2CZKA

Crystal structure of human myo-inositol monophosphatase 2 (impa2) (trigonal form)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
269
structure length
253
Chain Sequence
PWEECFQAAVQLALRAGQIIRKALTEEDLVTETDHLVEDLIISELRERFPSHRFIAEAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human myo-inositol monophosphatase 2, the product of the putative susceptibility gene for bipolar disorder, schizophrenia, and febrile seizures
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Inositol monophosphatase 2
total genus 69
structure length 253
sequence length 269
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2czkA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2czkA02
4HE0A 4HE1A 2HHMA 4GBVA 4HXVA 1NV7A 1AWBA 3KBZA 2FIEA 5EYGA 1FRPA 1LBZA 3A29A 4GX4A 1FBEA 4N81A 1IMCA 1FJ9A 1YYZA 4I3EA 1FPKA 1LEVA 2WBDA 2OWZA 1FBDA 1NUYA 1INPA 2BJIA 2Y5LA 4IR8A 1KZ8A 1FSAA 2VT5A 5ET5A 5DW8A 2PCRA 5IZ3B 1FBPA 4HE2A 1FBFA 1NUXA 1RDXA 2OX3A 3IFCA 1NV6A 5ET6A 3LUZA 4I3YA 1FPDA 4GWUA 4AS4A 2QVRA 2FIXA 5EQ7A 4H45A 4GBWA 2CZIA 3RPLA 1FPBA 4GWWA 4O7IA 2Q74A 1VDWA 1LBVA 1KA0A 1EYKA 4FBPA 1FTAA 4GX3A 2Q8MA 1IMAA 1YXIA 2P3NA 2F3DA 4GX6A 1NUZA 1XI6A 3D1RA 4MJOA 2CZHA 1JP4A 1K9ZA 1KA1A 1FBCA 5A5LA 1FPIA 4QXDA 1LBWA 3IFAA 1FBGA 4PTKA 2CZKA 1Q9DA 3T0JA 3RYDA 5IZ3A 3BIHA 1FJ6A 1RDYA 2QVVA 1DBZA 1DCUA 4GWZA 2GQ1A 1CNQA 5EQAA 1EYIA 1NV3A 1LBXA 1IMFA 1NI9A 1FPGA 1NV0A 5EYHA 1NV2A 3B8BA 3LV0A 1D9QA 1FPEA 5T3JA 5IZ1A 1RDZA 1LBYA 5I3SA 1NV5A 2DDKA 3KC1A 3FBPA 5FBPA 1QGXA 4I40A 1K9YA 1FBHA 4KXPA 1NUWA 2QFLA 2WEFA 1G0IA 2QVUA 2FBPA 4G61A 4GWSA 1FPLA 1BK4A 2F3BA 3BIGA 1SPIA 4GWYA 1DK4A 2FVZA 5EQ8A 3RPLB 2Y5KA 5ESYA 1FPJA 1G0HA 5ET8A 3ROJA 1IMDA 2R8TA 5LDZA 2FHYA 3QMFA 4GWXA 4AS5A 5J16A 1EYJA 5EQ9A 1NV4A 2P3VA 1IMBA 2JJKA 5ET7A 5F24A 2WBBA 1FPFA 4H46A 1NV1A 1IMEA 1YZ0A 3KC0A
chains in the Genus database with same CATH superfamily
4HE1A 2VD2A 1MQIA 4OZ9A 3A09A 5EYGA 4P8BA 4FORA 4F39A 3FVNA 3QAXA 1SYIA 4ISUA 4OANA 2CMOA 1LB9A 2V84A 3IFCA 2F35A 2UVJA 1LCFA 3OXNA 4OQOA 3PPNA 4AS4A 2PMSA 3K1PA 4MLVA 3LUYA 4HCWA 3RNNA 4OETA 2QMXA 1A54A 1LLSA 4X48A 1GR2A 1IMAA 2HZLA 4Q8RA 5JK4A 4IY6A 4KCCA 4R75A 2ANJA 4RNSA 3OSQA 1KA1A 4RYAA 1J1NA 4PGNA 4H8IA 4QXDA 3ODBA 4HW8A 5F1QA 3E78A 2KQZA 3HSTA 1I69A 1FJ6A 4UABA 5B70A 1OLAA 5ITPA 1ZBMA 4JSOA 4ZEKA 4FEBA 3SEYA 1B3LA 1NV5A 1ZJLA 2RCAA 3S9MC 1LCTA 3K6UA 3VXBA 3M3KA 4OVRA 5CBRA 1UTBB 3RPLB 4RXLA 2X26A 4JBZA 3CR9A 5I56B 3OD7A 3H6VA 1QKAA 3QIMA 3N6TA 1B3HA 3T66A 4H46A 4NWDA 3IX1A 4PCDA 3C4MA 4KPTA 1R1NA 1I6AA 3QYTA 5L9SA 4I3EA 2XD2A 4Z0IA 4QFOA 3EF7A 4OVTA 1BP5A 1MXWA 4ELQA 3K4UA 5I2NA 1RDXA 5H8NA 4EQ9A 1LFGA 5KDTA 1P1UA 3TTMA 3CVGA 3O6IA 2P0SA 4TQUQ 1DOTA 3MSTA 4NQ8A 3U72A 5TPAB 1US4A 3ZKLA 3MW0A 1Y3QA 4I9DA 5FHMA 2XWKA 1RYXA 3IFAA 3RYDA 5IAIA 1AOVA 3HO7A 1FPGA 4G2ZA 3EPEA 4NG7A 3KN7A 5I57A 2FNCA 5CM6A 3FATA 3M3LA 5DTBA 2ABHA 4E0WA 3K1NA 5I57B 1B1XA 1AMFA 2QVUA 5CRYA 4HCYA 4GWSA 3S4UA 1DK4A 4KHZE 3MC2A 4LVQA 1SVXB 4OYVA 1FTKA 1TFAA 5ICQA 2I6EA 4QSEA 2DWAA 1NV1A 3DELB 3AXFA 1USYE 3HV1A 2GHBA 3KBZA 1FPKA 3TELA 2IEEA 5TU0A 4EQBA 2Y84A 3MPKA 2ZNTA 5HBCA 3E3KA 2V93A 1M5FA 4QRZA 3PTYA 3KJ7A 4DIGA 3O9PA 1D9VA 4OERA 4IO2A 2HZKA 4PF8A 3L6GA 2XXUA 1VR5A 3JZJA 3MBPA 3PUWE 2DSFA 2YJPA 3RPLA 3KN3A 5DYHA 1EH3A 1FQCA 5I84A 2ZNUA 3G7WA 4DE8A 4JWYA 4R6YA 3DM0A 4F19A 4MJOA 3TUSA 1JP4A 5KDTB 3BKIB 5AE4A 1N84A 4PETA 1YCJA 4H0WA 1FBGA 1MQHA 1S7YA 3VFJA 3T0JA 4NEDA 3FVGA 2Q89A 4R73A 1NV2A 3LV0A 2CZLA 4O7MA 1I6BA 2THIA 1O64A 3G3IA 4PGPA 4XKPA 1B05A 4F1YA 3EQ1A 4N6DA 4P1LA 2WYKA 1Z7ME 2O69A 2REGA 1A8EA 1LAFE 3SDFA 1IEJA 3PUYE 3QMFA 2XX9A 3LR1A 1HSJA 1NV4A 2P3VA 4PQJA 5I58A 4OWDA 3VDFA 4PE5B 3O2AA 5H8SA 3H03A 1H45A 1B3GA 4PAKA 4I1DA 4X1DA 1MM6A 4AB6A 4X8RA 2QMWA 2HCAA 4H6DA 4FJPA 5ET6A 2O1MA 3T9HB 4ONYA 4PFWA 4G68C 2CZIA 4RPNA 4OVQA 2G29A 3TTKA 4U23A 2Q74A 3UN6A 3OELA 4G68A 4MIJA 3S9NC 1KA0A 2F36A 4FBPA 1LGBC 3B6TA 4FECA 1QUKA 2P1SA 2H25A 3TTLA 2DXRA 1NFTA 2DWHA 3MP1A 5H8FB 5DVJA 4GFRA 1QW0A 2O68A 3IORA 3JYRA 3O6HA 2YPNA 1VFDA 1MXXA 3FGSA 2QPQA 1LBXA 1IMFA 1NV0A 3SEVA 4MNPA 1MH4A 4GQOA 3I3VA 1Y4TA 1DSNA 4LZ7A 5L9OA 4I40A 1FBHA 2WEFA 2H9BA 5I2KA 3FIRA 4F3BA 4KD5A 1B51A 2Y5KA 2H98A 4Z7EA 2RF1A 1Y20A 3IJXB 4P0IA 