2CZKA

Crystal structure of human myo-inositol monophosphatase 2 (impa2) (trigonal form)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
269
structure length
253
Chain Sequence
PWEECFQAAVQLALRAGQIIRKALTEEDLVTETDHLVEDLIISELRERFPSHRFIAEAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol monophosphatase 2
publication title Crystal structure of human myo-inositol monophosphatase 2, the product of the putative susceptibility gene for bipolar disorder, schizophrenia, and febrile seizures
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 69
structure length 253
sequence length 269
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2czkA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2czkA02
1IMEA 5LDZA 4GX6A 2CZIA 1LBZA 4HE2A 4AS5A 4GX4A 4H45A 5IZ1A 1Q9DA 1FJ9A 1FBDA 1IMAA 4GWWA 2DDKA 1FPJA 2WBDA 1NV6A 4GBWA 4H46A 2FVZA 2Y5LA 1YYZA 1NUXA 1NV5A 1EYIA 4HXVA 1IMCA 1IMDA 1K9YA 1FBCA 3KBZA 4O7IA 1FPKA 3IFCA 5EYGA 5ET6A 1NV1A 1RDYA 5EQ8A 5EYHA 3RPLA 4PTKA 2HHMA 4N81A 4GWXA 3ROJA 1KA0A 4AS4A 1G0IA 2R8TA 5EQ9A 1NV3A 2QFLA 3KC0A 2P3NA 1NV7A 1FJ6A 1IMFA 1IMBA 5DW8A 1CNQA 5ET7A 2QVUA 5ESYA 4GBVA 1RDXA 2QVRA 4QXDA 1FPBA 3A29A 3B8BA 1FBHA 1LBWA 2Y5KA 2F3DA 2Q8MA 2WEFA 2FHYA 1QGXA 4GWZA 2CZKA 4MJOA 1VDWA 5IZ3A 1FTAA 3LUZA 1FPEA 1LBVA 1NV4A 1G0HA 2WBBA 1FBEA 1FBPA 2P3VA 3LV0A 1AWBA 5ET8A 1EYJA 1FRPA 1NUYA 1NV0A 5A5LA 2Q74A 5J16A 4G61A 1LBYA 5EQ7A 1FPFA 1FPLA 1FBGA 5F24A 1JP4A 2OWZA 5T3JA 2CZHA 2FIEA 4HE0A 1KA1A 1D9QA 1SPIA 1KZ8A 1EYKA 1NUZA 3IFAA 2PCRA 1K9ZA 1NI9A 4GX3A 1XI6A 2VT5A 3FBPA 1FPGA 2GQ1A 1DCUA 2OX3A 4I3YA 2FIXA 5I3SA 3QMFA 3RPLB 3BIHA 4FBPA 3T0JA 4GWUA 4KXPA 1INPA 1LBXA 1YXIA 1NUWA 3RYDA 1RDZA 1NV2A 1FPDA 4GWYA 5FBPA 1YZ0A 1BK4A 2F3BA 2QVVA 1FBFA 4GWSA 4I40A 4IR8A 1FPIA 4I3EA 3KC1A 1LEVA 2JJKA 3BIGA 3D1RA 1DK4A 5EQAA 2BJIA 5IZ3B 1DBZA 5ET5A 2FBPA 4HE1A 1FSAA
chains in the Genus database with same CATH superfamily
3CI8A 3MJNA 4U1OA 1MQGA 2F36A 4QSCA 2AIXA 3PD9A 2F6GA 2D5WA 4KYSA 4QRZA 4R9GA 1FPJA 1MQJA 3FJ7A 3VE1B 2CEYA 3BFTA 3K1MA 4X1DA 3PUXE 3PPPA 2DP8A 4RPOA 3QK6A 3FV2A 3O6HA 3S4UA 2F34A 5DVJA 2P3NA 3TUSA 1IXHA 5IKBA 1JVYA 3T93B 1HSEA 2WEFA 1P1WA 2B4MA 5JTYB 4PGPA 5IZ3A 2XXXA 1JEUA 3MBPA 4F31B 1FCKA 2QS1A 4PP0A 2HAUA 1A40A 5I57A 4DLDA 2P0SA 3S9LC 5I2NA 3EKIA 4RNSA 5BWJA 4OVJA 3H06B 2NWJA 3P7IA 1Q1KA 1MXXA 4ZEDA 2BJJX 4YAHX 4TLMB 2DOJA 2OBGA 3T9UA 2QVVA 4BDOA 4U4SA 4IR8A 1Y3QA 5L9OA 2XXHA 3O2AA 4HS7A 2B4LA 5FTIA 1YPNA 3G3HA 5M2VA 4X1BA 1LBZA 4HE2A 4ND9A 1IMAA 2ESNA 3HN0A 3LSWA 4EXKA 1A55A 4BDLA 4F1YA 1MQDA 2QS4A 3E4RA 3BBRA 4NF6A 5EYHA 4GD5A 3Q25A 2WX9A 4ELQA 1LFIA 3R6UA 1G0IA 2GHBA 1UTHB 5LOMA 1RDXA 3B8BA 1FBHA 2F3DA 2HAVA 4OEUA 3N94A 1M5CA 5DVIA 1ZKBA 3CVGA 1Y4TA 1VDWA 3PV0E 3WAFA 1FTJA 1FBPA 1P1QA 4YB5A 1S50A 1GVCA 2H98A 5J16A 4O94A 2PVUA 1MG1A 3I5OA 3U1OA 3PMXA 4OFJA 5EYFA 1K9ZA 1NNPA 4EQ7A 5H8HB 3BKIB 4IO7A 1MM6A 5I58B 4PDDA 2D3IA 4OYVA 1USYH 2DVZA 1O64A 2QL3A 3MW0A 1NNTA 4AB5A 1TXFA 2XWKA 5IZZA 3LSLA 1FQFA 1UIVA 5JTYA 3RT6B 1DBZA 3K6WA 4ZZAA 3K02A 4O7MA 5EHMA 3D4CA 4GX6A 4YMAA 5CMKA 2RF1A 4C0RA 4MH5A 4JVCA 3FV1A 4GWWA 5DEXB 2Q88A 2H9BA 5H8NB 1FTMA 3GBAA 1IITA 1P1UA 4DCYA 1MY1A 4GWXA 3TTNA 5ELVA 5DW8A 4QHQA 4ELOA 1NNFA 1JETA 4LQ2A 3MVWA 4G8HA 1QKBA 1SW4A 1FQBA 4JWXA 3FJGA 1NMUA 3VFJA 5TP9A 1XC1A 2WYPA 4OENA 3SETA 4G77A 3RGYA 1FRPA 4YB7A 1NV0A 1O7TA 3IB2A 4G61A 1UTBA 3SEVA 2YJPA 3QXMA 1JW5A 4RA1A 1N76A 3IFAA 4HW8A 1NI9A 4OANA 3TQLA 4H67A 3RTWB 1YTVA 1EZPA 4RYAA 2FIXA 3E79A 1AL3A 1IEJA 1UTHA 3CG1A 2O7UA 2R6GE 3W9VA 3EHUA 4YICA 1FQDA 1MPCA 5DTBA 4E0WA 3G3JA 1FSAA 2DE4A 1A8EA 3CFXA 1F9BA 2XWOA 3FXRA 3O6GA 3B6QA 4MBPA 2Q89A 4RPNA 1EYIA 2IA4A 3T9HB 3W9WA 5ET6A 2DE3A 5H8HA 3FVGA 4O8MA 4I62A 2O68A 4NHBA 1P1NA 4MLQA 4ZE9A 4H8JA 5I58A 5EQ9A 1NV3A 1II5A 2Q2CA 1SI0A 4HTGA 3RTFB 2DE2A 3SZPA 2QS2A 4EDPA 3RUMA 2E1SA 2KLFA 2REJA 1IUDA 3ZS6A 4GWZA 2F97A 4XEQA 4P0IA 3LUZA 2I0CA 1LAFE 1G0HA 3KOTA 4KCCA 1ZTYA 4O3AA 1Y1ZA 3ISPA 4F1UA 3E78A 4P1LA 5DEXA 5F24A 1KZ8A 4F1VA 5H8NA 4Z0IA 2DQVA 3ZSFA 3MAMA 2ZNTA 2GHAA 1URSA 1ELJA 4GQOA 2XWVA 3OENA 4OESA 1B32A 4OETA 5H8FB 2ZXTA 4MMPA 3QSLA 4GL8A 2F3BA 3PGFA 4POXA 1POTA 4QBAA 5EQAA 3DLNA 3HFUA 3I3VA 4AS5A 4H45A 2OWTA 5I5PA 3A3UA 4DI4B 3MP6A 4JWOA 