2CZFA

Crystal structure of orotidine 5'-phosphate decarboxylase from pyrococcus horikoshii ot3 complexed with xmp
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
208
structure length
208
Chain Sequence
MIVLALDVYEGERAIKIAKSVKDYISMIKVNWPLILGSGVDIIRRLKEETGVEIIADLKLADIPNTNRLIARKVFGAGADYVIVHTFVGRDSVMAVKELGEIIMVVEMSHPGALEFINPLTDRFIEVANEIEPFGVIAPGTRPERIGYIRDRLKEGIKILAPGIGAQGGKAKDAVKAGADYIIVGRAIYNAPNPREAAKAIYDEIRGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of orotidine 5'-phosphate decarboxylase from Pyrococcus horikoshii OT3 complexed with XMP
rcsb
source organism Pyrococcus horikoshii
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 72
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2czfA00
4UFJA 3L2IA 1FCUA 2DZPA 4PL1A 2GQ8A 1F73A 1TTJA 2R14A 3TXZA 5I3GA 1DV7A 1Z44A 1HG3A 4UTWA 3ZWSA 4CQ8A 3GZ3A 3PUDA 4GRSA 1W0MA 4NNBA 3GB6A 3NQDA 2NXGA 3PSWA 3FOKA 4LVFA 3S9YA 2QCGA 4YL2A 3D0CA 3G1AA 5AB3A 3QF0A 2H8ZA 1LP6A 2B7NA 3W7GA 4UUIA 3EX3A 3ZS4A 3W23A 1MXSA 5F1VA 4AHPA 3EWZA 4C1LA 1RQBA 1KFBA 3QPZA 2NXHA 3NDOA 4EVZA 5BNKA 3S1WA 3NQCA 4IXHA 4NJHA 1XFBA 2VEKA 1JUEA 4WXYA 1N8FA 4L4MA 3CB8A 3DFNA 5LNRA 4NJKA 2C13A 1J4EA 1JRBA 2I9EA 3G1VA 3HPXA 4UCGA 1GVQA 3LCWA 5I3KA 4RCXA 1IGSA 5LHEA 5LKYA 2J88A 3LCLA 1OFDA 5TQLA 4H4IA 1H7XA 3DENA 5DN1A 1MEHA 3NYZA 4PL2A 4I7WA 4WXZA 1EA0A 5D37A 2WSQA 1SW7A 1PHWA 1TRDA 3R5EA 5FEXA 3IIOA 4UTTC 1VH7A 3G22A 3TW7A 3FJLA 3LV6A 3W73A 5F2LA 1LORA 3HQ1A 4UTMA 4GJ1A 3WK1A 3Q2DA 1W54A 1FBAA 4ZL1A 4ADTA 4GBUA 3GR8A 4NX5A 3AO0A 4MJMA 2B0MA 5G1TA 4U4MA 3A21A 4XKYA 2YSWA 3PB2A 1HO1A 4JNMA 5F4WA 4D2JA 3TAOA 3NPVA 3STCA 4BI6A 4A3UA 1K7FA 3O06A 1M7OA 4S2BA 3U6WA 3QQ0A 4WX2A 1OYBA 2JK2A 3VI2A 1X1ZA 4FX6M 3CHVA 1VLIA 4FNSA 2ALDA 3HIJA 2X16A 1WV2A 4JYDA 2DZTA 2DZVA 3WJZA 1H51A 3TDFA 4JX6A 1XKYA 5FF7A 2A7NA 3BGGA 4RXFA 1MEWA 2ZTKA 4JYEA 3TAKA 1VS1A 1RPXA 4RR4A 1NVMA 1O95A 4JS3A 1TJPA 3B05A 5A8GA 3GDLA 3GNDA 3I7QA 2FPTA 3TA6A 1GYNA 1HFBA 3P8IA 3HGRA 1R47A 1KV5A 2H90A 3OVPA 2QCCA 3P5ZA 3UD6A 3A24A 4IMCA 1KTBA 1F74A 2WQPA 5CPNA 1P1XA 4U28A 1DKWA 1B4KA 3FJ6A 3W72A 4O8RA 1TPC1 3LCXA 3DI0A 4Z0SA 4UTUA 1I4NA 4K6AA 4WUIA 1FWWA 2CWNA 1ME7A 3R12A 1W5QA 2Y61A 1SSGA 3PG8A 4NQ1A 3SI9A 1R2SA 1PS9A 3NM3A 3WJWA 1OX4A 2ISWA 1SQ7A 1TTIA 2CZDA 4DF0A 4Q4KA 3M43A 2GOUA 5LNUA 3MP4A 5KZMA 3DU0A 3UNDA 1BEUA 1G7VA 4R7JA 2Q3RA 3QQ1A 1OYAA 3R8RA 2RDWA 2V9DA 3W1QA 1EP1A 4N6EA 2H3BA 3W2LA 5F4SA 1SFJA 3JS3A 4N2YA 4LV9A 1ME9A 2GQAA 3RLVA 1DJNA 3FLUA 4LRTA 5EA9A 3UWVA 4EOUA 3E49A 3TSDA 1G4TA 3BG5A 3RK8A 4UFLA 2WOQA 1KM4A 5D2YA 3EWWA 4LUJA 2I1OA 4KKXA 5HNRA 3GK0A 4GFSA 4Z1CA 1W5MA 3PC0A 4O13A 5DLCA 4RKAA 5GVJA 5G2WA 2ISSA 3MYOA 3LM7A 5DXYA 2E6AA 1UUMA 3DFTA 4I7VA 5K4XA 4O50A 3PSVA 3EX4A 3THAA 1KV8A 4M7TA 3LHUA 2PCQA 4O53A 3KVMA 1DHPA 1SO5A 3I65A 3IGXA 2ZA3A 1M5WA 5D2XA 1XL9A 2VFIA 3MYPA 1JR1A 3CC1A 5HUPA 3R89A 3G1SA 3CIXA 3I7RA 3LRKA 2RHGA 3PUEA 5AC6A 3W7KA 1W5PA 3EKZA 3MBDA 2A6LA 4ZQCA 2OT0A 4XTDA 4QAIA 5DBTA 1PVNA 4OGZA 1GTEA 3LGEA 3HGJA 3BLIA 1ZAIA 1TTPA 4WD0A 3PG9A 1GG1A 4K8HA 2CLHA 4O52A 1XBZA 2A6NA 3OHIA 5CZ0A 4PEKA 2J24A 2VEPA 5AC7A 2GJNA 2JGYA 2YPIA 3SY5A 1GJPA 2NXIA 1TB3A 1YDOA 5AN7A 1OFBA 2Y88A 4B5NA 4NT0A 3EWUA 5LHFA 1XDLA 5AFDA 1ZENA 2ZZ7A 3P60A 4L4LA 4LS1A 5KITA 2WNNA 3S1UA 5L6UA 1MSSA 2QDGA 3PULA 1ZALA 3RLUA 1VRDA 3G0XA 5IM51 3FKKA 3KFTA 4JTUA 4ZMGA 1K03A 4ONVA 4BR1A 3B06A 3EX2A 2IQTA 1WDWA 4O28A 3M5XA 4Z08A 3W7CA 3QRHA 1KFEA 3SGZA 4FIQA 4ML9A 4QIUA 3W6YA 4DQWA 3KVLA 1FY6A 3IIPA 2QUVA 3U2OA 1LROA 4MVAA 1VR6A 3P84A 1LBLA 5SWUA 3KVJA 3QC3A 2QAFA 4MZ8A 3LV5A 3VE7A 3EKLA 1TPDA 3ZWTA 1UJPA 2OJPA 2TSYA 3T55A 3PS7A 4M6PA 4NZFA 1BTMA 2J9XA 2CW6A 2H8XA 3M7WA 1H7NA 1DJQA 2DORA 3N9SA 2J6XA 2HS6A 2WSRA 2X1RA 3NL2A 4MOZA 1ZAHA 2DU2A 4HIBA 2QDHA 3QJAA 1A5AA 2NZLA 1KM0A 3T78A 4Z1BA 4OU1A 2E1DA 2GPTA 3NAVA 1SR9A 4K7VA 3UXAA 3W1PA 1A53A 1TV7A 3W84A 2CLLA 4JN6A 2OZ0A 4O1BA 3ANYA 3DFOA 4IOTA 1QNVA 4JR5A 1X1OA 4DF1A 3M5ZA 3ZR4A 4JIQA 4EF9A 2UV8G 3NVTA 3SJ3A 1QOPA 1SW3A 1G6CA 3E9AA 3M47A 5L9FA 3GR7A 3C52A 4P61A 5FF2A 4FHAA 3UY7A 1ZAJA 3CPRA 5KSWA 4TU1A 3W1LA 3LLDA 3H55A 4NJGA 1QCWA 1ZFJA 4N9BA 1THFD 3O6DA 4O0ZA 5FEPA 2QCDB 1JCLA 1AW5A 3PWAA 1W5OA 5CZSA 1JRCA 4IMGA 2JGQA 4POCA 4ADUA 5K9DA 1F2JA 4JGDA 4Z1DA 1LLZA 1X7FA 2X1SA 1LLWA 5AHLA 1GTHA 4FNPA 2F7FA 3ABQA 4K8EA 2YCEA 3LHZA 2Q3OA 2WKJA 5HWNA 1IXPA 1KM1A 4UR7A 2Q8LA 3SR7A 2FPVA 1WAUA 1SZFA 1XBVA 3G18A 4X3ZA 1K7EA 3A23A 4K7YA 4HPXA 4TO8A 4N4QA 4KFNA 1X6UA 5E0KA 3BW3A 3ELFA 1R46A 2ZRXA 4BWLC 2WJZA 3LERA 3IRDA 1OFOA 3L21A 2QJGA 2VFFA 1RD5A 5EMUA 1GQNA 1J5TA 1U5JA 5F2MA 5F2IA 5U7SA 3DZ1A 5FESA 4QISA 3F4WA 1H7OA 5HUOA 3NO5A 1RV8A 1OK6A 5HINA 3T7VA 1A5CA 4AWTA 1EIXA 2YW4A 4GE8A 3NXFA 3TK7A 1SU5A 4PH6A 4LV4A 2W6RA 3LTPA 1Y0EA 3W1NA 3BVJA 1DQWA 2E6DA 2QAPA 1Q6RA 1DOSA 4AB4A 1RQHA 4RZ4A 3TJXA 1GYLA 2TYSA 2VFDA 3STGA 3W71A 4LS0A 3PBUA 1CW2A 1T0OA 1ZNNA 3L5AA 1IF2A 2NUWA 3S5ZA 4ORIA 4WY0F 4CLMA 2R91A 5D32A 3EX1A 4LT9A 5CSSA 1U83A 5E1QA 1W3IA 4HNTA 2V2HA 3S5OA 1J2WA 1GG0A 1TV5A 1S5TA 3R13A 1FUYA 5D04C 1HTIA 3C6CA 5D09A 4MYXA 5D2VA 