2CZDA

Crystal structure of orotidine 5'-phosphate decarboxylase from pyrococcus horikoshii ot3 at 1.6 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
206
structure length
206
Chain Sequence
MIVLALDVYEGERAIKIAKSVKDYISMIKVNWPLILGSGVDIIRRLKEETGVEIIADLKLADIPNTNRLIARKVFGAGADYVIVHTFVGRDSVMAVKELGEIIMVVEMSHPGALEFINPLTDRFIEVANEIEPFGVIAPGTRPERIGYIRDRLKEGIKILAPGIGAQGGKAKDAVKAGADYIIVGRAIYNAPNPREAAKAIYDEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal structure of orotidine 5'-phosphate decarboxylase from Pyrococcus horikoshii OT3 at 1.6 A resolution
rcsb
source organism Pyrococcus horikoshii
molecule tags Lyase
total genus 73
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2czdA00
3OA3A 2A1YA 2GPTA 2VEIA 2CLOA 1K7XA 3M16A 1X7FA 1WA3A 5AHLA 1WYIA 3T55A 3PAJA 5MHBA 3HPSA 2ZRVA 5K7JA 2AGKA 2FPTA 3LRKA 4DPQA 4K6AA 3IGSA 4UXDA 4XKYA 3FYPA 4RZ4A 3PG9A 3BG3A 5HQEA 3EX1A 2FB2A 2GOUA 3TA6A 4PEKA 5LGXA 3M9YA 2ISVA 4JTJA 5DBUA 4I7UA 3KRSA 5F4SA 3LLDA 4JTLA 1TV5A 2BXVA 1A5SA 3BV4A 4JYDA 4WXYA 1H63A 4CCCA 2C18A 3QMRA 4XKYB 1M7OA 7TIMA 1RPXA 1TPEA 3LCWA 1OJXA 4MVAA 3SR7A 2W0UA 5G4EA 3NQ7A 5SWUA 5FF4A 5D2WA 2E77A 1H1YA 4AHPA 4IUOA 5CZTA 3TQ0A 2ISWA 1KFKA 4JICA 2QCDA 1U83A 1WQ5A 2ZZ6A 1ONRA 4EOUA 1HTIA 4QISA 1GTHA 2HSAA 1FCQA 4BWLA 4N9CA 3S9YA 1ZNNA 2P0OA 1QWGA 5I3HA 4NZJA 4HNNA 3W1XA 4N4PA 5D02A 2WQPA 2QCDB 3W1NA 1AW1A 3NPXA 4JTEA 2VFIA 3STEA 1QMLA 3W6YA 2JK2A 3V75A 1GPWA 3SGZA 1UUMA 2Q3OA 3GZ3A 4EVZA 3BGGA 1W3IA 3CU2A 5KZDA 2YYTA 3QM3A 1K8ZA 2V82A 4CQ9A 1THFD 3EXTA 2ZQ0A 1O5XA 1A5BA 2CU0A 4ZQRA 1XBYA 3PB2A 1VYSX 3QW3A 4FNTA 1KTBA 1VZWA 4N6FA 3NNTA 1LRTA 3ZFHA 4OBTA 3UPWA 1Q6QA 1LRNA 2WKJA 1SQ7A 2VEPA 3FFSA 1FQ0A 1T8XA 3G24A 4LC6A 3GAYA 1JCJA 3P80A 1IXOA 5DY2A 5LNSA 4MIMA 4LVBA 1QR7A 1UCWA 3STGA 1IGSA 3LRMA 4M7SA 4QNEA 2O7QA 5CZ0A 1SW0A 3NQEA 4UTLA 2CLKA 2X30A 3NEVA 2GUUA 1H60A 1VJIA 1SO6A 3QF0A 4O18A 3P84A 3LERA 2IQTA 3GR7A 3IIZA 3M41A 4IX0A 2C14A 5AYZA 3P5ZA 1L6YA 4UFIA 3N14A 2ZA3A 1BWKA 4XZ9A 1G6CA 3IIXA 1OFRA 1FBAA 3PM6A 1A5CA 2J6XA 3B0PA 1FUYA 1OYCA 1QAPA 3UWUA 4UNKA 1OVDA 3UNDA 4LVFA 3U2OA 3NM1A 1L6WA 5BMWA 3TE9A 4UTTC 3BW4A 4OV9A 3P62A 5DBTA 2RFGA 3HO8A 3Q2DA 1TPWA 3EX4A 3N73A 1W56A 3G8RA 3W7PA 4GE8A 5I3JA 2H8ZA 2A0NA 2CLLA 1H7PA 3GYEA 1G4SA 4JTTA 3L0GA 4X2RA 1DQWA 3W1LA 3MYOA 1D9EA 3DZ1A 4IMEA 3UYCA 1XBXA 4GRSA 4RJEA 4LV4A 3ZS4A 3GXPA 4RXFA 3HG4A 3THQA 3MHGA 3MP4A 3OVQA 2ZA1A 3B8DA 5GVJA 1G7VA 1DJNA 2BX7A 1TJRA 1EB3A 1HO1A 2JBMA 3LTSA 4LY8A 4U28A 5KSWA 4XBSA 3W22A 4N2YA 5CPOA 4CNPA 3MI2A 4N4QA 3W2UA 3YPIA 4JY8A 3W74A 3HMJG 2FFCA 4QQ3A 1XCFA 1KM0A 5D04C 3CPRA 2V2DA 3VKJA 4HPJA 3TNOA 1ME8A 5HWMA 1BKSA 1A50A 2ZRUA 3W7IA 5E0KA 5K9DA 4I7WA 5CG7A 2O7SA 3HBLA 4QSHA 4IPIA 2XN0A 2ATMA 2Y7EA 4UTKA 5G4WA 2QDHA 2HS8A 1RV8A 3E02A 3MO7A 3IIOA 1FWRA 2C19A 4NU7A 3W7OA 2TSYA 3FJ6A 3W7QA 3LM7A 1VH7A 3BO9A 3FS2A 2UV8G 1GJPA 3SSJA 4PL2A 4O0KA 1PS9A 5HR7A 1D3HA 4UTIA 2J24A 3W2KA 3NQAA 3W1TA 1TV7A 1EP2A 4O57A 3NQCA 2QAPA 1OX4B 3TROA 3M43A 4R33A 4ORMA 2RH9A 4HHPA 4XTIA 2NZLA 3QSRA 1N8FA 2QUVA 5AHNA 1KM5A 2H3DA 4QIUA 1P1XA 3C6CA 2YFNA 1C8VA 4NX5A 2YGYA 5C54A 1XFBA 3MP3A 4YL2A 3W73A 2Y62A 4HNTA 1SSGA 1IXPA 4ML9A 1J5TA 4R7JA 1SW3A 3TJLA 5H91A 3JRKA 4FIQA 2VKZG 3GDLA 3TAOA 1MZHA 5AYXA 1XBZA 1NAL1 3PBUA 1YXCA 3DAQA 5EA9A 1IXQA 3NZRA 1OK4A 4JN6A 2G96A 4QNWA 2YYUA 2A21A 3A22A 2EAWA 2ZYFA 2NWSA 2I14A 3Q94A 4JDBA 3FA5A 2DU2A 4IMGA 3UWZA 3WJXA 4YXGA 3HIJA 2WPBA 4UCGA 2A2IA 2WOQA 2NXGA 1YDOA 3JS3A 1HO4A 1Q45A 5TQLA 3MWAA 3W3OA 1M7PA 3RFAA 3ANYA 3KVJA 3INPA 2ABBA 4N9EA 1YTDA 1T96A 1WX0A 1SU5A 2CZDA 4O53A 3O05A 1LOSA 4DELA 1TYGA 3VNDA 1QPQA 3NO5A 4LC8A 3EKZA 5I3IA 4IMDA 3BLIA 3LHVA 5C5YA 3B0UX 1N55A 4FXSA 5IBXA 1SSDA 4UMCA 4NT0A 2ZZ5A 4UR8A 5AC7A 4CQAA 4RXGA 3O1NA 1Q6OA 1TTJA 2F84A 2C6QA 3AO0A 4Z0JA 3M1ZA 1GVFA 3DBPA 1TPDA 4UMBA 2P10A 2J9XA 3E12A 4QJ1A 2ZRYA 5CZJA 2R8WA 1TCDA 3AJXA 3H55A 5F2LA 1I45A 5G2IA 2EF9A 3S5OA 2J27A 1R2SA 1OABA 1TPFA 3QMTA 4LTSA 1I2QA 3OVPA 2QCMA 1MEHA 4JXCA 4UTMA 5J5RA 5BOOA 4JDYA 1ADOA 3LHTA 3M5YA 3CEPA 1JJKA 3M7WA 3FOKA 3W2JA 4NZFA 2OJPA 2FDSA 2J9YA 4M5PA 5G1TA 4K37A 1ICQA 3C0JA 4H4IA 5A5WA 1KM1A 3LI0A 5LHFA 3WK3A 1PL9A 5L9FA 3O15A 2H3BA 3TQVA 3KAOA 1QFEA 1H7OA 2J88A 5DXXA 1SZGA 3G3MA 3TSDA 3TKFA 3LCHA 2ZZ7A 4MYXA 1JQVA 1QOPA 4XQ6A 2VEMA 3G0UA 1CX9A 3NL6A 4IPJA 2EPHA 1MXSA 1GEQA 3RF9A 3GX9A 4K8EA 3NL2A 2GVGA 3C2EA 4OQVA 3PG8A 2RDWA 2CLEA 3A24A 5AHEA 3LCGA 5K9XA 3W7EA 3NPVA 1SZEA 4GUJA 3W87A 1KA9F 1OF8A 3S1UA 2VFFA 3W84A 4BFAA 4WY0A 2YPIA 4X9SA 3PR2A 3UZ5A 4LUJA 2ZDRA 1X8FA 2AAMA 3O6YX 2DZVA 3LV6A 3W07A 1G4TA 4MJMA 4FX7A 2PC4A 3QPZA 4AWUA 2E6AA 2EKCA 4NXKA 3NG3A 5FI8A 3B04A 4OGZA 4HSOA 5AN7A 1VCVA 2V9DA 2ZCGA 1GYLA 1AL7A 1DORA 5CPLA 1E51A 1K8XA 3P67A 1WDWA 1KFCA 2CZFA 1ALDA 4LU0A 3P7YA 5DELA 4ADUA 3T40A 4P61A 4TU1A 3QJAA 2G95A 2RKXA 3B0VC 5HR6A 2QJHA 3UXDA 2V2HA 1B57A 1QPNA 4JTGA 5D03A 4S2CA 3M44A 3GAKA 3MP5A 5AHIA 3GK0A 2Y7FA 2NUXA 4D2JA 3TW6A 3UWVA 3GVGA 1YPFA 2QCEA 3R2GA 1XL9A 3NL3A 4MLJA 4NQ1A 3F4WA 3PC0A 3T78A 4M6QA 4UTHA 3I6RA 4UUIA 3LBMA 4Z1CA 5LNVA 