2CZDA

Crystal structure of orotidine 5'-phosphate decarboxylase from pyrococcus horikoshii ot3 at 1.6 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
206
structure length
206
Chain Sequence
MIVLALDVYEGERAIKIAKSVKDYISMIKVNWPLILGSGVDIIRRLKEETGVEIIADLKLADIPNTNRLIARKVFGAGADYVIVHTFVGRDSVMAVKELGEIIMVVEMSHPGALEFINPLTDRFIEVANEIEPFGVIAPGTRPERIGYIRDRLKEGIKILAPGIGAQGGKAKDAVKAGADYIIVGRAIYNAPNPREAAKAIYDEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of orotidine 5'-phosphate decarboxylase from Pyrococcus horikoshii OT3 at 1.6 A resolution
rcsb
source organism Pyrococcus horikoshii
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 73
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2czdA00
2UV8G 1I2NA 1QMLA 3TIMA 1JVNA 4ZQMA 3C3NA 3NQ8A 4UFHA 3NR0A 4O4VA 4NZFA 3FYPA 1FDZA 5AHIA 3OA3A 4OHQA 3MBDA 3G3MA 4JNMA 3P8JA 1KFCA 4LVDA 1IXNA 3LXCA 4NJJA 2ZRZA 3PY2A 3DFNA 3W7QA 3G1FA 2B7QA 2CLMA 4UMAA 5D05A 1XFBA 3OBKA 3G1VA 1VYPX 3UPBA 4IUOA 2FTPA 3BW2A 3LHTA 5F2GA 4GUJA 1OYBA 5K7JA 3N3MA 2DZSA 5EMUA 5D37A 3R13A 1P4CA 1FWNA 3VI2A 1LOSA 4LVFA 4NUWA 3U6WA 4K38A 3N73A 5K9DA 4PH6A 3W1AA 5AB3A 1OJXA 3S1XA 1JCMP 1HFBA 5H91A 4S2BA 4O53A 3WJZA 3W1PA 1M6JA 4C1LA 3LCWA 2B7NA 1R2RA 1H51A 4WOQA 4EF9A 3TSMA 1VHNA 1ICQA 3L0NA 2YFOA 4HIBA 2NUWA 2X1UA 1S5VA 3EXSA 4FXRA 1OYCA 3M44A 3PBYA 5HWMA 1JCLA 4JICA 1GG0A 1P5BA 4H3DA 2QJHA 3RLUA 2F84A 1VCVA 3GXTA 4UTKA 3B0UX 2ZA2A 3P8IA 4WY0F 4CNOA 3KVLA 2FB2A 1TPB1 2ZZ4A 1O95A 2RDTA 3W2UA 4MLJA 5LSMA 5AYZA 3UWUA 2EPHA 1G67A 1L9WA 4JIPA 4FXSA 6ALDA 2OT0A 4U4MA 3NZRA 1QWGA 3MBFA 3R8RA 5CPLA 1K3UA 3W76A 1HUVA 1C29A 3PF3A 3KX6A 4E0CA 3BGGA 3V1PA 3ABQA 5BOOA 1F6PA 1SPQA 3L2IA 2JKAA 3NQ2A 3W7CA 4BR1A 2JKPA 1PCKA 2V5BA 4FX6M 3LHUA 4RXGA 4K6AA 1X8FA 2F7FA 4O10A 1PCWA 5G5IA 3Q94A 4N9DA 4FNQA 1ADOA 4ZMGA 1VYRA 2NZLA 2OT1A 4ADUA 4JTKA 1OK6A 1LTDA 4YCOA 5HWJA 4IMCA 3IIZA 2H90A 1XUUA 1A50A 1KFKA 1LZOA 3P61A 3L5MA 1FWWA 1MSSA 1WBJA 1OHLA 3W75A 3O6CA 3W87A 3NPUA 4HT3A 4OT7A 3S5YA 1NF0A 3TXZA 2PURA 2DZXA 4RZ4A 3TKFA 5LNUA 5AYYA 3QPYA 1ME7A 4Z1AA 1LCOA 3G1AA 2QCLA 4R7JA 1OF8A 1QO5A 3KVMA 2VXNA 4PL1A 1FX6A 3VE7A 1OFBA 1LYXA 5FEWA 1B57A 1PV8A 1VJIA 5K9XA 4GJ1A 4O50A 3W23A 2R8WA 3RU6A 3SECA 4IOTA 3TSDA 4LV4A 3SSJA 1SO6A 5LNVA 1WBHA 1JCYA 3ZS4A 3W3OA 1LOLA 4DBEA 3NPVA 3MI6A 3W22A 2E6YA 3QW3A 1GQNA 3NO5A 5LNSA 1THFD 4LS2A 4FNRA 4M19A 3TW7A 3ATYA 3NL3A 3LB0A 3DKJA 1AK5A 3NA8A 1IXQA 3DI0A 4MY8A 3PS7A 4LS0A 1YYAA 2ABAA 4O54A 1H60A 5AC7A 3B8DA 3LHWA 2A4AA 5FESA 2QJIA 2GJNA 3BLEA 4O1CA 3ZFHA 3Q37A 2NWSA 4LVAA 5AHMA 3HGSA 1UJPA 4EOUA 1LBMA 3SI9A 4WJEA 3I68A 2YFNA 4QNWA 1QCWA 2HSAA 4LS1A 4OGZA 3CEPA 2C14A 1G6CA 5I3IA 3B04A 3BLFA 1W31A 3BG3A 3CM4A 5J5DA 1S5WA 1KM6A 4AB4A 4XWUA 4AMAA 1F73A 1TPEA 5CGQA 3LV6A 3AO0A 2Z6JA 1SZGA 3LM7A 1SZFA 1AG1O 2DJXA 3GAKA 1D3HA 2O7SA 4MLRA 1A5AA 2TPSA 4X3ZA 5G4EA 3U2OA 5F4WA 4AHPA 4GC4A 3LCIA 3GYEA 3MHGA 1CW2A 2E5CA 4LVBA 3HMJG 3I7QA 3TA6A 5TBOA 3O6DA 4Q4KA 3QEZA 3BV4A 5T26A 3INPA 1M5WA 4Z1DA 1Q6LA 4RZ5A 1KFBA 5CZSA 3DAQA 1IGSA 1HL2A 1KFJA 4LY8A 4RLIA 5EYWA 1YDNA 3O6YX 3UWQA 4BWLC 1IF2A 4YCPA 3NM1A 4O15A 3MP4A 3A9IA 3NG3A 3TW6A 3EXTA 1I4NA 3M5VA 4XKYB 3W7OA 1W3TA 2Q3OA 3MHUA 4RK8A 3W73A 3EWBX 5SWUA 2G97A 3ABSA 2OX1A 1PVNA 4UR7A 3YPIA 4GUIA 3N19B 1XBZA 2YX0A 5G2IA 3WK1A 2YXGA 1X1ZA 2NXIA 4DO4A 3FKRA 4WY0A 3PM6A 1JRBA 3C2FA 2PRHA 2H6RA 2PRMA 2Y62A 2TYSA 1F2JA 4HNUA 3N14A 2NX3A 1DL3A 3BLIA 4OU1A 2E68A 1EEPA 1K03A 3W7EA 3HJZA 5D2XA 1TQXA 5D2WA 4GBUA 2EKCA 1GPWA 4WD0A 2QAFA 4JY9A 2Y89A 3MP3A 3TQKA 1F7BA 4FX8A 3DH7A 4CNPA 1HO1A 1IIGA 3MO7A 4L4MA 1JRCA 3OHIA 2CZDA 2YDAA 3MYPA 1GYLA 4O28A 4CCCA 3HG2A 2QR6A 3OEXA 3SY5A 4BK9A 1V7YA 3NXFA 2FPTA 3CIXA 1VR6A 1FCVA 1L2UA 1LBLA 1SO3A 3G1XA 1QPRA 2BSLA 1SW3A 4JTJA 3GDTA 4GFSA 2AGKA 3LOTA 3TSBA 1ML1A 1UUOA 2Y7EA 2D73A 1TPUA 3E49A 4UNLA 3PULA 4MFDA 3LRLA 2QCHA 4RJEA 1WV2A 5C6MA 3L21A 5C5YA 4N02A 3DFSA 1LP6A 3K30A 1IIHA 3DHDA 2ABBA 3KRSA 1DORA 2QF7A 2A7NA 4Q33A 5LHFA 4RR4A 4QITA 5E0KA 4HNTA 1R47A 3PBUA 4N9EA 4XKYA 1QPOA 2GQ9A 3LLFA 3C6CA 1W5NA 4S2CA 2OZ0A 2QCCA 5EKYA 4E38A 3B0PA 1L6SA 3R2GA 4IX2A 1EA0A 1GVFA 3OVQA 4UTWA 3T78A 3PBVA 3I7RA 5CSRA 3M7WA 1NEYA 3SFKA 1BKSA 3W7HA 1ZAJA 1YTEA 1FQ0A 2A5HA 2EGZA 2RDWA 3D0CA 2WO5A 5HQEA 4ML9A 1S3HA 3KHJA 1N7KA 2CZFA 2CLIA 4IXXA 3O8AA 2FB3A 1ALDA 2E09A 3LDVA 3EKZA 1K8YA 3MWAA 2B7PA 1JUKA 1OX5A 1YTKA 1WOBA 5BMWA 3FKKA 1A5SA 4UTWC 5DCBA 3KRUA 3NQFA 1DJNA 1OFQA 1TPFA 4Q32A 3STFA 1KFEA 4K37A 3HG4A 4O1BA 3IIOA 4NVTA 4K8EA 3P62A 5U4NA 1W8SA 1AMKA 2ZZ6A 2C15A 4W9TA 2ZRVA 4O0KA 5KZDA 1O5KA 5DY2A 3MJYA 4P2VA 5HWNA 2X1SA 1XBYA 2OJPA 2P0OA 4BI5A 2X1TA 4K7VA 4NT0A 2VFIA 2DZVA 5HMSA 3SJ3A 2WSYA 1OK4A 2ZBTA 4IJBA 8TIMA 2R14A 3NDOA 1KM0A 4KWVA 4PC8A 4YXGA 1KLYA 1SQ7A 2A0NA 3IGXA 1ICSA 3DFQA 1TPVA 2DZTA 3GB6A 2ZZ7A 2ZTJA 3A22A 3MYOA 1Y0EA 2E6FA 5EY5A 1F6KA 5L9FA 1FWRA 4DPQA 3PBWA 5CPOA 3FA5A 2HS6A 1YDVA 3TDFA 2CLEA 1B3OA 3FYOA 5L6UA 1KM4A 1XI3A 3I65A 3NQMA 3DZ1A 1XBVA 1XDMA 1TMHA 2BXVA 1EP1A 2ISVA 1KFLA 3W1XA 4PTNA 3QMRA 4PFMA 1DOSA 4MKNA 2CZEA 4FIQA 3HGOA 4NNBA 3RLVA 1QPNA 