5DY2A 3C0JA 2C14A 4UFIA 4HSOA 3C2EA 4IJBA 1ME8A 3SIZA 3LXCA 3O05A 3LRLA 4X22A 4XQ6A 2X1TA 3RFAA 4MY9A 3NR0A 4OV9A 1G4SA 4R53A 2X1UA 4FNUA 3CWNA 1AG1O 5C5YA 1VCFA 3IVUA 4GUFA 2E5DA 1SFLA 1K7XA 1LOLA 1MO0A 1JCYA 4Q32A 4O18A 1LBFA 1VYRA 3LHVA 3P82A 4RZ6A 3E0IA 3TKFA 2FDSA 3W7MA 1K02A 3F4NA 3M6YA 5DXXA 3W74A 5BW6A 5IBXC 1WBJA 1DORA 1OF6A 3GAKA 4UC5A 1K3UA 3OEXA 4MYAA 3GX9A 2Y89A 4LVBA 5T26A 1SO4A 2QJIA 4QSHA 3MW7A 1V7YA 2OT1A 1K8XA 4O15A 2QJHA 2QKFA 5FEZA 1T8XA 3PUOA 2QR6A 1VCVA 3HOJA 3RF9A 4OWGA 4KWVA 3HJZA 3BGJA 3MI2A 1KM6A 4JTHA 1EWDA 3B4UA 3KXQA 3TNOA 1ZY9A 2ZRVA 3T44A 3WFAA 3GKAA 3O6YX 3A22A 1VGAA 4UTTA 1R2RA 4QM1A 1ICSA 1RQEA 1UASA 3WK2A 5AYYA 3LCGA 3L67A 3N2XA 3LXBA 4DPQA 3EWYA 1UUOA 4A2RA 3R2GA 3N73A 3E96A 4LVAA 2VELA 3RMJA 5J5DA 2P1FA 2CLOA 3LLFA 3NG3A 4HSNA 3H53A 1NAL1 3GYEA 3LCIA 4JTSA 3UPWA 3GIYA 1TPB1 2QF7A 3N19B 1QO5A 2VFGA 3TXVA 1PV8A 2C0AA 1LYXA 4ZQOA 3KVKA 3L0GA 5G2HA 5AHIA 1N55A 4BFAA 3CEPA 2YW3A 4Y96A 1GOXA 4AAJA 2ZRZA 5KZEA 3DBPA 4JYFA 1ZHAA 5EL1A 1OJXA 1JQVA 3LXAA 1YADA 1O5XA 1PCKA 1S5WA 1OFAA 4N9EA 1WA3A 4M7SA 4M6VA 3PAJA 5DBUA 3EB2A 2RDUA 4P2VA 1SUXA 5HWMA 3N3MA 3L66A 4YCOA 3KRZA 2CLKA 2QEZA 1DVJA 3DFQA 3G0SA 1GPWA 2ZRWA 5C55A 1IIGA 4N4PA 4CQ9A 1VHCA 3C61A 4Y90A 1G4PA 3KRUA 1A50A 1I2PA 1WYIA 1XCFA 2J27A 3FA5A 3GXNA 2BWGA 1JCMP 2NWSA 4CNNA 4JTEA 3CT7A 3W2JA 1P0NA 1SPQA 2YZRA 4DPPA 3P80A 4JTTA 4OHQA 1XI3A 1Z42A 4QNEA 3W9ZA 4E0CA 3STEA 5BRBA 2PRHA 1TMHA 3W2NA 3W7HA 3B8DA 4OV4A 2PE4A 4NXKA 1WX0A 2H6RA 4N6FA 1VYSX 4K39A 2YYTA 5EPDA 4HNVA 1SW0A 1G69A 3C56A 4RK8A 3W7IA 1I2RA 1Q45A 1HO4A 1YTDA 3I6RA 3W7DA 6ALDA 1AW1A 3U8GA 2ZZ2A 4UXDA 3ATYA 3UWWA 2YDAA 2C18A 1KFCA 3UQNA 1TCDA 2A5HA 5IBXA 4XKYB 3G1DA 5KMYA 2G95A 1KA9F 4I7UA 2QUUA 4FXSA 1D3HA 4JTLA 5DCDA 3ABSA 3QM3A 5LZLA 5HWJA 4DXVA 1KTNA 1LOSA 1PE1A 2Y7FA 4ZVJA 3W7EA 1Q6QA 3KHJA 4JDBA 3GAYA 1Z48A 4JTKA 1P5BA 2RFGA 4ZQPA 3NL3A 4M6QA 1MZHA 3SGUA 4PFMA 4XWUA 3WJXA 3HPZA 2A7RA 3HO8A 5G5IA 1TPWA 3TQ0A 5HMSA 1O94A 2GVJA 2GVLA 4TX9A 1TPUA 4O19A 4AWSA 4IWWA 3DXIA 3THQA 4MY8A 2E09A 1QPOA 1OF8A 2NX9A 4JTFA 5G2IA 4O14A 1F76A 2W0UA 1H1ZA 1JULA 4DO6A 3W1TA 1ML1A 4N9CA 4UFKA 5I3IA 1H62A 1GT8A 1W37A 1YYAA 1ICPA 5CG7A 2AGKA 3FKRA 3MJYA 1EP2A 1K8YA 1I45A 4TMBA 3C2RA 3IIZA 3VE9A 4NJIA 3N14A 1HL2A 1H60A 1FCBA 4IPJA 2QCLA 4YMZA 1PCWA 4O12A 4RV8A 1OVDA 4RX0A 4A29A 4UMCA 1LRNA 4JY8A 2BX7A 3PR2A 1BWKA 5EKYA 3QFEA 4KFPA 4LTSA 1FWSA 3KOFA 2EGZA 2VENA 1CX9A 4E38A 2NLIA 4FB7A 3W3OA 1JCNA 2ZZ5A 5LGZA 5J5RA 1XXXA 3ZFHA 3HG5A 4BK9A 2C1HA 4JX5A 2BLEA 3GKFA 2XN1A 3NM1A 3S1XA 2A7PA 5FEWA 2R94A 4OBTA 4O0KA 5K4ZA 3C3NA 5ABTA 4Q33A 4HNNA 5G4WA 2Z2UA 2X2GA 3LOTA 2XN0A 2PC4A 3L0KA 5EY5A 4HNUA 1XC4A 2F84A 3G3DA 3T40A 3PY2A 2LLEA 1NSJA 5DY3A 3TMLA 1WOBA 5D38A 3LHYA 4K37A 3FYOA 1JUBA 1TREA 3OA3A 4WQ6A 2PRMA 5LNVA 4FNTA 1TSIA 2Q8ZA 4EF8A 4WJEA 1TPVA 3B04A 4LU0A 3USBA 2DZUA 3LRMA 4O10A 3W7RA 3CEUA 4UTJA 4GUGA 8TIMA 3MO7A 2QCHA 4A22A 2PURA 4HPJA 1KW1A 1H7RA 4NXSA 1ADOA 2VOMA 1OX5A 5HR7A 2O7SA 3FYPA 3BW2A 4O1AA 3PF3A 4GC4A 1VPXA 1ZJIA 1XUUA 5KINA 4AEOA 1TPH1 1BWLA 4LC8A 3MHFA 2G97A 3MI6A 4BWLA 3QEZA 3PBVA 1GVSA 3EWBX 3WJYA 2ZZ6A 1OX6A 2Y7DA 3LCFA 1L6WA 7TIMA 2TMDA 3MP3A 3P62A 3HGSA 1W56A 1X8FA 4UTLA 2C19A 3TUUA 3FFSA 3FIGA 3W2MA 4GNJA 3G1YA 4UIOA 2WPBA 3IV3A 2ZA2A 3M44A 1Z41A 3G8RA 3OVQA 4N02A 3NQFA 1YPFA 1LDCA 3NQ7A 4MLRA 5D03A 2FIQA 3B03A 3QYQA 3MBFA 2V2CA 3IEBA 4NNCA 5LNSA 3WJSA 1NEYA 3DGRA 3L5LA 3GXPA 4E2DA 5C54A 3PBYA 5I3JA 3TC7A 4PTNA 1B9BA 1KFKA 5G1YA 3NZRA 4H6KA 3LDVA 4DELA 2AQWA 2V8ZA 1JQXA 3W7LA 3P67A 5CPLA 4OQVA 3UWUA 1ICQA 2NX1A 4AHOA 1RR2A 2TPSA 5K9XA 4J9JA 5LGXA 5G4EA 2QCEA 4JDYA 4IMEA 3VCRA 3NA8A 3Q37A 3W88A 4RJEA 4MUZA 1VYPX 3NEVA 3NL5A 5AC8A 5I3HA 1W3TA 3TU9A 1IXQA 1TJRA 1P4CA 3W7JA 2ZCGA 4KFOA 3LHTA 1FDJA 3JRKA 1QPQA 4GUJA 1B57A 4O4WA 4YWIA 4BI5A 2DZXA 4IUOA 3W1UA 1FWNA 4JX4A 4MZ1A 1EB3A 1JUKA 3LBCA 1P0KA 2E5BA 1SZNA 4AVFA 2O7QA 4O1CA 3BW4A 3CIWA 2KZHA 5D33A 2OCZA 3OVRA 1L2UA 3P81A 1S3HA 1H5YA 2ZA1A 4O17A 1B4EA 1Q3NA 1QMLA 3L68A 1F6KA 3C8FA 5DCBA 4AH7A 2QUTA 3HMJG 3QMRA 3PBWA 4I9AA 4DO4A 3OBKA 3LB0A 3IVSA 3Q94A 2ZZ4A 4UMAA 3T4CA 4Z0JA 5EBUA 4CQAA 1ALDA 3G3MA 3W86A 1NFBA 1OFRA 1I2QA 2XN2A 3M5YA 3W1XA 5CSRA 1A5SA 3TFXA 3QMSA 4ZZ9A 1W31A 3HB9A 4NUWA 2I14A 2A21A 3EX6A 3MMTA 3O6CA 4XTIA 4WY0A 3GNNA 3MP5A 3S1VA 2ZDRA 2WSYA 3L9CA 3BLEA 4CCCA 3QZEA 2J9ZA 3OG3A 1G67A 2QCNA 1FWTA 1OG0A 1JVNA 4NNAA 1EPXA 2GJLA 3F03K 4DBEA 3LI0A 4JTJA 1S5VA 3QW4B 1H63A 1YLVA 1TO3A 3MWAA 1KFLA 2YGYA 3SW6A 2OMAA 2E68A 2VFHA 3DFPA 5DELA 5HULA 4TR9A 1LRTA 2FTPA 3UPBA 1JCXA 2VEIA 3BG9A 1L6YA 2QCFA 1R2TA 1KLYA 2WNZA 5HJLA 4TMCA 5K9CA 3OIXA 4FX8A 4AMAA 3P5YA 4H3DA 1FWRA 3NQMA 3TSMA 4DO5A 4PCFA 3UY8A 1FXPA 1MEIA 3BARA 3FS2A 3NQEA 3TE9A 2A0NA 2FB2A 3W1MA 2VFEA 1QPNA 3A9IA 3S5YA 3M0ZA 4UNKA 1DBTA 4OE7A 3NPXA 3O63A 2DJLA 1FXQA 1D3GA 2CZFA 3S8HA 2A85A 2V0TA 3W7NA 3LTYA 4M19A 3MHUA 4NVTA 5AHFA 3L0NA 3NQ6A 3PM6A 3W83A 1OFEA 3UZJA 4FX7A 1C29A 2XFWA 5BMXA 2NUXA 2CLIA 5AHMA 1KM2A 1QPRA 4ICNA 2YR1A 4S1FA 1VHNA 4O16A 1F05A 4AHQA 3NOEA 2EF9A 2GUUA 3ATZA 4LWWA 