3L2VA 2P0KA 2EKHA 2L3SA 4M7DC 2CUDA 2XD0A 3MI9B 3SHWA 1K1ZA 1VOMA 5IDPB 1WHMA 2CH4A 3M4GA 1J3TA 2CP6A 4OGEA 3TQ7P 1BCOA 3MEWA 5EFQB 2FB7A 4M77C 2EGCA 3X24B 2DNUA 4FU6A 4M7AB 3M57A 4OP0A 1UGQB 1QW1A 2EQIA 1I0CA 2O88A 2OI3A 2IVWA 4EIKA 3FLGA 3CC4A 2LT4A 2DD4A 4M6VA 2QDLA 3QIIA 4C92E 4ANJA 2V26A 1TFBA 4BXXX 4J7IA 2DO3A 1QWFA 3HBLA 3M0SA 3AT1B 2KT1A 1WHLA 2DVEA 1VQLA 4AMCA 3P8BB 1H1RB 4M7AC 2C6TB 4JLGA 2FO0A 2F2VA 1YIJT 3JSCA 4HKEA 2ZZDB 2MWOA 2K9GA 2GQIA 1RAGB 3JAME 3I9QA 2DAQA 2MK5A 1ENWA 3DB3A 3JB9F 4A4KA 2IG0A 2YLBA 1GXIE 3M0PA 3OYAA 2M1HA 1GCQC 2MF2A 2WIHB 1ZUYA 4M77F 2BZXA 1VOLA 5KCHA 5GAN5 1QQJA 2EQMA 5FW9A 4KBMB 4EOLB 2DYBA 3OYCA 1PRMC 4B9XA 3JCMg 3MEAA 2R58A 3H41A 1KC8U 2CZ6B 5M9OA 1TUDA 4C8QG 2D0QB 3CXCA 2DEQA 2GGRA 1H4LD 4JJBA 4LE9A 5LMKB 1VQMT 2FYKA 2Y4YA 3K7AM 2O9VA 3OS0A 2E12A 4BCND 2H3JA 2DFUA 2ZPGB 2DXTA 2PQWA 3NTHA 1KQSA 5KYUB 5LJ3g 2R5MA 1VQLQ 1JQQA 3DLLA 4CC7A 1W6XA 3OYYA 3QUIA 3CMEQ 5FGKB 4CFNB 1Q82R 2RK2A 1OOTA 5IAYA 4DQ2A 1G3TA 3CCST 2EJ9A 3PVQA 1OI9B 4L6V5 1JOWA 3SDZA 5LQFB 1Q82C 2RQWA 1URCB 4OB0B 3TNWB 4LDXA 3HB9A 1UHFA 1AZEA 4E7LA 4M7DE 2EFIA 2ZPIB 2D8JA 3X20B 2K57A 4EOOB 3C4SA 2QGGA 1UTIA 2UUEB 4HCKA 1BK2A 2DD4B 1WQ7A 2NUTB 4KRDB 3IQLA 4EDUA 4E2FB 1VQKT 4PJMA 3CXCP 3RKWA 1M2OA 2QEXQ 4D8DA 5HQ0B 3VS1A 1D09B 4HVUA 1Q81R 2OTJQ 5A0GA 2GQVA 2DXCA 1D1CA 3QG1A 1YI2T 1WX6A 1KHCA 2KGTA 2ZAEA 4UC4A 4FT2A 4F7SB 1PHTA 1UNGD 2VKNA 1GUXB 3L2RA 2XI9A 4ORZA 4BCGB 2JN0A 4E7HA 1Y07A 3T9NA 4ZTFA 1X27A 3V7CA 3FEOA 2GFUA 2BS4A 2YT6A 1RABB 4OR5B 3QHSA 1W2BS 4ATOA 1NJIU 1V76A 1AEYA 2F2CA 2YDLA 4JJDA 5KE2A 4D8KA 5CK9A 1IHWA 2VWFA 4NL2A 4DA4A 1AHJB 1XQHA 3FRNA 1OQKA 3TSWA 4CFVB 3VV0A 5LJ5e 4QT7A 1H3ZA 3LGFA 4CRLB 1A0NB 3OQ5A 3H8ZA 1RADB 2OTLT 1RUWA 2RH2A 2GTOA 4II1A 4EOKB 3QYHB 2RHIA 1B07A 1D3UB 2WJ9A 3EIDB 4EOQB 3LWIA 2LQWA 1C9BA 2KSSA 4BB7A 2OTJA 2WSCE 1NE8A 1ZUKA 1WHKA 1X69A 3EH2A 2Z0WA 2MAMA 2MI6A 3MIAB 1XTDA 1AWWA 5DM7R 4M7DA 4JS4A 1WPYA 1AD6A 2QQSA 4CXAB 2F1LA 2FPFA 3OYIA 4IMYB 1NYGA 1OZ2A 4XU3A 3BDUA 2WFYB 3RKXA 2DTIA 3QPHA 4RTTA 4FL6A 3TW6A 3JCMV 1WDXA 2JT4A 3JCMf 4FM4B 3QWYA 4MZMA 1W2BA 5GAMg 1JEGA 1GL5A 4II5B 3MO8A 2QQRA 4M75E 2KY9A 2PMIB 2G9XB 2V1RA 5KYWA 2A37A 1KQSS 3OYDA 5A0LA 1NJIC 4EOMB 3UF4A 2OX7A 4QW2A 4AG1C 4D6WA 2KR3A 2JM9A 2FEIA 5AT1B 2WMBB 3A8OB 3QYGB 3X25B 1M90U 5CKFA 2XDPA 5IT9E 3DDQB 1OGUB 4F7LB 1I5OB 3B57A 2DXBB 4PFPA 5CYIB 1JXOA 2J6FA 2HCKA 3SEMA 2DXUA 1JJ2A 3WVEB 1JO8A 1Q86C 2XHCA 2KR6A 3FDRA 1SSHA 2BKDN 4NSTB 3CC7T 2L0AA 4KRCB 3JCMP 3TU4K 3U23A 2LZ6B 3SWNC 3EG9B 3M53A 1KC8C 4MZPA 1M1KR 3VU3C 3QHRB 5HK0A 1PRLC 1OULA 1FVVB 1ZA1B 2QASA 4A4HA 2JTFA 2A7YA 2M16A 3JCMW 4R55A 1BIAA 3VS5A 1NPRA 4M4ZA 4J9BA 2SEMA 4MFDA 4JRIA 3SWNB 1UNHD 2G77A 3ER0A 4AFZC 1VQPA 1JRIA 1X6OA 3JB9I 1EX4A 4GY5A 4M78D 1B34B 1UNLD 1M27C 2EYWA 2O9SA 1KD1R 5I22A 3JB9G 5HCKA 1M3CA 2OAUA 4C5IA 4C8QF 3GBQA 3OYFA 2WMAB 2CSQA 2K5IA 5GAOr 2X4XA 1ZSZA 3C12A 3BE3A 5KYWB 4C8QD 4CFUB 4N0AC 4X9CA 5GAMh 2IW9B 2NUPB 5GJWB 2KBTA 1TS9A 2NWMA 1Q7YU 1G83A 5KYXB 1H3HA 1KXUA 2A08A 4PFZA 3QZ5B 3OMCA 1YP5A 4ZGDB 4OGCA 2L8DA 4J83A 1ZBXA 2EGEA 3JCMe 1M30A 3QWLA 1QVGA 5KCOA 1M1KU 5J3BA 2WHBB 4ZGJB 4P5NA 3OW2A 2K5FA 3CBOA 4J6YA 4BCMD 1E6GA 4OF1A 1Q95G 3KXTA 2LNHB 3V8JA 3L2ZA 2QGFB 4YOSA 3GTMS 5KH6A 1SKUB 3I56T 3CCQQ 1SHFA 2M0OA 1KG1A 4EPCA 3JCMX 4Q5WA 1GBQA 4LDVA 1Y71A 3R6OA 1VQOQ 2J7IA 3J7AF 1Y96B 1LPLA 2O4XB 2BE7D 2HEQA 1PKSA 3QDRB 2VGMA 3OS5A 2PVDB 4ELYC 2COYA 2DL7A 2AZSA 4GLMA 2WXVB 1NM7A 3O0GD 1IGUA 4C92B 4LUEA 3A8LB 2M0YA 4YC3B 2LCLA 5IHIA 4HLQA 1UGVA 4XU0A 1M8MA 1VQ5T 2LJ0A 2GNCA 2V22B 2HSPA 4DBFA 2RB6A 1H24B 4N4IA 1BKBA 4PJLA 4DEXA 4C92C 3H0FA 4C92D 4MMKA 2E70A 3VUBA 2P0QA 3CCVA 4DBRA 1GBRA 3MHXA 2YRDA 4HVWA 1WI7A 1FMVA 3CCQA 4M7AG 1JKWA 4M7DD 4AKHA 2AHJB 1LJOA 2XMFA 2P4RA 1VQOA 3CCUT 1OIUB 4M75G 2DE0X 1IREB 1N8RR 3M59A 1EFNA 5D7UA 4XTZA 1T0JA 3Q1JA 1JSTB 4BCHB 2DETA 3OYNA 4J9EA 5KYXA 2E65A 3HSBA 3DTOA 4J9HA 3TNIB 4B9WA 1YFNA 3CPFA 5DY9A 1I4K1 3URGA 1D3BA 3BG3A 4Y91A 5LJ3e 4C5EA 4C0DB 4JDSA 2DMOA 2K7AA 4BY6B 6AT1B 1OL1B 3CCSA 2LJ3A 2X4WA 1V29B 2RMOA 1SRLA 1X01A 1RI0A 3TW7A 2RM4A 4OB3B 3G4ST 3EGDA 4WCIA 4J9FA 1TWBA 2RHXA 2YRCA 1D1BA 4BY6C 5IDNB 2LQ8A 4XQ3A 1Y96A 2DZ9A 2WACA 3BLQB 1H1PB 2C0IA 2M02A 3NDQA 3P8HA 4M77A 1VQ4A 1WHJA 5HBEB 3OBWA 2LT1A 4AG2C 1QVPA 3RBBB 2E41A 4LD9K 4RODA 2CSIA 3C0CA 4C92A 4A53A 2XK0A 4ZTJA 1N8RU 1YJNQ 2EBPA 3LW5E 1G3WA 2MMPA 5ICPB 4JS5A 3BHVB 1XJWB 2RN8A 1SRMA 2QF7A 1TD6A 4J6XA 3I55Q 1UGPB 2IIMA 3QWXX 2COWA 2ZGWA 3E9GA 2D0NA 1GCQA 1BI0A 3E2UA 4QQDA 3JRZA 1YCYA 3EFOB 5GANg 2DERA 2PK9B 5HNBB 1CSKA 2HQHA 2FVUA 1U5SA 2E3IA 3I5RA 4EOJB 3HKSA 3VKIA 1VQ9A 2B86A 4RG8A 5D6YA 5CO7A 3MP6A 3M55A 2E5QA 2L5QA 2HKQB 2PNIA 3FJ5A 3A8HB 2DRKA 4C8QA 2DM1A 2D6FA 5GJVB 3PVLA 3CCRA 3OYHA 1IRXA 5GAN8 4BE2A 2OTLA 3DOGB 3OW2P 1RI9A 1N27A 3QO3A 2L3RA 5KYUA 3BHTB 5L8RE 1QP2A 3CCMT 5FLXE 4DEYA 2EYYA 5A0DA 3CC2A 1G3YA 4EMGA 3G71T 3CMAQ 2YHTA 4KGVB 2DXBA 1BI3A 2DL3A 1I81A 2JXBA 2MIOA 2C4GB 1R77A 2J05A 2QYZA 4HVVA 4NL3A 2DA9A 1VQ4T 3PGGA 3OMGA 1K9AA 4Y28E 3UATA 3J81E 3O5ZA 2A36A 1WJRA 2WEVB 4BCQB 5GAMj 2E1HA 2G6FX 1Q86R 1U3OA 3EG3A 4OMFB 2SRCA 1VIEA 3VUZA 3HP9A 2C5NB 2CP3A 1H27B 1VQPT 2E4HA 2PU9B 2XDDA 4EORB 2CT3A 2RQRA 2E64A 3RIRA 4TVRA 1KD1C 2QDJA 3LH0A 1NJIR 1WIEA 5I2SA 1AOJA 1MMNA 2RJFA 3GP8A 2LQNA 3L2QA 1PKTA 2D9TA 5KE3A 4A4FA 1NEGA 4A54A 3REAB 5DLQE 1TUGB 4XTUA 1H641 3CC2Q 1M3BA 5GANd 2DBMA
chains in the Genus database with same CATH topology