3FLUA 3G0SA 2GJLA 3PR2A 2V9DA 2OCZA 1XM3A 1TREA 1JUEA 4QISA 5IBXC 3G0UA 2HMCA 2QCNA 1XUZA 3FS2A 2CLHA 3LLDA 3NL5A 4UXDA 5F1VA 1Z41A 2NX9A 4M7TA 1VCGA 1I2OA 3GXPA 1KTCA 3F03K 3CWNA 2W0UA 4X22A 3HG5A 3C8FA 4S1FA 5AHFA 1H62A 1YXDA 1LRTA 3DBPA 3QJAA 1GVRA 3C2EA 5DN1A 1H1YA 1TB3A 3W7JA 3QZEA 2ZA3A 1T96A 1DBTA 3N9SA 4RXFA 3TFXA 3TFCA 1VRDA 2I9EA 3LERA 1EPXA 2C6QA 4QNEA 1XXXA 4OV4A 1F05A 4R34A 4WXYA 3SZ8A 1KM3A 3NQAA 1T8XA 3BK0A 3TMLA 5I3JA 3W74A 3O07A 2VC6A 2NXHA 3BARA 5E1QA 1DKWA 2WSQA 3UWVA 1QOQA 4HPXA 3UNDA 3QYQA 1YADA 1UB3A 1FWTA 1OFPA 3FJ6A 1TSIA 2P1FA 4UTIA 4ZQOA 3U8GA 1YPFA 2I1OA 3C52A 3E9AA 2GQAA 4A22A 2YPIA 1FBAA 3W7LA 1H7OA 3RK8A 4CQ9A 3UY8A 2VENA 1M7OA 1SSDA 1ZAHA 3STCA 5KTLA 2WOQA 2TRSA 1EP2A 3W7KA 3PUOA 1LRNA 3LHZA 3N34A 5LNWA 3QQ0A 3UZ5A 3QH2A 4JIQA 1SO4A 4D2JA 4FB7A 2Q3RA 5C2XA 5K4XA 1RQHA 4ZQRA 4FO4A 1VS1A 1UBSA 3SGZA 4CNNA 1LM1A 1KV8A 4MJZA 4HN4A 1Z44A 4LC6A 3HGRA 1S5TA 2W79A 1F74A 3T44A 4MFEA 3W1RA 1ZFJA 5KZMA 1FCQA 4IMEA 3DHFA 4JTSA 2LLEA 3M5ZA 1VC4A 3PG8A 2VFGA 3W85A 5DY3A 3E0IA 1WDWA 1SZEA 2QCMA 4H6KA 1H7RA 4JTUA 4IXHA 5KSWA 2GOUA 1SSGA 4AF0B 3LXAA 4TMCA 3CEUA 2QCEA 1GVSA 4OV9A 1J2WA 3G18A 4R53A 3JRKA 3O63A 2YW3A 4KFNA 3C0JA 4O16A 2PRLA 1TRIA 2Z2UA 3IVUA 2RHGA 3E12A 4LTSA 4Z08A 3DI1A 3UD6A 1KBIA 2ZZ3A 5AOUA 4DELA 5FF3A 1TTIA 1R30A 1W5MA 4O0ZA 3GDRA 3L5AA 3VKJA 1C9DA 3NQ6A 4Z1CA 4YL2A 3OVPA 3CWOX 3M5YA 4JTIA 3CLMA 3ZWTA 3TCEA 3WK0A 3G8EA 3W2NA 2ZRUA 2NX1A 4WQ6A 2P10A 2V81A 1NF7A 4CQ8A 1FXPA 4MZYA 2QKFA 3IIVA 3IRDA 1HTIA 4IPJA 1TV8A 2Y7GA 5KZEA 4NNAA 2H8XA 3KRZA 3LI1A 3WFAA 1AW5A 4BI6A 3T7VA 4GXMA 3F1QA 5AHNA 4JDYA 5CSSA 3L9CA 3GAYA 5C54A 2BZNA 4AVFA 5D04C 2GVJA 2B0MA 1JUBA 1ZHAA 5BRBA 1H5YA 2J9XA 3VE9A 2QUVA 3TUUA 1GTEA 1KLZA 2Q8LA 3M16A 2X2GA 2X16A 3IGUA 3LI0A 1D3GA 3QM3A 1I2RA 5DBUA 1TYGA 5FF4A 1UASA 4OQVA 4IX0A 1AW2A 4GE8A 1QAPA 1ONRA 2VFDA 1XBXA 3L65A 4WX2A 3NL2A 3CT7A 1YXCA 1KV5A 3HGJA 5E93A 5TQLA 1OX6A 3QMSA 1OVDA 4TR9A 1P0KA 1Q45A 3S5ZA 1LLZA 2ZRYA 5D32A 3P67A 3L5LA 3W1TA 1VHCA 1OFRA 4AF0A 1W5OA 1SZNA 3C2OA 1LROA 5LGZA 1MXSA 1OFAA 1TTJA 1YXYA 1WA3A 5DBTA 3O16A 3FFSA 3S6DA 1TTQA 2WPBA 3W86A 1WXJA 1OFEA 3NL6A 3EX6A 2A2IA 4NX5A 3PG9A 4NU7A 5D2TA 3LHYA 3W88A 2C1HA 5EL1A 2XN0A 3BO9A 4UTMA 1TIMA 3KAOA 3LGEA 3H55A 5FF0A 1EIXA 1R2SA 4ORIA 5D30A 1NAL1 2YGYA 4NXSA 5HJLA 1Z42A 4J9JA 5G1TA 2NUXA 4N9CA 2A6NA 4UFMA 3M47A 2IQTA 3B05A 3RFAA 3PVFA 1I2QA 2J9YA 4JEQA 2ZZ5A 4LW7A 2FPVA 4IPIA 3UWZA 1SUXA 5DXYA 3P81A 4UFJA 2A7RA 4K39A 2WNZA 3UWYA 4X2RA 1O94A 3LTYA 1RPXA 3TX9A 3HIJA 4N9BA 2EF9A 4UUIA 5CZ0A 4O13A 3UZJA 3PSWA 3TV8A 2WQPA 2DP3A 5BW6A 1G4PA 3CTLA 1TTPA 4XTDA 2Y85A 4GNJA 2GUUA 3A24A 3NQCA 3TH6A 4DF0A 2YYTA 4QSHA 2DU2A 1G7UA 5D03A 2ATSA 5I3KA 3SR7A 3SIZA 3M0ZA 1M7PA 3S0CA 4HSOA 3W6YA 3G1YA 2CZ5A 4UTHA 2E6DA 3W2MA 4Z0SA 2ALDA 5D2YA 3W7PA 5K3VA 1FCUA 5A8GA 1G4TA 5HNRA 4O18A 3QQ1A 3KVJA 4IWWA 1AL7A 4IGHA 3THAA 1FY6A 2E77A 3LTPA 4ADSA 2PC4A 4FX7A 2XN1A 4MY1A 2J88A 2R94A 4Z0JA 3NYZA 1EUAA 2QDHA 1KTBA 1XKYA 3O06A 2G96A 2VELA 4O57A 4MZ8A 3BVJA 3TK7A 1OFOA 3CQ0A 4UNKA 3S9YA 3L67A 1ZJIA 3NPWA 1W0MA 2V0TA 1UCWA 2CU0A 4YLWA 3IVSA 1FCBA 4C1KA 3UWWA 2FLIA 3NAVA 3TE9A 3P84A 3NQ7A 1VH7A 4DQWA 3BW3A 1Z48A 5D02A 3GIYA 3G0XA 1H1ZA 1H50A 1JJKA 4POCA 3PWAA 3W1LA 3P82A 2ZRWA 3S1VA 2KZHA 4DF1A 3KXQA 3FOKA 1JCJA 1R46A 4UTJA 2G5WA 5A5WA 1JR1A 4N6FA 5EBUA 1KM2A 4WOZA 1JCXA 3WJWA 4WUIA 3G1DA 4JDBA 3DFPA 2CWNA 1D9EA 4ADTA 2NWRA 1ZCOA 3G1HA 2VEIA 2VFFA 2Y88A 2JK2A 1XCFA 2YW4A 4E2DA 1ZAIA 5AC8A 2C18A 1DV7A 4QQ3A 5K4ZA 3S42A 4JD4A 4XUGA 5LNRA 3LCGA 3S1WA 2AAMA 4HSNA 3WJYA 3A5FA 1QFEA 5F2MA 4DBDA 3LCLA 1F5ZA 4WZHA 1LDCA 2PCQA 3OG3A 2DORA 4NJIA 3A23A 1H7WA 4JS3A 1EP3A 4JY8A 2C16A 1GYNA 4UR8A 1B4KA 4JTFA 3UQNA 3C61A 2BX7A 1RQEA 3DXIA 3THQA 3EX3A 4X9SA 3TROA 5G4WA 4ZVJA 3QFEA 4UTTA 3SGUA 5DCDA 4WXZA 3G3DA 4UCGA 2AQWA 3ABRA 3C2RA 3CU2A 4FIRA 3R89A 3W1QA 5I3HA 4OE7A 3PB0A 3W7DA 1PL9A 1GWJA 2ZZ1A 4ZL1A 4UMBA 1KM1A 1MEHA 2DJLA 3WK2A 7TIMA 1VLWA 1OABA 2WNNA 3MUXA 3KOFA 3OIXA 4O52A 5FF2A 4TIMA 1E51A 4FNUA 5LGXA 3LTSA 4Y96A 1DJQA 1O5XA 3MI3A 3W84A 5HULA 1F76A 1W56A 3TQVA 3JS3A 1TPDA 5F1UA 3TMQA 4LUIA 3GDLA 3W83A 4JX6A 3T55A 3W7MA 3M5XA 1TRDA 5D2VA 3EXRA 4ONVA 1G69A 2J9ZA 4RX0A 3R5EA 4FNSA 3P5YA 1WYIA 2R91A 2RH9A 4RKAA 1GT8A 2VOMA 3HG3A 4MOZA 1VGAA 1N8FA 3M43A 2Z1BA 1AL8A 3ELFA 3L68A 1RZMA 1X1OA 1RD5A 2CLLA 1W3IA 4JTTA 4M6PA 5KINA 1EWEA 2DZUA 3W7RA 4ORMA 1SFLA 2FDSA 3NVTA 4N6EA 2V8ZA 4G1KA 3FIGA 3MHFA 3W72A 2H3BA 3C2VA 4MVAA 5EA9A 4O4WA 1EUNA 3NOEA 4AWTA 4P61A 5MHBA 4Y90A 3MW7A 4KFOA 4EF8A 4JYDA 1QO2A 4MPQA 3EKLA 3QSTA 4JXCA 1NVMA 4XBKA 4NXKA 3RF9A 3S1UA 3DFOA 4XQ6A 3IIXA 4HPJA 3O05A 2ZZ2A 1GZGA 4AH7A 5BMXA 3GDKA 1XC4A 4N4PA 1H7XA 4XZ9A 1EX5A 4GUFA 3IGSA 3QPZA 3I7SA 1U83A 5HR7A 3IVTA 2WKJA 4MYXA 4HNNA 1B4EA 1H61A 1L6YA 3ATZA 4JTEA 4TO8A 4ZQPA 1A5BA 3G8RA 4IMDA 1CX9A 1WQ5A 3QF0A 3G24A 2QCGA 4MZ1A 1QR7A 4L4LA 3GKAA 3W2LA 5IM51 1MZHA 1N55A 2ZCGA 2YSWA 1PHQA 2DZWA 2V2HA 2YCEA 3DENA 3IEBA 4XTIA 3MP5A 3B03A 2ZQ0A 3N2XA 2RFGA 3CPRA 4Y9AA 4Y6GA 3W1NA 2VEKA 4A29A 3TU9A 4O17A 1X6UA 1FXQA 