2CZUA

Lipocalin-type prostaglandin d synthase
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
155
structure length
153
Chain Sequence
b'QQDKFLGRWYSAGLASNSSWFREKKAVLYMAKTVVAPSTEGGLNLTSTFLRKNQCETKIMVLQPAGAPGHYTYSSSGSIHSVSVVEANYDEYALLFSRGTKGPGQDFRMATLYSRTQTLKDELKEKFTTFSKAQGLTEEDIVFLPQPDKCIQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostaglandin-H2 D-isomerase
publication title Structural basis of the catalytic mechanism operating in open-closed conformers of lipocalin type prostaglandin D synthase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Isomerase
total genus 32
structure length 153
sequence length 155
chains with identical sequence B
ec nomenclature ec 5.3.99.2: Prostaglandin-D synthase.
pdb deposition date 2005-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2czuA00
1PBOA 4Y0PA 4O9SA 2CZUA 4I3CA 2DM5A 3L4RA 1YWBA 5H9NA 2WQ9A 4MVIA 3FENA 1QY2A 1SA8A 5B27A 3EM0A 3FELA 1IKEA 1I04A 3WXQA 1BRPA 1PEEA 4BQUA 4UU2A 1HQPA 2QO5A 1I4UA 4UU3A 1KT6A 1P6PA 3B2JA 1X89A 2P8GA 2WQAE 4EDEA 1OBQA 2CBSA 2FR3A 2FT9A 4QGXA 3KFGA 4YBUA 4HPDA 4TQ2A 1IW2A 1E02A 5CE4A 2XKLA 2QOSC 1LF7A 4ZR2A 2MM3A 5HWZA 5KHPA 4IMNA 4TKJA 2LFOA 5EEDA 4GRJA 1JYJA 2OVDA 5FAZA 4EXZA 1PMPA 2E4JA 3S26A 4N7CA 5D47A 2BLGA 1BBPA 1QQSA 1SY3A 1CRBA 3P6GA 2ANSA 5D48A 4OS0A 3BY0A 5HTDA 1QWDA 4GNYA 5DPQA 2RD7C 5LJEA 5D4AA 3U0DA 4IB8A 5H9KA 3ZQ3A 3VG3A 1BJ7A 5H9LA 1S2PA 1MUPA 3FW4A 3UEWA 4YCHA 3KFIA 2ACPX 2QO6A 1NP1A 1DFVA 3NP1A 1D2UA 3TF6A 1AVGI 3CMPA 2K23A 5HCEC 1KGLA 1LFOA 3PH5A 1DZMA 1FENA 1U17A 5F58A 1LIDA 2W2FA 1KOIA 5EDCA 4CK4A 1O1VA 4NP1A 1TOWA 4YKMA 4IB7A 4HPCA 2WUTA 4DQ4A 1DZJA 1HMSA 3JS1A 1I06A 2HYSA 1OEKA 3CQRA 1QABE 3STNA 1MX7A 5KICA 3HWEA 3RSWA 2L9CA 4KIIA 1LNMA 1GKAB 4YGHA 3JSQA 1IIUA 1A57A 4ORYA 2AT3X 1MX8A 1EW3A 1SXYA 1U0XA 1NGLA 2OVAA 3C77X 3KQ0A 4WFUA 2OFRX 1EXSA 1O1UA 3WJEA 2O62A 3BX8A 3FEKA 3APVA 3ELXA 5IO7A 3UEXA 1DZKA 5F7GA 3TGAA 1D3SA 1LPJA 4ZH6A 2FWVA 2L5PA 4TKBA 2A2GA 3EBWA 4ORXA 3FIQA 2G7BA 3TGBA 1G7NA 4QYPA 3WJBA 3FLLA 1ERBA 1CBQA 1S7DA 5LJGA 1KZXA 4YH0A 2AT5X 1ICNA 2JU7A 5LJHA 3D97A 1SY2A 5JR8A 3CQNA 3SAOA 3FR2A 3APUA 4A1HA 4ZFXA 1X71A 5LKEA 1OBPA 3VG7A 2AH7X 1BSQA 1Z24A 4OS8A 5HZ6A 4IAWA 3WJGA 2FRSA 1DC9A 4HFOA 2NNEA 4I3DA 4ODDA 3OJYC 2JU8A 3EMMA 4ZHHA 4AZMA 1VYFA 1JYDA 4LKPA 5LJDA 3ZUOA 1IFCA 2X46A 1SY1A 2AL0X 2GJ5A 4LZVA 2POAA 3PPTA 4IAXA 4ORSA 5HA1A 5HAEA 5LJBA 1ZNKA 1GT4A 5F1EA 2WEWA 3HK1A 4IBAA 1FDQA 2WWPA 5L8IA 1LICA 4Y0QA 4EEJA 4YCEA 3IFBA 1FE3A 3DSZA 2Q4NA 4YFQA 1ADLA 4YDBA 1OEEA 3BSZE 2ASNX 2LB6A 1R0UA 1QFTA 1SXUA 2KTDA 4AW8A 