5F4XA 3IGUA 3V75A 1OFPA 3IGSA 4IQLA 3W1RA 2FFCA 4BF9A 3HG4A 4YXGA 1NF7A 3QPYA 3UWZA 3EEGA 2A2IA 4O4VA 5K7JA 2BXVA 1AL7A 1R30A 4GUIA 1C8VA 5H91A 4LS2A 4JIPA 3M9YA 4CCDA 4IXXA 3N2MA 3HBLA 3SECA 4M5PA 2ATMA 3LX9A 2Y63A 3DFSA 2WV8A 1YXDA 3CU2A 3F1QA 5K3VA 4MKNA 4WOZA 3UWYA 1AMKA 3Q58A 4MZYA 4W9TA 4XBKA 2VEMA 1L9WA 2YFOA 3O8AA 3W87A 3IIXA 4MIMA 4GXMA 4NJJA 5MHBA 4MPQA 2CLMA 5BOOA 3I7SA 4UNLA 5BMWA 2ABBA 3DH7A 2BSLA 2RKXA 3UWQA 1W5NA 4QQ3A 3SSJA 2RH9A 4LY8A 4MJZA 1M7PA 1YPIA 2ZQ0A 4PODA 5AYZA 5F2GA 2R8WA 1LZOA 2VC6A 2B7OA 3NQ2A 3PB0A 2Z1BA 4O54A 4QNWA 2AAMA 2CLFA 1O5KA 5AOUA 3UZ5A 4Z1AA 2FB3A 3A5VA 4PC8A 1FCQA 4LW7A 2YXGA 1SZEA 5D02A 3BO9A 3QW3A 1VCGA 3C4UA 2CU0A 2ATSA 2C6QA 3O1NA 1I2NA 5F1UA 1FCVA 5D2WA 3B0PA 4IX2A 3S6DA 2ISVA 2Z0IA 5CPMA 5LNWA 4O57A 4K38A 2FJKA 3P61A 2Y7GA 3LI1A 1TQXA 4HKPA 3W22A 5LSMA 1JJKA 1FQ0A 3EXTA 3K30A 4EIVA 2CFFA 5D05A 4MY1A 1G7UA 4R33A 4FNRA 4S2CA 3W2UA 3EXSA 1AL8A 3W76A 2FLIA 4K36A 4HT3A 1LOQA 3VKJA 2E6FA 2P10A 4JICA 4LOCA 2ZRYA 1QAPA 5D2TA 1DL3A 1BKSA 1QOQA 3GDMA 3W7QA 4WY0B 4LVDA 3TX9A 2B7PA 3G0UA 2NV1A 5KTLA 3BG3A 1WOAA 3S5NA 2C3ZA 3GDRA 1I2OA 5H2ZA 2RDTA 5K2ZA 1OHLA 1PIIA 4DBDA 1FDZA 4LRSA 4YCPA 1ZCOA 1VZWA 1YXYA 3B0VC 1XBXA 2Y85A 3W1AA 3TFCA 1TIMA 1W8SA 3ABOA 3VNDA 3W85A 1VLWA 3GVGA 1UBSA 1GVFA 2B7QA 3CTLA 3TCEA 1QFEA 1WQ5A 1OABA 1KBJA 3NGJA 1QR7A 1SO6A 4MLJA 1I8JA 4QJ1A 2QCMA 2VXNA 3LCHA 1GZGA 1M6JA 2BTMA 3TC6A 3E02A 3I68A 2HSAA 2PRLA 3L65A 5AHNA 1VQTA 2NV2A 2V82A 1OFQA 3KRSA 4E2BA 1JCJA 3RU6A 2G96A 3EXRA 3TV8A 1EP3A 1CI1A 2V81A 5KZDA 2EPHA 2V5BA 1C9DA 1GEQA 1PL9A 4RLIA 4G1KA 5TIMA 1SSDA 4Y6GA 3MHGA 1XDMA 2GVGA 2P0OA 3AJXA 2JKAA 1YDNA 2JBMA 2ZZ1A 3QSRA 4NZJA 3BPWA 3LHWA 1G4EA 3H54A 2DP3A 3DHDA 3W2KA 2Z6JA 3GDKA 3BLFA 1KFJA 3BV4A 5HR6A 1EUNA 1XM3A 1W3NA 4BI7A 1RZMA 4X9SA 2Y7EA 1H7PA 5FF4A 3G24A 2DZSA 3DI1A 2HTMA 3NQVA 1OYCA 3TQKA 1H1YA 3TSBA 4GUHA 1KTCA 2W79A 4KWWA 5AYXA 4JTGA 1TV8A 4FXRA 3TIMA 4XUGA 3SFKA 3JR2A 1VJIA 3DHFA 3KX6A 2D73A 2Y62A 2ZBTA 4O1DA 2VKZG 5CGQA 5DCEA 1W1ZA 3W7OA 3QH2A 1LBMA 4AF0B 4LUIA 1T96A 4DEFA 3HF3A 2Z6IA 3QSTA 2Y70A 3C2OA 4FIRA 2CLEA 4IX0A 1EWEA 3C2FA 4IGHA 1TRIA 3E12A 1K8ZA 1TTQA 1IIHA 2NUYA 2DZWA 4GWEA 3N9RA 2EHHA 4MFDA 4UFHA 3VFLA 1NF0A 4JY9A 1L6SA 5C6MA 4UTWC 1WBHA 1LCOA 3PVFA 2YYUA 1XUZA 2FPYA 3O07A 4AWUA 4UTKA 2WNQA 4CNPA 3NPWA 3NPUA 4JD4A 1QWGA 1H61A 1PHQA 4RZ5A 1Q6LA 1DQXA 1GWJA 1LRQA 1E51A 3NQAA 1AK5A 3LTSA 3G8EA 3CLMA 4ZQRA 5HQEA 1OK4A 1OX4B 5U4NA 3RNDA 2A4AA 3NNTA 3IVTA 4TIMA 5CZJA 3S42A 3W7PA 3YPIA 3MI3A 1EX5A 4OT7A 1KLZA 3G1HA 2CZ5A 4O11A 5A5WA 5TBOA 1AW2A 2V5LA 1UCWA 2ABAA 3P7YA 3W75A 3UXDA 3GLCA 2ZYFA 1A5BA 2J9YA 4IMFA 5EYWA 1F5ZA 4UFMA 3WK0A 1GVOA 3A5FA 4X2RA 3B0UX 1ONRA 1SO3A 1WXJA 2C15A 2Y6ZA 4R34A 1YTEA 3FEMA 4UTHA 1KBIA 3DAQA 4MFEA 5CZTA 3TH6A 4JTIA 1HUVA 4CNOA 4NX0A 4C1KA 2YX0A 2V30A 2B4GA 4ZQNA 2C16A 4FEZA 1V5XA 3G1FA 3STFA 1TYGA 4WZHA 1KM3A 2JKEA 4QITA 1FDYA 2ZTJA 4PA8A 3HG3A 3GXTA 1O60A 2GQ9A 1IXOA 3NL6A 2ZZ3A 3MUXA 4XBSA 4A2SA 1QO2A 3L5MA 1IXNA 3NZ1A 4LNYA 1UB3A 3NQGA 3M1ZA 3M16A 1H7WA 3P74A 5FI8A 2A1YA 3TJLA 3GDTA 2V2DA 1N7KA 1VC4A 2QCDA 4FNQA 4UMBA 3CM4A 1SZGA 2JKPA 2NX3A 4HN4A 4ZQMA 4AF0A 5C2XA 3KAOA 1F6PA 4NU7A 5I3FA 2WO5A 3HG2A 2BZNA 2E6YA 3W07A 4JXCA 1YDVA 4XZ9A 4UR8A 2X30A 3DKJA 1TPFA 1KM5A 3CQ0A 3O16A 1FX6A 4FO4A 3TMQA 1GVRA 2ZFAA 5D30A 3M5VA 3INPA 3TR2A 4WOQA 2TRSA 4Y9AA 4EWND 4IMDA 4N9DA 3ABRA 3BK0A 1O4UA 1LM1A 3HPSA 4JEQA 1QDSA 4HHPA 1LTDA 2EKCA 2G5WA 2FQIA 2YFNA 5CPOA 3G1XA 1XBYA 4ORMA 1Q6OA 3NQ8A 5FF0A 3HGOA 2OX1A 2EAWA 1YTKA 2NWRA 3C2VA 1EUAA 4IPIA 4CCEA 2H3DA 4RXGA 3SZ8A 1TPEA 4UTIA 2HMCA 5CKSA 1D9EA 3TQVA 3TROA 4ALDA 4ADSA 6TIMA 3N34A 2ZRUA 2DJXA 5E93A 3TW6A 3W70A 3CWOX 4LC6A 2HS8A 3DKLA 5AHEA 1TQJA 4A21A 3O15A 3P8JA 1YXCA 1B3OA 2E5CA 4LVGA 1T99A 4AXKA 4FF7A 3WK3A 2E77A 3UYCA 1F7BA 1H50A 3LBMA 1RVGA 3S0CA 4DF2A 5FF3A 3M41A 4YLWA 2CZEA 1EEPA 3V1PA 3EWXA 4Y8FA 3QMTA 3IIVA
chains in the Genus database with same CATH superfamily
4C60A 3L2IA 2DZPA 4YHEA 4GACA 1DV7A 2PPGA 1HX0A 5CH9A 3PUDA 1W0MA 4AUBA 3NQDA 1A5MC 3T09A 5IDZA 4YL2A 3D0CA 3F4VA 2VQUA 1LP6A 3IRSA 2B7NA 1BSLA 3W7GA 4UUIA 3VNMA 2SFPA 2GQ3A 3EX3A 4HJFA 4AHPA 5CBJA 4M29A 2WBGA 1KFBA 5G4HC 3BAKA 2DT0A 2PTXA 4GO9A 1IHIA 3NDOA 3CUJA 1KR1A 1E15A 3MWCA 4IXHA 4C7FA 4WXYA 3CB8A 2G50A 1Z6KA 4E4UA 1POKA 1JRBA 3HPXA 4MB3A 1IGSA 1MDLA 1W2PA 3PZQA 4HYRA 4KIEA 5TQLA 4IIGA 1H7XA 5I3DA 1GW9A 1IT7A 2I57A 4PMOA 3NTYA 2ANUA 4FZIA 1PHWA 1TRDA 3TJ4A 2X0YA 3GW0A 3G22A 3LV6A 1LORA 4GJ1A 1FVPA 5C70A 3GR8A 3AO0A 4MJMA 4J3XA 4WDXA 2EO7A 3A21A 3PB2A 3EZ4A 3UF9A 5F4WA 1GZJA 3IJ9A 3TTOA 3STCA 3QQ0A 4IGNA 4PGLA 5DMMA 4WSJA 2F8QA 3HIJA 2QNEA 5JXQA 2DZTA 2J8GA 2DZVA 4GYPC 3WJZA 1XKYA 5FF7A 4MKSA 5LIWX 3LBOA 1MEWA 2GZXA 2VEGA 3KL0A 2WZEA 2OSXA 4ILSA 5C2GA 5REQA 4RR4A 4PB4A 1JPKA 4ROPA 4L9ZA 2CBJA 4BZYA 3I7QA 4UQ9A 2QS8A 1HFBA 2EPNA 4IIDA 2H90A 3BUVA 3UD6A 5A6BD 1P43A 4IMCA 4FI4A 3PFMA 3FJ6A 3LCXA 2O9PA 4UTUA 5A8MA 4BQ2A 1ME7A 1W5QA 4X60A 4NQ1A 1W9BM 4H7VA 1EGZA 1SQ7A 1FHUA 3U0HA 1NDZA 2CZDA 4DF0A 4QEHA 3APTA 4AC7C 5LNUA 5KZMA 1BEUA 3U2ZA 