4P0GA 1IQ7A 1RYOA 1DTZA 5EQ9A 3IL1B 1FPFA 2V3UA 4DXBA 4H1XA 3M3FA 4KYSA 3LC8A 3A29A 5DVIA 3B7DA 4N81A 4F29A 4R2FA 4EXLA 3TDJA 3E79A 2BJIA 4O3BA 1IXHA 1FQEA 5TPAA 1B4HA 3RN8A 4MH5A 4P11A 2R6GE 2OK2A 2GHAA 2XXKA 4JDFA 3KEIA 3MZ9A 4O8MA 1Z7NE 4MNCA 2QVRA 2DP8A 4GBWA 1JW1A 4F22A 4PE3A 5H8QB 4O7IA 3QSLA 1VSOA 1UIUA 2F7BA 4PFYA 4F3GA 1H43A 1VDWA 3K02A 5ISUA 5B7DA 3MVWA 2QS3A 1YXIA 3MVXA 2F8DA 3LBSA 2RKMA 3C33A 1JETA 4N17A 3M8UA 4YAHX 3PPOA 1PEBA 1LBWA 2Q9TA 5H8HA 2QS1A 2XA5A 2PFYA 2Q2CA 4DLDA 3KGCA 5KZTA 5EQAA 4MMPA 5AA2A 5LOMA 4NF8A 3B8BA 1BLFA 2ZNSA 3PMXA 3H6WA 3TCFA 5IKBA 1HSLA 2X7PA 1TXFA 2GFEA 3GXAA 2RINA 1B3EA 3IB0A 5TP9B 4QFLA 1N3XA 3GYYA 4GWYA 2FYIA 5FHOA 1EZ9A 4OENA 3ROJA 5CMKA 4MF3A 4GWXA 3TODA 5J16A 3IOWA 4MX6A 3CFXA 3Q25A 4BDMA 3PD9A 4QHQA 5F24A 2VP1A 4TLLB 3HFUA 4RPOA 3G3KA 4IO7A 4PFIA 5IM2A 5H8NB 2VGQA 3C31A 3FZVA 1MG1A 3MP6A 3TZAA 4NAPA 1O7TA 1B7HA 3VE1B 1POTA 3K6VA 2ZYNA 3DLNA 4G77A 4NTLA 3PUVE 2OX3A 4LN5A 4AQ4A 1P99A 4NN3A 1LAXA 4XIGQ 1NL5A 2UYEA 4LATA 2KR0A 5L9MA 2B65A 1XS5A 3U8QA 1H3DA 1S9TA 3KOTA 1NNPA 2QS4A 3MVZA 1IXIA 4ELPA 1B4ZA 1XHYA 4R2BA 3MAMA 3DP6A 4QFKA 2Q2AA 5I56A 3O29A 1PBPA 4PTKA 1MY2A 4LZ5A 1NI9A 3G3HA 5DEXB 4EF1A 2I48A 1FTOA 2Z8FA 3RT6B 4U4XA 1WDNA 3FXRA 4GL0A 4E0XA 4C0RA 4F1UA 3O6GA 1B32A 1N7WA 4Q30B 1N3WA 4ESXA 3U1OA 1B5IA 2WKYA 4LP2B 2FHYA 1DPPA 2F6GA 1CE2A 2WBBA 4LQ2A 1MQJA 1Y3PA 1YZ0A 4YU0A 4GVOA 4G8NA 1D9YA 4OVJA 4QSCA 4PAIA 1PDAA 1FTJA 1FBDA 1B5JA 4GXSB 4PC9A 5AA2D 2ZZXA 2Z8EA 5FTIA 2PCRA 3FUZA 1FBPA 3VVDA 3G3JA 1PBQA 1B0HA 1URDA 1N04A 4YB5A 2FIXA 4PBHA 4OFJA 1PC3A 2XXIA 3CI8A 3TKDA 1USYH 4IO3A 3B50A 3FV2A 5L8DA 2F6PA 2Q8MA 3EHTA 2HAUA 4NF4B 2XD3A 3D1RA 4WKMA 3MP8A 5A5LA 2ZYMA 3D4CA 3IAZA 1XOCA 4YKJA 4GWZA 3BBRA 1P1WA 1FTLA 3OSRA 2I4BA 2XXWA 3W15C 5CI5A 3FBPA 1QGXA 2QJEA 3IOTA 4KYEA 2QFLA 3KZGA 4BDLA 4ZS9A 2XXVA 2Y7KA 1TT1A 3V83A 3IOVA 2OPDA 1QVSA 3ONMA 2PX1A 4GD5A 1ZKBA 5HM4B 4JWXA 4YB6A 3CSGA 3OEMA 4MBPA 1SYHA 2HHMA 1WVJA 3ZS6A 4KI0E 2FIEA 1LBZA 1FBEA 2Y7WA 1N7XA 2GH9A 1OIBA 2OWZA 3RPWA 1JVYA 4GIZA 5A5XB 3NOHA 5DW8A 2M8CA 3R7XA 4JVCA 2F7AA 2PFZA 4ESWA 2ONKE 1LBCA 1FBFA 3LSXA 4IY5A 3SKPA 4Q0CA 3IB1A 4GWUA 5FHNA 4H65A 2XXRA 2XWOA 4H45A 4N8GA 1SW5A 4PDDA 3Q27A 3IK6B 4WEDA 3T96B 3FXQA 3VXCA 1DMBA 1YPNA 2Y7PA 4NHBA 1UTHA 1MRPA 3CFZA 3E4RA 1SW1A 2DS9A 4I62A 1B40A 1NH8A 2GQ1A 1EYIA 4M4GA 3QUJA 2HPGA 1R6ZA 4LONB 2B3FA 3R6UA 3CSBA 2H5YA 4R74A 3KC1A 2R71A 3OENA 2XXPA 2A5TA 3USDA 4PFTA 5H8QA 3GLBA 5A5XA 1NNFA 1G0HA 5JTYA 4JXIA 2HXRA 4NF8B 1EYJA 5K2XA 2OCUA 4H5GA 5K2YA 5BWJA 2OWTA 3VLUA 5AA3A 4WXJA 4C1UA 5F7VA 4GBVA 1Q35A 5H8FA 3K6WA 4BDNA 2RCBA 3V89B 1IMCA 4OA4A 4N15A 4WEPA 3U65A 1KZ8A 2VT5A 4FE8A 1FCKA 1FQBA 4JVIA 2OPEA 5ICTA 2F34A 3V5AA 2F5XA 1TFDA 4YB7A 4HS7A 2ZYKA 4G4PA 3ZSFA 1NV6A 3SETA 3T93B 1US5A 5DT6A 2VHAA 4OEUA 1BTJA 4BDQA 4XXUA 1FPBA 4FAJA 3K00A 1M5BA 3E9XA 3MPLA 1QJMA 4DCYA 3KG2A 1LBVA 3TCHA 3KN8A 3B6QA 1UTBA 2O84X 1T0KA 2P3NA 2F3DA 3ILTB 4OHNA 4DZ1A 1II5A 3MZBA 4R6HA 4DI3D 5AA1A 4Q5TA 2HFBA 3PMWA 4ZEDA 1SBPA 1IUDA 1AIVA 3WAEA 1HSEA 4JWOA 1DBZA 4IGRA 4I8CA 2X7QA 2NUVA 3HN0A 1MS7A 4FATA 1MXZA 2QRYA 3E13X 2DYXA 5ELVA 3CG3A 1B9JA 1MY0A 3ILUB 5AA4A 2AYSA 2FBPA 1SPIA 3LSFB 5ITOA 5EHSA 2UVIA 3H3GA 1A7LA 1DPEA 2UXAA 1H76A 3H06B 2H4IA 5ET7A 1LBBA 2D3IA 2O7UA 3HPIA 3IO6A 4HE0A 2BJJX 4R9FA 1NV7A 3BFTA 4EXKA 1MY3A 3SERA 1LEVA 4QSDA 1NUYA 4F2QA 3MUQA 2AL5A 1ZMGA 2XXHA 3CRBA 5ET5A 5I59B 2V4CA 2E1SA 5IZ3B 4XKQA 4GLIA 2DXYA 3TCGA 1XT8A 3OO9A 3TPAA 5FTHA 4I3YA 1FPDA 5EQ7A 4OESA 4LZ8A 3VLWA 3GBAA 2REJA 2RC7A 3TEPA 4NGUA 3UP9A 1R9QA 1NUZA 1XI6A 5AA4B 2CZHA 2HEUA 4G68B 3KJTA 4DDDA 2OLBA 4FIMA 3KBRA 2V25A 1FPIA 4DCXA 2B4LA 5I58B 5IZ3A 4ELRA 1R9LA 1ZIUA 4GF8A 4THIA 1Y3NA 3SESA 5IZ1A 1LFIA 3A3CA 3T1BA 4N91A 3H6TA 4XEQA 1MQGA 1SI0A 5EYFA 4KXPA 1G0IA 3PMVA 1B7ZA 4X9TA 2XWIA 4MAGA 2FVZA 1AL3A 5ESYA 4OTEA 3EHUA 3IJOB 5BUUA 1IMDA 2UVGA 1Y4CA 5LDZA 2XHDA 4X04A 3UIFA 1EZPA 5I7IA 1B6HA 1IMEA 1QUIA 4XTCQ 3TTNA 2H99A 3VLVA 1FTMA 4YKIA 2DE3A 2W7YA 1D4NA 2WBDA 1INPA 1MXVA 3DP4A 1BIYA 3TMGA 5DEXA 1FQFA 1OQHA 1P1OA 1UTHB 4JVDA 2Z23A 3I5OA 1B0LA 4HE2A 4H5FA 3W9WA 3OEKA 2R9JA 3U94A 3VVEA 3PPQA 4EF2A 4PFRA 3VV5A 4ND9A 4G8HA 1FTAA 1SD3A 1EU8A 1YAEA 3CHGA 1JNFA 2A5TB 2DVCA 4EDPA 5KCJB 