2CZFA

Crystal structure of orotidine 5'-phosphate decarboxylase from pyrococcus horikoshii ot3 complexed with xmp
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
208
structure length
208
Chain Sequence
MIVLALDVYEGERAIKIAKSVKDYISMIKVNWPLILGSGVDIIRRLKEETGVEIIADLKLADIPNTNRLIARKVFGAGADYVIVHTFVGRDSVMAVKELGEIIMVVEMSHPGALEFINPLTDRFIEVANEIEPFGVIAPGTRPERIGYIRDRLKEGIKILAPGIGAQGGKAKDAVKAGADYIIVGRAIYNAPNPREAAKAIYDEIRGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of orotidine 5'-phosphate decarboxylase from Pyrococcus horikoshii OT3 complexed with XMP
rcsb
source organism Pyrococcus horikoshii
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 72
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2czfA00
1SR9A 3LB0A 3W7PA 3GVGA 4O57A 3W7NA 3TSBA 1KBJA 3PB0A 3LHTA 4JTKA 3NPUA 3C61A 5HJLA 3GYEA 1TO3A 4RJEA 2RDTA 5F2MA 3NL5A 3HGJA 2C13A 4H6KA 1GPWA 2Y7EA 5HINA 4HPJA 2VFFA 4PCFA 3W70A 2AAMA 3M44A 3NQGA 1VYRA 1YDVA 4K7VA 3R8RA 1VHNA 5HNRA 2Q3RA 3R12A 4ALDA 4UCGA 4BFAA 1OFAA 1JVNA 2ZZ3A 4N4PA 1JJKA 4Y90A 1GYNA 4GUGA 4RX0A 3ABSA 1X1ZA 2QCCA 1LLWA 2H6RA 1I2QA 3L9CA 2ZCGA 3T44A 1OJXA 2ZRYA 2ZRUA 2DZSA 3TV8A 1Q45A 3QPYA 4O0KA 4AMAA 3LLFA 4ZL1A 4UR8A 4O16A 5AHMA 3NYZA 2NXIA 4MY1A 2F84A 3QC3A 3CC1A 4HHPA 1UBSA 4NNCA 1AL7A 5D02A 5G1YA 3LM7A 4JX4A 1H7NA 5FF4A 5AC7A 3SW6A 3VCRA 3HIJA 3W1AA 1VPXA 3S1WA 3RK8A 3YPIA 1VH7A 4NT0A 3W7DA 4IX0A 4FNUA 1R47A 2W0UA 3LHUA 1WX0A 4CNNA 5AYZA 2R91A 4JTHA 3VI2A 2EPHA 4RZ6A 3S8HA 1H1YA 3BVJA 1OX5A 4LC6A 3ZS4A 5DLCA 1S5WA 1OABA 1O5KA 4HSOA 3O6DA 4Z1AA 1M7OA 1IGSA 2ZRXA 3QPZA 3N9RA 3OVQA 1LOLA 3DFTA 3GKAA 1TV7A 4AWTA 4GJ1A 2ZTJA 5D33A 1WBHA 5E0KA 3ATZA 2QDGA 4GBUA 4IWWA 3RNDA 2CZFA 3MI6A 3M9YA 4LS0A 5D2VA 3TSDA 3W1MA 4X9SA 3T40A 4ZQOA 4LVBA 4IJBA 4JYEA 2BWGA 1P4CA 1Q3NA 2RH9A 1TQJA 3NR0A 4PL1A 4ZQPA 5EKYA 1L2UA 3NO5A 2XN0A 4BI7A 4RZ4A 4N6FA 1FCUA 3ZWTA 4AF0A 3CM4A 4N9BA 2DORA 2Y7FA 1T0OA 4A2RA 4M6QA 3DGRA 3OEXA 2DU2A 3SIZA 5KINA 4Q32A 1XXXA 4QM1A 3PSVA 4KFNA 3GAYA 4O53A 3A22A 3RLVA 5EL1A 3M5XA 4Y8FA 3TU9A 2Z1BA 1CI1A 2QF7A 1SW0A 4FEZA 3W85A 6ALDA 5CGQA 4OT7A 4TU1A 1OK4A 2CLOA 3TE9A 1VQTA 3DI0A 4X22A 3O16A 1WA3A 3LV5A 4Y96A 3FKKA 3IIVA 5G1TA 1GQNA 3FOKA 1F2JA 1QDSA 1UCWA 3U2OA 1AW2A 4UMBA 3OHIA 1KLZA 3W1QA 2DJXA 3GDMA 1OFEA 3VNDA 2FDSA 2VKZG 2B4GA 2NX3A 2VEIA 3MO7A 4O18A 3CLMA 3BLEA 3B04A 3TQ0A 4AHOA 3NVTA 4ZQNA 3WK2A 3W7OA 1TYGA 1W3TA 5HULA 1DJNA 1GEQA 3DH7A 3PG9A 4JIPA 3LXAA 4NU7A 4WOQA 4GUFA 4GRSA 3IVTA 4C1KA 3PM6A 5F1UA 1J4EA 2QJHA 1F73A 2ZZ5A 4DF2A 3W3OA 4MVAA 1I2NA 3S5OA 4ZMGA 1SFLA 4Z1DA 1NFBA 3W7KA 3IVUA 1FCBA 1I2RA 3TMLA 1VYPX 3P7YA 4KWWA 2X1RA 3EXTA 3V1PA 1XFBA 3G1HA 3HG3A 3CHVA 4N9DA 1H7OA 3NZRA 3WJXA 4K6AA 3FEMA 4UFMA 4HPXA 3W1PA 2V2DA 4A3UA 1QAPA 1EUNA 1O60A 1YXYA 3KFTA 4I7VA 3P74A 3DU0A 4AH7A 2DP3A 1VC4A 2ZQ0A 4WQ6A 3TFXA 1EB3A 4LVAA 5EMUA 3ZR4A 3FA5A 2J9XA 1FX6A 4QAIA 3W2NA 1K8XA 3OIXA 4N6EA 1LZOA 1PCWA 1F05A 1VRDA 2A1YA 4BI5A 4UFKA 3R13A 1ZJIA 5HWNA 3WJWA 4RKAA 5FF2A 3HG5A 2CZ5A 4UUIA 2CFFA 3P82A 4FO4A 5AC8A 5LKYA 2YYUA 3IGXA 5D04C 1H62A 1NF7A 1WOBA 4Z1CA 5I3JA 3GKFA 1WOAA 3C2EA 3W9ZA 1JR1A 3ABQA 5DY2A 1BWLA 1LBFA 4CQ9A 4D2JA 1K8YA 2VFIA 2Z6IA 3EWUA 1KW1A 4QSHA 5K9DA 2RDWA 1O95A 1JULA 4OE7A 4P61A 1R30A 3N3MA 3TH6A 3PR2A 1IXPA 3I7RA 5D30A 1C8VA 3LTSA 3PULA 4OQVA 5LNWA 3TJXA 1PVNA 4AAJA 3STCA 1C29A 1JQXA 1O94A 3LDVA 2YW4A 1GG1A 2VXNA 4NX5A 2J9ZA 1TIMA 2GQAA 3PBVA 3LHZA 2Y7DA 4PA8A 3QMTA 4CCCA 3G1FA 4O14A 1LYXA 2R14A 1HFBA 3VKJA 1Y0EA 2RKXA 5CPMA 5ABTA 4MZ8A 1U83A 3NQ7A 3QQ1A 1WDWA 5GVJA 4EOUA 4MZYA 1ZENA 1AG1O 3B4UA 2Y63A 3W6YA 3DHDA 4RCXA 3SZ8A 3TQVA 2H3BA 3PSWA 1KFLA 1DBTA 3JRKA 2PRLA 5LNSA 3W7LA 3G1VA 3W7MA 1EWEA 3O1NA 4XZ9A 2Y6ZA 5DN1A 4UTTC 1HG3A 1TPB1 3BGGA 3UXDA 1B3OA 5KZMA 3QM3A 1PV8A 4JEQA 2YZRA 1QFEA 4NXSA 3MBDA 1LLZA 2WPBA 2FB3A 2RHGA 3W2MA 4LTSA 1RR2A 4Z0SA 2A7NA 1OYBA 3HF3A 2A2IA 3PVFA 1MO0A 3U8GA 3LBCA 3O63A 3HGOA 2QKFA 1GTEA 2X1TA 5C54A 3R2GA 2QCGA 2Z6JA 1Z44A 4PTNA 1LM1A 3T78A 3GAKA 3G1YA 3THAA 1M5WA 3OVPA 2A85A 4IXXA 1JCXA 1AW5A 4ADUA 5U4NA 3W2LA 2GJLA 1Q6RA 3G1SA 3USBA 3TC7A 1DOSA 3N73A 3HG2A 1FCQA 4AEOA 2ZA3A 2H8ZA 4O1AA 3CT7A 3RLUA 1A53A 3W7GA 1QCWA 3W7JA 3BLFA 1S5VA 4PL2A 1Z41A 4WZHA 5A5WA 2GUUA 4UTKA 3CTLA 4TR9A 1GZGA 3UYCA 2Y85A 5AHFA 4CNPA 1A50A 4XUGA 1QOQA 3B0UX 2GVGA 5DELA 4TMCA 1J5TA 4I7WA 2E6FA 3TUUA 4NX0A 3C4UA 2TSYA 4DELA 3CEPA 1EPXA 3CPRA 4YCOA 3UY7A 1VYSX 2Q8ZA 2GQ9A 4GXMA 3W84A 1XM3A 5H2ZA 1LTDA 5G2WA 4Z0JA 3C52A 4RXGA 3TDFA 1WXJA 2NX1A 2C14A 5K4XA 2VENA 4IGHA 4NUWA 1DV7A 1X8FA 1FDZA 3NPWA 1HUVA 2C6QA 1FBAA 3HO8A 3WJZA 3LCXA 3TAOA 4NJIA 5DCDA 5FEXA 4DO6A 4I9AA 3EWYA 3UD6A 4Y9AA 5LNUA 2OZ0A 2A4AA 1W0MA 4UFIA 1ME9A 1XBZA 3M7WA 3L68A 1BTMA 3P8JA 3QZEA 3W75A 1THFD 2H90A 3O6YX 3MP4A 2PRHA 3LCGA 5C2XA 3FYPA 2OT0A 5H91A 3NQCA 4R33A 3V75A 5I3FA 2ZRZA 1TPC1 2E68A 1TCDA 1QPOA 1P5BA 4UTJA 4K38A 3A21A 1TJPA 3DHFA 1ME8A 1K7EA 2E6DA 4AWUA 3UWYA 4NJJA 1GVQA 2V9DA 2A21A 2X2GA 3A23A 1TTJA 3SY5A 2ISVA 2RDUA 1HO1A 3G8EA 1SO5A 5BNKA 5D37A 3W7IA 2V5LA 3DFSA 4LWWA 3KHJA 2DZPA 2YW3A 2ZRWA 1PE1A 4MKNA 4UTLA 