4KFPA 3TC7A 3GZ3A 5LKYA 3MMTA 1MEWA 1NSJA 4LC8A 1ME9A 3TJXA 3HOJA 2X1RA 3TAOA 3HB9A 5LHEA 2ISSA 2QCDA 4O12A 4HNVA 1VYSX 1I2PA 4DO6A 3UXAA 2CFFA 3NQDA 2NUYA 2Y7FA 1GOXA 3C4UA 5IBXA 1C8VA 3W7NA 3B4UA 2I14A 1A5CA 3QRHA 2Q8ZA 1PIIA 5FEXA 1EB3A 2Y63A 5U7SA 2HTMA 3W70A 1PHWA 4I7UA 4A2RA 4UTLA 3LRKA 2H3DA 1U5JA 3LBCA 3W7IA 2VFHA 1JCNA 3P60A 1GJPA 3PAJA 3KFTA 4LNYA 1FDJA 4ZZ9A 1X7FA 4I7VA 4JX5A 4K8HA 3P5ZA 1LOQA 3AJXA 4UTTC 3NQEA 1FUYA 3LRMA 1TV7A 2VKZG 4FNTA 4QIUA 3EEGA 1RVGA 3EX4A 2WNQA 2W6RA 4MY9A 2TMDA 1MO0A 4RCXA 5LZLA 3S5OA 4LV9A 6TIMA 1YPIA 4A2SA 1Q6OA 4O11A 1KA9F 3WJXA 5DXXA 5F2LA 4JTGA 2FPYA 2GVLA 3W1MA 2BLEA 1I8JA 3M1ZA 4AWUA 4UTUA 3B0VC 3DKLA 1DQWA 1LRQA 2FFCA 3GKFA 3BG5A 3L0GA 1W37A 1OG0A 4UMCA 4LOCA 3EB2A 4MJMA 3ABOA 4PL2A 4GUGA 5FEZA 4PA8A 1H7NA 4LU0A 1P1XA 3T40A 3C56A 3A21A 4ALDA 2ZDRA 1BTMA 5CKSA 4AHQA 3GVGA 1H63A 1TJRA 4M6QA 5HR6A 4DXVA 1K7FA 4AXKA 1O60A 1SU5A 2Y7DA 1PE1A 3CB8A 1KW1A 1GVQA 2VEMA 3BW4A 2CW6A 3FEMA 3NNTA 3GR7A 1QDSA 3E02A 2QJGA 3NQGA 2CLOA 5HINA 5KITA 3NGJA 3P74A 1G7VA 1K7EA 4E2BA 4JX4A 1WOAA 2Y6ZA 3FJLA 3GK0A 2Y61A 3JR2A 2V82A 4JTLA 1SW7A 3VNDA 4AHOA 4JGDA 1RR2A 3BG9A 3PUEA 2ISWA 3KVKA 4RV8A 3N2MA 3F4WA 4EVZA 3W2KA 4HKPA 4O19A 3ZWSA 3PC0A 4NX0A 4IMGA 1I45A 3TR2A 1ZNNA 2Z0IA 4JYFA 1T99A 1KTNA 4FEZA 4BI7A 3GLCA 3TJLA 3NEVA 1IXPA 3NPXA 4BWLA 3L66A 1FDYA 4K36A 5KMYA 3LXBA 3VCRA 4LT9A 1KBJA 2WSRA 4I7WA 3S8HA 1QPQA 4AAJA 3H53A 3PB2A 1FWSA 3BPWA 3STGA 2J6XA 2TSYA 1RV8A 5D33A 3HPZA 2V2DA 3HF3A 4RZ6A 1B9BA 1HO4A 1ME8A 1GEQA 1VQTA 4JTHA 5AFDA 4H4IA 3USBA 5CPNA 5AYXA 4NQ1A 3TAKA 5AHEA 4ICNA 1Q6QA 1T0OA 2QUTA 1Q3NA 3Q2DA 4O1AA 1NFBA 4CLMA 4QAIA 5H2ZA 4IMFA 1SFJA 1OFDA 1OYAA 1JULA 2QAPA 3GR8A 4NJHA 3H54A 2JGQA 3QC3A 1J5TA 2ZA1A 3RMJA 2CLKA 1G4SA 1KM5A 1R2TA 3P7YA 1W54A 1CI1A 3GX9A 4LUJA 3NZ1A 4CCDA 4N2YA 4DO5A 2QUUA 2YZRA 2ZTKA 3NQVA 3W07A 3GNDA 5FF7A 3N9RA 1O4UA 4GWEA 4I9AA 4WY0B 3Q58A 1TV5A 2J24A 1TPC1 1IXOA 1LBFA 4MUZA 4A3UA 3IIPA 5HUOA 3I6RA 1VCFA 5BNKA 5I3FA 2A21A 5J5RA 4PODA 2XN2A 1MEIA 4TU1A 5G2WA 1GG1A 4A21A 3LBMA 5K9CA 1TJPA 3G22A 3QW4B 2E1DA 1VPXA 1K02A 4O8RA 4FF7A 3TQ0A 4ZQCA 1L6WA 3UYCA 3GXNA 4R33A 1P0NA 4JR5A 4KWWA 2XFWA 1ZALA 2E6AA 1ZENA 3ZR4A 2RDUA 1SW0A 2V5LA 4XBSA 3TNOA 3EWUA 4LRSA 1BWLA 4UFKA 3TXVA 3EWYA 4CQAA 2J27A 1TPWA 3HPXA 2A1YA 1W5QA 3HO8A 4BF9A 2NV1A 3WK3A 4UIOA 5AHLA 4GRSA 5CZJA 1SR9A 4DEFA 1K8XA 4DF2A 1XDLA 4OWGA 1LORA 4NNCA 5DLCA 4ZQNA 5EPDA 5K2ZA 1OX4B 2WJZA 3S5NA 3W7GA 3CC1A 4TMBA 3EWXA 4UFLA 1J4EA 5CPMA 3EWZA 1XL9A 3PUDA 2FQIA 2VEPA 1BEUA 5GVJA 2ZYFA 2V2CA 1AW1A 2NV2A 5F2IA 1YDOA 1JQVA 3E96A 3DU0A 2QDGA 4IQLA 5TIMA 2ZFAA 4B5NA 2O7QA 1RQBA 2B7OA 5C55A 2JKEA 3G1SA 1TQJA 2EHHA 2A85A 2GVGA 4O14A 5I3GA 4UC5A 5ABTA 4QJ1A 3M9YA 4M6VA 4PCFA 1H7PA 1YTDA 3DFTA 3EX1A 3UY7A 3M6YA 2B4GA 5AC6A 5HUPA 2A6LA 3B06A 1G4EA 4KKXA 2CLFA 1TPH1 3GNNA 4FHAA 3HBLA 4PEKA 3ANYA 3F4NA 4M5PA 5FI8A 2EAWA 2JBMA 3NM3A 3R12A 2GQ8A 2GPTA 2ATMA 1GTHA 4N4QA 4EWND 3UXDA 4JN6A 2OMAA 2NXGA 3L0KA 3PSVA 4HHPA 2BTMA 5CZTA 1TO3A 3OVRA 4MIMA 2HS8A 1QNVA 3LHVA 4AEOA 3O15A 2C13A 1EWDA 3O1NA 3QMTA 3RNDA 4K7YA 1ICPA 4OBTA 5CG7A 5DELA 3BGJA 1W1ZA 2FIQA 2H8ZA 2G95A 3EX2A 2JGYA 3LCFA 3W9ZA 1K8ZA 3W2JA 4O1DA 4M7SA 1GVOA 1JQXA 3P80A 4MYAA 1OX4A 2C19A 1LLWA 2QCDB 5D38A 3IV3A 2QCFA 3TC6A 1QOPA 1W5PA 2ZRXA 4YWIA 5G1YA 5F4XA 2YYUA 4Y8FA 3W71A 1WX0A 2PE4A 3CHVA 5F4SA 1VZWA 2E5BA 1DQXA 3V75A 3CIWA 1Q6RA 2X30A 2NLIA 4QM1A 1HG3A 5AN7A 4FNPA 4AWSA 3STEA 3UPWA 1DVJA 2RKXA 2C3ZA 1SO5A 2QEZA 1V5XA 2Z6IA 3M41A 1WAUA 3WJSA 4LVGA 3VFLA 2WV8A 4YMZA 4JYEA 4EIVA 1UUMA 3LV5A 1VLIA 5FEPA 2V30A 1ZY9A 4Z1BA 3LCHA 2A7PA 3EWWA 4U28A 3T4CA 2VFEA 2C0AA 3LCXA 3W1UA 3DGRA 2Y70A 4LRTA 3HQ1A 4NJKA 1W3NA 3HPSA 1OF6A 4NJGA 2YR1A 3LX9A 2BWGA 1K7XA 4CCEA 2DZPA 1DHPA 4GUHA 3QSRA 1PS9A 3GDMA 4UFIA 3A5VA 3MI2A 4TX9A 4BFAA 5D09A 1BWKA 2E5DA 1YLVA 4NZJA 5G2HA 1TCDA 2FJKA 3SW6A 4LWWA 4DPPA 5DCEA 1A53A
chains in the Genus database with same CATH superfamily
2FMNA 1QMLA 4AZ7A 2YA1A 4AZ6A 1CPUA 3NQ8A 3NR0A 1VPYA 2HK1A 4NZFA 1FDZA 2PD9A 3OA3A 5AHIA 4OHQA 5HDRA 3G3MA 5HMDA 3GFXA 1DHKA 4LVDA 2IQ0A 3S9ZA 2XUCA 3L4UA 4Y9PA 3UJEA 2CLMA 2DW7A 4A6GA 3OBKA 3G1VA 3UESA 1BVZA 1VYPX 1XWYA 4IUOA 1POJA 5A6MA 1E6SM 4S3CA 1XRSA 2DT2A 4NKCA 3D47A 3LHTA 4QEEA 4GUJA 4LCQA 3CYVA 5K7JA 3PP7A 5EMUA 2J7FA 4MJ4A 1S5MA 4AFYA 4L6OA 1P4CA 1FWNA 2XM2A 3U6WA 1TWSA 3N73A 2WVTA 3CXOA 1V77A 4KMQA 4YTTA 1HFBA 3F4DA 1S2VA 2GQ3A 4FALA 3KBJA 1Q6EA 1ZUAX 5I5RA 3LCWA 1R2RA 1E71M 3UR8A 4C6BA 7PTDA 1S1PA 3B3DA 2NUWA 1CZ1A 1H5VA 1S5VA 1V0LA 3OG2A 5BXPA 2FHCA 4FXRA 3M44A 3PK7A 4HMCA 4JICA 3BAYA 4F2BA 1EGMA 4B5XA 3THUA 5AC4A 1QT1A 3SN1A 1HN1A 3EDDA 2ZA2A 1U5HA 5LA0A 1T41A 4WY0F 3GR4A 3KVLA 2YLAA 4M3PA 1TPB1 4NHVA 2W91A 4Z1YA 2DSUA 1NP0A 2EPHA 2Y8KA 3BJFA 3WNKA 5DEZA 1Q7QA 2VGIA 3IJIA 2OT0A 1QWGA 2E1WA 3MBFA 3R8RA 1JZ3A 4PR4A 2XU2A 3PF3A 3B8IA 1EKOA 2JKAA 3NQ2A 3P2VA 1W1PA 4KT2A 4M6UA 1OZMA 4AC7C 5G5IA 3Q94A 1DJYA 1UKOA 1AJ0A 4FNQA 1ADOA 4FLQA 4GK8A 1NDZA 5JIPA 3CPUA 1H0IA 3TJ4A 3CHFA 3TVAA 3CUFA 4IGSA 4D6DA 4Z2GA 4HPNA 1KFKA 2WVVA 5BYWA 1PX4A 