2VPOA 1A55A 3FVKA 2VD3A 4XKNA 1LAGE 2CZKA 1N0TA 1MDQA 1GGGA 4ECFA 3DP8A 4OEVA 1D9QA 4X1BA 4NWCA 5I3SA 1ATGA 1IZ1A 3MJNA 4IGTA 4KFQA 2XXQA 4BLAA 3TFLA 3I6VA 2DWJA 1SW4A 4BDOA 2I0BA 3T9UA 4YKKA 4P3LA 2PT2A 4F3SA 2ZXTA 3KC0A 5CMCA 4P56A 1NMUA 1SW2A 1OQGA 2F97A 4KQPA 4RK9A 3W9VA 4PAFA 3PD8A 1L5TA 4ZEFA 4ZE8A 4U22A 2Y5LA 4N4UA 3UGWA 1B2HA 4NF4A 2ZZWA 2I49A 4UA8A 1DTGA 3K6XA 4O3AA 3LSLA 4H67A 4U21A 1NH7A 2Q8JA 5JTYB 4PP0A 2I58A 2L5VA 1MPDA 4O3CA 1MY1A 4ZECA 5TP9A 4XF5A 3MQ9A 3SEWA 3CG1A 3RGYA 2GRVA 4IO4A 3EN3A 1MXUA 4U1ZA 2DVZA 4P1EA 4JB7A 1RDYA 3RTFB 4RA1A 2XXTA 4DXCA 1VE4A 1Y9UA 4NF6A 5HPQA 2DDKA 3TQWA 1SDXA 4KR5A 1POY1 3MZ1A 4QFPA 3RTWB 1S50A 1PB7A 3IOUA 3PUZE 1JEVA 1FPLA 1BK4A 2F3BA 1QKBA 3EKIA 3OO8A 4ZEIA 2NXOA 3N26A 1LFHA 1UQWA 4AS5A 5KCJA 4KCDA 1GVCA 3C36A 1LSTA 5I2KB 4RK2A 2ONRA 1B1HA 4MLQA 1D3KA 3S2VA 1B58A 1ZLQA 4YMBA 4GX4A 1EZOA 2OBGA 1FJ9A 4FEDA 1FQDA 3KOSA 4NMYA 1FSAA 2DE4A 3D4GA 4R9GA 1Y1MA 1OVBA 1F9BA 5IZZA 2PBWA 4MEVA 1RKMA 3UK4A 5CMBA 3WAFA 2XXYA 3FXBA 1MDP1 3UORA 1EYKA 2O7IA 4H8JA 5J1DA 5CBSA 3KFMA 4N6PA 1MH3A 1JW4A 3TYHA 4PFUA 2MKZA 3SEXA 2D5WA 4OFOA 4QF9A 2PT1A 2AIXA 2DOJA 2I0CA 1NV3A 4JSDA 3RT8A 1ZTYA 1Q1KA 5EYHA 5T3JA 1FPEA 1OMPA 2KLFA 3BFUA 4KYDA 4GOTA 1GTKA 3T9VA 2Y7IA 1UIVA 1NNKA 4POWA 2WYPA 3T9XB 3TQLA 3U93A 4M1VA 3S9EA 1K9YA 1NUWA 4P47A 5CC2A 3SZPA 1M5CA 1MPCA 4K3FA 1MXYA 4IO6A 3T22A 2RC8A 1PB8A 4GXAA 3RY3A 4OMBA 3K0VA 3F11A 3MVYA 2R8TA 3O97A 2FA7A 3C35A 3Q26A 3OOAA 3CIJA 3H4ZA 1IXGA 4F3PA 3FVOA 4YMAA 2UVHA 1QULA 1URSA 3HHFA 1YYZA 3HCQA 2ESNA 2XWVA 1MPBA 3IB2A 3O28A 4IR8A 4QBAA 1ZU0A 2I4CA 3FXUA 4ELOA 1NUXA 2F7CA 3G3FA 2YLNA 2ALUA 2O1LA 2Z8DA 2NOOA 4UACA 1M5DA 2VPNA 2ZYOA 4NF0A 1B3FA 4GX6A 4DXUA 5EHMA 4ZDMA 2XXXA 3U92A 1LAHE 2Y7RA 2NWJA 4PFBA 4NF5B 1Q9DA 1P1NA 4N6KA 3BIHA 3Q28A 3PPRA 3Q29A 3FD3A 1IITA 4MFIA 4RJZA 1GV8A 1RDZA 1LBYA 2AL4A 3N94A 3S9LC 2G93A 3G3GA 1LB8A 1VFEA 4AB5A 5DVFA 3K1MA 1NKXA 2HQ0A 3QXMA 3V8XB 3FV1A 2O6AA 1H44A 4PBQA 2PVUA 3K2DA 3ISPA 2CEYA 5I2NB 4LQ5A 4MHFA 4NF5A 4C1TA 4U2RA 4GWOA 4L17A 3GZGA 2E0SA 3OO6A 1AWBA 3FJMA 4RY1A 1FRPA 5LTCA 5JEIA 1IIWA 2QSXA 4ZEBA 3FASA 2UYFA 4TLMB 2Q88A 1MY4A 5I5PA 1FW0A 3PGFA 4F2OA 1URGA 1A40A 1QUJA 3LUZA 4N07A 3C9HA 1JW5A 3PV0E 4ZE9A 2V3TA 4GWWA 1XVXA 3IO4A 2NVUB 3QUFA 2XX8A 2ZMBA 3OO7A 2I3WA 3L6HA 1WODA 4GX3A 3HHGA 1KWHA 2CEXA 4GL8A 1OVTA 3C34A 4LUBA 3MWBA 1B52A 4P9KA 5AA2B 1YTVA 2F78A 4R72A 4NX1A 2IA4A 4F18A 3IR1A 4OXVA 1DCUA 4QFNA 3RQTA 4IB2A 1I6QA 4G8MA 4PF6A 3N5LA 3R26A 2DQVA 4NF6B 3H7MA 4R6KA 1SI1A 5CMMA 2DE2A 4G61A 4YICA 4IO5A 3BIGA 3O66A 2ONSA 5EQ8A 4OVSA 1FPJA 5ET8A 2DWIA 3A3UA 2B4MA 1XC1A 4F1VA 4YZZA 3GBBA 4MNIA 4OVPA 2OWSA 2QS2A 2HXWA 2D21A 4EUOA 1M5EA 2QL3A 3ECRA 1ELJA 3KSXA 1SQYA 4HXVA 3JV9A 2B3BA 3C32A 1P1QA 3RUMA 3MYUA 4XFEA 2PYYA 3RLFE 1N76A 1IXCA 4EQ7A 3ZKKA 4XKRA 4MCOA 3FJ7A 1NNTA 1PB9A 3QK6A 1BKAA 5M2VA 5H8HB 4YKPA 1XVYA 2Z22A 4U4SA 4F31B 4HTGA 2I3VA 2OJTA 1B7UA 4ZZAA 1AH5A 1CB6A 4LA9A 2LAOA 4BDRA 2WX9A 3THIA 3H6UA 1JVXA 3B6WA 2RC9A 4NE4A 5IGAA 1MQDA 3VVFA 2O51A 1B46A 1K9ZA 1FBCA 1JQFA 1MM7A 1FQAA 3KSJA 3CFLA 2QVVA 1A99A 1CNQA 4ZZEA 3EHSA 4GRKA 4O94A 3SEUA 3TTRA 1ANFA 1O63A 4POXA 3K01A 2XX7A 1TWYA 1OLCA 3LSWA 3PPPA 5I59A 1A8FA 5FBPA 3UA8A 4N8YA 1Y1ZA 4TOZA 2VOZA 2HAVA 2ZZVA 3TAJA 4OFLA 2V3QA 1B5HA 2P2AA 3P7IA 3N6UA 4U1OA 4PDHA 4N13A 4DI4B 3FJGA 3PUXE 1IMBA 2OZZA 2JJKA 3OMBA 2A5SA 3PU5A 1JEUA
chains in the Genus database with same CATH topology
4DI4B 4HE0A 4PCDA 4HE1A 2HHMA 4GBVA 4HXVA 4P56A 1NV7A 1AWBA 3KBZA 2FIEA 5EYGA 1FRPA 1LBZA 3A29A 4GX4A 4P8BA 1FBEA 5LTCA 4N81A 1IMCA 1FJ9A 1YYZA 2DE3A 3W9VA 4PAKA 4I3EA 4PAIA 1FPKA 1LEVA 4PAFA 2WBDA 2OWZA 2XWVA 1FBDA 1NUYA 1INPA 3MYUA 4NAPA 3E79A 4OA4A 2BJIA 4N15A 4XFEA 4PC9A 2Y5LA 4IR8A 1KZ8A 4N4UA 4OANA 4QBAA 1FSAA 3U65A 2VT5A 5ET5A 2ZZXA 3GYYA 3NOHA 4MCOA 2ZZWA 2DE4A 5DW8A 4OVTA 4JVDA 4X8RA 2V4CA 4JVIA 5I5PA 4JVCA 3PTYA 2PFZA 2PCRA 5IZ3B 1FBPA 4HE2A 1FBFA 2F5XA 3W9WA 1NUXA 1RDXA 2OX3A 3IFCA 4LN5A 5IZZA 2XXKA 4MEVA 2HZKA 4PF8A 1NV6A 5ET6A 4NN3A 4O8MA 3LUZA 4MNCA 4I3YA 1FPDA 4GWUA 4AS4A 2QVRA 2FIXA 4PBHA 2XWOA 5EQ7A 4H45A 4GBWA 2KR0A 2L5VA 2CZIA 3RPLA 4HCWA 4PE3A 4OVQA 4N8GA 1FPBA 4GWWA 4O7IA 3B50A 4PDDA 2WX9A 4PFRA 2Q74A 3MSTA 4XF5A 4NQ8A 4MIJA 1VDWA 3FXBA 