2TMDA 3UWWA 5LGZA 3CEUA 3I6RA 1FCVA 2A5HA 3TKFA 3NL6A 1RQEA 3GDTA 2ZTKA 3HG4A 1OF6A 1QMLA 3HPZA 2FLIA 3MJYA 4YXGA 5HWJA 2NZLA 5LSMA 1WV2A 4AB4A 2Z0IA 2DZXA 2V5BA 2PC4A 5AB3A 4MZ1A 5K4ZA 4JTEA 1GWJA 3TC6A 4O28A 3IRDA 4HT3A 5CZJA 1JRBA 2FQIA 2QCDA 1ICPA 1O5XA 3UXAA 1VR6A 4Z08A 1QWGA 5CPOA 4FHAA 3QJAA 2C0AA 1XDMA 3G8RA 6TIMA 3GX9A 3N14A 3D0CA 1L9WA 1FDYA 4M19A 3UPBA 2B7QA 3M47A 3NQDA 1YPFA 1PIIA 4MPQA 4IX2A 3SFKA 1XBXA 3P84A 4WXZA 5E1QA 4MY9A 4QNWA 4JY9A 3W7CA 4GC4A 2NX9A 3GLCA 1XBYA 1G4EA 4N2YA 1EP2A 3DFPA 1HTIA 3IV3A 2HMCA 3EX6A 3TA6A 1X6UA 3GR8A 4GUIA 3NPXA 2QCEA 2WSRA 5EA9A 3MHGA 4E0CA 3WK3A 3S0CA 5CPNA 3W7EA 3DI1A 5G2IA 4MUZA 1Q6QA 1OFOA 3QF0A 4PH6A 3EXSA 3NDOA 3B06A 1OX4A 3ZWSA 4ICNA 1K03A 4YLWA 1WAUA 3L5MA 3L2IA 4N4QA 3LX9A 2Z2UA 2ZZ7A 2VEKA 3HJZA 4LVGA 5DCBA 3HPSA 3OBKA 5LHFA 5CZSA 3ZFHA 3RU6A 2YX0A 4K8EA 3PUOA 1IXQA 4K7YA 3DKJA 1TTPA 5F4XA 2J27A 2PE4A 1B4EA 1TMHA 5LZLA 3B0VC 5L6UA 1FUYA 2V2CA 4NXKA 5C6MA 3NNTA 4K37A 1V5XA 3BG5A 4QISA 3MP3A 1VCVA 3N34A 3TR2A 2QCNA 2A7PA 4NZFA 4FNTA 4WD0A 2VFHA 1JQVA 1EIXA 3QRHA 3CU2A 1AL8A 5TQLA 1UUOA 1EA0A 1FWNA 2QCHA 3LCWA 1H7WA 1RD5A 3ELFA 2IQTA 1PL9A 2H3DA 1TRIA 3T55A 4AHQA 2YPIA 3A9IA 1OG0A 3SGUA 5C55A 3W23A 1OX6A 1XL9A 3I65A 1LOSA 2QCLA 1EX5A 3F4WA 5BMWA 3T7VA 1GOXA 4JNMA 1R46A 3NQMA 4MY8A 5IBXA 3DFNA 3F4NA 1K7FA 3TW6A 5D2YA 3HBLA 1FWSA 2UV8G 1OFQA 3M43A 2ZZ1A 5HWMA 3W86A 4A29A 4L4MA 4UTIA 5KMYA 2VFGA 4U4MA 4JTIA 4LS2A 3W7RA 3KVKA 1G69A 5EPDA 1KLYA 1F6KA 2LLEA 3R89A 4QIUA 1Z48A 2V8ZA 4JYFA 2ZDRA 1KTBA 2CLLA 3M5YA 3G0UA 4LV9A 2EGZA 2GOUA 1H5YA 3L0GA 3LTYA 2FPYA 1GYLA 3FS2A 5D09A 3KRZA 2FTPA 4FNSA 5G4WA 1VGAA 4O13A 2P1FA 4Q4KA 3OG3A 5EBUA 4DF1A 4O50A 2RFGA 1RQBA 2NWSA 3KOFA 1KM2A 4UC5A 5DCEA 1SO6A 4WY0A 1MEWA 4UFLA 1VCFA 2DZUA 4FNPA 3FFSA 3LBMA 2QUTA 2E5DA 1G4PA 5F4SA 4JTTA 2E1DA 2YR1A 2EAWA 3S9YA 1G6CA 4H3DA 2WSQA 4UFJA 3BW4A 4IMEA 3UNDA 4E2DA 1RPXA 4JY8A 1JCNA 2Y89A 5LGXA 3A5FA 3GXPA 3RMJA 4R7JA 4WX2A 1H51A 3HB9A 3W2KA 3VFLA 4JTGA 1XC4A 4LOCA 2C1HA 1TTQA 2TYSA 5IBXC 5FEWA 4DBEA 4HNUA 3QMRA 1W8SA 2G95A 5FF0A 1DJQA 1KM4A 3DENA 1FWTA 2V2HA 4K39A 4XKYA 4K36A 2YYTA 2E5BA 1DORA 4M5PA 3W1UA 3WK0A 2B0MA 2ZBTA 3C2VA 1SZFA 1LOQA 3LRKA 3W73A 4UTMA 1NSJA 1NAL1 4UNKA 4IMFA 3FJLA 1YXCA 3G3DA 4EVZA 5J5RA 4H4IA 2EHHA 1ZNNA 3C2OA 3WJSA 5K3VA 1XDLA 4FX8A 4GFSA 4KKXA 4YWIA 4PFMA 4JD4A 1MEIA 1YDOA 3HGSA 3E02A 3U6WA 1H61A 3W1LA 3C2FA 3IIOA 3QEZA 1DQXA 4CLMA 2OMAA 4LNYA 2DJLA 2QAFA 2JBMA 3W88A 1GVSA 1IIGA 4YMZA 4UTWA 5HR6A 3LHWA 4JTFA 3C0JA 1OK6A 2QDHA 4LY8A 1X1OA 2BTMA 1W5MA 2NUWA 1OYCA 4AF0B 1TV8A 5KZDA 1W5QA 1IF2A 3STFA 1OVDA 3ABRA 3FLUA 3NAVA 4MJMA 1W31A 1VLWA 4IMDA 2YGYA 1ONRA 2ZRVA 3BG3A 5CPLA 1RVGA 3G24A 3O6CA 4PC8A 4UNLA 1SUXA 3G1DA 2J6XA 1S3HA 3MP5A 3NQ8A 1R2TA 1SO3A 1LBMA 1A5CA 1KTCA 4M6VA 1IIHA 4O17A 2D73A 5FEZA 4JS3A 3S1UA 4CQ8A 3HQ1A 4ZQMA 1TPFA 4AXKA 3N2MA 4GWEA 4P2VA 3IEBA 1UB3A 2FPTA 1UUMA 3N19B 1JCJA 3S1VA 4OHQA 3M5ZA 5G5IA 2G5WA 3N2XA 3EWWA 1N8FA 4RLIA 3W83A 4YCPA 5KITA 2B7OA 4HIBA 4LS1A 1TV5A 2BZNA 4CNOA 3G0XA 1N55A 3TSMA 2VFDA 4JDBA 1YADA 3KAOA 4FF7A 3P62A 2QJIA 3KVJA 1ME7A 1DVJA 4LVFA 1ML1A 1KFBA 1EP3A 3LOTA 1TB3A 2F7FA 5F1VA 3W2UA 1TSIA 3HGRA 1QNVA 2WOQA 4JXCA 2V82A 1FXPA 3IVSA 2EF9A 4GUJA 3LRMA 1UASA 4BF9A 1I4NA 3TMQA 4MLRA 4S1FA 2CU0A 3NQVA 4KFOA 3PB2A 4WY0B 4ML9A 4KFPA 4ONVA 3W2JA 2V81A 3NQ2A 4IMGA 3TAKA 1TQXA 2ATSA 1J2WA 3GDKA 3HPXA 3QMSA 4J9JA 3G0SA 1QO2A 3W7HA 1NEYA 4C1LA 3O8AA 4JTUA 5MHBA 4DXVA 3P5YA 3IIZA 3INPA 4JTLA 1XKYA 1EEPA 4UTWC 1P1XA 3ATYA 5FF3A 2A7RA 3PBWA 1SW7A 4WUIA 4NJGA 3UZ5A 2WQPA 2E77A 3M0ZA 3TQKA 1R2RA 2A6NA 2AGKA 5AYYA 3PUEA 1LRQA 1TPH1 2O7QA 1T96A 2V0TA 3LLDA 3C2RA 1LDCA 3S42A 2ZZ4A 3S6DA 3MW7A 5L9FA 5AN7A 3E96A 5TIMA 4AVFA 4AHPA 3W07A 2WV8A 5HQEA 2Y88A 3PUDA 4O10A 5BRBA 4MJZA 4QITA 1W3IA 2ISSA 4DQWA 1KV5A 1SU5A 3EWBX 4R53A 3LGEA 2NUXA 3EX1A 4LUIA 2DZVA 2CLFA 3W1TA 1QPQA 1GT8A 1Q6LA 3T4CA 2CLHA 1BWKA 2WNNA 3GXNA 1CW2A 1HO4A 3GNDA 4O52A 1WQ5A 4DBDA 4WXYA 3R5EA 4M6PA 4MFDA 1IXOA 1MSSA 4NZJA 3DBPA 3PAJA 2A6LA 3ANYA 1QOPA 1XUUA 1VS1A 5HMSA 2QEZA 1G4SA 1NF0A 2A0NA 1VHCA 1FDJA 3STEA 4IOTA 3JS3A 2W79A 3NG3A 5A8GA 1JUBA 1PCKA 1KFJA 3NEVA 4O1DA 5F2LA 5C5YA 1LROA 4I7UA 2WNZA 4FX7A 3L5AA 4HNNA 1WYIA 3L0NA 2P0OA 4LVDA 2QCMA 1GTHA 3SR7A 4O1BA 1W5NA 3LV6A 2NLIA 3CIXA 4QQ3A 2QUUA 1YDNA 3DFOA 5TBOA 4GNJA 1BKSA 4PODA 4IQLA 1KM1A 1L6WA 3THQA 1ALDA 2G97A 1GVOA 1GG0A 3Q37A 2J88A 4O4WA 3GDLA 4WJEA 2EKCA 3FKRA 5K2ZA 1KV8A 4FNQA 1ICQA 5D32A 7TIMA 3W1NA 5T26A 5IM51 3W74A 1SZGA 1W3NA 2JGYA 1KM3A 4JDYA 3UZJA 3NM3A 2DZTA 1GVRA 4HNVA 2YFNA 3EKZA 4OWGA 2FFCA 2ZA2A 3Q58A 2YDAA 1AMKA 4UMCA 2BLEA 1IXNA 4NVTA 1GVFA 4EF8A 1I8JA 1P0KA 3ABOA 3NOEA 1PS9A 3CB8A 5EY5A 4HN4A 5K9XA 3W1RA 4EF9A 5CSRA 4JX5A 2VC6A 3A24A 1M7PA 4XTIA 3WK1A 1RQHA 2WJZA 3P8IA 1Q6OA 4OV4A 5LNRA 4UTTA 3WJYA 1AW1A 3DKLA 1AK5A 1B9BA 2GVLA 2WO5A 3QW3A 1I45A 1PHQA 3GK0A 3TJLA 3KX6A 4ORIA 3QSTA 3QYQA 4N9EA 5I3IA 1QPRA 1D9EA 4O0ZA 3MWAA 3H54A 3KRSA 3DXIA 5FESA 3W1XA 1GJPA 1F7BA 3IGUA 4XBKA 1W1ZA 1JRCA 5G4EA 3BW2A 3H55A 2ZYFA 1A5AA 4CCEA 3SECA 4N9CA 