2P0PA 2RI3A 2RI2A 5DM7R 4M7DA 3L2UA 4JS4A 1Q81C 1MHNA 2DIGA 4J6WA 5GAOl 1WPYA 2QQSA 2DIQA 4MIMA 3OYIA 4VUBA 4RCBA 5GANf 1OZ2A 3BW1A 1M1KC 4BBRM 4XU3A 3BDUA 2R57A 3FB9A 3RKXA 3OS2A 2DTIA 2EQUA 3QPHA 4MMLA 4FL6A 3TW6A 5D6XA 3JCMV 3UDCA 3V8KA 1VQOT 1HXDA 1BI2A 4F7UF 4JX6A 5LJ5g 3JCMf 3OYJA 2QA4A 2X4JA 4QQGA 3GIBA 4A4GA 4C0FA 4FM4B 5GAMf 1G5VA 4M78G 4MZMA 4XK8E 2DD5B 2LX9A 5J26A 2QQ9A 3JB9J 2YLCA 1YITA 1W2BA 1M90C 4KT0E 1K9MC 5GAMg 3JCMb 3CCET 3UPUA 3OYGA 3CMET 3AHUA 3MO8A 3GLXA 4C0DC 2QQRA 4M75E 1WNLA 2KY9A 3LLRA 1YJWT 2EYQA 3HRTA 3CC2T 4C92G 2BS3A 1KQSS 3MEVA 4PLLA 5GANh 1BIBA 4BI4A 4JX5A 4M78A 2F5KA 4X34A 3OYDA 3QYBA 5A0LA 3JCMQ 4R56A 1NJIC 4PJOE 2XKOC 2B8AA 2ZZDA 4HNVA 5GAN4 2QA4T 1M9SA 3HFOA 4ZN1A 4M78F 4QW2A 1S72T 4HNTA 4D6WA 4KUIA 1D3BB 2QQBA 4PKCC 4JRQA 2X4YA 3S3OA 2JTMA 2P4TA 3LGLA 2WSFE 3EAEA 3CD6T 3E9FA 2RHUA 1NPPA 3A8OB 1K8AU 3I56A 4PJOF 3QYGB 4PNOA 4IUTA 3L1AA 3X25B 1M90U 1LNXA 2XDPA 3LX7A 3M56A 4XTWA 5CKFA 5IT9E 5GMKi 3G6EA 5LL6S 2DXBB 1N9RA 3JB9D 3J80E 4M7AD 1O75A 3M58A 2HNIA 2ZPHB 3CC4T 1K73C 1IZ6A 2DXUA 1JJ2A 1FWZA 1M1GA 3WVEB 2CZ1B 2LQKA 2XHCA 3NTIA 5GAOm 4E7KA 1WQWA 2KR6A 3FDRA 3M4YA 4J5YA 4BE1A 4HCCA 4M7DB 3CEYA 5EJCA 3O8VA 1XOVA 2BKDN 3OYMA 3CC7T 3HRSA 3A5ZB 3N5BB 4RCCA 2CS7A 4NC6A 2RJCA 4PJOG 3TU4K 3SWNC 3JCMP 2G3RA 3M53A 1KC8C 3CCJT 4MZPA 4EMKB 5CR2A 3LWHA 2PVOB 2O01E 2V8JA 5CVIA 3VU3C 1YIJA 5HK0A 1M5Q1 4M7DF 3I55T 2EWNA 4HA8A 4ZN3A 1JB0E 1HK9A 1WJQA 4CRIA 2DTHA 4QVCA 1KQ2A 3V8LA 3VKHA 3HZJA 2LTOA 1VQ7A 3RMSA 4ME7A 4J7FA 3QYEA 3INZA 4NS5A 4A4HA 2FHDA 2QTXA 2JTFA 2A7YA 2M16A 5FROA 3JCMW 4PJOB 4R55A 1BIAA 5CKBA 1NPRA 4DOVA 2K2VA 3SB2A 2RHYA 4MFDA 1FX7A 4JRIA 4OVAA 2LC4A 3SWNB 2G77A 3ER0A 1VQPA 1JRIA 1X6OA 3HFNA 4GY5A 4L59A 4M75D 2VXEA 3JB9I 4M78D 3OYEA 4WF2A 1B34B 1YI2A 2EKOA 1KD1U 3HPWA 1UB4A 3PNWC 1S72A 4E7JA 3OB9A 3JB9G 2RJDA 2OAUA 3L42A 4C5IA 1MGQA 4C8QF 3OYFA 3OYBA 2K5IA 5GAOr 2X4XA 3VYHB 3EFRA 3OBYA 3C12A 2Y90A 4C8QD 5GAMd 4M7AF 2DXCB 4N0AC 4X9CA 3VJPA 5GAMh 3M9QA 3CCQT 2K3YA 3OA6A 4JUVA 2KQWA 2BS2A 4M7AA 5FU6C 4MZTA 2XIDA 2E6NA 1WGSA 4XAXB 1Q7YU 3E19A 3ZBDA 2DD5A 4BACA 5LJ5h 2X35A 3ZFJA 4BI3A 5GAMe 3QZ5B 1KQ1A 3OMCA 3TCJA 4FSXA 3QXEB 4JX4A 4ZGDB 4OGCA 4HL4A 4M77D 4C8QE 2HD0A 4EMKA 5I21A 2L8DA 3PMTA 3MP1A 1ZBXA 4J83A 1YJWA 2EQKA 2WSEE 4F7UG 3JCMe 4HNUA 4JJNK 3OY9A 3QWLA 4IUUA 1VQLT 1QVGA 5KCOA 5GAOp 1M1KU 4L5GA 5J3BA 2KDSA 2JUFA 4F7UE 3PT9A 3CD6A 4ZGJB 4P5NA 5GAN7 2K5FA 3RESA 4YTLA 3OW2A 3JB9H 1Q81U 3CBOA 4J6YA 2K3XA 4HT8A 1UGRB 2FL7A 4OF1A 2RI5A 5FU6B 5CCAA 2JOYA 3KXTA 5HY6A 3MEUA 3V8JA 1Q86U 1M1FA 3L2ZA 3CBPA 3G71A 4IKFA 2QXFA 2GFAA 3JCMd 3CPWA 1VIFA 2DZCA 2QFZA 4LDUA 3ME9A 4BE0A 4KULA 1O9SA 4FIBA 2QQAA 3BFMA 3DB4A 5KH6A 3I56T 5FU7B 3QJYA 2M0OA 1KG1A 2XG8D 1B34A 4IUPA 4EPCA 4M77B 1K8AC 2Y4XA 4LD6A 4Q5WA 3JCMX 4LDVA 2YRVA 1Y71A 3R6OA 4Z02A 3J7AF 1Y96B 3CCUA 2O4XB 4QVDA 3BG9A 2EJFA 5GAN6 4M75C 2XDBA 4F7UA 5HKCA 3QDRB 4IUVA 2VV5A 2VGMA 4C0GA 3OS5A 2PVDB 3FJPA 4ELYC 1Q7YC 4E47A 2DKGA 1PSEA 5FRMA 2LCCA 3OSVA 3ASKA 3EFSA 5J39A 3OYKA 1VQKA 1W4SA 3A8MB 5GAOq 3P8DA 4C92B 3V7SA 5GANe 3A8LB 2L89A 3A8GB 1NZ9A 2GF7A 3GOXA 3G6ET 4O5VA 3RKYA 2LCLA 2DTOA 3CPWS 3JCMh 1VQ7T 4BD3A 1QVGS 4HLQA 1SSFA 1PSFA 4XU2A 4M75B 2M9UA 3JCMc 4XU0A 4HT9A 3RERA 4ELJA 4PL6A 5D6WA 1G3SA 4C5HA 4BI8B 1VQMA 1VQ5T 3M5AA 3GNGA 2VC8A 1I5LA 2PUOB 1JJ2S 3OW2S 3HO8A 5CKDA 2O4XA 4Z6YA 1JBMA 3L2VA 2RB6A 2DJZA 2P0KA 4N4IA 1BKBA 4BDZA 1Q86C 2C06A 4M7DC 2XD0A 1U8RA 1UEBA 4C92C 4QSHA 4ELZC 4FT4A 3H4CA 2ZPFB 5LJ5d 5GAN2 3G4SA 3M4GA 4C92D 4QVZA 5CIUA 3PTAA 1YJ9A 3QBYA 2E70A 4MMKA 3DL1A 2LVMA 4OGEA 2P0QA 3VUBA 4MFEA 3CCVA 2DK3A 2JNGA 2K4YA 3CCRT 2EIFA 4M77E 2A3LA 3MEWA 3S3MA 1K73U 2CZ7B 2FB7A 3MHXA 2XICA 1Y7XA 4M77C 4HCZA 3S3NA 1EIFA 5CAIA 3X24B 3C94A 4FU6A 5EG2A 4C5GA 2HBPA 1VQ8A 4RG2A 2LNVA 3CCQA 4M7AB 3M57A 4M78E 2CKKA 4OP0A 4M7AG 1UGQB 1QW1A 4M7DD 4ZGEB 2AHJB 4AKHA 1LJOA 2RO0A 1VQ9T 1VQOA 3CCUT 4PJOC 2IVWA 3FLGA 4M75G 3CC4A 2LT4A 1YJ9T 1YJNA 2DD4A 1IREB 2KMGA 2QQ8A 4M6VA 3X26B 3M59A 2ZPBB 3QIIA 4C92E 1M8VA 4XTZA 1YITT 3Q1JA 4OB1B 4J7IA 5LJ3f 2DO3A 3HBLA 3OYNA 1VQ8T 3HSBA 2E65A 4MDXA 5GMKm 3CC7A 3VYGB 3QKJA 2DVEA 4B9WA 1VQLA 3CPFA 3LYIA 5DY9A 1I4K1 3URGA 1D3BA 1VQ6T 3BG3A 3P8BB 4Y91A 2BIVA 3X28B 5LJ3e 3PIOA 3CMEA 4M78C 1QP3A 3QJ6A 4JLGA 4M77G 4C0DB 4C5EA 1YHQT 1YIJT 3JSCA 4HKEA 2ZZDB 2HAXA 5FRNA 2MWOA 3E1SA 4JDSA 1QVFA 4BY6B 3JAME 4N4HA 3HHTB 1I8FA 4O6JA 1K9MU 5HK3A 2DAQA 4LDYA 1OZ3A 5GMKl 3PFSA 3DB3A 4XU1A 2CZ0B 2NLUA 3CCSA 2VUBA 1LOJA 2X4WA 3JB9F 1VQNT 3KUFA 3F70A 2IG0A 4A4KA 2YLBA 2E6ZA 1GXIE 3L2WA 3KBGA 1V29B 4J8OA 3OYAA 2M1HA 3VYGA 2MF2A 1X01A 2MWPA 1RI0A 3TW7A 2JVVA 2QDYB 5LJ3h 4M77F 5GANj 2EAYA 2RM4A 3UWNA 5KCHA 5GAN5 4OB3B 2LDMA 3G4ST 2EQMA 2EQJA 4KBMB 1U1TA 4PJOA 2RHXA 3OYCA 4BY6C 1N9SA 2VXFA 4B9XA 2LQ8A 1R8OB 3NFCA 4XQ3A 3JCMg 1Y96A 2DZ9A 1KHIA 2WACA 3MEAA 4JLIA 2R58A 3P8HA 3GPLA 4M77A 1VQ4A 2PVGB 4KUDK 2K5LA 3OBWA 2LT1A 2QEXA 1KC8U 2CZ6B 1QVPA 5M9OA 1TH7A 4C8QG 1UGSB 2D0QB 2E41A 3UT1A 3KHIA 2GCXA 3CXCA 4LD9K 2DEQA 2RA2A 1WJSA 4C92A 2CYZB 1QLBA 2XK0A 2V8IA 3PMIA 4A53A 3CBMA 4ZTJA 1N8RU 5LJ5f 3M54A 1BI1A 1VQMT 1VQ5A 2FYKA 3LW5E 2Y4YA 3OS0A 1OYXA 1G3WA 2E12A 3FC3A 4OB2B 2MMPA 2H3JA 2PQWA 2ZPGB 2DXTA 3NTHA 4IURA 5GMKj 4JS5A 1KQSA 4RMOA 1X75C 3CCLT 5LJ3g 2R5MA 2QEXT 3DLLA 3S6WA 5C0MA 4V2SA 3OYYA 2QF7A 3QUIA 4J6XA 4C92F 1UGPB 1FKMA 3GF5A 2ZGWA 2RK2A 5GMKe 1FXXA 2RD1A 3E9GA 2OTJT 2V8KA 2VGNA 5IAYA 1BI0A 4BUGA 4DQ2A 1G3TA 4QQDA 2KK4A 3JRZA 1YCYA 3CCST 2EJ9A 4LOCA 4PLIA 1U1SA 1YBYA 5GANg 4L6V5 3META 3V7RA 4HCBA 2FVUA 4JRKA 3SDZA 1Q82C 4M7DG 4OB0B 3HKSA 3SD4A 3VKIA 4LDXA 2E10A 3HB9A 4E7IA 5LJ3j 3FIFA 1VQ9A 4MDWA 4CI0C 4E7LA 4XTXA 4M75A 4RG8A 5D6YA 5CO7A 4M7DE 5GAOn 3MP6A 3M55A 4AKIA 2E5QA 5AYFA 2XU8A 3CCMA 2EFIA 3WVDB 2L5QA 1BYMA 2HQEA 2ZPIB 2RJEA 3X20B 2K57A 3RMQA 2BUDA 3A8HB 4C8QA 2D6FA 3C4SA 3CCRA 3TREA 3MCAB 2F5TX 4LDWA 5CKEA 3OYHA 3WXMB 5GAN8 3SWNA 4BE2A 2DD4B 2OTLA 1WQ7A 4EDUA 5DLOA 3JCMJ 4RKUE 1VQKT 1N27A 3QO3A 2L3RA 4XTVA 1VQNA 1P92A 3RKWA 2CGHA 