3EX6A 2V2CA 1P0NA 4ZVJA 2DZTA 3RNDA 3HJZA 5DCBA 2QEZA 1LYXA 1TRIA 3MBDA 1VRDA 1L9WA 3A23A 4QM1A 4RZ6A 1DV7A 3P5YA 4AAJA 2QUUA 1DQXA 1B4KA 1QOQA 2C15A 3M5ZA 4GFSA 2W79A 2Z6IA 1OX6A 1U5JA 3HG2A 1EWEA 1GVQA 2E6YA 1AMKA 4XBKA 4LS1A 1DOSA 3WJWA 4O8RA 4DBDA 5D2YA 5A8GA 3QW4B 3FLUA 2E1DA 1G67A 4JS3A 3R8RA 3UPBA 3L5AA 3LXBA 1W3TA 5H2ZA 4O28A 3TC6A 3LDVA 1KV8A 2GQ9A 1W1ZA 4JYEA 3HGRA 3ELFA 4ZZ9A 3FEMA 1GWJA 1W3NA 1YXDA 4O54A 3R13A 1LM1A 3G1SA 4WUIA 1V7YA 1SPQA 3EWXA 1GG0A 4UFMA 3IVTA 2AQWA 3EKLA 4EWND 1JCXA 1YYAA 4O1AA 1DL3A 3L9CA 4GNJA 1R2TA 1FWTA 4GUHA 4R34A 3NQ6A 3T44A 3U6WA 1XBVA 2EHHA 4JTUA 2Y7GA 4B5NA 3B06A 5F1UA 1VS1A 5HUOA 1B9BA 3ABRA 3W2LA 2NXIA 4Z1AA 3BG9A 3HF3A 4M7TA 2J9ZA 1PE1A 5EL1A 3SZ8A 3BARA 1PHWA 1OG0A 4I7VA 2QF7A 5C2XA 3QRHA 1VQTA 4PFMA 5FF2A 4MZ8A 3W88A 2NV2A 5F4XA 4LT9A 3S1VA 2R14A 2C0AA 1W5QA 5K9CA 2PE4A 3U8GA 3LXCA 4Y96A 4JX4A 3FYOA 4DO5A 5KITA 4O50A 3RLVA 5D37A 4OHQA 3KVKA 2QUTA 5FF0A 3PS7A 3M5XA 3ZR4A 3PB0A 2HMCA 1SO5A 3BK0A 4ZQCA 1LTDA 2E5DA 2H90A 4CQ8A 3KHJA 4O12A 3UD6A 1KFBA 3V1PA 1W37A 4WQ6A 3ZWSA 1VCFA 1UJPA 1H1ZA 1PV8A 1TB3A 4MY9A 2Z6JA 3TFXA 1VHNA 1H7XA 3E96A 4QAIA 1OF6A 5KZMA 3L5MA 3PBYA 4BK9A 4LNYA 1PCKA 1XUZA 2BZNA 2ZTKA 4H6KA 4HNVA 5HULA 1SZNA 3BGJA 1YLVA 1KLZA 4IJBA 3SIZA 1TREA 3TMLA 3GDTA 4CNOA 2A7PA 3MUXA 3WK1A 5J5DA 4DO6A 3ABSA 2X1RA 3QH2A 4MUZA 3LB0A 3LXAA 2TPSA 4KWWA 1S5TA 3SI9A 1SZFA 1FDZA 3HPXA 4JY9A 4UFJA 2VFEA 2ZRXA 4AB4A 2CWNA 2B4GA 1FXPA 3CC1A 4IMFA 3HOJA 2V0TA 1KM6A 1AG1O 4JIQA 5C6MA 2EGZA 2WNZA 3WK2A 3A5VA 4UFHA 3MW7A 3DFQA 5I3KA 5CKSA 2RHGA 4TIMA 5FEXA 3W86A 3N9RA 3OVRA 4TMCA 1EPXA 5EPDA 5F4WA 2V5LA 3HB9A 1OFEA 1ME7A 3EXSA 3G0XA 1LRQA 1W5PA 3ABOA 1SO3A 2QCGA 1S5VA 4ICNA 1EX5A 5G5IA 4AVFA 1RQHA 3LV5A 1WOBA 2V8ZA 4NJIA 5DLCA 2YCEA 2Y63A 2ZRZA 4MJZA 3MHFA 1Y0EA 3JR2A 3PSVA 1P5BA 2ABAA 3N9SA 4IMCA 4KFOA 4HN4A 1I4NA 3FKKA 4Q4KA 4W9TA 3WK0A 3S1WA 3QQ0A 4G1KA 1EP3A 2JKAA 2HTMA 3W7JA 3DXIA 2Y70A 3W7RA 2B7QA 5C55A 3O6CA 2C16A 5K4ZA 4YCPA 1FDJA 3FKRA 4LV9A 3F4NA 4O1BA 4JX6A 4FB7A 3RU6A 3S6DA 2FQIA 3T7VA 4ORIA 1R46A 1YDNA 4E38A 4AEOA 1FDYA 2GJNA 4HSNA 1R47A 1EEPA 2OT0A 3LHUA 3G1XA 4PCFA 1Z48A 1EA0A 4UTWA 3CEUA 3G1YA 1Q6LA 1VR6A 1ZALA 1R30A 3OEXA 1BWLA 3W70A 2XN1A 3NVTA 2RDUA 3PBVA 3DENA 1LLZA 3SGUA 3BPWA 3TU9A 4N02A 1YADA 1OX5A 1O5KA 3W2MA 3RMJA 3C4UA 3I7QA 3NQDA 4K36A 2B0MA 5T26A 1CW2A 3BW3A 1TQXA 2VEKA 2ZFAA 3CWNA 5I3FA 1TPUA 4O17A 1LLWA 1OFDA 5DY3A 4ALDA 3M5VA 1VHCA 1XDLA 1O60A 4IWWA 3TUUA 1SUXA 2CZEA 3LHZA 5DN1A 1Q6RA 2Z1BA 1OFBA 4RKAA 1K03A 1EIXA 3B03A 4FIRA 3TIMA 4FEZA 4XTDA 5AB3A 4BR1A 2QR6A 3OIXA 2VFDA 1ZAHA 1KFEA 2DZSA 1TTQA 2VFHA 4IQLA 3P82A 4NNCA 8TIMA 2V81A 4MPQA 4RV8A 1XKYA 5G1YA 5IBXC 4FX8A 1LP6A 4GJ1A 2Y6ZA 2Y7DA 1JCLA 3QSTA 1I2PA 1O4UA 1GG1A 4WOZA 2QCNA 3N2MA 2FPYA 3H54A 3G1VA 2WO5A 3NPUA 3S8HA 1KFLA 3NOEA 4BF9A 3DU0A 2RDTA 4JR5A 2WNQA 1GYNA 3E0IA 4UNLA 1F74A 1FCUA 1QPOA 3KVMA 2C1HA 4JIPA 4CCEA 5LHEA 3W83A 4IOTA 4M6PA 1K3UA 1JUBA 3GDMA 1GVSA 1ZHAA 1LOLA 1ICPA 1TIMA 5FEZA 4MFEA 4FXRA 1JRBA 3C56A 1YTEA 1GZGA 5F2IA 1DHPA 2F7FA 3W75A 2DORA 3EWYA 4LRSA 4M6VA 5LNUA 4Z08A 3I68A 2YFOA 5TIMA 4A22A 1RD5A 1K7EA 3I7SA 2VOMA 5LNRA 4ADSA 4UIOA 3NL5A 1UASA 1M6JA 2CLMA 4GUFA 4DF0A 3MJYA 3E9AA 1C9DA 5IM51 2GVJA 3C2OA 2X1SA 1X1OA 5EYWA 3KOFA 5D09A 3LRLA 3DFSA 3PY2A 3WJZA 3IV3A 2E6DA 2DZXA 4ADTA 4S1FA 2XN2A 3EWWA 3UWYA 4R53A 3EB2A 5CGQA 1QPRA 3G1FA 5CPNA 2QJGA 3O63A 1QO5A 4O4VA 3DKJA 3LHWA 3M6YA 3NGJA 2WNNA 5U7SA 5FF7A 1Z44A 3C61A 3SJ3A 1WAUA 2D73A 3ATYA 4QITA 3FJLA 4UR7A 1XUUA 3W71A 4DQWA 2A6NA 1OFOA 2WSYA 1M5WA 4RR4A 2JKPA 4A2RA 2YW4A 3UXAA 3VE9A 3CTLA 1FX6A 4LS0A 2CLIA 3L67A 3L65A 1JCMP 2A5HA 2ZBTA 4HNUA 1P0KA 4PA8A 3L2IA 1F05A 3LCLA 4JGDA 1S3HA 1Z42A 2NX9A 3MI3A 5CSSA 2JGYA 4Y9AA 3TXZA 3EEGA 2A7NA 5KZEA 4K7YA 4JYFA 1H5YA 4WY0B 3PF3A 5HWNA 1GQNA 3NQFA 1O94A 2R94A 5BW6A 4IXHA 5LSMA 1MEWA 1RR2A 5KINA 4WD0A 3S5YA 4CCDA 3P8JA 4FNSA 1KM2A 2WJZA 5ABTA 1OK6A 2VELA 4TMBA 2CFFA 3DFTA 3W7HA 5K2ZA 3L5LA 4NJHA 4YMZA 2A4AA 2A85A 3W85A 4EIVA 1TTPA 4MLRA 2YX0A 4UTJA 5L6UA 1OFAA 4DF1A 4Z0SA 1JUEA 2YXGA 3TW7A 2QCCA 1GVRA 6TIMA 5FESA 1F6PA 4AF0A 1ZAIA 1IIHA 3BLEA 5D38A 5D33A 3M0ZA 3C8FA 3Q58A 3KVLA 2NV1A 3WJYA 1VPXA 2Q3RA 3L68A 1RZMA 2H6RA 5AHMA 2ZA2A 1TTIA 3O8AA 6ALDA 1I2NA 1KW1A 1SFLA 3TC7A 3QYQA 1RQBA 1F73A 4JD4A 1DBTA 2QCLA 2G5WA 4PH6A 4AF0B 1T99A 3W7MA 3LBCA 1OFPA 3A9IA 1D3GA 3UQNA 4O52A 3MYPA 3O6DA 4PL1A 1LBFA 4WXZA 3W1RA 4ZQOA 3A5FA 2VC6A 3GKFA 1NFBA 1TV8A 4N9BA 2FTPA 3CB8A 4JTIA 2PURA 4AWSA 4BWLC 3W7NA 1FXQA 1SR9A 5HMSA 1IIGA 1TPH1 3TV8A 3PWAA 4RLIA 1IF2A 3G22A 3O16A 2DP3A 1SO4A 3N3MA 2Z2UA 3LOTA 4EF8A 1FWNA 2XFWA 4Z1DA 1TPB1 5HINA 3TSMA 1FCVA 1VCGA 3WJSA 3QZEA 1XC4A 5CZSA 5DXYA 3SW6A 2C13A 2JKEA 1EP1A 4OV4A 3GDRA 3MMTA 4WOQA 3IGUA 3VCRA 1KBJA 4MZ1A 2DJLA 1QNVA 4A29A 1TO3A 3PUDA 3WFAA 3DGRA 1BTMA 1PVNA 1EUNA 4ZQMA 4NXSA 3P81A 3GKAA 3GDKA 4OWGA 2VXNA 3TJXA 4H3DA 3TXVA 4GUGA 3PVFA 2QKFA 3L0NA 3PULA 4Y90A 5HJLA 3B05A 4Q33A 2NWRA 1LROA 1H7RA 1W8SA 4TO8A 3GB6A 1CI1A 3DFPA 3IVUA 4X22A 4JEQA 1PHQA 3UZJA 5AFDA 3R89A 1ME9A 4I9AA 4O1DA 