2B7NA 3BARA 4EWND 3QSRA 3MI3A 3SGZA 1JCMP 4Z1BA 2I1OA 4S2CA 2Y7GA 4M7TA 5DBTA 3BG9A 1OYAA 2XN2A 1OFBA 1YTDA 3QQ0A 1G4TA 4DO5A 3CQ0A 4G1KA 2BX7A 1RZMA 3PWAA 5AOUA 3LCHA 2VELA 1ZAHA 1ICSA 2ISWA 4UXDA 2X30A 2ABAA 1X7FA 1G7UA 5I3KA 1YPIA 2ALDA 3NQ6A 5CKSA 1H63A 4CCDA 4DEFA 4IMCA 5AHIA 3B8DA 4IPJA 3UWQA 1DHPA 2QCFA 1H50A 1LBLA 1O4UA 4FX6M 3BO9A 1SFJA 4NQ1A 4OBTA 2FB2A 2Y61A 3P67A 1H7PA 4XQ6A 3UWUA 1EP1A 2CLMA 4DF0A 8TIMA 1OFRA 1TRDA 4XBSA 2JKEA 4EIVA 1W56A 3C8FA 3IIPA 4UMAA 1ZY9A 1RV8A 4XKYB 1YLVA 1P0NA 4Q33A 3M16A 3P61A 2AQWA 3FIGA 2WSYA 3LTPA 1QR7A 1F74A 2VEPA 1N7KA 4UIOA 5D2XA 1TTIA 2QUVA 4A22A 4FB7A 2JKAA 2X1SA 3OVRA 1FWWA 1XUZA 1OX4B 1L6YA 3QFEA 3PF3A 4TX9A 3BV4A 1VLIA 2B7PA 3MYOA 1H1ZA 4R34A 3B05A 4XWUA 3N9SA 4AWSA 3EEGA 4CQAA 2CW6A 5I3HA 3W72A 3E9AA 5HUOA 5KTLA 2VOMA 2C18A 3W22A 4IXHA 3DFQA 2W6RA 4FNRA 4JIQA 2ATMA 3TIMA 2CZDA 1ZALA 1OF8A 1SSDA 2I9EA 3I7QA 1B4KA 1YYAA 5AFDA 2E09A 3P80A 4W9TA 2XFWA 2X1UA 1A5SA 2C15A 2YXGA 2NXHA 4UFHA 4NNAA 2CLKA 3AO0A 1A5BA 2OT1A 4U28A 3EX3A 2GJNA 1H60A 5CZTA 4LV4A 3NQEA 2NV1A 4RR4A 2FPVA 4ZQCA 2JKPA 4JYDA 4M7SA 3G3MA 3I7SA 1E51A 1K3UA 1KTNA 1VZWA 4OU1A 4N02A 1FQ0A 3CWOX 4QNEA 3FYOA 4JR5A 5F2IA 2X16A 3SI9A 2R94A 1U5JA 4O8RA 3GIYA 3H53A 1HL2A 3PBYA 3S5YA 3E12A 3G1AA 4ZVJA 1R2SA 1BEUA 1C9DA 4FIQA 4O4VA 3LCLA 4BR1A 2YSWA 1FXQA 3G18A 1YTEA 2BSLA 3O05A 3BLIA 3IGSA 4O15A 4TIMA 1I2OA 1TREA 1UJPA 1F6PA 2QR6A 3QW4B 3NL3A 4WOZA 4RK8A 5AC6A 1D3GA 2GPTA 5SWUA 3K30A 2C16A 2E6YA 2QJGA 1F5ZA 3B0PA 1W5PA 1SW3A 3GZ3A 5E93A 3W87A 1T8XA 3PBUA 3UY8A 1SPQA 4O19A 1OHLA 4LU0A 4Y6GA 2I14A 4JICA 3MUXA 3L67A 5D03A 1TPEA 3STGA 2C19A 3M5VA 5KSWA 3UQNA 4OGZA 3P5ZA 2QAPA 1G67A 2VEMA 3MBFA 2G96A 1FY6A 3EX2A 3Q94A 5G2HA 5LNVA 3NA8A 5CG7A 1ZAIA 4DPPA 3TNOA 4KWVA 3MHFA 2OX1A 1W5OA 2KZHA 1ZAJA 4K8HA 5D2WA 3W76A 4GE8A 3SSJA 3LI1A 3EWZA 1KFEA 5BMXA 5DXYA 3EX4A 3HMJG 4S2BA 2FJKA 3TX9A 5K9CA 3NQFA 4NJKA 1H7RA 1ZCOA 1W54A 4LW7A 3TW7A 2V30A 3LI0A 3NZ1A 4XTDA 1KM0A 1SQ7A 3VE9A 1EWDA 1TPUA 3M1ZA 3S5ZA 2OCZA 4IPIA 3LERA 4FIRA 1D3HA 2DZWA 3W7QA 4FXSA 3GR7A 5U7SA 2CLIA 3WFAA 5HR7A 4FXRA 4ADSA 3NM1A 5D2TA 4ORMA 4HNTA 4YL2A 1M6JA 5LHEA 3NPVA 3BGJA 2HSAA 1JCLA 4X3ZA 1Z42A 1L6SA 3S1XA 3GNNA 5DXXA 1LP6A 1XI3A 5HUPA 4HSNA 1TPDA 1YTKA 3JR2A 1KM5A 5EYWA 5FEPA 3UWZA 3TXVA 5FI8A 5F4WA 3HOJA 1MZHA 5AYXA 4B5NA 4UTUA 2ABBA 1KFKA 1VJIA 4LUJA 1OFPA 2NV2A 5K7JA 2NXGA 1H7XA 1S5TA 3IIXA 3BPWA 3E49A 2YCEA 1B57A 1QO5A 5D05A 3TXZA 3G22A 4LT9A 2O7SA 1W37A 4BWLC 4MOZA 1V7YA 3EB2A 2OJPA 3M41A 3O07A 2Y70A 1DQWA 2R8WA 3LCIA 3C56A 3QH2A 3CIWA 1FWRA 1DKWA 3F03K 2TRSA 1I2PA 3C6CA 4A2SA 1LRTA 1NVMA 1CX9A 1EUAA 1TPVA 3MMTA 2ZFAA 4LC8A 3LRLA 4TO8A 4MYXA 1JCYA 5I3GA 1SSGA 1G7VA 3OA3A 3PY2A 1T99A 5D38A 1F76A 4E38A 2GVJA 1KBIA 2PURA 1XBVA 3MYPA 2NWRA 3RF9A 5F2GA 4O12A 5DY3A 4TMBA 3O06A 3KVMA 5CZ0A 2CZEA 2YFOA 4E2BA 1LRNA 4MFEA 1MEHA 4ZQRA 3FJ6A 3RFAA 1ADOA 4JTJA 5J5DA 3BW3A 4ADTA 1YXDA 3L21A 4GUHA 1XCFA 4RXFA 3O15A 4X2RA 4JTSA 1ZHAA 2WNQA 5DBUA 3EKLA 4OV9A 2TPSA 3LHYA 2XN1A 5AHEA 2PRMA 2CWNA 3Q2DA 1SZEA 2GQ8A 1K7XA 3I68A 1QPNA 3E0IA 3PC0A 3VE7A 1KA9F 3SJ3A 3LXCA 4JX6A 3EXRA 3B03A 1SZNA 3G1XA 4LRSA 2NUYA 4POCA 2JGQA 2Q3OA 4BI6A 3F1QA 4WY0F 2HS6A 2Q8LA 3UWVA 4A21A 4QJ1A 3TROA 3W71A 2H8XA 2HS8A 4LRTA 3PG8A 4L4LA 1K8ZA 3UPWA 4O54A 3A5VA 3C3NA 3GDRA 4O1CA 1KFCA 2CLEA 3S5NA 5BW6A 3PS7A 3LHVA 4HKPA 1ZFJA 1SO4A 4JGDA 3BK0A 3L0KA 3TFCA 3KVLA 3KXQA 3AJXA 4BK9A 1K02A 1LORA 5AHLA 5KZEA 1KM6A 2ZZ2A 3P81A 3TCEA 3CWNA 2ZA1A 3M6YA 4NJHA 1JUEA 3EWXA 3DAQA 1DL3A 2P10A 2Y62A 2JK2A 3L66A 2WKJA 2J24A 4IUOA 1JUKA 4UR7A 1LCOA 2VFEA 2ZZ6A 1PHWA 5BOOA 4UTHA 2QCDB 2J9YA 1TPWA 1TJRA 2E6AA 4O11A 5AHNA 5CSSA 4PEKA 4NNBA 3L65A 1WBJA 3NGJA 3NQAA 4MLJA 2BXVA 3L5LA 4MYAA 3GXTA 4BWLA 4JN6A 1OFDA 4MIMA 2HTMA 3MI2A 4DPQA 3LXBA 5FF7A 2E5CA 3NXFA 4ZZ9A 2FIQA 1VCGA 2C3ZA 4DO4A 3MHUA 3NL2A 3GB6A 4RZ5A 4RV8A 3TK7A 3DZ1A 3LCFA 3KRUA 3P60A 2PCQA 1MXSA
chains in the Genus database with same CATH superfamily
3LB0A 1FH7A 2BVWA 3C61A 3IS4A 3PNUA 4RJEA 1TO3A 4IIGA 1DWGM 1TCMA 3EWCA 3GU1A 3H12A 4M51A 4UQBA 2NW0A 3MUAA 2GWGA 4DBSA 5DT7A 4Z2HA 3AMLA 4K7VA 3RITA 4L9ZA 4ALDA 9RUBA 4UCGA 1JJKA 2NSXA 3KL0A 2GWNA 2QCCA 3VGEA 5DMYA 1GHSA 1I2QA 4QROA 3VDHA 2JALA 2ZRUA 5EMYA 3V0UA 1Q45A 1BG9A 4AMAA 4D72A 3OB8A 3R8HA 4PR4A 3V7PA 3KP0A 5AHMA 2NXIA 3U5YA 3R0UA 3GNPA 5GJNA 1UBSA 1AL7A 3O9NA 2ON3A 4JX4A 1VFMA 3A3WA 3NDZA 2NVCA 3HIJA 3W1AA 4R85A 5CAHA 1AMYA 4IX0A 2W63A 3SIMA 2R91A 3MQTA 3P2VA 1V77A 5DQPA 3BVJA 1CCWB 2V5JA 2ZE3A 1O5KA 5HMFA 3AIUA 4HSOA 3PWGA 5JH2A 3O6DA 4HYWA 4Z1AA 1IGSA 1J8VA 3N9RA 2AMGA 2PDCA 1NELA 4YS1A 3IJ8A 4GJ1A 5D33A 5GNYA 1UOKA 4GBUA 3KS6A 3D3AA 4QBXA 1H4PA 2CZFA 3MI6A 1ESWA 5BOFA 4ZQOA 1HNYA 1P4CA 3N13A 4C6JA 1L2UA 5DANA 4BI7A 4DZHA 1Y5WA 2ZUUA 1BG4A 4N6FA 3AYRA 4AZHA 1DHKA 4A2RA 4M6QA 1WXYA 3URNA 2QPSA 4LB4A 2WQDA 1XXXA 4QM1A 3PSVA 4KFNA 3BE7A 5EL1A 4DY1A 4PTXA 1WAWA 1DJWA 2Z1BA 1CI1A 2QF7A 1SW0A 2OLHA 4FEZA 4F9JA 3VMPA 1TIWA 4OT7A 1HXJA 1A47A 2JQXA 3DI0A 3PWIA 4X22A 3T2OA 1X97A 3FKKA 1F07A 5G1TA 3U7BA 3FOKA 1YPXA 4G5DA 3IACA 5CAKA 1KLZA 