2CZFA

Crystal structure of orotidine 5'-phosphate decarboxylase from pyrococcus horikoshii ot3 complexed with xmp
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
208
structure length
208
Chain Sequence
MIVLALDVYEGERAIKIAKSVKDYISMIKVNWPLILGSGVDIIRRLKEETGVEIIADLKLADIPNTNRLIARKVFGAGADYVIVHTFVGRDSVMAVKELGEIIMVVEMSHPGALEFINPLTDRFIEVANEIEPFGVIAPGTRPERIGYIRDRLKEGIKILAPGIGAQGGKAKDAVKAGADYIIVGRAIYNAPNPREAAKAIYDEIRGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal structure of orotidine 5'-phosphate decarboxylase from Pyrococcus horikoshii OT3 complexed with XMP
rcsb
source organism Pyrococcus horikoshii
molecule tags Lyase
total genus 72
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2czfA00
1I45A 1TCDA 3UY7A 4Z1CA 2PCQA 2DZTA 1W8SA 3GK0A 3TKFA 3W07A 1TO3A 3TIMA 3IGUA 1RZMA 5D04C 1WX0A 5AC8A 2FQIA 4JYEA 4FX6M 2ZZ3A 4NQ1A 4NZFA 1NFBA 3DKJA 3C2OA 1YDOA 4A29A 2Z6JA 4E38A 1NSJA 1M7OA 2WSQA 4IOTA 5LNVA 3W7JA 4K36A 4LS2A 5CPNA 4NZJA 1KM2A 2P0OA 3GB6A 4LV9A 3P74A 4R34A 4ZZ9A 2E09A 1JCNA 4Z08A 5LNRA 3BVJA 3LI1A 3TK7A 3R5EA 3W86A 4IMEA 1H7XA 2FB2A 1TTPA 4LS0A 3W2UA 4GBUA 2NUWA 1AG1O 1KW1A 2Y70A 4ZL1A 3G1XA 4JX6A 3OG3A 1O5XA 3AO0A 4UMCA 1L6YA 3BG5A 3A5FA 3NGJA 3M1ZA 3PSVA 2NX1A 3NPWA 2QCLA 3PBWA 4EOUA 1UJPA 4WXZA 1F5ZA 1SZGA 4U28A 5F1UA 3PULA 2ZFAA 2ZRZA 3P81A 1ME9A 4OGZA 2Q3RA 3IV3A 3LX9A 4O14A 1LCOA 1VLIA 2WV8A 1EWDA 3PF3A 5HQEA 4RZ5A 2C6QA 3GDTA 4K37A 3NVTA 1ZJIA 3NM3A 1VRDA 1TIMA 1H60A 3P7YA 4NNAA 2A2IA 3L2IA 1SZEA 4Y6GA 4R53A 1EP1A 1GVSA 1VHCA 4Y9AA 2H6RA 4J9JA 4CNOA 3M43A 4QNEA 3SW6A 4HNUA 5K4ZA 1W5MA 2Q8LA 3B03A 1GG0A 4W9TA 3W7GA 2NX9A 3DFNA 1JQXA 3EKZA 5FF3A 2DZUA 4FX8A 4UTUA 3IGSA 3LCLA 3S1VA 3NXFA 4AB4A 5HJLA 1IXNA 3AJXA 5CPMA 1LM1A 4RJEA 4WY0A 1VGAA 1SO6A 2EHHA 3BV4A 3SECA 3NQ2A 3QC3A 4NT0A 1V5XA 1OG0A 2E68A 2DZSA 4XUGA 1P1XA 4AF0A 3L9CA 3E9AA 1A50A 4JTTA 4N6EA 2CZFA 1JUKA 3A23A 1Q45A 2AAMA 2WNNA 3TQ0A 1FCVA 1YXCA 3PBUA 1K7XA 3OVPA 4DXVA 1G6CA 1NEYA 2E5CA 5AHMA 1MEWA 3TR2A 4IX2A 5D30A 4MVAA 1ZAJA 3W2MA 2EGZA 1DQWA 1T8XA 1UASA 4K7VA 2Z6IA 2IQTA 4B5NA 1WYIA 1YDNA 1D3HA 2C19A 4O13A 1Q3NA 5LGZA 5K4XA 2H3BA 2YFNA 3O15A 1TPB1 4CCDA 4DPPA 3TFCA 1KBJA 3NQVA 3VCRA 4MYAA 3P84A 3GDMA 3SZ8A 3NO5A 4S2BA 4KWVA 5C6MA 3HOJA 3KXQA 3NQDA 3DI0A 2FIQA 4C1LA 4IGHA 4GUGA 3USBA 4TMCA 3IIPA 3TJLA 4QM1A 2C16A 3W7RA 3HO8A 4GE8A 5G2IA 3NL6A 3UD6A 5FF4A 2ISVA 4MY8A 1RQEA 4LVFA 3S1UA 5CSRA 5LNWA 1I2PA 1XL9A 3O6CA 3O07A 1H1ZA 5TQLA 1R47A 3CTLA 1YDVA 4JYDA 4MY9A 4N9EA 1FXPA 4O1AA 3LRLA 4JTEA 5FF2A 3M41A 4IJBA 1E51A 4A2SA 4WZHA 3BGGA 5LHFA 2YPIA 3NPUA 3W1PA 1PV8A 3ABSA 4FIQA 4YXGA 4LWWA 1BWLA 3W74A 4MLRA 1GZGA 2OJPA 1KBIA 3G22A 4GC4A 3NQ6A 5CG7A 4TMBA 4JN6A 5C54A 2E1DA 1XM3A 4BR1A 1BEUA 5D03A 4BI6A 3BW3A 2OMAA 1H7WA 3MWAA 3S5YA 3TQKA 3HBLA 5AC6A 1W5PA 1ONRA 4MZ1A 1O94A 1Z42A 1XUUA 4MFEA 4ZQOA 3FLUA 2W6RA 1JQVA 4MZYA 5KZMA 1O95A 1W54A 5I3IA 4O1BA 3W73A 2ZA3A 2VOMA 3HJZA 2NLIA 3QSTA 5K9DA 3EX1A 3W3OA 1YTEA 5DY3A 1R46A 3TX9A 3QMSA 3DKLA 4A3UA 3DXIA 1DORA 1FDZA 2RHGA 1O60A 5FEWA 5F2MA 3W76A 2DJXA 3FIGA 1KTCA 4HIBA 4LVBA 1OFAA 4ZQPA 1JCXA 1H62A 4MJZA 4N9DA 3TMQA 1ICSA 4O18A 1XBYA 3MYOA 1TPUA 2VFEA 3W72A 2QEZA 4IX0A 2V30A 5C2XA 1VPXA 1NF7A 2QJHA 1TPDA 4A2RA 3NEVA 1FUYA 1HL2A 5HR6A 3EWXA 3I65A 3NZ1A 3F4NA 2NXHA 3FS2A 3OA3A 4O54A 3MP5A 3W75A 4FIRA 1JR1A 1IXOA 1ZHAA 4UTMA 1TV8A 1GVOA 2FB3A 3B0PA 3W2NA 3S42A 3BARA 3CIWA 2Q3OA 5DXXA 1P0KA 2YFOA 5EYWA 1PIIA 2W79A 4FNSA 1G4EA 2RFGA 3GX9A 3M9YA 3PG8A 3W1RA 3G1VA 3IIOA 5DCBA 1Z44A 3HPXA 3ZR4A 4HT3A 1CX9A 4X9SA 3QW4B 4LT9A 1X6UA 3C2FA 3CWNA 4NX5A 5F1VA 2A21A 2OCZA 4IMFA 4ADSA 3S5OA 2QCMA 3GYEA 1PVNA 2WKJA 3W1UA 1N55A 3C2RA 5EPDA 1AW2A 3W9ZA 5AHIA 3BG3A 2Z1BA 1G69A 1GG1A 1ADOA 3CQ0A 4RCXA 3NM1A 1SO3A 4FF7A 1P0NA 2H3DA 5LSMA 3P8JA 5TBOA 4OE7A 4Z1BA 1KFLA 4H3DA 4JR5A 4RXGA 4UNLA 2C14A 1LYXA 2CLEA 3LHYA 3FYOA 1FQ0A 4Y90A 2TRSA 3CWOX 4HN4A 1TPFA 2CLHA 4FNRA 3DFOA 3Q58A 1K7FA 1WDWA 4POCA 3SGUA 5IBXA 4DBDA 4DF0A 1I8JA 1IIGA 4XKYB 4NUWA 4WJEA 2EPHA 5DCEA 4EIVA 3N73A 4AXKA 1LP6A 3TSBA 3NQCA 3CHVA 3N34A 2X2GA 3TAKA 3UY8A 5D02A 1GVFA 2QDGA 4FXRA 4IUOA 2X1UA 3F4WA 1FCUA 1H7NA 2B7NA 3PB2A 3LCFA 3N9SA 3G0SA 4OT7A 4DPQA 2ZRUA 1W3IA 3DHFA 3STGA 3TC7A 1G67A 3UWYA 1HO1A 3U6WA 3OBKA 3I6RA 4FNQA 3BLFA 1OFDA 5DLCA 4TX9A 2E6YA 2P1FA 4RKAA 4QSHA 3TNOA 3B04A 2AQWA 5DCDA 1TQJA 2DZPA 2YYTA 4BI5A 3M5VA 4Z1AA 3LCXA 2VFFA 2VFGA 5D2TA 5D2YA 1KA9F 2E77A 1RR2A 5LNSA 1LBMA 2A0NA 4Q4KA 3IRDA 1EEPA 3DAQA 3PG9A 4KFNA 3NYZA 4JS3A 2HS8A 1VZWA 2Y61A 5AB3A 5AHLA 4MY1A 2V2CA 1O5KA 1QWGA 3LTYA 4GUFA 3UYCA 3PUEA 2CLFA 1K03A 3LGEA 2F7FA 3ABOA 4KFOA 4PFMA 3EEGA 2YXGA 5A5WA 1RPXA 3C61A 4PL2A 1SFJA 3KOFA 5I3KA 2DZXA 2A7RA 1VHNA 1WQ5A 3ANYA 1GT8A 4WXYA 3FEMA 2B0MA 1A5AA 4XBKA 1OK4A 2VXNA 3EWWA 5G2WA 4N9BA 5CPOA 2QCNA 3TE9A 1QCWA 2BLEA 1EUNA 2BXVA 4EWND 1I2RA 3QFEA 4O11A 2GPTA 3GDLA 2JGYA 1TJPA 2NV2A 2QJGA 1QPQA 3TU9A 1SZFA 3GXPA 3INPA 3NOEA 3UWZA 3S9YA 5G1TA 4LC8A 5E1QA 1EUAA 3L67A 3MHUA 2ZA1A 2TYSA 4JIQA 3D0CA 2NUXA 1H61A 1SW0A 3MHGA 3W2JA 1Q6RA 1YPFA 2ZQ0A 5G2HA 3PC0A 1QO2A 4S2CA 