1LBVA 1KA0A 1EYKA 4FBPA 5J1DA 1FTAA 4GX3A 2Q8MA 5IGAA 4NGUA 3CHGA 1IMAA 2CEXA 1YXIA 2P3NA 2HZLA 2VPNA 4NHBA 4NF0A 5JK4A 2F3DA 4GX6A 1NUZA 1XI6A 3D1RA 4F19A 4MJOA 2CZHA 1JP4A 1K9ZA 4N17A 2VPOA 1KA1A 1FBCA 5A5LA 2DVZA 4PETA 4DI3D 2MKZA 4PGNA 1FPIA 2XWKA 4QXDA 4P9KA 1LBWA 2Q9TA 3IFAA 4NX1A 2B4LA 1FBGA 4PTKA 2KQZA 2CZKA 2PFYA 2XA5A 4PFBA 4P1EA 1Q9DA 3T0JA 3RYDA 5IZ3A 3BIHA 1FJ6A 4N6KA 4UABA 1RDYA 2QVVA 1DBZA 1DCUA 4GWZA 2GQ1A 1CNQA 5EQAA 2QPQA 1EYIA 1NV3A 4MMPA 1LBXA 1IMFA 1NI9A 1FPGA 1NV0A 5EYHA 2HPGA 4O94A 1NV2A 5IM2A 4NG7A 3B8BA 3LV0A 1D9QA 1FPEA 5T3JA 4MNPA 5IZ1A 1RDZA 1LBYA 5I3SA 4O7MA 3T1BA 1NV5A 5CM6A 4PF6A 4N91A 4F18A 4XEQA 4PGPA 2DDKA 3KC1A 2WYPA 3FBPA 5FBPA 1QGXA 4M1VA 4N8YA 4I40A 1K9YA 1FBHA 4KXPA 1NUWA 3E78A 2QFLA 2WEFA 1G0IA 4F1UA 2QVUA 4P47A 4X9TA 4OVRA 2DE2A 4HCYA 2FBPA 4G61A 4YICA 3SZPA 4GWSA 1FPLA 1BK4A 2F3BA 3BIGA 1SPIA 4GWYA 2XWIA 1DK4A 2ZZVA 2FVZA 4MAGA 4N6DA 3EKIA 5EQ8A 3RPLB 2Y5KA 5ESYA 4OVSA 1FPJA 2V3QA 4P1LA 2WYKA 1G0HA 5ET8A 3ROJA 1IMDA 2B4MA 2R8TA 4F1VA 4YZZA 4PBQA 5LDZA 4PDHA 4MNIA 2FHYA 3QMFA 4GWXA 4AS5A 5J16A 2HXRA 3ISPA 4OVPA 4X04A 1EYJA 5EQ9A 1NV4A 2CEYA 4MX6A 4P3LA 2P3VA 4MHFA 1IMBA 2JJKA 5ET7A 5F24A 2WBBA 1FPFA 5I7IA 4H46A 3HFUA 1NV1A 1IMEA 1YZ0A 4PFIA 3KC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HE0 A;  4HE1 A;  2HHM A;  4GBV A;  4HXV A;  1NV7 A;  1AWB A;  3KBZ A;  2FIE A;  5EYG A;  1FRP A;  1LBZ A;  3A29 A;  4GX4 A;  1FBE A;  4N81 A;  1IMC A;  1FJ9 A;  1YYZ A;  4I3E A;  1FPK A;  1LEV A;  2WBD A;  2OWZ A;  1FBD A;  1NUY A;  1INP A;  2BJI A;  2Y5L A;  4IR8 A;  1KZ8 A;  1FSA A;  2VT5 A;  5ET5 A;  5DW8 A;  2PCR A;  5IZ3 B;  1FBP A;  4HE2 A;  1FBF A;  1NUX A;  1RDX A;  2OX3 A;  3IFC A;  1NV6 A;  5ET6 A;  3LUZ A;  4I3Y A;  1FPD A;  4GWU A;  4AS4 A;  2QVR A;  2FIX A;  5EQ7 A;  4H45 A;  4GBW A;  2CZI A;  3RPL A;  1FPB A;  4GWW A;  4O7I A;  2Q74 A;  1VDW A;  1LBV A;  1KA0 A;  1EYK A;  4FBP A;  1FTA A;  4GX3 A;  2Q8M A;  1IMA A;  1YXI A;  2P3N A;  2F3D A;  4GX6 A;  1NUZ A;  1XI6 A;  3D1R A;  4MJO A;  2CZH A;  1JP4 A;  1K9Z A;  1KA1 A;  1FBC A;  5A5L A;  1FPI A;  4QXD A;  1LBW A;  3IFA A;  1FBG A;  4PTK A;  2CZK A;  1Q9D A;  3T0J A;  3RYD A;  5IZ3 A;  3BIH A;  1FJ6 A;  1RDY A;  2QVV A;  1DBZ A;  1DCU A;  4GWZ A;  2GQ1 A;  1CNQ A;  5EQA A;  1EYI A;  1NV3 A;  1LBX A;  1IMF A;  1NI9 A;  1FPG A;  1NV0 A;  5EYH A;  1NV2 A;  3B8B A;  3LV0 A;  1D9Q A;  1FPE A;  5T3J A;  5IZ1 A;  1RDZ A;  1LBY A;  5I3S A;  1NV5 A;  2DDK A;  3KC1 A;  3FBP A;  5FBP A;  1QGX A;  4I40 A;  1K9Y A;  1FBH A;  4KXP A;  1NUW A;  2QFL A;  2WEF A;  1G0I A;  2QVU A;  2FBP A;  4G61 A;  4GWS A;  1FPL A;  1BK4 A;  2F3B A;  3BIG A;  1SPI A;  4GWY A;  1DK4 A;  2FVZ A;  5EQ8 A;  3RPL B;  2Y5K A;  5ESY A;  1FPJ A;  1G0H A;  5ET8 A;  3ROJ A;  1IMD A;  2R8T A;  5LDZ A;  2FHY A;  3QMF A;  4GWX A;  4AS5 A;  5J16 A;  1EYJ A;  5EQ9 A;  1NV4 A;  2P3V A;  1IMB A;  2JJK A;  5ET7 A;  5F24 A;  2WBB A;  1FPF A;  4H46 A;  1NV1 A;  1IME A;  1YZ0 A;  3KC0 A; 
#chains in the Genus database with same CATH topology
 4HE1 A;  2VD2 A;  1MQI A;  4OZ9 A;  3A09 A;  5EYG A;  4P8B A;  4FOR A;  4F39 A;  3FVN A;  3QAX A;  1SYI A;  4ISU A;  4OAN A;  2CMO A;  1LB9 A;  2V84 A;  3IFC A;  2F35 A;  2UVJ A;  1LCF A;  3OXN A;  4OQO A;  3PPN A;  4AS4 A;  2PMS A;  3K1P A;  4MLV A;  3LUY A;  4HCW A;  3RNN A;  4OET A;  2QMX A;  1A54 A;  1LLS A;  4X48 A;  1GR2 A;  1IMA A;  2HZL A;  4Q8R A;  5JK4 A;  4IY6 A;  4KCC A;  4R75 A;  2ANJ A;  4RNS A;  3OSQ A;  1KA1 A;  4RYA A;  1J1N A;  4PGN A;  4H8I A;  4QXD A;  3ODB A;  4HW8 A;  5F1Q A;  3E78 A;  2KQZ A;  3HST A;  1I69 A;  1FJ6 A;  4UAB A;  5B70 A;  1OLA A;  5ITP A;  1ZBM A;  4JSO A;  4ZEK A;  4FEB A;  3SEY A;  1B3L A;  1NV5 A;  1ZJL A;  2RCA A;  3S9M C;  1LCT A;  3K6U A;  3VXB A;  3M3K A;  4OVR A;  5CBR A;  1UTB B;  3RPL B;  4RXL A;  2X26 A;  4JBZ A;  3CR9 A;  5I56 B;  3OD7 A;  3H6V A;  1QKA A;  3QIM A;  3N6T A;  1B3H A;  3T66 A;  4H46 A;  4NWD A;  3IX1 A;  4PCD A;  3C4M A;  4KPT A;  1R1N A;  1I6A A;  3QYT A;  5L9S A;  4I3E A;  2XD2 A;  4Z0I A;  4QFO A;  3EF7 A;  4OVT A;  1BP5 A;  1MXW A;  4ELQ A;  3K4U A;  5I2N A;  1RDX A;  5H8N A;  4EQ9 A;  1LFG A;  5KDT A;  1P1U A;  3TTM A;  3CVG A;  