5HK4A 1Q7QA 3GDMA 1OFEA 3A47A 3DX5A 6XIMA 4XIAA 3MO7A 1H1NA 2PF8A 3PZGA 7XIMA 4MNLA 1XD0A 1L2QA 3WK2A 4AY8A 5HULA 2BASA 1GEQA 4GUFA 4J2MA 3PPHA 1J4EA 3SURA 4MVAA 3S5OA 5CSUA 2B31A 4PSRA 3IVUA 4P8XA 3P7YA 4KWWA 1AFSA 2OLSA 3V1PA 8RUCA 2XFRA 3G1HA 3HG3A 3WUFA 1K9FA 1R9YA 3CHVA 4N9DA 1H7OA 2E4TA 4D6DA 2NQHA 4HU3A 2V2DA 1O60A 3L4XA 4PGLA 3A3HA 5MKGB 1OSEA 1NQKA 4AH7A 2VJXA 2CEQA 4J1OA 5HNTA 1KGUA 3TFXA 4RUBA 3PJXA 1EB3A 3K4DA 1FWHC 3ZR4A 3OLDA 2IKJA 1PCWA 2ADAA 4BI5A 4KS0A 2YA2A 4RKAA 3HG5A 1JPIA 2F6KA 4UUIA 5PTDA 3P82A 4FO4A 1NF7A 1LG2A 1WOBA 4Z1CA 5I3JA 3C2EA 1J96A 1JR1A 1UJQA 2BOFX 5AZ0A 2OEKA 1LBFA 3WH7A 4CQ9A 4D2JA 2Z28A 1FWAC 3URAA 3EWUA 5I07A 5K9DA 1O95A 1QK2A 4OE7A 1VPYA 3URQA 3WQDA 4P61A 1BXBA 3PR2A 1Q2RA 3I7RA 4BY3A 2ALRA 5D30A 3GQYA 3V3WA 2DVXA 4AAJA 1C29A 4BQ4A 2HPIA 2P8CA 4U5IA 2WVVB 3NYDA 4YTTA 4V28A 3BJFA 2W91A 3U4AA 1MUCA 1G1YA 2Y7DA 1PBGA 3QMTA 4CCCA 4O14A 1UR1A 1XYBA 1XLIA 1GQJA 5FJTA 1U83A 1K77A 1R9ZA 1WDWA 2KAUC 4Q22A 3N2OA 3T0BA 4GZJA 4D71A 4K3ZA 2HNEA 4OKDA 3TQVA 1P48A 4RCXA 1CWYA 1I60A 3JRKA 1EH9A 5TAOA 3G1VA 4PUUA 3O1NA 3UJEA 4RE2A 4W85A 3UXDA 3BGGA 5KZMA 1B3OA 3VINA 3MV11 2X2YA 4MAVA 2OWXA 4KEZA 3WIJA 2R6OA 2UY3A 4O0QA 2FB3A 2D20A 1IEXA 2J7BA 1U2YA 4KEMA 1Q4WA 3HF3A 4AW7A 3AYTA 3QY8A 2HVMA 3VC6A 3N18A 3B9DA 3KRBA 4DXKA 2QKFA 1GTEA 4LEFA 2WMJA 3ITCA 3CYVA 4PTNA 3R11A 1LM1A 3THAA 3U2CA 1JCXA 1J6PA 2BHUA 2TODA 1US2A 3FVDA 4F3HA 3U0HA 4WKHA 3SUVA 4QG9A 3TC7A 3HG2A 1FCQA 4Q4MA 4AEOA 1Z3NA 2Z2AA 3BLFA 3S6OA 4WZHA 1XYLA 2BBFA 4FSAA 3ZSSA 1ONEA 1GZGA 5AHFA 4CNPA 1EKOA 3B0UX 2GVGA 4TMCA 2E6FA 1XYAA 1OIFA 5IOBA 3KEHA 3SN0A 2FMNA 2TSYA 4UQAA 4NKCA 4EAMA 1EPXA 2Q8ZA 4NG3A 1UR3M 4GXMA 1LTDA 2NX1A 3VNYA 3HJEA 4NUWA 1FDZA 4ZTYA 1YHTA 4YVVA 2HDJA 4PMRA 1UH2A 1XISA 5DCDA 5FEXA 3TAOA 1EXBA 4DN1A 3KDOA 2Q8XA 4GQQA 4Y9AA 1X38A 2OZ0A 3CL6A 3ARSA 3GTHA 4I6KA 4KESA 4HZ8A 4Q7BA 4XAFA 2TAAA 1XBZA 4LX4A 4ZB2A 3GM8A 3QZEA 1CIUA 2OWCA 1HKWA 1L8NA 4DXXA 1VBRA 3O6YX 3QZAA 3TTYA 3LCGA 3BAJA 3OP2A 3F7JA 5I3FA 2PA6A 2ZRZA 1TPC1 4JQAA 1QPOA 3H8AA 4CD6A 8CGTA 1EC9A 4UTJA 4K38A 3PPGA 1XG3A 2INZA 3CAKA 3DHFA 3GW3A 4V1YA 2DW6A 1IT8A 3A23A 1QI2A 2J77A 4GC3A 2ISVA 2NT1A 1HO1A 1SO5A 2ZVIA 3IGHX 4PMZA 3VFCA 1I0DA 2V5LA 4LWWA 3KHJA 3L4TA 2YW3A 1HQTA 1RJQA 2ZRWA 2OKOA 5EMKA 1XYZA 3AU6A 3CEUA 2BVYA 3C8NA 2VGFA 4HYRA 2A5HA 3ITOA 3TKFA 1O1HA 1ZZMA 3PZIA 2YLLA 4IGMA 3WQ5A 1M41A 2GYIA 1QMLA 2VO5A 1BWVA 3ITGA 1E1CB 3E0LA 4JQ1A 3QV7A 3SBFA 2PTWA 2G8ZA 3BH4A 3H4XA 1QHPA 2GDVA 3TVAA 3CK5A 4EK7A 3EA3A 3AXMA 5AB3A 2O0TA 1R3WA 1E6SM 3NZGA 1CXFA 1VFOA 2D3NA 3GXFA 3TC6A 1GQKA 4O28A 4I9TA 1NDVA 2VVSA 5CZJA 2QCDA 4M0XA 1O5XA 3UXAA 3WMBA 1EQPA 5CPOA 3ZIZA 3QJAA 5LA2A 3ZOAA 3N14A 4J3ZA 4R88A 2Z1WA 2B7QA 2F6XA 3HZ3A 4XK2A 5LA1A 3GHTA 4WCJA 4AC1X 1S5NA 1A5UA 3UT0A 3SFKA 4Z1YA 2ZC8A 1MUWA 5E1QA 4NIRA 4QNWA 3W7CA 1OCBA 4GC4A 3GLCA 4N2YA 3DFPA 3Q4DA 2ODOA 3B8SA 3ZM8A 3TA6A 1S2TA 5A8OA 4JKLA 2QCEA 3LMZA 5CLTA 1XLDA 4AC7C 3GBEA 2J8GA 2DZBA 1E0XA 4IIBA 4MUZA 1OD8A 4IHCA 3H70A 3ISIX 4L1WA 3B06A 1V4YA 1OX4A 3ZWSA 1V6TA 3AMKA 1K03A 3L2IA 2Z2UA 2VEKA 3HJZA 4QSFA 2IPFA 4H6EA 3RU6A 2BGSA 2YX0A 1IXQA 3ITXA 2J27A 2XHYA 3W37A 2PE4A 3SRDA 3B0VC 2DSKA 2WZMA 3RCNA 3SFWA 9XIMA 4WSKA 1VCVA 2QCNA 2A7PA 1AUSL 4HBKA 3AC0A 4KPLA 3W01A 1YQ2A 3OZMA 4FNTA 2BY0A 4L9XA 3QRHA 3CU2A 4LF2A 4EAYA 2ZUNA 1S46A 4A8LA 1BYBA 1EA0A 1FWNA 2QCHA 2IW0A 1XWYA 1V3HA 3MVIA 3EA2A 4AD5A 4JTQA 1C92A 1OX6A 1XL9A 3RUBL 4L1XA 1V6WA 1GOXA 1GOWA 3NQMA 5IBXA 3VM7A 1G9HA 3F4NA 4PUNA 3TW6A 5D2YA 3B9EA 2UV8G 2PDYA 3URBA 4AZIA 2ZZ1A 2AKMA 4FAMA 4U4MA 3LNPA 4K8GA 3W7RA 3CQKA 1KLYA 3U2EA 5JUVA 1Z48A 1KTBA 1U33A 4G7EA 3ARQA 3CB3A 1LUCB 3J7HA 1M68A 1H5YA 3A4AA 2POZA 3FHAA 9CGTA 2FTPA 4RZBA 4FNSA 3IJ9A 2P1FA 3OG3A 1RQBA 4BJHA 4EXAA 3P6LA 3KOFA 2PDMA 2XM1A 5DCEA 4WKFA 4WY0A 2G4JA 3M0HA 3BOXA 4UFLA 4DJEA 1W6TA 3BAXA 4FF5A 2HQAA 3LBMA 1VFFA 2E5DA 4KCTA 5M1TA 1EYEA 5F4SA 1DE5A 1MW0A 4GHRA 2YR1A 3L7RA 2EAWA 1G6CA 4H3DA 3CHCA 3CUFA 4H01A 1UA3A 2QVHA 3VXGA 3RHGA 3GXPA 2GVYA 4ZB5A 3RCMA 4I5RA 4R27A 3CZEA 1XC4A 1TTQA 4JQ3A 2TYSA 4KCWA 1M65A 1UR8A 1TWZA 1W8SA 1UG6A 4PBFA 3IANA 4ATWA 1R3TA 3I6EA 1FWTA 3N25A 2V2HA 3POCA 4M5PA 2B0MA 4ML4A 1LOQA 3MPGA 1KWGA 3LRKA 2HE5A 3PN8A 4Q8TA 1VEPA 2XIMA 3FJLA 5XINA 2HV5A 4HZMA 2GJRA 3ZO9A 5K3VA 3KUMA 4CVWA 4FX8A 4GFSA 1DJIA 4JD4A 1FKWA 2BGNE 1J0YA 3QV9A 4UOZA 3W27A 1R3YA 4H04A 4JKMA 1QTWA 3E2SA 3IIOA 2C71A 1K6WA 3QEZA 5I7GA 1DQXA 3GDBA 4HA1A 3TN5A 3OYXA 3OBAA 1AQHA 4GABA 3W88A 3FY1A 1XIJA 4JTFA 1W3JA 4C5ZA 2QDHA 3LS9A 1RH9A 4DJFD 2NUWA 1A5LC 4AF0B 1N8IA 1W5QA 4MJMA 1XD1A 1XH1A 3N17A 4NZ5A 5CPLA 6XIAA 3F4VA 1SUXA 2E9MA 2J6XA 1NWSA 3MP5A 1R2TA 1FP9A 1EJSC 4US6A 2VX4A 1BXCA 4O17A 2D73A 5FEZA 4CQ8A 4ZQMA 4DZIA 2NV9A 1U1JA 3N2MA 4JFVA 4HJFA 1XX1A 3ZLGA 1UUMA 2YA1A 1FVPA 4OHQA 3IJQA 2V6AA 2G5WA 3N2XA 3CIVA 3KLLA 3W83A 4YCPA 4LS1A 3G0XA 2VFDA 1ISXA 3KAOA 4QS6A 1VFHA 3MDWA 3AZTA 2QJIA 4AIEA 4IM4A 3VYLA 3WH8A 3FGCA 1TA3B 3QHMA 1EJUC 4DUOA 1FWBC 1TSIA 3ZR6A 1E6XM 2GDUA 5BRQA 3SN4A 5DRCA 2OODA 3EMQA 5I3DA 4D6HA 4YJ5A 3THDA 5CJ5A 1UASA 