4XKYA 5HNRA 3L21A 3DENA 5AYYA 3P61A 4K39A 2CZDA 5A8GA 5KMYA 2VENA 3EB2A 1VCGA 3I7QA 3QZEA 4DO4A 3NZRA 2YZRA 4FXSA 1THFD 1H7PA 3DU0A 4XQ6A 4E2BA 3VKJA 4HNTA 5HMSA 5HR7A 1TTJA 3C2EA 4AWUA 4FO4A 4Z0JA 3P8IA 3PB0A 5CZ0A 2DZVA 3Q94A 1LRTA 1NF0A 3C2VA 1TREA 5K3VA 4O57A 4CQAA 2Y85A 4JGDA 3S5NA 2QAFA 4BFAA 1GTEA 2NWRA 2BZNA 3BW4A 5DELA 5H2ZA 1LRNA 3LCGA 3L5MA 3QEZA 1LROA 1VH7A 1M5WA 4DELA 2YYUA 3JR2A 2H90A 2RDTA 5KTLA 3MO7A 1XBVA 4OQVA 4ML9A 2VEKA 3HGOA 4O1DA 2CW6A 1OHLA 1A53A 4M5PA 1ML1A 4M7TA 4UNKA 1WBHA 1DQXA 4UTTC 1TQXA 3WK0A 4O12A 3O8AA 1OX4A 1KFJA 5AC7A 3GVGA 1UUOA 1Y0EA 3L0NA 4Y8FA 2JKPA 3G24A 3WJSA 3TXVA 1SQ7A 1G7UA 1IXPA 1W5NA 2ZRWA 4GRSA 2EKCA 4O52A 3O6DA 3FOKA 3W7PA 3G0UA 1W0MA 1OF8A 4ZQCA 2WQPA 2GJNA 2RDUA 5K2ZA 3P5YA 1XFBA 4JTKA 3HG3A 1DL3A 3TW6A 1Q6QA 5EMUA 4IXHA 4LOCA 3S1WA 4P61A 3A9IA 3LLDA 4DBEA 4HPXA 1OYAA 3N14A 2DZWA 3I7RA 2A1YA 3W22A 5EA9A 1FCQA 2JBMA 3LTPA 4QITA 2CZEA 4FNPA 2TPSA 5BMWA 3LV5A 3W7CA 4X2RA 4GXMA 3DFQA 1YYAA 5KSWA 3FA5A 1H5YA 4HHPA 1QDSA 2Y62A 5CPLA 1SW3A 3STEA 3W84A 2A6LA 3T40A 4O28A 1W56A 3C8FA 3IGXA 3NL5A 1MEIA 2JGQA 3G8RA 3EX6A 3GKAA 3G1SA 1OX5A 1HUVA 2EF9A 4XZ9A 1GWJA 4H4IA 2HS6A 4IXXA 3LHUA 5C5YA 3W87A 4DO5A 1KTNA 1A5CA 5FEXA 1DKWA 1YTKA 3QPZA 1YTDA 1TPEA 2ZRXA 2A4AA 1KLZA 3WJWA 1LDCA 1JVNA 1TRDA 1SO5A 3O6YX 2C13A 2FLIA 3UZ5A 1LTDA 4ZQRA 3WK2A 3GKFA 4AHQA 3LRMA 4M19A 3STFA 4LW7A 1YLVA 4NNBA 3M5XA 4MJMA 2X1SA 1Z48A 1B57A 3LERA 1KFBA 2Q8ZA 1K02A 3W7OA 4N4PA 3R89A 2W0UA 2NV1A 2UV8G 4UTTA 2VFHA 3C3NA 3GXNA 1XKYA 1KM0A 3RF9A 2CLKA 2ZCGA 4GUHA 2GOUA 4OWGA 3FFSA 5TIMA 1ZAIA 4JY9A 1J2WA 1R2TA 4RXFA 1TSIA 1F76A 4E2DA 3TUUA 2C3ZA 3EXRA 4QISA 1I2NA 4GWEA 3O06A 3WJXA 4NU7A 2ZZ5A 1L6SA 3DH7A 5BW6A 4O17A 1NVMA 1GEQA 2V81A 4PCFA 4UCGA 2ZA2A 1GOXA 5G5IA 3W71A 4UTWA 4L4MA 5I3HA 6ALDA 3HQ1A 5C55A 3W70A 2E5DA 5IBXC 1SZNA 2AGKA 3SFKA 3W7DA 2XFWA 1T99A 3FJLA 5IM51 4NJGA 3DI1A 1F73A 3L65A 1G7VA 5AHNA 5LGXA 1F05A 2XN1A 3F1QA 3UWWA 1TJRA 5FEPA 2QCGA 4TU1A 3QH2A 3OIXA 3KVLA 4UFMA 4YMZA 3GR8A 1GPWA 1TMHA 2CLIA 4NXSA 4FX7A 2PRLA 1X7FA 5HWMA 2GVGA 3IVUA 1PCKA 3GNNA 4DF2A 5DN1A 5I3JA 1ZCOA 4CLMA 1ZFJA 1XC4A 1QO5A 3K30A 1FCBA 5L6UA 1PS9A 1GYLA 4AMAA 3W7NA 2ZTJA 1PE1A 2QCHA 3PBVA 1FX6A 2VFIA 4D2JA 1N7KA 3QMTA 4KKXA 3N3MA 2Y7FA 2X16A 3G0XA 1LLWA 2QCEA 2X30A 2YSWA 3P67A 4JD4A 5HUOA 2QUTA 1OFPA 4MYXA 4JTHA 3N19B 3KRUA 5F2LA 4O4WA 4PC8A 2ZTKA 1S3HA 3TROA 4UMBA 2Y7EA 1P4CA 3TC6A 4N4QA 2BSLA 2FPTA 2RH9A 3PUDA 4K7YA 1ZAHA 1SU5A 1GYNA 1IF2A 5D38A 1F6KA 3E96A 4LNYA 3H53A 3WFAA 3PVFA 3CT7A 1TPWA 4GUIA 5D33A 4AWTA 2ZZ6A 3O1NA 1VQTA 4DQWA 2J27A 5F4SA 3UWUA 4IMDA 3A21A 2GVJA 2CLLA 3V75A 3TW7A 3GIYA 1OFBA 1SPQA 3LI0A 5AOUA 5D37A 1SO4A 1G4SA 5FI8A 2LLEA 3BW2A 2ATMA 2QR6A 1PHWA 4TR9A 2NWSA 1V7YA 1VJIA 4A21A 1UUMA 1S5TA 3MP4A 4O16A 4ONVA 4CCCA 1LZOA 3CU2A 2EAWA 3OVQA 5AFDA 2VKZG 4IMCA 1MEHA 4LUJA 2WO5A 1H7OA 4IWWA 1JULA 5F4XA 1DJQA 3W2KA 3N2MA 1HG3A 4JTJA 4ORIA 4JYFA 1B3OA 1DOSA 1LOLA 1WV2A 3WJZA 3G1FA 4DF1A 2B7OA 2QF7A 5KITA 2PRMA 1AW5A 4RLIA 5AYXA 3DFPA 4UIOA 1QFEA 1EP3A 4MIMA 3B05A 1RVGA 1C9DA 1VYSX 4PTNA 5F2IA 1PL9A 3CEPA 4HPJA 3W85A 3SI9A 2J9ZA 3E02A 2J9XA 1ME7A 2QCCA 1TB3A 1VR6A 2JKAA 4G1KA 2ISWA 4NJJA 5DXYA 2B4GA 3UQNA 1L6WA 4NJHA 1W5QA 3HF3A 2BWGA 3GZ3A 4UR8A 3STCA 4EF9A 4UFHA 2R8WA 3TJXA 5BRBA 2QDHA 3QW3A 1SFLA 5KZDA 1HFBA 2PURA 1W5OA 4I7WA 3P5ZA 3M5ZA 3T7VA 2V8ZA 3KVKA 1HTIA 3KRZA 3VI2A 3S0CA 5K9XA 3HG2A 3G1YA 4DO6A 3C0JA 2CU0A 3FJ6A 3NR0A 3W1MA 2G95A 3LBMA 2GQ9A 4QIUA 1VC4A 3M44A 1XDLA 4BWLA 2Y7GA 2BTMA 3MW7A 3UWVA 4EVZA 2GQAA 3GDRA 3NL3A 3TSDA 1QMLA 4CQ9A 3HG4A 1X1ZA 1EB3A 3TXZA 2CLOA 3G18A 2ZZ7A 2D73A 4YWIA 4UFJA 5BMXA 4UR7A 1U5JA 1K3UA 4K38A 4JNMA 4M6VA 4LU0A 4CQ8A 2VEPA 1QPRA 3G3DA 3LXBA 3GNDA 4O50A 3TFXA 5KINA 2B7PA 2Y89A 4UTLA 4WX2A 1TPH1 2TSYA 4JICA 3LCIA 2WOQA 4UMAA 2X1TA 4RK8A 4UC5A 2Z0IA 1FWWA 2HTMA 3UXAA 3MP3A 1SUXA 3MYPA 3PAJA 4IPIA 3MHFA 3LTSA 3LXAA 2ALDA 3LHTA 5D2VA 4UTIA 3BG9A 2OZ0A 3TV8A 3L5LA 2ABBA 3W1QA 4QJ1A 3T55A 2XN0A 3ABQA 3GR7A 3NQ7A 3PM6A 2V5BA 1K8YA 2FTPA 4LVAA 4OBTA 3DGRA 1P5BA 2ATSA 5AHEA 3SGZA 3SJ3A 2V0TA 3GXTA 3NL2A 2CFFA 4DEFA 1BWKA 1SSDA 4YL2A 1Q6OA 3P80A 5D2XA 3E0IA 3QRHA 1AW1A 2A5HA 4IPJA 4MOZA 4LRSA 3S8HA 4Z1DA 3P60A 1ZNNA 2OT1A 3FKKA 1TTIA 4O53A 3ATZA 4XBSA 1ALDA 4AF0B 4YLWA 5D2WA 2C1HA 2HMCA 4HNVA 2VFDA 2G5WA 2QUVA 1JUBA 2B7QA 3RK8A 1GTHA 1VYRA 3W88A 3VE9A 1W3NA 3NDOA 3MBDA 2Y7DA 4AWSA 3ZWSA 4O0KA 1K8ZA 3PUOA 2ZBTA 2WNQA 3TSMA 4KWWA 1FY6A 3M5YA 5KZEA 1GQNA 3W7EA 5MHBA 3W1LA 1DBTA 3ELFA 2DU2A 2OT0A 4XTDA 3QJAA 3HPZA 2YR1A 1IGSA 3B0VC 3LHVA 1T96A 1QR7A 2QJIA 3IVSA 2DORA 4O0ZA 4AH7A 4GJ1A 1JRCA 1Z41A 3LOTA 2YDAA 3GLCA 4GFSA 1U83A 2VC6A 1QPNA 3DFSA 5FF0A 2DJLA 2DP3A 1SSGA 3TQVA 3N2XA 1KFEA 1YXYA 1UBSA 4RX0A 1SR9A 4MKNA 3KVMA 3NQ8A 4LV4A 5K7JA 4ICNA 2F84A 3NQAA 3RLUA 3PY2A 5EBUA 3KRSA 3UNDA 2QKFA 1FWNA 3DFTA 2ZZ2A 4JX5A 4TIMA 1PHQA 3N9RA 1I2QA 3VFLA 1F74A 4FNTA 2FFCA 4NX0A 4O8RA 5EL1A 2E5BA 4R33A 1H51A 2A85A 3W1NA 5SWUA 1EIXA 1G4PA 3I7SA 3PWAA 4UTWC 3QYQA 3SSJA 3BPWA 3Q2DA 3W1AA 4N6FA 3TAOA 1LOSA 4QQ3A 3VE7A 3NPVA 3HGSA 