2Y1HA 4GQGA 1FWWA 3K46A 3WLOA 1OHLA 3W75A 2PDJA 3QR3A 4HT3A 3OBEA 4M51A 3GC5A 3PN8A 3TKFA 1TA3B 5LNUA 1PKYA 2OZ8A 1LQAA 2GDUA 2QCLA 4R7JA 3KVMA 3U48A 1Z3NA 3VE7A 1OFBA 1LYXA 2POTA 4GY0A 1B57A 1PV8A 3AC0A 1OBAA 3ZJ8A 2CWXA 3B9EA 3WQVA 3SECA 4IOTA 3WNMA 1OY0A 3TSDA 1FFQA 3ZS4A 4DBEA 3MI6A 3WD2A 4G9PA 1U5VA 1A3XA 3BLOA 1NP2A 1U30A 1M7XA 1SJAA 1AK5A 1HXJA 3T9PA 4O54A 2EKGA 3B8DA 1RAKA 4WDXA 3LBOA 2YXXA 4DJDC 2A4AA 2FVKA 5FESA 5CGMA 3VGDA 2GJNA 3BLEA 1KRMA 3R8GA 1JGIA 2NWSA 4LVAA 3WMSA 3HGSA 2KX9A 2UZ9A 3ZLHA 5CC3A 2D2JA 2I5QA 4F79A 5BOEA 4OGZA 1M68A 3W24A 2C14A 5I3IA 3WYZA 2R1PA 4PCPA 1ZJHA 3LV6A 2Z6JA 5HOSA 5HQMA 1A5AA 2TPSA 5A6LA 3TYBA 5G4EA 4P8XA 5F4WA 4AHPA 2BY3A 2PDMA 3GYEA 1B3XA 3MHGA 1CW2A 2WHMA 2E5CA 1L6FA 3I7QA 5DMMA 5TBOA 3KBVA 1YNPA 3QEZA 5T26A 1Q7ZA 3INPA 1M5WA 2FZ8A 3E5PA 4Z1DA 4RZ5A 1Q13A 4JIIX 2Z25A 3VGGA 2HV5A 4E8CA 3CBWA 4YTQA 3U57A 2E3ZA 3EKGA 4WKAA 3GBEA 4ECLA 1DTUA 4BQ4A 4KGLA 2WJFA 4O15A 4R9OA 2P8BA 1A0EA 3EXTA 1I4NA 3QV9A 4YN5A 3O2LA 1CEOA 4JQ2A 2W62A 1HW6A 3K4WA 2G97A 3CO4A 1EBGA 4MWAC 4B2DA 2JF7A 2VP8A 3N19B 1FHDA 2CKRA 1E1EA 3CYJA 4IQEA 3MV01 4V15A 3PM6A 1UR1A 4F0KA 1DL3A 3WNPA 4GNVA 5T91A 1K03A 3W7EA 5D2XA 1TQXA 4GBUA 1B3ZA 2FTYA 1GPWA 1W1A1 3VNKA 3QV7A 3I4KA 3MP3A 1UJQA 1HO1A 2ZADA 3LK6A 2CZDA 1GYLA 3CV6A 4O28A 3HG2A 2QR6A 3E1F1 3SY5A 2F8QA 1B3WA 4FSAA 2WPGA 4AZGA 1LBLA 2PB1A 4KCUA 1SO3A 1QPRA 4IMAA 5GQBA 2BSLA 1QXLA 1YPXA 2AGKA 2J79A 4Q8UA 1YX1A 1ML1A 5EGRA 4LBSA 3W4RA 3SADA 2XHYA 4UNLA 4LGXA 3PULA 3AI0A 1WV2A 2QS8A 4KGJA 3L21A 2VCBA 3VNZA 3FJ4A 2MNRA 3K30A 3DHDA 5LHFA 2NQZA 2PTYA 3L4VA 3SSZA 4Q7BA 1OINA 3G1RA 3BJTA 4A8LA 2AQVA 4B92A 3WQ6A 4DJEC 1XG4A 4E38A 1M04A 3TLLA 1FH7A 3OU8A 2OQYA 4F8XA 4GY7A 2BOFX 1EA0A 3DESA 3ARWA 3OVQA 3T78A 3PBVA 5CSRA 4JZ5A 1NEYA 3P93A 1HJWA 5HPOA 3HQOA 2WMKA 1BKSA 2RAGA 3DG6A 1YTEA 2EGZA 2A3AA 2RDWA 4L9YA 4Z17A 3GIQA 1S3HA 1V6UA 4I6KA 4GMEA 4AU0A 2CLIA 4ROPA 3V0UA 4W84A 3GNXA 1ALDA 4PTMA 1M9HA 1OX5A 1EJTC 4NY2A 4H9UA 4A4AA 2BODX 4LFYA 1CXFA 4XG1A 3GZAA 2ICSA 4YYFA 1M3UA 3R4IA 4CD6A 4YHEA 2CNCA 4Q32A 3STFA 2PDNA 5KETA 7XIMA 3N12A 1U1UA 4PRTA 4ACZB 4YU1A 1W3LA 3H2FA 4O0KA 3RPMA 1EYWA 1JF6A 1EC8A 5KZDA 2UY5A 3UXKA 3V18A 3HFTA 1XLCA 2CHNA 2PWEA 2X1SA 4GQQA 1XBYA 2P0OA 2X1TA 4NT0A 4TUFA 4TVUA 3L4TA 5HMSA 3SJ3A 2WSYA 3T42A 1Y5XA 1KM0A 1KLYA 1SQ7A 3FSTA 4LCSA 1GORA 1LJYA 1W1VA 2Y5JA 3HFYA 3DFQA 3Q65A 2ZZ7A 1I75A 2YOCA 3A22A 3MYOA 2E6FA 1BQGA 1JD7A 1N8IA 3TTSA 3FA5A 5CEWA 1VFOA 5EMJA 2CLEA 2IUZA 4HSHA 4GO8A 3WDRA 3FYOA 1KM4A 1XI3A 1KBLA 1XDMA 2BXVA 1EP1A 3AZTA 1KFLA 4HZ8A 4MM1A 3ITLA 7TAAA 1DOSA 2CZEA 3QGAC 4E3TA 4D6HA 2P53A 1QPNA 5ABHA 1VBGA 4LUTA 4I90A 1UC5A 2Y24A 4N0RA 3GU2A 1VP5A 3PR2A 1KNWA 1PX8A 4XVEA 5E09A 3FXYA 4HZMA 3QHNA 4AYGA 2HMCA 2QCNA 3FS2A 3WF3A 2DZAA 3WH9A 5F1VA 5I2UA 3AS1A 2GDVA 2ZKMX 3CQIA 1H62A 3N17A 1YXDA 4X0VA 3FJNA 1E4NA 2UWFA 2ZVIA 2QV4A 3VGFA 1SVDA 1H1YA 1B9ZA 3AU2A 3W7JA 3GXDA 2ZA3A 3RN6A 1WKEA 4AG0A 3TFCA 1VRDA 2I9EA 3LERA 1EPXA 4OV4A 4R34A 3NQAA 1T8XA 5FJUA 2VC6A 2NSXA 2NXHA 4ZOEA 3L4WA 5M2FX 1KD0A 3B0XA 4HPXA 3UNDA 3QYQA 5C8BB 3WG6A 2V3FA 1FWTA 1LG1A 3LLXA 1OFPA 3FJ6A 3TYAA 1TSIA 4ZQOA 3U8GA 1YPFA 3WL0A 2JE8A 1FBAA 4G5DA 2ODOA 1YBQA 2VUYA 4UWMA 1CB2A 2WB5A 1VJZA 2VENA 2JALA 4CEXC 1F3WA 1M7OA 1ZAHA 4URIA 3STCA 5KTLA 3VIOA 3WLIA 1RUSA 3RCMA 5J04A 3QQ0A 3UZ5A 3E2RA 1S39A 4JIQA 3THDA 1SO4A 2FGZA 4D2JA 3ONBA 1SZRA 2AKZA 4FO4A 1UBSA 1LM1A 1XD0A 3AYSA 4O1FA 3T44A 1IEIA 4Q8QA 4GYPA 1W1TA 2QW5A 1VIWA 4IIBA 4ICCX 2DFAA 1VC4A 3P0WA 2IPFA 2VFGA 3POCA 3AAMA 3CAKA 2JF6A 2NQLA 2GOUA 4AF0B 1B31A 2BMBA 3CEUA 4OV9A 5FJJA 3R94A 1TRIA 3IVUA 3C0LA 2RHGA 4LTSA 4BEQA 1XIDA 1KBIA 3QHMA 5AOUA 3EMZA 4DELA 1ECQA 3VKJA 3GDRA 3NQ6A 4L5ZA 3OVPA 3CWOX 1J18A 3WQFA 4KRUA 3QC0A 4DZIA 5AECA 2IW0A 4WQ6A 4CQ8A 2V81A 4DI8A 3IIVA 3U9IA 3IRDA 1BRLA 1TV8A 5C9WA 3PPFA 4EPEC 3MSRA 1YBQB 4NRRA 1ZBCA 2J7GA 3OA5A 3T7VA 1KB3A 1EQCA 3F1QA 3PJUA 5AHNA 3L9CA 2BZNA 3TWBA 4QE4A 1LT8A 1AMYA 5BCAA 4Q7NA 4DUXA 4LAMA 1A5UA 2VQTA 2VX5A 1WB0A 3A64A 5HPCA 3MB9A 3LI0A 5KZ6A 3F4VA 3IJ7A 1JYXA 3PFMA 1I2RA 1CTNA 3ZT6A 4E8DA 3F4CA 5FF4A 2E8YA 4OQVA 4IX0A 1QAPA 3L65A 4WX2A 3G2GA 3CT7A 1KV5A 3ANUA 2XVNA 1OX6A 3GNRA 1Q45A 2TAAA 1GJUA 2HZGA 3VZXA 5FKYA 1Y8BA 4H83A 4AF0A 3SQSA 1A0DA 4RPQA 2VC7A 1YXYA 1UR8A 2XVPA 3REQA 2WMJA 3EX6A 3W38A 2A2IA 4QX4A 4H9VA 4NX5A 4NU7A 3W88A 2VX7A 2XN0A 3BO9A 4UNIA 1TIMA 2XDFA 5FCZA 3LGEA 4YTUA 3ARXA 3JZEA 4HU3A 5LXEA 4KRTA 5FF0A 1R2SA 3VNLA 1NAL1 4W88A 3WIJA 4NXSA 3VGHA 5G1TA 1XHGA 4N9CA 2IQTA 1UROA 3TN5A 4XAFA 2ZZ5A 1UD3A 2BHZA 3KUMA 4GX9A 1DWAM 1SUXA 3N1AA 2EPKX 3S46A 4DX3A 4UFJA 2ZXBA 3QV8A 1HP5A 4W7VA 4WCJA 4N9BA 4RUBA 3GWQA 1PZ3A 2VWSA 5I79A 5BW6A 3GFYA 3MVIA 3W25A 4HMNA 3AOFA 4FOJA 1XQLA 3NQCA 3KHDA 4DF0A 3EMQA 4C7FA 4NAFA 5D03A 3MS8A 9CGTA 4KEVA 3SR7A 2ZUTA 2Y4SA 1W9BM 4B5VA 1M7PA 4HSOA 3TQPA 4PMOA 3W6YA 3P0XA 2E6DA 4GINA 2FMOA 5A8GA 4UTFA 5A8PA 1ENUA 4O18A 1VJSA 3BLLA 3THAA 1FY6A 4HCLA 1A47A 4HOXA 3PWIA 3RU8X 3M0YA 2G96A 4MZ8A 1UKSA 3S9YA 4GCAA 3L67A 4L1XA 3IVSA 1UUQA 4G7EB 4C1KA 5HNNA 3C86A 5DMLA 4BQ3A 