1NV5A 2O84X 2XXVA 2XX8A 4R75A 2THIA 3FVKA 1RDYA 5HBCA 1O63A 4IB2A 4EXLA 4O3CA 2I4BA 4N6KA 2V3UA 4LZ5A 4RK2A 2YLNA 4IO4A 5CMBA 2QVRA 2M8CA 4JVIA 4PAIA 3IOVA 4R74A 3R7XA 4NWDA 3S9EA 2Y7IA 4OEVA 2X7QA 1LFHA 3QIMA 2RC8A 2UVHA 1UQWA 5ICQA 3JZJA 3TCGA 2VD2A 5DYHA 2CZKA 4IY5A 4MFIA 4U4XA 1ZIUA 3USDA 1TT1A 1H76A 3PPNA 2VPOA 3EN3A 5F1QA 3PPQA 1FPFA 5CRYA 4F18A 2CZHA 4PCDA 3VVDA 3L6HA 4G68A 1H3DA 4M1VA 1KWHA 2OZZA 2VPNA 3TODA 4FBPA 2FYIA 4P3LA 3UA8A 4DDDA 1XVYA 3OO8A 1XOCA 1ANFA 2OWSA 1NV2A 2RC9A 1ZJLA 3N26A 1IQ7A 4EQBA 5ITOA 3TTLA 1LEVA 2ZNSA 3SEUA 3OSQA 2ONSA 3H03A 3EPEA 4NF6B 3PMWA 3H7MA 2FNCA 2XX7A 3OEMA 1Q9DA 4Q0CA 1EZ9A 4FJPA 3UGWA 2AL5A 1JW1A 3KN8A 4H46A 4F3SA 3AXFA 1IIWA 3R26A 1CB6A 5KCJB 2O6AA 4GRKA 3M8UA 3GXAA 3B7DA 4MLVA 1IXCA 1SD3A 4ESWA 3D4GA 1CNQA 1LBCA 4F29A 3LBSA 3Q29A 5H8FA 4YKKA 1A54A 3K00A 4NQ8A 3RT8A 2FHYA 4ZZEA 3M3KA 4KR5A 4MJOA 1Y3PA 4R6KA 1FBEA 1PB8A 4JWYA 1CE2A 3OD7A 3O97A 3VXBA 4EF2A 1PBQA 3CR9A 2Q74A 1IXGA 1YCJA 4XIGQ 5I7IA 2HXRA 5H8QB 5B70A 5T3JA 1UIUA 1MQIA 3KEIA 1LB9A 3HCQA 1M5BA 3WAEA 3TELA 2Y7KA 4KPTA 1N3WA 2VGQA 5TPAB 3MVYA 2D21A 1ZU0A 5H8SA 1LBXA 3KOSA 1S9TA 1FQAA 3PMVA 1OIBA 4JSOA 1MY4A 4U21A 1B5IA 2AYSA 4I3EA 3BIGA 3S9MC 2FBPA 3MZ1A 3KSJA 4MX6A 1P99A 4JB7A 1FTOA 3GBBA 3SKPA 2H25A 4QF9A 2HZKA 4DCXA 3CIJA 1T0KA 3PUWE 4MCOA 2MKZA 3QAXA 2FVZA 2Y5LA 2QSXA 2ONRA 1B3LA 1AOVA 4O7IA 5EYGA 4NF4B 4LA9A 4AB6A 4F22A 4NF8B 2KQZA 4PTKA 5TP9B 5FHMA 4RY1A 3C9HA 4IO2A 3I6VA 4LP2B 1FTKA 1QULA 4X9TA 4F3GA 3MP8A 3JV9A 1UTBB 1XS5A 3A3CA 2Y5KA 2ZZVA 5ISUA 3B50A 4R73A 1L5TA 4K3FA 1PB7A 2A5SA 4PFTA 1NV4A 4DIGA 2DXRA 3BFUA 4E0XA 1JEVA 2P3VA 3FASA 2F6PA 3TPAA 4F2OA 2H99A 1XT8A 3PU5A 3OMBA 1H44A 5EQ7A 2I3WA 4C1UA 2UVIA 1ZMGA 4H65A 1D9QA 5KCJA 3FXQA 4X48A 1B58A 4KD5A 3TDJA 3VLWA 3N6UA 1B4ZA 4NAPA 3CRBA 1INPA 3M3FA 1YXIA 4TOZA 4P8BA 1RDZA 4FORA 2RCBA 4GWYA 1J1NA 4DXUA 4Z7EA 2IEEA 2H5YA 1FPIA 4DZ1A 4THIA 2L5VA 2BJIA 3MPLA 1PDAA 1AIVA 4NEDA 1D4NA 3MPKA 3OXNA 5TU0A 1FJ9A 1H45A 2O51A 4N15A 5H8QA 4PE5B 2B65A 4UA8A 2G29A 5AA1A 1IMCA 4P9KA 4JVDA 2R9JA 1NV1A 5TPAA 2HHMA 2QPQA 1MXZA 3B6TA 4XTCQ 2V84A 1Y4CA 4M4GA 3H3GA 3RPWA 1OMPA 4IGTA 4LATA 3U92A 1B7ZA 2Q8MA 3RNNA 1N7WA 2VOZA 3THIA 3L6GA 1XHYA 4QFOA 1H43A 3U94A 4NWCA 4MIJA 1Q35A 3S2VA 3DP4A 1WDNA 2HZLA 2QRYA 3A09A 1EYKA 4FEDA 1ATGA 4NF4A 1QUJA 4EUOA 4NF8A 2I48A 5J1DA 1AMFA 3FJMA 4U2RA 1LCTA 4OVTA 4I3YA 2PBWA 4PC9A 2OLBA 3E13X 4WEPA 2O69A 1NH8A 5I2KB 1B5HA 5ICTA 4AQ4A 2I6EA 4OFOA 4I40A 4ECFA 2VHAA 3D1RA 1BP5A 4OVRA 1I6BA 5I59A 4PGNA 2I49A 3T22A 4IO6A 4GBWA 1Y1MA 1EZOA 1QUIA 2NOOA 1SDXA 4LZ7A 1YAEA 3H4ZA 1FPKA 5CMMA 3KGCA 3IORA 3PTYA 1GV8A 5AE4A 1R6ZA 3MUQA 1I69A 1MDQA 3DP8A 2CEXA 2Z23A 1NV7A 3MZBA 4WXJA 4KCDA 3HSTA 1SI1A 3QUFA 3IB1A 4NF0A 3S9NC 2Z22A 4RXLA 1LBWA 2XXIA 3CSGA 3IB0A 2NUVA 3G7WA 1MPBA 2ALUA 5EHSA 1ZBMA 2CMOA 2B3FA 4G68B 3OOAA 3C34A 2O1LA 3PUYE 1LBVA 5CI5A 3LSXA 1QVSA 4H0WA 5CC2A 3UN6A 3VVEA 1FBGA 2ZNUA 3MVXA 3V8XB 4OVQA 3K01A 1NUZA 4F2QA 1B3HA 1BTJA 2DVCA 3EHSA 5IGAA 2ZYKA 4PETA 5I3SA 1NL5A 2XXQA 3RPLB 3ILUB 1B52A 3MSTA 4GWUA 1N3XA 3TCHA 4ESXA 3CHGA 1NUWA 3OO6A 4OTEA 3VVFA 1LAXA 3T96B 3SERA 3HPIA 3K2DA 3VV5A 4GXSB 4LQ5A 4G4PA 1BKAA 4N13A 4ZS9A 3TTMA 3FZVA 3HHGA 4QFPA 1GGGA 5A5XA 3TZAA 3TQWA 1LFGA 2F78A 3PPOA 4ISUA 3FUZA 4ZEBA 1Y3NA 4NG7A 1B3FA 2PX1A 1B3EA 1NV6A 5DVFA 4R6HA 4OFLA 4F19A 5I84A 4HXVA 4PE3A 4N4UA 1K9YA 1OLAA 3KBZA 4FE8A 4JSDA 1QJMA 3LUYA 1DMBA 3GYYA 5HPQA 3PD8A 1OVBA 2DS9A 2XHDA 4GLIA 1KA0A 4I9DA 1DTZA 1R1NA 1LBBA 2HXWA 4DXBA 5ET7A 1R9LA 2Y7PA 3ODBA 2QMXA 3B6WA 1N0TA 4ZECA 5I2KA 2XX9A 3K1NA 4I8CA 1QGXA 1Z7ME 1LLSA 4QSEA 5KDTA 2WBBA 3W15C 2OCUA 2UXAA 1AWBA 3V89B 2F5XA 2OPEA 4YKJA 4MEVA 1KA1A 3HV1A 2I3VA 2ZYOA 1A7LA 2ZYNA 5FHNA 2VT5A 5AA4B 1FPGA 1B4HA 2XA5A 3IJOB 3MC2A 3QMFA 3FVOA 5L9MA 1NFTA 1PEBA 4R72A 4KXPA 3PUVE 1IZ1A 3DELB 4Q30B 4P11A 2V25A 3ONMA 4I1DA 3MP1A 4QFKA 4QSDA 1DTGA 1FW0A 4L17A 1DK4A 4H1XA 1B3GA 3RLFE 3TAJA 3GLBA 5AA3A 1GTKA 2DDKA 1PC3A 2FA7A 2WBDA 2I58A 3IAZA 2GRVA 1HSLA 3TEPA 1YYZA 3O9PA 3IFCA 4KYDA 1M5FA 1VR5A 2PYYA 3SDFA 1B7HA 3RPLA 4NE4A 4OQOA 3K6UA 2I4CA 1B0LA 2F8DA 2QFLA 4GOTA 3O29A 1FJ6A 4G2ZA 1IMFA 1IMBA 3KN7A 4PBHA 1B7UA 4KQPA 4QFNA 5K2XA 4GL0A 2XXRA 4DI3D 4PAKA 1FPEA 2DWHA 4NMYA 2Z8FA 4P56A 3TTRA 3LV0A 