1G7VA 2Q3RA 1OYAA 2RDWA 4LAKA 3S3GA 1M3UA 3A12A 3W1QA 3RR1A 3KBVA 4AYSA 4V28A 2CZVA 3ONCA 1U5HA 2PLKA 1Y5WA 3M4HA 4GBDA 4N2YA 4D8ZA 1ME9A 2GQAA 2VVNA 3R58A 4ZCWA 4H00A 3UWVA 4EOUA 3TSDA 1CXKA 1XRVA 1G4TA 2Q09A 3BG5A 4UFLA 4G2DA 1KM4A 1Q6FA 3EWWA 4H2CA 3W0KA 3ZZ1A 4IQJA 1NTHA 2Q02A 1RPKA 2PDUA 1PO9A 1R85A 1V0LA 4O13A 1M68A 5GVJA 1FKXA 1MWOA 5G2WA 1AA1B 2E6AA 4O50A 3F5KA 3TLLA 3EX4A 3THAA 4DUVA 4O53A 3KVMA 1DHPA 4D6EA 2ZA3A 4YVXA 3VNJA 3J7HA 3MYPA 3CC1A 1SMAA 3A4WA 5BU6A 3KL3A 3I7RA 2HROA 4GOAA 3MBDA 2OT0A 1XYMA 5DBTA 4JL2A 1XH1A 1BRLA 4TVDA 4H41A 2OODA 3BLIA 1ZAIA 1EC8A 3K8KA 4GG9A 3UR5A 3PG9A 4CN6A 1E72M 2A6NA 1KGUA 3OHIA 5CZ0A 2WCSA 2GJNA 4CN1A 3BSHA 1UD8A 4PTWA 4GI9A 4EAMA 2QGHA 3S5SA 4A4AA 2IXVA 5CBBA 2ASHA 3EDFA 2ZZ7A 4H6EA 4LS1A 3ZM8A 5JH2A 5KITA 2WNNA 2XGIA 4CKQA 3WD0A 2QDGA 1TG7A 1VRDA 3KFTA 3QZ6A 4YTRA 2IQTA 4E6MA 3WBYA 5A69A 2WAGA 5HXMA 3QRHA 1CLKA 1KFEA 4ML9A 4CNSA 4M6UA 5CJNA 3KVLA 2OU4A 1VBRA 3WD3A 3OG2A 3QC3A 3OLDA 5GJPA 4RW5A 3M0JA 4MZ8A 4GNVA 3VE7A 3EKLA 2PA6A 1S38A 5EGRA 1UJPA 1KBBA 2OJPA 3R94A 1J0HA 1EJRC 4WKFA 3FGCB 2IPFA 3IAQA 2CBUA 2ZADA 1A49A 2V3DA 4JFTA 5A1AA 2WZTA 2Y4SA 4GZ7A 3RM9A 1V6UA 2ISFA 4Z2IA 4Z1BA 4KMQA 1NOUA 3NZQA 2GPTA 3NAVA 5D9NA 3VIOA 2I5QA 1JZ4A 1A53A 4W8BA 1ADSA 1GORA 2J8FA 3TZNA 2FVLA 1UR3M 4KEMA 5HNNA 4GI8A 7ENLA 3IK2A 4O1BA 4KWOA 1QNVA 4JR5A 4HK6A 1EQPA 2FGLA 2OLSA 1NFPA 1QOPA 1UD5A 3QV9A 3WNPA 3GR7A 3C52A 1KRBC 3BANA 5FF2A 3IACA 1BFNA 3GFZA 5A2AA 4E2VA 1C91A 3BC9A 3EOOA 3EB3A 5FEPA 3UWEA 1JCLA 5ABGA 4W85A 3VTRA 3PWAA 2Z00A 4D6IA 3AXHA 1W5OA 1A3WA 2PWDA 4C6FA 4INFA 1JRCA 4ADUA 1X7FA 4GJJA 4LB3A 5AHLA 1GTHA 2ZUNA 1GNXA 5GNXA 2F7FA 3ABZA 3BAWA 3PN8A 1KM1A 1JDEA 2C8NA 4FAMA 3SR7A 3AJ7A 4XUYA 1K7EA 3A23A 4K7YA 1V8EA 1R46A 2ZRXA 4M8UA 1W91A 3LERA 3IRDA 2GGGA 1B0IA 2DEPA 3ICJA 4LSBA 1GQNA 4S3FA 5F2MA 5I0DA 5U7SA 3DZ1A 4PMDA 5FOOA 3F4WA 3FJ4A 1IR2A 2XFYA 3IJ7A 1A5CA 3NXFA 1SU5A 4DJFD 1HJXA 2W6RA 2BY3A 3ARSA 4XD5A 2QAPA 2XGZA 4GA8A 1NELA 3TJXA 3WLJA 3UA3A 3STGA 1V3MA 2BOFX 1E6NA 2OZ8A 2VC7A 4V1XA 4C1NA 3WLLA 4AYGA 5BWAA 1T0OA 1ZNNA 2PWFA 4E8DA 4GY1A 3AS1A 4LT9A 2ZWYA 2W63A 4HNTA 1NDWA 3PAOA 3S2NA 4LANA 3R13A 1AODA 2VO5A 2WSPA 5DY2A 1FWIC 4JAWA 1XYFA 4GQQA 1P48A 1VFLA 1MRAA 4RNFA 5LA1A 4UFIA 4HSOA 1ME8A 3SIZA 2J6VA 4X22A 3ARQA 4MB5A 3WDIA 3RX2A 3BMXA 4MDOA 1G4SA 3E0WA 4DAIA 3CWNA 1AG1O 1PWLA 2Q8XA 3ZT5A 2Y5EA 5BWFA 4FPSA 1JCYA 3FJNA 5CJ5A 3B8WA 2OWWA 2Y1HA 1K02A 3HA1A 3F4NA 4F9JA 3W53A 5BW6A 1O12A 1KCXA 5IBXC 3M46A 5H8UA 4GX8A 1SMDA 2D2JA 4R9OA 1GCYA 1QNOA 1SO4A 1VFSA 4ATWA 2RGMA 3HU7A 1YPXA 4US5D 4PCTA 3PZIA 4KWVA 4JPGA 4NI8A 1TWSA 4P7OA 4UQAA 3AIBA 3WNNA 1KM6A 3BTNA 4JTHA 1F61A 1CNVA 3TNOA 1EGMA 2D0FA 2DQWA 3OJGA 1AQHA 3UW6A 2D0HA 3A22A 4Q8PA 1R2RA 3LU2A 4GISA 1E5JA 1UASA 5I00A 4ZB2A 4AD2A 3ARVA 1ZB5A 4DPQA 2XJ7A 5C2CA 3QV8A 1BG4A 2YZ5A 2OR2A 1PIFA 5J5DA 3NG3A 4HSNA 3TYDA 5HQMA 1Q5MA 1NAL1 4GIYA 4M1BA 3UPWA 3E2QA 1TPB1 2QF7A 1Y65A 2HISA 1PV8A 4LYRA 1AJ2A 5G2HA 5AHIA 2BGSA 3CEPA 5CSYA 4QCFA 1PDZA 1CB2A 1FRBA 1RA5A 1QBBA 2Q71A 5KZEA 3DBPA 4I8YA 1ZHAA 5EU9A 2WMHA 3EA3A 3WQCA 4JN7A 1M1BA 4LBUA 1O5XA 2PDCA 3VCNA 4C65A 3HTWA 3TNBA 4QJ5B 1K70A 2PP0A 2RDUA 4UQEA 3S83A 4P2VA 3WQEA 4WDUA 5HWMA 1KCZA 1U1HA 2QEZA 1CT5A 2X41A 3G0SA 1R7OA 3VMOA 3GQYA 5C55A 2DUZA 1KKRA 1JDFA 1G4PA 1LWHA 3KRUA 1A50A 3HURA 1WYIA 2PTWA 3GXNA 2XGBA 2YBVA 4CNNA 4DXXA 2J13A 4ZO7A 3W2JA 5C9XA 1SJBA 4PUEA 6XIAA 2PRHA 2E8YA 2BGNE 4TUFA 3B8DA 4OV4A 3K8MA 1WX0A 4Q4RA 1VYSX 3S9ZA 4DI9A 4DLFA 1M41A 1JGMA 3O3RA 3PPFA 1XIHA 3W7IA 1Q45A 1XQLA 3V5OA 3W7DA 1ZJAA 1DWIM 4UXDA 5I6SA 1E3ZA 1UP2A 3MSYA 4K3ZA 4XKYB 3G1DA 2DGAA 4L65A 4L7ZA 4I7UA 2HCVA 2PD5A 1D3HA 3GG1A 3WNKA 4EPKA 3TA9A 3LGGA 3PP7A 4R9XA 1KTNA 3WMBA 1HNYA 1WKEA 4AC1X 3T0TA 3M0IA 4KRZA 3SB0A 3JU2A 4HCLA 3VABA 3PHAA 1U1JA 4JTKA 1EFZA 2RFGA 2VP8A 1EYWA 4M6QA 1MZHA 3QY8A 4XWUA 3RPMA 3HPZA 3VNIA 5A8OA 2A7RA 5CC6A 3ES8A 1XR2A 3AU2A 4LYQA 2GVJA 2ALRA 4DVOA 4NY2A 3DXIA 1I0BA 3THQA 4MY8A 2NX9A 4DYKA 4JTFA 4JFVA 5G2IA 4L1WA 3VKCA 1F76A 4N9CA 4ACZB 4UFKA 2NVCA 5CG7A 1YYAA 1ICPA 2AGKA 1EP2A 1I45A 4NZ5A 4TMBA 1JL8A 2PSNA 4MWAD 4QE4A 3VE9A 2PD9A 2CBIA 1S3TC 1FCBA 3S9IA 2GVEA 3MUCA 3KBWA 4O12A 2Z1KA 4B15A 2V5JA 1OVDA 3RAOA 1GQIA 3NDYA 3BSMA 4A29A 3SIMA 1B3ZA 3EDDA 4G8TA 4XAGA 3FA4A 1AZ1A 3ITCA 3FDKA 1ECEA 4F8XA 3WO8A 3L4XA 1E0UA 3CUZA 3GG7A 3W3OA 1JCNA 5LGZA 3ZFHA 4B91A 4HQVA 3HG5A 1T8QA 2C1HA 2BLEA 4NI3A 3S1XA 1XKJA 3JZEA 4ZOEA 3C3NA 2OYLA 4Q33A 5G1MA 4LNCA 2XN0A 2UWFA 4WDWA 3PY2A 2FKPA 3LHYA 1R3WA 1TE6A 1VEPA 1TR9A 1XSJA 1PYFA 6XIMA 3NSMA 4UOZA 4S3AA 3AALA 4LU0A 1E6XM 4XVEA 1CCWB 3CB3A 8TIMA 3WMCA 2PWHA 3CHEA 3MO7A 4LF2A 2R1PA 2ZKMX 3SRFA 4HPJA 1PTGA 2AQOA 3CZEA 1X97A 1GOMA 1UHVA 2QPUA 5CAHA 3URQA 5LIYX 3CUIA 1TZ7A 4M51A 1OX5A 5HR7A 4KRUA 3PTMA 3FYPA 1VPXA 2A3LA 1XUUA 3RM4A 5LIUX 3NO3A 2XSAA 3LY0A 3I4EA 3HFTA 2G97A 3K2GA 2GUYA 4US5A 1OX6A 2HRWA 1L6WA 2A3AA 7TIMA 1QU4A 1N82A 1W56A 3G5EA 2HVMA 3FFSA 3FIGA 1UMLA 4UIOA 4U10A 4C5YA 1YX1A 3M44A 1POJA 2W62A 3U7BA 4DHGA 2PZNA 1LDCA 1OC7A 3NQ7A 4L80A 3POHA 1LJYA 1XLDA 2VRJA 