3ITOA 1Z48A 5D02A 1KCXA 2HNEA 4ML4A 1H1ZA 1TR9A 3URQA 1E6ZA 5CAKA 3W1LA 4GCXA 4DF1A 1ZQ5A 4UTJA 4F48A 2NT1A 5EBUA 1KM2A 4MADA 1NQKA 2D69A 3ZVHB 2O9TA 3WJWA 4JDBA 1SFTA 3LUTA 3OGRA 1D9EA 3PTMA 1QI3A 2NWRA 2PDXA 1ZCOA 3G1HA 2HQAA 4RDWA 1XYLA 1SYTA 2VEIA 2VFFA 1E9YB 3FW6A 3CUHA 1WDPA 4TX6A 2J66A 3IUHA 2YW4A 3H7RA 1R85A 2F2HA 1LQ0A 1XH2A 1DV7A 4JD4A 3A5FA 3PPCA 2PA6A 1RCQA 1XC6A 1F5ZA 5MKGA 3TTOA 3STPA 1XYBA 2WWDA 2VHLA 1MDRA 5FIPA 1H7WA 4JS3A 2WSPA 4JY8A 1GYNA 4V33A 1B0IA 1B4KA 3QGKC 3C61A 4QAWA 3DXIA 3THQA 4OJYA 2YCIX 3QFEA 3ZO9A 1N2VA 3C2RA 3CU2A 3R89A 4OE7A 3PB0A 1PL9A 4ZL1A 4UMBA 1MEHA 4YTSA 1AA1B 7TIMA 5FA5A 4O52A 4BJHA 2WMFA 3JVAA 1Q6GA 4FNUA 1XPYA 3I10A 4Y96A 1DJQA 3MJMA 1E4MM 2VZOA 2WANA 4WIWA 5F1UA 1IWBA 3TMQA 4I8DA 1EYEA 3ZVHA 3GDLA 1M41A 3LQGA 3HQPA 3W7MA 9RUBA 3N13A 1GPFA 5GJMA 3EXRA 3TN3A 5C9XA 1DJGA 1XLKA 1N8FA 1FP9A 3ELFA 3L68A 4PTXA 2QGHA 3E0VA 1UD8A 1UWAA 5LIYX 3ARZA 3ERPA 4M6PA 1JDEA 3BLPX 2DZUA 3W7RA 4ORMA 1SFLA 3OQ8A 3NVTA 3OODA 2V8ZA 3FIGA 3MHFA 4AIBA 5C9UA 4MVAA 5EA9A 3H2AA 4O4WA 3NOEA 4ZXLA 4P61A 4KFOA 4JYDA 3E74A 3EKLA 4XBKA 5JH2A 3BXWA 4XQ6A 3IIXA 3SUSA 2UY4A 3KE0A 1HX0A 1PJ9A 2ZZ2A 1AZ2A 4N4PA 3QXBA 1EX5A 4GUFA 4R7WA 3I7SA 3IVTA 2WKJA 3OLGA 1B4EA 1TJ2A 4TO8A 4NP7A 4ZQPA 1A5BA 1CX9A 3QF0A 1UW9A 5LA1A 2Z1SA 3NO1A 4B5SA 3H21A 1PHQA 2V2HA 3IEBA 3MP5A 2ZQ0A 2RFGA 3ORWA 3QKZA 4A29A 3TU9A 1ZBKA 3DIPA 1J11A 4IQJA 3TC7A 1Q65A 2D2HA 3LPPA 1E0XA 1RSCA 3HB9A 3TAOA 1JFHA 2VT0A 3NZQA 1VYSX 1I2PA 4GIRA 3EB3A 3NQDA 2NUYA 2V67A 4OIFA 2Z24A 1NJJA 1PIIA 4XVDA 1F8IA 3SCOA 3W70A 1EZWA 1PHWA 1CB7B 5BRQA 4I7UA 3LRKA 2H3DA 4Q6XA 3S3GA 4W8LA 3LBCA 3W7IA 2VFHA 3U5YA 1GJPA 1AODA 4FXJA 4LNYA 1NQ6A 1HJVA 2PTWA 3P5ZA 1P1MA 2FGLA 3AJXA 2PDHA 2XJ7A 3GG7A 1FUYA 1UD6A 1XDJA 3GVWA 4JL1A 4I5RA 4GACA 1MO0A 2XIMA 3E2SA 3S5OA 4LV9A 1NWRA 4O11A 3E2QA 4QBXA 2GVLA 2QV5A 4Q4OA 4B90A 2INEA 4MWAD 1UZHA 4L6HA 3BG5A 3VD4A 2QUMA 4UMCA 2XFYA 5FSDC 1G1YA 3SB0A 4MJMA 3WEZA 2EG6A 1QBAA 3MPGA 4PA8A 5DT5A 3C56A 4MSSA 2ZDRA 1BTMA 5HR6A 1FWDC 1XFCA 1O60A 3CUIA 3U0HA 9XIAA 2VEMA 5LIUX 4G2DA 2CW6A 2G3JA 3CTTA 1QDSA 4IP5A 3NQGA 3B8WA 1QRQA 4E2BA 2BVYA 1R8LA 4DZHA 3QY7A 4LY4A 5IFTA 2Y61A 3JR2A 4AD3A 4DRSA 4JGDA 2Z1VA 3D46A 4A05A 2ISWA 4MKSA 1A4LA 3F4WA 2DVXA 1EDTA 2WC4A 3W29A 1FFRA 3LPGA 4NX0A 1CGYA 2B81A 3ES7A 1I45A 3TR2A 1HZYA 4F0HA 3T1GA 4ERAA 2D0GA 3GH4A 3TJLA 1IXPA 1I0BA 4K36A 3VCRA 4LT9A 3HPFA 4JIRA 3TYDA 2W67A 2PGEA 1S5NA 4DWSC 3KDOA 4E3VA 2XGBA 3GTFA 3H53A 2J6XA 1RV8A 5D33A 1BXCA 3OB8A 3EDEA 2V2DA 4V28A 2A3EA 1US2A 3EGJA 3L12A 4HMDA 3R7MA 3F5LA 1OCBA 3IJ9A 4PE8A 4O1AA 4S23A 1KWGA 4YS1A 3PBMA 4RPPA 5FJRA 4DXXA 3GR8A 2JIEA 4C6CA 4ROQA 1J5TA 1G4SA 1V3MA 3P7YA 1O12A 1W54A 1CI1A 4H8VA 5DQPA 1WZAA 1X39A 2IPWA 4DO5A 2ZTKA 4RE0A 3GNDA 5D9MA 2PZ0A 1O4UA 5DANA 4YTRA 3Q58A 3WFZA 4GKLA 4WJ8A 5I3FA 1ZBWA 3PZIA 4PUWA 2BY0A 4PODA 2XN2A 4R88A 1MEIA 4C5YA 4QR6A 4UQBA 1TZ9A 4QE5A 2CETA 4JFVA 3K2GA 4QCFA 3QW4B 5LIXX 1S2TA 3ARRA 3TQ0A 4FF7A 4ZQCA 4ZOBA 4C6EA 4R33A 2Y5EA 4JR5A 2D0HA 3OW1A 3VIJA 2XFWA 4AY7A 1MZRA 1P43A 3AHZA 1ZALA 1R6WA 2VX4A 4A8NA 2V5LA 5I02A 4BF5A 5FJOA 4DZ5A 3VKBA 4UFKA 4FXFA 1OGGA 3VMOA 2A3BA 3BSGA 1TPWA 4GH3A 1VFLA 3WQ4A 2NV1A 1X1NA 4UIOA 1CGTA 4IGMA 3KBWA 2AKMA 4DEFA 4KH2A 1K8XA 2AMGA 3VTRA 2JFEX 1V6YA 4NNCA 5DLCA 1W9UA 3TZNA 1UIPA 1F3TA 5EPDA 5K2ZA 1OX4B 1GOMA 3SQLA 5HMEA 4TMBA 4D6JA 1J4EA 2Z28A 3EWZA 1XL9A 3LMZA 2PGWA 1BSLA 3M7SA 3QR0A 4W8BA 1KXQA 2PWHA 2ZYFA 4F4RA 1AW1A 2J7CA 4GBDA 5C9ZA 4LPCA 1QNQA 4JNYA 4DLFA 2Q8XA 5TIMA 2ZFAA 4HPHA 2B7OA 3G1SA 2A3LA 1HKWA 2A85A 3PNZA 4F66A 1HJSA 1E0TA 3WNLA 4QJ1A 3M6YA 1OWQA 2B4GA 3ZXWA 2WNWA 3NJ3A 1G4EA 1ZGDA 4KKXA 1JYWA 3GNNA 2ISFA 1LF1A 3W37A 4FHAA 4ZFMA 3E6EA 3I6EA 1EHNA 3NM3A 2GQ8A 3BAIA 1L8NA 1WKDA 3S6TA 1UZ1A 3MUZ1 4EPDC 2DVTA 1QI4A 4JQ3A 1E4LA 4DM2A 3C2YA 4GABA 4H6RA 3V3WA 3ZR6A 2BTMA 4WEVX 2HS8A 2XPKA 4EXQA 1QNVA 4AEOA 1XYZA 1EWDA 4K7YA 4J28A 4AZCB 1DXFA 3UEQA 3SRKA 5AC5A 5DRIA 2H8ZA 4HHHA 3BAJA 2JGYA 3W9ZA 2BGNE 4MYAA 1CECA 1OX4A 2FZ9A 3FX4A 1LLWA 3HN3A 1QOPA 1UWTA 4PFHA 4ATDA 3WQWA 1BVNP 1CENA 3NGFA 4Y8FA 4D6EA 3W71A 1KXVA 1WX0A 2VL4A 3CHVA 5F4SA 5LA2A 5H6HA 1MXDA 4LXFA 1DQXA 3V75A 3FXGA 3RX2A 1Q6RA 2X30A 4Q8WA 5FJTA 4FNPA 3STEA 3UPWA 4NRSA 2BDQA 3RM9A 2V38A 3WY1A 1WAUA 1KCLA 4XISA 3R6IA 3LD5A 4EIVA 1UUMA 5FEPA 4F40A 4HPGA 2AL2A 3I6TA 2A7PA 3NURA 2I56A 4U28A 3T4CA 3LCXA 3W1UA 4MG4A 3APYA 2Y70A 3HQ1A 4NJKA 2FYMA 3EEZA 4BA0A 1OF6A 2FHFA 1K7XA 4EANA 3EDFA 5A2CA 1IEQA 1M7JA 3MI2A 2GYIA 4TX9A 4JNZA 4BFAA 1Q6DA 3E3HA 5D09A 2VYOA 1YLVA 4NZJA 5G2HA 4AC1X 2FJKA 5H8UA 1ADSA 1MMFA 1R9XA 4D71A 1I2NA 5ENLA 4J3ZA 3APGA 3TIMA 1PBGA 2HEJA 3UNTA 4ZQMA 3C3NA 1GOIA 4UFHA 4WJXA 1PYMA 2PI6A 5H1WA 2YA2A 3QVQA 4Q4RA 3WKZA 1JD9A 1GJWA 1AQHA 3P8JA 4AXNA 3HA1A 4NJJA 2ZRZA 3PY2A 3DFNA 3W7QA 4S3EA 4UMAA 3CZLA 4G1NA 1XFBA 3DFHA 1PB0A 3VABA 2GDQA 3F7JA 1UWUA 1X38A 1IT0A 1R87A 2G3FA 1KCZA 2OSYA 1OYBA 3R8HA 4D1IA 1RY8A 3GHUA 1B54A 5D37A 2FKPA 3VI2A 1LOSA 4K38A 3KCOA 5BOFA 4GQRA 1OJXA 2R1KA 4J35A 4J3VA 1JCMP 4DJEA 5H91A 2J13A 1N82A 3WJZA 4IIEA 1E3ZA 4ZE5A 5IXEA 