3QSRA 2YCEA 3PBYA 4WD0A 3MBFA 5HULA 4BK9A 1W1ZA 1B4KA 5U7SA 1OK6A 2A7PA 2NXIA 5ABTA 1VYPX 1S5WA 1JCJA 1TV5A 4LVDA 3LLFA 1J4EA 1H7RA 3B4UA 3IEBA 3LDVA 3O63A 4OV4A 2NUYA 2PRHA 5CKSA 2JK2A 1LRQA 2GUUA 1YADA 1R2RA 3MUXA 3L0GA 5G1YA 2NZLA 3QPYA 2V9DA 5AN7A 3EXSA 2QCFA 3F03K 3EKLA 1RD5A 3BLIA 3L0KA 4H6KA 3ZWTA 1D9EA 3B06A 4FHAA 3BLEA 3C52A 4X3ZA 4E0CA 3ZFHA 1D3GA 4LVGA 2G96A 1KTBA 4UXDA 4CNPA 2WPBA 2XN2A 3THAA 3ATYA 4ZQNA 1A5BA 3M47A 3W7HA 4NJIA 1LLZA 1VCVA 4M7SA 2I1OA 4UTKA 1W31A 1W37A 3R2GA 4S1FA 4PODA 5LZLA 1EA0A 1FWSA 3RNDA 1BKSA 1S5VA 3NNTA 3BK0A 1MO0A 1R30A 1MZHA 3KX6A 4MUZA 3IVTA 1KV5A 4HKPA 3C56A 3GAYA 3LV6A 3W2LA 3C6CA 3HIJA 3HB9A 1QPOA 4ZVJA 3QMRA 1XBXA 2E6FA 2ZRYA 3R12A 3U8GA 3LCHA 4RZ4A 4JDYA 4JXCA 1KM3A 2WSRA 5EY5A 2J6XA 4KFPA 5H91A 2C18A 3W6YA 3TMLA 3UPBA 3CB8A 5HWJA 1FDYA 2QUUA 2C15A 3QF0A 5F4WA 3SR7A 3EXTA 5HINA 2TMDA 1TRIA 3LBCA 4PEKA 5I3GA 1HO4A 4JTIA 4N9CA 3E12A 4JIPA 3LRKA 4N02A 3MI3A 1EX5A 3FKRA 5G4WA 4UTJA 4O10A 4GNJA 1F2JA 1XI3A 2C0AA 3G1AA 3KHJA 1XBZA 4OU1A 3W7IA 3L66A 2R91A 4PL1A 8TIMA 1KM4A 3U2OA 2E6AA 1JCLA 1JCMP 1FDJA 1DV7A 3HG5A 1ZALA 2CLMA 3H54A 3YPIA 3KVJA 3GAKA 1JRBA 1EP2A 1LBFA 2WNZA 1NAL1 3EWUA 1WOBA 1WBJA 3T44A 4LC6A 1L2UA 1MSSA 3V1PA 1GVQA 1K8XA 3WK3A 1OYBA 3PS7A 1KM6A 2J9YA 3CPRA 4JY8A 4UUIA 1BTMA 3CC1A 1F6PA 4U4MA 1TYGA 1SW7A 2QCDB 4M6PA 3EX4A 4ADUA 3NQFA 4JX4A 1AMKA 1B9BA 1X1OA 1M6JA 2WSYA 4CNNA 4Q32A 4WOZA 2YGYA 4UFIA 2Y88A 2H8ZA 5LKYA 5AHFA 5CSSA 1TPVA 3O05A 2Y6ZA 3RFAA 3B8DA 5DBTA 3RMJA 1ZY9A 3EWZA 4NVTA 4X22A 4NXKA 1OABA 2YX0A 2A6NA 4RR4A 1AL7A 3OVRA 3LCWA 4JTGA 4YCPA 4LRTA 1IXQA 2I14A 3LB0A 2V5LA 2Z2UA 3IIVA 4Z0SA 4O1CA 1WOAA 5J5RA 1QAPA 1ICPA 1UB3A 1N8FA 2NXGA 1IIHA 1RV8A 4JTSA 4JTFA 4NNCA 4ALDA 1KFCA 3CEUA 4BWLC 3TCEA 5BNKA 1GJPA 3I68A 4JTUA 3THQA 3FYPA 3G1DA 6TIMA 4PH6A 5E93A 1FWRA 4WQ6A 3W23A 1H50A 1UCWA 5CZJA 5CZTA 3ABRA 1VLWA 3CLMA 2ZYFA 3E49A 3S1XA 4ZMGA 2X1RA 1LOQA 4YCOA 3C4UA 4WY0F 2VELA 4JEQA 3OHIA 4JDBA 1L9WA 1PCWA 2KZHA 4UTHA 1KM5A 1AL8A 2RKXA 2A7NA 3RLVA 4AHOA 5HUPA 3R8RA 4I9AA 2YW4A 4HNNA 4ADTA 1VCFA 3P62A 3KFTA 1OFRA 3T4CA 5AYZA 1H63A 4OV9A 4QAIA 3OEXA 4I7VA 3HMJG 1VS1A 1QOPA 3NQGA 3NQMA 3LM7A 3DZ1A 4BI7A 5DY2A 1O4UA 2FDSA 3M16A 1Q6LA 1R2SA 3QQ1A 3IIZA 3W7KA 5F2GA 2VEMA 3UZJA 3A24A 2GJLA 5EKYA 3JRKA 3EX2A 2FPYA 4C1KA 1OYCA 2ZZ4A 5G4EA 1WXJA 1C29A 3S5ZA 1LBLA 3GDKA 1OVDA 2GQ8A 2CWNA 4FNUA 2H8XA 1XDMA 1TV7A 3A22A 1F7BA 3DBPA 5J5DA 1DJNA 5DBUA 2PC4A 2WJZA 1EWEA 4OHQA 3MJYA 5T26A 1ZENA 3M6YA 3JS3A 5D05A 3Q37A 3NAVA 2QCDA 3R13A 7TIMA 3NG3A 2R14A 4HSOA 3LHWA 1W3TA 3QQ0A 4XWUA 1LORA 1CW2A 4HSNA 3ZS4A 1FWTA 3CM4A 1C8VA 4O4VA 3T78A 3W1XA 1B4EA 1FXQA 1KLYA 1XUZA 4WUIA 4I7UA 3UPWA 4Q33A 3NA8A 4FEZA 3RU6A 1GVRA 1XCFA 3L68A 2ZZ1A 3W1TA 1G4TA 1H1YA 4RZ6A 3EWBX 3PSWA 1CI1A 1I4NA 1JJKA 3LHZA 2V2DA 3KAOA 5K9CA 1YPIA 1DVJA 4UFLA 5U4NA 3G1HA 4RV8A 3MI6A 3TH6A 3VNDA 4K6AA 2J88A 4LUIA 3HGJA 1RQHA 1KV8A 4AAJA 2NX3A 2G97A 1TTQA 1A5SA 2GVLA 4L4LA 1M7PA 4R7JA 5CZSA 3DHDA 2ZRVA 4O19A 1XXXA 4ORMA 3H55A 2RDWA 4N2YA 4LS1A 1MXSA 3UWQA 2FPVA 2ZDRA 3W7QA 2E6DA 5BOOA 2J24A 1KFKA 4IQLA 1OJXA 1OX6A 3SIZA 2O7QA 4TO8A 4AHPA 1I2OA 3EX3A 2CZ5A 1OFEA 1OFOA 4UFKA 4P2VA 1JUEA 1OX4B 3HGRA 3UXDA 4GUJA 2FJKA 3MMTA 1YXDA 3W7MA 3O16A 3B0UX 2I9EA 2JKEA 3PR2A 1FBAA 1EPXA 1QOQA 5HWNA 3NQEA 2ABAA 3WK1A 1TPC1 3HPSA 2OX1A 5FEZA 3TA6A 3A5VA 2PE4A 3CIXA 1T0OA 2VEIA 4M6QA 4XTIA 1WAUA 4FB7A 1DHPA 4O15A 5D09A 1RQBA 3MI2A 4LY8A 4CCEA 5E0KA 4K8HA 5CGQA 5D32A 2V2HA 5FESA 2ISSA 1QNVA 2YW3A 2O7SA 4MFDA 4MPQA 3W83A 5L9FA 1K7EA 4JTLA 4PA8A 4ZQMA 3G8EA 1ICQA 3BGJA 5FF7A 1ME8A 4NJKA 3G3MA 4EF8A 2QAPA 4BF9A 1JCYA 3L5AA 2V82A 3LXCA 1OFQA 3EWYA 3S6DA 2P10A 3IIXA 3M0ZA 4A22A 5LHEA 4QNWA 4MZ8A 4AEOA 3M7WA 2Y63A 4Y96A 2BX7A 3W7LA 4AVFA 3NPXA 1WA3A 3P82A 1OF6A 1AK5A 4IMGA 4WY0B 5I3FA 3BO9A 5GVJA 4K8EA 4MLJA 3QM3A 1KM1A 3SY5A 4WOQA 1X8FA 2R94A 4LTSA 5LNUA 3WJYA 1J5TA 3TDFA 2HSAA
chains in the Genus database with same CATH superfamily
2XVPA 4Z1CA 3TKFA 3W07A 2UY5A 5A8OA 1TO3A 1RZMA 3AZTA 5D04C 1M68A 5AC8A 5CLTA 3K4AA 4NQ1A 5TNVA 3RJYA 2FGBA 4PUEA 2WSQA 1M7OA 4FP1A 3W7JA 4LS2A 3CB3A 1S2TA 3HV9A 3GB6A 2WW5A 3U2EA 2HV5A 2DT1A 3FVMA 3BSGA 4LBUA 3VOFA 3LI1A 3WDJA 4CN6A 5A8NA 1XIHA 1A4MA 1H7XA 5BWFA 1I75A 3W6LA 4JN8A 5BXTA 2Y70A 3FJNA 4ZL1A 4UMCA 4HZ6A 3USZA 3BG5A 3VDCA 3A5FA 1JYVA 1HNYA 2ACSA 3NGJA 1Y5WA 4GKLA 3RGTA 4WXZA 4U28A 5F1UA 3PULA 2AMXA 4OGZA 5M1TA 3PF3A 5HA7A 4NZ1A 4RZ5A 1AH3A 4C6KA 4NZ4A 2OQYA 1ZJIA 2HBVA 1F6YA 2BY2A 1VRDA 1Q2RA 4NNAA 3L2IA 1SZEA 1RJQA 1HIZA 1VKFA 1WDSA 1DWIM 4R53A 5CBJA 4Y9AA 2H6RA 2YL8A 3OGVA 3LPOA 1NTHA 2I5QA 1RBOB 1B3ZA 2VWSA 1XPYA 3K5XA 2NX9A 4G9PA 3RUBL 3ZXWA 5JU6A 4WDXA 3LPPA 4DJDC 4IF2A 3VC5A 4ZOBA 1XINA 4ENLA 2GSEA 2WMHA 3AJXA 1VGAA 3V0UA 2EHHA 2X0SA 1BYDA 3WD1A 1B31A 4ZXLA 2E68A 4JFSA 5CGTA 4AF0A 3FY1A 1U30A 2ZOXA 3WQ5A 1A50A 1MRQA 3D46A 1Q45A 4HCHA 2A3HA 3TQ0A 3EB3A 3PBUA 3B0XA 1NEYA 3TLLA 3TR2A 1ZAJA 1T8XA 3UERA 1CPUA 3I4EA 4K7VA 2FKPA 3T2QA 2W63A 5M17A 4AEEA 3MSYA 4XISA 5EU9A 3VGEA 1YDNA 4O13A 3SCRA 5K4XA 2YFNA 3L4TA 3VKAA 3VCRA 2AOSA 1GQKA 