4GLKA 3DLMA 3GNFB 3TEEA 5L8RE 4C0ZA 1QP2A 3CCMT 5FLXE 3DKMA 1QVFS 1XNIA 1DJ7B 5A0GA 2GQVA 2DXCA 4M7AC 5A0DA 2ZPEB 1G3YA 4EMGA 3QG1A 3CC2A 3MP8A 3H6ZA 5IN1A 5CQYA 1YI2T 3QSUA 3G71T 1KHCA 5LJ3d 2YHTA 4AKGA 4DOWA 1YJNT 3CMAT 2DXBA 4UC4A 1BI3A 3CCEA 3BY7A 4FT2A 1I81A 5I2MA 4EMKC 3HL8A 1E7PA 5FU7C 3QZ9B 4IUQA 3ZEHA 1ZQ1A 4NL3A 3L2RA 1M4ZA 1VQ4T 2XI9A 3PGGA 4C8QC 2R5AA 3OMGA 1VQ6A 2ZCFB 2JN0A 4Y28E 4E7HA 5A2QE 3I55A 1YHQA 1Y07A 3T9NA 3J81E 1Q82U 4ZTFA 2VYTA 3BG5A 1OI1A 3V7CA 3CCVT 3FEOA 2GFUA 4M75F 2BS4A 1WJRA 3QHSA 4N0AA 3C95A 3G7ZA 5GAMj 2E1HA 4M78B 2KVQG 1W2BS 4M7AE 4ATOA 4EMHA 2KMTA 1NJIU 4OMFB 2QI2A 3NTKA 1VIEA 4NOYA 5LJ5j 1ZHIA 4XTYA 5CQXA 3VUZA 3OS1A 3OSSC 5KE2A 3PIPA 1VUBA 3HP9A 5CK9A 2F69A 1VQPT 4NL2A 2LRQA 3CXCS 3CCLA 4DA4A 2PU9B 2JZ2A 1AHJB 4C8QB 2XDDA 2DPPB 1XQHA 3HRUA 5CKHA 3CCJA 2RK1A 3FRNA 2E64A 3BDLA 3VV0A 5C6SA 3RIRA 5LJ5e 4TVRA 3SFMA 5GAN3 2KAFA 2EJGA 4JRPA 1H3ZA 1KD1C 4AI6A 3LGFA 1RL2A 2RHZA 4A4EA 2QDJA 3OQ5A 3H8ZA 3LH0A 4F7UB 2OTLT 2RH2A 1N8RC 4II1A 5I2SA 3VKGA 3OYLA 2RJFA 3GP8A 1N6AA 3QYHB 2RHIA 3L2QA 2WJ9A 4BBSM 3LWIA 3RUXA 2D9TA 5KE3A 2PUKB 2KSSA 4A4FA 4A54A 2HQXA 2I2LA 4QQ6A 4BB7A 2OTJA 5DLQE 2WSCE 4XTUA 1H641 1NE8A 4PJOD 4X9DA 2MAMA 2MI6A 4BDYA 5GANd 1XTDA 3CMAA 5GMKh 4N4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZ7 B;  4L6V 5;  3X24 B;  3VYH B;  4OB0 B;  1UGQ B;  2DXC B;  4ZGE B;  2AHJ B;  3WVD B;  2ZPI B;  3X20 B;  1IRE B;  2DD4 A;  2DD5 A;  3X26 B;  2ZPB B;  3A8H B;  4FM4 B;  3QZ5 B;  4OB1 B;  3QXE B;  4ZGD B;  4XK8 E;  2DD5 B;  2DD4 B;  4KT0 E;  3VYG B;  4RKU E;  2WSE E;  5L8R E;  1QP2 A;  3X28 B;  1QP3 A;  2ZZD B;  4ZGJ B;  1DJ7 B;  2DXC A;  2ZPE B;  1UGR B;  3HHT B;  2ZZD A;  2CZ0 B;  2DXB A;  1GXI E;  1V29 B;  3QZ9 B;  3VYG A;  2WSF E;  3A8O B;  2QDY B;  3QYG B;  3X25 B;  2ZCF B;  4OB3 B;  4Y28 E;  2DXB B;  2ZPH B;  3WVE B;  2CZ1 B;  2PVD B;  1PSE A;  2PVG B;  2CZ6 B;  3A8M B;  3A8L B;  1UGS B;  2D0Q B;  2PU9 B;  1AHJ B;  2O01 E;  2PVO B;  2DPP B;  3A8G B;  2CYZ B;  1JB0 E;  1PSF A;  3LW5 E;  4OB2 B;  2ZPG B;  2PUO B;  3QYH B;  2PUK B;  2ZPF B;  1UGP B;  2WSC E; 
#chains in the Genus database with same CATH topology
 2P0P A;  2RI3 A;  1MHN A;  2DIG A;  4J6W A;  5GAO l;  2FRW A;  4MIM A;  4EOS B;  4RCB A;  5GAN f;  1E6H A;  4BBR M;  1M1K C;  1KC8 R;  1YJ9 Q;  4MML A;  4AFQ C;  5D6X A;  4E7Z A;  3UDC A;  1HXD A;  1BI2 A;  2QA4 A;  4JX6 A;  4F6W B;  3OYJ A;  4FYY B;  2K2M A;  1WXT A;  4C0F A;  1NLP C;  2DD5 B;  2LX9 A;  5J26 A;  2QQ9 A;  1YIT A;  1K9M C;  2PZ1 A;  1F5Q B;  3JCM b;  3AHU A;  1GFD A;  1YJW T;  3LLR A;  1OX9 A;  4FW1 A;  4BI4 A;  4X34 A;  2F5K A;  4PJO E;  2XKO C;  1QVG P;  3REB B;  2QA4 T;  3HFO A;  2LX7 A;  4CC2 A;  2FPE A;  1K0X A;  4HNT A;  2E5K A;  4KGX B;  2RQU A;  5FWC A;  2P4T A;  2WSF E;  3E9F A;  1TTH B;  4AFU C;  4IUT A;  3NMZ C;  1GCP A;  1R0B G;  3EG9 A;  4A63 B;  3JB9 D;  5LL6 S;  8AT1 B;  1G2B A;  5IHY A;  3M58 A;  3CC4 T;  1QMC A;  1K73 C;  1IZ6 A;  1M2V B;  2LQK A;  2CZ1 B;  3NTI A;  4PFO A;  3M4Y A;  4J5Y A;  1MV3 A;  2LP5 A;  4RTY A;  4LNP A;  4NC6 A;  2RJC A;  3A1P A;  1ZP2 A;  1OU9 A;  2C5X B;  4EON B;  3CCJ T;  3CD6 Q;  5CR2 A;  3LWH A;  5CVI A;  1RLQ C;  1YIJ A;  4KGZ B;  2C0T A;  1M5Q 1;  4M7D F;  1BCM A;  2EWN A;  2JGZ B;  1KQ2 A;  4CRI A;  2COZ A;  4OML A;  3V8L A;  1OU8 A;  1VQ7 A;  1P5E B;  1MV0 B;  4J7F A;  1SG5 A;  4NS5 A;  2QTX A;  5HVY B;  4PJO B;  2AZV A;  5CKB A;  4OMM A;  4FX3 B;  2K79 A;  1MMA A;  1FX7 A;  1OX8 A;  2LC4 A;  3HFN A;  1MMD A;  2YUN A;  4L59 A;  4M75 D;  1VQ9 Q;  3OYE A;  1R0C B;  1M3A A;  1FYN A;  1S72 A;  4F14 A;  2RJD A;  3NHN A;  1MGQ A;  2LCS A;  2ED0 A;  3VYH B;  3EFR A;  1QWE A;  3OBY A;  1TXQ A;  1O9K B;  1W70 A;  4IIO A;  1X43 A;  2BS2 A;  4R0K A;  4BCJ B;  5FU6 C;  1B3Q A;  2DD5 A;  3ZBD A;  4BAC A;  2X35 A;  3ZFJ A;  1X2K A;  1KQ1 A;  5FWB A;  4FSX A;  3QXE B;  2VB6 A;  4HL4 A;  4EMK A;  5HBJ B;  1WHH A;  2WSE E;  4JJN K;  4BCM B;  1OKV B;  3RGF B;  2OAW A;  2F2W A;  1VQL T;  4F7U E;  2D1X A;  3RES A;  4YTL A;  3JB9 H;  4ZNX A;  1PM3 A;  1M2V A;  1UGR B;  2AKK A;  2FL7 A;  5FU6 B;  5CCA A;  2JOY A;  4FW2 A;  3M0R A;  1Q86 U;  1M1F A;  1BU1 A;  4IKF A;  2QXF A;  1D0Z A;  3JCM d;  2QFZ A;  3ME9 A;  2CH4 W;  5FU7 B;  4IUP A;  1ZA2 B;  4BY1 X;  4M77 B;  2YRV A;  2P84 A;  3CCU A;  4QVD A;  3NGP A;  5GAN 6;  3CCJ Q;  1Y57 A;  4F7U A;  4IUV A;  2PHG A;  4CFM B;  2VV5 A;  4F16 A;  3EGD B;  1PSE A;  5FRM A;  2LCC A;  2DME A;  3ASK A;  3OSV A;  4I3Z B;  1VQK A;  5GAN e;  4F70 B;  1YWP A;  1T0H A;  1VYU A;  3A8G B;  1NZ9 A;  1MMG A;  3GOX A;  3G6E T;  3RKY A;  3CPW S;  1X6B A;  3EHQ A;  4BD3 A;  1QVG S;  3TNH B;  2BTT A;  4PL6 A;  1HSQ A;  1VQM A;  3M5A A;  3GNG A;  1I5L A;  1JJ2 S;  3OW2 S;  5CKD A;  1YJW Q;  2DJZ A;  2C5O B;  4BDZ A;  2KRO A;  1UEB A;  4M7A F;  4QSH A;  4FT4 A;  2ZPF B;  3G4S A;  2ATC B;  1YJ9 A;  2LVM A;  4MFE A;  3M0U A;  2DK3 A;  2JNG A;  4RUG A;  3CCR T;  2EIF A;  4M77 E;  4OMP A;  4FYX B;  3S3M A;  2CZ7 B;  1KSW A;  2J06 A;  2EUF A;  1Y7X A;  2XIC A;  5CAI A;  2HL3 A;  3C94 A;  5EG2 A;  4C5G A;  2HBP A;  2NUZ A;  1YIT Q;  4KRT A;  2LNV A;  4RG2 A;  1AWO A;  3POM A;  1TOV A;  2W0Z A;  2W9Z A;  1JXM A;  4PJO C;  2V1Q A;  2DIL A;  1YJ9 T;  4Y92 A;  2KMG A;  3X26 B;  1V1C A;  5LJ3 f;  1VQ8 T;  3EGX A;  5GMK m;  2DYI A;  4JZ3 A;  3VYG B;  3QKJ A;  3PIO A;  2BIV A;  3CME A;  4M78 C;  3QJ6 A;  1BB9 A;  2RPN A;  1ACM B;  3E1S A;  1K9M U;  5HK3 A;  1ZSZ C;  1OZ3 A;  5GMK l;  1OKW B;  2VUB A;  5ACB A;  1FMW A;  3KUF A;  2KXD A;  2E6Z A;  3KBG A;  2HZY A;  4J8O A;  2FG0 A;  3VYG A;  2ENM A;  2MWP A;  5GAN j;  4BCI B;  2EAY A;  1G3N C;  2LDM A;  2EQJ A;  4GBQ A;  1U1T