1V5XA 4A2SA 4LW7A 1J4EA 4PTNA 4DO4A 3BVJA 3LGEA 4N6EA 3NA8A 3W1MA 3BW2A 4GXMA 2CW6A 1NEYA 3PBWA 2G97A 5AC6A 3HGSA 1EUAA 3MHUA 2Y88A 2DZUA 2OT1A 3CLMA 1LORA 5U4NA 4DF2A 1LBMA 3TAKA 3C2RA 4YLWA 5E93A 3C2FA 5EY5A 4KWVA 4LS2A 2WSQA 1OHLA 3GXNA 5CPMA 3HGJA 3O07A 2QAFA 2ZRWA 3UWQA 2CLHA 4MYAA 1JCYA 2E5BA 5F2MA 3I65A 4GWEA 3G18A 1W54A 1DVJA 1ZFJA 3P74A 1LOQA 4WX2A 3DHFA 1H62A 1Q3NA 3NYZA 3QFEA 4AMAA 2JGQA 1DJQA 3W76A 4E0CA 3HPZA 3H53A 3T4CA 1VYRA 2PRHA 3HG5A 2A7RA 4Q32A 3CT7A 5LKYA 1N7KA 2GQ8A 2FPVA 1H7WA 2W6RA 4K38A 1AW2A 3W2NA 3NQGA 3W23A 4IGHA 3IIPA 4NJJA 2Q8ZA 5AYYA 4IX2A 5G2WA 4MZYA 4C1KA 2H8XA 1MSSA 5D2VA 1G7UA 4CLMA 1KBIA 5F1VA 3EXRA 3VE7A 5BRBA 1OYBA 2Y61A 4FF7A 3LI1A 1W0MA 4KFPA 1FY6A 3QPYA 4FNRA 4ZL1A 1ZAJA 2Q8LA 3G1HA 3NXFA 3DI1A 4ONVA 3FIGA 2X1TA 1UB3A 1LBLA 1VLIA 4FNQA 1IXNA 1QDSA 4M19A 1LZOA 4MY8A 4LVAA 3PUOA 4KFNA 4CNNA 4MKNA 4O0ZA 1KTCA 5FF3A 3DFOA 1HFBA 3VFLA 4JTSA 1J2WA 5KTLA 4AHQA 4C1LA 1W31A 1XM3A 3BG5A 1F6KA 3QMSA 3TQKA 5E1QA 2DZWA 2DZPA 4P2VA 3NQ2A 4PODA 3N2XA 4HT3A 3CM4A 1KM4A 4L4MA 1MEIA 1F76A 3TFCA 4ZMGA 3KXQA 1QO2A 3L0KA 4O13A 2ZTJA 3C3NA 3OG3A 4BI5A 1KM3A 4UC5A 1FCBA 4K8HA 1I2RA 1XDMA 2BTMA 2OCZA 1AL8A 1QCWA 2NX3A 4FHAA 3QC3A 4UTTA 2X2GA 1AK5A 3OBKA 4OT7A 2B7OA 3O06A 1P4CA 1AW5A 3L66A 4JNMA 5HNRA 2A6LA 3EX3A 1JQXA 4K39A 4XUGA 3LX9A 3W7CA 2CZ5A 4UTWC 4O10A 4HIBA 4UTUA 1K7FA 5D2TA 4E2BA 3G1AA 2TRSA 2YR1A 3OHIA 3N34A 1JULA 3DHDA 1XXXA 3IGXA 3TX9A 1S5WA 1ZCOA 3THAA 4AWTA 4JTHA 1FWWA 3K30A 4U4MA 4DXVA 2E09A 4Y6GA 1VC4A 1KTNA 5LGZA 2E68A 1F7BA 5BMXA 3GIYA 4NNAA 3EX2A 1OX4A 4L4LA 1YXYA 2OZ0A 3NQVA 3NQMA 3DH7A 5F2GA 1JVNA 1FWSA 1R2RA 2DJXA 1YDVA 3G8EA 3NZ1A 5KMYA 4AH7A 4LVGA 2V30A 3SY5A 5HUPA 4XWUA 1RVGA 4MOZA 4DPPA 3NQ8A 2ZZ4A 1GTEA 3LCIA 4LVDA 4NUWA 3LLFA 3W1QA 3G1DA 4NX0A 1MO0A 1OYAA 1PCWA 5TBOA 1X1ZA 3UWWA 2ISSA 3NPWA 4BI6A 4JX5A 4RX0A 3EWZA 1YPIA 1NVMA 2BLEA 1KFJA 2BSLA 5EMUA 2B7PA 4LWWA 4AHOA 3F1QA 4N9DA 1EWDA 4WJEA 2B7NA 4NJKA 1A53A 1NSJA 1W5MA 2TMDA 3W9ZA 2NX1A 4NVTA 1TSIA 5G2HA 3ZWTA 2FLIA 3CHVA 1GT8A 4AXKA 4J9JA 2Z0IA 4ZQNA 1NF0A 5EBUA 3F03K 3QQ1A 3IRDA 3Q37A 2C3ZA 1ICSA 3M47A 3TK7A 1LCOA 5AC8A 2FB3A 2HS6A 3KRZA 1HL2A 1B3OA 2NLIA 1JR1A 2QCHA 3IEBA 3KX6A 3SFKA 1H61A 2GJLA 4NJGA 3G3DA 1JCNA 1LDCA 1G4EA 4OE7A 3TSBA 3IIVA 4LRTA 3CIXA 2NUWA 5FEPA 3LCFA 4O11A 4FNPA 2R91A 3PUEA 4PC8A 4RZ5A 4O16A 1HG3A 1F5ZA 3S1XA 4O4WA 1WV2A 1VGAA 2LLEA 5AOUA 4Y8FA 2VENA 1NF7A 3P61A 4JTKA 3EWUA 1B4EA 1TPVA 3BLFA 4WY0F 1Z41A 1G4PA 1L2UA 3W7DA 1K02A 1ZJIA 2QCFA 1TPC1 5K4XA 3NDOA 4DBEA 3W7KA 1VLWA 5BNKA 5HWJA 3GNDA 5EKYA 3W72A 4LOCA 3W1UA 4UMAA 2YZRA 4FO4A 5LZLA 2VFGA 1L6SA 2GQAA 3B4UA 3S42A 4RCXA 3LHYA 1H51A 4TX9A 3P8IA 1JUKA 3S5NA 2WSRA 3RLUA 1W5NA 1ZY9A 2PRMA 4UFLA 2E6FA 4TR9A 3GR8A 2CLFA 2I9EA 1BEUA 3G0SA 4POCA 4YWIA 3R5EA 1T0OA 5AHFA 2QDGA 3HQ1A 3P60A 4FX6M 5D32A 3CQ0A 3N19B 4EF9A 2ZZ2A 3C52A 1F2JA 3USBA 1OFQA 2PRLA 4LUIA 2KZHA 3W1AA 2X16A 1UUOA 1SW7A 1DKWA 4KKXA 1UBSA 3ABQA 4WZHA 3MI6A 3LCXA 4OU1A 1K8YA 5D30A 4A21A 1TRDA 2FJKA 3IVSA 3S0CA 3TR2A 3TDFA 1JRCA 4X3ZA 3DKLA 3MBFA 3GXTA 4IXXA 4O1CA 4FNUA 2FIQA 3VI2A 2WV8A 3TH6A 3QEZA 1RQEA 4BI7A 1VYPX 3DFNA 3LTYA 3GLCA 4YCOA 1G69A 3ATZA 1H7NA 4O15A 3HG3A 4HPXA 3SECA 3UY8A 1WOAA 4O14A 1HUVA 5LNWA 3EWBX 2BWGA 3TCEA 4GUIA 5FEWA 4E2DA 1H50A 1O95A 3L21A 5D2XA 1C29A 3DI0A 2ALDA 2Y85A 1ML1A 3PSWA 3C2VA 2GVLA 4O19A 2OX1A 3HGOA 1KV5A 2ZZ3A 4MFDA 1WBHA 2P1FA 1X6UA 2V5BA 3NAVA 4Z1BA 3UY7A 4GC4A 3A21A 3W1PA 2NXHA 1KLYA 1YTKA 3CIWA 3KFTA 4S2BA 3TMQA 5CSRA 1GOXA 4GBUA 1TQJA 5K3VA 1XI3A 3STCA 4A3UA 4RK8A 3E49A 1WBJA 2ATSA 2PCQA 2TYSA 4JTFA 4MY1A 4NNBA 3W7GA 3CWOX 2YSWA 1I8JA 3NM3A 4DEFA 2YW3A 2X1UA 2Y89A 2QJIA 1SFJA 5D05A 1I2OA 2ZZ1A 3STFA 4K7VA 1GVOA 1TJPA 2NUYA 5I3GA 5DCDA 1W5OA 3NR0A 2OMAA 3R12A 2E5CA 4ZQPA 3D0CA 1PIIA 3W7LA 4UFKA 2I1OA 1A5AA 1ZENA 1TMHA 3KRUA 3I7RA 4HKPA 3S5ZA 3LTPA 3GNNA 3RK8A 2YDAA 5DCEA 1WXJA
chains in the Genus database with same CATH superfamily
3OA3A 2PWFA 1K7XA 4H7ZA 5AHLA 2J75A 3PAJA 1BXNA 2XIQA 3GC4A 1J93A 2PU1A 1JZ8A 4K6AA 1U1HA 2QV4A 4XKYA 2Y0FA 5HQEA 3REQA 4JKKA 3TA6A 1W1A1 1P0DA 2ISVA 2J13A 4IQJA 4ACYA 1OM0A 5BU9A 1B3ZA 2CHRA 5DBUA 1HJXA 3KRSA 1A5SA 4WXYA 1EF2A 3N6JA 2E28A 7TIMA 1OJXA 4EXBA 1POJA 1QJWA 1DXEA 4J4KA 1H1YA 4AHPA 4IUOA 4LAOA 2ISWA 4PMNA 1KFKA 2R82A 2VVNA 1U83A 1B2YA 3DC0A 4EOUA 2ICSA 4KCWA 3VC5A 4QISA 4PUUA 4N9CA 2GWGA 1ZNNA 2P0OA 1JDAA 5I3HA 5HNTA 8RUCA 3N18A 3W1XA 5HPOA 3MUY1 3P14A 2Z00A 2QCDB 3W1NA 1AW1A 3VYLA 4ROQA 2PP0A 4DZ5A 1QMLA 4MB1A 1G1YA 4NZ4A 4DYKA 3M0LA 4U31A 4XKMA 3SGZA 2Q3OA 3V35A 3DYOA 3PJXA 4UBPC 2EO7A 5KZDA 5JXQA 4QHRA 4GGHA 1H2JA 3EXTA 1JZ7A 1O5XA 3SUWA 2WBKA 2OEKA 3PB2A 2IPWA 1VZWA 3FSTA 1LRTA 2V68A 3TOYA 2BHUA 2WKJA 1SQ7A 1ECQA 2VEPA 1C7TA 3FFSA 4DIAA 3SCSA 1JCJA 4I3GA 1NH6A 4MIMA 1GK8A 2VO5A 4D6CA 3K8KA 2YL6A 1DP0A 3GTNA 4FMVA 1LT8A 1JGMA 1H49A 3RN6A 3AXXA 2DIEA 2EKGA 4DWSD 4Y9NA 5FJTA 1SW0A 2FVMA 2X30A 4HYWA 3NEVA 2GUUA 2XU2A 1H60A 1VJIA 2ZXBA 1QHOA 3TTSA 4AZ6A 5ENLA 4AVNA 1U2YA 1TELA 1GVEA 1H09A 3WD1A 3IGHX 1W2VA 4JIHA 3IIXA 4I5XA 1FBAA 3OZYA 2PGWA 