1QJWA 2ZUUA 1RK6A 3IEBA 4DO7A 4M1RA 3B0YA 3DGRA 3B8UA 1EJUC 3L5LA 4GD0A 3GXPA 2QPSA 4OBRA 2P5NA 4AFYA 1DQUA 4H6KA 4XD6A 3LDVA 3ITOA 1RY0A 1JQXA 1XLBA 1REQA 2XINA 4HPGA 1MNZA 4KH2A 1RR2A 3LSBA 5LGXA 3SN0A 3GRIA 3VIFA 4DBWA 5AKQA 5IDIA 3NL5A 3TU9A 1REQB 3WLSA 5ENLA 2DIKA 1QRQA 2R1MA 4C1NB 4QR6A 5EMYA 4L6DA 4YWIA 2DUXA 4IUOA 1R0MA 4TTUA 1GOIA 4MG4A 1HN1A 1P0KA 4AVFA 2H9AA 1EOKA 5D33A 4U31A 1DWFM 1GQJA 2PDHA 4V27A 1L2UA 1QWKA 1BVNP 3A4AA 1Q3NA 1FWCC 2WLZA 2VYOA 5DCBA 4DUXA 2QUTA 1G0CA 5FAJA 4XISA 4U3AA 2PDWA 2CXGA 4W88A 3E2SA 1TZZA 5EBUA 2EKGA 3GNOA 3GVVA 3IS4A 3E0FA 2PCEA 3W86A 1NFBA 1DE5A 2QIWA 3RYSA 3W1XA 5CSRA 1A5SA 3RPDA 3URNA 2G3NA 2GK1A 2I14A 2A21A 2HWGA 3EX6A 4RW3A 3G2GA 4GX9A 2VGGA 5FJRA 3S1VA 2X09A 2OLAA 3QZEA 1UQYA 3OG3A 1OG0A 1UMYA 1JVNA 1FWJC 2GJLA 4OUEA 3BH4A 1WB0A 1C93A 3KLKA 4MWAA 2QYGA 4OBSA 3BJFA 1E1CB 2VFHA 4JEJA 4TR9A 4G56A 3AICA 4DWSC 1EQCA 3TCSA 1JCXA 2DSWA 1L6YA 2QCFA 3TN6A 3BAIA 1R2TA 1KLYA 4HZMA 3P5YA 3ITGA 1MZRA 1MEIA 3BARA 2A0NA 3KL5A 4NIRA 4O0QA 2VFEA 3A9IA 3EPOA 4LEQA 4DAFA 3SCNA 4OE7A 3FXGA 2DJLA 1I60A 1BPLB 3BMWA 1D3GA 3GDBA 5EB8A 2VM8A 2QDEA 2DUAA 2J8TA 3LTYA 4M19A 2BVDA 3UZJA 1C29A 3UJFA 1A47A 5CC5A 5AHMA 2YR1A 4S1FA 4BF5A 2VTFA 1IEXA 3U48A 4AHQA 4KPLA 2Z1SA 1RBLA 5DEZA 1EO7A 3TYUA 4IHCA 4P8WA 3EEGA 2A2IA 3VGEA 4B9YA 1V03A 5H91A 1J0KA 3PPGA 3VO0A 4OIFA 2ATMA 4ICMA 5DMNA 3DFSA 2YA1A 3OLEA 2YCJA 3WY1A 2YDQA 3QGKC 3WLQA 1ZBKA 2DVUA 1I0DA 2YFOA 3IIXA 2VC9A 1U22A 5BOOA 4RDVA 4UNLA 4F66A 1Y7VA 2XFFA 3DH7A 1CXEA 3QZAA 4NZ1A 4J3ZA 4QQ3A 1JDDA 4JNYA 3AS3A 3JW7A 4WKAA 2VC6A 1UQZA 3PB0A 2EEXA 4P7RA 4OUIA 1RBAA 3GHSA 5AOUA 2Z4GA 4F9DA 1Q4NX 5HNTA 1J6OA 4B90A 3CTTA 1H49A 1SZEA 1BXCA 3AROA 3IANA 3STPA 3SN1A 3QW3A 1H0IA 2HJPA 4HYWA 3WNLA 2CU0A 3N4EA 2YA2A 5F1UA 1FCVA 3B0PA 4IX2A 2BHUA 2ISVA 4YN5A 6PTDA 1FQ0A 3EXTA 3DECA 1B3XA 3MCOA 2GDUA 1DWAM 1NQ6A 4S2CA 4MWAC 2IKIA 1XIBA 3DFHA 3Q45A 4GIAA 1RJQA 1K6AA 3W76A 1XIFA 3CS2A 1VPQA 1LOQA 1RHCA 5XIMA 2E6FA 2P10A 3RCYA 1XW8A 2ZRYA 4JIRA 3TC3A 3R43A 5JBFA 3W7QA 3T0CA 3T2PA 2B7PA 2GWGA 4LX4A 1YDYA 3G0UA 4FR1A 4HK5A 4F0RA 2VUNA 1R86A 4DBDA 4IT1A 2DSUA 1Q2RA 4YCPA 1YXYA 5C7VA 3MV11 4OOZA 4ZOBA 1TIMA 5I09A 5IFTA 3GVGA 3UNTA 1XLFA 1XCXA 1GVFA 2HBVA 3OO2A 1QFEA 4C90A 3PFRA 2QMJA 4MLJA 4QJ1A 3B4YA 4EANA 3E02A 3BLOA 2HSAA 2QVHA 1E6RA 3IPWA 1VQTA 3H8AA 2YBUA 4E2BA 2G96A 4G1NA 1FWAC 1Z8AA 1CI1A 2V81A 5KZDA 3U5YA 1GEQA 1PL9A 3CUHA 2FZNA 1NWUA 1SSDA 4ICCX 1AMYA 3RJXA 3CZJA 3SURA 4NZJA 3PPCA 3LHWA 4S23A 2ZC1A 4LCRA 2Z6JA 4CVWA 3BV4A 4KEVA 1GVIA 1XM3A 3R11A 4HOZA 4UCFA 4BI7A 1UR2A 1YBQB 1E5NA 3C0SA 3VNZA 4N0RA 1JYWA 4U3CA 5ECVA 1WKDA 4ATDA 1DIDA 3BCDA 4Q4MA 3A13A 3TSBA 4R7OA 4Q8QA 1EJ7L 4KCVA 4KWWA 5CSUA 5AYXA 4QROA 5F7UA 3LLXA 4FXRA 3JR2A 4GFIA 4IFKB 4WDTA 1BRLB 3APGA 1RLCL 5FSDC 2QJMA 4O1DA 1M7XA 2G4JA 3OQ8A 1BHGA 1W1ZA 3QH2A 2HV5A 1B1YA 1FOBA 4AF0B 1T96A 1OC5A 1I1XA 2PWEA 1XRSA 3VOGA 5JIWA 2GGIA 1EWEA 3C2FA 3E12A 1QPKA 1JFXA 3SRDA 4V15A 2EHHA 3A4XA 3BXWA 3VIJA 3H6OA 5C6MA 4UTWC 1X98A 3TQPA 1XUZA 1R3VA 3O07A 4UTKA 1EXPA 3OPSA 1A80A 2BASA 3IJ8A 4ZE5A 1EO5A 3SEPA 1GWJA 2INZA 5CAKA 1AK5A 1JG9A 5JVLA 3CLMA 4IIHA 1OK4A 5U4NA 3W7PA 3YPIA 4JBRA 3BZJA 2XPKA 2CESA 2VEFA 3W02A 4GC3A 5A5WA 5TBOA 3M0XA 4DN1A 3V35A 1ZU8A 1UCWA 3W75A 3QBUA 3AZSA 2ZYFA 2J9YA 3FGCA 4TX8A 2YL8A 4UFMA 1GVOA 1S2CA 3MY9A 4R34A 1EOMA 4PUWA 2X7VA 3GWQA 4QHRA 3UBPC 1E71M 3TH6A 3GU1A 3E2VA 3GH4A 1G01A 4NX0A 2YX0A 4C6EA 2YLAA 3F7JA 3NGFA 1U5VA 3GTIA 1V5XA 3G1FA 3STFA 2DY3A 4QITA 2ZTJA 4ZR8A 4PA8A 3GXTA 3FNDA 3MUXA 4ASTA 2CPUA 1QO2A 4MPKA 3F2CA 3P74A 3QQWA 5FI8A 2I56A 1E70M 1SZGA 3VOIA 4HN4A 1IQ8A 5C2XA 5I3FA 2D69A 2BZNA 3HG2A 1UIOA 4Q4OA 3RRXA 2WNWA 4ZE4A 2AL1A 4XZ9A 2MANA 2X30A 4GZIA 1KM5A 3B8VA 1PZ3A 4F0KA 3KM8A 4WOQA 3VIGA 4EWND 4UOJA 1RCQA 3PTDA 4HHPA 1LTDA 4ZO9A 3RN6A 1P6BA 5CPOA 1H5VA 3G1XA 4ORMA 3VZXA 1U30A 2PFHA 5FF0A 3HGOA 1YTKA 4DNHA 2NWRA 3G6MA 3NSXA 4CUCA 3QTGA 5CKSA 3TQVA 3TROA 2G37A 3N4AA 4H2HA 2DJXA 5E93A 3RM8A 3TW6A 3W70A 2NQ5A 4ZB5A 3BLDA 3CWOX 2HS8A 3MO4A 1UZHA 3WF1A 3RU8X 1ENUA 3GS6A 3SUSA 2WM1A 1MUWA 1PIGA 1B30A 3V18A 3P2VA 2Q01A 3S0CA 3B9AA 5RUBA 2WM0A 1EEPA 4Y8FA 1PAMA 2WVVA 1DWGM 4UFJA 4HYVA 1FCUA 4PL1A 3ERPA 5HDRA 3H22A 2R14A 3E38A 3TXZA 4H8UA 4MJ2A 1SVDA 1Z44A 1LT7A 4UTWA 3ZWSA 1LQ2A 1WDRA 3VDHA 3BCJA 2H9AB 3GZ3A 4NNBA 3MDWA 4B2DA 3GB6A 2NXGA 3ARXA 3FOKA 4O1FA 3S9YA 2PI6A 3EOLA 2CC0A 5AB3A 2H8ZA 4TVCA 3ZS4A 1MXSA 1ZCCA 4Y9MA 2V63A 3WH9A 3EWZA 3H7RA 1RQBA 4JIHA 4EVZA 1WDSA 3S1WA 3OODA 4JQAA 1AQ0A 2HVNA 1I6NA 2PF0A 1JUEA 1ITCA 1P0EA 2DVXA 4L4MA 4HU3A 5LNRA 1IE7C 3EAUA 2P3ZA 1J4EA 3CHFA 2E4TA 2I9EA 3G1VA 2OQHA 1GVQA 2PDBA 4C6NA 2IPGA 5LKYA 1IZJA 3LCLA 2YJQA 1TVLA 3L2LA 2QV4A 1S39A 1MEHA 3NYZA 4PL2A 4I7WA 2BOGX 2VT0A 5D37A 4JTRA 3LZ3A 3VGGA 3KTXA 1BLIA 1P0DA 4PUKA 1E6QM 4QXIA 1UR9A 3V0UA 2HK1A 3BCFA 3NXLA 4R27A 3W73A 3WF0A 3HQ1A 4D6DA 4MJ4A 3WK1A 3ZR5A 1HL9A 1W54A 5ABFA 4ZL1A 4OOUA 3CQKA 3PK7A 4NX5A 2VZSA 2YA0A 3VXGA 3WQ8A 4U4MA 3SRKA 4XKYA 2YSWA 1VB9A 3QGAC 5M03A 1LL4A 1KR0A 3TAOA 1JI2A 4BI6A 4A3UA 3DHPA 3O06A 1OYBA 1T7LA 3VI2A 