A;  4PJO A;  1PCX A;  2VXF A;  1R8O B;  1KIK A;  1KHI A;  2IW8 B;  4JLI A;  1ZLM A;  2PVG B;  2D8H A;  2L2P A;  2QEX A;  8ATC B;  4BY7 X;  2H8H A;  2NUT A;  4RTW A;  2ROT A;  2CYZ B;  1QLB A;  2V8I A;  3CBM A;  3THK A;  5LJ5 f;  1RAE B;  3M54 A;  1BI1 A;  2NUP A;  4OB2 B;  5GMK j;  1WHG A;  4OMQ A;  4RMO A;  3CCL T;  2QEX T;  1EZZ B;  1VQ6 Q;  3S6W A;  5C0M A;  4V2S A;  4C92 F;  1FKM A;  3GF5 A;  1AZG B;  2CT4 A;  1N5Z A;  1FXX A;  4JJC A;  2OTJ T;  2V8K A;  3LQ5 B;  3MET A;  1PC0 A;  2RF0 A;  4M7D G;  1JSU B;  1VQP Q;  2IW6 B;  1UHC A;  1ABO A;  2CP0 A;  4M75 A;  2PJQ A;  4AKI A;  3G33 B;  5AYF A;  2XU8 A;  3CCM A;  1KK7 A;  2PTK A;  2RJE A;  2BUD A;  3TRE A;  4LDW A;  5CKE A;  3WXM B;  2C5V B;  1OV3 A;  5DLO A;  1UE9 A;  4XTV A;  2CCH B;  1WA7 A;  2W10 A;  4GLK A;  3GNF B;  4CC3 A;  4C0Z A;  1QVF S;  1XNI A;  1DJ7 B;  3QSU A;  2YWW A;  3I5S A;  3H6Z A;  5IN1 A;  5CQY A;  2ESW A;  1SHG A;  4KH0 B;  2CJM B;  4EC9 B;  5LJ3 d;  4AKG A;  2BZ8 A;  1YJN T;  4IIM A;  3CMA T;  2BZY A;  3CCE A;  3BY7 A;  5I2M A;  3HL8 A;  1E7P A;  2MPX C;  3QZ9 B;  1JU5 C;  3VRZ A;  1M4Z A;  3VS2 A;  1IO6 A;  2EYZ A;  1VQ6 A;  4J9C A;  2ZCF B;  2ABL A;  5L2W B;  2JTE A;  3LH5 A;  1YHQ A;  1NLO C;  3EOC B;  3VS4 A;  4M75 F;  4PK4 A;  5I5Z B;  3C95 A;  3G7Z A;  4M7A E;  4M78 B;  2KVQ G;  1VA7 A;  2JS2 A;  3NTK A;  1O9K A;  4NOY A;  4F7N B;  5L23 A;  4FYW B;  1ZSG A;  3OSS C;  1VUB A;  3BHU B;  2F69 A;  4QKU A;  1K0S A;  2L3P A;  3CCL A;  2DPP B;  5CKH A;  1H92 A;  1QKX A;  3BDL A;  5C6S A;  3G4S Q;  1GUX A;  1OPK A;  1UJ0 A;  2EJG A;  4AI6 A;  1K76 A;  4A4E A;  4ELL A;  4F7U B;  2RNA A;  4RTX A;  4OGR B;  2J6K A;  3BLH B;  3VKG A;  2M51 A;  2X1N B;  3M0T A;  3OYL A;  1ZUU A;  4BBS M;  2PUK B;  2X3X D;  3G6E Q;  2CRE A;  4BCQ D;  4PJO D;  5GMK h;  4N4G A;  2FZK B;  3CC4 Q;  2RI2 A;  3L2U A;  1Q81 C;  4UN0 A;  3CCE Q;  5HBH B;  2DIQ A;  3BW1 A;  2R57 A;  3FB9 A;  1AIS B;  3OS2 A;  3CCV Q;  1JJ2 P;  1C6V X;  2IN3 A;  1SPK A;  1QCN A;  1H1Q B;  3V8K A;  1HYO A;  3RR6 A;  5LJ5 g;  1ARK A;  2X4J A;  4QQG A;  1IB8 A;  4A4G A;  1G5V A;  4F7J B;  4M78 G;  4XK8 E;  2PK2 A;  1PWT A;  4KT0 E;  3CCE T;  4C0D C;  1AVZ C;  2EYQ A;  3HRT A;  4F04 B;  3CCL Q;  2LMJ A;  2BS3 A;  2DJQ A;  5GAN h;  4AFS C;  1BIB A;  4JX5 A;  4M78 A;  3I35 A;  4LN2 A;  4RTU A;  3JCM Q;  2F2X A;  1M9S A;  4ZN1 A;  1S72 T;  2HDA A;  2AK5 A;  2NYS A;  4KUI A;  2QQB A;  4JRQ A;  1BBZ A;  2JTM A;  3H0I A;  1OEB A;  2RHU A;  1NPP A;  9ATC B;  3I56 A;  4PNO A;  2W9F A;  3UA6 A;  4FYV B;  5GMK i;  3G6E A;  4M7A D;  3J80 E;  1O75 A;  2HNI A;  2HKN A;  1M1G A;  5GAO m;  1G8X A;  4HCC A;  1IHV A;  5EJC A;  2HSE B;  3O8V A;  1XOV A;  4WTO B;  3OYM A;  4RCC A;  3A5Z B;  3N5B B;  2O2O A;  4PJO G;  5DQV A;  4OMN A;  2O01 E;  2JMC A;  2FRY A;  1PD0 A;  3I55 T;  1RAI B;  1HK9 A;  1WJQ A;  2CP2 A;  2DTH A;  4QVC A;  1WLP B;  1HJD A;  1VQ4 Q;  1MND A;  4ME7 A;  3QYE A;  5FRO A;  4EOI B;  4DOV A;  2K2V A;  1VYW B;  2KYB A;  4OVA A;  1VQ5 Q;  1YI2 A;  2EKO A;  2I40 B;  1UB4 A;  3CCM Q;  1UEC A;  2VVK A;  4OMO A;  4TTH A;  4BCF B;  4Z89 A;  3OYB A;  3RNJ A;  1IGQ A;  1TG0 A;  2Y90 A;  2MOX A;  5GAM d;  3VRY A;  3I56 Q;  3CCQ T;  2K3Y A;  1CKA A;  3ZL7 C;  4JUV A;  2KQW A;  1I1J A;  4XAX B;  3E19 A;  3VS7 A;  5LJ5 h;  4BI3 A;  5GAM e;  4C8Q E;  4JX4 A;  4M77 D;  3DDP B;  1ABQ A;  3MP1 A;  2EQK A;  5IHK A;  1E9H B;  4HNU A;  2VAS A;  1W1F A;  3QDF A;  2DEU A;  5GAO p;  1C0M A;  2KDS A;  1FMK A;  2E3H A;  4CFW B;  1E7O A;  2KT8 A;  2EGA A;  4HT8 A;  2RI5 A;  1YHQ Q;  1BU2 A;  3MEU A;  1KQS P;  4ROE A;  2MYS A;  3CPW A;  2GFA A;  3MY5 B;  1K73 R;  2DZC A;  3EG1 A;  2C0O A;  3H9N A;  4BE0 A;  4KUL A;  1WYX A;  1X2Q A;  2QQA A;  1VQ8 Q;  3QJY A;  2XG8 D;  1B34 A;  1K8A C;  4BCK B;  2Y4X A;  4LD6 A;  1VYT A;  4Z02 A;  2JM8 A;  2CP5 A;  4X1V A;  3VS0 A;  3BG9 A;  1QLY A;  2EJF A;  4M75 C;  2XDB A;  3H0H A;  1LVK A;  1MNE A;  5HKC A;  1Q7Y C;  1GH6 B;  4C0G A;  1SF9 A;  1D0Y A;  4E47 A;  3CC7 Q;  2DKG A;  3EFS A;  2OJ2 A;  4PJJ A;  5GAO q;  2YUP A;  2L89 A;  1PNJ A;  2DLP A;  1PD1 A;  1WXB A;  2X9H A;  2GF7 A;  1RAA B;  1U06 A;  2L3Q A;  3JCM h;  1Z9Q A;  1K9M R;  1SSF A;  1PSF A;  4XU2 A;  3CCS Q;  4M75 B;  3JCM c;  4HT9 A;  3RER A;  2IVX A;  4ELJ A;  1PG5 B;  5D6W A;  4CFX B;  2DX1 A;  2PUO B;  3HO8 A;  2CUB A;  2O4X A;  4BCO B;  4F6S B;  5IH2 A;  2WPA B;  1X6G A;  5IXF A;  2C06 A;  1U8R A;  4ELZ C;  5LJ5 d;  3H4C A;  5GAN 2;  1WXU A;  4FCY A;  2BKZ B;  4PJN A;  4QVZ A;  5CIU A;  3R6N A;  3PTA A;  1H25 B;  3QBY A;  3DL1 A;  1WFW A;  1Y0M A;  2K4Y A;  2AIR B;  2FZC B;  2A3L A;  1K73 U;  4HCZ A;  3S3N A;  1EIF A;  2FZG B;  2CP7 A;  5I11 A;  2UZD B;  1VQ8 A;  2ECZ A;  4M78 E;  2CKK A;  1QKW A;  1H28 B;  4ZGE B;  2RO0 A;  1VQ9 T;  1TU0 B;  1YJN A;  2QQ8 A;  1AWJ A;  2ZPB B;  1M8V A;  1YIT T;  4OB1 B;  1CKB A;  3VS3 A;  2HMA A;  4MDX A;  3CC7 A;  1YNZ A;  3LYI A;  2JS0 A;  1VQ6 T;  3X28 B;  3D7S B;  1QP3 A;  1YHQ T;  4M77 G;  2HAX A;  5FRN A;  2H3E B;  1QVF A;  5CEI B;  4N4H A;  3HHT B;  1I8F A;  2I0N A;  4O6J A;  4LDY A;  3PFS A;  4XU1 A;  2CZ0 B;  2NLU A;  1LOJ A;  2CDT A;  2HL5 C;  1VQN T;  3F70 A;  3L2W A;  2QAZ A;  2JVV A;  5LJ3 h;  2QDY B;  2LJ1 A;  2RQT A;  3UWN A;  1ZX6 A;  3TSZ A;  1QMZ B;  1AT1 B;  1N9S A;  2FPD A;  2HBW A;  3NFC A;  3CCR Q;  1UFF A;  3GPL A;  4KUD K;  2UZE B;  2K5L A;  1VQN Q;  2O31 A;  2AKL A;  3JV3 A;  1K8A R;  1TH7 A;  2DRM A;  1F1B B;  1UGS B;  3UT1 A;  1IXD A;  3KHI A;  2GCX A;  2RA2 A;  1WJS A;  3PMI A;  3EGU A;  1RLP C;  2IPO B;  1VQ5 A;  1D0X A;  1YI2 Q;  1OYX A;  2DBK A;  4E6R A;  3FC3 A;  1B7T A;  4IUR A;  1S1N A;  2LW4 A;  1AD5 A;  