4ACZB 3BZJA 1WNOA 4NL1A 4GI6A 3PZUA 1DXIA 2CU0A 3NQVA 3WD4A 1GZJA 2H9AB 2YDQA 4KFPA 4PMDA 3W2JA 3NQ2A 1RCQA 1JPDX 3TAKA 1J2WA 1VRXA 4J9JA 1JDDA 3VKKA 5F7UA 3SSZA 2FGBA 4LYPA 3MB9A 5MHBA 2ZUSA 1KO0A 3IIZA 4MMWA 4I8DA 4A8RA 3BURA 4AD2A 2WJFA 2A7RA 3M7SA 3EDFA 4WUIA 4NJGA 3UZ5A 3M0ZA 3TQKA 2AGKA 1TPH1 2XISA 2O7QA 1T96A 3LG3A 3LLDA 3E0VA 4O8AA 4FLSA 3MW7A 1JDFA 5AN7A 3E96A 3AIRA 1FHVA 3RO8A 2Y88A 2MNRA 3QY7A 2CKRA 1W3IA 3N6QA 3WH9A 3WELA 4R53A 3WBWA 2GL5A 4H00A 2CLFA 1QNRA 1QPQA 3R43A 1BWKA 1SMDA 2L5HA 5BRPA 4O52A 3NGFA 4M3PA 4WK9A 3SCUA 4M6PA 2JIEA 5HDRA 3H24A 1Z32X 1MSSA 4NZJA 4P7OA 2AGTA 1JPHA 4XG1A 4CNSA 2VCAA 3GTNA 2OZ3A 2VRKA 4Q8VA 3T0AA 5HMSA 2DUZA 1JDAA 2WZTA 3S83A 2QJMA 4HMNA 4IOTA 4HU4A 1KFJA 4D6IA 1H41A 3TYAA 2WNZA 4I7UA 5C8BB 4LVDA 3SR7A 1W5NA 4GVIA 4QQ3A 3CIXA 4LQ1A 1FWFC 4GNJA 1KXVA 3TJ4A 2DEPA 3THQA 4TVCA 1W9VA 4K1WA 1GVOA 1GG0A 2PZ0A 3WQ6A 1X98A 2ZX9A 3GDLA 1XC6A 2EKCA 2A3LA 2QUNA 1C91A 1UD2A 3MSYA 3WDRA 1IWBA 2XU2A 3RJXA 4DYJA 4BS0A 2YFNA 3EKZA 5CPTA 4V27A 4GYJA 3C3UA 4NVTA 1GVFA 1P7TB 1I8JA 3ARTA 4HMCA 1ISWA 2ZX6A 5CSRA 4JX5A 1ONXA 3A24A 3KBVA 3JUGA 4FK9A 1IWAA 1RQHA 5LNRA 3K4AA 4AISA 1AW1A 4U31A 4M29A 4ACZA 3EOEA 3KX6A 2QQ6A 1Y8BA 1UP2A 1FA2A 2VQUA 1D9EA 2Y4SA 3MWAA 3MTWA 3W1XA 4JN8A 1F7BA 3R79A 3IGUA 5G4EA 3BW2A 4CCEA 4WGHA 3VNMA 3VM5A 2VWSA 4JNYA 4IISA 3AAMA 2GSHA 1Y5XA 4F4RA 3VIKA 1OFBA 1YTDA 2QV4A 1G4TA 4DO5A 1AH4A 4KIEA 3CH9A 2OSXA 1RZMA 3B8UA 3PWAA 3L2MA 3LYEA 5AOUA 1L6FA 3V5OA 4EANA 4YPJA 3LCHA 4U33A 1M7JA 2Z25A 4KCVA 4JFUA 2PPGA 3WD0A 2ISWA 4DM1A 4PZVA 1YPIA 1RAKA 2YL8A 1U5VA 4IPJA 1PSCA 1DHPA 1H50A 2WVVA 4NQ1A 2QULA 3N6JA 1EHAA 1VBUA 2FB2A 1W3LA 1RA0A 3SO7A 5CC3A 3RJYA 1H7PA 4XQ6A 1TUFA 4D6GA 5BWAA 1TMLA 3SM0A 3N1AA 1V0KA 2Z1XA 1W56A 4C65A 1GCYA 3NOYA 3C8FA 3IIPA 4UMAA 4QQUA 4D8LA 1RV8A 4XKYB 1V6XA 3E5BA 5BCAA 1MFUA 2AQWA 3ZT6A 3FIGA 2WSYA 3MUZ1 2XGIA 2BB0A 5D2XA 4ZOBA 4IP7A 3TTSA 1FWWA 1XUZA 3QFEA 4IIDA 1VLIA 2B7PA 1NARA 1RK5A 4XWUA 3EEGA 2IUZA 3FSTA 1O7AA 2VOMA 3MKKA 2HBVA 4IXHA 3DFQA 1GW9A 4Q7IA 4PTWA 3SRKA 3S1GA 1UKPA 4MB1A 1KQZA 2XFWA 1A5SA 1CGWA 4UFHA 4NNAA 2CLKA 3LLXA 3AS3A 2D3LA 4U28A 3EX3A 1H60A 3ORWA 3N4FA 5CZTA 3ALFA 3O0FA 1RBAA 3VGGA 3BAYA 2AL2A 2QMJA 3SUSA 1HJSA 4QCEA 4PUDA 3I7SA 1UWRA 4HCHA 4OU1A 6REQA 3I3DA 4N02A 1BLIA 2RDXA 1UW9A 2FHCA 4HPHA 4R7WA 5JIPA 3GIYA 3H53A 2YKKA 4FA3A 3E5PA 1Z8AA 2J7EA 1OCJA 2UBPC 3CNYA 4O4VA 1ZJBA 3EBVA 1Q6EA 3A3XA 3O05A 4O15A 2OKTA 3NZPA 2PLJA 3AUJA 1TREA 3LY0A 3T0TA 2EPOA 3QW4B 4WOZA 1CZ1A 4LUSA 1J0KA 1KCZA 5C70A 2GPTA 3K30A 2C16A 1J0JA 2E6YA 4JHOA 2JIWA 2X41A 1V02A 4P7RA 3W87A 1W9XA 2J62A 3CUHA 3JVAA 3MUXA 3L67A 4B3KA 5D03A 2V67A 1PDZA 5KSWA 3KBWA 4OUEA 1G67A 3B97A 1UMLA 3GNRA 3EX2A 5LNVA 3TNBA 3QXBA 1E6NA 4GCXA 3TNOA 2OX1A 3KOXA 4HK7A 1ZAJA 4K8HA 4EE9A 4QGCA 3ZT7A 3W28A 1KFEA 2PF0A 4PUWA 1E40A 2FJKA 2RJGA 1ZBCA 5A8NA 1G5AA 3UJ2A 5K9CA 4NJKA 1ZCOA 3I4EA 3OODA 4GINA 3WUEA 2W9MA 2CYGA 5HJXA 2VWTA 2OCZA 4D6CA 5H8UA 3GU9A 4FIRA 3UZXA 2POTA 3W81A 4JHMA 2GK1B 2DT0A 4FXRA 3NM1A 4I90A 3VNZA 4A3RA 3VUSA 1Q65A 2O4MA 1XG4A 4IICA 3NPVA 3BGJA 3CZLA 1PTAA 1O12A 1JDCA 5JBEA 5HUPA 4ICMA 1DE6A 1Y7VA 5GNZA 1EF2A 3JR2A 5CBJA 1KM5A 3DYPA 2J7DA 3HOJA 1MZHA 5AYXA 3BAIA 4P7NA 1PZ3A 4PUMA 3LZ3A 3VIMA 3PJUA 2NV2A 3VIHA 3OQ8A 3AHZA 1S5TA 3BPWA 4H9YA 3E49A 1JZ3A 5A2AA 1QO5A 5D05A 1W37A 4BWLC 1UD5A 3VKCA 3EB2A 5ABFB 3I3EA 3C56A 1DKWA 3F03K 4CD4A 4LYRA 1QWKA 4A2SA 1LRTA 3EGJA 3GTFA 3SCWA 3MMTA 4LC8A 4TO8A 4Y8EA 1SSGA 3AXHA 3PY2A 2W27A 1A3HA 1K6AA 5ECVA 2GVJA 1KBIA 3MYPA 1VFSA 1KR0A 3I6TA 1BTCA 3AOFA 3A64A 2BHZA 4E2BA 1LRNA 1MEHA 3CXOA 3RFAA 1XFCA 1ITXA 3BW3A 4DUXA 5JH1A 3W25A 4L7ZA 4ADTA 1YXDA 3MY9A 1XCFA 4LNCA 1UMYA 5DBUA 5LA0A 2TPSA 2PRMA 3Q2DA 3S2MA 3PJWA 1K7XA 4W86A 2QVNA 3LXCA 2DSWA 4CN4A 1UD4A 2BS9A 4KRTA 4H7ZA 1XH0A 1YDYA 4KH2A 1ITUA 1QOXA 4H1ZA 2YA0A 2Q3OA 4BI6A 3UJSA 1ZQ5A 8A3HA 2XH0A 2DV0A 2Q8LA 1VJZA 2RUSA 4FP1A 1S2AA 3TROA 4XZBA 3SCPA 5CH9A 1A4MA 4L4LA 1E5NA 3CJPA 1NP0A 1RCXB 4O54A 3A4XA 2G41A 3GDRA 1KFCA 1UR2A 4KWUA 5EGRA 3GNXA 3OYZA 5FD0A 3LHVA 3WMSA 1ZFJA 1SO4A 3S5SA 3BK0A 1FHDA 3WQVA 4DO7A 5E0FA 1LORA 2PDKA 2W5FA 3CWNA 4IG2A 4FPSA 1C8YA 3WNLA 2AAAA 2HWGA 3ARUA 1NOWA 5C71A 1LQ0A 3QOMA 1RJPA 2PDBA 4H41A 3DBNA 5BXRA 2WKJA 2J24A 3TN6A 2GK1A 1J10A 3EPOA 3WCZA 2VCBA 2PWDA 2R1MA 2J9YA 1TPWA 4I9JA 2PFHA 3SEPA 5CSSA 4TOQA 3NGJA 3PUGA 4GI9A 4KWOA 3M0XA 1ZUAX 4MLJA 1U1UA 1RD6A 3FCPA 4JN6A 3PP7A 3ZVHB 2WC3A 4B3LA 4LUSB 1NDYA 1VCGA 3MHUA 4H7CA 4MWAD 4HU0A 4M80A 4IP4A 1QI0A 5H8MA 4RZ5A 4RV8A 1VFLA 1BD0A 4TV5A 3Q45A 3FNDA 3TOYA 1XW8A 3GVGA 4O57A 3W7NA 3TSBA 1KBJA 3KM8A 3PB0A 3NPUA 1T40A 2R1KA 4HQVA 3TZFA 5F2MA 4KETA 3HGJA 1JI2A 3MUCA 4EPDC 1ZJAA 3HPFA 4ZE5A 3VOCA 3NQGA 2NQLA 1OINA 2VYOA 1TE6A 1YDVA 3R8RA 1MWOA 1VHNA 4GFIA 1QI4A 1XP3A 3VU2A 4J3TA 1TG7A 1CGVA 3NIYA 2VDHA 4N4PA 1VJSA 1GOKA 1GYNA 2YOCA 2HVNA 3MZNA 4GIRA 2DSVA 2ZCGA 4QX4A 4N7QA 3N15A 5A69A 3TV8A 3WQFA 4A4AA 3MC5A 3LLFA 3NYZA 2EG7A 4HK5A 4HVXA 3BMWA 4HHPA 3PTQA 3UF9A 5G1YA 4E8CA 5FF4A 4YTQA 1VPXA 1VBGA 2DH3A 3G5EA 1V7AA 1LQAA 3S1WA 2SFPA 4NT0A 3W38A 