1EU8A 1MXYA 2UVGA 2QMWA 2ZZXA 2CZLA 5L9SA 2OPDA 3EF7A 4ZDMA 4N8YA 3QYTA 3UORA 2OWZA 3C32A 1JVXA 3N6TA 3E3KA 1USYE 1RYOA 3IL1B 4BDMA 2Q8JA 1MY2A 3BIHA 1TWYA 3LC8A 3IK6B 4YB6A 4FIMA 4OMBA 1BIYA 4NF5B 1SQYA 3K6VA 3RN8A 2W7YA 1SW2A 4ZEIA 5HM4B 1B2HA 3FATA 3OO7A 3KJTA 5ITPA 3FGSA 1VE4A 4KHZE 1BK4A 4YZZA 4OERA 3KFMA 3CSBA 2Q2AA 4FEBA 1LB8A 4QFLA 2DWAA 3SEWA 4HE1A 3U72A 2I0BA 4GX4A 1NKXA 1MH4A 2P2AA 1VFDA 3M3LA 1MXUA 1FBCA 5AA4A 3TMGA 4MNIA 3TYHA 4XF5A 1TFDA 1N04A 4LUBA 3IOTA 2R8TA 5AA2D 4GWOA 3ILTB 4FECA 4IGRA 1MM7A 4DXCA 4KFQA 4IO5A 2X26A 4NN3A 4TLLB 2GFEA 2Y7RA 1POY1 1URGA 3OELA 1WODA 4LONB 2O7IA 3RY3A 3UK4A 2NXOA 1NUYA 4Q5TA 5A5LA 4UACA 2OK2A 1LBYA 3K0VA 4FAJA 2XD3A 3KG2A 1SYHA 4PFRA 3C31A 1B0HA 3DM0A 1SPIA 3C33A 2WKYA 2PCRA 4POWA 2HQ0A 3FBPA 3O28A 3IOUA 2OX3A 4G68C 4PF8A 5I59B 4P1EA 3N5LA 3Q28A 2DYXA 4XXUA 4H8IA 1B51A 4GIZA 1FPDA 3HO7A 4PF6A 2E0SA 5FBPA 4MF3A 2DWJA 4PFYA 1FBFA 2JJKA 2RC7A 4YMBA 3CFZA 3KN3A 2ZZWA 5AA2B 2XXUA 2DXYA 1PBPA 4R6YA 1DPEA 5LDZA 5FTHA 2XXWA 5IZ1A 1FBDA 4U23A 4JXIA 2R71A 1WVJA 1M5DA 4JDFA 3OEKA 1URDA 1NNKA 1JNFA 3U8QA 4LVQA 3O6IA 5JEIA 3O66A 1QW0A 1Y20A 4PQJA 4N81A 2XXPA 3ROJA 4WKMA 2UVJA 3TKDA 3KC0A 4NF5A 4P0GA 4IY6A 4XKRA 2QVUA 5K2YA 4GBVA 3A29A 1FQEA 4FATA 1A8FA 1D3KA 4H5FA 3CFLA 3IO6A 3HHFA 4C1TA 2ANJA 2F7CA 2NVUB 4PFUA 1QUKA 2LAOA 4EQ9A 1B46A 2PMSA 1I6AA 4HCWA 4ZE8A 3T1BA 3KJ7A 2FIEA 1Z7NE 4ZEKA 2ZMBA 1RKMA 4GX3A 5CBSA 2H4IA 4X8RA 3VLUA 1LAHE 1FTLA 3TTKA 3G3FA 3LSFB 5A5XB 3SESA 4N6DA 5IM2A 2OJTA 1GR2A 2RCAA 4XFEA 3GZGA 5I56B 3T9VA 3PUZE 4KI0E 4GWSA 4PFWA 2Y84A 3KC1A 4GF8A 3VLVA 3C36A 5JK4A 5L8DA 4BDQA 1HSJA 3IJXB 2Z8DA 4U22A 4R2BA 1NUXA 4UABA 1N7XA 3EHTA 1IMDA 3SEXA 1LSTA 4IO3A 3Q27A 5EQ8A 1SBPA 2HPGA 5KDTB 4OZ9A 4AS4A 4O3BA 3OSRA 4NGUA 3DP6A 4NTLA 1R9QA 1JW4A 3MWBA 1N84A 4N17A 4R2FA 2DWIA 5AA2A 1JQFA 1MPDA 4MNPA 4PFIA 1EYJA 3IOWA 1QKAA 1OLCA 2XWIA 2AL4A 4ONYA 4YKPA 4BDRA 1LAGE 4HE0A 5LTCA 5CM6A 2GH9A 4DE8A 1XI6A 3K6XA 1DCUA 1LGBC 3EQ1A 3G3KA 3Q26A 3H6WA 3T0JA 1ZLQA 3SEYA 3FD3A 3QUJA 4N6PA 4PFBA 4MNCA 2F7AA 1MY3A 2V3QA 2V3TA 1TFAA 2DSFA 4HCYA 1SW1A 2ZYMA 3MYUA 2XXTA 1DSNA 3G3GA 2HEUA 5KZTA 2Y7WA 1B9JA 4F39A 5ET5A 4XKPA 3MQ9A 1B6HA 2REGA 1SW5A 3V5AA 2X7PA 5IAIA 1MS7A 1S7YA 1LCFA 3KBRA 4MAGA 2HCAA 2PFZA 3NOHA 1MH3A 4H5GA 2A5TB 3ZKLA 4LZ8A 1NH7A 1RYXA 4JBZA 4N91A 3G3IA 1MQHA 3UP9A 4F3PA 4N8GA 1OQHA 2UYEA 4KYEA 4RJZA 4RK9A 1EH3A 4G8MA 3KSXA 5ESYA 5I56A 4Q8RA 4LN5A 4PAFA 4GXAA 1FTAA 1Y9UA 2PT2A 5FHOA 1AH5A 1B5JA 5ET8A 4TQUQ 5BUUA 1US4A 3PPRA 1A99A 4H6DA 1I6QA 3TCFA 4OA4A 3ZKKA 1OQGA 4N07A 1MRPA 1JP4A 4MHFA 1MY0A 4OHNA 2YPNA 2WYKA 2B3BA 2ONKE 3JYRA 4ELRA 1OVTA 1XVXA 2F35A 2P1SA 1VFEA 5DT6A 1D9YA 1MDP1 3H6VA 2VD3A 3H6TA 4GFRA 3IR1A 5CMCA 4PBQA 3MVZA 1PB9A 4YKIA 4XKQA 1DOTA 3MZ9A 1D9VA 3K4UA 4X04A 1US5A 2Q9TA 3T66A 3E9XA 3CG3A 4GVOA 5IZ3B 3KZGA 2PFYA 4G8NA 2RINA 1IMEA 2CZIA 4OVPA 3FXBA 4BLAA 3V83A 5I57B 3IX1A 1SYIA 5I2NB 3T9XB 1IXIA 4NX1A 3OO9A 2KR0A 4EF1A 3LR1A 3TFLA 2VP1A 1BLFA 2XD2A 4BDNA 3H6UA 4QXDA 2XXYA 1FPBA 3RQTA 1B05A 4F3BA 3VDFA 3UIFA 2UYFA 2QJEA 4P47A 3U65A 1MXVA 2XXKA 2QS3A 4WEDA 4ZEFA 3C35A 3IO4A 2A5TA 3C4MA 1FPLA 2F7BA 3FIRA 2ABHA 1B1HA 2PT1A 4OVSA 5B7DA 1FQCA 2GQ1A 3F11A 4YU0A 1B40A 2G93A 1SVXB 2RKMA 3K1PA 1M5EA 3ECRA 4R9FA 4XKNA 2V93A 4ELPA 3RYDA 3FXUA 1MXWA 5CBRA 2HFBA 1B1XA 1YZ0A 3VXCA 2V4CA 4PDHA 3FVNA 2Z8EA 1DPPA 5F7VA 4U1ZA 4OWDA 1VSOA 4OXVA 1P1OA 2O1MA 3U93A
chains in the Genus database with same CATH topology
5LDZA 4PGNA 4AS5A 4H45A 5IZ1A 1FBDA 5I5PA 1FPJA 4GBWA 4DI4B 1NV5A 2CEYA 1FPKA 3PTYA 1RDYA 4N81A 3ROJA 4N6KA 2CEXA 3KC0A 2P3NA 1NV7A 2QVUA 4GBVA 4NF0A 2QVRA 4PAIA 4JVIA 3A29A 1LBWA 2WEFA 2B4MA 4PGPA 2CZKA 5IZ3A 1LBVA 4HCWA 2VPOA 3T1BA 3EKIA 1FPFA 1FBGA 4F18A 2CZHA 2FIEA 4PCDA 4OVQA 1NUZA 4GX3A 4X8RA 4M1VA 5IGAA 4PETA 5I3SA 3RPLB 2VPNA 4N6DA 4FBPA 4P3LA 3MSTA 4GWUA 5IM2A 3CHGA 1NUWA 4XFEA 1NV2A 2QVVA 4GWSA 4IR8A 3KC1A 1LEVA 5JK4A 2B4LA 1LBZA 4HE2A 1Q9DA 4NG7A 1IMAA 1NV6A 4H46A 4F19A 1NUXA 4HXVA 4UABA 4PE3A 4N4UA 1IMDA 1K9YA 3KBZA 3GYYA 5EQ8A 5EYHA 2WX9A 2HPGA 1KA0A 4AS4A 1G0IA 4NGUA 1CNQA 5ET7A 1RDXA 3B8BA 4NQ8A 1FBHA 2F3DA 2FHYA 4N17A 1QGXA 4MJOA 1VDWA 2WBBA 1FBEA 1FBPA 4MNPA 1AWBA 4PFIA 1EYJA 2F5XA 2Q74A 5J16A 4O94A 2XWIA 5I7IA 2HXRA 4MEVA 