1RAC B;  1X75 C;  1KFZ A;  4DBQ A;  5BNJ B;  3MKD A;  5GMK e;  2RD1 A;  1UUE A;  2VGN A;  4BUG A;  4BCN B;  1QCO A;  2KK4 A;  4LOC A;  4PLI A;  1U1S A;  1YBY A;  1KJW A;  3V7R A;  4HCB A;  1VIN A;  4JRK A;  5EC7 A;  3SD4 A;  3EG2 A;  5KYY A;  3TN8 B;  2E10 A;  4E7I A;  5LJ3 j;  3FIF A;  1M90 R;  4DBH A;  4MDW A;  3PO3 S;  4CI0 C;  4XTX A;  5GAO n;  3ULR B;  3WVD B;  1H26 B;  1BYM A;  2HQE A;  3BLR B;  3RMQ A;  4JPB W;  1WZO A;  2CCI B;  3MCA B;  2F5T X;  2DL5 A;  2A0F B;  2BPM B;  3EG0 A;  3SWN A;  1UJY A;  3JCM J;  2WIP B;  5DQW A;  4RKU E;  2YXY A;  1GY3 B;  1MUZ A;  1LCK A;  1VQN A;  1P92 A;  2CGH A;  3DLM A;  3TEE A;  3DKM A;  2ZPE B;  3MP8 A;  2KNB B;  4DOW A;  4EMK C;  5FU7 C;  4CC4 B;  2B9R A;  4IUQ A;  4RTZ A;  3ZEH A;  1ZQ1 A;  3QHW B;  4YOZ A;  1UDL A;  4C8Q C;  2R5A A;  5IHN A;  5A2Q E;  3I55 A;  1HD3 A;  4BCP B;  2QG9 B;  1Q82 U;  3CQT A;  2VYT A;  3BG5 A;  1OI1 A;  3CCV T;  3F5X B;  4N0A A;  1D1A A;  4JZ4 A;  4EMH A;  1K4U S;  2KMT A;  1QCF A;  2QI2 A;  2W96 A;  1Z9Z A;  1T3L A;  4Z88 A;  5LJ5 j;  1ZHI A;  5IXB A;  4XTY A;  5CQX A;  1N4M A;  3OS1 A;  3PIP A;  1NBE B;  2LRQ A;  3CXC S;  4CFU D;  4C8Q B;  2JZ2 A;  3HRU A;  3CCJ A;  2RK1 A;  2GBQ A;  2UZB B;  3SFM A;  5GAN 3;  3MJX A;  1RAF B;  2KAF A;  4JRP A;  2AT1 B;  1NYF A;  1RL2 A;  2RHZ A;  1SEM A;  3RDV A;  1VQK Q;  3EHR A;  2W2H A;  1N8R C;  3M0Q A;  2OTL Q;  1N6A A;  1OL2 B;  3RUX A;  2DF6 A;  3DJB A;  3EH1 A;  2HQX A;  2I2L A;  4QQ6 A;  2K3B A;  4FSS A;  2JJ9 A;  4G6L B;  4X9D A;  4BDY A;  1VQM Q;  2KRS A;  1OPL A;  4VUB A;  4HXJ A;  2X51 A;  3HTR A;  1FIN B;  2EQU A;  5ECA A;  5KYY B;  2QTV A;  1VQO T;  4F7U F;  2MCN A;  2ROL A;  1UG1 A;  4KH1 B;  3GIB A;  5GAM f;  3JB9 J;  2YLC A;  1M90 C;  3UPU A;  3OYG A;  2UZL B;  3CME T;  2K6D A;  3GLX A;  4AT1 B;  4E7S A;  1WNL A;  3A98 A;  4LXC A;  3CC2 T;  1W98 B;  2EYX A;  4C92 G;  1YN8 A;  3MEV A;  4PLL A;  4F17 A;  1GFC A;  3QYB A;  1NG2 A;  4R56 A;  1S72 Q;  3TVT A;  2B8A A;  2ZZD A;  4HNV A;  5GAN 4;  4M78 F;  1QVF P;  1D3B B;  4PKC C;  2X4Y A;  3S3O A;  3CMA A;  3LGL A;  3EAE A;  4ESR A;  3CD6 T;  1K8A U;  4PJO F;  4RTV A;  3L1A A;  2J6O A;  1LNX A;  3M56 A;  3LX7 A;  4XTW A;  1N9R A;  1C1A A;  2ED1 A;  2ZPH B;  2KI7 A;  4YOO A;  1H8K A;  5KYN A;  1FWZ A;  4E7K A;  2YUO A;  2JMA A;  4EOP B;  1WQW A;  2KRM A;  2YSQ A;  4BE1 A;  4M7D B;  2W99 A;  3CEY A;  3MPU B;  2KEA A;  2EW3 A;  3HRS A;  4J9I A;  2CS7 A;  2G3R A;  1W2B P;  4EMK B;  2PVO B;  2KRN A;  2V8J A;  3NPF A;  4F6U B;  1T3S A;  4ROC A;  4HA8 A;  4ZN3 A;  1JB0 E;  4LUD A;  2I53 A;  3G71 Q;  3VKH A;  3HZJ A;  2DVJ A;  2QA4 Q;  2LTO A;  2JW4 A;  3RMS A;  2BE9 B;  1ZBJ A;  3INZ A;  2FHD A;  1RAH B;  1H1S B;  2RQV A;  3SB2 A;  2RHY A;  3PE0 A;  7AT1 B;  1I07 A;  3EFO A;  3CCU Q;  2VXE A;  2GTJ A;  4WF2 A;  1KD1 U;  3HPW A;  1XO2 A;  3PNW C;  4E7J A;  3OB9 A;  3KFV A;  1AWX A;  3L42 A;  1YWO A;  3G1J A;  4J9D A;  2DXC B;  1NEB A;  3VJP A;  3M9Q A;  3OA6 A;  3MY1 B;  1OIY B;  4M7A A;  2EPD A;  1TSF A;  4MZT A;  2XID A;  2E6N A;  1WGS A;  4Y72 B;  2DL8 A;  3UA7 A;  3TCJ A;  1VYV A;  2HD0 A;  5I21 A;  3PMT A;  1YJW A;  4F7U G;  3OY9 A;  2X3W D;  4IUU A;  4B6M A;  4L5G A;  2JUF A;  3CD6 A;  3PT9 A;  3CPW P;  5GAN 7;  2DL4 A;  4Z8A A;  1YIJ Q;  1Q81 U;  2K3X A;  5IF1 B;  5HY6 A;  3CBP A;  3G71 A;  1VQ7 Q;  1VIF A;  4LDU A;  1O9S A;  4FIB A;  3DB4 A;  3BFM A;  3EJ1 B;  1TUC A;  1PKD B;  1YCS B;  2QK0 A;  3VS6 A;  2YUQ A;  3FJP A;  4J9G A;  5J39 A;  3OYK A;  1W4S A;  3A8M B;  3P8D A;  3V7S A;  2QGS A;  3EGX B;  3M03 A;  2EVR A;  2R7G A;  2KXC A;  4K11 A;  1Q7Y R;  2A28 A;  4O5V A;  2DTO A;  1VQ7 T;  1GRI A;  2M9U A;  2KE9 A;  1G3S A;  4C5H A;  4BI8 B;  1ZSZ B;  2VC8 A;  2KYM A;  4Z6Y A;  4EC8 B;  1JBM A;  3L2V A;  2P0K A;  2EKH A;  2L3S A;  4M7D C;  2CUD A;  2XD0 A;  3MI9 B;  3SHW A;  1K1Z A;  1VOM A;  5IDP B;  1WHM A;  2CH4 A;  3M4G A;  1J3T A;  2CP6 A;  4OGE A;  3TQ7 P;  1BCO A;  3MEW A;  5EFQ B;  2FB7 A;  4M77 C;  2EGC A;  3X24 B;  2DNU A;  4FU6 A;  4M7A B;  3M57 A;  4OP0 A;  1UGQ B;  1QW1 A;  2EQI A;  1I0C A;  2O88 A;  2OI3 A;  2IVW A;  4EIK A;  3FLG A;  3CC4 A;  2LT4 A;  2DD4 A;  4M6V A;  2QDL A;  3QII A;  4C92 E;  4ANJ A;  2V26 A;  1TFB A;  4BXX X;  4J7I A;  2DO3 A;  1QWF A;  3HBL A;  3M0S A;  3AT1 B;  2KT1 A;  1WHL A;  2DVE A;  1VQL A;  4AMC A;  3P8B B;  1H1R B;  4M7A C;  2C6T B;  4JLG A;  2FO0 A;  2F2V A;  1YIJ T;  3JSC A;  4HKE A;  2ZZD B;  2MWO A;  2K9G A;  2GQI A;  1RAG B;  3JAM E;  3I9Q A;  2DAQ A;  2MK5 A;  1ENW A;  3DB3 A;  3JB9 F;  4A4K A;  2IG0 A;  2YLB A;  1GXI E;  3M0P A;  3OYA A;  2M1H A;  1GCQ C;  2MF2 A;  2WIH B;  1ZUY A;  4M77 F;  2BZX A;  1VOL A;  5KCH A;  5GAN 5;  1QQJ A;  2EQM A;  5FW9 A;  4KBM B;  4EOL B;  2DYB A;  3OYC A;  1PRM C;  4B9X A;  3JCM g;  3MEA A;  2R58 A;  3H41 A;  1KC8 U;  2CZ6 B;  5M9O A;  1TUD A;  4C8Q G;  2D0Q B;  3CXC A;  2DEQ A;  2GGR A;  1H4L D;  4JJB A;  4LE9 A;  5LMK B;  1VQM T;  2FYK A;  2Y4Y A;  3K7A M;  2O9V A;  3OS0 A;  2E12 A;  4BCN D;  2H3J A;  2DFU A;  2ZPG B;  2DXT A;  2PQW A;  3NTH A;  1KQS A;  5KYU B;  5LJ3 g;  2R5M A;  1VQL Q;  1JQQ A;  3DLL A;  4CC7 A;  1W6X A;  3OYY A;  3QUI A;  3CME Q;  5FGK B;  4CFN B;  1Q82 R;  2RK2 A;  1OOT A;  5IAY A;  4DQ2 A;  1G3T A;  3CCS T;  2EJ9 A;  3PVQ A;  1OI9 B;  4L6V 5;  1JOW A;  3SDZ A;  5LQF B;  1Q82 C;  2RQW A;  1URC B;  4OB0 B;  3TNW B;  4LDX A;  3HB9 A;  1UHF A;  1AZE A;  4E7L A;  4M7D E;  2EFI A;  2ZPI B;  2D8J A;  3X20 B;  2K57 A;  4EOO B;  3C4S A;  2QGG A;  1UTI A;  2UUE B;  4HCK A;  1BK2 A;  2DD4 B;  1WQ7 A;  2NUT B;  4KRD B;  3IQL A;  4EDU A;  4E2F B;  1VQK T;  4PJM A;  3CXC P;  3RKW A;  1M2O A;  2QEX Q;  4D8D