3Q67A 3CHVA 3CBWA 3R79A 2PGRA 3S46A 4GNKB 4XO6A 4JYDA 3AIQA 4EPEC 1EH9A 1VJZA 2Z1VA 1HL8A 4JX6A 1RP9A 1OEPA 2VD9A 1VJSA 2ZTKA 1YKWA 1RPXA 5FL0A 1C3FA 4XZBA 2VZOA 3V0SA 5A8GA 2VZUA 1GYNA 2IUZA 3P8IA 4BS0A 1R47A 3KEHA 1TWZA 2QCCA 3P5ZA 3MMUA 1KTBA 1ISWA 1DKWA 1VAHA 4R7WA 3W72A 3CHDA 1MFVA 3DI0A 2GWNA 2WMIB 3S4TA 3H7VA 2CWNA 4CU8A 3N13A 1RSCA 3PG8A 4JCMA 3SI9A 4J4KA 4MAZA 1AH4A 3QLDA 1HF6A 1TWWA 1LQAA 1E0XA 5T8GA 1V6TA 1V4YA 2DIJA 3M43A 3WQVA 1AQMA 3MKVA 4XZWA 5FJUA 1EC7A 2HE8A 3H2FA 2VURA 3ARUA 1BG9A 2BY1A 2V9DA 1BQGA 4EAYA 1EP1A 6ENLA 4N6EA 3CV1A 1ISZA 2ZXBA 2BVWA 5HA7A 1VBHA 5F4SA 1SFJA 2F2HA 1UR4A 5EA9A 4Z2LA 3WD2A 2ZX8A 4RV3A 3RK8A 1B3WA 1HGWA 1TX2A 4TQTA 4LUJA 5HNRA 4EWJA 3GK0A 1IWPA 1PDYA 2JALA 1W5MA 4CEXC 2RUSA 4RKAA 3LM7A 2J74A 2DSVA 1UUMA 1V3HA 3DFTA 4EACA 2BXYA 4K1WA 2RJGA 1EF3A 3E74A 3WDQA 4M7TA 1UZDA 1EX1A 1SO5A 3KZSA 3I65A 1M5WA 5D2XA 1XL9A 2VFIA 4HHHA 1E4MM 4H9MA 4C6OA 4P5UA 3EA1A 3CO4A 5HUPA 4H8NA 3WMSA 3B40A 5AVNA 5HBFA 2BODX 2YB1A 3PUEA 3NCOA 1W5PA 3LZ5A 4ZQCA 4JQ2A 2WKLA 2GOKA 3HGJA 2Z24A 4HU4A 4C7DA 2PGWA 2CYGA 2D2HA 1Z7AA 5E70A 2J77A 2CLHA 1XBZA 3LNPA 3VMPA 1KKOA 4UBPC 3AZTA 5AN7A 2Q6ZA 2W27A 4NHVA 3EWUA 4QP0A 2YOCA 1XP3A 3P60A 1ISXA 3S1UA 4EP8C 4HA4A 1XYLA 3FVMA 4ZGYA 1DTNA 1MSSA 1F4HA 3G0XA 4JFUA 1CBGA 5FA5A 3B06A 3V36A 1WDWA 3M5XA 1VEMA 2ZVIA 3W7CA 3P3BA 4FIQA 3W6YA 3O0KA 4B3LA 4DQWA 1EDTA 1DYSA 2OOFA 4MNMA 4ZB0A 1KWGA 3U2OA 3GTFA 2UY5A 4DXKA 4MVAA 1VR6A 1M01A 1E1EA 1LBLA 5FSEC 2QAFA 4I9TA 1MXDA 3OYZA 3T0AA 3WFZA 1BGGA 2WMFA 4H6RA 2TSYA 1XHGA 3KOXA 2Z7KA 4M6PA 1KCLA 1XIJA 1BTMA 4PUUA 5B7YA 4CD7A 1DJQA 2DORA 3DG3A 3GE7A 2PAJA 1UKQA 2WSRA 3NL2A 2INFA 4HIBA 2EG8A 1OQFA 2QDHA 1FFQA 2J75A 3QJAA 2NZLA 4MAVA 1CENA 2EG6A 2E1DA 3EPMA 1SR9A 3W1PA 3UXAA 3GTHA 1JF6A 3RILA 5A6BA 1ONEA 4KGJA 2CLLA 2AGTA 1UP3A 2VDIA 3ANYA 2IQ0A 2PLMA 4DF1A 3M5ZA 5BYWA 3ZR4A 1T6MA 1GOWA 3EBVA 3PNUA 4D8LA 4EF9A 3GH7A 2UV8G 4HMDA 4EPDC 1W1B1 4CN4A 1SW3A 3E9AA 4U2YA 3VC5A 5FAGA 3UY7A 3CPRA 1CGUA 5KSWA 3KUMA 3LLDA 3VD7A 3EYPA 3W38A 1AVAA 1QCWA 1E43A 4D1JA 4B5WA 3NIYA 2HBXA 1BYBA 3N15A 3UYIA 4US6A 4H9YA 2OXNA 5I02A 1WXYA 4P7LA 2HDJA 3GNPA 1UBPC 1E1FA 4IMGA 4PULA 2JGQA 1F2JA 1KXTA 2YCLB 3H4XA 1LLWA 4FNPA 3USZA 2WZIA 3ABQA 4X2PA 4K8EA 2WKJA 1IXPA 1Q6CA 2Q8LA 5C9UA 2FPVA 1WAUA 4WGHA 1XS2A 2OGJA 3BLKA 1P6CA 3G18A 4WRHA 1SM9A 4CNUA 4HPXA 4TO8A 1XIEA 1X6UA 5XIAA 4BWLC 3GFYA 3WQWA 4EKJA 1LUCA 4WCJA 3H12A 4LQ1A 2E9LA 1V0KA 3BAXA 1U5JA 3UZXA 1UJQA 5CPTA 1H7OA 5HUOA 1CXFA 4IICA 3WSUA 2YW4A 4GE8A 1CGYA 5D8ZA 4YTUA 2UY4A 3N18A 4XSLA 1Q8JA 2WW5A 1WP6A 3OIHA 3AI0A 5MKGA 2E6DA 3T8QA 3GU9A 1WZKA 1DOSA 4AB4A 1GYLA 2XVKA 1SJCA 3WNOA 1CB7B 3QLLA 4LS0A 1CW2A 3DC8A 1CGXA 3QC0A 4Y9PA 1FFRA 4DJED 3KOWA 2DW7A 1JPIA 4CLMA 4ZENA 4D71A 5CSSA 1W1PA 1HJUA 1W3IA 4LGXA 2ZUMA 3S5OA 4QX4A 2CETA 1S5TA 2PDQA 2ZUSA 4GI4A 3VUPA 4WR3A 4MADA 5D09A 4Z17A 5D9MA 1CXIA 3CO8A 4J3VA 3HPAA 4G7EA 2W92A 3OVGA 3C2EA 1VFHA 3O05A 1X96A 4H9TA 4X9YA 2AMXA 3FYYA 1IEWA 3P14A 1VFUA 3NR0A 2G8ZA 2YL9A 5C5YA 3IVUA 1LOLA 2VJXA 2OEJA 4NZ3A 4RZ6A 3TKFA 3W7MA 1ZUAX 3CH0A 4N42A 4QQUA 1WBJA 1S2TA 2GUBA 2Y89A 4LVBA 3H4WA 4LBSA 4QSHA 1OADA 1K8XA 2QJHA 5FEZA 5FJIA 5C7HA 1EBGA 4GYJA 5ABHA 3PUOA 3RMEA 3R6IA 4AWEA 3HJZA 3WL1A 3BGJA 3MI2A 5BOEA 1HKKA 3DFYA 4YVVA 1UD2A 2AQVA 3AISA 3F2DA 4RDYA 4YIWA 1EWDA 2FYMA 3B4UA 4XZNX 3SCOA 4EE9A 3T44A 4CCZA 3GKAA 3O6YX 4GGHA 1JYXA 4QM1A 2YIHA 1GKRA 4GMEA 2V3GA 5AYYA 3LCGA 4KIRA 3OB8A 1UKTA 3IAPA 3N2XA 3LXBA 5A6JA 3EWYA 3R2GA 3WLOA 3CL8A 1MQRA 2VELA 3RMJA 4DWSA 4UZUA 2REQB 4MNJA 2CLOA 3WYZA 3WNMA 3WQ4A 3LCIA 3UCCA 3EMQA 4PZVA 2YBTA 3GIYA 3SCQA 2VFGA 4QLJA 3TXVA 2C0AA 2EG7A 1LYXA 3L0GA 4JKKA 2R6OA 4BFAA 2XVGA 1GOXA 4GKLA 4W8AA 4NAFA 1OIMA 3AYSA 4UR9A 2YLLA 3GFXA 4V1YA 1OJXA 4DZAA 1CDGA 1UPMB 1CLVA 1S5WA 3MC5A 1WA3A 1YNPA 1IYXA 4M6VA 4CU7A 3IGHX 3KRZA 2CLKA 1L2QA 3UG3A 1X7IA 2WBKA 3MPGA 1E4IA 1LG1A 1IIGA 4N4PA 1K9DA 3CYVA 1B9ZA 1XCFA 2J27A 3FA5A 2BWGA 3R0KA 3GHTA 1V93A 2CITA 1R38A 1P0NA 3P80A 4OHQA 3W9ZA 5ECUA 4H01A 2BGQA 3S1GA 1TMHA 3W2NA 3GH5A 3MT1A 1XD0A 4NXKA 3QV6A 1CWYA 2PU1A 3KWSA 4AIOA 5C71A 3SADA 5EPDA 7ODCA 2PU0A 4XIAA 3I6RA 3MUZ1 1V6WA 6ALDA 1XYBA 1OD0A 3SCRA 3ATYA 3SUUA 1GYMA 1KFCA 1BGAA 5KMYA 1CLXA 5D9OA 4CD8A 1SFSA 1KA9F 2QUUA 4LCQA 4FXSA 5DCDA 5LZLA 4PMVA 5HWJA 4DXVA 4JHMA 2VX5A 1LOSA 3CUGA 4QGCA 1KRAC 3C0LA 4H04A 1DWHM 1Q6QA 2VCCA 4JDBA 3TP4A 3MMWA 2DZAA 1BXBA 4ZQPA 3NL3A 3AU6A 3F4DA 1XWYA 3WJXA 4AZCB 1FWEC 4XKMA 4M3PA 4LAUA 5IHSA 3ZO9A 3TQ0A 2QVNA 2GVLA 1CGWA 1TPUA 4AWSA 4IZGA 3IJQA 3TZFA 2A3HA 4AZIA 4O14A 3F5JA 4DO6A 3BZGA 3W1TA 3W37A 2DDXA 1E3XA 5I3IA 3ORWA 1H62A 2FZBA 1A0CA 3FKRA 3MJYA 2GLKA 1K8YA 4J3TA 1QW9A 1HL2A 2PDIA 3JUGA 1EYEA 2GGHA 3WLNA 1PCWA 3T6CA 1HP5A 4S38A 4F0MA 5MKGB 3VPLA 2XWDA 1B2YA 2D0GA 3PR2A 3PNZA 3OZOA 3SAZA 4GINA 4Q8VA 1WAWA 2VENA 2NLIA 4QJ3B 4RPQA 3P0XA 2ZZ5A 2QZRA 5HMDA 4O0KA 5K4ZA 4HNNA 1XD1A 2X2GA 4PTVA 2ACRA 3WENA 4Q3MA 2F84A 4PFHA 1LL6A 2PDJA 3T40A 5A6SA 3NWRA 1CTNA 1NSJA 4D72A 5DY3A 1TV2A 2A3BA 3TMLA 4GQBA 5D38A 4K37A 3FYOA 1TREA 4AZCA 4H8HA 4PYSA 4WQ6A 2PRMA 