3O6I A;  2P0S A;  4TQU Q;  1DOT A;  3MST A;  4NQ8 A;  3U72 A;  5TPA B;  1US4 A;  3ZKL A;  3MW0 A;  1Y3Q A;  4I9D A;  5FHM A;  2XWK A;  1RYX A;  3IFA A;  3RYD A;  5IAI A;  1AOV A;  3HO7 A;  1FPG A;  4G2Z A;  3EPE A;  4NG7 A;  3KN7 A;  5I57 A;  2FNC A;  5CM6 A;  3FAT A;  3M3L A;  5DTB A;  2ABH A;  4E0W A;  3K1N A;  5I57 B;  1B1X A;  1AMF A;  2QVU A;  5CRY A;  4HCY A;  4GWS A;  3S4U A;  1DK4 A;  4KHZ E;  3MC2 A;  4LVQ A;  1SVX B;  4OYV A;  1FTK A;  1TFA A;  5ICQ A;  2I6E A;  4QSE A;  2DWA A;  1NV1 A;  3DEL B;  3AXF A;  1USY E;  3HV1 A;  2GHB A;  3KBZ A;  1FPK A;  3TEL A;  2IEE A;  5TU0 A;  4EQB A;  2Y84 A;  3MPK A;  2ZNT A;  5HBC A;  3E3K A;  2V93 A;  1M5F A;  4QRZ A;  3PTY A;  3KJ7 A;  4DIG A;  3O9P A;  1D9V A;  4OER A;  4IO2 A;  2HZK A;  4PF8 A;  3L6G A;  2XXU A;  1VR5 A;  3JZJ A;  3MBP A;  3PUW E;  2DSF A;  2YJP A;  3RPL A;  3KN3 A;  5DYH A;  1EH3 A;  1FQC A;  5I84 A;  2ZNU A;  3G7W A;  4DE8 A;  4JWY A;  4R6Y A;  3DM0 A;  4F19 A;  4MJO A;  3TUS A;  1JP4 A;  5KDT B;  3BKI B;  5AE4 A;  1N84 A;  4PET A;  1YCJ A;  4H0W A;  1FBG A;  1MQH A;  1S7Y A;  3VFJ A;  3T0J A;  4NED A;  3FVG A;  2Q89 A;  4R73 A;  1NV2 A;  3LV0 A;  2CZL A;  4O7M A;  1I6B A;  2THI A;  1O64 A;  3G3I A;  4PGP A;  4XKP A;  1B05 A;  4F1Y A;  3EQ1 A;  4N6D A;  4P1L A;  2WYK A;  1Z7M E;  2O69 A;  2REG A;  1A8E A;  1LAF E;  3SDF A;  1IEJ A;  3PUY E;  3QMF A;  2XX9 A;  3LR1 A;  1HSJ A;  1NV4 A;  2P3V A;  4PQJ A;  5I58 A;  4OWD A;  3VDF A;  4PE5 B;  3O2A A;  5H8S A;  3H03 A;  1H45 A;  1B3G A;  4PAK A;  4I1D A;  4X1D A;  1MM6 A;  4AB6 A;  4X8R A;  2QMW A;  2HCA A;  4H6D A;  4FJP A;  5ET6 A;  2O1M A;  3T9H B;  4ONY A;  4PFW A;  4G68 C;  2CZI A;  4RPN A;  4OVQ A;  2G29 A;  3TTK A;  4U23 A;  2Q74 A;  3UN6 A;  3OEL A;  4G68 A;  4MIJ A;  3S9N C;  1KA0 A;  2F36 A;  4FBP A;  1LGB C;  3B6T A;  4FEC A;  1QUK A;  2P1S A;  2H25 A;  3TTL A;  2DXR A;  1NFT A;  2DWH A;  3MP1 A;  5H8F B;  5DVJ A;  4GFR A;  1QW0 A;  2O68 A;  3IOR A;  3JYR A;  3O6H A;  2YPN A;  1VFD A;  1MXX A;  3FGS A;  2QPQ A;  1LBX A;  1IMF A;  1NV0 A;  3SEV A;  4MNP A;  1MH4 A;  4GQO A;  3I3V A;  1Y4T A;  1DSN A;  4LZ7 A;  5L9O A;  4I40 A;  1FBH A;  2WEF A;  2H9B A;  5I2K A;  3FIR A;  4F3B A;  4KD5 A;  1B51 A;  2Y5K A;  2H98 A;  4Z7E A;  2RF1 A;  1Y20 A;  3IJX B;  4P0I A;  4P0G A;  1IQ7 A;  1RYO A;  1DTZ A;  5EQ9 A;  3IL1 B;  1FPF A;  2V3U A;  4DXB A;  4H1X A;  3M3F A;  4KYS A;  3LC8 A;  3A29 A;  5DVI A;  3B7D A;  4N81 A;  4F29 A;  4R2F A;  4EXL A;  3TDJ A;  3E79 A;  2BJI A;  4O3B A;  1IXH A;  1FQE A;  5TPA A;  1B4H A;  3RN8 A;  4MH5 A;  4P11 A;  2R6G E;  2OK2 A;  2GHA A;  2XXK A;  4JDF A;  3KEI A;  3MZ9 A;  4O8M A;  1Z7N E;  4MNC A;  2QVR A;  2DP8 A;  4GBW A;  1JW1 A;  4F22 A;  4PE3 A;  5H8Q B;  4O7I A;  3QSL A;  1VSO A;  1UIU A;  2F7B A;  4PFY A;  4F3G A;  1H43 A;  1VDW A;  3K02 A;  5ISU A;  5B7D A;  3MVW A;  2QS3 A;  1YXI A;  3MVX A;  2F8D A;  3LBS A;  2RKM A;  3C33 A;  1JET A;  4N17 A;  3M8U A;  4YAH X;  3PPO A;  1PEB A;  1LBW A;  2Q9T A;  5H8H A;  2QS1 A;  2XA5 A;  2PFY A;  2Q2C A;  4DLD A;  3KGC A;  5KZT A;  5EQA A;  4MMP A;  5AA2 A;  5LOM A;  4NF8 A;  3B8B A;  1BLF A;  2ZNS A;  3PMX A;  3H6W A;  3TCF A;  5IKB A;  1HSL A;  2X7P A;  1TXF A;  2GFE A;  3GXA A;  2RIN A;  1B3E A;  3IB0 A;  5TP9 B;  4QFL A;  1N3X A;  3GYY A;  4GWY A;  2FYI A;  5FHO A;  1EZ9 A;  4OEN A;  3ROJ A;  5CMK A;  4MF3 A;  4GWX A;  3TOD A;  5J16 A;  3IOW A;  4MX6 A;  3CFX A;  3Q25 A;  4BDM A;  3PD9 A;  4QHQ A;  5F24 A;  2VP1 A;  4TLL B;  3HFU A;  4RPO A;  3G3K A;  4IO7 A;  4PFI A;  5IM2 A;  5H8N B;  2VGQ A;  3C31 A;  3FZV A;  1MG1 A;  3MP6 A;  3TZA A;  4NAP A;  1O7T A;  1B7H A;  3VE1 B;  1POT A;  3K6V A;  2ZYN A;  3DLN A;  4G77 A;  4NTL A;  3PUV E;  2OX3 A;  4LN5 A;  4AQ4 A;  1P99 A;  4NN3 A;  1LAX A;  4XIG Q;  1NL5 A;  2UYE A;  4LAT A;  2KR0 A;  5L9M A;  2B65 A;  1XS5 A;  3U8Q A;  1H3D A;  1S9T A;  3KOT A;  1NNP A;  2QS4 A;  3MVZ A;  1IXI A;  4ELP A;  1B4Z A;  1XHY A;  4R2B A;  3MAM A;  3DP6 A;  4QFK A;  2Q2A A;  5I56 A;  3O29 A;  1PBP A;  4PTK A;  1MY2 A;  4LZ5 A;  1NI9 A;  3G3H A;  5DEX B;  4EF1 A;  2I48 A;  1FTO A;  2Z8F A;  3RT6 B;  4U4X A;  1WDN A;  3FXR A;  4GL0 A;  4E0X A;  4C0R A;  4F1U A;  