4WVXA 1M6JA 3B8TA 4RV3A 4C1LA 3VZZA 4H9ZA 1VHNA 2XIIA 3KL5A 1ICQA 2BOEX 1FH8A 4HIBA 3EA3A 3WBWA 2BOGX 3SURA 4C6OA 3EXSA 1B3VA 5A6BD 3RJYA 5JBFA 1Z8AA 3GXTA 3EDJA 5DT7A 3UJFA 4IPLA 2FB2A 2DIEA 2ZZ4A 2NSOA 4BY3A 3VX0A 1O95A 2RDTA 3W2UA 3UYIA 2ZXDA 3GXIA 5LSMA 5AYZA 2Z26A 3GUGA 1L9WA 3U3HA 3IGHX 4JIPA 1P6BA 3T81A 5CPLA 1K3UA 3UCCA 2PWUA 2INFA 3T2QA 5BXSA 3RAOA 2D1ZA 1FWGC 3KX6A 3V1PA 3ABQA 4MF4A 4NAEA 2JKPA 2Q71A 1PCKA 4OVXA 3LHUA 2V6AA 1PCWA 2QPXA 2PLJA 4N9DA 4TOQA 1Z32X 2DQWA 2CBIA 1VD6A 2X7WA 4ACYA 3VOCA 1ISZA 1OK6A 3ECQA 3VUSA 1LTDA 5HWJA 3SCUA 5C2GA 3WLLA 3IIZA 1AFSA 2QDEA 3DYOA 2H90A 1XUUA 4C65A 1A50A 3HURA 4ZTXA 4TX8A 3PUGA 2XSAA 2QDDA 1FOBA 3P61A 1MSSA 3T08A 4E5TA 4PRWA 3W87A 1IEWA 1S46A 4HCDA 4OT7A 1JIBA 4D72A 2HNHA 3LSBA 4U31A 4RZ4A 1EC7A 3JU2A 4NG3A 3QPYA 4OKDA 4Z1AA 2VZTA 3K5XA 1V0NA 1OF8A 1OC6A 2VXNA 4PL1A 3CMJA 3N18A 1WE5A 2Q01A 1VJIA 2ANUA 1FWJC 5K9XA 4HK6A 2QIIA 4YWSA 4DBSA 3WMCA 3LG3A 3SSJA 1WBHA 1POKA 5CC7A 3QW3A 1GQNA 3GW0A 1RJRA 4PN2A 1DP0A 2PP3A 4TV6A 3ATYA 2AGTA 2ZX7A 4Y7EA 1Q2SA 3OGSA 1IXQA 2R24A 4E4UA 5REQA 4LS0A 2ABAA 1V6TA 4D6FA 1VAHA 3VC5A 3ANVA 3ZFHA 3Q37A 4MDPA 1FTXA 3NDZA 1H2JA 2G8ZA 1GW1A 5A94A 2BXZA 3WDQA 5TF0A 2PP1A 5CC6A 5M17A 4FA3A 4V27A 3BSHA 4QNWA 2HSAA 2HDJA 5EMYA 1G6CA 3B04A 3VDBA 1DIKA 3BLFA 3BG3A 4AB4A 1KM6A 3WLMA 1TPEA 3EDKA 4B5TA 3VD5A 1XLGA 2I57A 2X41A 1RPKA 4F0RA 2O7SA 4GZIA 3LCIA 3UR7A 5JUVA 3HMJG 3CV7A 3MCOA 4Q4KA 1YMYA 4MWAA 2J7EA 4I3GA 1Q6LA 3EPNA 1IGSA 4IHCA 4C1NA 2IMRA 2X0YA 4RLIA 4GXPA 5EYWA 3UETA 3HM7A 1EGZA 4GX8A 1H0GA 4GXWA 3O6YX 3UWQA 3CAVA 5AYBA 1CGWA 3NM1A 1MXGA 2OXNA 3A9IA 3MU7A 1E56A 3UZYA 3TW6A 5C2CA 3QPEA 4MTVA 4XKYB 1HIZA 4REQA 3PZNA 1R7AA 3W73A 5EFFA 3EWBX 5SWUA 3UU0A 1E4IA 3ABSA 3W02A 3UG3A 2J77A 2YX0A 5FJIA 2X09A 3WK1A 4F9JA 3UR2A 4K68A 5CH9A 4J27A 2HXUA 2DDXA 3FA3A 3C2FA 2H6RA 2Y62A 4HNUA 2NX3A 4IGNA 3WBAA 1UG6A 2E68A 1EEPA 3BTNA 3VAVA 1A4MA 1ISXA 5D2WA 4LYPA 4W85A 1CDGA 4IFKA 4J3UA 4CNPA 4FR6A 3MO7A 2PWVA 4ZEPA 4P7QA 2RDXA 3LNMA 1JI2A 3S1GA 1V7YA 2V3DA 1FCVA 3WLHA 2Y5SA 3M6DA 1EDQA 3VK5A 1SW3A 4MWAB 2P50A 3VGEA 2J62A 3H4WA 4CU6A 4LYQA 4B9YA 1UUOA 4WLCA 3AZSA 2D73A 3DN5A 4HNLA 5C0QA 3E49A 2BY1A 4RJEA 5C5YA 4J5NA 4V2XA 4N02A 3DFSA 1LP6A 1IIHA 3MT1A 3VMNA 3VYLA 1R47A 2YZ5A 4N9EA 2GWGA 1QNOA 4XKYA 1QPOA 3II1A 2OZ0A 4IX2A 1I1XA 3WQCA 3MUY1 4L4PA 4UTWA 3WEOA 1TKKA 1TWWA 1W2PA 3ZT7A 5CC5A 3OHMB 4XIMA 2VD9A 3W7HA 4H7VA 2A5HA 2WSKA 4FOKA 1K6AA 4ML9A 3KHJA 3WLKX 2CZFA 4FI4A 1D2KA 4A35A 2FB3A 3EKZA 1PWMA 1YTKA 1WOBA 3BUVA 3RGTA 4DYEA 2XWEA 1TV4A 1A5SA 3A3XA 1NTHA 3RHGA 5DCBA 3NQFA 1DJNA 1GKPA 5BRPA 3USZA 3HG4A 5U4NA 1Q4NX 2ZUNA 1W8SA 2C15A 5C7VA 3CPGA 4W9TA 2V3GA 1ZB5A 4GGHA 1O5KA 3MMUA 2ZWZA 3TA9A 4R7OA 3G77A 3MJYA 4LBUA 3SUVA 4P2VA 5HWNA 3I3BA 3LA4A 3M07A 4K7VA 2VFIA 2DZVA 3NSMA 8TIMA 1XLMA 3NDOA 4YXGA 4PC8A 3IGXA 2VVSA 1LLOA 3GTNA 2GSJA 1Q63A 1FWRA 4DPQA 5JXQA 1NOFA 2NQ5A 1HNYA 2D23A 6XIAA 2XSBA 3RDKA 3T05A 4PUMA 3I65A 1H11A 1Q5MA 1PXGA 4C91A 1DTNA 3L23A 1EXPA 4IQDA 3QMRA 4MKNA 4C6KA 1Z9AA 2OOFA 3DOPA 3WLPA 4QJ4B 3APTA 3MKVA 3FLUA 1XINA 3G0SA 2GJLA 2V9DA 5F7UA 2OCZA 1E72M 2BFGA 2X0HA 3RILA 3W82A 4QISA 1ITUA 3ZYZA 5IBXC 1TFVA 2CLHA 5CG0A 4M7TA 3UVIA 1BF2A 4HN8A 1HQTA 2Z7KA 2PD5A 1BLIA 1G5AA 3CWNA 1UH2A 4X22A 1NARA 4QLLA 4XD3A 1TB3A 4RE4A 1DBTA 1YE6A 3TFXA 1XXXA 3SZ8A 4D6IA 3W74A 3O07A 2PWDA 5E1QA 1DKWA 5AVNA 2WSQA 3UWVA 1OD8A 1UB3A 1ZSXA 2I1OA 2QZRA 3C52A 2GQAA 3PZMA 1H7OA 3O7UA 3UF9A 3E5BA 1R3TA 1SSDA 3D5HA 2WOQA 4S3BA 2TRSA 1EP2A 3AYTA 1I9CB 2I17A 3PUOA 1LRNA 1PUDA 5LNWA 3SN4A 4LAUA 3QH2A 3HZ3A 4F2TA 2Q3RA 5C2XA 4L1GA 5K4XA 2X42A 4INFA 1RQHA 4ZBCA 1VS1A 3IARA 4CNNA 2NVDA 4US6A 2QIWA 1F74A 1PIFA 4OBSA 1HGWA 1D7FA 1LUCB 2FDMA 4DNHA 6REQA 4IMEA 3LS9A 4JTSA 1OCQA 2ADAA 2EG8A 2EO7A 5DY3A 5LXXA 1PTDA 1WDWA 2QLYA 4H6KA 4IXHA 3FYYA 3LXAA 3UVAA 2QCEA 4JKLA 2Z1XA 2YW3A 2PRLA 5FACA 3DUGA 4Z08A 3DHPA 2VRKA 3V35A 1LWIA 1R30A 4O0ZA 4Z1CA 4GNKB 2DT0A 3BAXA 4LYKA 4HK7A 3ZWTA 1RD6A 4MZYA 4NYUA 3FA4A 3ITTA 4RNFA 4NNAA 3KS6A 4ZB2A 3U4FA 1IGWA 3N4EA 1RY0A 4BI6A 3LEPA 4GXMA 3R0DA 1FA2A 4LAKA 1M65A 5CSSA 1SFSA 4B3LA 2W63A 1ZHAA 2MANA 1G94A 5BRBA 4IPPA 4UOZA 2J9XA 1WZLA 5BU9A 2EPOA 2QUVA 3TW9A 2P3ZA 3MSGA 2Q8LA 3M16A 2X2GA 3IGUA 3W28A 4QDMA 3VD7A 4PMYA 3K8KA 4XAYA 2OODA 4BQ2A 1ONRA 4UQDA 2L5HA 4RNIA 2J25A 3AJ7A 1LUCA 2PDLA 4HZ7A 3NL2A 5I24A 5E93A 4HU0A 1P0KA 1LLZA 5D32A 1E6QM 3P67A 1TWZA 3UJ2A 1TWIA 1IV8A 2V3EA 4U2YA 1FWAC 5LGZA 1MXSA 2OLHA 3R25A 3OBAA 1TTJA 3T0BA 1WA3A 3FFSA 2O4MA 1TTQA 2WPBA 1CLKA 2GK1A 3BV7A 3PG9A 2PSNA 3KAOA 1EIXA 3MA8A 2Z00A 3FDKA 1A49A 4J9JA 4M1RA 2R82A 4A3HA 2NUXA 4RDVA 2A6NA 5JU6A 3B9OA 4IL0A 3RFAA 4AZCA 3S2NA 1I2QA 2J9YA 4ZENA 1GEHA 2FPVA 3ARSA 3C5QA 3HU7A 1C8QA 3V4BA 3UWYA 4N7QA 4S3FA 3U2ZA 3HIJA 5HJYA 2WXDM 3PSWA 1EC9A 1SJBA 3TV8A 1NDWA 3IK2A 1KC7A 3CTLA 2Y85A 3CUGA 5HNUA 2F6XA 3ME3A 1VPQA 3S0CA 4QDWA 1O66A 2GLKA 3B4YA 1K4GA 4Z0SA 2ALDA 5D2YA 4F9DA 5FSEC 4GLEA 1DJWA 1FCUA 1G4TA 2CEQA 1EOMA 3KVJA 1R86A 4QS6A 3LTPA 5DMNA 4FX7A 1Y65A 3LU2A 2REQB 4MY1A 2J88A 2R94A 1UR4A 4W87A 2QDHA 1XKYA 