5T3JA 4HE0A 1KA1A 5LTCA 1K9ZA 5CM6A 1XI6A 2VT5A 1FPGA 1DCUA 2XA5A 3QMFA 3T0JA 4KXPA 4PDDA 1LBXA 4PFBA 4MNCA 2DVZA 2XWKA 5IZZA 2V3QA 4HCYA 3MYUA 4I3EA 3BIGA 1DK4A 1DBZA 5ET5A 2FBPA 4O7MA 4MX6A 4GX6A 4JVCA 4MAGA 2HZKA 4GWWA 2DDKA 2PFZA 2WBDA 3NOHA 4MCOA 2MKZA 2FVZA 2Y5LA 1YYZA 4O7IA 3IFCA 5EYGA 4N91A 3RPLA 2KQZA 4PTKA 4GWXA 4N8GA 2QFLA 1FJ6A 1IMFA 1IMBA 5DW8A 4X9TA 5ESYA 2Y5KA 2ZZVA 4LN5A 3B50A 4PBHA 4PAFA 4DI3D 4PAKA 1FTAA 1FPEA 1NV4A 2WYPA 4P56A 2P3VA 3LV0A 5ET8A 1FRPA 2ZZXA 1NV0A 4G61A 5EQ7A 4OA4A 4N8YA 1JP4A 2OWZA 4MHFA 1D9QA 3IFAA 1NI9A 2WYKA 4OANA 2FIXA 3BIHA 4NAPA 3E79A 1INPA 1YXIA 4PBQA 4P8BA 1RDZA 3W9VA 4GWYA 1BK4A 4YZZA 4X04A 4YICA 2Q9TA 1FPIA 2L5VA 2BJIA 5IZ3B 2PFYA 4HE1A 1FSAA 2DE4A 1IMEA 2CZIA 4OVPA 3FXBA 4GX4A 2XWOA 1FJ9A 4N15A 4NX1A 2KR0A 1EYIA 1IMCA 4P9KA 4JVDA 1FBCA 3W9WA 5ET6A 2DE3A 1NV1A 4O8MA 4MNIA 4XF5A 4NHBA 2HHMA 2QPQA 2R8TA 5EQ9A 1NV3A 4QXDA 1FPBA 2DE2A 3SZPA 4NN3A 2Q8MA 4P47A 3U65A 4GWZA 4XEQA 3LUZA 2XXKA 1G0HA 4MIJA 1NUYA 5A5LA 3ISPA 4F1UA 1LBYA 3E78A 4P1LA 1FPLA 5F24A 2HZLA 4PFRA 1SPIA 1KZ8A 1EYKA 4F1VA 2PCRA 4OVSA 3FBPA 2GQ1A 5J1DA 4OVTA 2OX3A 4I3YA 4PF8A 4PC9A 2XWVA 3RYDA 4P1EA 1FPDA 4PF6A 5FBPA 4MMPA 1YZ0A 2V4CA 4PDHA 2F3BA 1FBFA 4I40A 2JJKA 3D1RA 4QBAA 5EQAA 2ZZWA 3HFUA 4OVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IME A;  5LDZ A;  4GX6 A;  2CZI A;  1LBZ A;  4HE2 A;  4AS5 A;  4GX4 A;  4H45 A;  5IZ1 A;  1Q9D A;  1FJ9 A;  1FBD A;  1IMA A;  4GWW A;  2DDK A;  1FPJ A;  2WBD A;  1NV6 A;  4GBW A;  4H46 A;  2FVZ A;  2Y5L A;  1YYZ A;  1NUX A;  1NV5 A;  1EYI A;  4HXV A;  1IMC A;  1IMD A;  1K9Y A;  1FBC A;  3KBZ A;  4O7I A;  1FPK A;  3IFC A;  5EYG A;  5ET6 A;  1NV1 A;  1RDY A;  5EQ8 A;  5EYH A;  3RPL A;  4PTK A;  2HHM A;  4N81 A;  4GWX A;  3ROJ A;  1KA0 A;  4AS4 A;  1G0I A;  2R8T A;  5EQ9 A;  1NV3 A;  2QFL A;  3KC0 A;  2P3N A;  1NV7 A;  1FJ6 A;  1IMF A;  1IMB A;  5DW8 A;  1CNQ A;  5ET7 A;  2QVU A;  5ESY A;  4GBV A;  1RDX A;  2QVR A;  4QXD A;  1FPB A;  3A29 A;  3B8B A;  1FBH A;  1LBW A;  2Y5K A;  2F3D A;  2Q8M A;  2WEF A;  2FHY A;  1QGX A;  4GWZ A;  2CZK A;  4MJO A;  1VDW A;  5IZ3 A;  1FTA A;  3LUZ A;  1FPE A;  1LBV A;  1NV4 A;  1G0H A;  2WBB A;  1FBE A;  1FBP A;  2P3V A;  3LV0 A;  1AWB A;  5ET8 A;  1EYJ A;  1FRP A;  1NUY A;  1NV0 A;  5A5L A;  2Q74 A;  5J16 A;  4G61 A;  1LBY A;  5EQ7 A;  1FPF A;  1FPL A;  1FBG A;  5F24 A;  1JP4 A;  2OWZ A;  5T3J A;  2CZH A;  2FIE A;  4HE0 A;  1KA1 A;  1D9Q A;  1SPI A;  1KZ8 A;  1EYK A;  1NUZ A;  3IFA A;  2PCR A;  1K9Z A;  1NI9 A;  4GX3 A;  1XI6 A;  2VT5 A;  3FBP A;  1FPG A;  2GQ1 A;  1DCU A;  2OX3 A;  4I3Y A;  2FIX A;  5I3S A;  3QMF A;  3RPL B;  3BIH A;  4FBP A;  3T0J A;  4GWU A;  4KXP A;  1INP A;  1LBX A;  1YXI A;  1NUW A;  3RYD A;  1RDZ A;  1NV2 A;  1FPD A;  4GWY A;  5FBP A;  1YZ0 A;  1BK4 A;  2F3B A;  2QVV A;  1FBF A;  4GWS A;  4I40 A;  4IR8 A;  1FPI A;  4I3E A;  3KC1 A;  1LEV A;  2JJK A;  3BIG A;  3D1R A;  1DK4 A;  5EQA A;  2BJI A;  5IZ3 B;  1DBZ A;  5ET5 A;  2FBP A;  4HE1 A;  1FSA A; 
#chains in the Genus database with same CATH topology
 3CI8 A;  3MJN A;  4U1O A;  1MQG A;  2F36 A;  4QSC A;  2AIX A;  3PD9 A;  2F6G A;  2D5W A;  4KYS A;  4QRZ A;  4R9G A;  1FPJ A;  1MQJ A;  3FJ7 A;  3VE1 B;  2CEY A;  3BFT A;  3K1M A;  4X1D A;  3PUX E;  3PPP A;  2DP8 A;  4RPO A;  3QK6 A;  3FV2 A;  3O6H A;  3S4U A;  2F34 A;  5DVJ A;  2P3N A;  3TUS A;  1IXH A;  5IKB A;  1JVY A;  3T93 B;  1HSE A;  2WEF A;  1P1W A;  2B4M A;  5JTY B;  4PGP A;  5IZ3 A;  2XXX A;  1JEU A;  3MBP A;  4F31 B;  1FCK A;  2QS1 A;  4PP0 A;  2HAU A;  1A40 A;  5I57 A;  4DLD A;  2P0S A;  3S9L C;  5I2N A;  3EKI A;  4RNS A;  5BWJ A;  4OVJ A;  3H06 B;  2NWJ A;  3P7I A;  1Q1K A;  1MXX A;  4ZED A;  2BJJ X;  4YAH X;  4TLM B;  2DOJ A;  2OBG A;  3T9U A;  2QVV A;  4BDO A;  4U4S A;  4IR8 A;  1Y3Q A;  5L9O A;  2XXH A;  3O2A A;  4HS7 A;  2B4L A;  5FTI A;  1YPN A;  3G3H A;  5M2V A;  4X1B A;  1LBZ A;  4HE2 A;  4ND9 A;  1IMA A;  2ESN A;  3HN0 A;  3LSW A;  4EXK A;  1A55 A;  4BDL A;  4F1Y A;  1MQD A;  2QS4 A;  3E4R A;  3BBR A;  4NF6 A;  5EYH A;  4GD5 A;  3Q25 A;  2WX9 A;  4ELQ A;  1LFI A;  3R6U A;  1G0I A;  2GHB A;  1UTH B;  5LOM A;  1RDX A;  3B8B A;  1FBH A;  2F3D A;  2HAV A;  4OEU A;  3N94 A;  