2HVNA 3BOFA 2J6XA 1TJ2A 3B0PA 5BROA 1OYCA 1RK6A 2GQ3A 1OVDA 4UNKA 3U2OA 1IZCA 1L6WA 3TE9A 4LQ1A 3P62A 1R3YA 1XYCA 2RFGA 6TAAA 1R3VA 4B2DD 3EBVA 2MUCA 1W3LA 1PTDA 4GE8A 4PBFA 2ZC8A 2WK2A 4OUIA 1H7PA 1TE1A 1G4SA 1JPDX 3WQEA 4X2RA 1DQWA 4GZEA 3W1LA 3UYCA 1XBXA 4GRSA 2GSHA 4H19A 3ZS4A 3CQKA 3VM5A 1EPVA 3WY1A 3STPA 1GQIA 2HWGA 3MTWA 4G1NA 3MP4A 2DIJA 3B8DA 1QATA 1G7VA 4Q22A 3SCQA 2ZXDA 1R3RA 2WWDA 4OKDA 3T0AA 3PZQA 3W2UA 3YPIA 1E6NA 2Q02A 3KDOA 3TYBA 3HMJG 2FFCA 4QQ3A 5DRIA 5AVHA 1KM0A 2BY3A 2E9BA 2V2DA 2GUBA 3RJYA 1UD2A 2V6AA 4WCJA 4UQDA 5ABFB 3TNOA 3SSZA 2WM0A 2YLAA 5HWMA 1BKSA 1VD6A 2VWTA 4JTAA 1NDZA 1D7FA 2ZRUA 1S2VA 3CAQA 4I7WA 5CG7A 3W27A 3GFXA 3PPFA 4G6CA 2ATMA 4H1ZA 2Y7EA 4XG1A 5G4WA 1O6IA 4M3PA 4UQAA 1RV8A 1JD7A 3DESA 2HVOA 3MO7A 4KGLA 1B5TA 1T6MA 3SRHA 3LM7A 4Z1YA 3IJDA 1JAEA 1DWGM 4WJ8A 2WAGA 1TV7A 1EP2A 4Q3MA 1OX4B 1ISYA 4ORMA 3WYZA 1OT1A 3IUIA 3R79A 3VKCA 2NZLA 1P1XA 3CAWA 3RDKA 2YFNA 4NYUA 1PX3A 4NX5A 2YGYA 1WDDA 2W63A 2Y62A 1SSGA 4R7JA 1SW3A 1V0MA 4HPNA 3L12A 2ZXQA 4GQRA 4C6DA 1NAL1 1TE6A 3PBUA 4B92A 5EA9A 4JCLA 4JN6A 2DSKA 1UR4A 2ZYFA 2NWSA 4JDBA 3FA5A 4AZBA 3UWZA 3CUZA 1UKOA 4IIGA 4I9MA 4KBXA 3WDJA 4Z2IA 2NQJA 1UZ4A 1Z69A 5IDZA 1TMLA 3ANYA 3KVJA 4HCHA 3TTEA 1YTDA 4OJYA 3GW0A 3MDWA 4M0XA 3VNIA 4QQUA 1WX0A 1UR1A 4CNUA 4Z42C 3VNJA 3WMSA 3SEPA 3W53A 3GNRA 4DELA 1TYGA 5AKQA 3NO5A 4LC8A 5C5YA 1EDGA 3WH6A 2G4FA 1OCNA 3HV9A 1QVBA 1KKRA 1XG3A 2C7FA 2PDKA 1SSDA 4KCTA 4NT0A 3VCCA 5IHRA 3RCNA 4GH1A 1ECEA 4QJ1A 1IEVA 3UJEA 4BKNA 2ZRYA 2R8WA 2XFRA 3I3DA 5F2LA 2ANUA 3WLOA 2J27A 4REQA 2WPGA 4YYFA 1R2SA 3R0DA 3QMTA 4LTSA 1I2QA 3CV7A 4KGJA 2QCMA 4W8AA 4YHEA 1ADOA 3LHTA 3M5YA 1JJKA 4S3KA 3M7WA 1ZLPA 4WR3A 3W02A 3DHPA 3WQ5A 2CERA 2DQXA 4M5PA 5G1TA 5HQLA 1K8CA 2P3EA 1R3SA 2ZADA 2F38A 3OIHA 3KTCA 3WNOA 2I56A 4IICA 1PL9A 5L9FA 2YCLA 1PYMA 3AMKA 3SO7A 4LEQA 1Q8JA 3E0VA 4XVEA 3G3MA 2NQ5A 3LG3A 3TSDA 3LM3A 3MB9A 3TKFA 4S23A 4AC1X 1UQYA 4L7ZA 1CX9A 4QG9A 3ID7A 2EPHA 1MXSA 2XGBA 3NL2A 2PLKA 4MF4A 1T5AA 3C2EA 4OQVA 2CLEA 2PC8A 1VBRA 1SZEA 3GFYA 3W87A 2ISFA 1N82A 3TYEA 4QP0A 4BFAA 4FK9A 4WY0A 3H4WA 3QV7A 2WSPA 4X9SA 1R86A 3T9PA 2ZDRA 1P0BA 1OC6A 3BQ6A 1WDQA 5EB8A 1E9YB 2HZGA 2YL5A 1IHIA 1A3WA 1ZL1A 5J8LA 4MJMA 3QPZA 4NXKA 3NG3A 5FI8A 4TX6A 4KIEA 3BMVA 1VCVA 2V9DA 1GYLA 2VVSA 1E51A 1FWCC 5FA5A 1K8XA 3UG8A 4LU0A 3P7YA 3ZIZA 2INZA 3SDOA 1W1IE 4UOQA 2G95A 1RD6A 3DDMA 4AYGA 1HXJA 4WKHA 3KOZA 1JDFA 4JTGA 3GAKA 2OKTA 2HBXA 5AHIA 2Y7FA 3TW6A 3UWVA 1J79A 1XSIA 1KCLA 4QLKA 4MLJA 3F4WA 4W84A 4NILA 3E5PA 4UUIA 5LNVA 3AWNA 3QGVA 1UD5A 2HV5A 1ISWA 3OTRA 3RNDA 3HJZA 3N15A 4PMJA 1LYXA 1TRIA 1QT1A 3A23A 4RZ6A 2OXNA 3SRKA 2QUUA 1SJAA 3WQ6A 2TODA 1U5JA 3HG2A 1GVQA 3IUDA 2E6YA 4C1NB 3R25A 1KXQA 4XBKA 3H6OA 4U2ZA 4LS1A 4IJRA 2IS7A 1DOSA 4PMQA 1JZ2A 3WJWA 1CBGA 4O8RA 4QS5A 1AQHA 4HZ6A 5A8GA 3QW4B 5EMLA 3FLUA 3TP4A 2E1DA 4JS3A 3L5AA 3D46A 3TW9A 4L56A 5H2ZA 3V0UA 1J0YA 5CEWA 3CPGA 3GD6A 1W3KA 4H6EA 1E4NA 1OGGA 2R1NA 4J3ZA 4EK7A 2PD5A 1S1RA 1EL3A 3BTNA 1EA9C 3G1SA 4WUIA 5CLTA 5F7UA 1V7YA 4NI8A 3EWXA 3VD5A 3IVTA 2PEVA 4JFSA 3EKLA 3WNMA 4EWND 1GPFA 3I6EA 3R58A 1DL3A 3L9CA 4YTSA 4JQ1A 1V0LA 4GUHA 2VQTA 4R34A 2EHHA 2R1LA 2JIEA 1PKLA 2Y7GA 1FHVA 2VWSA 1VS1A 2NXIA 3VOIA 3WSUA 4Z1AA 3HF3A 4M7TA 1PE1A 1VFUA 3M0MA 3SZ8A 2FHFA 5HPCA 4PFMA 5FF2A 3EPMA 4M82A 4AUBA 5F4XA 3M07A 4HSHA 1W5QA 5K9CA 3FYOA 4JHMA 1TVPA 3VABA 4O50A 3WLHA 4PBGA 4JIIX 2IW0A 2P76A 3BZJA 3KVKA 2QUTA 3ZT6A 2IKHA 8XIMA 3PTDA 2WCAA 1SO5A 1KR1A 5GNYA 3KHJA 4O12A 3BOXA 4RE2A 1UJPA 1R3QA 2WVSA 3DEQA 1JDDA 3NZQA 4QE4A 1A4MA 4MY9A 2PPGA 1QW9A 2OSXA 1H7XA 1KCXA 4MWAC 5H8MA 4BK9A 4LNYA 4UQBA 2ZTKA 2JEPA 3BGJA 4L9YA 4US6A 1KLZA 5BYWA 3E0WA 2FH8A 2PDBA 3QHMA 1XLJA 1UH2A 1XYMA 5JBDA 4GVHA 2DDXA 4BY3A 3ABSA 1HT6A 3BJFA 1LQ0A 1H0GA 2VFEA 5MKGB 2CWNA 1FXPA 4YIWA 3W38A 3I4EA 3TYDA 3MMDA 2V0TA 1KM6A 4GNKB 1E0WA 3V18A 4JIQA 2DH2A 1V3JA 3OYXA 4HU3A 2EGZA 2WNZA 3KTXA 3WK2A 4S3BA 3A5VA 4UFHA 1SFTA 5A2AA 1FHUA 5A1AA 5M5DA 5I3KA 3W82A 5FCZA 5CKSA 1V3MA 1GZJA 2CIPA 1UP3A 1E1CA 3N9RA 1W9UA 3OVRA 4TMCA 2XVKA 2V5LA 2G41A 3SQLA 5I23A 5T91A 3SFWA 4UWMA 2QCGA 3H7UA 4XSMA 4H7VA 4ICNA 4NRRA 1VBHA 5G5IA 3TN5A 1KGUA 3LV5A 1WOBA 1K70A 3RR1A 4KH2A 2IKIA 4MJZA 1Y0EA 2ABAA 1W9PA 2YDSA 1I4NA 4Q4KA 4W9TA 1Z7AA 2X1IA 4HA3A 3L4TA 3QQ0A 1XQLA 2HTMA 3W7JA 3SIMA 1EJVC 2P5NA 4W7UA 3R1ZA 2QMKA 2VX4A 3NDZA 1FDJA 4LV9A 4LUSA 4O1BA 3TTQA 1XIEA 4FB7A 3RU6A 3S6DA 4G2DA 1R46A 3CUHA 3QXBA 1YDNA 1GQKA 3PZGA 4HD5A 1RJPA 4HSNA 2R24A 1EEPA 3MU7A 3GUGA 1Z48A 3CEUA 1VR6A 3VD3A 3EDKA 1R30A 1BWLA 2XN1A 3PBVA 4LY4A 3DENA 1RBOB 3FDKA 4LCRA 4N02A 4TOQA 1DIOA 1UOKA 3C4UA 2PFHA 3BLDA 3RPTA 5EFFA 1V93A 1TQXA 1W3JA 1ZB5A 2VEKA 3AIWA 1OZMA 5I3FA 1UH3A 5LIXX 2XWDA 4NZ5A 5DY3A 2Z27A 3JZEA 3BUVA 1VHCA 5FL0A 3UG3A 3SUTA 3TUUA 4LAMA 1FFQA 3K8MA 2G3NA 1MW1A 2PDGA 5DN1A 1H5VA 1Q6RA 4FIRA 4B5UA 3VOJA 3OIXA 3VK5A 4ATLA 1XR2A 2GVEA 4KWSA 2VFDA 1ZAHA 5A6MA 4IQLA 3P82A 3T81A 5J04A 4FX8A 2D23A 4GJ1A 3LY0A 1XKJA 1I2PA 1MWOA 2P88A 1GG1A 2Z28A 2Q8XA 2VD8A 5CC7A 2ZX5A 3EB4A 3G1VA 3SQSA 2PDXA 1KCZA 3S8HA 3F4VA 1KFLA 