1EJXC 4Y8EA 3OYXA 5LNVA 4FNTA 2Q8ZA 3XINA 3SY1A 1H1NA 4HK7A 3W7RA 1GKQA 3OZMA 4GCAA 4M81A 2PURA 5AYBA 4NXSA 1ADOA 3R0DA 4AY7A 5AC5A 5FL1A 2VWTA 4GO8A 2O7SA 3BW2A 3VD3A 4B2DD 5BXRA 1ZBCA 2BG5A 2INEA 4B5VA 3RCNA 3ZT7A 4RE3A 1DJYA 3PBVA 3WJYA 3XISA 4CVUA 3OZPA 3ARYA 4L64A 1M9HA 2R9RA 4UTLA 4DLMA 5A8NA 4GNJA 3VUSA 3IV3A 4JTQA 7XIMA 1PWMA 3G8RA 2HXUA 3NQFA 5DX7A 4AIBA 5IFPA 1DJIA 5TD4A 1Q6GA 5D03A 2FIQA 4D6HA 1EL3A 4UTFA 4NNCA 3GXDA 5LNSA 1FWGC 3C2YA 1YHTA 3L23A 4MNKA 4OZOA 4E2DA 4WJ8A 4PTNA 1B9BA 1KFKA 3BOXA 1PKNA 2EJ1A 4AZ6A 5CPLA 3P67A 3DCPA 3OP2A 5FCZA 1ICQA 4DX3A 5K9XA 4J9JA 3S6OA 4JTDA 1V08A 3W82A 1V79A 3NA8A 3Q37A 4MUZA 4HNOA 2WYSA 5HQLA 5AC8A 2D24A 1TJRA 1A4LA 3WLPA 1P4CA 3ZYZA 3M64A 3W7JA 2KX9A 2C1IA 4L5ZA 1DJWA 1QPQA 4GUJA 4BI5A 4AEEA 2XUCA 3LPGA 1FWNA 1VFMA 4H1ZA 3UJSA 1Q7QA 3LBCA 3K5XA 3XIMA 3CHCA 4O1CA 3DUGA 5D8WA 2OCZA 1GEHA 3OVRA 3RITA 4E4FA 3UVIA 1H5YA 1HKMA 1B4EA 2JIWA 1F6KA 1HKJA 4IJRA 3C8FA 4AH7A 1CEOA 1V77A 4W87A 2XSXA 1HVQA 4Q8OA 4PRTA 8RUCA 3PBWA 4HOWA 4HA0A 3OBKA 1Z9AA 3IVSA 3OA5A 4Z0JA 2HK0A 1ALDA 3G3MA 4X0VA 2NQ9A 3P93A 2GDQA 1OFRA 1I2QA 4HMEA 1TCMA 4NUWA 5PTDA 4JKLA 4XTIA 3GNNA 4H7ZA 3WEMA 4YTTA 1HKIA 1JAKA 3MP5A 2ZDRA 3L9CA 3SCTA 2J9ZA 4BEQA 4JL1A 1HP4A 3AMCA 2AKMA 1H63A 1YLVA 2BDQA 1TO3A 3MWAA 2BVTA 1US2A 4RNIA 4W7WA 1V0MA 2OMAA 5HULA 5DELA 4WHBA 2FTPA 1E9LA 3BG9A 4XD4A 4DM2A 1MUCA 2WNZA 4TMCA 1K9EA 5D4YA 5EFDA 4H3DA 1FWRA 1O68A 3NQMA 4DO5A 4PCFA 4QFUA 1FXPA 3NQEA 1O7AA 2FB2A 3W1MA 4F0HA 3DYMA 7REQB 4UNKA 1H3GA 2CWXA 3O63A 3W00A 1X39A 1VBJA 1NP2A 1FXQA 1ZPTA 2CZFA 3ZR6A 1S1PA 3BV7A 4AVNA 3SJNA 4FXJA 1E9ZB 2XIMA 4YYFA 2OSYA 2FHCA 3PM6A 5E0CA 3GR4A 2EQDA 3GHUA 1UWRA 1R87A 4ICNA 4O16A 3NOEA 2EF9A 3ATZA 2VNCA 3F5LA 3IGUA 1UKSA 1GW1A 4Z2KA 1X1NA 2FFCA 2PTZA 1NF7A 3QPYA 2BXVA 1R30A 1C8VA 6REQA 4JIPA 2OFJA 3N2MA 4AISA 3KBNA 3SECA 2Y63A 3CK5A 1J79A 3IV8A 3MDUA 1OBAA 1YXDA 3CU2A 4W89A 3CGTA 2XU2A 4E3TA 4WOZA 1J5SA 3Q58A 4MZYA 4PEEA 4YU1A 4W9TA 2VEMA 4KWSA 3O8AA 3W87A 4MIMA 1XIIA 2NT0A 2GJXA 4NJJA 3FY1A 3VGBA 4C7GA 2CLMA 1XSIA 1TZ9A 3I7SA 5BMWA 2ABBA 3N2BA 2VD8A 5DF0A 3PUGA 3TTQA 3BL3A 4ZTXA 3SSJA 2RH9A 2P8BA 3NFUA 4MJZA 1MQQA 4FLQA 2Y2WA 5DQPA 5A95A 3SQMA 2VI0A 4A3YA 3H7UA 2D2OA 4J28A 2B7OA 2E67A 3NQ2A 3K4DA 4O54A 1V02A 4QNWA 1KFWA 2CLFA 4Z1AA 3UZYA 3A5VA 2YCLA 3BAJA 1WDPA 3R25A 4UOQA 1FCQA 1Z89A 4LW7A 2YXGA 3CH9A 3A9BA 1YBQA 3BO9A 4J1OA 1EZ2A 5BOFA 3AHVA 4OKDA 3DN5A 2I9UA 4NAEA 4M56A 2Z0IA 4ZXOA 2XH0A 1QXLA 3ZJ6A 3LI1A 1E0VA 1TQXA 4HKPA 1FWHC 3MANA 5FACA 1JJKA 2J7BA 3K30A 3PTKA 1FTXA 1S2WA 5IOBA 3PWGA 1R9ZA 4BEUA 5C8BB 1F3WA 2JF6A 4PN2A 3ZLFA 1ZP4A 4LOCA 3Q4DA 1UWIA 2VQTA 1QAPA 1DL3A 1VIWA 1QOQA 1AFSA 7A3HA 4WY0B 3TX9A 1Q13A 1DXEA 3REQB 4H9VA 4IIFA 4Q6XA 1H0GA 3BG3A 3NDZA 3S5NA 3GIPA 2C3ZA 1NWTA 4ROQA 1Q63A 5K2ZA 2EBNA 1OHLA 2G3IA 3CUFA 4RUBA 1M53A 4L56A 3VOJA 1VZWA 1ZTVA 1XBXA 3I4KA 3TFCA 3OGSA 3VD4A 3MVIA 3W85A 1A5LC 1UBSA 1CXHA 2WVVB 4PBGA 5AECA 3CTLA 1JGIA 3TCEA 1J93A 3WQ5A 3SY8A 4GYPA 1KBJA 3N6HA 1QR7A 1SO6A 3FV9A 3GTNA 1DJXA 4URIA 4DIAA 4W7VA 3OOQA 2PRLA 2V82A 3UJEA 4B4FA 3TV8A 1C9DA 1VPYA 1YE4A 2XM1A 4ERGA 4G1KA 5TIMA 3QKEA 3AJXA 3QSRA 4S3JA 3BPWA 4GCXA 5A6MA 3W2KA 3GDKA 4OJYA 2XVNA 4H9UA 1TVNA 1RZMA 2Y7EA 5FF4A 4W93A 3T0DA 3DI1A 1D3CA 2PF8A 8XIMA 5HMFA 4QRNA 5CXPA 3HZ3A 2OWCA 3AWOA 1KTCA 1BYDA 4XUGA 3ZJ7A 2Y5JA 1XLKA 3DHFA 5LA2A 2G4FA 3KX6A 4RL3A 1MI3A 4GVHA 5A6KA 1Z32X 3W7OA 5DCEA 5CGQA 3L2MA 1QI2A 4C6QA 3HF3A 2Z6IA 2BBFA 2XZ9A 1J01A 4XIMA 4IX0A 4MHBA 3HQOA 4IGHA 1XYCA 1K8ZA 1TTQA 4DZ5A 2DZWA 4GWEA 1WDQA 3ITLA 3SBFA 3VFLA 5A2CA 4R88A 3AHXA 2HVOA 1LCOA 2YYUA 2W66A 4TX6A 1WUFA 4PMQA 4AWUA 2WNQA 4CNPA 3THCA 3NPWA 3NPUA 1QWGA 2GYIA 2PGFA 1H61A 3LEPA 4RZ5A 5DRCA 3NZGA 1ONWA 2PGEA 1W1TA 1Y5XA 3G8EA 4BA0A 3ARPA 2ACUA 2DV0A 1OX4B 4BF7A 3IVTA 3S42A 2OZ3A 3MI3A 2CEQA 3H2CA 4OT7A 2ODOA 3G1HA 2CHOA 4AX6A 3THDA 3W01A 3JVAA 3ARWA 2X40A 2ABAA 3QV7A 3ANVA 2PTYA 1F5ZA 1R6WA 4QDPA 4X2RA 3A5FA 5I79A 3B0UX 1F3TA 4LJ3A 1XQKA 4MTVA 5I23A 3FEMA 2O9RA 3R8HA 1UWTA 3SCSA 1PYMA 3CPUA 3SO7A 1XIDA 1IT8A 2E28A 3WD4A 1S2VA 3RHGA 4F0SA 4RE4A 1HUVA 4C1KA 4ZQNA 5AVHA 3AUOA 3VOHA 4NL1A 4ZSTA 1RK5A 4JZ5A 1UOKA 4TV5A 4HTBA 3UXKA 4ML4A 3E2RA 1ODZA 1AH3A 2GQ9A 3NL6A 4XBSA 3E5BA 4DJDA 2GSJA 3E6EA 4LNYA 3M16A 1UH2A 3ZJKA 2A1YA 3M0MA 3T9PA 4UMBA 2NX3A 2B31A 3W07A 4DZHA 5CZKA 1D7KA 3DKJA 3NEHA 3FCPA 1GVRA 5D30A 4Q4QA 2IMRA 3WH8A 3M5VA 3LNMA 3MQTA 4ZFCA 4Y9AA 1J0YA 4N9DA 2QHAA 2Z27A 3U5UA 4M24A 2GJXB 1V3IA 4Z42C 1ZRQA 2PWGA 2EKCA 2G5WA 1FWDC 2WWDA 1YIXA 2FQIA 1IEIA 1KBLA 4QE5A 2QW5A 3WUBA 4B5UA 2R1LA 1EUAA 2H3DA 4A8RA 3SZ8A 1TPEA 4UTIA 2HMCA 4EX4A 2F9RA 1RP8A 2PEVA 3CIVA 3S2LA 5J8LA 1HT6A 3O15A 3P8JA 3CV7A 3PZUA 1B3OA 1JXKA 1DEDA 2DW6A 2D3NA 1IR1A 3OLIA 3UYCA 1F7BA 1H50A 1VFOA 4HN8A 3LBMA 3TOYA 4P7QA 1VENA 2V38A 4GZJA 1EC9A 4PSPA 3FHQA 2GQ8A 1FH7A 1TTJA 4AEFA 1VF8A 4FR6A 1TE1A 2ISDA 1PEZA 5JMUA 4N7QA 2CLPA 1K4GA 1HG3A 4CQ8A 3WLKX 4LCSA 4GRSA 1Q6EA 4LVFA 1F3XA 4PBFA 3GXFA 4GY7A 1UD6A 1U1UA 3G1AA 2DH2A 3QF0A 1QK2A 3BQ6A 3F2BA 3A3WA 1M04A 3KW3A 4J35A 4J40A 5F1VA 3TOPA 