1MQPA 3HOJA 3KXQA 4B9YA 4E4UA 3NQDA 3DI0A 1TV2A 4KEVA 1LG2A 3K8KA 3VIKA 1F9CA 3W7RA 3THUA 1X97A 3R11A 2WZHA 4LVFA 2AAAA 1VFOA 3N4EA 2P0IA 3U2ZA 5TQLA 1V02A 3CTLA 4JYDA 3CQJA 1TJ1A 2KX9A 4ROQA 2OYMA 2CESA 4PYSA 5IDIA 3LG3A 4ICCX 3M41A 4Q8PA 4IJBA 2PBGA 1E72M 1E51A 3AMLA 1ADSA 2YPIA 3GNPA 3ABSA 4YXGA 3CHCA 1YBQB 2PTDA 4HA4A 1QHOA 4KCWA 3W0KA 3RIKA 3G22A 4GC4A 3NQ6A 3CZLA 4AZCB 5CG7A 4LANA 4TMBA 4XSMA 3I6TA 3RM4A 1BEUA 3ZR5A 5D03A 2XPKA 4BI6A 4CNTA 3CYJA 5JBEA 3MZNA 3TQKA 3HBLA 1JL8A 3H12A 1ONRA 4GC3A 4GZEA 4MZ1A 3SIMA 2QUNA 4AZ6A 4MFEA 1XYCA 4F9JA 2W6RA 3KBWA 4FF5A 4IP7A 3EOUA 1UG6A 4FPSA 1E6PA 3AXXA 2NLIA 3HJZA 1YTEA 1KGWA 5DY3A 4W5UA 3NGFA 3HU7A 4FOUA 4GVGA 1HKIA 4CEXC 4J2MA 3U5YA 3W76A 2DJXA 5I23A 1P0DA 1IE7C 2Z24A 4LVBA 1K9EA 2AL1A 2HROA 3SQLA 3WLOA 5I6SA 4H8HA 3MYOA 1TPUA 2QEZA 3UVAA 5CAHA 3PWIA 7XIMA 2ZC8A 3H4WA 5FAJA 1U1JA 2V5CA 3UNTA 2NXHA 4FIRA 1JZ4A 1VF8A 1GVEA 2Z2AA 3VD9A 1Q6GA 3B0PA 3E2QA 3CIWA 5HATA 1PIIA 3KTXA 1G4EA 3VDAA 1HXJA 5DCBA 3ZR4A 3A3HA 3W28A 2ZX5A 4X9SA 4QG9A 1X6UA 1EYEA 7TAAA 2VO5A 2OCZA 2OQLA 4IMFA 3C8NA 3GYEA 4GYFA 2PDIA 1AW2A 3BG3A 3MMDA 2PWHA 1AD4A 4RCXA 1W1VA 1YNYA 4OE7A 3WLHA 4Z1BA 1KFLA 2CKSA 4DJFD 3GHTA 1LYXA 1GKRA 3FYOA 3UG8A 1E40A 1LQ0A 3T81A 4Y90A 3VX1A 1TPFA 3DFOA 1WDWA 3H7UA 1IEXA 4WF7A 2FHBA 4DBDA 4ZB2A 1PKNA 4XKYB 2QPUA 4WJEA 2I57A 3N73A 3KL0A 4OJYA 3CHVA 4MNKA 3POHA 7A3HA 4DAIA 1GVFA 4ZA0A 4A4AA 1ESWA 1R8LA 2VR4A 1UZHA 3F4WA 3FYYA 3CO4A 3SQSA 3LNPA 3LM3A 3TLQA 2GVEA 3AMCA 4F0LA 1Q13A 3N9SA 3CQHA 3STGA 3TC7A 1G67A 2PDGA 3QHOA 2I5IA 1HO1A 3U6WA 3SCPA 3OBKA 1UR8A 5DMNA 1EXPA 4TX9A 1I0BA 1XIEA 4A8NA 1PYFA 3VMPA 3B04A 4H8UA 1VBUA 2VDGA 5DCDA 2GK1B 4AZHA 1S2AA 1EZ2A 2QVNA 2WHJA 2I7GA 3CPGA 3T07A 5LNSA 1N82A 4S23A 2YCLB 1EEPA 3PG9A 4JOMA 3OLDA 3KTCA 2Y61A 3LMZA 1ZBKA 3R43A 3URAA 2BVDA 4MY1A 3R6IA 5JBDA 1PB0A 1NARA 1UWUA 2ZUWA 3BTNA 4JQ2A 2Y8UA 3UYCA 4GPNA 3K8MA 1S5MA 2Z26A 3CUHA 4KFOA 3BLKA 4CNUA 1GOWA 1A0DA 4AU0A 1V8EA 2PS2A 5I3KA 3ANYA 1GT8A 4XBKA 2PWFA 2VXNA 5G2WA 1GONA 1ZPTA 2J66A 5CPOA 1EUNA 3AICA 5FIPA 4EWND 1I2RA 1PO9A 3OQ8A 4UB9A 1TJPA 1QPQA 1RBLA 1J93A 2NQ5A 1DWJM 3VD7A 3TU9A 2HEJA 3GXPA 3INPA 3NOEA 3UWZA 4Q7IA 5G1TA 4LC8A 1EUAA 5A2BA 2ZA1A 4GGHA 3L2LA 2NUXA 1H61A 2PGWA 1TMQA 1UKOA 2DT2A 4G7EA 2ZQ0A 4EAMA 4R9XA 3SB0A 1SJBA 4S2CA 3L21A 1AMYA 1YQ2A 1LQ2A 1C91A 5TD4A 2PMQA 4PZVA 1HKKA 4K39A 1HQTA 2CZDA 4FI4A 3EB2A 3BGAA 4LNCA 4YTTA 2YBVA 3QZEA 1JIBA 4NG3A 4FXSA 2XFFA 1Z69A 3E2VA 4XQ6A 4G1NA 5HMSA 5HR7A 3P8IA 4MDPA 4EKJA 3MDWA 3I3BA 1OD8A 5CZ0A 2P53A 4V15A 1GOQA 4KS0A 2QGHA 4I90A 2QAFA 4EPDC 4UOZA 4A8RA 4BFAA 2BZNA 4LEFA 1BVWA 3DC8A 4MSSA 5DELA 2Y5EA 3LCGA 3L5MA 1HJWA 3VIGA 1VH7A 1M5WA 4DELA 1V77A 1W2VA 2RDTA 3JR2A 3VNJA 5KTLA 1XBVA 4DBSA 3T0BA 1DIKA 3HGOA 4O1DA 2G41A 4M7TA 2PDCA 1DQXA 1T5AA 1MNZA 1A3HA 3N4AA 4O12A 5AC7A 2WMGA 3WQDA 1V79A 3TXVA 3PPHA 4Q4OA 1IXPA 2ZC1A 2Z29A 2EKCA 3RILA 3RCMA 1AH0A 2WQPA 4I8YA 4LH8A 2DEPA 2WJDA 3TW9A 4QS6A 1EGZA 1W9UA 1W2PA 4LSBA 3BL3A 3HG3A 4PMQA 5EMUA 1T7LA 3H2NA 3S1WA 3LLDA 3FW6A 4DBEA 2NSXA 4XVDA 4DUOA 2R82A 2V68A 3I7RA 4EXQA 2A1YA 2JBMA 3S9IA 4FLQA 4FNPA 2TPSA 5BMWA 3HQOA 4LJ3A 3TN6A 3DFQA 1W9VA 1YYAA 4NZCA 4C6IA 2Y62A 2I5GA 4GKTA 3ECQA 3P0XA 1DJHA 1V93A 3MWCA 1UPPA 3UESA 1BKHA 4H2CA 1BVZA 3H2EA 4WSHA 2CIPA 1RCOB 2X0HA 2FJUB 6TAAA 1O1HA 3DECA 2E9MA 3NFUA 1KO0A 3B8IA 2FMOA 3QPZA 1CB7B 5IFTA 2ZRXA 1F3XA 1KLZA 1LDCA 1JVNA 3AIVA 3KS6A 3WJWA 2C13A 2VOTA 4QDPA 2ASHA 3WK2A 4F2TA 3LRMA 4M19A 3STFA 1YLVA 5EMMA 2WANA 3LERA 3MJMA 5CJMA 2JEPA 4I9MA 1XG3A 2W0UA 5C7HA 3BJFA 4UTTA 4LGXA 3S5SA 1DQUA 3WUFA 1W6TA 1E5NA 3RF9A 2CLKA 4GUHA 2WC3A 3M0LA 4WDUA 1OSEA 3CAQA 5LIYX 1R2TA 1UWQA 8RUCA 4E2DA 4RDZA 2DDXA 2WZEA 1GQLA 4IQJA 2W27A 3EXRA 3AIUA 1I2NA 1S3TC 4GWEA 1OGBA 4HA3A 5CC7A 5M03A 2ZZ5A 1L6SA 1Z6KA 2WVTA 2ZXAA 2GJXA 4GYPA 1NVMA 1JD7A 5G5IA 3QZAA 4KIEA 3MS8A 6ALDA 3WNOA 2E5DA 1SZNA 1D3CA 1J01A 3RRAA 5IM51 1K77A 2V3DA 4NJGA 3L65A 4L61A 5LGXA 3VFCA 2XN1A 3F1QA 4F2BA 5FEPA 2QCGA 3GH7A 4TU1A 4UFMA 1LQAA 5HK4A 1GPWA 2CLIA 3B8WA 2PRLA 1X7FA 3WG6A 5HWMA 2VNCA 2GVGA 3TTYA 1UWIA 5DN1A 5C9ZA 4PB3A 3GG7A 1MUWA 5L6UA 4HN8A 3OOQA 4JIEA 3FHAA 2GOKA 3QMTA 4KKXA 3N3MA 2X16A 2FZNA 4PCPA 5BWAA 2O55A 2NVAA 5HUOA 1QNPA 2QV4A 4MYXA 1FHVA 2R9RA 2Y7EA 1DWGM 1NWTA 3TC6A 2FPTA 4D6IA 1SZRA 4UBPC 4K7YA 1ZAHA 4XD5A 5A95A 4AG0A 4S3GA 3FSTA 4TVDA 2NQLA 1MMFA 3H53A 5I07A 2R24A 3ANUA 4HNLA 2D22A 3LNMA 3W02A 4JTDA 1PEZA 5I79A 1U5HA 4AWTA 3RCYA 4BS0A 3O1NA 2Y2WA 4W7VA 3UWUA 3QTGA 3CHFA 1A0CA 3TW7A 3GIYA 1OFBA 2NQHA 1UWSA 4HPNA 4Y2WA 5EMYA 3KTSA 1CLVA 3VNLA 5HNUA 1JD9A 1VJIA 3H23A 3BMVA 1UUMA 1S5TA 1PX4A 1ZS2A 1YW1A 4ONVA 4LUTB 1DJZA 3WEZA 2EAWA 1AODA 3OVQA 5AFDA 2X8RA 2VKZG 1T41A 2AQVA 2WO5A 1XLLA 4IWWA 5F4XA 4XG1A 3N3TA 4I5RA 3QYSA 1WV2A 2Z27A 2EPLX 3H2CA 4DF1A 3NTYA 1HGYA 1QFEA 5DT5A 1XSKA 4JHZA 1K70A 3B05A 4J27A 2G4JA 3CYVA 5CEWA 4RV3A 4DBWA 3GS6A 5ABEA 1FHLA 2QCCA 2JKAA 2J79A 2B4GA 1W5QA 1KRMA 3DESA 2QVHA 1HP4A 3T1GA 2R8WA 3GH5A 3TJXA 4Y9OA 3UWEA 1D2KA 1SFLA 4DUWA 3NZPA 1HFBA 3ONCA 4YHGA 4I7WA 3VNKA 3KVKA 1HT6A 3OG2A 