1M5C A;  5DVI A;  1ZKB A;  3CVG A;  1Y4T A;  1VDW A;  3PV0 E;  3WAF A;  1FTJ A;  1FBP A;  1P1Q A;  4YB5 A;  1S50 A;  1GVC A;  2H98 A;  5J16 A;  4O94 A;  2PVU A;  1MG1 A;  3I5O A;  3U1O A;  3PMX A;  4OFJ A;  5EYF A;  1K9Z A;  1NNP A;  4EQ7 A;  5H8H B;  3BKI B;  4IO7 A;  1MM6 A;  5I58 B;  4PDD A;  2D3I A;  4OYV A;  1USY H;  2DVZ A;  1O64 A;  2QL3 A;  3MW0 A;  1NNT A;  4AB5 A;  1TXF A;  2XWK A;  5IZZ A;  3LSL A;  1FQF A;  1UIV A;  5JTY A;  3RT6 B;  1DBZ A;  3K6W A;  4ZZA A;  3K02 A;  4O7M A;  5EHM A;  3D4C A;  4GX6 A;  4YMA A;  5CMK A;  2RF1 A;  4C0R A;  4MH5 A;  4JVC A;  3FV1 A;  4GWW A;  5DEX B;  2Q88 A;  2H9B A;  5H8N B;  1FTM A;  3GBA A;  1IIT A;  1P1U A;  4DCY A;  1MY1 A;  4GWX A;  3TTN A;  5ELV A;  5DW8 A;  4QHQ A;  4ELO A;  1NNF A;  1JET A;  4LQ2 A;  3MVW A;  4G8H A;  1QKB A;  1SW4 A;  1FQB A;  4JWX A;  3FJG A;  1NMU A;  3VFJ A;  5TP9 A;  1XC1 A;  2WYP A;  4OEN A;  3SET A;  4G77 A;  3RGY A;  1FRP A;  4YB7 A;  1NV0 A;  1O7T A;  3IB2 A;  4G61 A;  1UTB A;  3SEV A;  2YJP A;  3QXM A;  1JW5 A;  4RA1 A;  1N76 A;  3IFA A;  4HW8 A;  1NI9 A;  4OAN A;  3TQL A;  4H67 A;  3RTW B;  1YTV A;  1EZP A;  4RYA A;  2FIX A;  3E79 A;  1AL3 A;  1IEJ A;  1UTH A;  3CG1 A;  2O7U A;  2R6G E;  3W9V A;  3EHU A;  4YIC A;  1FQD A;  1MPC A;  5DTB A;  4E0W A;  3G3J A;  1FSA A;  2DE4 A;  1A8E A;  3CFX A;  1F9B A;  2XWO A;  3FXR A;  3O6G A;  3B6Q A;  4MBP A;  2Q89 A;  4RPN A;  1EYI A;  2IA4 A;  3T9H B;  3W9W A;  5ET6 A;  2DE3 A;  5H8H A;  3FVG A;  4O8M A;  4I62 A;  2O68 A;  4NHB A;  1P1N A;  4MLQ A;  4ZE9 A;  4H8J A;  5I58 A;  5EQ9 A;  1NV3 A;  1II5 A;  2Q2C A;  1SI0 A;  4HTG A;  3RTF B;  2DE2 A;  3SZP A;  2QS2 A;  4EDP A;  3RUM A;  2E1S A;  2KLF A;  2REJ A;  1IUD A;  3ZS6 A;  4GWZ A;  2F97 A;  4XEQ A;  4P0I A;  3LUZ A;  2I0C A;  1LAF E;  1G0H A;  3KOT A;  4KCC A;  1ZTY A;  4O3A A;  1Y1Z A;  3ISP A;  4F1U A;  3E78 A;  4P1L A;  5DEX A;  5F24 A;  1KZ8 A;  4F1V A;  5H8N A;  4Z0I A;  2DQV A;  3ZSF A;  3MAM A;  2ZNT A;  2GHA A;  1URS A;  1ELJ A;  4GQO A;  2XWV A;  3OEN A;  4OES A;  1B32 A;  4OET A;  5H8F B;  2ZXT A;  4MMP A;  3QSL A;  4GL8 A;  2F3B A;  3PGF A;  4POX A;  1POT A;  4QBA A;  5EQA A;  3DLN A;  3HFU A;  3I3V A;  4AS5 A;  4H45 A;  2OWT A;  5I5P A;  3A3U A;  4DI4 B;  3MP6 A;  4JWO A;  1NV5 A;  2O84 X;  2XXV A;  2XX8 A;  4R75 A;  2THI A;  3FVK A;  1RDY A;  5HBC A;  1O63 A;  4IB2 A;  4EXL A;  4O3C A;  2I4B A;  4N6K A;  2V3U A;  4LZ5 A;  4RK2 A;  2YLN A;  4IO4 A;  5CMB A;  2QVR A;  2M8C A;  4JVI A;  4PAI A;  3IOV A;  4R74 A;  3R7X A;  4NWD A;  3S9E A;  2Y7I A;  4OEV A;  2X7Q A;  1LFH A;  3QIM A;  2RC8 A;  2UVH A;  1UQW A;  5ICQ A;  3JZJ A;  3TCG A;  2VD2 A;  5DYH A;  2CZK A;  4IY5 A;  4MFI A;  4U4X A;  1ZIU A;  3USD A;  1TT1 A;  1H76 A;  3PPN A;  2VPO A;  3EN3 A;  5F1Q A;  3PPQ A;  1FPF A;  5CRY A;  4F18 A;  2CZH A;  4PCD A;  3VVD A;  3L6H A;  4G68 A;  1H3D A;  4M1V A;  1KWH A;  2OZZ A;  2VPN A;  3TOD A;  4FBP A;  2FYI A;  4P3L A;  3UA8 A;  4DDD A;  1XVY A;  3OO8 A;  1XOC A;  1ANF A;  2OWS A;  1NV2 A;  2RC9 A;  1ZJL A;  3N26 A;  1IQ7 A;  4EQB A;  5ITO A;  3TTL A;  1LEV A;  2ZNS A;  3SEU A;  3OSQ A;  2ONS A;  3H03 A;  3EPE A;  4NF6 B;  3PMW A;  3H7M A;  2FNC A;  2XX7 A;  3OEM A;  1Q9D A;  4Q0C A;  1EZ9 A;  4FJP A;  3UGW A;  2AL5 A;  1JW1 A;  3KN8 A;  4H46 A;  4F3S A;  3AXF A;  1IIW A;  3R26 A;  1CB6 A;  5KCJ B;  2O6A A;  4GRK A;  3M8U A;  3GXA A;  3B7D A;  4MLV A;  1IXC A;  1SD3 A;  4ESW A;  3D4G A;  1CNQ A;  1LBC A;  4F29 A;  3LBS A;  3Q29 A;  5H8F A;  4YKK A;  1A54 A;  3K00 A;  4NQ8 A;  3RT8 A;  2FHY A;  4ZZE A;  3M3K A;  4KR5 A;  4MJO A;  1Y3P A;  4R6K A;  1FBE A;  1PB8 A;  4JWY A;  1CE2 A;  3OD7 A;  3O97 A;  3VXB A;  4EF2 A;  1PBQ A;  3CR9 A;  2Q74 A;  1IXG A;  1YCJ A;  4XIG Q;  5I7I A;  2HXR A;  5H8Q B;  5B70 A;  5T3J A;  1UIU A;  1MQI A;  3KEI A;  1LB9 A;  3HCQ A;  1M5B A;  3WAE A;  3TEL A;  2Y7K A;  4KPT A;  1N3W A;  2VGQ A;  5TPA B;  3MVY A;  2D21 A;  1ZU0 A;  5H8S A;  1LBX A;  3KOS A;  1S9T A;  1FQA A;  3PMV A;  1OIB A;  4JSO A;  1MY4 A;  4U21 A;  1B5I A;  2AYS A;  4I3E A;  3BIG A;  3S9M C;  2FBP A;  3MZ1 A;  3KSJ A;  4MX6 A;  1P99 A;  4JB7 A;  1FTO A;  3GBB A;  3SKP A;  2H25 A;  4QF9 A;  2HZK A;  4DCX A;  