A;  5HQ0 B;  3VS1 A;  1D09 B;  4HVU A;  1Q81 R;  2OTJ Q;  5A0G A;  2GQV A;  2DXC A;  1D1C A;  3QG1 A;  1YI2 T;  1WX6 A;  1KHC A;  2KGT A;  2ZAE A;  4UC4 A;  4FT2 A;  4F7S B;  1PHT A;  1UNG D;  2VKN A;  1GUX B;  3L2R A;  2XI9 A;  4ORZ A;  4BCG B;  2JN0 A;  4E7H A;  1Y07 A;  3T9N A;  4ZTF A;  1X27 A;  3V7C A;  3FEO A;  2GFU A;  2BS4 A;  2YT6 A;  1RAB B;  4OR5 B;  3QHS A;  1W2B S;  4ATO A;  1NJI U;  1V76 A;  1AEY A;  2F2C A;  2YDL A;  4JJD A;  5KE2 A;  4D8K A;  5CK9 A;  1IHW A;  2VWF A;  4NL2 A;  4DA4 A;  1AHJ B;  1XQH A;  3FRN A;  1OQK A;  3TSW A;  4CFV B;  3VV0 A;  5LJ5 e;  4QT7 A;  1H3Z A;  3LGF A;  4CRL B;  1A0N B;  3OQ5 A;  3H8Z A;  1RAD B;  2OTL T;  1RUW A;  2RH2 A;  2GTO A;  4II1 A;  4EOK B;  3QYH B;  2RHI A;  1B07 A;  1D3U B;  2WJ9 A;  3EID B;  4EOQ B;  3LWI A;  2LQW A;  1C9B A;  2KSS A;  4BB7 A;  2OTJ A;  2WSC E;  1NE8 A;  1ZUK A;  1WHK A;  1X69 A;  3EH2 A;  2Z0W A;  2MAM A;  2MI6 A;  3MIA B;  1XTD A;  1AWW A;  5DM7 R;  4M7D A;  4JS4 A;  1WPY A;  1AD6 A;  2QQS A;  4CXA B;  2F1L A;  2FPF A;  3OYI A;  4IMY B;  1NYG A;  1OZ2 A;  4XU3 A;  3BDU A;  2WFY B;  3RKX A;  2DTI A;  3QPH A;  4RTT A;  4FL6 A;  3TW6 A;  3JCM V;  1WDX A;  2JT4 A;  3JCM f;  4FM4 B;  3QWY A;  4MZM A;  1W2B A;  5GAM g;  1JEG A;  1GL5 A;  4II5 B;  3MO8 A;  2QQR A;  4M75 E;  2KY9 A;  2PMI B;  2G9X B;  2V1R A;  5KYW A;  2A37 A;  1KQS S;  3OYD A;  5A0L A;  1NJI C;  4EOM B;  3UF4 A;  2OX7 A;  4QW2 A;  4AG1 C;  4D6W A;  2KR3 A;  2JM9 A;  2FEI A;  5AT1 B;  2WMB B;  3A8O B;  3QYG B;  3X25 B;  1M90 U;  5CKF A;  2XDP A;  5IT9 E;  3DDQ B;  1OGU B;  4F7L B;  1I5O B;  3B57 A;  2DXB B;  4PFP A;  5CYI B;  1JXO A;  2J6F A;  2HCK A;  3SEM A;  2DXU A;  1JJ2 A;  3WVE B;  1JO8 A;  1Q86 C;  2XHC A;  2KR6 A;  3FDR A;  1SSH A;  2BKD N;  4NST B;  3CC7 T;  2L0A A;  4KRC B;  3JCM P;  3TU4 K;  3U23 A;  2LZ6 B;  3SWN C;  3EG9 B;  3M53 A;  1KC8 C;  4MZP A;  1M1K R;  3VU3 C;  3QHR B;  5HK0 A;  1PRL C;  1OUL A;  1FVV B;  1ZA1 B;  2QAS A;  4A4H A;  2JTF A;  2A7Y A;  2M16 A;  3JCM W;  4R55 A;  1BIA A;  3VS5 A;  1NPR A;  4M4Z A;  4J9B A;  2SEM A;  4MFD A;  4JRI A;  3SWN B;  1UNH D;  2G77 A;  3ER0 A;  4AFZ C;  1VQP A;  1JRI A;  1X6O A;  3JB9 I;  1EX4 A;  4GY5 A;  4M78 D;  1B34 B;  1UNL D;  1M27 C;  2EYW A;  2O9S A;  1KD1 R;  5I22 A;  3JB9 G;  5HCK A;  1M3C A;  2OAU A;  4C5I A;  4C8Q F;  3GBQ A;  3OYF A;  2WMA B;  2CSQ A;  2K5I A;  5GAO r;  2X4X A;  1ZSZ A;  3C12 A;  3BE3 A;  5KYW B;  4C8Q D;  4CFU B;  4N0A C;  4X9C A;  5GAM h;  2IW9 B;  2NUP B;  5GJW B;  2KBT A;  1TS9 A;  2NWM A;  1Q7Y U;  1G83 A;  5KYX B;  1H3H A;  1KXU A;  2A08 A;  4PFZ A;  3QZ5 B;  3OMC A;  1YP5 A;  4ZGD B;  4OGC A;  2L8D A;  4J83 A;  1ZBX A;  2EGE A;  3JCM e;  1M30 A;  3QWL A;  1QVG A;  5KCO A;  1M1K U;  5J3B A;  2WHB B;  4ZGJ B;  4P5N A;  3OW2 A;  2K5F A;  3CBO A;  4J6Y A;  4BCM D;  1E6G A;  4OF1 A;  1Q95 G;  3KXT A;  2LNH B;  3V8J A;  3L2Z A;  2QGF B;  4YOS A;  3GTM S;  5KH6 A;  1SKU B;  3I56 T;  3CCQ Q;  1SHF A;  2M0O A;  1KG1 A;  4EPC A;  3JCM X;  4Q5W A;  1GBQ A;  4LDV A;  1Y71 A;  3R6O A;  1VQO Q;  2J7I A;  3J7A F;  1Y96 B;  1LPL A;  2O4X B;  2BE7 D;  2HEQ A;  1PKS A;  3QDR B;  2VGM A;  3OS5 A;  2PVD B;  4ELY C;  2COY A;  2DL7 A;  2AZS A;  4GLM A;  2WXV B;  1NM7 A;  3O0G D;  1IGU A;  4C92 B;  4LUE A;  3A8L B;  2M0Y A;  4YC3 B;  2LCL A;  5IHI A;  4HLQ A;  1UGV A;  4XU0 A;  1M8M A;  1VQ5 T;  2LJ0 A;  2GNC A;  2V22 B;  2HSP A;  4DBF A;  2RB6 A;  1H24 B;  4N4I A;  1BKB A;  4PJL A;  4DEX A;  4C92 C;  3H0F A;  4C92 D;  4MMK A;  2E70 A;  3VUB A;  2P0Q A;  3CCV A;  4DBR A;  1GBR A;  3MHX A;  2YRD A;  4HVW A;  1WI7 A;  1FMV A;  3CCQ A;  4M7A G;  1JKW A;  4M7D D;  4AKH A;  2AHJ B;  1LJO A;  2XMF A;  2P4R A;  1VQO A;  3CCU T;  1OIU B;  4M75 G;  2DE0 X;  1IRE B;  1N8R R;  3M59 A;  1EFN A;  5D7U A;  4XTZ A;  1T0J A;  3Q1J A;  1JST B;  4BCH B;  2DET A;  3OYN A;  4J9E A;  5KYX A;  2E65 A;  3HSB A;  3DTO A;  4J9H A;  3TNI B;  4B9W A;  1YFN A;  3CPF A;  5DY9 A;  1I4K 1;  3URG A;  1D3B A;  3BG3 A;  4Y91 A;  5LJ3 e;  4C5E A;  4C0D B;  4JDS A;  2DMO A;  2K7A A;  4BY6 B;  6AT1 B;  1OL1 B;  3CCS A;  2LJ3 A;  2X4W A;  1V29 B;  2RMO A;  1SRL A;  1X01 A;  1RI0 A;  3TW7 A;  2RM4 A;  4OB3 B;  3G4S T;  3EGD A;  4WCI A;  4J9F A;  1TWB A;  2RHX A;  2YRC A;  1D1B A;  4BY6 C;  5IDN B;  2LQ8 A;  4XQ3 A;  1Y96 A;  2DZ9 A;  2WAC A;  3BLQ B;  1H1P B;  2C0I A;  2M02 A;  3NDQ A;  3P8H A;  4M77 A;  1VQ4 A;  1WHJ A;  5HBE B;  3OBW A;  2LT1 A;  4AG2 C;  1QVP A;  3RBB B;  2E41 A;  4LD9 K;  4ROD A;  2CSI A;  3C0C A;  4C92 A;  4A53 A;  2XK0 A;  4ZTJ A;  1N8R U;  1YJN Q;  2EBP A;  3LW5 E;  1G3W A;  2MMP A;  5ICP B;  4JS5 A;  3BHV B;  1XJW B;  2RN8 A;  1SRM A;  2QF7 A;  1TD6 A;  4J6X A;  3I55 Q;  1UGP B;  2IIM A;  3QWX X;  2COW A;  2ZGW A;  3E9G A;  2D0N A;  1GCQ A;  1BI0 A;  3E2U A;  4QQD A;  3JRZ A;  1YCY A;  3EFO B;  5GAN g;  2DER A;  2PK9 B;  5HNB B;  1CSK A;  2HQH A;  2FVU A;  1U5S A;  2E3I A;  3I5R A;  4EOJ B;  3HKS A;  3VKI A;  1VQ9 A;  2B86 A;  4RG8 A;  5D6Y A;  5CO7 A;  3MP6 A;  3M55 A;  2E5Q A;  2L5Q A;  2HKQ B;  2PNI A;  3FJ5 A;  3A8H B;  2DRK A;  4C8Q A;  2DM1 A;  2D6F A;  5GJV B;  3PVL A;  3CCR A;  3OYH A;  1IRX A;  5GAN 8;  4BE2 A;  2OTL A;  3DOG B;  3OW2 P;  1RI9 A;  1N27 A;  3QO3 A;  2L3R A;  5KYU A;  3BHT B;  5L8R E;  1QP2 A;  3CCM T;  5FLX E;  4DEY A;  2EYY A;  5A0D A;  3CC2 A;  1G3Y A;  4EMG A;  3G71 T;  3CMA Q;  2YHT A;  4KGV B;  2DXB A;  1BI3 A;  2DL3 A;  1I81 A;  2JXB A;  2MIO A;  2C4G B;  1R77 A;  2J05 A;  2QYZ A;  4HVV A;  4NL3 A;  2DA9 A;  1VQ4 T;  3PGG A;  3OMG A;  1K9A A;  4Y28 E;  3UAT A;  3J81 E;  3O5Z A;  2A36 A;  1WJR A;  2WEV B;  4BCQ B;  5GAM j;  2E1H A;  2G6F X;  1Q86 R;  1U3O A;  3EG3 A;  4OMF B;  2SRC A;  1VIE A;  3VUZ A;  3HP9 A;  2C5N B;  2CP3 A;  1H27 B;  1VQP T;  2E4H A;  2PU9 B;  2XDD A;  4EOR B;  2CT3 A;  2RQR A;  2E64 A;  3RIR A;  4TVR A;  1KD1 C;  2QDJ A;  3LH0 A;  1NJI R;  1WIE A;  5I2S A;  1AOJ A;  1MMN A;  2RJF A;  3GP8 A;  2LQN A;  3L2Q A;  1PKT A;  2D9T A;  5KE3 A;  4A4F A;  1NEG A;  4A54 A;  3REA B;  5DLQ E;  1TUG B;  4XTU A;  1H64 1;  3CC2 Q;  1M3B A;  5GAN d;  2DBM A; 