2CZVA 2PD9A 4Q8OA 2E4TA 1LL7A 3FXGA 4W89A 4ZO9A 5MKGB 4DO6A 3HFTA 2QUMA 1OIFA 1JG9A 4P8WA 4AWEA 1XQKA 1ISXA 3D5HA 2G95A 2GQ9A 4C6BA 2X0YA 4GZIA 3LUTA 3MW7A 3UWVA 4EVZA 2C7FA 5DFAA 5I77A 4R7OA 2E40A 2AKZA 1CEOA 2ZZ7A 5BMXA 1ZZMA 3MPGA 3W37A 4KERA 1PZ2A 4LU0A 3P3BA 5ECUA 4LY4A 2VEPA 2YCIX 2WYSA 2INFA 3LXBA 3TJ4A 5KINA 1E1FA 3VOHA 4F4RA 4WX2A 1ZJBA 2TSYA 5F7UA 5GNXA 3EMQA 2NW0A 3UXAA 3OLEA 1G1YA 4C6FA 9CGTA 1NH6A 1P43A 1AQMA 3GTHA 3TTSA 3LHTA 3SN4A 4PMOA 3ZOAA 3L5LA 3G2GA 3W1QA 3SN0A 5A8PA 1RJRA 4QJ1A 3H7RA 3ABQA 3GR7A 4Q8MA 3NQ7A 3PM6A 2V5BA 4TX6A 5A8MA 3W82A 1K8YA 2FTPA 3F5JA 4LVAA 4OBTA 1P5BA 2J8TA 4QJ5B 2V63A 1CECA 3NL2A 2CFFA 2DT0A 1SSDA 2XSBA 4FS9A 5D2XA 4S3DA 4ZXOA 1OG6A 4IPJA 1BWVA 2HZGA 4REQB 3PTDA 4Z1DA 1ZNNA 3MKKA 1TTIA 2OODA 4XBSA 1EDGA 4OBSA 3WYZA 1UR1A 1H41A 1J0YA 4HNVA 2VFDA 2QW5A 4XO7A 2BG5A 1VYRA 1KRAC 4DVOA 1FFQA 2PC8A 2Y7DA 4AWSA 3K4WA 3AUJA 1K8ZA 1CCWB 1MNSA 1UH2A 1UH3A 1KXHA 3H2MA 1SGJA 4KWWA 3PTMA 3A4AA 3UXIA 3ELFA 3JZEA 2OT0A 2XWEA 2YR1A 4I6VA 3LHVA 2DORA 4GJ1A 4QJ3B 1DWHM 3GLCA 1VFFA 2VC6A 5A6JA 1QPNA 4KH2A 1TWSA 2D3LA 2X2YA 2DP3A 3T0AA 3URQA 3GM8A 1QW7A 5LIWX 2ZX7A 4LV4A 1DJGA 3KCJA 4GYKA 1ZLPA 3PY2A 1V3LA 4FR6A 2QKFA 3CXOA 4N42A 3N9RA 3WLNA 1RPKA 1F74A 4FNTA 4NX0A 1R87A 5HAOA 4YJ5A 4KWUA 2HPMA 1UOKA 2RAGA 3ITYA 1H2JA 1LT8A 4LQ1A 4RDWA 3WQOA 1DYSA 3Q2DA 3VZYA 3U7VA 1ISZA 1OC7A 3N1AA 3TYUA 3GNOA 3D3FA 1B4KA 3UZYA 3BANA 1TR9A 1QK2A 1JCJA 3AHXA 1J4EA 1JZ5A 2GVYA 5AZ1A 5CSYA 2GYIA 1GOIA 3O63A 3GU1A 4OV4A 2JK2A 2GUUA 3MUXA 3L0GA 5G1YA 2NZLA 2OKTA 4QQUA 5AN7A 4QX4A 3H4GA 4HA0A 1RD5A 4H6KA 4B3LA 4FHAA 3W4RA 1CGUA 1PZ3A 3RG6A 1JGMA 2GFTA 2WPBA 4Y8EA 4NJIA 1VCVA 1E1EA 1HW6A 2PDPA 1Q5MA 4BQ5A 5LZLA 4K2SA 1EA0A 2J78A 3NWRA 2OYKA 1EQPA 1QNQA 1GVIA 3KOZA 3C56A 2O56A 1QPOA 4TUFA 2OO0A 4ZVJA 5BRPA 1XBXA 3R12A 4GO8A 3CTTA 3O2LA 1XLMA 2WSRA 3AIBA 2GJPA 3IACA 3CB8A 4A05A 3F4CA 4JPGA 4XIMA 1OGSA 5F4WA 5JH1A 4WJ8A 3GUGA 1Q7ZA 4OECA 2PP1A 2A79A 1EF3A 2Y8VA 1E1CA 1LUCB 2FGZA 3QY6A 3GXIA 2GSJA 4O10A 2FDMA 1X6NA 2YZ5A 3SRFA 3G1AA 4DWSB 3CK5A 3LA4A 3L66A 4QDMA 2WQDA 2E6AA 1JCMP 1UD5A 3HG5A 2CLMA 4PMDA 4XV0A 3GAKA 5A6BD 2WNZA 1E4IA 1NAL1 1WOBA 2ZVRA 1WBJA 3EB4A 4GX8A 4KW2A 2OOGA 1GKQA 5M2FX 1K8XA 3LSCA 3PS7A 4JY8A 3CPRA 4I9JA 4UUIA 4DXXA 5BXSA 2PPGA 1F6PA 1Q8JA 2DUXA 2CC0A 1WXZA 4M6PA 3WBWA 1GJUA 1RCXB 4S38A 3PNZA 1X1OA 1M6JA 1VPQA 2YGYA 1HF6A 2H8ZA 2P8CA 5CSSA 1TPVA 2EBNA 3CHEA 4EPBC 4X22A 3L23A 1U33A 1X98A 4RR4A 3VD4A 3FGCA 1IXQA 2I14A 2UZ9A 3P2VA 1JI1A 1E6NA 5CC3A 2Z2UA 1KKOA 5LA2A 4Z0SA 1P6BA 1CXIA 3GVWA 4PE8A 5J5RA 4U2YA 1ICPA 5CBBA 1N8FA 2NXGA 4WCJA 4LYQA 3S46A 3BQ6A 5JQ9A 3B8SA 4CVWA 4NNCA 4F2UA 2OSXA 2VC7A 1GJPA 3I68A 4JTUA 4HZMA 3FYPA 4PH6A 1TX0A 1XISA 2IPWA 1H50A 1UCWA 5CZTA 3ABRA 4C60A 4PRRA 3CLMA 4Y9NA 3ZJ6A 3GY1A 4YCOA 3C4UA 5CPTA 3AXKA 1E0XA 4WY0F 2QIIA 4D6FA 4PMJA 1L9WA 1TR1A 2BFGA 2A7NA 1JZ6A 5JUVA 4HYVA 5C71A 4HNNA 3CUJA 1K9DA 4ATWA 3KFTA 1OFRA 3T4CA 1E43A 2YBUA 3E0VA 4B5SA 2OLSA 3NUKA 3RX2A 1DJXA 5I78A 4I7VA 3APYA 3CH9A 4M81A 1QOPA 3VNIA 1P0EA 3R79A 5FCZA 3U7BA 4BI7A 2GUBA 1WKDA 4L1XA 3KBMA 3PZIA 3VNZA 3ZIZA 4KPLA 4E3TA 5EKYA 4B4HA 3W26A 3AMGA 3ABZA 3WDIA 4AEFA 1OYCA 5G4EA 1LBLA 4Q7NA 4XK2A 3BMXA 4FNUA 1XDMA 1TV7A 1KBBA 4RZBA 1DJNA 3FDKA 1WNOA 3SO7A 1US0A 1NP2A 4V33A 5HJYA 5BCAA 2JQXA 4PULA 1FFRA 3NAVA 2QCDA 3GTNA 2F6XA 1FWTA 3MSDA 1CT5A 1O66A 1C8VA 1LWJA 2OOFA 4EXAA 4LEQA 4WUIA 1A49A 1RAKA 4X9YA 4J3WA 3GVVA 3VGDA 2H9AA 4B9ZA 2OZ3A 1GVRA 1UWTA 3PTQA 3FJ4A 3L68A 2FZMA 1OCBA 3BZGA 3W1TA 1H1YA 1GQIA 1XIDA 1JXKA 4KEMA 2WMJA 5K9CA 4GG9A 4Q3MA 4AW7A 5U4NA 3MUY1 3TH6A 4MNJA 4K6AA 2J88A 3WF4A 2QPSA 2Y5JA 4GQGA 1RQHA 3TA9A 2NX3A 3IS4A 1WZLA 1M7PA 3WQWA 2ZE3A 4ORMA 2RDWA 4GLEA 2Q09A 4HZ8A 4JZ5A 1BYCA 1R38A 2E6DA 5BOOA 2J24A 3GHRA 3BAWA 1OJXA 2P5NA 1MWOA 3NSXA 4W4QA 4TO8A 4AIUA 1HJQA 1OFOA 3WUEA 1A5MC 2FJKA 3MMTA 4M6UA 2JKEA 3PR2A 1QTWA 2ON3A 2GDUA 4MJ2A 2XG9A 4OKDA 3NQEA 3ZO9A 3WK1A 4GINA 1FWBC 2HQAA 1WO2A 5FEZA 1WZAA 2DH3A 1PX8A 1C92A 2VEIA 4M6QA 3RX3A 1WAUA 1RQBA 2WLZA 4K8HA 5FESA 2YW3A 4GNKB 2PF0A 5CGMA 4MFDA 1TZ7A 3C0QA 3MKVA 4PA8A 1W1IE 4W84A 1ICQA 1V6XA 2QF8A 1ME8A 2E1WA 4BF9A 3DG3A 2V82A 4J3XA 4ROPA 1K9TA 3M0ZA 5LHEA 4C6MA 1U22A 1E0WA 2XJ7A 4AEOA 4GI4A 5CC5A 5I09A 3Q67A 3W7LA 3NPXA 4IMGA 2BY0A 2D2GA 5E6ZA 1YRRA 3MDUA 3BSMA 3AXIA 1W17A 1UYQA 2R94A 1PBGA 1UKQA 3RM9A 4HP5A 2FFIA 4Q8NA 2PCQA 3GK0A 1QI3A 1QOXA 4IFKA 1UMLA 3IGUA 4GQ0A 1NFBA 1W1TA 3MY9A 3DKJA 3GR4A 3TONA 3WLIA 3C2OA 3TOPA 3RITA 1ITCA 4ZTXA 4A29A 3KBSA 4E38A 1IZCA 1GPFA 4YIWA 5C8BB 1KM2A 4Y9MA 2VQTA 3WX7A 4C5YA 1JCNA 1LG1A 3TK7A 4XAPA 2DUAA 2OLAA 4DZIA 4QTGA 4GBUA 1ONWA 2HE5A 3HFYA 3EPOA 3SUWA 3G6MA 3UR2A 3G1XA 4HD5A 3HPAA 3M1ZA 3MB9A 3AYRA 3PSVA 1WDRA 3PBWA 4H7ZA 1UJPA 1XGDA 1SZGA 3HV8A 1PTGA 2XIBA 2ZRZA 4UQEA 2ZXDA 1VLIA 3UR8A 1B5TA 5E09A 1CXLA 1J11A 3S2LA 3SCSA 4KEUA 5E9AA 1TIMA 2BXZA 4PB4A 1R6WA 4Y6GA 3C3UA 4O1EA 1GVSA 4W8LA 4LAOA 4KRZA 1YE4A 3HA1A 4CNOA 4B90A 2PODA 3L4XA 3STPA 4HSHA 3SW6A 3DYMA 4Q8QA 4IIDA 4HNUA 5K4ZA 1VFMA 3CUGA 1A5NC 3O6AA 1W5MA 1BXNA 2PZ0A 3SCVA 5IFPA 