3O6G A;  1B32 A;  1N7W A;  4Q30 B;  1N3W A;  4ESX A;  3U1O A;  1B5I A;  2WKY A;  4LP2 B;  2FHY A;  1DPP A;  2F6G A;  1CE2 A;  2WBB A;  4LQ2 A;  1MQJ A;  1Y3P A;  1YZ0 A;  4YU0 A;  4GVO A;  4G8N A;  1D9Y A;  4OVJ A;  4QSC A;  4PAI A;  1PDA A;  1FTJ A;  1FBD A;  1B5J A;  4GXS B;  4PC9 A;  5AA2 D;  2ZZX A;  2Z8E A;  5FTI A;  2PCR A;  3FUZ A;  1FBP A;  3VVD A;  3G3J A;  1PBQ A;  1B0H A;  1URD A;  1N04 A;  4YB5 A;  2FIX A;  4PBH A;  4OFJ A;  1PC3 A;  2XXI A;  3CI8 A;  3TKD A;  1USY H;  4IO3 A;  3B50 A;  3FV2 A;  5L8D A;  2F6P A;  2Q8M A;  3EHT A;  2HAU A;  4NF4 B;  2XD3 A;  3D1R A;  4WKM A;  3MP8 A;  5A5L A;  2ZYM A;  3D4C A;  3IAZ A;  1XOC A;  4YKJ A;  4GWZ A;  3BBR A;  1P1W A;  1FTL A;  3OSR A;  2I4B A;  2XXW A;  3W15 C;  5CI5 A;  3FBP A;  1QGX A;  2QJE A;  3IOT A;  4KYE A;  2QFL A;  3KZG A;  4BDL A;  4ZS9 A;  2XXV A;  2Y7K A;  1TT1 A;  3V83 A;  3IOV A;  2OPD A;  1QVS A;  3ONM A;  2PX1 A;  4GD5 A;  1ZKB A;  5HM4 B;  4JWX A;  4YB6 A;  3CSG A;  3OEM A;  4MBP A;  1SYH A;  2HHM A;  1WVJ A;  3ZS6 A;  4KI0 E;  2FIE A;  1LBZ A;  1FBE A;  2Y7W A;  1N7X A;  2GH9 A;  1OIB A;  2OWZ A;  3RPW A;  1JVY A;  4GIZ A;  5A5X B;  3NOH A;  5DW8 A;  2M8C A;  3R7X A;  4JVC A;  2F7A A;  2PFZ A;  4ESW A;  2ONK E;  1LBC A;  1FBF A;  3LSX A;  4IY5 A;  3SKP A;  4Q0C A;  3IB1 A;  4GWU A;  5FHN A;  4H65 A;  2XXR A;  2XWO A;  4H45 A;  4N8G A;  1SW5 A;  4PDD A;  3Q27 A;  3IK6 B;  4WED A;  3T96 B;  3FXQ A;  3VXC A;  1DMB A;  1YPN A;  2Y7P A;  4NHB A;  1UTH A;  1MRP A;  3CFZ A;  3E4R A;  1SW1 A;  2DS9 A;  4I62 A;  1B40 A;  1NH8 A;  2GQ1 A;  1EYI A;  4M4G A;  3QUJ A;  2HPG A;  1R6Z A;  4LON B;  2B3F A;  3R6U A;  3CSB A;  2H5Y A;  4R74 A;  3KC1 A;  2R71 A;  3OEN A;  2XXP A;  2A5T A;  3USD A;  4PFT A;  5H8Q A;  3GLB A;  5A5X A;  1NNF A;  1G0H A;  5JTY A;  4JXI A;  2HXR A;  4NF8 B;  1EYJ A;  5K2X A;  2OCU A;  4H5G A;  5K2Y A;  5BWJ A;  2OWT A;  3VLU A;  5AA3 A;  4WXJ A;  4C1U A;  5F7V A;  4GBV A;  1Q35 A;  5H8F A;  3K6W A;  4BDN A;  2RCB A;  3V89 B;  1IMC A;  4OA4 A;  4N15 A;  4WEP A;  3U65 A;  1KZ8 A;  2VT5 A;  4FE8 A;  1FCK A;  1FQB A;  4JVI A;  2OPE A;  5ICT A;  2F34 A;  3V5A A;  2F5X A;  1TFD A;  4YB7 A;  4HS7 A;  2ZYK A;  4G4P A;  3ZSF A;  1NV6 A;  3SET A;  3T93 B;  1US5 A;  5DT6 A;  2VHA A;  4OEU A;  1BTJ A;  4BDQ A;  4XXU A;  1FPB A;  4FAJ A;  3K00 A;  1M5B A;  3E9X A;  3MPL A;  1QJM A;  4DCY A;  3KG2 A;  1LBV A;  3TCH A;  3KN8 A;  3B6Q A;  1UTB A;  2O84 X;  1T0K A;  2P3N A;  2F3D A;  3ILT B;  4OHN A;  4DZ1 A;  1II5 A;  3MZB A;  4R6H A;  4DI3 D;  5AA1 A;  4Q5T A;  2HFB A;  3PMW A;  4ZED A;  1SBP A;  1IUD A;  1AIV A;  3WAE A;  1HSE A;  4JWO A;  1DBZ A;  4IGR A;  4I8C A;  2X7Q A;  2NUV A;  3HN0 A;  1MS7 A;  4FAT A;  1MXZ A;  2QRY A;  3E13 X;  2DYX A;  5ELV A;  3CG3 A;  1B9J A;  1MY0 A;  3ILU B;  5AA4 A;  2AYS A;  2FBP A;  1SPI A;  3LSF B;  5ITO A;  5EHS A;  2UVI A;  3H3G A;  1A7L A;  1DPE A;  2UXA A;  1H76 A;  3H06 B;  2H4I A;  5ET7 A;  1LBB A;  2D3I A;  2O7U A;  3HPI A;  3IO6 A;  4HE0 A;  2BJJ X;  4R9F A;  1NV7 A;  3BFT A;  4EXK A;  1MY3 A;  3SER A;  1LEV A;  4QSD A;  1NUY A;  4F2Q A;  3MUQ A;  2AL5 A;  1ZMG A;  2XXH A;  3CRB A;  5ET5 A;  5I59 B;  2V4C A;  2E1S A;  5IZ3 B;  4XKQ A;  4GLI A;  2DXY A;  3TCG A;  1XT8 A;  3OO9 A;  3TPA A;  5FTH A;  4I3Y A;  1FPD A;  5EQ7 A;  4OES A;  4LZ8 A;  3VLW A;  3GBA A;  2REJ A;  2RC7 A;  3TEP A;  4NGU A;  3UP9 A;  1R9Q A;  1NUZ A;  1XI6 A;  5AA4 B;  2CZH A;  2HEU A;  4G68 B;  3KJT A;  4DDD A;  2OLB A;  4FIM A;  3KBR A;  2V25 A;  1FPI A;  4DCX A;  2B4L A;  5I58 B;  5IZ3 A;  4ELR A;  1R9L A;  1ZIU A;  4GF8 A;  4THI A;  1Y3N A;  3SES A;  5IZ1 A;  1LFI A;  3A3C A;  3T1B A;  4N91 A;  3H6T A;  4XEQ A;  1MQG A;  1SI0 A;  5EYF A;  4KXP A;  1G0I A;  3PMV A;  1B7Z A;  4X9T A;  2XWI A;  4MAG A;  2FVZ A;  1AL3 A;  5ESY A;  4OTE A;  3EHU A;  3IJO B;  5BUU A;  1IMD A;  2UVG A;  1Y4C A;  5LDZ A;  2XHD A;  4X04 A;  3UIF A;  1EZP A;  5I7I A;  1B6H A;  1IME A;  1QUI A;  4XTC Q;  3TTN A;  2H99 A;  3VLV A;  1FTM A;  4YKI A;  2DE3 A;  2W7Y A;  1D4N A;  2WBD A;  1INP A;  1MXV A;  3DP4 A;  1BIY A;  3TMG A;  5DEX A;  1FQF A;  1OQH A;  1P1O A;  1UTH B;  4JVD A;  2Z23 A;  3I5O A;  1B0L A;  4HE2 A;  4H5F A;  