3W7DA 1N2VA 4DWSD 5IXEA 4FR6A 4HNCA 2W0UA 3P3BA 1WX0A 3JW7A 3VI2A 3WLIA 2EPHA 5KETA 1H1YA 1OX5A 3E0WA 4YNGA 2PDJA 4LC6A 3TWAA 1S5WA 4FLQA 1OADA 2WBKA 1XF0A 4F66A 4AVOA 3WBXA 2WB5A 1M7OA 2ZRXA 3QPZA 2XVNA 1LOLA 1OD0A 1TV7A 3FXGA 4F0MA 4M6UA 4PCSA 2ZTJA 2XIQA 3HFTA 3VDAA 1V6YA 3W4RA 1WZKA 6A3HA 1J79A 5D2VA 4IIEA 3L2LA 4X9SA 3IWPA 3T40A 4IJBA 2O55A 2RGLA 2VOTA 5JBFA 4PL1A 4IIHA 2ZIDA 3ZWTA 3PFMA 4AF0A 1ZRQA 3SCRA 4N9BA 1T0OA 3OEXA 1BVNP 4QHRA 5EU9A 5KINA 4P5UA 1UPPA 2VUYA 1SYTA 4GPNA 3M5XA 4Y8FA 3TU9A 4TVDA 6ALDA 4PB4A 3S2JA 3BOFA 3REQB 1OK4A 3VA8A 1C8XA 2R1LA 4C91A 1JXKA 1XLEA 3LV5A 4Y96A 1R0MA 2E9BA 3QKEA 4GYFA 2F8QA 1UCWA 5C7HA 1B1YA 1AW2A 4UMBA 3VPLA 1O68A 2PC8A 1JYVA 3H7RA 4KIRA 1R85A 2O4QA 2YL6A 3OZOA 2B4GA 2G4FA 4M24A 2NX3A 2VEIA 4E3TA 1GUVA 3B8TA 3BLEA 1S1PA 4Z2JA 4AHOA 3GD6A 4QJ4B 2I17A 3LGGA 2QMKA 2XIJA 3LXAA 4NU7A 4WOQA 3TOPA 3IVTA 4GRSA 4C1KA 6ENLA 2DT3A 2VVNA 1FP8A 3MKCA 2Z29A 4AUBA 4L61A 3W3OA 5C9ZA 4P7LA 3USZA 3FA4A 4Z1DA 5CXPA 3T9PA 1P6BA 2V69A 4JKKA 5JVLA 1VYPX 4AX7A 2X1RA 4DUVA 3AIVA 1OT2A 3TYBA 4OFCA 2CXEA 3FEMA 3GFYA 1BVZA 4AWEA 1R86A 2ISFA 4GY1A 3NQBA 3P74A 3DU0A 5RUBA 1VC4A 2WYSA 1UWQA 1CT5A 1KXTA 4U10A 3UG3A 2XVKA 2J9XA 1FX6A 1RXOB 4QAIA 4L4OA 3GHUA 1XH2A 3UVIA 4A35A 2D69A 2A1YA 4G7EB 4UFKA 4GQ0A 5HWNA 1FTXA 3RILA 4PCTA 2CZ5A 1LWHA 5AC8A 2YYUA 1UH4A 1S5MA 2J25A 2YB1A 3ABQA 5DY2A 1BWLA 2D22A 1J6OA 4ZOCA 4QSHA 4JIEA 1KR1A 2OQHA 3BJSA 1KKOA 3BV7A 1UKTA 4W87A 2CETA 1ZU8A 2KX9A 4OQVA 1XLGA 1DWJM 1S2UA 1GG1A 3MKVA 2J9ZA 1W1YA 2GQAA 4FS9A 3PBVA 4LCQA 3NFUA 3LHZA 2YCLB 3SY1A 4HGXA 2R14A 4KWSA 1CGYA 3VKJA 1IV8A 2RKXA 5CPMA 2Q71A 3FDGA 1DJXA 4LF1A 2CC0A 1ZTVA 3NQ7A 2GSEA 3DYOA 4H9ZA 3NSNA 1QBAA 3PPFA 3W6YA 2WZIA 2PS2A 4I8YA 3SZ8A 2EJAA 3P93A 3CZJA 1KFLA 4WSHA 1EWEA 4XZ9A 3W29A 2FDMA 1HG3A 3NO1A 1B31A 4ERGA 4H83A 1PV8A 4JEQA 1QFEA 1KNWA 4NXSA 4IFKA 1O5QA 2IMRA 1LLZA 2XJ7A 2WPBA 3K4WA 1UA7A 5IDIA 3UA4A 1UIPA 2A7NA 3TYDA 3MDUA 2QJJA 2Q02A 1MO0A 5BROA 3T2QA 2ESCA 1W2VA 5HJYA 1VIWA 3Q65A 3JZUA 2X1TA 1GVYA 5D8WA 2J78A 5ABHA 3TLLA 1POKA 3S2CA 3GAKA 1EO5A 4IIFA 4F79A 2A85A 1W1PA 1AW5A 3G2GA 1Q6FA 2C8NA 2I57A 4AZ6A 2GJLA 1Q6RA 3G1SA 1CENA 5I02A 1EFZA 3TYEA 5IDZA 2ZA3A 5A6BA 4O1AA 4W4QA 1TWDA 2E0PA 1QCWA 4JTCA 3BDKA 1S5VA 2GUUA 1EL3A 2NQJA 2C91A 3CTLA 2Y85A 2W92A 2E28A 3E74A 2E40A 4C6OA 3AFBA 2XIOA 5DELA 5DMNA 3M07A 4I7WA 4Q6JA 3VGFA 4W5UA 3TUUA 4NX0A 3C4UA 1WKYA 1MZRA 2WC4A 1ODZA 4DELA 3CEPA 4YCOA 1ISZA 1VYSX 2PGWA 1XM3A 3VX0A 5H2ZA 3C52A 3NPWA 3W02A 1FFQA 1HUVA 2FGLA 3HO8A 1QATA 4XAGA 2BOGX 2EG6A 4NJIA 1DIKA 3WF4A 3EWYA 2QNEA 1AJZA 5LNUA 4PMJA 4ILSA 5FACA 2WZHA 1W0MA 1RJRA 1BTMA 2PRHA 4ZENA 4OJYA 3NQCA 3V75A 3IJ6A 1TCDA 1AZ1A 3C0LA 1E72M 2P3EA 2DSUA 3A21A 1ME8A 4BF5A 4NJJA 3VD9A 4BQ2A 1TTJA 1OGSA 3MUIA 2Y2WA 3W7IA 7ENLA 3BSMA 3DFSA 3VIJA 2DZPA 3BLPX 4LB3A 1PE1A 3LPOA 1B2YA 4MKNA 1GVIA 3UWWA 1JFXA 2ZTKA 2V68A 2E9LA 3H4GA 4AG0A 4MG4A 4PUEA 2FLIA 4YXGA 2D2JA 1VP5A 4HCLA 5HWJA 1IEVA 2Y5SA 4NY2A 1WV2A 2V5BA 4Z2KA 4C6FA 5K4ZA 3B9NA 4JTEA 2VQTA 1GWJA 2EQDA 3CPUA 3RN6A 3VNLA 2FQIA 3TZNA 2C0AA 1XDMA 3M46A 1NWTA 3G8RA 4YYFA 3GX9A 3CMGA 3UCDA 1FDYA 3APYA 4DYEA 3UPBA 2EXOA 1CB7B 1BQCA 2Q6ZA 4MPQA 1XV8A 5LXXA 1XBXA 2J13A 3DYMA 5MF5A 3W82A 4MY9A 5E09A 4JY9A 1HJQA 1WDSA 4AY7A 4KMQA 4B3ZA 1TZ7A 1X6UA 2CBVA 3DECA 2WLZA 1XLLA 3TTQA 1Q5MA 3MHGA 1OFOA 1V0MA 4ICNA 4YLWA 1WAUA 4N4QA 3PZ9A 3LX9A 4RW3A 2ZZ7A 1DJZA 3OBKA 5LHFA 3ZFHA 1HJWA 1UWSA 3H2OA 4K8EA 3IAPA 4K7YA 1D7FA 1J9YA 4AYSA 1TMHA 3AISA 2I5IA 4K37A 4LBUA 3VIIA 4QISA 1MXGA 2VZTA 1H3GA 4OIFA 4WD0A 1NIUA 2V38A 1B5TA 2ZWYA 1EJ7L 5HANA 1E9IA 5TQLA 3DUGA 2AL2B 3TCSA 2GGEA 3LCWA 2V5KA 1RD5A 3ELFA 4XUYA 3RG6A 3BZGA 3PTKA 1PL9A 3TTEA 1UZDA 2YPIA 1OG0A 2P8BA 5C55A 3GVQA 4PCPA 4TV6A 3I65A 1LOSA 2QCLA 4E4FA 4BCEA 2GQ3A 3CL7A 5BMWA 3CAWA 1R46A 1FWIC 3KTSA 2EPMX 4B5VA 3DFNA 2HEJA 5A6LA 1X6NA 4XD4A 1OFQA 4UTIA 5KMYA 5GJMA 2VFGA 2AMXA 2FHBA 4DUWA 4WJ8A 3UWEA 3T4WA 1BAGA 4GO9A 1F6KA 2XZ9A 3R89A 4C90A 4JYFA 3M5YA 3G0UA 1F9CA 2VGBA 4ZSTA 4KRZA 4LV9A 3MMWA 3EOSA 4GIYA 5ECUA 3L0GA 4AD1A 1K4HA 2FPYA 3FS2A 5D09A 2V3DA 5D9OA 3T8QA 5EBUA 2NWSA 4CVUA 3G6LA 1CXLA 3RXZA 1MEWA 3C2YA 5CZKA 4DJDA 3EZ4A 4FNPA 1KXQA 3I10A 3NEHA 1S2CA 1G4PA 3A12A 1XRFA 3DHPA 1HIZA 1BSIA 3ARZA 3LQGA 1V6UA 4UFJA 4S3CA 2W66A 4IMEA 1I0BA 1RPXA 2Y89A 4AZCA 4QEHA 3RMJA 2Z1KA 4CQBA 1ZPTA 3W2KA 2DVTA 3K2GA 4XB3A 4Z17A 5A6SA 1YEYA 5IBXC 2PDPA 5FEWA 1MRAA 4FZIA 4HNUA 3QMRA 4E2OA 5FF0A 3DENA 4PMQA 2OYKA 4OTKA 2CPUA 4R3UA 4K36A 3T8LA 2DH2A 2YYTA 1JZ2A 1K8CA 3C2VA 1YMYA 1RHCA 4UTMA 5IRPA 4HOWA 1NAL1 2ZUWA 3EPNA 3LUTA 2PDGA 1IEIA 4UNKA 4IMFA 3I3BA 2EKGA 4WR3A 3AS1A 3K5XA 4EVZA 5J5RA 3AI0A 4H4IA 2FZBA 4HOXA 4MAZA 4YWIA 2FVMA 3VD5A 3LMYA 4I5XA 2BXZA 1MEIA 3E02A 1H61A 3W1LA 2J66A 5JQ9A 1FWDC 1OQFA 1OEPA 4L6HA 4L6OA 3MO4A 1RBLA 2QAFA 3B8IA 3CAVA 4LJ3A 4LBSA 4PYSA 1IIGA 4UTWA 2D24A 4R9OA 1OK6A 5FOOA 1X1OA 1W5MA 4S3AA 3ITLA 1IF2A 2QIIA 1R9XA 1OVDA 1LL4A 3ABRA 3FLUA 3NAVA 1KRCC 5HPCA 1W31A 3KZSA 1VLWA 1UHVA 2DPEA 4IMDA 4IQEA 2ZRVA 3KCOA 1BRLB 3G1DA 2PD9A 3NQ8A 3VD4A 4QLKA 4AXNA 3P0XA 