3MSDA 3WD1A 1EPVA 1UP0A 3UJRA 4C1LA 3WUFA 3QPZA 1PUDA 5DO8A 1T40A 4NJHA 1XFBA 2VEKA 3MZNA 1E9IA 3GNXA 3KBJA 4LYPA 1RY8A 1KXQA 2I5GA 4UCGA 1W6TA 2VOTA 4BQ3A 3GIQA 4RCXA 2J88A 4XBJA 2J7DA 5H8MA 2HXTA 4H4IA 4KRTA 2E40A 3T4WA 1EA0A 1DIOA 3SCUA 1SW7A 1JZ8A 5FEXA 3V1HA 3IIOA 4L6HA 4UTTC 3FJLA 5F2LA 4HHMA 4AY1A 3Q2DA 3QVQA 5DANA 3QPEA 1Q7ZA 3R7MA 1OWQA 4QSFA 3WELA 2B0MA 5G1TA 3VKDA 4IUGA 4UB9A 4F2BA 4Q8MA 1HXJA 4D2JA 2OELA 3NPVA 3WFLA 3EB4A 4I5XA 1K7FA 1M7OA 5D9PA 3U6WA 2OX4A 4WX2A 2WLYA 4FX6M 3RPTA 1V02E 4P7NA 1VLIA 4FNSA 2O0TA 2ALDA 2X16A 5DFAA 3I10A 3RO6A 1NWRA 1H51A 4M80A 3TDFA 2A7NA 3BGGA 3CL7A 2IKJA 1JCTA 3CQHA 3LENA 4JYEA 3TAKA 4E4PA 4Q8TA 3I6EA 3UR8A 1OCJA 1NVMA 3B05A 2V67A 2FPTA 3N17A 3DBNA 3HGRA 3H2EA 3H2NA 1W32A 1ZZMA 4YTSA 2WQPA 4U28A 1B4KA 3R8GA 4O8RA 1KC7A 4Z0SA 2ONEA 2J79A 4WUIA 3UU0A 1FWWA 3K8LA 3WBXA 2Y61A 3AHYA 3M7SA 4IISA 1PS9A 1OX4A 4EPBC 4HMNA 3N2TA 4LUSA 2BB0A 1TTIA 1J9YA 2WHKA 2XVPA 3MVTA 2X0HA 2GOUA 3IJIA 4LUYA 4B16A 3TN4A 3DU0A 1BF2A 5B7ZA 2TAAA 1CIUA 4WGXA 2P3EA 2WMIA 3W2LA 2X7WA 5JBEA 4XVDA 3L12A 1J12A 2I17A 3RLVA 5B80A 4LRTA 1KO0A 5M1TA 2IS7A 5I24A 5D2YA 1YW1A 3RX3A 4KKXA 2VCBA 1BXNA 4GFSA 4IPLA 2QLYA 4S3BA 5DLCA 5FIPA 1OCNA 2ISSA 3MYOA 2OG9A 1J6PA 1QATA 3AZRA 1I9CB 1X8CA 3HQNA 3ME3A 3PSVA 1PXGA 1XLAA 3LHUA 5C9ZA 1S5NA 5LXXA 3BICA 3FDGA 3WLHA 1JR1A 4HZ7A 3R89A 2VR2A 4PB5A 5AC6A 3TYCA 4B3KA 4S3KA 2WK2A 3A4JA 3LQGA 3W7KA 3OBAA 3GUGA 3QGVA 4QAIA 1PVNA 2WXDM 3AXIA 3LGEA 3JZUA 4IL2A 4WD0A 4J3SA 2OO6A 4C6CA 1GG1A 1XISA 4K8HA 1AUSL 2QV5A 1R5YA 4PEKA 2JGYA 2X0SA 2NXIA 4D8AA 1TB3A 2G3MA 3K4WA 1OFBA 2G0WA 4R3UA 3S47A 3R1ZA 5LHFA 4I3GA 5EBAA 4IG2B 1GVYA 4L4LA 1HVXA 1EF2A 1GONA 3PZNA 1R3TA 5L6UA 4MDPA 3PULA 5IM51 2IPJA 3RLUA 3FKKA 9XIAA 4JTUA 4ZMGA 1K03A 2Y8VA 4ONVA 1KRCC 2W5FA 1UPPA 4Z08A 1ZL1A 3UCQA 1PSCA 3LS9A 1FY6A 4AD5A 3IIPA 2QUVA 3QOKA 3UGVA 1LROA 3P84A 1OGGA 5SWUA 3KVJA 4JNZA 2D22A 2PB1A 3LV5A 3SQSA 1TPDA 3ZWTA 3EA2A 4DUOA 3T55A 4TOQA 3GD6A 1SFTA 4NZFA 4FF5A 4MNLA 3OW1A 1H7NA 4H83A 2J6XA 3N4FA 1TJ1A 7REQA 4HA1A 1QNPA 2PC8A 4OU1A 2PBGA 5AY7A 4K7VA 1MW1A 4MM1A 1NQKA 3W84A 3SSZA 2P88A 4KETA 1E0WA 4JN6A 3RR4A 5REQB 3KS6A 1E9YB 2XVLA 4FA3A 3R10A 4IOTA 1VEOA 3M0HA 3TEVA 4PRWA 3UCDA 3VIKA 4JOMA 4JIQA 1JZ7A 1DJZA 3NVTA 3SJ3A 3CJPA 4RDZA 1C7TA 3M47A 5L9FA 1V0NA 1SJDA 4UQDA 4FHAA 1IT0A 1ZQ5A 3U3HA 3LN3A 4QG6A 1PTAA 1UD3A 2C79A 4TU1A 3W1LA 5IXEA 3A64A 3SUVA 5A2BA 1ZFJA 1XPYA 4N9BA 1THFD 4CD5A 3EDJA 2QCDB 1MW3A 3H2AA 3DIPA 2OPJA 4DJEA 2Y5SA 4L4OA 2BV9A 3ECQA 2J7CA 4POCA 3WH5A 2PTDA 1LLZA 2FFIA 2X1SA 3TTEA 1W2VA 3L4UA 3B9DA 2YCEA 5HWNA 4UR7A 4S3CA 4IJCA 1I75A 3PANA 3S2MA 4AZ7A 1XBVA 4R5EA 3IARA 5T91A 4JFWA 4KFNA 4N4QA 5E0KA 2WJZA 3W24A 1E4NA 1OFOA 2QJGA 2VC5A 2VFFA 1H41A 1RD5A 1XLCA 3LUTA 1NIUA 4YS1A 1R7AA 3VD5A 1XH2A 5F2IA 4REQB 3NO5A 5GJNA 5HINA 3WDPP 3T7VA 5E9XA 5C9RA 3VDBA 1EIXA 2Z26A 4H19A 2YXOA 4OECA 4YHGA 2NVAA 3KOZA 1Y0EA 3LTPA 5AYIA 1DQWA 1ECQA 3VOCA 4GVFA 1XICA 1AJ0A 4RZ4A 1HZYA 1TA3B 3IJLA 2FZ8A 3GVRA 3O6AA 3URBA 4EXQA 1JZ6A 3PBUA 2HPMA 2VR4A 1W9UA 1J0ZA 2VGIA 3S5ZA 4ORIA 3N9KA 3EDKA 5E1QA 3DEQA 4XAPA 4Q22A 1TV5A 1AD1A 3AIWA 1FUYA 3C6CA 4LY4A 1D2KA 5BROA 1XIMA 1HKWA 3C0JA 3DOPA 2C14A 5FJOA 1TV3A 2GGEA 4GHRA 5H6HA 3NVDA 4C91A 1S1RA 2YB4A 4IJBA 3V7PA 3LRLA 2NLYA 3FVDA 3VM5A 2WMJA 3RFAA 4MY9A 4GYFA 4OV9A 3VGDA 2JQXA 2QULA 4FNUA 2FH8A 1VCFA 2TODA 4GUFA 4MUPA 1YRRA 3CQJA 3PBGA 3T81A 4HZ8A 4R85A 3CASA 4Q32A 4O18A 1VYRA 3LHVA 3P82A 2RJHA 3MB9A 3E0IA 3GO2A 2FDSA 3AQUA 5FJJA 1XIGA 3TONA 3ZQ9A 3U7VA 1DORA 3GAKA 4UC5A 1K3UA 2CNCA 1ITXA 3E5PA 3FSUA 1XYAA 5JU6A 4G9PA 1ITUA 3MW7A 2OT1A 3CV2A 4O15A 3TR9A 4CD6A 1OG6A 1NDVA 3ZLHA 4AXNA 1XGZA 3HOJA 3IUIA 2VWSA 1TX0A 4OWGA 2E3ZA 1KXVA 1OGSA 1XH0A 4NF7A 1EJWC 3KXQA 1PX4A 4Q7BA 1ZY9A 2ZRVA 3WDRA 4ES4A 1PKYA 3VIHA 5GQBA 1VGAA 4XZLX 1ICSA 3IK4A 3THUA 2ZXQA 3WQDA 1ADDA 3L67A 2ZUWA 1EJTC 1E0TA 1QK0A 3N3TA 4LAOA 3N73A 7TAAA 3E96A 4LVAA 4QTGA 1DPMA 2P1FA 3A6OA 3LLFA 3H53A 3MKCA 4K2SA 3CUXA 2PDYA 2QJNA 4PMZA 3RIKA 3N19B 1QO5A 4P8UA 2WKGA 4ZQOA 3KVKA 1TWDA 1KXHA 1U2YA 3CAWA 2BNJA 1W1YA 1MUMA 4NAFB 3E0VA 1QT1A 2OZTA 2VDHA 3SQLA 2P76A 1YADA 2WMKA 4EK7A 1FWFC 1PCKA 1OFAA 5BXTA 4MF4A 3PAJA 3EB2A 3WBWA 1SUXA 2B81A 4IFRA 3N3MA 4YCOA 3ZIZA 4LYKA 1DVJA 3BJSA 3DFQA 1GPWA 2ZRWA 3VA8A 1EJVC 1BF6A 2XIQA 1VHCA 3C61A 4OFCA 1RD6A 3B0XA 2XTKA 4Y90A 4L9XA 3KCLA 1I2PA 2I16A 5TNVA 2Z2AA 6TAAA 1JCMP 4LALA 2I5IA 2NWSA 1UH3A 4C6LA 4JTEA 1EZWA 2YZRA 1NY1A 4FLRA 4JTTA 3BDKA 1XI3A 1TFVA 4E0CA 2OGYA 3QTPA 3T2QA 3STEA 5BRBA 4RDWA 1WKFA 3T05A 4AD1A 2W9MA 3LMYA 4N6FA 4K39A 1C7SA 2YYTA 4QBXA 1XSKA 1G69A 3K1DA 4LAMA 2Y0FA 1UD4A 4WSKA 1I2RA 1YTDA 1O66A 4AZGA 1TELA 4S3GA 4AZHA 1AH0A 3VC6A 1UZ4A 3UWWA 2YDAA 2C18A 3VNYA 4ENLA 4A35A 1E56A 3UQNA 1TCDA 2A5HA 3GW3A 5IBXA 3VDAA 4B9ZA 2V5DA 3L4ZA 3QM3A 2FVKA 1H4PA 2FHFA 3VNKA 1PE1A 2Y7FA 3W7EA 2OYKA 1B5TA 2QDDA 3CNYA 1XJBA 1RUSA 4D6JA 2A79A 1JYVA 3UEQA 4PFMA 1JAEA 4ZTYA 1TPWA 4IPPA 3ONBA 5HMSA 1O94A 1TV4A 1RBOB 1BWVA 4O19A 5CLWA 4QG8A 2D23A 4YNGA 5FD0A 2HZGA 1B31A 1QPOA 1UW9A 2PDKA 2PZ0A 2W0UA 3VAVA 1JULA