3W9W A;  3OEK A;  2R9J A;  3U94 A;  3VVE A;  3PPQ A;  4EF2 A;  4PFR A;  3VV5 A;  4ND9 A;  4G8H A;  1FTA A;  1SD3 A;  1EU8 A;  1YAE A;  3CHG A;  1JNF A;  2A5T B;  2DVC A;  4EDP A;  5KCJ B;  2VPO A;  1A55 A;  3FVK A;  2VD3 A;  4XKN A;  1LAG E;  2CZK A;  1N0T A;  1MDQ A;  1GGG A;  4ECF A;  3DP8 A;  4OEV A;  1D9Q A;  4X1B A;  4NWC A;  5I3S A;  1ATG A;  1IZ1 A;  3MJN A;  4IGT A;  4KFQ A;  2XXQ A;  4BLA A;  3TFL A;  3I6V A;  2DWJ A;  1SW4 A;  4BDO A;  2I0B A;  3T9U A;  4YKK A;  4P3L A;  2PT2 A;  4F3S A;  2ZXT A;  3KC0 A;  5CMC A;  4P56 A;  1NMU A;  1SW2 A;  1OQG A;  2F97 A;  4KQP A;  4RK9 A;  3W9V A;  4PAF A;  3PD8 A;  1L5T A;  4ZEF A;  4ZE8 A;  4U22 A;  2Y5L A;  4N4U A;  3UGW A;  1B2H A;  4NF4 A;  2ZZW A;  2I49 A;  4UA8 A;  1DTG A;  3K6X A;  4O3A A;  3LSL A;  4H67 A;  4U21 A;  1NH7 A;  2Q8J A;  5JTY B;  4PP0 A;  2I58 A;  2L5V A;  1MPD A;  4O3C A;  1MY1 A;  4ZEC A;  5TP9 A;  4XF5 A;  3MQ9 A;  3SEW A;  3CG1 A;  3RGY A;  2GRV A;  4IO4 A;  3EN3 A;  1MXU A;  4U1Z A;  2DVZ A;  4P1E A;  4JB7 A;  1RDY A;  3RTF B;  4RA1 A;  2XXT A;  4DXC A;  1VE4 A;  1Y9U A;  4NF6 A;  5HPQ A;  2DDK A;  3TQW A;  1SDX A;  4KR5 A;  1POY 1;  3MZ1 A;  4QFP A;  3RTW B;  1S50 A;  1PB7 A;  3IOU A;  3PUZ E;  1JEV A;  1FPL A;  1BK4 A;  2F3B A;  1QKB A;  3EKI A;  3OO8 A;  4ZEI A;  2NXO A;  3N26 A;  1LFH A;  1UQW A;  4AS5 A;  5KCJ A;  4KCD A;  1GVC A;  3C36 A;  1LST A;  5I2K B;  4RK2 A;  2ONR A;  1B1H A;  4MLQ A;  1D3K A;  3S2V A;  1B58 A;  1ZLQ A;  4YMB A;  4GX4 A;  1EZO A;  2OBG A;  1FJ9 A;  4FED A;  1FQD A;  3KOS A;  4NMY A;  1FSA A;  2DE4 A;  3D4G A;  4R9G A;  1Y1M A;  1OVB A;  1F9B A;  5IZZ A;  2PBW A;  4MEV A;  1RKM A;  3UK4 A;  5CMB A;  3WAF A;  2XXY A;  3FXB A;  1MDP 1;  3UOR A;  1EYK A;  2O7I A;  4H8J A;  5J1D A;  5CBS A;  3KFM A;  4N6P A;  1MH3 A;  1JW4 A;  3TYH A;  4PFU A;  2MKZ A;  3SEX A;  2D5W A;  4OFO A;  4QF9 A;  2PT1 A;  2AIX A;  2DOJ A;  2I0C A;  1NV3 A;  4JSD A;  3RT8 A;  1ZTY A;  1Q1K A;  5EYH A;  5T3J A;  1FPE A;  1OMP A;  2KLF A;  3BFU A;  4KYD A;  4GOT A;  1GTK A;  3T9V A;  2Y7I A;  1UIV A;  1NNK A;  4POW A;  2WYP A;  3T9X B;  3TQL A;  3U93 A;  4M1V A;  3S9E A;  1K9Y A;  1NUW A;  4P47 A;  5CC2 A;  3SZP A;  1M5C A;  1MPC A;  4K3F A;  1MXY A;  4IO6 A;  3T22 A;  2RC8 A;  1PB8 A;  4GXA A;  3RY3 A;  4OMB A;  3K0V A;  3F11 A;  3MVY A;  2R8T A;  3O97 A;  2FA7 A;  3C35 A;  3Q26 A;  3OOA A;  3CIJ A;  3H4Z A;  1IXG A;  4F3P A;  3FVO A;  4YMA A;  2UVH A;  1QUL A;  1URS A;  3HHF A;  1YYZ A;  3HCQ A;  2ESN A;  2XWV A;  1MPB A;  3IB2 A;  3O28 A;  4IR8 A;  4QBA A;  1ZU0 A;  2I4C A;  3FXU A;  4ELO A;  1NUX A;  2F7C A;  3G3F A;  2YLN A;  2ALU A;  2O1L A;  2Z8D A;  2NOO A;  4UAC A;  1M5D A;  2VPN A;  2ZYO A;  4NF0 A;  1B3F A;  4GX6 A;  4DXU A;  5EHM A;  4ZDM A;  2XXX A;  3U92 A;  1LAH E;  2Y7R A;  2NWJ A;  4PFB A;  4NF5 B;  1Q9D A;  1P1N A;  4N6K A;  3BIH A;  3Q28 A;  3PPR A;  3Q29 A;  3FD3 A;  1IIT A;  4MFI A;  4RJZ A;  1GV8 A;  1RDZ A;  1LBY A;  2AL4 A;  3N94 A;  3S9L C;  2G93 A;  3G3G A;  1LB8 A;  1VFE A;  4AB5 A;  5DVF A;  3K1M A;  1NKX A;  2HQ0 A;  3QXM A;  3V8X B;  3FV1 A;  2O6A A;  1H44 A;  4PBQ A;  2PVU A;  3K2D A;  3ISP A;  2CEY A;  5I2N B;  4LQ5 A;  4MHF A;  4NF5 A;  4C1T A;  4U2R A;  4GWO A;  4L17 A;  3GZG A;  2E0S A;  3OO6 A;  1AWB A;  3FJM A;  4RY1 A;  1FRP A;  5LTC A;  5JEI A;  1IIW A;  2QSX A;  4ZEB A;  3FAS A;  2UYF A;  4TLM B;  2Q88 A;  1MY4 A;  5I5P A;  1FW0 A;  3PGF A;  4F2O A;  1URG A;  1A40 A;  1QUJ A;  3LUZ A;  4N07 A;  3C9H A;  1JW5 A;  3PV0 E;  4ZE9 A;  2V3T A;  4GWW A;  1XVX A;  3IO4 A;  2NVU B;  3QUF A;  2XX8 A;  2ZMB A;  3OO7 A;  2I3W A;  3L6H A;  1WOD A;  4GX3 A;  3HHG A;  1KWH A;  2CEX A;  4GL8 A;  1OVT A;  3C34 A;  4LUB A;  3MWB A;  1B52 A;  4P9K A;  5AA2 B;  1YTV A;  2F78 A;  4R72 A;  4NX1 A;  2IA4 A;  4F18 A;  3IR1 A;  4OXV A;  1DCU A;  4QFN A;  3RQT A;  4IB2 A;  1I6Q A;  4G8M A;  4PF6 A;  3N5L A;  3R26 A;  2DQV A;  4NF6 B;  3H7M A;  4R6K A;  1SI1 A;  5CMM A;  2DE2 A;  4G61 A;  4YIC A;  4IO5 A;  3BIG A;  3O66 A;  2ONS A;  5EQ8 A;  4OVS A;  1FPJ A;  5ET8 A;  2DWI A;  3A3U A;  2B4M A;  1XC1 A;  4F1V A;  4YZZ A;  3GBB A;  4MNI A;  4OVP A;  2OWS A;  2QS2 A;  2HXW A;  2D21 A;  4EUO A;  1M5E