3CIJ A;  1T0K A;  3PUW E;  4MCO A;  2MKZ A;  3QAX A;  2FVZ A;  2Y5L A;  2QSX A;  2ONR A;  1B3L A;  1AOV A;  4O7I A;  5EYG A;  4NF4 B;  4LA9 A;  4AB6 A;  4F22 A;  4NF8 B;  2KQZ A;  4PTK A;  5TP9 B;  5FHM A;  4RY1 A;  3C9H A;  4IO2 A;  3I6V A;  4LP2 B;  1FTK A;  1QUL A;  4X9T A;  4F3G A;  3MP8 A;  3JV9 A;  1UTB B;  1XS5 A;  3A3C A;  2Y5K A;  2ZZV A;  5ISU A;  3B50 A;  4R73 A;  1L5T A;  4K3F A;  1PB7 A;  2A5S A;  4PFT A;  1NV4 A;  4DIG A;  2DXR A;  3BFU A;  4E0X A;  1JEV A;  2P3V A;  3FAS A;  2F6P A;  3TPA A;  4F2O A;  2H99 A;  1XT8 A;  3PU5 A;  3OMB A;  1H44 A;  5EQ7 A;  2I3W A;  4C1U A;  2UVI A;  1ZMG A;  4H65 A;  1D9Q A;  5KCJ A;  3FXQ A;  4X48 A;  1B58 A;  4KD5 A;  3TDJ A;  3VLW A;  3N6U A;  1B4Z A;  4NAP A;  3CRB A;  1INP A;  3M3F A;  1YXI A;  4TOZ A;  4P8B A;  1RDZ A;  4FOR A;  2RCB A;  4GWY A;  1J1N A;  4DXU A;  4Z7E A;  2IEE A;  2H5Y A;  1FPI A;  4DZ1 A;  4THI A;  2L5V A;  2BJI A;  3MPL A;  1PDA A;  1AIV A;  4NED A;  1D4N A;  3MPK A;  3OXN A;  5TU0 A;  1FJ9 A;  1H45 A;  2O51 A;  4N15 A;  5H8Q A;  4PE5 B;  2B65 A;  4UA8 A;  2G29 A;  5AA1 A;  1IMC A;  4P9K A;  4JVD A;  2R9J A;  1NV1 A;  5TPA A;  2HHM A;  2QPQ A;  1MXZ A;  3B6T A;  4XTC Q;  2V84 A;  1Y4C A;  4M4G A;  3H3G A;  3RPW A;  1OMP A;  4IGT A;  4LAT A;  3U92 A;  1B7Z A;  2Q8M A;  3RNN A;  1N7W A;  2VOZ A;  3THI A;  3L6G A;  1XHY A;  4QFO A;  1H43 A;  3U94 A;  4NWC A;  4MIJ A;  1Q35 A;  3S2V A;  3DP4 A;  1WDN A;  2HZL A;  2QRY A;  3A09 A;  1EYK A;  4FED A;  1ATG A;  4NF4 A;  1QUJ A;  4EUO A;  4NF8 A;  2I48 A;  5J1D A;  1AMF A;  3FJM A;  4U2R A;  1LCT A;  4OVT A;  4I3Y A;  2PBW A;  4PC9 A;  2OLB A;  3E13 X;  4WEP A;  2O69 A;  1NH8 A;  5I2K B;  1B5H A;  5ICT A;  4AQ4 A;  2I6E A;  4OFO A;  4I40 A;  4ECF A;  2VHA A;  3D1R A;  1BP5 A;  4OVR A;  1I6B A;  5I59 A;  4PGN A;  2I49 A;  3T22 A;  4IO6 A;  4GBW A;  1Y1M A;  1EZO A;  1QUI A;  2NOO A;  1SDX A;  4LZ7 A;  1YAE A;  3H4Z A;  1FPK A;  5CMM A;  3KGC A;  3IOR A;  3PTY A;  1GV8 A;  5AE4 A;  1R6Z A;  3MUQ A;  1I69 A;  1MDQ A;  3DP8 A;  2CEX A;  2Z23 A;  1NV7 A;  3MZB A;  4WXJ A;  4KCD A;  3HST A;  1SI1 A;  3QUF A;  3IB1 A;  4NF0 A;  3S9N C;  2Z22 A;  4RXL A;  1LBW A;  2XXI A;  3CSG A;  3IB0 A;  2NUV A;  3G7W A;  1MPB A;  2ALU A;  5EHS A;  1ZBM A;  2CMO A;  2B3F A;  4G68 B;  3OOA A;  3C34 A;  2O1L A;  3PUY E;  1LBV A;  5CI5 A;  3LSX A;  1QVS A;  4H0W A;  5CC2 A;  3UN6 A;  3VVE A;  1FBG A;  2ZNU A;  3MVX A;  3V8X B;  4OVQ A;  3K01 A;  1NUZ A;  4F2Q A;  1B3H A;  1BTJ A;  2DVC A;  3EHS A;  5IGA A;  2ZYK A;  4PET A;  5I3S A;  1NL5 A;  2XXQ A;  3RPL B;  3ILU B;  1B52 A;  3MST A;  4GWU A;  1N3X A;  3TCH A;  4ESX A;  3CHG A;  1NUW A;  3OO6 A;  4OTE A;  3VVF A;  1LAX A;  3T96 B;  3SER A;  3HPI A;  3K2D A;  3VV5 A;  4GXS B;  4LQ5 A;  4G4P A;  1BKA A;  4N13 A;  4ZS9 A;  3TTM A;  3FZV A;  3HHG A;  4QFP A;  1GGG A;  5A5X A;  3TZA A;  3TQW A;  1LFG A;  2F78 A;  3PPO A;  4ISU A;  3FUZ A;  4ZEB A;  1Y3N A;  4NG7 A;  1B3F A;  2PX1 A;  1B3E A;  1NV6 A;  5DVF A;  4R6H A;  4OFL A;  4F19 A;  5I84 A;  4HXV A;  4PE3 A;  4N4U A;  1K9Y A;  1OLA A;  3KBZ A;  4FE8 A;  4JSD A;  1QJM A;  3LUY A;  1DMB A;  3GYY A;  5HPQ A;  3PD8 A;  1OVB A;  2DS9 A;  2XHD A;  4GLI A;  1KA0 A;  4I9D A;  1DTZ A;  1R1N A;  1LBB A;  2HXW A;  4DXB A;  5ET7 A;  1R9L A;  2Y7P A;  3ODB A;  2QMX A;  3B6W A;  1N0T A;  4ZEC A;  5I2K A;  2XX9 A;  3K1N A;  4I8C A;  1QGX A;  1Z7M E;  1LLS A;  4QSE A;  5KDT A;  2WBB A;  3W15 C;  2OCU A;  2UXA A;  1AWB A;  3V89 B;  2F5X A;  2OPE A;  4YKJ A;  4MEV A;  1KA1 A;  3HV1 A;  2I3V A;  2ZYO A;  1A7L A;  2ZYN A;  5FHN A;  2VT5 A;  5AA4 B;  1FPG A;  1B4H A;  2XA5 A;  3IJO B;  3MC2 A;  3QMF A;  3FVO A;  5L9M A;  1NFT A;  1PEB A;  4R72 A;  4KXP A;  3PUV E;  1IZ1 A;  3DEL B;  4Q30 B;  4P11 A;  2V25 A;  3ONM A;  4I1D A;  3MP1 A;  4QFK A;  4QSD A;  1DTG A;  1FW0 A;  4L17 A;  1DK4 A;  4H1X A;  1B3G A;  3RLF E;  3TAJ A;  3GLB A;  5AA3 A;  1GTK A;  2DDK A;  1PC3 A;  2FA7 A;  2WBD A;  2I58 A;  3IAZ A;  2GRV A;  1HSL A;  3TEP A;  1YYZ A;  3O9P A;  3IFC A;  4KYD A;  1M5F A;  1VR5 A;  2PYY A;  3SDF A;  1B7H A;  3RPL A;  4NE4 A;  4OQO A;  3K6U A;  2I4C A;  1B0L A;  2F8D A;  2QFL A;  4GOT A;  3O29 A;  1FJ6 A;  4G2Z A;  