1LBMA 2OSYA 4M6VA 4O1FA 3GC5A 3LSCA 3MANA 4JS3A 3KWXA 5C2GA 1XLBA 3HQ1A 4ZE4A 4ROPA 1XHGA 2Y24A 2FFIA 3IEBA 5I6SA 2FPTA 3NSMA 1JCJA 1B30A 3HURA 3M5ZA 5A8QA 3DN5A 5G5IA 3OOQA 1GOMA 3CBWA 4Q4RA 5KITA 4JQ4A 1E71M 2B7OA 4HIBA 1T6MA 4Q4QA 4CU8A 1N55A 1GONA 3KBJA 3KOZA 3P62A 4D6EA 3KVJA 4L5ZA 4LVFA 5A1AA 1B54A 1EYWA 2F7FA 3XISA 2WOQA 2QIWA 2EF9A 3KLKA 1UWIA 4QJ3B 2B81A 4U2YA 1VFTA 6REQB 4C6DA 3TMQA 5AC4A 1CYGA 3OW1A 4X60A 3V5FA 1XR2A 4WY0B 5FSDC 4GVGA 1EA9C 2NT0A 1VF8A 3VOHA 4DZAA 3XIMA 1TQXA 3VKDA 2PTDA 3QMSA 3DC0A 4KGLA 1QO2A 4C6CA 1XIIA 1NEYA 1UWAA 4JTUA 4HHHA 4IJRA 4Y2WA 5GQBA 3INPA 1XLMA 2OWWA 2XINA 3TYCA 2E77A 2Q09A 2YIHA 5AYYA 3PUEA 3VOIA 2IKIA 4C6PA 4MUPA 2V0TA 3U7VA 3S9ZA 4A3QA 3A9BA 3S6DA 1MXDA 2OXNA 4Q8WA 5L9FA 3ZJ6A 4AHPA 2WMKA 1SZRA 3L4WA 5HQEA 3PUDA 4O10A 4QITA 5JU6A 2ISSA 1GNXA 1KV5A 2QZRA 2NUXA 3EX1A 2HJPA 3N3TA 1GT8A 3T4CA 1GPFA 2CLHA 2VDIA 2RGMA 4WF7A 4K1GA 1GKPA 1TR9A 3HV8A 1TVNA 4BQ3A 3PAJA 2A6LA 1TJ1A 2GLKA 3ANYA 1EJWC 1XUUA 1F3WA 1WUEA 1G4SA 1YNQA 4J27A 1VHCA 3E1F1 3A4WA 3STEA 3NEVA 3N4EA 4KGJA 7PTDA 1GW1A 4J28A 1W9DM 3CQJA 4GKTA 1WYIA 3L0NA 3L4ZA 2VR2A 1QASA 2AOSA 3MUY1 5TBOA 3AS0A 5M5DA 2VEGA 3CUXA 1QVBA 3RU8X 1GQLA 2JEPA 2WSPA 4LPCA 4FMVA 2PDQA 1W17A 7TIMA 1TWSA 2PB1A 1SZGA 1BF2A 4ZOEA 3V5CA 2BGQA 1E3XA 1GVRA 2CNCA 4RDWA 2FFCA 2V5CA 3QYSA 5T91A 1IXNA 1P0KA 3NSXA 5HMEA 3CB8A 5EY5A 3PHAA 4EF9A 3H21A 1KRMA 2OR2A 2VC6A 4BZYA 3RM4A 1UZHA 1K9EA 1R7OA 3WJYA 1X1NA 1IE7C 1XLAA 2GVLA 3D3FA 4QE4A 3QW3A 5A94A 4KF1A 1I45A 1JF5A 1PHQA 2OO6A 3GK0A 2INFA 4ORIA 3TP4A 1AD1A 2OU4A 4PSPA 3QSTA 2CZVA 2JF6A 1VIZA 4N9EA 5I3IA 1QPRA 4US5A 3E3HA 1UR4A 5FIPA 4MM1A 1W1ZA 5I06A 1T8QA 1D3CA 2ZYFA 3AMDA 4YN5A 1P6CA 4EWND 2DZAA 3MI3A 2ZXAA 4W7VA 4Z1BA 4FOKA 5EMMA 5DBTA 3BG9A 3WLNA 5EMJA 1JCTA 3CQ0A 1JNDA 1W3KA 2D2OA 1Z6KA 2I7GA 3WYZA 3SDOA 3RAOA 1A0EA 1ZAHA 3T81A 2X30A 5A2BA 5I3KA 4ZODA 2J6VA 3GHRA 4NRRA 5CKSA 1SGJA 5AHIA 4ZEPA 3UWQA 1O4UA 4FX6M 3W26A 4OBTA 2Y61A 2E67A 5AECA 3Q67A 2XFYA 3MCNA 1EP1A 2DW7A 2JFEX 4DF0A 1OFRA 3QOKA 1EOMA 1MFVA 2PODA 1B90A 1J2BA 1YLVA 3SQMA 4Q33A 3M16A 2Y1HA 3P61A 2E8YA 4P8WA 3LTPA 1E6QM 2VEPA 3GVRA 4UIOA 1TTIA 3CQIA 3MVTA 1HKMA 2JKAA 2X1SA 1TZ9A 2XG9A 3OVRA 1OX4B 1QBBA 1C3FA 5T8GA 1QPKA 4GNKB 3UFYA 5D9NA 3BV4A 1H1ZA 2VX6A 4FOJA 4GVFA 4ZO9A 3LGDA 3N9SA 3ARYA 1BYDA 4CQAA 2CW6A 3E9AA 5KTLA 2C18A 4ZXLA 3WLTA 4FNRA 2OB3A 2W6RA 2CZDA 2YXOA 1XLKA 3LN3A 5AFDA 1YYAA 3P80A 4LFYA 6PTDA 2C0HA 4LY4A 4MKSA 2Y8UA 3AO0A 2OEMA 4LAOA 2GJNA 4LV4A 3NQEA 1O66A 4ZQCA 4JYDA 2XSAA 4V2XA 4U3AA 1K3UA 1KTNA 3CWOX 2PLMA 2XM2A 2J8TA 2VM8A 4WSJA 3SI9A 3E6EA 2R94A 3WQWA 1U5JA 2ISDA 3WQCA 4GKLA 4D1IA 2BV9A 3PBYA 3S5YA 3G1AA 1R2SA 2X1IA 3UJFA 4PMVA 1REQB 2XH7A 4FIQA 4GG9A 3LCLA 3GBDA 3TLQA 4ASTA 3R7MA 1K1DA 5GPRA 1YTEA 1UKOA 1I2OA 1ZLPA 3L4YA 3U3HA 3R94A 3LPGA 4RK8A 2PTYA 2YL9A 5AVHA 2ACQA 3RO6A 3TYZA 4Q6XA 1XPGA 2QJGA 1NOUA 4F2BA 1W5PA 1PO9A 3R4IA 3WBEA 4LU0A 4O1EA 2I14A 4JICA 3ZJ8A 2V63A 3GG7A 1TPEA 4CEXC 2C19A 5XIMA 1V8EA 5JXQA 2QAPA 1JGMA 2AQVA 4J4KA 3UZWA 3M64A 3KP1A 4NZ4A 1M7XA 3NA8A 1XSIA 3MHFA 3AXXA 2HPMA 1T7LA 2KZHA 5A3HA 1R5YA 3SSJA 3LI1A 3KCLA 3HMCA 5BMXA 4J5NA 2OX4A 1M1BA 4F2TA 4S2BA 2VX7A 3FAXA 1T41A 2GJPA 1H7RA 3FN9A 3M0JA 1W54A 1AQMA 3TW7A 1LLOA 1GJWA 3NZ1A 4GYPC 4FXJA 4XTDA 1LJYA 3VE9A 1EWDA 4UOQA 3M1ZA 4IPIA 3LERA 1D3HA 4H8VA 1NFGA 2DZWA 4FXSA 2WHKA 3QR0A 3S47A 3W7QA 5U7SA 2CLIA 1RBOB 5TD4A 5I23A 2PMQA 2XZ7A 3QBUA 4HNTA 2WHLA 1JCLA 1OY0A 4Q8OA 1XI3A 4A8NA 4HK6A 4HSNA 1XYMA 1BSLA 1YTKA 3UVAA 5FEPA 4C6NA 5FI8A 4B5NA 4DJED 4I3GA 1HVXA 1KFKA 1OFPA 1WCGA 3TN3A 2Z4GA 4E4UA 3ARXA 3IIXA 4B2DA 4AZ7A 2YCEA 4GZ7A 1Q2SA 4PMNA 4OECA 4LT9A 4Y7EA 2OJPA 1UROA 2WMIA 1R3VA 3O07A 2Y70A 1T5AA 1FWRA 4A8IA 2TRSA 1POJA 3C6CA 1WZMA 3AIEA 1J12A 4BF7A 2ZFAA 3LRLA 3POHA 5I3GA 1MRQA 1G7VA 3OA3A 3VTRA 5LXEA 3AIWA 3NVDA 1ZBKA 3GWQA 2E7FA 3LZ5A 5EBAA 5JBDA 1XBVA 1RVKA 1WKDA 3RF9A 5F2GA 3O06A 2IKGA 5CZ0A 2CZEA 4B4HA 4QAWA 3D6NA 3WNMA 1ADOA 3IJ7A 4JTJA 4CQDA 1OIMA 4XO7A 5T9BG 3MU7A 1KCKA 3O15A 3H2FA 4JTSA 1R7AA 2WNQA 3THUA 4Z2LA 3GIPA 5CG0A 2D0GA 4Q8UA 2XN1A 5AHEA 3WQGA 3VOGA 3RM8A 3WN6A 1I1WA 2O9PA 3LENA 3I68A 3SQLA 4CD8A 1KA9F 3SJ3A 3BICA 3EEZA 1TWWA 4UZUA 4AZBA 4Q8PA 2Y8VA 3G1XA 1SJAA 4LRSA 2NUYA 1C7SA 3PZOA 1QNQA 1V6VA 3F1QA 3MA8A 4HA0A 3FGCB 2IXUA 4GK8A 3B8VA 3VZXA 4DLMA 2H8XA 1DWIM 1JD9A 2JF7A 3PG8A 1TELA 4C6BA 4DJDC 3QPEA 1IWPA 2ZUVA 3LPFA 3C3NA 3UZZA 1UH3A 1IZCA 3S5NA 3EB3A 1JD7A 4ZR8A 1XIBA 1NY1A 3PS7A 4JGDA 4MF4A 3H23A 1EJRC 3NWRA 4MSSA 3TFCA 1YW1A 4HA4A 3AJXA 4ZCWA 5AHLA 5KZEA 1KKRA 3P81A 2ZA1A 3ARPA 5I09A 3SCVA 1L8PA 1PXGA 3M6YA 1JUEA 3EWXA 3F4CA 3BXWA 4L9YA 1DL3A 2Y62A 3GC4A 1ISYA 2J47A 1IR2A 1JYXA 4UR7A 2ZZ6A 2VD8A 1PHWA 4UTHA 4MPKA 3IUHA 3SRHA 4NNBA 1WBJA 4Y9NA 4PRRA 3HQOA 3W6MA 3VOFA 3VILA 3WH6A 1UYQA 3GXTA 3VGBA 4BWLA 1OFDA 1ZGDA 4QR6A 2GJXB 4DPQA 3LXBA 2E5CA 3AYSA 4ZZ9A 3NL2A 2Q01A 4M1RA 1UWTA 1PTGA 4MWAA 3TK7A 8XIMA 2Y8KA 2PCQA 1P43A 3HA1A 1SR9A 3W7PA 5A6AA 2Y5JA 3LHTA 3GYEA 5A8MA 1I9CB 3EDEA 2G3NA 3ECQA 4H6KA 1CXEA 3CASA 2YBTA 1QJWA 2Z7GA 4PCFA 3W70A 5A95A 