#chains in the Genus database with same CATH homology
 2P0P A;  2RI3 A;  2RI2 A;  5DM7 R;  4M7D A;  3L2U A;  4JS4 A;  1Q81 C;  1MHN A;  2DIG A;  4J6W A;  5GAO l;  1WPY A;  2QQS A;  2DIQ A;  4MIM A;  3OYI A;  4VUB A;  4RCB A;  5GAN f;  1OZ2 A;  3BW1 A;  1M1K C;  4BBR M;  4XU3 A;  3BDU A;  2R57 A;  3FB9 A;  3RKX A;  3OS2 A;  2DTI A;  2EQU A;  3QPH A;  4MML A;  4FL6 A;  3TW6 A;  5D6X A;  3JCM V;  3UDC A;  3V8K A;  1VQO T;  1HXD A;  1BI2 A;  4F7U F;  4JX6 A;  5LJ5 g;  3JCM f;  3OYJ A;  2QA4 A;  2X4J A;  4QQG A;  3GIB A;  4A4G A;  4C0F A;  4FM4 B;  5GAM f;  1G5V A;  4M78 G;  4MZM A;  4XK8 E;  2DD5 B;  2LX9 A;  5J26 A;  2QQ9 A;  3JB9 J;  2YLC A;  1YIT A;  1W2B A;  1M90 C;  4KT0 E;  1K9M C;  5GAM g;  3JCM b;  3CCE T;  3UPU A;  3OYG A;  3CME T;  3AHU A;  3MO8 A;  3GLX A;  4C0D C;  2QQR A;  4M75 E;  1WNL A;  2KY9 A;  3LLR A;  1YJW T;  2EYQ A;  3HRT A;  3CC2 T;  4C92 G;  2BS3 A;  1KQS S;  3MEV A;  4PLL A;  5GAN h;  1BIB A;  4BI4 A;  4JX5 A;  4M78 A;  2F5K A;  4X34 A;  3OYD A;  3QYB A;  5A0L A;  3JCM Q;  4R56 A;  1NJI C;  4PJO E;  2XKO C;  2B8A A;  2ZZD A;  4HNV A;  5GAN 4;  2QA4 T;  1M9S A;  3HFO A;  4ZN1 A;  4M78 F;  4QW2 A;  1S72 T;  4HNT A;  4D6W A;  4KUI A;  1D3B B;  2QQB A;  4PKC C;  4JRQ A;  2X4Y A;  3S3O A;  2JTM A;  2P4T A;  3LGL A;  2WSF E;  3EAE A;  3CD6 T;  3E9F A;  2RHU A;  1NPP A;  3A8O B;  1K8A U;  3I56 A;  4PJO F;  3QYG B;  4PNO A;  4IUT A;  3L1A A;  3X25 B;  1M90 U;  1LNX A;  2XDP A;  3LX7 A;  3M56 A;  4XTW A;  5CKF A;  5IT9 E;  5GMK i;  3G6E A;  5LL6 S;  2DXB B;  1N9R A;  3JB9 D;  3J80 E;  4M7A D;  1O75 A;  3M58 A;  2HNI A;  2ZPH B;  3CC4 T;  1K73 C;  1IZ6 A;  2DXU A;  1JJ2 A;  1FWZ A;  1M1G A;  3WVE B;  2CZ1 B;  2LQK A;  2XHC A;  3NTI A;  5GAO m;  4E7K A;  1WQW A;  2KR6 A;  3FDR A;  3M4Y A;  4J5Y A;  4BE1 A;  4HCC A;  4M7D B;  3CEY A;  5EJC A;  3O8V A;  1XOV A;  2BKD N;  3OYM A;  3CC7 T;  3HRS A;  3A5Z B;  3N5B B;  4RCC A;  2CS7 A;  4NC6 A;  2RJC A;  4PJO G;  3TU4 K;  3SWN C;  3JCM P;  2G3R A;  3M53 A;  1KC8 C;  3CCJ T;  4MZP A;  4EMK B;  5CR2 A;  3LWH A;  2PVO B;  2O01 E;  2V8J A;  5CVI A;  3VU3 C;  1YIJ A;  5HK0 A;  1M5Q 1;  4M7D F;  3I55 T;  2EWN A;  4HA8 A;  4ZN3 A;  1JB0 E;  1HK9 A;  1WJQ A;  4CRI A;  2DTH A;  4QVC A;  1KQ2 A;  3V8L A;  3VKH A;  3HZJ A;  2LTO A;  1VQ7 A;  3RMS A;  4ME7 A;  4J7F A;  3QYE A;  3INZ A;  4NS5 A;  4A4H A;  2FHD A;  2QTX A;  2JTF A;  2A7Y A;  2M16 A;  5FRO A;  3JCM W;  4PJO B;  4R55 A;  1BIA A;  5CKB A;  1NPR A;  4DOV A;  2K2V A;  3SB2 A;  2RHY A;  4MFD A;  1FX7 A;  4JRI A;  4OVA A;  2LC4 A;  3SWN B;  2G77 A;  3ER0 A;  1VQP A;  1JRI A;  1X6O A;  3HFN A;  4GY5 A;  4L59 A;  4M75 D;  2VXE A;  3JB9 I;  4M78 D;  3OYE A;  4WF2 A;  1B34 B;  1YI2 A;  2EKO A;  1KD1 U;  3HPW A;  1UB4 A;  3PNW C;  1S72 A;  4E7J A;  3OB9 A;  3JB9 G;  2RJD A;  2OAU A;  3L42 A;  4C5I A;  1MGQ A;  4C8Q F;  3OYF A;  3OYB A;  2K5I A;  5GAO r;  2X4X A;  3VYH B;  3EFR A;  3OBY A;  3C12 A;  2Y90 A;  4C8Q D;  5GAM d;  4M7A F;  2DXC B;  4N0A C;  4X9C A;  3VJP A;  5GAM h;  3M9Q A;  3CCQ T;  2K3Y A;  3OA6 A;  4JUV A;  2KQW A;  2BS2 A;  4M7A A;  5FU6 C;  4MZT A;  2XID A;  2E6N A;  1WGS A;  4XAX B;  1Q7Y U;  3E19 A;  3ZBD A;  2DD5 A;  4BAC A;  5LJ5 h;  2X35 A;  3ZFJ A;  4BI3 A;  5GAM e;  3QZ5 B;  1KQ1 A;  3OMC A;  3TCJ A;  4FSX A;  3QXE B;  4JX4 A;  4ZGD B;  4OGC A;  4HL4 A;  4M77 D;  4C8Q E;  2HD0 A;  4EMK A;  5I21 A;  2L8D A;  3PMT A;  3MP1 A;  1ZBX A;  4J83 A;  1YJW A;  2EQK A;  2WSE E;  4F7U G;  3JCM e;  4HNU A;  4JJN K;  3OY9 A;  3QWL A;  4IUU A;  1VQL T;  1QVG A;  5KCO A;  5GAO p;  1M1K U;  4L5G A;  5J3B A;  2KDS A;  2JUF A;  4F7U E;  3PT9 A;  3CD6 A;  4ZGJ B;  4P5N A;  5GAN 7;  2K5F A;  3RES A;  4YTL A;  3OW2 A;  3JB9 H;  1Q81 U;  3CBO A;  4J6Y A;  2K3X A;  4HT8 A;  1UGR B;  2FL7 A;  4OF1 A;  2RI5 A;  5FU6 B;  5CCA A;  2JOY A;  3KXT A;  5HY6 A;  3MEU A;  3V8J A;  1Q86 U;  1M1F A;  3L2Z A;  3CBP A;  3G71 A;  4IKF A;  2QXF A;  2GFA A;  3JCM d;  3CPW A;  1VIF A;  2DZC A;  2QFZ A;  4LDU A;  3ME9 A;  4BE0 A;  4KUL A;  1O9S A;  4FIB A;  2QQA A;  3BFM A;  3DB4 A;  5KH6 A;  3I56 T;  5FU7 B;  3QJY A;  2M0O A;  1KG1 A;  2XG8 D;  1B34 A;  4IUP A;  4EPC A;  4M77 B;  1K8A C;  2Y4X A;  4LD6 A;  4Q5W A;  3JCM X;  4LDV A;  2YRV A;  1Y71 A;  3R6O A;  4Z02 A;  3J7A F;  1Y96 B;  3CCU A;  2O4X B;  4QVD A;  3BG9 A;  2EJF A;  5GAN 6;  4M75 C;  2XDB A;  4F7U A;  5HKC A;  3QDR B;  4IUV A;  2VV5 A;  2VGM A;  4C0G A;  3OS5 A;  2PVD B;  3FJP A;  4ELY C;  1Q7Y C;  4E47 A;  2DKG A;  1PSE A;  5FRM A;  2LCC A;  3OSV A;  3ASK A;  3EFS A;  5J39 A;  3OYK A;  1VQK A;  1W4S A;  3A8M B;  5GAO q;  3P8D A;  4C92 B;  3V7S A;  5GAN e;  3A8L B;  2L89 A;  3A8G B;  1NZ9 A;  2GF7 A;  3GOX A;  3G6E T;  4O5V A;  3RKY A;  2LCL A;  2DTO A;  3CPW S;  3JCM h;  1VQ7 T;  4BD3 A;  1QVG S;  4HLQ A;  1SSF A;  1PSF A;  4XU2 A;  4M75 B;  2M9U A;  3JCM c;  4XU0 A;  4HT9 A;  3RER A;  4ELJ A;  4PL6 A;  5D6W A;  1G3S A;  4C5H A;  4BI8 B;  1VQM A;  1VQ5 T;  3M5A A;  3GNG A;  2VC8 A;  1I5L A;  2PUO B;  1JJ2 S;  3OW2 S;  3HO8 A;  5CKD A;  2O4X A;  4Z6Y A;  1JBM A;  3L2V A;  2RB6 A;  2DJZ A;  2P0K A;  4N4I A;  1BKB A;  4BDZ A;  1Q86 C;  2C06 A;  4M7D C;  2XD0 A;  1U8R A;  1UEB A;  4C92 C;  4QSH A;  4ELZ C;  4FT4 A;  