1IMF A;  1IMB A;  3KN7 A;  4PBH A;  1B7U A;  4KQP A;  4QFN A;  5K2X A;  4GL0 A;  2XXR A;  4DI3 D;  4PAK A;  1FPE A;  2DWH A;  4NMY A;  2Z8F A;  4P56 A;  3TTR A;  3LV0 A;  1EU8 A;  1MXY A;  2UVG A;  2QMW A;  2ZZX A;  2CZL A;  5L9S A;  2OPD A;  3EF7 A;  4ZDM A;  4N8Y A;  3QYT A;  3UOR A;  2OWZ A;  3C32 A;  1JVX A;  3N6T A;  3E3K A;  1USY E;  1RYO A;  3IL1 B;  4BDM A;  2Q8J A;  1MY2 A;  3BIH A;  1TWY A;  3LC8 A;  3IK6 B;  4YB6 A;  4FIM A;  4OMB A;  1BIY A;  4NF5 B;  1SQY A;  3K6V A;  3RN8 A;  2W7Y A;  1SW2 A;  4ZEI A;  5HM4 B;  1B2H A;  3FAT A;  3OO7 A;  3KJT A;  5ITP A;  3FGS A;  1VE4 A;  4KHZ E;  1BK4 A;  4YZZ A;  4OER A;  3KFM A;  3CSB A;  2Q2A A;  4FEB A;  1LB8 A;  4QFL A;  2DWA A;  3SEW A;  4HE1 A;  3U72 A;  2I0B A;  4GX4 A;  1NKX A;  1MH4 A;  2P2A A;  1VFD A;  3M3L A;  1MXU A;  1FBC A;  5AA4 A;  3TMG A;  4MNI A;  3TYH A;  4XF5 A;  1TFD A;  1N04 A;  4LUB A;  3IOT A;  2R8T A;  5AA2 D;  4GWO A;  3ILT B;  4FEC A;  4IGR A;  1MM7 A;  4DXC A;  4KFQ A;  4IO5 A;  2X26 A;  4NN3 A;  4TLL B;  2GFE A;  2Y7R A;  1POY 1;  1URG A;  3OEL A;  1WOD A;  4LON B;  2O7I A;  3RY3 A;  3UK4 A;  2NXO A;  1NUY A;  4Q5T A;  5A5L A;  4UAC A;  2OK2 A;  1LBY A;  3K0V A;  4FAJ A;  2XD3 A;  3KG2 A;  1SYH A;  4PFR A;  3C31 A;  1B0H A;  3DM0 A;  1SPI A;  3C33 A;  2WKY A;  2PCR A;  4POW A;  2HQ0 A;  3FBP A;  3O28 A;  3IOU A;  2OX3 A;  4G68 C;  4PF8 A;  5I59 B;  4P1E A;  3N5L A;  3Q28 A;  2DYX A;  4XXU A;  4H8I A;  1B51 A;  4GIZ A;  1FPD A;  3HO7 A;  4PF6 A;  2E0S A;  5FBP A;  4MF3 A;  2DWJ A;  4PFY A;  1FBF A;  2JJK A;  2RC7 A;  4YMB A;  3CFZ A;  3KN3 A;  2ZZW A;  5AA2 B;  2XXU A;  2DXY A;  1PBP A;  4R6Y A;  1DPE A;  5LDZ A;  5FTH A;  2XXW A;  5IZ1 A;  1FBD A;  4U23 A;  4JXI A;  2R71 A;  1WVJ A;  1M5D A;  4JDF A;  3OEK A;  1URD A;  1NNK A;  1JNF A;  3U8Q A;  4LVQ A;  3O6I A;  5JEI A;  3O66 A;  1QW0 A;  1Y20 A;  4PQJ A;  4N81 A;  2XXP A;  3ROJ A;  4WKM A;  2UVJ A;  3TKD A;  3KC0 A;  4NF5 A;  4P0G A;  4IY6 A;  4XKR A;  2QVU A;  5K2Y A;  4GBV A;  3A29 A;  1FQE A;  4FAT A;  1A8F A;  1D3K A;  4H5F A;  3CFL A;  3IO6 A;  3HHF A;  4C1T A;  2ANJ A;  2F7C A;  2NVU B;  4PFU A;  1QUK A;  2LAO A;  4EQ9 A;  1B46 A;  2PMS A;  1I6A A;  4HCW A;  4ZE8 A;  3T1B A;  3KJ7 A;  2FIE A;  1Z7N E;  4ZEK A;  2ZMB A;  1RKM A;  4GX3 A;  5CBS A;  2H4I A;  4X8R A;  3VLU A;  1LAH E;  1FTL A;  3TTK A;  3G3F A;  3LSF B;  5A5X B;  3SES A;  4N6D A;  5IM2 A;  2OJT A;  1GR2 A;  2RCA A;  4XFE A;  3GZG A;  5I56 B;  3T9V A;  3PUZ E;  4KI0 E;  4GWS A;  4PFW A;  2Y84 A;  3KC1 A;  4GF8 A;  3VLV A;  3C36 A;  5JK4 A;  5L8D A;  4BDQ A;  1HSJ A;  3IJX B;  2Z8D A;  4U22 A;  4R2B A;  1NUX A;  4UAB A;  1N7X A;  3EHT A;  1IMD A;  3SEX A;  1LST A;  4IO3 A;  3Q27 A;  5EQ8 A;  1SBP A;  2HPG A;  5KDT B;  4OZ9 A;  4AS4 A;  4O3B A;  3OSR A;  4NGU A;  3DP6 A;  4NTL A;  1R9Q A;  1JW4 A;  3MWB A;  1N84 A;  4N17 A;  4R2F A;  2DWI A;  5AA2 A;  1JQF A;  1MPD A;  4MNP A;  4PFI A;  1EYJ A;  3IOW A;  1QKA A;  1OLC A;  2XWI A;  2AL4 A;  4ONY A;  4YKP A;  4BDR A;  1LAG E;  4HE0 A;  5LTC A;  5CM6 A;  2GH9 A;  4DE8 A;  1XI6 A;  3K6X A;  1DCU A;  1LGB C;  3EQ1 A;  3G3K A;  3Q26 A;  3H6W A;  3T0J A;  1ZLQ A;  3SEY A;  3FD3 A;  3QUJ A;  4N6P A;  4PFB A;  4MNC A;  2F7A A;  1MY3 A;  2V3Q A;  2V3T A;  1TFA A;  2DSF A;  4HCY A;  1SW1 A;  2ZYM A;  3MYU A;  2XXT A;  1DSN A;  3G3G A;  2HEU A;  5KZT A;  2Y7W A;  1B9J A;  4F39 A;  5ET5 A;  4XKP A;  3MQ9 A;  1B6H A;  2REG A;  1SW5 A;  3V5A A;  2X7P A;  5IAI A;  1MS7 A;  1S7Y A;  1LCF A;  3KBR A;  4MAG A;  2HCA A;  2PFZ A;  3NOH A;  1MH3 A;  4H5G A;  2A5T B;  3ZKL A;  4LZ8 A;  1NH7 A;  1RYX A;  4JBZ A;  4N91 A;  3G3I A;  1MQH A;  3UP9 A;  4F3P A;  4N8G A;  1OQH A;  2UYE A;  4KYE A;  4RJZ A;  4RK9 A;  1EH3 A;  4G8M A;  3KSX A;  5ESY A;  5I56 A;  4Q8R A;  4LN5 A;  4PAF A;  4GXA A;  1FTA A;  1Y9U A;  2PT2 A;  5FHO A;  1AH5 A;  1B5J A;  5ET8 A;  4TQU Q;  5BUU A;  1US4 A;  3PPR A;  1A99 A;  4H6D A;  1I6Q A;  3TCF A;  4OA4 A;  3ZKK A;  1OQG A;  4N07 A;  1MRP A;  1JP4 A;  4MHF A;  1MY0 A;  4OHN A;  2YPN A;  2WYK A;  2B3B A;  2ONK E;  3JYR A;  4ELR A;  1OVT A;  1XVX A;  2F35 A;  2P1S A;  1VFE A;  5DT6 A;  1D9Y A;  1MDP 1;  3H6V A;  2VD3 A;  3H6T A;  4GFR A;  3IR1 