3M44A 2WK2A 1WDRA 3KDNA 1NDZA 1VYRA 4S3DA 2PAJA 2Q3RA 4QRNA 3R12A 4BFAA 1OFAA 3KOYA 4GUGA 1IZJA 1LLWA 3VX1A 1A3XA 1W1VA 3L9CA 4XD6A 4UTFA 4QLJA 3T44A 3GH7A 2ZRYA 1HKKA 2PLCA 2PWEA 2DZSA 4L1GA 3LPPA 2FZDA 3QPYA 4O0KA 1F8MA 3KZPA 4O16A 3GR4A 3OBEA 4MY1A 3QC3A 3CC1A 2WBGA 4NNCA 5LIXX 4E5TA 3LM7A 3UXLA 1KCLA 3AICA 5AC7A 3SW6A 2PWVA 3VCRA 2E8ZA 1UPMB 3RK8A 3R0DA 3H2EA 1R47A 3BLLA 3RPTA 3UESA 3LHUA 4UQ9A 3M0KA 4CNNA 5ABFA 4JTHA 4L65A 3S8HA 4QE1A 2IPGA 1OABA 2OG9A 2QXWA 4PB5A 4LUTA 5DX7A 3CHDA 3NJ3A 1Q6GA 3OVQA 1GOOA 1JG9A 1WBHA 4TTGA 2QDGA 1YE6A 3V36A 4IPLA 3DESA 1H5VA 2FGZA 3PPCA 4LYQA 3ITYA 4C6KA 5FCZA 5G1MA 3GZAA 4NAFA 4ZQPA 5EKYA 2QF8A 2XN0A 2C1GA 1FCUA 2BDQA 1AJ2A 2O9OA 1EGZA 2DORA 2Y7FA 2G3FA 3HQPA 4GVHA 4C5YA 1JYWA 1EC8A 3SB0A 3SIZA 2W3ZA 3NCOA 3CUZA 1OGBA 1TFVA 3OLEA 3A22A 4CU7A 1FWGC 5CGQA 3FW6A 4Y9MA 4IP5A 4TU1A 4IJCA 2YBUA 1D8CA 5IHRA 4XVDA 3O16A 4XAYA 1V79A 1WA3A 2OGYA 1JPMA 1XQKA 3V0SA 1GQNA 1F2JA 1G01A 3SCQA 3GC2A 5CBBA 1XRVA 3OHIA 3W1QA 2DJXA 2FDSA 2VKZG 4XZWA 4F8XA 5LIYX 3CLMA 3VO0A 3B04A 3TQ0A 5I5RA 4ZQNA 1SJDA 2F6UA 3W7OA 1W3TA 3DH7A 4XZMX 1GQIA 3PM6A 3RLGA 5F1UA 4KQNA 4MDPA 1F73A 2ZZ5A 4MWAE 1FWJC 5J04A 1A5OC 2GSJA 3N11A 1Q4NX 3WLQA 3W7KA 3QGAC 3F2BA 1FCBA 4H2HA 4CD5A 1EJTC 1M53A 3GIQA 3NZRA 1UP0A 4K6AA 4UFMA 3W1PA 2UY4A 4A3UA 1QAPA 1WE5A 2O56A 4RL3A 3BCDA 4RNJA 2NVAA 1DWHM 3KFTA 4I7VA 3WDJA 2DP3A 1VFUA 3WNPA 4AQLA 2ZQ0A 4FR1A 1TJ0A 4PMXA 4WQ6A 3EMCA 5EMUA 1K8XA 3OIXA 1HT6A 4GACA 3IJLA 4N6EA 1LZOA 1J0HA 1F05A 1PEZA 1VRDA 7A3HA 3UW6A 1ZJIA 3WJWA 2PP1A 5FF2A 4ZXOA 4GD0A 2CFFA 5D04C 5AZ1A 5D9PA 3PAOA 2VT0A 3GKFA 1WOAA 4MWAB 3VDGA 3W9ZA 4PTMA 1IT7A 1E70M 3B9OA 4NHVA 4ZB0A 3EWDA 3F5LA 2VFIA 2REQA 1KW1A 2RDWA 1MMFA 3MZ2A 1EO7A 2XGBA 1WPCA 1R30A 3K8LA 3N3MA 1AD4A 3CHEA 3UNTA 1IZKA 2WJDA 3EB4A 1C8VA 3PULA 3TJXA 2QUMA 1PVNA 1XGEA 1JQXA 2QPXA 2YW4A 2VXNA 1TZZA 4U2ZA 1OC7A 1TIMA 2XSBA 4E3VA 2WMHA 3PBMA 3D47A 5HBFA 1BPLB 3WLRA 1Y0EA 1B3WA 4MZ8A 3QQ1A 4Q4SA 5GVJA 4ATDA 1LQ2A 4EOUA 2W4XA 4MZYA 1AG1O 2ONEA 3CPGA 4AEEA 1V51A 1RP8A 3BC9A 3R1ZA 2HE8A 3DHDA 2VMFA 3IRSA 2H3BA 3AYVA 1HN1A 3PTMA 1DBTA 3W7MA 5I77A 1OM0A 2BVDA 3RYSA 1D2KA 4WDXA 2DGAA 2BG5A 2J79A 3GSMA 1CXHA 4C7FA 2YZRA 3MBDA 4G9PA 2OVLA 3KS5A 2WWDA 1RR2A 1OYBA 2A2IA 3AMGA 4ROQA 3PVFA 3KE0A 3LBCA 3VKBA 3O63A 3HGOA 4OUIA 5C54A 2PP3A 3B0XA 4WKAA 2QCGA 4GXPA 2FTWA 1XIEA 2GUYA 1U1HA 3T78A 1CECA 3G1YA 2R82A 3OVPA 4IXXA 2DIJA 4GQRA 3D46A 3W2LA 2VZOA 3USBA 2V5DA 2VR5A 4S3KA 2ZKMX 4F0RA 3RLUA 1GKQA 3W7GA 1Z41A 2PSNA 3VD7A 4CUCA 4AZCB 3UYCA 2X7VA 2QV5A 4CKQA 1A50A 3AQUA 1QOQA 4NRSA 1Z7AA 4TX8A 3WBYA 5DMLA 1NTHA 3WLPA 3CPRA 3UY7A 1HGWA 3BLDA 3WY1A 3TDFA 1WXJA 1DJYA 2C14A 5K4XA 2VENA 1PAMA 2HVOA 4IGHA 4J7RA 2A3BA 1TJ2A 1X8FA 3UETA 1FBAA 3WJZA 3LCXA 2NQZA 4IFRA 4OBSA 4DO6A 3WENA 4HPNA 3UD6A 2GFTA 3AXKA 3WQPA 5CC5A 2IQDA 5A6BD 4FLRA 3QV6A 1ME9A 3M7WA 3L68A 4B91A 3P8JA 3W0KA 1QXLA 1ISVA 3W75A 1THFD 1AQFA 2H90A 3FYPA 5H91A 4R33A 3S4TA 3AXIA 2PTZA 4NI8A 3UERA 2E68A 1XYCA 3IUIA 1A5KC 3MSGA 5JMUA 3QQWA 3GY1A 3UWYA 5FKYA 1GVQA 2V9DA 3OZYA 2A21A 5B7YA 2X2GA 4H8UA 3SY5A 1E9ZB 2YXXA 4S3EA 5HQLA 3WQEA 3OLIA 1TVLA 4PE8A 3ANUA 3QZ6A 4UTLA 5EFFA 3WMLA 3ZR5A 1CTNA 4NF7A 1PKLA 1RQEA 3GDTA 3DFYA 1OF6A 2WLYA 3U4FA 1V02E 1RY8A 4UCFA 4KERA 3EOOA 3AUOA 1DIDA 4GLEA 3A4JA 3FVMA 3GFXA 4IL0A 4IGSA 2WHJA 1LF1A 2WW5A 4UQDA 4AB4A 1GORA 2P3ZA 1Q8AA 4AY1A 1BQGA 4HT3A 1ZSXA 4EP8C 1ICPA 5FJPA 1VR6A 4Z08A 1QWGA 2WM1A 3A6OA 4FHAA 1EJXC 2VGIA 2W67A 4G6CA 5I03A 3H6OA 6TIMA 4ZSUA 4XKMA 5EMLA 3WG6A 3D0CA 3NZQA 1L6GA 4NILA 1Q85A 3NQDA 3CUIA 1YPFA 4G56A 4DWSC 1PIIA 2OEJA 3P84A 3TQPA 3F2CA 4XAPA 3ZQ9A 4GIAA 1C8QA 2NX9A 1PX3A 1XBYA 1G4EA 3OVGA 1EP2A 4DNMA 3RMEA 1HTIA 3IV3A 3EX6A 4EPBC 1AQ0A 4IQDA 4AD4A 1V3IA 1SVDA 3NPXA 2WSRA 4E0CA 1M01A 3DI1A 5G2IA 4MGGA 3QF0A 4HCDA 2FZNA 3EXSA 4HMEA 4DAIA 3AHVA 3L5MA 2HXTA 4LVGA 5DCBA 3HPSA 1WDQA 3NO3A 3PUOA 2HXUA 4LXFA 1XLCA 1CGTA 4X61A 1AVAA 3NNTA 3TN4A 3NDYA 1V5XA 3BG5A 4DZ5A 3MP3A 4TXEA 1H49A 3C0SA 5FJRA 4XZIA 2Z27A 2VFHA 3UJRA 2WCSA 3UR7A 3KTXA 1A4LA 1AL8A 3OQEA 2EG8A 3GYCA 2C7FA 4DHGA 4TVUA 1H7WA 2EPLX 1Q63A 2IQTA 1TRIA 3T55A 4AHQA 3A9IA 3SGUA 3V1HA 3K13A 4HP5A 4IF2A 3T7VA 4X63A 1DTNA 5BWFA 4JNMA 4MY8A 1QI5A 1I6NA 1KCXA 1BF6A 1REQA 4W84A 3HBLA 3O0KA 1V93A 4DJDD 1TV4A 3W86A 4L4MA 4U5KA 4IQJA 3PK7A 1X39A 4JTIA 4LS2A 2VL4A 4IFKB 1G69A 2PU1A 2LLEA 5HQMA 4UZSA 4UB9A 2J7GA 1CLVA 2V8ZA 2ZDRA 2CLLA 4DYKA 1QNPA 2EGZA 4XSLA 2BMBA 1E4NA 2GOUA 4NSBA 1GYLA 1CLKA 3EA1A 4DJEC 1ZB5A 5LYRA 4YTSA 1VGAA 4O13A 4Q4KA 4DF1A 4O50A 4UC5A 3VK5A 1YBQB 1QW7A 2DZUA 1LL6A 3L23A 4R5EA 3HPAA 2EBNA 2FH8A 4EPEC 2QUTA 4X2PA 1I75A 4JTTA 2E1DA 5ENLA 3LD5A 1Z9AA 4Y9OA 5E70A 1HVQA 3REQA 2WSQA 1VAHA 4LH8A 3UGVA 1YNPA 4GGBA 1U5HA 3OGRA 5ABEA 1DJHA 4GY7A 4E2DA 4ZGYA 2C79A 4JY8A 3AIQA 5DT5A 1E0TA 1HZYA 1XICA 4WX2A 1H51A 3HB9A 2WWCA 3VFLA 4CGTA 3UZYA 4LOCA 2C1HA 3CYJA 5I0DA 3WDIA 3EMZA 1JFHA 4S3BA 5TF0A 4L6DA 1KM4A 4XKYA 2E5BA 1UR9A 3QHNA 1B0IA 3W1UA 2ZBTA 1SZFA 4B9ZA 3W73A 1UC4A 1NSJA 4MKVA 2ZDSA 2ZICA 2JE8A 3QKZA 1YXCA 3G3DA 2DT1A 1HKIA 5FJOA 1ZNNA