A;  2QL3 A;  3ECR A;  1ELJ A;  3KSX A;  1SQY A;  4HXV A;  3JV9 A;  2B3B A;  3C32 A;  1P1Q A;  3RUM A;  3MYU A;  4XFE A;  2PYY A;  3RLF E;  1N76 A;  1IXC A;  4EQ7 A;  3ZKK A;  4XKR A;  4MCO A;  3FJ7 A;  1NNT A;  1PB9 A;  3QK6 A;  1BKA A;  5M2V A;  5H8H B;  4YKP A;  1XVY A;  2Z22 A;  4U4S A;  4F31 B;  4HTG A;  2I3V A;  2OJT A;  1B7U A;  4ZZA A;  1AH5 A;  1CB6 A;  4LA9 A;  2LAO A;  4BDR A;  2WX9 A;  3THI A;  3H6U A;  1JVX A;  3B6W A;  2RC9 A;  4NE4 A;  5IGA A;  1MQD A;  3VVF A;  2O51 A;  1B46 A;  1K9Z A;  1FBC A;  1JQF A;  1MM7 A;  1FQA A;  3KSJ A;  3CFL A;  2QVV A;  1A99 A;  1CNQ A;  4ZZE A;  3EHS A;  4GRK A;  4O94 A;  3SEU A;  3TTR A;  1ANF A;  1O63 A;  4POX A;  3K01 A;  2XX7 A;  1TWY A;  1OLC A;  3LSW A;  3PPP A;  5I59 A;  1A8F A;  5FBP A;  3UA8 A;  4N8Y A;  1Y1Z A;  4TOZ A;  2VOZ A;  2HAV A;  2ZZV A;  3TAJ A;  4OFL A;  2V3Q A;  1B5H A;  2P2A A;  3P7I A;  3N6U A;  4U1O A;  4PDH A;  4N13 A;  4DI4 B;  3FJG A;  3PUX E;  1IMB A;  2OZZ A;  2JJK A;  3OMB A;  2A5S A;  3PU5 A;  1JEU A; 
#chains in the Genus database with same CATH homology
 4DI4 B;  4HE0 A;  4PCD A;  4HE1 A;  2HHM A;  4GBV A;  4HXV A;  4P56 A;  1NV7 A;  1AWB A;  3KBZ A;  2FIE A;  5EYG A;  1FRP A;  1LBZ A;  3A29 A;  4GX4 A;  4P8B A;  1FBE A;  5LTC A;  4N81 A;  1IMC A;  1FJ9 A;  1YYZ A;  2DE3 A;  3W9V A;  4PAK A;  4I3E A;  4PAI A;  1FPK A;  1LEV A;  4PAF A;  2WBD A;  2OWZ A;  2XWV A;  1FBD A;  1NUY A;  1INP A;  3MYU A;  4NAP A;  3E79 A;  4OA4 A;  2BJI A;  4N15 A;  4XFE A;  4PC9 A;  2Y5L A;  4IR8 A;  1KZ8 A;  4N4U A;  4OAN A;  4QBA A;  1FSA A;  3U65 A;  2VT5 A;  5ET5 A;  2ZZX A;  3GYY A;  3NOH A;  4MCO A;  2ZZW A;  2DE4 A;  5DW8 A;  4OVT A;  4JVD A;  4X8R A;  2V4C A;  4JVI A;  5I5P A;  4JVC A;  3PTY A;  2PFZ A;  2PCR A;  5IZ3 B;  1FBP A;  4HE2 A;  1FBF A;  2F5X A;  3W9W A;  1NUX A;  1RDX A;  2OX3 A;  3IFC A;  4LN5 A;  5IZZ A;  2XXK A;  4MEV A;  2HZK A;  4PF8 A;  1NV6 A;  5ET6 A;  4NN3 A;  4O8M A;  3LUZ A;  4MNC A;  4I3Y A;  1FPD A;  4GWU A;  4AS4 A;  2QVR A;  2FIX A;  4PBH A;  2XWO A;  5EQ7 A;  4H45 A;  4GBW A;  2KR0 A;  2L5V A;  2CZI A;  3RPL A;  4HCW A;  4PE3 A;  4OVQ A;  4N8G A;  1FPB A;  4GWW A;  4O7I A;  3B50 A;  4PDD A;  2WX9 A;  4PFR A;  2Q74 A;  3MST A;  4XF5 A;  4NQ8 A;  4MIJ A;  1VDW A;  3FXB A;  1LBV A;  1KA0 A;  1EYK A;  4FBP A;  5J1D A;  1FTA A;  4GX3 A;  2Q8M A;  5IGA A;  4NGU A;  3CHG A;  1IMA A;  2CEX A;  1YXI A;  2P3N A;  2HZL A;  2VPN A;  4NHB A;  4NF0 A;  5JK4 A;  2F3D A;  4GX6 A;  1NUZ A;  1XI6 A;  3D1R A;  4F19 A;  4MJO A;  2CZH A;  1JP4 A;  1K9Z A;  4N17 A;  2VPO A;  1KA1 A;  1FBC A;  5A5L A;  2DVZ A;  4PET A;  4DI3 D;  2MKZ A;  4PGN A;  1FPI A;  2XWK A;  4QXD A;  4P9K A;  1LBW A;  2Q9T A;  3IFA A;  4NX1 A;  2B4L A;  1FBG A;  4PTK A;  2KQZ A;  2CZK A;  2PFY A;  2XA5 A;  4PFB A;  4P1E A;  1Q9D A;  3T0J A;  3RYD A;  5IZ3 A;  3BIH A;  1FJ6 A;  4N6K A;  4UAB A;  1RDY A;  2QVV A;  1DBZ A;  1DCU A;  4GWZ A;  2GQ1 A;  1CNQ A;  5EQA A;  2QPQ A;  1EYI A;  1NV3 A;  4MMP A;  1LBX A;  1IMF A;  1NI9 A;  1FPG A;  1NV0 A;  5EYH A;  2HPG A;  4O94 A;  1NV2 A;  5IM2 A;  4NG7 A;  3B8B A;  3LV0 A;  1D9Q A;  1FPE A;  5T3J A;  4MNP A;  5IZ1 A;  1RDZ A;  1LBY A;  5I3S A;  4O7M A;  3T1B A;  1NV5 A;  5CM6 A;  4PF6 A;  4N91 A;  4F18 A;  4XEQ A;  4PGP A;  2DDK A;  3KC1 A;  2WYP A;  3FBP A;  5FBP A;  1QGX A;  4M1V A;  4N8Y A;  4I40 A;  1K9Y A;  1FBH A;  4KXP A;  1NUW A;  3E78 A;  2QFL A;  2WEF A;  1G0I A;  4F1U A;  2QVU A;  4P47 A;  4X9T A;  4OVR A;  2DE2 A;  4HCY A;  2FBP A;  4G61 A;  4YIC A;  3SZP A;  4GWS A;  1FPL A;  1BK4 A;  2F3B A;  3BIG A;  1SPI A;  4GWY A;  2XWI A;  1DK4 A;  2ZZV A;  2FVZ A;  4MAG A;  4N6D A;  3EKI A;  5EQ8 A;  3RPL B;  2Y5K A;  5ESY A;  4OVS A;  1FPJ A;  2V3Q A;  4P1L A;  2WYK A;  1G0H A;  5ET8 A;  3ROJ A;  1IMD A;  2B4M A;  2R8T A;  4F1V A;  4YZZ A;  4PBQ A;  5LDZ A;  4PDH A;  4MNI A;  2FHY A;  3QMF A;  4GWX A;  4AS5 A;  5J16 A;  2HXR A;  3ISP A;  4OVP A;  4X04 A;  1EYJ A;  5EQ9 A;  1NV4 A;  2CEY A;  4MX6 A;  4P3L A;  2P3V A;  4MHF A;  1IMB A;  2JJK A;  5ET7 A;  5F24 A;  2WBB A;  1FPF A;  5I7I A;  4H46 A;  3HFU A;  1NV1 A;  1IME A;  1YZ0 A;  4PFI A;  3KC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...