A;  5CMC A;  4PBQ A;  3MVZ A;  1PB9 A;  4YKI A;  4XKQ A;  1DOT A;  3MZ9 A;  1D9V A;  3K4U A;  4X04 A;  1US5 A;  2Q9T A;  3T66 A;  3E9X A;  3CG3 A;  4GVO A;  5IZ3 B;  3KZG A;  2PFY A;  4G8N A;  2RIN A;  1IME A;  2CZI A;  4OVP A;  3FXB A;  4BLA A;  3V83 A;  5I57 B;  3IX1 A;  1SYI A;  5I2N B;  3T9X B;  1IXI A;  4NX1 A;  3OO9 A;  2KR0 A;  4EF1 A;  3LR1 A;  3TFL A;  2VP1 A;  1BLF A;  2XD2 A;  4BDN A;  3H6U A;  4QXD A;  2XXY A;  1FPB A;  3RQT A;  1B05 A;  4F3B A;  3VDF A;  3UIF A;  2UYF A;  2QJE A;  4P47 A;  3U65 A;  1MXV A;  2XXK A;  2QS3 A;  4WED A;  4ZEF A;  3C35 A;  3IO4 A;  2A5T A;  3C4M A;  1FPL A;  2F7B A;  3FIR A;  2ABH A;  1B1H A;  2PT1 A;  4OVS A;  5B7D A;  1FQC A;  2GQ1 A;  3F11 A;  4YU0 A;  1B40 A;  2G93 A;  1SVX B;  2RKM A;  3K1P A;  1M5E A;  3ECR A;  4R9F A;  4XKN A;  2V93 A;  4ELP A;  3RYD A;  3FXU A;  1MXW A;  5CBR A;  2HFB A;  1B1X A;  1YZ0 A;  3VXC A;  2V4C A;  4PDH A;  3FVN A;  2Z8E A;  1DPP A;  5F7V A;  4U1Z A;  4OWD A;  1VSO A;  4OXV A;  1P1O A;  2O1M A;  3U93 A; 
#chains in the Genus database with same CATH homology
 5LDZ A;  4PGN A;  4AS5 A;  4H45 A;  5IZ1 A;  1FBD A;  5I5P A;  1FPJ A;  4GBW A;  4DI4 B;  1NV5 A;  2CEY A;  1FPK A;  3PTY A;  1RDY A;  4N81 A;  3ROJ A;  4N6K A;  2CEX A;  3KC0 A;  2P3N A;  1NV7 A;  2QVU A;  4GBV A;  4NF0 A;  2QVR A;  4PAI A;  4JVI A;  3A29 A;  1LBW A;  2WEF A;  2B4M A;  4PGP A;  2CZK A;  5IZ3 A;  1LBV A;  4HCW A;  2VPO A;  3T1B A;  3EKI A;  1FPF A;  1FBG A;  4F18 A;  2CZH A;  2FIE A;  4PCD A;  4OVQ A;  1NUZ A;  4GX3 A;  4X8R A;  4M1V A;  5IGA A;  4PET A;  5I3S A;  3RPL B;  2VPN A;  4N6D A;  4FBP A;  4P3L A;  3MST A;  4GWU A;  5IM2 A;  3CHG A;  1NUW A;  4XFE A;  1NV2 A;  2QVV A;  4GWS A;  4IR8 A;  3KC1 A;  1LEV A;  5JK4 A;  2B4L A;  1LBZ A;  4HE2 A;  1Q9D A;  4NG7 A;  1IMA A;  1NV6 A;  4H46 A;  4F19 A;  1NUX A;  4HXV A;  4UAB A;  4PE3 A;  4N4U A;  1IMD A;  1K9Y A;  3KBZ A;  3GYY A;  5EQ8 A;  5EYH A;  2WX9 A;  2HPG A;  1KA0 A;  4AS4 A;  1G0I A;  4NGU A;  1CNQ A;  5ET7 A;  1RDX A;  3B8B A;  4NQ8 A;  1FBH A;  2F3D A;  2FHY A;  4N17 A;  1QGX A;  4MJO A;  1VDW A;  2WBB A;  1FBE A;  1FBP A;  4MNP A;  1AWB A;  4PFI A;  1EYJ A;  2F5X A;  2Q74 A;  5J16 A;  4O94 A;  2XWI A;  5I7I A;  2HXR A;  4MEV A;  5T3J A;  4HE0 A;  1KA1 A;  5LTC A;  1K9Z A;  5CM6 A;  1XI6 A;  2VT5 A;  1FPG A;  1DCU A;  2XA5 A;  3QMF A;  3T0J A;  4KXP A;  4PDD A;  1LBX A;  4PFB A;  4MNC A;  2DVZ A;  2XWK A;  5IZZ A;  2V3Q A;  4HCY A;  3MYU A;  4I3E A;  3BIG A;  1DK4 A;  1DBZ A;  5ET5 A;  2FBP A;  4O7M A;  4MX6 A;  4GX6 A;  4JVC A;  4MAG A;  2HZK A;  4GWW A;  2DDK A;  2PFZ A;  2WBD A;  3NOH A;  4MCO A;  2MKZ A;  2FVZ A;  2Y5L A;  1YYZ A;  4O7I A;  3IFC A;  5EYG A;  4N91 A;  3RPL A;  2KQZ A;  4PTK A;  4GWX A;  4N8G A;  2QFL A;  1FJ6 A;  1IMF A;  1IMB A;  5DW8 A;  4X9T A;  5ESY A;  2Y5K A;  2ZZV A;  4LN5 A;  3B50 A;  4PBH A;  4PAF A;  4DI3 D;  4PAK A;  1FTA A;  1FPE A;  1NV4 A;  2WYP A;  4P56 A;  2P3V A;  3LV0 A;  5ET8 A;  1FRP A;  2ZZX A;  1NV0 A;  4G61 A;  5EQ7 A;  4OA4 A;  4N8Y A;  1JP4 A;  2OWZ A;  4MHF A;  1D9Q A;  3IFA A;  1NI9 A;  2WYK A;  4OAN A;  2FIX A;  3BIH A;  4NAP A;  3E79 A;  1INP A;  1YXI A;  4PBQ A;  4P8B A;  1RDZ A;  3W9V A;  4GWY A;  1BK4 A;  4YZZ A;  4X04 A;  4YIC A;  2Q9T A;  1FPI A;  2L5V A;  2BJI A;  5IZ3 B;  2PFY A;  4HE1 A;  1FSA A;  2DE4 A;  1IME A;  2CZI A;  4OVP A;  3FXB A;  4GX4 A;  2XWO A;  1FJ9 A;  4N15 A;  4NX1 A;  2KR0 A;  1EYI A;  1IMC A;  4P9K A;  4JVD A;  1FBC A;  3W9W A;  5ET6 A;  2DE3 A;  1NV1 A;  4O8M A;  4MNI A;  4XF5 A;  4NHB A;  2HHM A;  2QPQ A;  2R8T A;  5EQ9 A;  1NV3 A;  4QXD A;  1FPB A;  2DE2 A;  3SZP A;  4NN3 A;  2Q8M A;  4P47 A;  3U65 A;  4GWZ A;  4XEQ A;  3LUZ A;  2XXK A;  1G0H A;  4MIJ A;  1NUY A;  5A5L A;  3ISP A;  4F1U A;  1LBY A;  3E78 A;  4P1L A;  1FPL A;  5F24 A;  2HZL A;  4PFR A;  1SPI A;  1KZ8 A;  1EYK A;  4F1V A;  2PCR A;  4OVS A;  3FBP A;  2GQ1 A;  5J1D A;  4OVT A;  2OX3 A;  4I3Y A;  4PF8 A;  4PC9 A;  2XWV A;  3RYD A;  4P1E A;  1FPD A;  4PF6 A;  5FBP A;  4MMP A;  1YZ0 A;  2V4C A;  4PDH A;  2F3B A;  1FBF A;  4I40 A;  2JJK A;  3D1R A;  4QBA A;  5EQA A;  2ZZW A;  3HFU A;  4OVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...