3TLLA 1UP2A 1KNWA 2RUSA 3E0IA 1F74A 1FCUA 1E4MM 4JIPA 5JVLA 1KXTA 4M6PA 1JUBA 4IFRA 3CPUA 1ZHAA 1LOLA 3CQJA 3UR2A 7PTDA 1B31A 4FXRA 1O1HA 1JRBA 1YTEA 1B0IA 1GZGA 1DHPA 2CKRA 4X9YA 4LRSA 1XV8A 2PBOA 3CASA 1OT2A 2GJXA 2NQHA 4A22A 3I7SA 4UIOA 3RLHA 3H4XA 1UASA 2CLMA 3TC3A 1LL6A 2QXWA 3MJYA 1UA7A 3WLRA 2XSBA 2I57A 1UPPA 3C2OA 1TVNA 3KOFA 3WJZA 3IV3A 1JZ4A 3DGBA 4R53A 4GVIA 3QZ6A 2H9AA 1QPRA 1GOIA 3H23A 1OGBA 4YWSA 2GK1B 3ITYA 1QO5A 3VILA 3K46A 1A4LA 4BQ3A 2QJJA 4LAUA 3U48A 3SJ3A 3FCPA 3W00A 2YCLB 4OOUA 4FZIA 4UR7A 4A8IA 4A4AA 3WDHA 4DQWA 2A6NA 3WZ0E 4RR4A 2JKPA 1BVWA 4A2RA 4Q4QA 4HYVA 1LWJA 3L67A 3L65A 1JCMP 2W3ZA 2ZBTA 4ZB5A 3GWQA 1F05A 3LCLA 1W91A 4JGDA 3R0KA 1UWRA 4GKTA 4WSKA 1A5LC 1Z42A 2CPUA 4ZTXA 1BD0A 5CSSA 1B3YA 4Y9AA 3EEGA 4WY0B 4JYFA 2I5GA 3G1RA 3FHAA 1GQNA 3NQFA 5HWNA 1RBLA 4L1GA 1O94A 3QOKA 1J11A 4B5TA 1MEWA 3ZJKA 3KBVA 1AH0A 3S5YA 4CCDA 3P8JA 4FNSA 4JQ2A 3THUA 5ABTA 1S46A 3UGRA 1VJZA 4TMBA 3FAWA 3L5LA 4YMZA 3TR9A 4MLRA 3DN5A 1JUEA 1RK5A 1A0DA 1B54A 1EJSC 3OA5A 1EJ7L 1JZ6A 3MPGA 3TJ4A 2QCCA 4AZIA 3RMEA 2D22A 1BSLA 4PZVA 3OZPA 4XAYA 5D38A 2VI0A 3CZJA 4MKSA 3U4FA 3WJYA 1REQB 4CGTA 4CEXC 3O8AA 1XPGA 1I2NA 3M0VA 2YB4A 4XD6A 1RQBA 4JD4A 3LK6A 4X61A 3GO2A 1DBTA 4PH6A 2AOSA 1A5NC 3R43A 3LYEA 5BWFA 3WLSA 4LBUA 4C65A 4PUJA 3A64A 3W1RA 4WXZA 4ACZB 1US2A 3E0LA 4QS6A 2VC6A 4W8LA 2PURA 1X1NA 1DHKA 3A4JA 1IIGA 4GI8A 3P3BA 2PTZA 3PWAA 4RLIA 1PWLA 3LU2A 4H8UA 3LOTA 4E8CA 4MUPA 4DZIA 4DI9A 3V0SA 2PDYA 3RRAA 1XC4A 4XIMA 5CZSA 3UR5A 2C13A 3MCMA 1EP1A 1POKA 4AX7A 3GDRA 3AFBA 2W92A 3IK4A 3K1GA 4DO7A 2DJLA 3IACA 1QNVA 2XPKA 5C70A 3WFAA 3FX4A 3DGRA 1RY0A 3ZYZA 3VGDA 4JKMA 1SR0A 3E74A 1EUNA 3MV11 2VXNA 4F2BA 4U33A 4GUGA 3JZUA 3PVFA 4HZ8A 1DXFA 4W7WA 2O9OA 4Y90A 4Q33A 4OZOA 1H7RA 4GZJA 2PF0A 5KETA 4DUOA 3F4CA 3JU2A 3IVUA 4JEQA 4DXXA 4GJIA 4J2PA 4PCSA 3FHQA 3CL8A 3UZJA 2CEQA 1CXEA 1ME9A 3QV6A 1E15A 5C9WA 3CUIA 4LW7A 4DO4A 3BVJA 4IGSA 3H2OA 3BW2A 4GXMA 1NEYA 2O9PA 3MHUA 1E0UA 3CLMA 4P7NA 4W5ZA 3C2RA 5E93A 3C2FA 5EY5A 2L5HA 1ADSA 2OGYA 1K6WA 5CPMA 1L2QA 1CXHA 4CD6A 3T1GA 2ZRWA 1KQYA 4MYAA 3TZFA 1Q63A 3HJEA 4ENLA 3I65A 3G18A 4JFTA 1DVJA 1GOKA 3VGEA 3Q4DA 1B30A 1V6XA 3QFEA 3WBEA 5LIUX 4AMAA 1IQ8A 3VX1A 1VYRA 1Y7VA 4P8UA 2ON3A 3HG5A 1TKKA 1ZJBA 2ACQA 2C8NA 1N7KA 2GQ8A 2FPVA 4HU4A 4PE8A 2W6RA 3NQGA 4G56A 3W23A 4NJJA 1S38A 3WDRA 1AODA 4GIYA 2H8XA 5A94A 3AYSA 1DPMA 1KBIA 3VE7A 1RJRA 1BAGA 5BZAA 1AH3A 4ZL1A 1PZ0A 3Q45A 1H0IA 4MTVA 3U4AA 1PUDA 1Q7QA 2BGSA 4ONVA 2X1TA 1UWAA 1IXNA 3UPMA 1IEQA 4LBSA 4V28A 2QGHA 3IAPA 2VM8A 3AAMA 3HFYA 4QJ5B 6REQB 3ARVA 1AA1B 1XM3A 3BG5A 1TUFA 3QMSA 3NWRA 3TQKA 2ZX6A 4LPCA 3T2QA 2BMBA 2DZPA 4GO8A 3CM4A 3TFCA 3ZLFA 4A3HA 4BI5A 1FCBA 3H2MA 4K8HA 5B80A 1GVYA 1GHSA 5BOFA 4V27A 4UTTA 3TVAA 2PSNA 4N0RA 3OBKA 2B7OA 2E7FA 4JNMA 3NSNA 1E1FA 1JQXA 2CHOA 1OZQA 4H2CA 3ITGA 1K7FA 4E2BA 3G1AA 4FR6A 3I3EA 2BGQA 6PTDA 2O0TA 4A8NA 4M24A 3IGXA 2GGIA 4AWTA 4DXVA 4Y6GA 1VC4A 5LGZA 1S5MA 3HPAA 1F7BA 2WHJA 5I02A 2G3IA 1JYNA 1XGZA 1KGXA 4V1XA 4L4LA 2OZ0A 1R85A 3NQVA 5F2GA 1UQZA 2OB3A 3NUKA 1JVNA 1I9CB 1K9TA 1YDVA 4D6FA 3G8EA 5JU6A 3WUBA 2V69A 4CU6A 2EBNA 3A9BA 6ENLA 1RVGA 4MOZA 1KBLA 4MMWA 3FEQA 1GTEA 3LCIA 4LVDA 1DEDA 1QI0A 4EPKA 4BQ2A 4NRSA 4NX0A 4GX9A 1W2PA 4PB5A 4BI6A 4JX5A 4RX0A 1TJ1A 4A3QA 2GLKA 1G9HA 1KFJA 3VKKA 4LWWA 3MZ2A 4N9DA 2YIHA 3WEOA 1W5MA 2TMDA 3W9ZA 2NX1A 1YHTA 4NVTA 2OYMA 4GKLA 3ZWTA 1CECA 1CB7B 1TIWA 1PSCA 3WD0A 1JF5A 1YNQA 1Y8BA 3BWWA 5EBUA 3QQ1A 4MWAE 1ICSA 1LCOA 1R87A 3T8QA 3BLOA 1UKTA 3K4WA 2QCHA 3KX6A 1RCQA 3SFKA 2ZVRA 1EQPA 5I77A 5C2CA 4QFUA 4OE7A 3UEQA 2CWXA 3CIXA 3LCFA 2DFAA 4FNPA 4EXQA 3MMUA 2DZBA 1WDRA 1HG3A 2J7GA 1F5ZA 3S1XA 3IJ8A 4Y8FA 2FVLA 6CGTA 1TPVA 4L65A 3H24A 4WY0F 3WMCA 4PSPA 3KRBA 2QPSA 2OZ3A 3LGGA 5K4XA 3NDOA 4DBEA 4NKCA 5G1MA 5BNKA 5A6TC 1SFSA 3RUBL 1EQCA 2GJXB 4GIEA 3PP7A 1BVNP 2QDEA 3CZEA 1L6SA 3BMXA 3S42A 4DWDA 4QRNA 3LHYA 4PCTA 1H51A 3CHCA 3P8IA 4M1BA 4Y9OA 3S5NA 2W4XA 2WSRA 2PRMA 4OTKA 3FNDA 5B7YA 2CLFA 2I9EA 3UXIA 2WMJA 4POCA 3R5EA 3BAWA 4RW5A 1AZ1A 5D32A 3GDBA 4I8DA 2ZZ2A 4HGXA 2BGNE 1OFQA 2PRLA 2X16A 1UUOA 1DKWA 3OQEA 3L2LA 5DMNA 2X41A 4WZHA 1J2BA 3LCXA 1JZ5A 3N1AA 2FJKA 4FXFA 3TH6A 5C9ZA 1F61A 3LLXA 4LF1A 1VYPX 2HK0A 2EPNA 2F2HA 1H7NA 7ENLA 3HG3A 3IJ9A 4ECLA 3UY8A 4IUGA 1HUVA 3V5FA 2BWGA 2REQA 4QE1A 2ZDSA 3FGCB 1H50A 1KXHA 3VNMA 1ONWA 1GGOA 5A3HA 3HQOA 3ARUA 1NELA 1D8CA 1QHPA 2G0WA 1YTKA 4IQEA 1TQJA 3B0YA 5K3VA 4XSLA 2QULA 5EBAA 3WNKA 3EMZA 3E49A 4LUTB 4XAPA 3BSHA 1UIPA 4NNBA 3ZO9A 2EQDA 2FZNA 2YSWA 3KDNA 1I8JA 4AIEA 4L80A 2YW3A 2X1UA 3QOMA 2Y89A 2WANA 2F2KA 1SFJA 2PDUA 1I2OA 4UQCA 2VOTA 4D8ZA 3FA4A 4R27A 3GTHA 2NUYA 3H70A 3PJUA 2OMAA 2E5CA 3TYAA 1IZJA 3WQ4A 5IRPA 5FACA 3AHZA 4ZXLA 3BL3A 5FJRA 1TMHA 3I7RA 1WPCA 1PKYA 2YDAA 3KL0A 1UC5A 3M16A 2ZUUA 1WA3A 1WYIA 3T55A 4DBSA 1A49A 1DJYA 3IRSA 2ZRVA 3QHOA 1IT0A 2DH3A 4DZHA 3B8IA 3BG3A 4EAMA 3MSDA 4CD8A 3SUSA 2VEGA 3H8AA 2FB2A 2GOUA 4C6EA 1A5MC 3M9YA 1UKSA 2DT0A 3DECA 2GWNA 4JTJA 4I7UA 1TV5A 2BXVA 1H63A 2VT0A 4X2PA 1M7OA 1XLAA 1RPXA 4C91A 4TVCA 2G50A 3K5XA 4OBSA 3SR7A 3W6MA 