4W9TA 3W7GA 2BASA 3IK2A 4IPLA 3EKZA 3KEHA 3TJIA 3ZT6A 5FF3A 1BXBA 3LCLA 2PDKA 5HJLA 4AB4A 1IXNA 5CPMA 1LM1A 4H8VA 3QV7A 4NT0A 2EPOA 1P1XA 4D6HA 2F38A 2CCRA 4UZSA 1WDPA 3A23A 3GE7A 3S6OA 1FCVA 1YXCA 4B5VA 2WBGA 3OVPA 3WLJA 4DXVA 1G6CA 1TVLA 4MVAA 1MYRA 3EA1A 4X2PA 4PN2A 1XLKA 1DXIA 4JCLA 4GY7A 3GW3A 2Z6IA 4XVEA 1WYIA 4F79A 3WIJA 3ARQA 5LGZA 4DJDD 3O15A 1TPB1 2VCBA 4CCDA 2DW6A 4DPPA 4HVXA 1XFCA 3I3DA 3P84A 4S2BA 4KWVA 1IHIA 3E6EA 3WQCA 2VI0A 1DIDA 4KIRA 4C1LA 3AC0A 3IIPA 1RLDA 5ABGA 5ABFA 2P8BA 3ARPA 2FZ8A 4P7RA 3MUCA 5FF4A 2ISVA 1UA7A 4MY8A 3GXFA 1RQEA 5CSRA 3WF1A 3CZGA 1E3XA 4ICMA 3GBEA 2A3AA 3W00A 2WCGA 1LWIA 1YDVA 2UY2A 3AXMA 4MY9A 1SJDA 4N9EA 4O1AA 1CXFA 2YBTA 2ZX9A 2OTDA 3LRLA 5FF2A 4ZB5A 4DWSC 3V1HA 4C1NA 4FIQA 5JH2A 2PDXA 4WR3A 2IQDA 3W74A 4MLRA 1V51A 1GZGA 1KBIA 2B81A 4DN1A 3S2JA 3GW0A 1KWGA 5C54A 2NVCA 2E1DA 1XM3A 3KBNA 1E6XM 1XRTA 1JDDA 4QDWA 1HP5A 1W3KA 4CQBA 4YYCA 5BRQA 3JVAA 3C2YA 5D9OA 1O94A 4PSRA 2BHZA 1XUUA 1EOKA 2D20A 1JNEA 2O9OA 5AC4A 1O95A 4XD4A 3W73A 2VOMA 3VM7A 4S3BA 3BSHA 4AD5A 3OLIA 3TX9A 4A3UA 4MF4A 1DORA 2RHGA 4AC1X 1O60A 5FEWA 1EQCA 5F2MA 1KTCA 2VTFA 4HIBA 3VIPA 1OFAA 1H62A 5C9XA 1NWRA 1A5KC 1FP8A 3PUGA 1V0LA 1J6OA 1FWFC 3W72A 2UY3A 2ISFA 5C2XA 4I9TA 5AZ0A 1NF7A 4PUMA 3I6EA 4QLKA 3NEVA 1JPIA 4NZ5A 3UCCA 3PFMA 3I65A 3F4NA 3HJEA 3KW3A 3VGGA 3OA3A 4M8UA 1JR1A 2C8NA 4FXJA 1ZHAA 1TV8A 3CUFA 1GVOA 1GK8A 1TKKA 4LXFA 3W2NA 3BARA 2EPKX 5DXXA 4GA8A 1VEOA 4H9TA 1P0KA 4F0SA 2YFOA 5EYWA 3F2DA 4K68A 4FNSA 2RFGA 2DIEA 1D7FA 3IIOA 1Z44A 3HPXA 2VQUA 1GZ1A 4UZUA 2JF7A 3PHAA 3C2FA 3IJIA 3J7HA 1Q6DA 4DO7A 4DYKA 2W5FA 3TOYA 5B80A 2PDNA 2OWCA 3S5OA 2REQB 2QCMA 1N55A 4AVNA 5EPDA 2WVVA 3ALFA 3W9ZA 2PI6A 4IHCA 1G69A 2VZOA 1ADOA 3CQ0A 1CB2A 3T05A 1HN1A 1P0NA 3P8JA 2INEA 3QKEA 3T2OA 5FL1A 1EJWC 1KXVA 4H3DA 1BVNP 4JR5A 4PFHA 1R0MA 4RXGA 3VOIA 4UTFA 2C14A 2CLEA 4H01A 4AIOA 4HN4A 4J40A 4C6QA 4G7EB 3OIHA 3SUTA 4POCA 5IBXA 4DF0A 4JQ3A 3S4TA 4NUWA 4L9XA 4QEEA 3NO3A 2J8FA 3B8VA 2WLYA 3NQCA 2QNEA 1PIGA 1IEVA 4XZMX 5D02A 4FXRA 2ZUTA 1RVKA 1E9LA 1RY8A 3GDBA 4DPQA 2D2HA 1W3IA 2ZRUA 3N18A 4LCSA 4C7FA 4FNQA 2VGFA 3OZOA 1UMYA 1ZJAA 4WKAA 4M1RA 3LZ3A 2YJQA 3VOGA 4XAYA 1BPLB 1JXJA 1EBHA 1TQJA 2DZPA 3BLOA 3M5VA 1F07A 1KA9F 1RR2A 3N2TA 1W3JA 1CNVA 3DAQA 3NYZA 4M80A 1VZWA 4M56A 3VA8A 5AB3A 5AHLA 2V2CA 1QWGA 3VXGA 1A47A 1K03A 3LGEA 1AA1B 3EEGA 3HMCA 3UJ2A 4IJRA 4PL2A 3TTEA 2BHUA 3Q4DA 2A7RA 3D47A 1VHNA 1A5AA 3B9OA 1OK4A 3M0HA 3ZJ7A 2CEQA 3WL1A 2J47A 3TE9A 2RUSA 2BXVA 4KBXA 2GPTA 3PZQA 2IQ0A 3LD5A 1SZFA 2RJGA 3CV2A 4GBDA 3OJGA 2RGLA 1P7TA 2TYSA 3FV9A 1YHTA 4ZBCA 1SW0A 3EEZA 3C0SA 3MHGA 3W2JA 5ABHA 1UC5A 4JIRA 1GHSA 5HNRA 3DENA 3WLSA 2VL4A 1S2WA 4DM2A 4AY1A 4EAYA 1Q85A 4MMWA 1EO5A 4XAFA 2YZRA 2WWDA 1XIFA 3QXBA 4HNTA 4RDVA 3EA3A 3WH9A 3C2EA 3N17A 4AYGA 1EX1A 3MQTA 1QPKA 1E4MM 4YYFA 4TTUA 3PB0A 2R1KA 3Q94A 3N29A 4HTYA 4IFRA 2Q02A 1TREA 3MV11 3N4FA 1HL9A 3IAPA 2OLHA 3MMUA 2NWRA 2XUCA 4BHYA 3VMOA 3RR1A 4DXKA 5H2ZA 1XD0A 3SDOA 3AYVA 2YYUA 2H90A 1E9IA 4Q6XA 4IMAA 2INZA 1A53A 1ML1A 1C7SA 4ZTYA 3WK0A 3T09A 3O8AA 1OX4A 4LUSA 3SGGA 1Y0EA 3ZJKA 2NQ9A 1UJQA 1B3VA 4J3SA 2VT0A 3FAWA 4IIEA 2XFYA 1W0MA 1OF8A 4ZQCA 5JIPA 1TA3B 5LA0A 1DL3A 2GJXB 3TW6A 3DDMA 3SURA 3UG4A 1ADDA 4JL1A 4L56A 1KXTA 2PGRA 1U2YA 3REQA 4L9ZA 4WEVX 2Z1KA 3VZXA 1BF6A 1JPDX 3LTPA 3GFZA 3ZM8A 3W7CA 6XIAA 4B91A 3MCMA 4X2RA 4GXMA 3FA5A 1H5YA 2DW7A 5CPLA 1SW3A 3QBUA 5CQ1A 1E55A 4O28A 2DSZA 3NL5A 4QCFA 3G8RA 3GKAA 1P6CA 4CN4A 4IQEA 1OX5A 3B4YA 3C86A 4XZ9A 3MZ2A 2HS6A 3LHUA 4HA1A 5C5YA 2PF8A 5DMMA 1RA0A 3FEQA 4QE5A 4C6NA 1KTNA 2YA2A 3ITTA 1A5CA 4E4FA 1MFUA 1XX1A 1JYWA 3PZGA 4KWOA 3UJSA 1BYAA 1V03A 3KM8A 3B8UA 1GNXA 3IPWA 4MM1A 1JAEA 4DZAA 2XIQA 4X63A 3WQ6A 3WLKX 5G1MA 5LXXA 1LTDA 3GKFA 3S6TA 2X7WA 3EOSA 1TWZA 3SQMA 3ARRA 3MCNA 1EJRC 4NNBA 1X7IA 2BY3A 3VO0A 1Z48A 1BD0A 1RP9A 4EWJA 2BODX 2Q8ZA 3E0WA 5DQPA 3R89A 2UV8G 4MADA 3CHDA 4BQ3A 3GXNA 3WF0A 4DAFA 2ZCGA 3ES8A 4ZGYA 1AD1A 3T4WA 1NIUA 4RXFA 1TSIA 1QUMA 3F2CA 4P8XA 1C8YA 1VENA 2E25A 1XLJA 3WD2A 2VD8A 5IXEA 1QI4A 3IUIA 4YPJA 3WJXA 2ACQA 5B7YA 4NASA 4XD3A 1F8IA 1XIGA 5BW6A 1C3FA 3TEVA 2V81A 4UCGA 3W71A 1NU5A 3H6OA 4NYUA 1XIBA 3WKZA 2AGKA 4QROA 3W7DA 1T99A 4LPCA 3EWDA 3FJLA 2ZX8A 3BJTA 4AD1A 1G7VA 1Y65A 4UQ9A 4XZWA 3ENLA 4YTUA 4AFYA 3DX5A 4C6CA 3OIXA 3ZSSA 1UR0A 4JTQA 2POTA 3WEMA 1TMHA 2EJ1A 4FX7A 2J7CA 4B2DD 5FSEC 1GHRA 3IVUA 4HCDA 4Z2GA 4DF2A 1VJZA 5I3JA 3CAVA 1XC4A 2FTWA 3K30A 3S2NA 3EPMA 2J8GA 1JPMA 4GOAA 3GG1A 1PE1A 4YS1A 5IRPA 2QZRA 1FX6A 4V27A 2G37A 2QCEA 2X30A 3U0HA 4JD4A 3IRSA 1YPXA 5HOSA 1J8VA 1QI0A 3AS0A 2QUTA 4JTHA 5F2LA 4O4WA 4PC8A 2J74A 3TROA 4JIIX 5EMLA 2XSAA 2DVXA 4N0RA 3VKCA 2BVWA 4CD8A 1PAMA 4UNIA 5E70A 1IF2A 1JZ7A 4AD4A 3E96A 3LLXA 3WFAA 3DFYA 1US2A 3PVFA 3AS1A 1C93A 3GVQA 1TPWA 3M46A 3U3HA 4GUIA 2IMRA 1UD6A 3SM0A 1WZKA 1VQTA 1W9PA 2OEMA 3LY0A 1SPQA 3LI0A 1FWGC 3DG6A 2V3GA 4GI9A 5AC5A 4F0KA 3RPDA 2QR6A 1Q8AA 4FK9A 1BLIA 4TR9A 4XD6A 3OP2A 4A21A 1L0PA 1QBAA 3CIVA 4IP5A 1QRQA 4B2DA 2Y0FA 3MP4A 2VRKA 5HPOA 1LZOA 3CU2A 1A5OC 4W93A 4IMCA 1MEHA 3GUWA 3UVIA 2NV9A 1GZJA 