2CZOA

Solution structure of the px domain of bem1p
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
130
structure length
130
Chain Sequence
KSAKLVDGELLVKASVESFGLEDEKYWFLVCCELSNGKTRQLKRYYQDFYDLQVQLLDAFPAEAGKLRDAGGQWSKRIMPYIPGPVPYVTNSITKKRKEDLNIYVADLVNLPDYISRSEMVHSLFVVLNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bud emergence protein 1
publication title Solution structure of the PX domain of Bem1p
rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 18
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2005-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 2czoA00
3DYTA 1O7KA 2L73A 2V14A 2RAKA 4PQPA 4HASA 4PZGA 4P2JA 2REAA 2CSKA 3HPBA 2YPSA 3IQ2A 2DYBA 3P0CA 4BGJA 2REDA 4AKVA 2V6VA 4ON3A 4IKDA 4IKBB 3HPCX 1KQ6A 2CZOA 1XTEA 3FOGA 4P2IA 4OXWA 1KMDA 2ETTA 2RAIA 2WWEA 4PQOA 3LUIA 4AZ9A 2I4KA 1OCUA 2AR5A 1OCSA 1GD5A 2IWLX 2RAJA 1H6HA 4IKBA 1XTNA
chains in the Genus database with same CATH superfamily
3DYTA 1O7KA 2L73A 2V14A 2RAKA 4PQPA 4HASA 4PZGA 4P2JA 2REAA 2CSKA 3HPBA 2YPSA 3IQ2A 2DYBA 3P0CA 4BGJA 2REDA 4AKVA 2V6VA 4ON3A 4IKDA 4IKBB 3HPCX 1KQ6A 2CZOA 1XTEA 3FOGA 4P2IA 4OXWA 1KMDA 2ETTA 2RAIA 2WWEA 4PQOA 3LUIA 4AZ9A 2I4KA 1OCUA 2AR5A 1OCSA 1GD5A 2IWLX 2RAJA 1H6HA 4IKBA 1XTNA
chains in the Genus database with same CATH topology
3DYTA 1O7KA 2L73A 2V14A 2RAKA 4PQPA 4HASA 4PZGA 4P2JA 2REAA 2CSKA 3HPBA 2YPSA 3IQ2A 2DYBA 3P0CA 4BGJA 2REDA 4AKVA 2V6VA 4ON3A 4IKDA 4IKBB 3HPCX 1KQ6A 2CZOA 1XTEA 3FOGA 4P2IA 4OXWA 1KMDA 2ETTA 2RAIA 2WWEA 4PQOA 3LUIA 4AZ9A 2I4KA 1OCUA 2AR5A 1OCSA 1GD5A 2IWLX 2RAJA 1H6HA 4IKBA 1XTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DYT A;  1O7K A;  2L73 A;  2V14 A;  2RAK A;  4PQP A;  4HAS A;  4PZG A;  4P2J A;  2REA A;  2CSK A;  3HPB A;  2YPS A;  3IQ2 A;  2DYB A;  3P0C A;  4BGJ A;  2RED A;  4AKV A;  2V6V A;  4ON3 A;  4IKD A;  4IKB B;  3HPC X;  1KQ6 A;  2CZO A;  1XTE A;  3FOG A;  4P2I A;  4OXW A;  1KMD A;  2ETT A;  2RAI A;  2WWE A;  4PQO A;  3LUI A;  4AZ9 A;  2I4K A;  1OCU A;  2AR5 A;  1OCS A;  1GD5 A;  2IWL X;  2RAJ A;  1H6H A;  4IKB A;  1XTN A; 
#chains in the Genus database with same CATH topology
 3DYT A;  1O7K A;  2L73 A;  2V14 A;  2RAK A;  4PQP A;  4HAS A;  4PZG A;  4P2J A;  2REA A;  2CSK A;  3HPB A;  2YPS A;  3IQ2 A;  2DYB A;  3P0C A;  4BGJ A;  2RED A;  4AKV A;  2V6V A;  4ON3 A;  4IKD A;  4IKB B;  3HPC X;  1KQ6 A;  2CZO A;  1XTE A;  3FOG A;  4P2I A;  4OXW A;  1KMD A;  2ETT A;  2RAI A;  2WWE A;  4PQO A;  3LUI A;  4AZ9 A;  2I4K A;  1OCU A;  2AR5 A;  1OCS A;  1GD5 A;  2IWL X;  2RAJ A;  1H6H A;  4IKB A;  1XTN A; 
#chains in the Genus database with same CATH homology
 3DYT A;  1O7K A;  2L73 A;  2V14 A;  2RAK A;  4PQP A;  4HAS A;  4PZG A;  4P2J A;  2REA A;  2CSK A;  3HPB A;  2YPS A;  3IQ2 A;  2DYB A;  3P0C A;  4BGJ A;  2RED A;  4AKV A;  2V6V A;  4ON3 A;  4IKD A;  4IKB B;  3HPC X;  1KQ6 A;  2CZO A;  1XTE A;  3FOG A;  4P2I A;  4OXW A;  1KMD A;  2ETT A;  2RAI A;  2WWE A;  4PQO A;  3LUI A;  4AZ9 A;  2I4K A;  1OCU A;  2AR5 A;  1OCS A;  1GD5 A;  2IWL X;  2RAJ A;  1H6H A;  4IKB A;  1XTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...