3NQ7A 2XGZA 2BP1A 2E77A 5CZTA 3TQ0A 2XVLA 4F0MA 4AMCA 4GX8A 1WQ5A 1HTIA 3HZ3A 1SVDA 1CLXA 3RX3A 1XLHA 4IQDA 1FCQA 3S9YA 4BJHA 1ZJHA 1EJRC 4QG6A 5HBFA 4N4PA 1JXJA 2WQPA 5TAOA 3GS6A 3CH9A 3R10A 3DC8A 2QHAA 5CJ5A 1EOMA 3MUAA 1E6RA 1XH2A 4MJ4A 1GPWA 3A47A 1I1XA 4EXAA 1VF8A 1VFSA 4PUKA 2PWGA 3QM3A 3DG3A 4CQ9A 1THFD 4HZMA 1RH9A 2ZQ0A 3AIRA 3WH5A 1A5BA 1XBYA 4ZB2A 1XGDA 2R9RA 3TNBA 3NNTA 5JBEA 3ZFHA 4W87A 1XLGA 4ML4A 1NWUA 2MANA 3R8HA 4LC6A 4HU0A 1IXOA 5LNSA 4LVBA 1QR7A 1UCWA 3IARA 1WB0A 1OD8A 1XIFA 4NYYA 3AIQA 3LRMA 2ZX7A 2O7QA 3KS6A 3CTTA 5CZ0A 5REQA 3NQEA 2CLKA 3EDFA 1SO6A 1XGEA 1V6WA 1OQFA 2IQTA 3S2MA 3GR7A 1OEPA 3IIZA 4IX0A 5AYZA 3CS2A 3P5ZA 4UFIA 3GQYA 1OFRA 3LQGA 4TVUA 3NIYA 2PDHA 4UOZA 3UWUA 3OG2A 4LVFA 5H8UA 4LYPA 5DBTA 4QX4A 1TX2A 3HO8A 3Q2DA 5DQPA 3WF4A 3W7PA 5FJPA 1UMYA 4MWAB 5I3JA 3CAVA 2CLLA 2AMGA 3MYOA 4IMEA 3DZ1A 1HIZA 3HG4A 2VR4A 2W67A 4JL1A 4U10A 3THQA 3MHGA 2OFJA 5GVJA 2BX7A 4WJXA 2YDRA 1HO1A 2JBMA 2NSOA 4LY8A 5KSWA 3AALA 4N2YA 1R6WA 3CIVA 3MI2A 4N4QA 4JY8A 3W74A 4F9JA 1RALA 2DW7A 4TV5A 4J7RA 4C7DA 2J7EA 3A12A 1K9FA 5TD4A 3WFZA 4ZOEA 3AMDA 4LJ3A 4B91A 5K9DA 4PMRA 1XCXA 2O7SA 1DJXA 3WL1A 2HBVA 3L4YA 2XN0A 4DWSC 3K4AA 1OSEA 3K4DA 3AUOA 1TA3B 3E02A 2XZ7A 1FWRA 3W25A 3OOQA 1VH7A 3BO9A 1GJPA 3SSJA 4PL2A 5HR7A 1D3HA 4UTIA 3W2KA 3JVAA 4O57A 3NQCA 1UROA 2QAPA 4AU0A 4PTWA 1T7LA 2PMQA 2VGGA 1JF6A 3K2GA 3AXHA 2RH9A 3VGFA 4HHPA 3D47A 4XTIA 1PDYA 5I7GA 4GQGA 2H3DA 4W88A 2OODA 3T0CA 3C6CA 2C0HA 2Y1HA 3I3BA 1AJ2A 4Q4SA 1ENUA 1VIWA 4YL2A 4Z2GA 1WZLA 2FH6A 2Y24A 3VC6A 3AHVA 1HKKA 3OQ8A 4QLLA 3TJLA 4D9PA 5H91A 3O7UA 2VKZG 2BODX 4J27A 3TAOA 1MZHA 5AYXA 1R7OA 3H2CA 1YXCA 3W0KA 2PZ0A 1IXQA 2AKZA 2PWDA 5LIYX 2A21A 2I14A 3Q94A 4RE4A 5JQ9A 2DU2A 3WJXA 1F07A 4UCGA 2A2IA 3JS3A 1HO4A 2P50A 1BYAA 2WMHA 3RX4A 4G7EB 4B16A 3B97A 4OIFA 2A3AA 1V3IA 1M7PA 4KQNA 2WVVA 4PB4A 4N9EA 4BQ5A 3JUGA 2Y2WA 1LG2A 4NAEB 2PWEA 5A8MA 1E6ZA 4QEHA 4IPPA 1W17A 3PK7A 1QPQA 3M0JA 3VGGA 1MFUA 2X7WA 4LANA 5AVNA 1S2CA 3W29A 5IBXA 4LYQA 3IV8A 4RXGA 4R7OA 2F84A 1DJWA 2PB1A 3OLIA 4ASTA 3AQUA 1TPDA 2P10A 5CZJA 2QIWA 4ES4A 2R1KA 3W37A 3QY6A 1I45A 2OR2A 2FHCA 3MC5A 1TPFA 2OLSA 1MEHA 4JXCA 5BOOA 3SN4A 1PJ9A 4H7CA 3FA3A 4RW3A 2PDJA 1HX0A 2C71A 4Q7NA 1OC5A 1QW7A 3LS9A 3WMBA 4JQ3A 4FSAA 5LHFA 3H7RA 4V2XA 4ZSTA 3WK3A 3O15A 3RPMA 2H3BA 1TX0A 1QFEA 1E6XM 5DXXA 2J88A 1SZGA 1QPKA 5ABEA 1UWSA 1A5KC 4Q8NA 1QOPA 4XQ6A 2VEMA 4F79A 2GFTA 3NL6A 3V36A 3RF9A 1DTNA 3GX9A 1E0VA 2FZMA 4DX3A 3DYMA 4P7OA 3WQCA 5FIPA 1EIBA 3A24A 1R0MA 3NFUA 4LB4A 3MZNA 3SCTA 3E2RA 2FHBA 2DT1A 3KOXA 1OF8A 4RL3A 2VFFA 4DLFA 3WF1A 3B0XA 3DBNA 3ORWA 1W9BM 1VPQA 3OLGA 5C2GA 2V5JA 1E4LA 4DJFA 3O6YX 1KFWA 6XIAA 1G4TA 1ONEA 1ZS2A 3GHTA 4KW2A 3ZT5A 3VM7A 2EKCA 1UA3A 1PWMA 4PRTA 4BS0A 4HSOA 1R8LA 1NQKA 5AN7A 5I3DA 1WKDA 2DUAA 3KBJA 3P67A 4N42A 2CZFA 1ALDA 2E0PA 4ADUA 1PTAA 5DELA 4P61A 4TU1A 8XIAA 2RKXA 2CNCA 1Z6KA 1HGWA 3VDAA 4F0LA 1B57A 5A69A 2EJAA 4S2CA 3MP5A 1XIIA 3ALFA 2XM2A 5E9AA 3OGRA 1FFRA 3GVGA 3NL3A 4XUYA 4NQ1A 3ALGA 3PC0A 3I10A 1YRRA 3I6RA 1BSIA 4B5VA 3VOCA 1VBJA 3NTYA 2V2CA 1M41A 4MNJA 1P0NA 1PPIA 5I06A 4RNIA 1B9ZA 5DCBA 4FOKA 3WN6A 4ZBCA 1R7AA 3P5YA 4AAJA 2DGAA 1E43A 4GZ7A 1QOQA 2C15A 4GFSA 2W79A 4QG8A 2Z6IA 3SCUA 1OX6A 2GOKA 2QZRA 1AMKA 2CHNA 1YDYA 1ITUA 3GHUA 3SN0A 1EDTA 2ZX8A 4WK9A 4DBDA 2YKKA 3T08A 1ISVA 4C5ZA 1G67A 4DHGA 3BLLA 4C6MA 3VUPA 1W3TA 3MV01 3UGVA 3TC6A 1MW2A 7REQA 2YA1A 2J77A 2ZE3A 3CUFA 4HN8A 3FN9A 2Z1SA 1W3NA 1YXDA 3N4AA 1UYQA 4O54A 3GSMA 1OG6A 1FHLA 1LM1A 1GKPA 1WP6A 2J7FA 2OO0A 2SFPA 1GG0A 4IG2B 4FP1A 1FP9A 2VDHA 4LFYA 1YYAA 2Z29A 1GKRA 3B3DA 1R2TA 3WENA 3OZMA 3UJRA 4K8GA 2PLJA 1VFTA 1Q5MA 1XJBA 4M6UA 4ZOBA 3PZ9A 3EYPA 2WKLA 1B9BA 3W2LA 3P2VA 2J9ZA 3BARA 1PHWA 1OG0A 5C2XA 5E0FA 1VQTA 3MA8A 1CXFA 4MZ8A 1AH4A 4Z17A 2C0AA 4GHRA 4KCVA 2WMFA 4RZBA 4P7QA 3EZ4A 3RLVA 1PAMA 4OHQA 1QI5A 3VIOA 5A8QA 5I6SA 3K8LA 3AIVA 2VQUA 3GHSA 3M5XA 4S3JA 1JIBA 1ESWA 3TN6A 2HMCA 4J3VA 4IP7A 4GD0A 2E5DA 1RA0A 3UA3A 3UD6A 1KFBA 3LNMA 2X8RA 4DUWA 3ES8A 3HV8A 1TB3A 4XZLX 3TFXA 2BNJA 2UY2A 3DFHA 4PCNA 3F5LA 3OU8A 1OCJA 3NURA 1LUCB 1YX1A 1PCKA 2OTDA 1J0IA 3ITVA 1K9EA 5HULA 1GVIA 1YLVA 3LD5A 3ARQA 5JUVA 4AX6A 3TMLA 1EXPA 2E9MA 3UETA 2A7PA 3MUXA 4RPPA 3Q67A 4Q8TA 1JI1A 3SUUA 3FV9A 4ERGA 4MUZA 2TPSA 1XIHA 1W9VA 2ZUSA 2ZE0A 4UFJA 2NVDA 3FVDA 4F48A 2B4GA 3EMQA 3S2JA 1NJJA 2HRWA 4S3DA 1WNOA 1RP8A 1DXIA 1IGWA 4U5KA 1WDPA 1E6QM 4GY0A 1JI2A 4DZAA 5HATA 1CGTA 1RP9A 4TIMA 3GG8A 5I24A 5E5CA 2ZIDA 3ITCA 2ZWYA 4XZBA 5HNNA 3EXSA 3G0XA 4ZENA 1RA5A 1LRQA 1W5PA 2F8QA 3ABOA 2WZMA 1HKVA 2HQAA 5CSYA 4AVFA 2HE8A 1RQHA 4NJIA 2AL2B 5DLCA 2Y63A 3MHFA 3JR2A 3LENA 4HN4A 3WK0A 2C1GA 4DY1A 3LBOA 3DXIA 1A3HA 3W7RA 3K13A 2C16A 1M53A 4JX6A 1M7XA 2V63A 3T7VA 4KESA 1GONA 4K3ZA 3WBWA 1G5AA 3OBEA 3U9IA 2GJNA 3RIKA 2V38A 2CBUA 5A6BA 1EA0A 2WXDM 4UTWA 3G1YA 1Q6LA 5D9OA 1OADA 2V3EA 1WKFA 3POCA 3FW6A 2J7HA 3KWSA 2VR2A 2GL5A 4B3ZA 1ODUA 3SGUA 1C7SA 3TU9A 3M64A 1YADA 3ITLA 3VDBA 1O5KA 1P48A 1RUSA 3I7QA 3NQDA 2B0MA 4E4UA 3WH7A 2VC9A 3QKEA 1LT7A 2HCVA 4XZIA 3CWNA 1TPUA 1LLWA 2XIBA 3CAKA 