2V67A 2HISA 2F2KA 3EA2A 2PWGA 3W2KA 3T42A 4OOZA 2FZ9A 4ORIA 4JYFA 3WJZA 1F3TA 3G1FA 2AL2A 1UWAA 1AW5A 1M41A 4RLIA 5AYXA 4UIOA 5HJXA 5FJOA 1H5VA 3EDEA 1VYSX 4PTNA 4DJEA 1VPYA 2ZWZA 3CL6A 1PL9A 3QV6A 5F2IA 4HPJA 3WMSA 3E02A 1ME7A 1TB3A 1EHAA 4KWSA 4G1KA 3IUHA 2ISWA 5DXYA 2X7VA 3UQNA 1L6WA 3T0CA 3WH6A 1FRBA 2BWGA 3GZ3A 3N6QA 1XYBA 1YE6A 3WD3A 2OVLA 1V0MA 2QDHA 5DMYA 4H9VA 3H2AA 5CC6A 3QW3A 3FK4A 4MWAA 2PURA 1XLGA 1W5OA 3M5ZA 1OBAA 3T7VA 1W3LA 2V8ZA 1HTIA 3WDPP 3VI2A 1X8CA 3S0CA 1KQZA 3HG2A 3G1YA 1AJZA 1Q7MA 1PYMA 4QIUA 4S3CA 1VC4A 1XDLA 5HDRA 5REQB 4PMVA 4Q7BA 3URNA 2GQAA 2QYGA 1HX0A 4Z17A 1E15A 1X1ZA 2OZTA 4ACZA 3KHDA 1FP9A 4ZO7A 4B5WA 5I02A 1AZ2A 2D73A 3CAKA 1KR1A 1U5JA 4A8LA 4JNMA 2IW0A 4M6VA 1GYMA 1T40A 6A3HA 4CQ8A 2WSKA 3OO2A 4PUJA 3LQLA 2V6AA 3FSUA 1QPRA 3G3DA 3TFXA 3GNDA 2B7PA 3N25A 1NQKA 2Y89A 3I4KA 4UTLA 3WQ8A 1UW9A 4GO9A 4JICA 4UC5A 4PCTA 3V5OA 4C91A 5BOEA 1KBKA 1EEXA 2QPXA 3PAJA 1XCWA 3OB8A 1MZRA 1AZ1A 1WAWA 1NFGA 3W81A 3TZFA 1IEQA 2XM1A 3M07A 1JPKA 2OZ0A 3TV8A 1W32A 2GDQA 1IV8A 2DZBA 2Z28A 2XN0A 3L4VA 3T55A 3W24A 2QMJA 4KCUA 4IL0A 2VD9A 3N6JA 3G1RA 4U10A 3DGRA 2ATSA 3BURA 3A64A 3GXTA 4ZFMA 1DE5A 4YL2A 3W25A 3BXWA 3GIQA 1M7JA 4M3PA 3E0IA 3GU2A 3QRHA 1AW1A 4PUKA 4CU8A 1D8WA 4I8DA 2QDEA 3S47A 1UH4A 2OT1A 3FKKA 4FR1A 3MC5A 4CCZA 4YLWA 5D2WA 4F40A 1JUBA 3RK8A 3V0TA 3KL5A 1DWFM 1W3NA 3NDOA 4V2XA 3T0DA 2D2OA 1SFTA 1WDDA 2NT1A 2ZBTA 2TAAA 3TSMA 1NELA 4NAEA 1FY6A 1IT0A 2WBKA 3E2SA 1O7AA 4MB1A 3OZPA 2PAJA 3W7EA 5MHBA 4S39A 9RUBA 4XTDA 3FVDA 1IGSA 1Y5VA 3L2MA 3B0VC 1T96A 3IVSA 4AH7A 2XDFA 1JRCA 1Z41A 3LOTA 2YDAA 4GFSA 7CGTA 1JPHA 1YEYA 1V7AA 4KGLA 3DFSA 4FALA 4GQBA 5FF0A 2DJLA 3FA4A 3U57A 3TQVA 1MFVA 1JZ3A 1KFEA 1UBSA 3VKKA 4RX0A 3DHPA 1SR9A 3NQ8A 5K7JA 4ICNA 3NXLA 4ERAA 3N04A 2ZZ2A 4JX5A 1PHQA 4E2VA 3VFLA 3M0IA 4GYPC 2A85A 3W1NA 5SWUA 1G4PA 1OZQA 2FZDA 3FNDA 2Z2BA 4L7ZA 2IKIA 4N6FA 3TAOA 3HGSA 3PPGA 5IHSA 3QSRA 1TVPA 1M04A 1J0JA 1W1A1 4TX8A 5J8LA 4UQDA 2WZTA 3BCFA 4FOJA 2PGEA 5U7SA 4DNHA 1OK6A 2A7PA 2NXIA 3VINA 5ABTA 1VYPX 4LVDA 1TV5A 2IUZA 2ACUA 1PWLA 3B4UA 1UR4A 1H0IA 4U3AA 4ZODA 4H1ZA 5CKSA 4NI3A 3RR4A 4LUYA 4US6A 3EXSA 2QCFA 3COTA 3BLIA 3HTWA 3L0KA 3OBAA 3A3WA 3QTPA 3FGCB 3UU0A 1D3GA 1XIJA 2R6OA 4XO6A 4W8AA 1KTBA 4UXDA 2XN2A 3THAA 2VVNA 4ZQNA 1XIMA 1A5BA 2VR5A 4QLLA 3M47A 1JFXA 4W5ZA 3W7HA 1LLZA 1DJIA 1OT1A 1R9XA 4NAFA 4LBRA 2FH8A 4L5ZA 1ZCCA 4S1FA 3RNDA 3WUGA 3GSMA 1MO0A 1R30A 1MZHA 4MUZA 1W91A 3IVTA 4DI8A 4DLMA 3HB9A 2ZDSA 4F48A 3QMRA 1G5AA 2E6FA 3FXYA 4GFIA 4CQCA 5BZAA 2XU2A 5GJPA 2EPNA 4KFPA 5KETA 2WJEA 4ZOCA 4GXWA 2XISA 3TMLA 5HWJA 2QUUA 3XIMA 4QGCA 1NJJA 3EMCA 3QC0A 6PTDA 4ATDA 2J4GA 3DOPA 3EXTA 3AHYA 5HINA 1R7OA 3LBCA 4J3TA 2ISDA 3WMBA 4PEKA 5I3GA 4N9CA 4N02A 4H9XA 3FKRA 1PDYA 1XLDA 2VCCA 2PDLA 3W29A 1XBZA 4G5DA 2NSOA 3W7IA 3N15A 2R91A 4PL1A 4Q22A 8TIMA 3AUOA 1DV7A 1ZALA 2Z25A 3YPIA 2X09A 3AU2A 4D6JA 1JRBA 1LBFA 1ELSA 2KAUC 1FWJC 4PTMA 3WK3A 4U4MA 1TYGA 3CS2A 5FL0A 2QCDB 3AWOA 3SFWA 5LYRA 4Q32A 4WOZA 2Y88A 5LKYA 2J77A 4OIFA 2PDUA 3O05A 2VC5A 2Y6ZA 3B8DA 2JEQA 1ZY9A 4NVTA 3GC5A 3IGHX 3NOYA 2QIWA 2H9AB 4HMEA 4Y7EA 1LF1A 4JTGA 2WKGA 1CWYA 1EBGA 3O0FA 3FA3A 5BROA 1JI2A 4M29A 4G56A 1QAPA 1R9ZA 1OD0A 1BF2A 3DBNA 1Z3NA 3IAQA 1RV8A 4HHHA 1HJSA 4JTSA 2OXNA 4ALDA 3R94A 3BICA 3V5FA 3CEUA 5BNKA 4AYSA 3THQA 3R10A 2EO7A 3G1DA 4J35A 2FH6A 4E8DA 2VDHA 3UCQA 1FWRA 3W23A 4DYEA 4D9PA 4ZENA 5D8WA 2J13A 2X1RA 4LB4A 3W53A 3LS9A 1XV8A 4JEQA 1ISWA 3R1ZA 1DXEA 1KM5A 1AL8A 3RLVA 3WBXA 2VGGA 5HUPA 1K4GA 4I9AA 3WH5A 2IS7A 1OB0A 3P62A 4OV9A 3OEXA 3HMJG 4LCRA 3NQMA 3OYXA 4AZBA 3K46A 1QT1A 1REQA 4JHMA 4KESA 4N7QA 1EJXC 4J4KA 4QHRA 4JNZA 3W7KA 2GJLA 1Y7VA 3JRKA 2FPYA 4C1KA 1EHNA 4GABA 2XHYA 1PDZA 3GDKA 2GQ8A 4YVXA 3LBOA 3H2FA 3DGBA 4RW3A 1EGVA 1F7BA 3BC9A 3DBPA 3VPLA 5J5DA 4D1IA 2PDWA 2GJRA 1KRCC 2EKGA 3AXHA 3M6YA 3PP7A 1UKSA 1WXYA 4RE4A 4ZB0A 3LEPA 3KBJA 3NG3A 2BVYA 2Z1WA 3LENA 4XWUA 3N9KA 1CW2A 3MT1A 4HSNA 3CM4A 3ICJA 3W1XA 1B4EA 1S1PA 3UA4A 2BVTA 1EJTC 4C6DA 4Q33A 4R88A 5GPRA 2O0TA 1I1XA 4IFKB 2VX4A 4RZ6A 2E28A 4CN1A 1E71M 5KEZA 1CI1A 2G3IA 1JJKA 1QASA 3LHZA 2V2DA 3KAOA 1ZU8A 1YPIA 3MI6A 4LUIA 2PLKA 3SUSA 4AAJA 1OCNA 2G97A 1TTQA 1A5SA 4HHLA 3DHDA 2PU0A 1HL8A 4N2YA 1S39A 4GISA 3F2BA 1UP0A 2FPVA 3AZSA 5I00A 3W7QA 1M03A 4GXPA 3ISIX 2YB4A 1B1YA 3JU2A 4FMVA 3WF3A 4X0VA 4R9OA 1EC9A 4AHPA 1I2OA 3PJWA 3L4YA 1A3XA 4L65A 3E5BA 4F0HA 4UFKA 2DVTA 4P2VA 3HGRA 4E8GA 4DJFA 3O16A 2I9EA 6CGTA 4Q4MA 1FBAA 1DIOA 4P5UA 1QOQA 2XVGA 4QRNA 2X40A 2OX1A 3QLLA 2CBJA 4QBXA 3V5CA 3QPEA 2EG8A 2PE4A 3WMLA 2DGAA 3F5LA 1R3QA 4XTIA 1Q2SA 2XH4A 4XBJA 3MI2A 1CDGA 3R0UA 4CCEA 5D32A 2V2HA 3IWPA 2DY3A 2ISSA 1QNVA 3ARUA 3UZZA 3W83A 1ODZA 3L12A 4M82A 5FF7A 5B7ZA 3Q65A 3G3MA 2NT0A 1GW9A 2WZMA 5DT7A 7ENLA 3L5AA 4QP0A 4EANA 1UC4A 3EWYA 2AMGA 3IIXA 4A22A 4D6EA 3V3WA 4MZ8A 3BAJA 1MW1A 2F61A 3EPNA 2Y63A 2BX7A 4AVFA 3GO2A 1WA3A 1AK5A 4QR6A 5A8QA 3T8QA 4O0QA 5M5DA 4PTVA 5EMKA 1HKWA 4K8EA 4MLJA 3UT0A 4LYKA 1KM1A 3SY5A 1VD6A 3S2MA 1K6WA 2O9RA 4LTSA 4ILSA 3QY8A 3TDFA 2HSAA 3GC4A 1TCDA 2GWNA 3OVGA 3UY7A 1XJBA 1OZMA 