1EPVA 4A8IA 3CQ0A 4PB3A 1KRCC 2IS7A 1ZJIA 1W0MA 1NFGA 2DUAA 1CCWB 1UCWA 2CU0A 4MAZA 4QXIA 4YLWA 1WUFA 3GE7A 1UIOA 3TE9A 2GJPA 1VH7A 2EBNA 4DQWA 3BW3A 3R10A 1W1IE 1XPGA 2QYGA 3BDKA 4KEUA 3GIYA 2QXWA 3PWAA 3P82A 4GZEA 3KXQA 1SGJA 3FOKA 1JCJA 2P76A 3VC6A 2BHYA 3JZUA 4OOUA 3IS4A 4ERGA 2G5WA 4H8UA 3B8UA 1JPHA 1JR1A 1KCKA 5G1MA 5BWAA 3PJTA 3DC0A 3IRSA 2PTDA 1DWGM 3IPWA 5MF5A 3WSUA 2WLZA 4W86A 1XP3A 2J8TA 1XLJA 2Y88A 2JK2A 1XCFA 3CMFA 2EPLX 4E2DA 4MB3A 1JZ2A 1ZAIA 4Z2LA 4AISA 1VBRA 2Y8VA 4HYRA 5LNRA 3AHXA 3BURA 1W2VA 4HHLA 4R27A 5F2MA 3WF1A 3GQYA 3BMWA 3O9NA 1YHTA 4W5ZA 5B80A 2HE5A 4NJIA 3A23A 1XH0A 1UPPA 1CGUA 3VIIA 2C16A 1V03A 2W5FA 4PBGA 2QJNA 4RW3A 3EA1A 4Z2KA 3UQNA 3S83A 1UH3A 1ECEA 1J6OA 3CHDA 3EX3A 4PBFA 3TROA 1J0ZA 5G4WA 1GGOA 4ZVJA 2OPJA 3G3DA 2AQWA 2OYLA 3ABRA 1B3YA 4FIRA 3W1QA 3W7DA 1XLHA 1GWJA 3GIPA 1OABA 4LAOA 2UY3A 1TELA 2PLCA 3WUBA 3SUTA 2CITA 2ACUA 4NAEB 1F76A 1E55A 1W56A 3PFRA 1CGVA 4L64A 1C8YA 4XSMA 4DWSB 2XVKA 2V68A 1PPIA 3QZ6A 4MUPA 1QW8A 3EOOA 4JX6A 3WENA 3M5XA 4JCMA 3KLKA 1TRDA 5D2VA 2YCLA 2P3EA 1EH9A 4RX0A 3R5EA 2R91A 5CXPA 1VGAA 4XUYA 4US5D 1J01A 3A4AA 2CLPA 1OGSA 3VDCA 2IPGA 1VBJA 2D2OA 1X1OA 2CLLA 1FHVA 4R5EA 4I8YA 1GW9A 3K1GA 3EWDA 3H7UA 4G1KA 3W72A 2H3BA 1TWDA 1F9CA 1UQYA 1ZLPA 4Y90A 4EF8A 1QO2A 4B5UA 3ARYA 4MPQA 4DJDA 2IKIA 4JXCA 3RO8A 1PKNA 2JQXA 1NVMA 2PLMA 3S1UA 1O1ZA 3K8LA 2D3NA 3WDJA 3GDKA 4W8AA 1XC4A 3NO3A 4UOJA 1XICA 1S2WA 2PBGA 3QPZA 3VKCA 5E0FA 4U5KA 3KL3A 3H2EA 3PBGA 4JFWA 4MYXA 4AY1A 3ARQA 3QOKA 5CJ5A 4JTEA 4M8UA 3DBNA 2A79A 4GYFA 2BVDA 5G4HC 2F6KA 1AH3A 2VWTA 4MZ1A 4L4LA 3W2LA 6TAAA 5IM51 3AUJA 4J40A 1N55A 5REQB 2DZWA 1GOKA 4XTIA 1AUSL 3FVDA 3N2XA 4HNOA 2VC5A 3OLEA 3W1NA 4DWSA 3AMGA 4O17A 4DBWA 4KFPA 1FKWA 4C7GA 3KZSA 3GZ3A 3LENA 2D0FA 5LKYA 1QNSA 3FEQA 1ME9A 5CJMA 3HOJA 1H3GA 2X1RA 5LHEA 3DCPA 2ISSA 2QCDA 5BU6A 1PO9A 1XIFA 4DO6A 1IYXA 2CFFA 1GOXA 5IBXA 3S5SA 3W7NA 3B4UA 2I14A 3QRHA 4ZE4A 3N4AA 4KIEA 2Y63A 5U7SA 5GJPA 3GHRA 1LL4A 4PUNA 3VIPA 3W01A 2YL5A 4UTLA 4UOQA 2ZC8A 3NDYA 8CGTA 1U5JA 1J0HA 1BG4A 1K6WA 3P60A 3PAJA 4Y8EA 2EG7A 4JX5A 3D3FA 4IM4A 3RMEA 5CLWA 4UTTC 3LRMA 1E5NA 3KWSA 1TV7A 3KEHA 4FNTA 3T2OA 3HV9A 2RJHA 2TMDA 1SR0A 1XIIA 4JFSA 6TIMA 4A2SA 1Q6OA 4H7CA 5DXXA 3GC4A 3H2NA 1AJZA 3AMCA 2IKHA 1R3QA 3EOEA 2O0TA 4PB4A 3EMCA 4UZSA 4P8VA 3PWGA 3QV6A 2QGYA 1ELSA 1LRQA 4AQLA 3R11A 4JBRA 4XZIA 4XBJA 1OG0A 1ONWA 2WM0A 2WBKA 4LOCA 3EB2A 2FHBA 1S2CA 3T8QA 3RX4A 3MZ2A 2PBOA 5FEZA 1H7NA 3T40A 3DECA 3CB3A 4GH1A 3A21A 4ALDA 3AS3A 3N11A 2JIWA 4ZFCA 4NZ5A 4OBRA 5ABFA 2DVUA 1GNXA 1V6WA 1K7FA 5M3WA 1RVKA 1SU5A 1PE1A 4OUIA 3ZJ6A 1MW0A 1W9PA 3BW4A 2TODA 4BZYA 4I9JA 3NNTA 3THCA 4C6JA 3GR7A 3TONA 1UQZA 1Z6KA 3E02A 2OZTA 5HINA 5CPTA 1HKKA 1G7VA 1K7EA 1ONXA 4MKVA 1WOAA 1X8CA 3MC5A 1RHCA 2V82A 1C91A 1SW7A 3GW3A 1E15A 4GYKA 1V0MA 4HD5A 3F2BA 4HU8A 3W2KA 1X6LA 4CU7A 2E9MA 3CAWA 3VD9A 3AYVA 1C7TA 3ES8A 3NEVA 3K4AA 3L66A 5KMYA 3B9NA 4BQ5A 5CQ1A 4DWSD 4HTYA 2WSRA 4D9PA 4I7WA 1UP3A 4O0QA 2X40A 4QGCA 3HPZA 2F38A 4K2SA 1T7LA 4JTHA 5AFDA 5CPNA 3UA3A 1OT2A 1WXYA 1UD5A 3Q2DA 1L0PA 1MUWA 3OTRA 5BWFA 1T5AA 4U2ZA 4QAIA 4ENLA 3L4XA 4NJHA 5CBIA 1OEPA 2ZE3A 3NVDA 4G56A 2ZA1A 1ZZMA 1R2TA 3NWRA 1O5QA 3A4JA 3GSMA 2YZRA 1GQIA 3UPMA 2FZMA 3NQVA 5FF7A 4QJ3B 2G41A 4NIRA 1NWUA 2J74A 4I9AA 3RRAA 4E4FA 1MRAA 1TPC1 3SUWA 3M0XA 2WKGA 3IIPA 3N2TA 4F0SA 4U5IA 2WAGA 1TMQA 1FWFC 5BNKA 5J5RA 4QHRA 1DJXA 1UWQA 4BF7A 3U7VA 2W3ZA 3SCRA 4CVWA 3LBMA 3VFCA 5IOBA 4LALA 1VPXA 3OQEA 4IJCA 1K02A 4B3ZA 1P0NA 1U22A 1TA3A 2J7HA 1QI2A 3AIBA 3GNOA 2ACRA 3ZR4A 1MUMA 1CXKA 5XIMA 2WK2A 2GJXA 3KOXA 1MW1A 3FK4A 3SRDA 4RNJA 2PDIA 3WK3A 1EGVA 5AHLA 1KWKA 4GRSA 4J2MA 5CZJA 3VIMA 4OFCA 3KTCA 4P5UA 4DF2A 2QJMA 2YCJA 1WPCA 5IHSA 1T40A 2PZNA 1JDFA 4PSPA 3CC1A 3KRBA 3UZXA 1GK8A 4IG2A 3EWXA 5LIKX 1FWEC 4H19A 4MNLA 3DG3A 3H6OA 3BAWA 1E3XA 2FQIA 1KR0A 2PAJA 4TV5A 2WCSA 3MZNA 2XGIA 1UKQA 2NV2A 5F2IA 1YDOA 1JQVA 1BVWA 1HL9A 1HJXA 1QI5A 1QNPA 4UB9A 4FF5A 4B5NA 1JZ5A 1J10A 1LWHA 5C55A 2Y0FA 3SCSA 1I6NA 1G0CA 2GVGA 3AIVA 1TE6A 3S2LA 4PCFA 3EBVA 1KBKA 1XYMA 3EX1A 3CQJA 2A6LA 1JCTA 1GHRA 3HBLA 4M5PA 4LF2A 5I03A 3SUUA 2GPTA 1GTHA 3WUEA 4PMUA 3TN6A 2XSXA 3UXDA 2G4JA 1XIEA 4HVXA 3ITCA 2WHKA 1HKVA 1T8QA 1X98A 3L0KA 3PSVA 4HHPA 1HKIA 1TO3A 3OVRA 4PTVA 2OO0A 3P6LA 3O15A 2AL1A 5GPRA 2FH6A 3UWEA 3QMTA 1ICPA 5CG7A 5DELA 2F2KA 4GI4A 2FIQA 2HVOA 3RG6A 1XJBA 1K8ZA 4LSBA 4M7SA 1V8EA 3P80A 1BSIA 4GVHA 3H7VA 1YIXA 1RP9A 1MW2A 4IG2B 2QCFA 3W6LA 1E9LA 4C5ZA 3H2OA 5F4XA 4JN8A 3CGTA 1GHSA 4PEEA 3RIKA 4Q4MA 1Q6CA 1QVBA 4QM1A 4WSJA 4JTCA 3RLGA 1SO5A 4FP1A 2Z29A 2QEZA 1V5XA 2OVLA 5CCZA 1R7OA 2VR2A 4KIRA 3WJSA 4YNGA 4LVGA 3VFLA 4ICMA 1OADA 4JYEA 2V30A 1ZY9A 2FZDA 3PZ9A 3LCHA 3EWWA 1U2YA 2C1GA 4AZBA 4UQCA 4LRTA 1BFNA 3VNJA 1XIHA 4NJGA 3IJLA 1DJIA 2E4TA 4O8AA 5HNTA 2CYGA 3ZJKA 2BWGA 4LH8A 2DZPA 2WHLA 1PS9A 3GDMA 1A5MC 4KESA 4MHBA 1C8XA 2PCEA 3CLWA 1TUXA 5DCEA 3A3HA 5D8WA 4EWJA 3KCJA 3Q67A 1F3EA 1JVNA 3G6LA 2P0IA 1I0DA 2Z7GA 4PMRA 4O4VA 3SDOA 3DYMA 2H9AA 1P6CA 4WF7A 4E2OA 4IP4A 3AQUA 4BHYA 1VFMA 3KP1A 4JNMA 1KFCA 1IXNA 3LXCA 