4ALDA 3PBMA 3TWBA 2WJEA 1IWPA 5CBBA 4QCEA 3V0TA 2V5CA 1SUXA 3SN1A 1NOWA 4KERA 2CZEA 6XIMA 3LHZA 4GIRA 1Z32X 2Z1BA 4F66A 1K03A 1LJYA 1MRQA 3TIMA 2W5FA 4FEZA 1P7TB 4BR1A 4JL2A 4DJFD 3KOYA 1WDSA 1TTQA 2VFHA 7A3HA 1SJCA 4XBJA 1L6GA 2Y7DA 1JCLA 3QSTA 2QCNA 3D5HA 1Q85A 1PDZA 4PR4A 3DU0A 4JR5A 2WNQA 3CT2A 3SQMA 1US0A 2VZUA 5LHEA 2NT0A 3W83A 4F0RA 1XLLA 1DTUA 3LMZA 2YJQA 4IOTA 1K3UA 2WVVB 3KOWA 3SJNA 1GVSA 4V1YA 1E73M 1ICPA 5FEZA 2Q01A 4MFEA 2PAJA 3C56A 1E5JA 4JHOA 2F7FA 3EWYA 1ZP4A 1C90A 4Z08A 3RCMA 1MUWA 4GA8A 3AS1A 5TIMA 1RD5A 1PYFA 2VOMA 4ADSA 1EOKA 3NL5A 5I5RA 1M6JA 4GUFA 1XYLA 3E5BA 4NSBA 4DF0A 2BB0A 3EOSA 3VGHA 2XYLA 3E9AA 4JCMA 5IM51 2GVJA 2X1SA 3U3HA 1X1OA 3N3TA 2Z1KA 1XLCA 1EF3A 4KRZA 5EMKA 5EYWA 2JIWA 2DZXA 3QKZA 4S1FA 4GYPA 2XN2A 3EWWA 4HQVA 5T9BG 3EB2A 1ITQA 3MSRA 3LQLA 5CGQA 2XVGA 4JN7A 5CPNA 3EDEA 2EG8A 2QJGA 1WKEA 3KW3A 3DKJA 2NT1A 4QSFA 1PKNA 4IIHA 1WAUA 4K1GA 1OB0A 3VIJA 3GIQA 4Z2LA 4QITA 4JFUA 3FJLA 4KEVA 3W71A 3RM8A 2UY5A 1OFOA 4DJDC 3GNPA 4KRUA 2X42A 2WWCA 5IXEA 2YW4A 1HL9A 2WHKA 3VOHA 3KP0A 3VE9A 3CTLA 4LS0A 4NI3A 2CLIA 4RUBA 3V3WA 2WC7A 3BJTA 2BVWA 3AXMA 3KL3A 1GOMA 4HNUA 2ZOXA 2NX9A 1UR2A 2HROA 3MI3A 2JGYA 2YBVA 3VO0A 1D7KA 3PF3A 4HJFA 3VNKA 1G0CA 3BXWA 4IXHA 2GSEA 5LSMA 4KIRA 2XH4A 4IZGA 1RR2A 3WQVA 3BV7A 4HNCA 3WLNA 1KM2A 4AZHA 1OK6A 3U0HA 1MI3A 3GXFA 1F6YA 3GVVA 1X6NA 2A85A 2XZ9A 3N9KA 3W01A 4AD4A 4IFKA 1XPYA 2YX0A 4UTJA 1OFAA 4Z0SA 1Q6DA 5TNVA 1GVRA 1I1WA 3BC9A 6TIMA 1XISA 1UH4A 5D9NA 1IT8A 3CYVA 4L5ZA 3C8FA 3Q58A 2NV1A 3FAXA 1VPXA 5CGTA 1RZMA 2H6RA 5HOSA 4NP7A 4HOXA 4CQCA 1H4PA 5M3WA 4RDZA 3PUGA 4PMDA 2G5WA 4AF0B 1LG1A 4JTDA 3VIMA 4DRSA 1QBBA 2J79A 2ZC1A 3KCJA 4OFCA 3LBCA 1OFPA 1GJUA 5BRPA 3A9IA 1D3GA 3UQNA 4YPJA 4ERIA 3O6DA 3F2BA 3EDJA 3NVDA 1Q7MA 2PZNA 3A5FA 3DHUA 3H12A 3TOPA 2GGEA 2FTPA 3CB8A 4AWSA 4K68A 1SR9A 3TV8A 1S5NA 3WQGA 4D8AA 3V1HA 2QT3A 4UB9A 5T8GA 3ECQA 2KX9A 3GG1A 2IMRA 2IPJA 4URIA 4FPSA 3TSMA 1FCVA 3QZEA 1DJGA 2XUCA 2CLPA 1X97A 1L6FA 4JZ5A 1EXBA 1KR0A 1KB3A 1KBJA 1V08A 4MZ1A 1C92A 3SGGA 2UY3A 1RLDA 1D2KA 2POZA 1BTMA 2WMKA 4ZQMA 3PJTA 4H3DA 3MT1A 2QKFA 3L0NA 2CBVA 1EBHA 4Q6JA 3V5CA 1LROA 1W8SA 4TO8A 3GB6A 4QDMA 3RXZA 4LB3A 1DE6A 3CZLA 5AECA 1GOQA 3DFPA 3QR3A 1WXYA 1L0PA 2QQ6A 5AFDA 3R89A 3O2LA 4O1DA 4PTNA 4N6EA 2UBPC 1GJWA 5CPTA 2CW6A 5AC6A 3OLEA 5U4NA 5GQBA 4DF2A 1LBMA 4M80A 1H3GA 4PYSA 3SM0A 4R7WA 4LS2A 3DX5A 3UNTA 1OHLA 1TV2A 3GXNA 3ARXA 1Q6CA 4P7RA 3TZNA 3QY7A 4IP4A 3WQ8A 5A6BD 4C6IA 5GJNA 2CLHA 2DT2A 4UZUA 1F3WA 4E8GA 1VFLA 1AQ0A 5FL1A 4YYCA 1H62A 3L23A 3NYZA 3OGSA 1DJQA 2ZUVA 2A7RA 3CT7A 1C3FA 4WKAA 1SJDA 1CPUA 2R6OA 1AW2A 2Q8ZA 4IX2A 5G2WA 3T07A 3RYSA 5C9XA 1XP3A 3ARRA 3EXRA 4ZSUA 2WJFA 1OYBA 2Y61A 4FF7A 3WNNA 1W0MA 4FLRA 3IANA 2GSJA 2Y8UA 1XS2A 2PTXA 3OODA 3DI1A 4B5SA 4LYKA 3GVWA 4JQ4A 1VLIA 1QDSA 4M19A 1E6SM 1LZOA 4MY8A 1TZ7A 1DJZA 1T8QA 4KFNA 4CNNA 1XH1A 1KTCA 5FF3A 3DFOA 3VFLA 5A6JA 1JEZA 1ZCCA 2D1ZA 4AHQA 1W31A 1QNQA 3ZJ7A 1D8WA 1TFVA 4P2VA 4HT3A 4HHHA 1BYCA 1F76A 4ZMGA 3KXQA 3VKBA 1U33A 4XO7A 1XHGA 4B4FA 2ZTJA 4S3FA 3OG3A 1KM3A 4C60A 4UC5A 3N2BA 2Y5EA 1I2RA 3UXLA 1BYDA 4G9PA 3QC3A 3Q65A 2X2GA 3PPHA 1AK5A 4HK5A 2OELA 4WHBA 3EX3A 4GABA 4K39A 3W7CA 2ZUWA 4O10A 4UTUA 4CQBA 1O1ZA 2WMIA 1GUVA 2YZ5A 1GOWA 3OHIA 7TAAA 3F7JA 1JULA 4Z2HA 3TX9A 3THAA 1QK2A 4U4MA 1KTNA 2XDFA 4H8NA 5XINA 1TJ0A 3DH7A 1QNPA 4D71A 1FWSA 2XH0A 1R2RA 4IP5A 2DJXA 3PTMA 2RDXA 4AH7A 3CQHA 4TX8A 2ALRA 2V30A 3RITA 3SY5A 5HUPA 4C7GA 5C7VA 3TLQA 4BEQA 1VIZA 3OYZA 3LLFA 3W1QA 1ONXA 4GYJA 1X1ZA 2ISSA 3AXKA 4D1JA 4XX6A 3DCPA 2BLEA 2BSLA 1UKPA 4AHOA 2EPOA 4XZWA 4WLCA 1FTXA 4XD5A 3F1QA 1PXGA 4R5EA 4AISA 2B7NA 4NJKA 2HK1A 1NSJA 3QLDA 2XISA 3P6LA 4DWSB 2BVYA 2BS9A 5JH1A 4YS1A 2MNRA 2ZUMA 1FRBA 2Z2BA 4GXPA 3VDCA 2PS2A 4J9JA 2D2OA 1ZSXA 4DXKA 3B8SA 3TK7A 4YVVA 1ZQ5A 3KRZA 1B3OA 2NLIA 1JR1A 4AQLA 3IEBA 3BANA 3IJQA 2Y5SA 1JCNA 1RCOB 1G4EA 4D6GA 5LXXA 3TSBA 3PNUA 2NUWA 5CZKA 5FEPA 1A80A 2HPMA 3IPWA 1G01A 2WJDA 4RZ5A 4O16A 4W86A 5AOUA 1YW1A 1YE4A 4R88A 2CESA 3P61A 1DWJM 3U2EA 3LSCA 1T40A 1Z41A 1AQFA 4WDXA 1L2UA 3O0KA 4KEUA 3KZPA 1KKOA 2J7BA 3M0KA 1NM9A 3W7KA 1VLWA 2GJRA 3F2DA 1J12A 3W72A 1U1JA 4IGNA 2BHYA 2W62A 3HU7A 2VFGA 1E9LA 4WGXA 5BXTA 4RPQA 3CUXA 1T41A 1EJTC 4I5UA 4TX9A 4IIFA 1E9ZB 3CK5A 4W7VA 3RLUA 1W5NA 1ZY9A 3KEHA 2ZWZA 5FSDC 1BEUA 3B8TA 1TR9A 4YWIA 1T0OA 5AHFA 2QDGA 3ARTA 5BCAA 1NDWA 4FX6M 5E6ZA 3CQ0A 4GQBA 3C52A 1UPMB 2XWEA 3ARPA 1SW7A 3PTKA 1KD0A 1IEWA 1V51A 3M7SA 4JHZA 4A21A 4ZO7A 1FWHC 1XF0A 4X3ZA 3PJWA 3MBFA 4IXXA 4O1CA 1EBGA 4PMYA 1NY1A 1PX8A 4F40A 3M4HA 1DYSA 2VMFA 3O0FA 4YCOA 5A6KA 1G69A 3EEZA 4O15A 4JIRA 3TA9A 1KWKA 3SECA 2RJHA 3ZXWA 3IJLA 5JBFA 2ODOA 2A3EA 2J8TA 3UP8A 2P0IA 1E72M 2WNWA 4G8TA 3WELA 3EWBX 4XD4A 3VMOA 4RE0A 1LQ2A 5HANA 4E2DA 1O95A 3GVRA 4LNCA 5D2XA 1RXOB 3CWHA 1ML1A 4O19A 3RO6A 4DUXA 4PCPA 2YB1A 4MFDA 3QTPA 1WBHA 3AYTA 2P1FA 5BRQA 1O5RA 1O7AA 3W1PA 1YBQA 1KLYA 3CIWA 3KFTA 3EAUA 3TMQA 5CSRA 4NIRA 4GBUA 5E6YA 1PTGA 1XC6A 2NQZA 3KHDA 1XI3A 4DJDA 4PUMA 1ZZMA 3STCA 4A3UA 3WIJA 1QRQA 4D6IA 2PCQA 4JTFA 2D0FA 4MAVA 4F4RA 4IH3A 5CAHA 