2Y24A 3TIMA 4GGBA 2NLYA 2V5JA 1IEIA 1WX0A 3EDKA 3BOXA 4JYEA 2L5HA 3HN3A 5D8ZA 4NZJA 2P0OA 3OQEA 3AZRA 3RX4A 3P74A 4ZZ9A 4GYJA 2OQHA 2E09A 1SJAA 1XLFA 4Z08A 2PA6A 3R0DA 3BVJA 1FHUA 3BMWA 5ABFB 1MRAA 4ZOEA 3R5EA 3IJ6A 5A6MA 4GY0A 2NUWA 4MB5A 3BE7A 5TF0A 1AG1O 4EACA 4JX6A 3WZ0E 3OG3A 1O5XA 3AO0A 3I3EA 4IPPA 3MMWA 2NX1A 1HGWA 1UP3A 1YX1A 2BXYA 3CZEA 3T9PA 1VIWA 1ME9A 4HGXA 3LX9A 3GIPA 3IV3A 3G5EA 3QHNA 3AYSA 4AD3A 1V6TA 4HMDA 4D8AA 4OBRA 5KZ6A 1EIBA 2UWFA 3XINA 2C6QA 3GDTA 2BOGX 5CAKA 3OA5A 1CTNA 3H7VA 5CPSA 1H60A 3B3DA 2A2IA 1ZL1A 3PJXA 4KF1A 3S3GA 5FD0A 3G6LA 4RW5A 3K1DA 1EP1A 3OBEA 4J9JA 2PD5A 5HNNA 4L4OA 1NWSA 4QNEA 1RH9A 1YKWA 1FHDA 1O5QA 2PDBA 3SADA 4ECLA 1CGVA 3DFNA 1JQXA 4Z2JA 2X1IA 2DZUA 3JZUA 2VEFA 3BV4A 3SECA 3KS5A 3QC3A 2DZSA 4MNLA 3L9CA 1R7AA 1V6VA 4JTTA 1JUKA 2WNNA 1B9ZA 4IISA 3EDJA 2I9UA 1K7XA 3AQUA 2ZUUA 5AHMA 1N2VA 2GGJA 2ZUNA 5H8PA 2EGZA 1DQWA 2UBPC 5HNTA 3TN3A 1OWQA 4DUVA 2IQTA 4B5NA 3EZ4A 4X0NA 2C19A 3L4WA 1KCXA 4P7LA 3TQPA 3U5UA 3TFCA 3WLLA 3OLGA 3NQVA 4MYAA 1DXFA 3SZ8A 3NO5A 4HU8A 4QXIA 1TUFA 5C6MA 4HBKA 1R3SA 4IGHA 2D3NA 4GUGA 3USBA 5ECVA 3TJLA 3RJXA 1R3WA 2C16A 2E3ZA 4GE8A 5G2IA 1GW1A 3NL6A 3UD6A 3HPFA 4D1JA 2J25A 4D8ZA 2YL5A 1TWWA 1JNDA 3T0TA 5LNWA 3KDNA 1I2PA 1XL9A 3O6CA 3O07A 1H1ZA 5C2GA 5H1WA 1R47A 3V4BA 3VCNA 4LFYA 2OWWA 4JTEA 1AJ2A 3O3RA 4A2SA 5LHFA 3BGGA 2GZXA 1W9XA 5I7GA 4CKQA 1BWLA 2D1ZA 1GCYA 1UD4A 4XSLA 1BAGA 5HANA 4JN6A 2FHFA 4BR1A 2E9BA 3ZT7A 2YL9A 3DFHA 3IJ9A 3BW3A 2OMAA 1H7WA 2YDRA 3DEQA 1W5PA 3E38A 3WEOA 2XZ9A 4QEHA 2Y5SA 3FHQA 4MZYA 4PMUA 2YLAA 4DWSD 1W54A 4IPNB 4O1BA 5CG0A 5K9DA 1G01A 2O4MA 1DTNA 3QMSA 1MW0A 7REQA 4XAZA 3D6NA 3KZSA 1FDZA 1OM0A 4NI8A 1JGIA 3FIGA 1JCXA 1R5YA 1DJYA 4A3QA 2GWGA 3TMQA 3EOEA 4O18A 1ITUA 1UKPA 2VFEA 1XC6A 2V30A 1VPXA 5H8UA 1TPDA 4A2RA 1FUYA 1ZP4A 1QK0A 1BXCA 4EPKA 1HL2A 4BQ2A 2F6KA 5HR6A 3EWXA 3NZ1A 3FS2A 2DFAA 3BLLA 3W75A 1IXOA 2GGIA 1TX2A 5LIXX 2FB3A 2WPGA 3S42A 3MUIA 2Q3OA 4US5D 3TZNA 5CZKA 3VDGA 1JYNA 1E56A 1IR1A 3KCOA 1ZRQA 1ECEA 4HT3A 1SR0A 3QW4B 4LT9A 4ZSUA 4NX5A 5F1VA 4WSJA 3SCTA 2A21A 2VUYA 3VZZA 4J3VA 6REQA 1PVNA 2WKJA 3C2RA 2Z1BA 2OZ8A 2VC9A 1GG1A 2BBFA 4XZNX 1W3HA 2CNCA 3NM1A 3UG3A 2VX5A 2H3DA 5LSMA 3CASA 2WHLA 4DX3A 1JYXA 1EFZA 1EXBA 4UNLA 1C8XA 2QLYA 3K13A 2IKJA 4QCEA 1S2VA 3LHYA 2ANUA 2QMKA 1FQ0A 1TWIA 1E6SM 1U1HA 2TRSA 1POJA 1O1ZA 2CLHA 4S3EA 4FNRA 1W9BM 1I8JA 4MNMA 2WC4A 1XIIA 4IIGA 4PMYA 2PDYA 3VUPA 1LP6A 3TSBA 4BQ4A 1UROA 1XHGA 2Q71A 3BQ5A 4U3CA 3TAKA 2QDGA 4IUOA 2X1UA 3B9EA 2ACRA 1OT2A 3WH7A 3N2BA 3PB2A 4OT7A 4US5A 2HK0A 2Z1SA 4NILA 4ACYA 4AD0A 1KFWA 1RY0A 4M51A 3FN9A 3UR5A 4CD4A 3AMDA 3CJPA 1E0VA 3BLFA 1EOMA 3M7SA 2E6YA 2P1FA 1B54A 4RKAA 3TNOA 5A6SA 2AQWA 4HJFA 4WLCA 3U2CA 1S46A 4BI5A 4Z1AA 5D2YA 1ZP3A 1LBMA 1RUSA 3QZ6A 2A0NA 3E0LA 1XLAA 4KFNA 1ITXA 2HS8A 3KRBA 1XYMA 4AZIA 4AX7A 2IXUA 1Q63A 1B90A 1UQYA 3LTYA 1RCQA 1EKOA 3DHUA 3PUEA 2CETA 2CLFA 3EBVA 2F7FA 3UW6A 4B4FA 4PFMA 3OZMA 2YXGA 5A5WA 4IG2A 2O4QA 4FOKA 4R7WA 4NSBA 1U5VA 4PB5A 1RPXA 1EPVA 4DRSA 1WP6A 4WXYA 3FEMA 4Q4QA 1O12A 3AHTA 1NQ6A 3EWWA 3WNKA 3VIHA 4N9BA 2G3NA 4F0MA 1D7KA 3H2OA 2WSPA 3NYDA 2BB0A 4S3KA 1FKXA 2BLEA 3NIYA 4JFTA 4GVFA 1GJWA 4O11A 1TE1A 2QJGA 4C90A 1F8MA 3PN8A 3REQB 2D0GA 4YWSA 3S9YA 7ODCA 3MHUA 2PLJA 2ZICA 2ZX6A 5FA5A 1EL3A 2PP3A 4L4PA 3ZZ1A 1Q6RA 4Z1YA 3TC3A 2HXTA 5G2HA 1QO2A 1A5LC 2CHNA 5AYYA 1JAKA 4ERGA 3PBMA 1IT8A 5CCZA 2FYMA 2OB3A 1Y8BA 1SFSA 1NM9A 4BF5A 4FLRA 3WF2A 2HWGA 2WVSA 3URBA 5KMYA 2VENA 3WY1A 1VCGA 1VFSA 2HJPA 2OX4A 2VRJA 2DSKA 1A80A 1KXQA 1UR9A 1V6YA 2J7GA 4XX6A 1EJVC 3CUIA 4AWUA 4FO4A 2EXOA 2E67A 4Q4PA 2DZVA 3T6CA 3ZLHA 4LYRA 3C2VA 4CQAA 1PKMA 3NDZA 2Y85A 5A6LA 2CPUA 1GTEA 2BS9A 1OC5A 3SUVA 2FHCA 3QEZA 1LROA 3TP4A 4JNYA 2CWXA 1OHLA 4JKLA 4M5PA 4ZFCA 4UNKA 1MQQA 1WBHA 1RSCA 1KFJA 3GVGA 1XS2A 3L0NA 4Y8FA 4QE4A 3WJSA 4PR4A 1SQ7A 5CLWA 5D9NA 2MANA 4NP7A 4GRSA 5FJJA 2HRWA 4O52A 1SMDA 3W7PA 4PSPA 4BJHA 4HJWA 4RNFA 2PUZA 2RDUA 1BFNA 5K2ZA 3BJSA 4RE2A 1Q4WA 1WUFA 4IXHA 1P0BA 4LOCA 4IICA 3A9IA 2GL5A 4HPXA 1OYAA 3N14A 2FMNA 4IGSA 5GNYA 3DC0A 2OO6A 3W22A 1FCQA 3N6HA 3SCQA 2PFHA 4L80A 3TYCA 8A3HA 5KSWA 1CXEA 2POZA 1DJWA 2WK2A 1XKJA 3EYPA 1US3A 1TMLA 4QS5A 4FLSA 3STEA 2HVOA 3W84A 1CXHA 2A6LA 3SJNA 3T40A 4Z2KA 1W56A 3UYIA 3C8FA 1VFHA 2OSWA 2JGQA 1VFUA 1PTAA 3EX6A 3G1SA 1TFVA 4LAKA 4H6QA 4JIHA 4MB4A 2DQWA 1GWJA 4WHBA 4H4IA 4W86A 4IXXA 1R85A 2ZXBA 2GGEA 4M0XA 1XSIA 2YXOA 4MPKA 3WQEA 4DO5A 2I56A 3WFLA 3M0VA 5FEXA 2BV9A 1DKWA 3ZJ8A 1BRLB 4CUCA 1IWPA 1TRDA 3NZGA 3ITLA 2FZBA 5XIAA 2DV0A 1K8CA 1OIMA 3O6YX 3T8LA 1E0UA 1I1WA 1EA9C 1NDVA 4K1GA 2CHRA 1XH0A 4E6MA 4L9YA 4LW7A 1B3WA 3BZJA 1E3ZA 2X1SA 1B57A 2ZADA 3WLMA 4V28A 1K02A 1VJSA 2W66A 1ITQA 4N4PA 1IR2A 5CSUA 2NV1A 2DPEA 3QV9A 5E9XA 2VFHA 3C3NA 1XKYA 2C71A 1EDQA 1KM0A 4DY1A 2GOUA 1HVQA 3FFSA 4OWGA 4JY9A 3KWXA 4AX6A 4IL2A 3VTRA 4A3RA 2C3ZA 4QISA 5BU6A 3BAYA 1XYFA 3O06A 1T8QA 4NU7A 3WH8A 1UZ4A 3DH7A 3BUVA 3GG8A 4PCFA 1GOXA 4UTWA 4L4MA 5I3HA 1C9WA 3K8LA 1FKWA 1W1YA 5C55A 3W70A 2JIEA 5IBXC 4TV6A 3SFKA 4H6EA 2XFWA 1C8QA 2F8QA 4JQ4A 1F4HA 2AL2B 3DI1A 1LWHA