3H4C A;  2ZPF B;  5LJ5 d;  5GAN 2;  3G4S A;  3M4G A;  4C92 D;  4QVZ A;  5CIU A;  3PTA A;  1YJ9 A;  3QBY A;  2E70 A;  4MMK A;  3DL1 A;  2LVM A;  4OGE A;  2P0Q A;  3VUB A;  4MFE A;  3CCV A;  2DK3 A;  2JNG A;  2K4Y A;  3CCR T;  2EIF A;  4M77 E;  2A3L A;  3MEW A;  3S3M A;  1K73 U;  2CZ7 B;  2FB7 A;  3MHX A;  2XIC A;  1Y7X A;  4M77 C;  4HCZ A;  3S3N A;  1EIF A;  5CAI A;  3X24 B;  3C94 A;  4FU6 A;  5EG2 A;  4C5G A;  2HBP A;  1VQ8 A;  4RG2 A;  2LNV A;  3CCQ A;  4M7A B;  3M57 A;  4M78 E;  2CKK A;  4OP0 A;  4M7A G;  1UGQ B;  1QW1 A;  4M7D D;  4ZGE B;  2AHJ B;  4AKH A;  1LJO A;  2RO0 A;  1VQ9 T;  1VQO A;  3CCU T;  4PJO C;  2IVW A;  3FLG A;  4M75 G;  3CC4 A;  2LT4 A;  1YJ9 T;  1YJN A;  2DD4 A;  1IRE B;  2KMG A;  2QQ8 A;  4M6V A;  3X26 B;  3M59 A;  2ZPB B;  3QII A;  4C92 E;  1M8V A;  4XTZ A;  1YIT T;  3Q1J A;  4OB1 B;  4J7I A;  5LJ3 f;  2DO3 A;  3HBL A;  3OYN A;  1VQ8 T;  3HSB A;  2E65 A;  4MDX A;  5GMK m;  3CC7 A;  3VYG B;  3QKJ A;  2DVE A;  4B9W A;  1VQL A;  3CPF A;  3LYI A;  5DY9 A;  1I4K 1;  3URG A;  1D3B A;  1VQ6 T;  3BG3 A;  3P8B B;  4Y91 A;  2BIV A;  3X28 B;  5LJ3 e;  3PIO A;  3CME A;  4M78 C;  1QP3 A;  3QJ6 A;  4JLG A;  4M77 G;  4C0D B;  4C5E A;  1YHQ T;  1YIJ T;  3JSC A;  4HKE A;  2ZZD B;  2HAX A;  5FRN A;  2MWO A;  3E1S A;  4JDS A;  1QVF A;  4BY6 B;  3JAM E;  4N4H A;  3HHT B;  1I8F A;  4O6J A;  1K9M U;  5HK3 A;  2DAQ A;  4LDY A;  1OZ3 A;  5GMK l;  3PFS A;  3DB3 A;  4XU1 A;  2CZ0 B;  2NLU A;  3CCS A;  2VUB A;  1LOJ A;  2X4W A;  3JB9 F;  1VQN T;  3KUF A;  3F70 A;  2IG0 A;  4A4K A;  2YLB A;  2E6Z A;  1GXI E;  3L2W A;  3KBG A;  1V29 B;  4J8O A;  3OYA A;  2M1H A;  3VYG A;  2MF2 A;  1X01 A;  2MWP A;  1RI0 A;  3TW7 A;  2JVV A;  2QDY B;  5LJ3 h;  4M77 F;  5GAN j;  2EAY A;  2RM4 A;  3UWN A;  5KCH A;  5GAN 5;  4OB3 B;  2LDM A;  3G4S T;  2EQM A;  2EQJ A;  4KBM B;  1U1T A;  4PJO A;  2RHX A;  3OYC A;  4BY6 C;  1N9S A;  2VXF A;  4B9X A;  2LQ8 A;  1R8O B;  3NFC A;  4XQ3 A;  3JCM g;  1Y96 A;  2DZ9 A;  1KHI A;  2WAC A;  3MEA A;  4JLI A;  2R58 A;  3P8H A;  3GPL A;  4M77 A;  1VQ4 A;  2PVG B;  4KUD K;  2K5L A;  3OBW A;  2LT1 A;  2QEX A;  1KC8 U;  2CZ6 B;  1QVP A;  5M9O A;  1TH7 A;  4C8Q G;  1UGS B;  2D0Q B;  2E41 A;  3UT1 A;  3KHI A;  2GCX A;  3CXC A;  4LD9 K;  2DEQ A;  2RA2 A;  1WJS A;  4C92 A;  2CYZ B;  1QLB A;  2XK0 A;  2V8I A;  3PMI A;  4A53 A;  3CBM A;  4ZTJ A;  1N8R U;  5LJ5 f;  3M54 A;  1BI1 A;  1VQM T;  1VQ5 A;  2FYK A;  3LW5 E;  2Y4Y A;  3OS0 A;  1OYX A;  1G3W A;  2E12 A;  3FC3 A;  4OB2 B;  2MMP A;  2H3J A;  2PQW A;  2ZPG B;  2DXT A;  3NTH A;  4IUR A;  5GMK j;  4JS5 A;  1KQS A;  4RMO A;  1X75 C;  3CCL T;  5LJ3 g;  2R5M A;  2QEX T;  3DLL A;  3S6W A;  5C0M A;  4V2S A;  3OYY A;  2QF7 A;  3QUI A;  4J6X A;  4C92 F;  1UGP B;  1FKM A;  3GF5 A;  2ZGW A;  2RK2 A;  5GMK e;  1FXX A;  2RD1 A;  3E9G A;  2OTJ T;  2V8K A;  2VGN A;  5IAY A;  1BI0 A;  4BUG A;  4DQ2 A;  1G3T A;  4QQD A;  2KK4 A;  3JRZ A;  1YCY A;  3CCS T;  2EJ9 A;  4LOC A;  4PLI A;  1U1S A;  1YBY A;  5GAN g;  4L6V 5;  3MET A;  3V7R A;  4HCB A;  2FVU A;  4JRK A;  3SDZ A;  1Q82 C;  4M7D G;  4OB0 B;  3HKS A;  3SD4 A;  3VKI A;  4LDX A;  2E10 A;  3HB9 A;  4E7I A;  5LJ3 j;  3FIF A;  1VQ9 A;  4MDW A;  4CI0 C;  4E7L A;  4XTX A;  4M75 A;  4RG8 A;  5D6Y A;  5CO7 A;  4M7D E;  5GAO n;  3MP6 A;  3M55 A;  4AKI A;  2E5Q A;  5AYF A;  2XU8 A;  3CCM A;  2EFI A;  3WVD B;  2L5Q A;  1BYM A;  2HQE A;  2ZPI B;  2RJE A;  3X20 B;  2K57 A;  3RMQ A;  2BUD A;  3A8H B;  4C8Q A;  2D6F A;  3C4S A;  3CCR A;  3TRE A;  3MCA B;  2F5T X;  4LDW A;  5CKE A;  3OYH A;  3WXM B;  5GAN 8;  3SWN A;  4BE2 A;  2DD4 B;  2OTL A;  1WQ7 A;  4EDU A;  5DLO A;  3JCM J;  4RKU E;  1VQK T;  1N27 A;  3QO3 A;  2L3R A;  4XTV A;  1VQN A;  1P92 A;  3RKW A;  2CGH A;  4GLK A;  3DLM A;  3GNF B;  3TEE A;  5L8R E;  4C0Z A;  1QP2 A;  3CCM T;  5FLX E;  3DKM A;  1QVF S;  1XNI A;  1DJ7 B;  5A0G A;  2GQV A;  2DXC A;  4M7A C;  5A0D A;  2ZPE B;  1G3Y A;  4EMG A;  3QG1 A;  3CC2 A;  3MP8 A;  3H6Z A;  5IN1 A;  5CQY A;  1YI2 T;  3QSU A;  3G71 T;  1KHC A;  5LJ3 d;  2YHT A;  4AKG A;  4DOW A;  1YJN T;  3CMA T;  2DXB A;  4UC4 A;  1BI3 A;  3CCE A;  3BY7 A;  4FT2 A;  1I81 A;  5I2M A;  4EMK C;  3HL8 A;  1E7P A;  5FU7 C;  3QZ9 B;  4IUQ A;  3ZEH A;  1ZQ1 A;  4NL3 A;  3L2R A;  1M4Z A;  1VQ4 T;  2XI9 A;  3PGG A;  4C8Q C;  2R5A A;  3OMG A;  1VQ6 A;  2ZCF B;  2JN0 A;  4Y28 E;  4E7H A;  5A2Q E;  3I55 A;  1YHQ A;  1Y07 A;  3T9N A;  3J81 E;  1Q82 U;  4ZTF A;  2VYT A;  3BG5 A;  1OI1 A;  3V7C A;  3CCV T;  3FEO A;  2GFU A;  4M75 F;  2BS4 A;  1WJR A;  3QHS A;  4N0A A;  3C95 A;  3G7Z A;  5GAM j;  2E1H A;  4M78 B;  2KVQ G;  1W2B S;  4M7A E;  4ATO A;  4EMH A;  2KMT A;  1NJI U;  4OMF B;  2QI2 A;  3NTK A;  1VIE A;  4NOY A;  5LJ5 j;  1ZHI A;  4XTY A;  5CQX A;  3VUZ A;  3OS1 A;  3OSS C;  5KE2 A;  3PIP A;  1VUB A;  3HP9 A;  5CK9 A;  2F69 A;  1VQP T;  4NL2 A;  2LRQ A;  3CXC S;  3CCL A;  4DA4 A;  2PU9 B;  2JZ2 A;  1AHJ B;  4C8Q B;  2XDD A;  2DPP B;  1XQH A;  3HRU A;  5CKH A;  3CCJ A;  2RK1 A;  3FRN A;  2E64 A;  3BDL A;  3VV0 A;  5C6S A;  3RIR A;  5LJ5 e;  4TVR A;  3SFM A;  5GAN 3;  2KAF A;  2EJG A;  4JRP A;  1H3Z A;  1KD1 C;  4AI6 A;  3LGF A;  1RL2 A;  2RHZ A;  4A4E A;  2QDJ A;  3OQ5 A;  3H8Z A;  3LH0 A;  4F7U B;  2OTL T;  2RH2 A;  1N8R C;  4II1 A;  5I2S A;  3VKG A;  3OYL A;  2RJF A;  3GP8 A;  1N6A A;  3QYH B;  2RHI A;  3L2Q A;  2WJ9 A;  4BBS M;  3LWI A;  3RUX A;  2D9T A;  5KE3 A;  2PUK B;  2KSS A;  4A4F A;  4A54 A;  2HQX A;  2I2L A;  4QQ6 A;  4BB7 A;  2OTJ A;  5DLQ E;  2WSC E;  4XTU A;  1H64 1;  1NE8 A;  4PJO D;  4X9D A;  2MAM A;  2MI6 A;  4BDY A;  5GAN d;  1XTD A;  3CMA A;  5GMK h;  4N4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...