4GY1A 4HNOA 2NW0A 4AZ7A 1WUFA 1EGZA 5I2UA 4JQAA 4FI4A 4XD3A 2E4TA 2PF8A 5I00A 5D05A 3HQNA 4K7VA 1GVOA 3B4YA 4HMDA 3R8GA 1MYRA 1BF6A 4ZQPA 1GW9A 1A5OC 4LF2A 3N17A 4TTGA 4CN1A 3LMYA 5CPQA 2VUNA 3NGFA 3H21A 3GNNA 1XIDA 1W1PA 4RNFA 5HA7A 5DCEA 2A1YA 4PTVA 1NP0A 2CLOA 4Q8OA 4FA3A 1P6WA 5GJMA 5MHBA 3HPSA 2FPTA 4DPQA 3IGSA 1MW3A 2E25A 4YJ5A 3ARYA 3B9DA 3FYPA 4RZ4A 3EX1A 1Q6EA 3PZTA 4DYJA 2G4JA 1Q8AA 3GR4A 1OD0A 1TV3A 3AUJA 1I6NA 1J10A 1V03A 3LLDA 1RPKA 4JTLA 4CCCA 1CZ1A 2C18A 4XKYB 1V0KA 3REQB 3LCWA 3S2LA 1E4IA 3HTWA 4MVAA 3SCRA 1HKJA 1QHZA 5FF4A 5D2WA 1QBAA 1TWZA 4OVXA 1CWYA 4CU8A 4P8WA 3SBFA 3M0HA 2QCDA 1ONRA 4D6EA 1JNDA 2HSAA 1CCWB 4ZE4A 3PZNA 1QWGA 2GVYA 3T05A 2FJUB 1HN1A 2RAGA 3NPXA 1W3HA 4JTEA 2VFIA 1M3UA 3TYUA 3THCA 4Y9PA 4C6FA 3FY1A 2VGIA 2A3HA 4Q8QA 2JK2A 1BHGA 3WCZA 2PGEA 1UUMA 2J8FA 4HP5A 3GZ3A 4UZSA 1V02A 3CU2A 1W8GA 5I0DA 3KBNA 1K8ZA 5CXPA 2I5QA 2V82A 3T6CA 2FDMA 3VXGA 4QEEA 1JL8A 4IF2A 1HKWA 2CU0A 4ZQRA 3R94A 4FNTA 1VYSX 3QW3A 4O1EA 4KEZA 3FXYA 4OBTA 4Q8VA 1KWGA 4X63A 3AIBA 1BQCA 1LRNA 1JFXA 1ZBKA 4S3GA 1VFHA 1QI2A 1FQ0A 3G24A 3GAYA 3WUFA 2YXXA 3QR0A 5DY2A 3STGA 3C86A 2OLAA 4M7SA 3GRIA 4QNEA 4AXNA 4IPLA 4UTLA 3ZOAA 2Z7GA 3QF0A 3SUVA 3S9ZA 3GXIA 2QGYA 3P84A 4OECA 2ZUTA 3LERA 5JMUA 1FWFC 3M41A 4QCFA 2C14A 4H41A 3N14A 2ZA3A 3LGDA 4GLEA 4XZ9A 4W8BA 3VOGA 2ZVIA 1HZYA 1E71M 4QJ4B 2D0GA 1AD1A 4UTTC 4OV9A 5AZ0A 2E3ZA 4D6HA 1XIBA 5I79A 4KRTA 2YCJA 2HNEA 2R1MA 3EX4A 3G8RA 3BZGA 2H8ZA 2A0NA 4AIBA 4GYKA 4JTTA 1XCWA 2B81A 4HHLA 1D9EA 2BASA 4RJEA 3GXPA 4DN1A 2XJ7A 3IJIA 4F0HA 3GTIA 5AYIA 5ABFA 3WD3A 4QBXA 1TJRA 4PTMA 1EB3A 3K1DA 3EKGA 4U28A 4XBSA 3QQWA 2PI6A 2W27A 5CBIA 1RY8A 2GDQA 1XCFA 5D04C 3CPRA 1UWTA 4JOMA 1ME8A 2YCIX 2OU4A 1Q4NX 1UR0A 2YCKX 2NQLA 4M1RA 5M1TA 3U2ZA 2FZDA 4LBRA 2GYIA 3R7MA 4LCSA 1R38A 3ME3A 3HBLA 4QSHA 4IPIA 4Q6XA 2GUYA 3R11A 3IWPA 1XRFA 3CUJA 1R5YA 3HMCA 3ZVHA 3UFYA 2PGRA 1JCTA 2HJPA 4MKVA 4H9VA 4NU7A 4ZR8A 4NHVA 1BTCA 2AQVA 2JQXA 3FS2A 2UV8G 3DERA 1NWRA 4NASA 3SY1A 1E1EA 4MM1A 1S2AA 2QJNA 2WZEA 4R33A 2BBFA 3RLGA 1EKOA 4B9YA 1N8FA 5AHNA 4QIUA 3PPGA 3GBEA 3V7PA 3RPDA 2V5DA 3MP3A 2VNCA 1DWFM 4ML9A 1J5TA 3R4IA 3ZVIA 2Z1WA 4FIQA 4ZEPA 1ODZA 2NLYA 3GDLA 1KCKA 4J1OA 5LA2A 1GKQA 3UWEA 2WW5A 4C6LA 3NZRA 3KZSA 2G96A 4UOJA 4QNWA 3S2CA 3MJMA 1XWYA 2PWVA 4YXGA 3HIJA 2WPBA 4LAKA 1XICA 2WOQA 2NXGA 1YDOA 3XISA 1Q45A 3GE7A 5TQLA 4ZE5A 3MWAA 2C91A 2FKPA 2IXUA 1EJUC 4PMZA 2P8BA 4ATWA 3T42A 4DJDD 1BYBA 1QWKA 1T96A 1RJQA 1NP2A 3WLMA 4O53A 3O05A 1M04A 2DQWA 1IYXA 1JG9A 3WD4A 3VNDA 3EKZA 4IMDA 3BICA 3LHVA 3OVGA 4IFOA 2EJ1A 3B0UX 1XW8A 1ZU8A 2AGTA 4UMCA 5FSEC 1HJVA 2ZZ5A 5AC7A 4CQAA 3BAIA 3TONA 3AO0A 5E09A 3PZVA 3ANUA 1XRSA 3P0WA 1GVFA 3DBPA 2PCEA 3OGVA 4UMBA 3B8VA 3TJIA 1UHVA 3E3HA 3CXOA 3H55A 4PMXA 3GH7A 2EF9A 2XIOA 5EMMA 3S5OA 3UT0A 1P43A 3OVPA 4MHBA 5J5RA 3APGA 1DWAM 5AC4A 1A3XA 4BZYA 3V16A 2NQ9A 3VZXA 3APTA 3W2JA 4D72A 3NOYA 2FDSA 3ZJ8A 1UD6A 4REQB 2DEPA 1AQMA 1HGYA 4K2SA 3C0JA 4BQ4A 5A5WA 1U1UA 2A79A 3CMGA 3TQVA 3KAOA 2HPIA 1MDRA 3VX0A 4RNHA 4GJJA 5ABHA 1E5NA 2ZZ7A 4LCQA 1JQVA 4ZO8A 3G0UA 4LALA 5AY7A 4IPJA 1S2WA 1O12A 1CGWA 4K8EA 4IISA 4B3LA 3PG8A 1C8QA 3QV8A 3RAOA 3W7EA 3NPVA 4GUJA 4HCDA 1I0BA 2YPIA 1WKYA 4GOAA 3PR2A 1TVLA 4WGHA 4FXJA 5HK4A 4Z2JA 3UZ5A 1VEPA 1P1MA 1X8FA 2AAMA 5CCZA 1XSKA 2DZVA 1F4AA 2V3FA 3N4FA 2PA6A 2EG7A 5FJIA 3NO3A 4W4QA 4FX7A 2PC4A 4Q7BA 3WUEA 3RM9A 2E6AA 2QMJA 4AWUA 1N8IA 3DG7A 2AL1A 4OGZA 2ZCGA 1AL7A 1DORA 1TG7A 2Z24A 2Z1VA 3KE0A 2I7GA 8CGTA 1YBQB 3B0VC 5HR6A 4DB7A 2V2HA 1QPNA 4AWEA 3N25A 1SGJA 3VUSA 2BG5A 5D03A 4L6DA 2D20A 4Q8WA 3M44A 3GK0A 4D2JA 4BF7A 1WZMA 3PAOA 3R2GA 2ISDA 1UZ1A 4FLQA 4L1XA 3B8UA 4UTHA 5ABGA 3T0DA 3LBMA 4Z1CA 1S1PA 3EX6A 4G7FA 2YBUA 5A8PA 2XHYA 1FWGC 1FHDA 1WAWA 5HNUA 4ZVJA 2OYLA 5FOOA 3KCLA 2QEZA 1BWVA 1DJHA 2V67A 3MBDA 1GEHA 1X7IA 1L9WA 3F4DA 4F0SA 5E70A 4AYSA 1B3XA 2HISA 2RJGA 1Q66A 3GNOA 3KCOA 3S6OA 4W85A 3GIPA 5EMJA 1EWEA 8A3HA 3VFCA 3PNZA 4YTTA 1U5VA 5FJUA 1E56A 2VHLA 3R8RA 3A3HA 3LXBA 4O28A 5AC5A 3ZJ6A 2INFA 2ZUNA 3LDVA 2GZXA 1W1YA 1KV8A 2OVLA 4Q4RA 3HGRA 2Z4GA 3VD4A 3FEMA 1GWJA 3PZMA 4PTDA 1V6YA 5H1WA 3R13A 1J5SA 1K6AA 5EU9A 1UBPC 4XVDA 1SPQA 3GY1A 5BXRA 4X0NA 3GW3A 3VU2A 3SB0A 5A2BA 4O1AA 4LAZA 3S2NA 3SCNA 1XRVA 4M8UA 2IUZA 1XBVA 4JTUA 5CC5A 4RDWA 4DJEC 4J5NA 1LL4A 4B5NA 1UOZA 3EMCA 4CVUA 1EEXA 2WVTA 3B06A 3WQFA 5F1UA 1YIXA 2Z26A 1XD0A 3E2SA 3BG9A 5EL1A 1ZBCA 4QE5A 1Q4WA 5DMMA 4QXIA 3URQA 1ZBVA 2NV2A 1PO9A 3W88A 3DYPA 3RJXA 1WO2A 1J0ZA 2PE4A 3U8GA 3LXCA 4Y96A 5JIPA 4JX4A 1CLVA 1TV4A 2J62A 5EGRA 2QW5A 3WLQA 2NVAA 4DVOA 1YNPA 3PS7A 3PB0A 3BK0A 4I9JA 4ZQCA 1LTDA 2H90A 4TV6A 3V1PA 1AMYA 1W37A 4J3WA 4CN4A 1VCFA 1J9YA 1H1ZA 1PV8A 2X7VA 1VHNA 1JPMA 5KZMA 4HMCA 3PBYA 2D3LA 3HQPA 1O68A 1QI4A 1XUZA 1EYEA 3M0YA 4HNVA 1UJQA 1ZPTA 5C0QA 5C8BB 1FWJC 2G3JA 4UQ9A 1SZNA 4I6VA 4IJBA 5MKGA 4GO9A 2HNHA 3ABXA 1E6PA 2XH2A 4CN6A 3WK1A 5J5DA 4L9XA 1MRAA 4YN5A 3GC5A 4DO6A 2X1RA 1KQZA 4KWWA 3A4XA 1JD9A 1HNYA 1S5TA 3UJSA 1ZUAX 4FLSA 4HTYA 4DNHA 1KRBC 1WCGA 3CC1A 2WLZA 3UU0A 1IEXA 3G5EA 1VFMA 4A8RA 2QPXA 1CGUA 3VKAA 3BAYA