3QLDA 1WDDA 3G1FA 4HOZA 4L4OA 3WLQA 1RXOB 2FTPA 4X9YA 2FVMA 3FVMA 3BW2A 1GOOA 3PZQA 4FPSA 4DYJA 5F2GA 2NVCA 6PTDA 3WO8A 4Q8OA 5JVLA 4M0XA 4FOUA 1OZQA 4TTUA 3AIWA 4GZ7A 4LVFA 3URNA 5K9DA 4XAZA 3W1AA 5AB3A 2HRWA 2W66A 1PZ1A 3RJXA 2GK1B 3WD1A 4BCEA 4JL2A 3PTDA 3SQMA 4H8NA 4WGXA 3MV11 2NQJA 5M1TA 2E7FA 2B7NA 2VTFA 3H8AA 4WOQA 4EF9A 3E38A 3TSMA 2YFOA 3QTPA 1PX3A 2X1UA 4P8UA 3ZJ7A 5HWMA 3PBYA 5CLTA 4H3DA 7ODCA 2F84A 1VCVA 3ITGA 4UTKA 3P8IA 4IIHA 4CNOA 4HTBA 5FJPA 3SY1A 4EXBA 3O0KA 4WHBA 4C6NA 4XO6A 3UERA 1XLAA 2J6VA 1G67A 1S2UA 1S3TC 4HA4A 1JYNA 3MDWA 1K9TA 1MQRA 1UD4A 4FXSA 6ALDA 3NZRA 4HYVA 2X0SA 3AZRA 4Q8MA 1C29A 1A5KC 1L8PA 4E0CA 3BGGA 1O5RA 1F6PA 4US5A 3TWAA 3W7CA 4BR1A 3T4WA 2WYSA 4FX6M 2V5BA 1XCXA 4RXGA 1X8FA 1GKRA 3MQTA 1IEXA 4LUTB 4LUSA 1VYRA 4H9YA 4JTKA 3LNPA 4YCOA 1XIMA 2PF8A 1TV2A 4IMCA 4BS0A 4IFRA 4D8ZA 2OGJA 5EFDA 1ODZA 5DF0A 3AXKA 3MUAA 1ISVA 4LBRA 1JZ8A 3PZUA 2HROA 4W7UA 1CT5A 2ZX8A 2ZX9A 2ZVRA 3O6CA 4M82A 3NPUA 5LIWX 3TXZA 2I5GA 2WW5A 1FH9A 2PURA 3L2MA 1TUFA 5AYYA 1ME7A 1LCOA 3G1AA 2IXUA 1TV3A 4P8WA 2FGBA 5FEWA 2OG9A 1GOWA 2Z27A 4O50A 2R8WA 4W89A 5B7ZA 4NYYA 1BYBA 4CNUA 1JF5A 2B31A 4LV4A 5I00A 1SO6A 5C7HA 1XX1A 1JCYA 1UMLA 1LOLA 3MKKA 3NPVA 4A3YA 2E6YA 2PDCA 5LNSA 2DIKA 1PKMA 1THFD 4M19A 4FNRA 1UA3A 2PMQA 1US0A 3TW7A 3AUOA 1E1CB 3CS2A 3NL3A 2G50A 3NA8A 1MFUA 3DI0A 3CQHA 3ID7A 2VQUA 4NI8A 2OYKA 1W91A 3QBUA 1HKJA 3LHWA 1XS2A 2I16A 3VIHA 1JPKA 3NTYA 1D8WA 4O1CA 1P7TB 1VB9A 1UC4A 3R0KA 5A6SA 5AHMA 1CNVA 3F5KA 3ICJA 1GVIA 4GC3A 4DJED 5A2AA 4WJEA 3I68A 2BGQA 2YFNA 1QCWA 4LS1A 2Z4GA 1EZ2A 2PDKA 2OYMA 1W31A 5HA7A 1MRQA 4ASTA 4KRZA 3A47A 3CM4A 5J5DA 7A3HA 1F73A 1UKTA 1SZGA 1SZFA 1AG1O 2E67A 1RA0A 2ZX5A 1WCGA 1D3HA 4MLRA 5HJXA 4HHMA 3AIQA 1OC5A 3OP2A 3E0WA 4GC4A 3VOGA 1W8GA 4XO7A 5HATA 3WH8A 3KBNA 4FAMA 1VFTA 1YEYA 3O6DA 3GH5A 3KP0A 4WGHA 1KFBA 3TTQA 1Z89A 2WM1A 3BSMA 5M03A 1YDNA 5D9OA 3KWXA 2ZOXA 3WUFA 4P7RA 3EOSA 2INZA 2Z1WA 4G7EA 2WWCA 2DSWA 2GFTA 3NG3A 3QY6A 2HWGA 1E1CA 3M5VA 2NQHA 3W7OA 4QCEA 5DX7A 2Q3OA 2GSHA 4AEEA 4PMQA 3BZGA 3VXGA 2OX1A 1PVNA 1XW8A 1XBZA 4GUIA 3GRIA 4JHMA 5G2IA 5AYIA 2YXGA 3MWCA 1X1ZA 1AZ1A 2NXIA 4DO4A 3FKRA 4WY0A 3IUDA 3N6JA 2WCAA 1JRBA 4JKMA 2PRHA 1WP6A 4YHGA 1V79A 4PCNA 4BEUA 1UKPA 3BLIA 1VEOA 2F9RA 4OU1A 4DZAA 3SRHA 3WMLA 1XSJA 3DHUA 2OLAA 4WD0A 4JY9A 1HJUA 3V16A 1F7BA 4FX8A 2DIJA 3MCMA 3C0SA 4S3GA 5GNYA 1IIGA 4L4MA 1E0WA 1JRCA 1TMLA 3MYPA 1F4HA 4CCCA 5MKGB 4L1WA 3XIMA 2FPTA 3OJGA 2EPNA 1ZPTA 1VR6A 2VUNA 1L2UA 4DI9A 3G1XA 2VR5A 3TNBA 2D24A 4JTJA 1WDSA 3GDTA 4GFSA 4CU8A 3T8LA 1XLEA 4DJDD 2NQ9A 3LOTA 2Y7EA 3BANA 2O9PA 1IWAA 4OTKA 3WQ8A 1TPUA 1WKFA 4MFDA 3LRLA 2WVSA 3DYPA 1NELA 2VEFA 2YL6A 1W32A 2DY3A 1DORA 4Q33A 2A7NA 2ZC1A 1RP8A 3B0YA 2FTWA 3I4EA 1VFHA 1DYSA 4HA1A 2GQ9A 3LLFA 3C6CA 4JQAA 4QSFA 4AD2A 5EKYA 2UY2A 3B0PA 3TN4A 1L6SA 3R2GA 1QWKA 1H09A 3M64A 1J79A 1V3JA 3COTA 2X7VA 1GVFA 4RZBA 1DXIA 3I7RA 3U2CA 2O55A 3M7WA 3ARUA 3SFKA 1GONA 2BXYA 1FQ0A 1L2QA 2WO5A 4LUYA 3EPMA 3OZYA 5TD4A 1N7KA 3BAKA 4UR9A 1XQKA 3O8AA 2ISDA 3LDVA 5CBBA 2B7PA 4R9XA 1JUKA 3M0IA 3KDNA 1D3CA 4XB3A 4PRRA 1BGGA 4XZHA 3FKKA 3S6OA 4UTWC 2ON3A 1FVPA 4X61A 5FAGA 1QPKA 1KFEA 4I9TA 4K37A 3VM5A 2QJJA 4O1BA 4NVTA 4K8EA 3P62A 5CPQA 2WJEA 1LL6A 2ZZ6A 3WNNA 1I60A 1MVYA 2ZRVA 1F8MA 1UYQA 2BNJA 3R0UA 3WLRA 5JQ9A 2OJPA 3W6MA 2OLSA 1EFZA 1OB0A 1OIFA 2A0NA 3A13A 1DXEA 3RRXA 3W53A 2ZTJA 4M29A 4O1EA 5A6BA 3B40A 1Y0EA 5L9FA 5CPOA 5AZ1A 1ITXA 5IRPA 1TJ0A 2HS6A 2EXOA 1VKFA 3CHCA 5I77A 3CIVA 2J78A 1M53A 3LGGA 3DZ1A 3VCNA 1XBVA 4TQTA 4ZOCA 4C60A 1M1BA 3CZKA 4ILSA 2ISVA 3W1XA 4PTNA 2VI0A 4PFMA 4FIQA 1ZJAA 3RLVA 3PAOA 1XG3A 3FHQA 4LQ1A 3UG8A 5EMMA 4KEZA 1XM3A 1TREA 3VIKA 3CUZA 1E6PA 1EJXC 1JYVA 1JUEA 4PTWA 1PWLA 1XUZA 3NL5A 4FLRA 1MNSA 1Z41A 3H23A 1VCGA 1E6RA 2OKOA 4CQBA 4ZB0A 2PC8A 1I2OA 3GXPA 2ZWYA 3GVQA 3WQEA 2W0UA 3WF0A 5JIWA 1QW7A 3HG5A 2PPGA 4S1FA 4PCSA 2GUBA 1E6XM 3VOFA 5DN1A 2QNEA 1PTGA 2FH8A 3MMWA 3QZEA 4QJ5B 5HANA 3VDGA 3ALGA 3N9SA 1UA7A 4RXFA 2CC0A 3T0DA 4R3UA 3SCQA 1QTWA 3VO0A 2BS9A 2C6QA 2ZUUA 1F05A 4WXYA 3TMLA 2W27A 3TOPA 4DWDA 1EIBA 3WDHA 2GVYA 3RR4A 4HB7A 2VOTA 3VM7A 1GCYA 4GIYA 3J7HA 1PYFA 1GYMA 4B3KA 4UTIA 3TYUA 2WMIA 3E9AA 4MDOA 4A22A 2YPIA 2XVLA 3LY0A 3N04A 2VZVA 3UY8A 4L80A 2XYLA 4AVNA 3NIYA 3N3TA 2VDGA 3D3AA 2Q09A 3OO2A 2GVEA 6CGTA 1W3HA 2WMHA 1ZS2A 3GU1A 3HJEA 2DZBA 3EA2A 4QROA 3LZ5A 1Q66A 3LHZA 3N34A 3CJPA 4K8GA 3W0KA 2QPSA 4K1GA 4FB7A 1CIUA 4FLOA 2YBVA 1EO7A 1KRBC 3OPSA 1KV8A 4MJZA 4HN4A 1Z44A 4LC6A 1B30A 3WEMA 3CO8A 2YXOA 1XISA 3W1RA 4WSKA 3GC2A 3WUGA 1E70M 1IT7A 1MFVA 5A6TC 3L7RA 4LEQA 2LLEA 4QG9A 3M5ZA 3PG8A 4L9XA 8XIAA 2JEPA 5I06A 5HMFA 1R9ZA 3L4YA 2QCMA 1LWJA 3FGCB 4TMCA 1U1JA 2OU4A 1J2WA 3G18A 4R53A 5BXRA 3O63A 3CV1A 1HP4A 4JTRA 2Z2UA 5D9NA 3E12A 5E5CA 1K9EA 3N6QA 3DI1A 5FF3A 1TTIA 4FR1A 3L5AA 4YL2A 3AALA 1CXIA 3DEQA 6XIMA 2PU0A 4JTIA 2YL8A 3TCEA 3WK0A 3W2NA 1C92A 3M4HA 2W4XA 2P10A 2WC3A 1NF7A 2GJXB 2ACQA 1Z7AA 2QKFA 3V5CA 3VA8A 4IPJA 2Y7GA 3IUIA 2H8XA 1E73M 1J8VA 3CAQA 4QS5A 3LI1A 1T6MA 2X05A 4AD4A 5C71A 1SJCA 2OQHA 3RO6A 1W9VA 3AYRA 3C0QA 3QFWA