4ZCBA 3VG5A 3VG6A 1CJ5A 1PM1X 1E00A 2FTBA 1OPAA 1GKAA 3PEDA 4YMYA 3P6HA 4GETA 4QGWA 3UEVA 2FS6A 1KXOA 2JU3A 2LKKA 3ELZA 4IMOA 5H8TA 1G5WA 5H9AA 1LIFA 4AZOA 1JBHA 3VG4A 3DTQA 4GKCA 4ZHFA 3RZYA 3I17A 1X8QA 3QKGA 5FFHA 3CBCA 5L8OA 1GXAA 1BWYA 1ERXA 4OS3A 1LKEA 3U9PC 3AKMA 5EPQA 4YDAA 1GM6A 2WR6A 4XMHA 4YFPA 4TJZA 1KT4A 2R56A 3HWDA 4A1YA 1H91A 2Q9SA 1X8UA 1ACDA 1T0VA 5LJCA 3I0AA 1DV9A 3NADA 5LKFA 3TZSA 1X8PA 1RBPA 2NNDA 3NX1A 4XMDA 1AB0A 2XSTA 4GE1A 1KQXA 3D95A 3FA8A 2CBRA 1QY0A 1VYGA 2ALLX 1HBQA 2CM9A 3CBSA 1GT1A 2FR2A 3G7XA 1GX9A 1LIEA 1HMTA 3KFFA 3F9DA 1E5PA 4D6AA 5HA0A 1OPBA 3WJDA 4LZUA 2L68A 2NNQA 3FR4A 1HN2A 1ZNGA 1JJXA 1IFBA 2L67A 3FA9A 3BDRA 5D8JA 2W2AA 3CR6A 1B0OA 3F8AA 4QZUA 1YWCA 1E06A 1G74A 1KT5A 2HNXA 4MVLA 4TKHA 1B56A 2ACOA 2AT6X 3WJCA 1LIBA 4I3BA 3C78X 5EZ2A 1JJJA 3WBGA 2F73A 2X45A 4M7MA 4XMCA 2A3FX 3B2HA 2K62A 2A2UA 4AZRA 3AKNA 4BVMA 3GAQA 1NP4A 2WEXA 3EYCA 1YUPA 1GT5A 3FR5A 3O19A 2HZQA 3STKA 5F6BA 2AT0X 5HZQA 5BVTA 1ZNLA 4ORUA 4RUUA 1AQBA 4GNWA 4DQ3A 4AZQA 3B2KA 4NLJA 1KT7A 4ES7A 1GX8A 4QZTA 3PP6A 2CZTA 2MJIA 1FELA 2GTFX 1DZPA 1ZNHA 3IA8A 3NPOA 1BEBA 1FTPA 2OVEA 2Q2MA 1X8NA 1SXWA 2IFBA 4AYHA 1YP6A 3O22A 2YG2A 4NLIA 1IKJA 3BLGA 3HWFA 4AZPA 1EPBA 5HCDC 1T68X 1HBPA 2R74A 4ARHA 1A3YA 1QFVA 1ZNEA 3B2LA 3MBTA 1EUOA 4XMGA 4EFGA 2KT4B 3WJFA 1KT3A 2NP1A 1GGLA 4I9RA 4QAEA 1BSYA 4OMWA 1AELA 1BLRA 2AT8X 4IB6A 1QG5A 3BX7A 3VG2A 4WFVA 4BOEA 2QM9A 1YWAA 2HMBA 4D6BA 4ZHDA 3BRNA 4K19A 3HWGA 1RLBE 5IO5A 4A8ZA 3U03A 1A18A 5F6ZA 4I9SA 1EALA 1I05A 4Y0RA 2PY1A 4YBPA 2R73A 2OZQA 5BVSA 3FA7A 4NYRA 1MVGA 1XCAA 2RCQA 2RCTA 4RUNA 4HPAA 4QYNA 4LKTA 3NX2A 4IB9A 1EPAA 4ORWA 3FW5A 1ML7A 3T1DA 5KIDA 3BU9A 5IO6A 5HBSA 1B8EA 4YKOA 1EIIA 1TVQA 4GH7A 3UEUA 4ZH9A 5EDBA 2FS7A 2G79A 3WVMA 4ZJ0A 4NNTA 4XMEA 1B4MA 1ICMA 1S44A 1BM5A 2RA6A 4HPBA 1ALBA 3EBKA 2CM4A 5FENA 5LJKA 2QO4A 1EIOA 2FLJA 2HLVA 1A2DA 2A13A 4ZHGA 4M6SA 3D96A 3KFHA 4TNNA 1GT3A 3MVFA 2JN3A 4R0BA 5DG4A 5BVQA 4OMXA 4QGVA 1OEJA 1ZNDA 5C0NA 2JOZA 1CBRA 1TOUA 4A60A 1FEMA 1EQDA 3FMZA 3FA6A 3O2YA 2LBVA 1SY0A 3P6CA 1CBSA 2AMMX 1TW4A 1VPRA 1X8OA 5B29A 4YGZA 1BRQA 4YGGA 2N93A 3P6DA 1HMRA 1YP7A 2AKQA 3APWA 4NNSA 1JV4A 1O8VA 1KZWA 4PSQA 2Q39A 1MDCA 4ZHCA 1SXXA 2W2BA 1T8VA 4MVKA 4TLJA 2EU7X 2Q2PA 1G85A 3BS2A 2A0AA 3NQ3A 4Y0SA 5EEEA 1JZUA 4ALBA 1OBUA 1UREA 1YIVA 4ZGUA 3K3LA 3CWKA 3ZUIA 2OFMX 5HZ8A 4N7DA 4YFRA 3B2IA 1KQWA 3APXA 4ORRA 5HZ5A 5D45A 3KZAA 5L8NA 1BSOA 2HZRA 3TGCA 1U18A 4ALOA 1YWDA 5HZ9A 4XMFA 3STMX 1L6MA 3C76X 3FEPA 5K06A 2GC9A 2RQ0A 2MO5A 2G78A 5HCCC 1ZRYA 3P6EA 2WSJA 1TXLA 4NYQA 4WBKA 5HTEA 3PECA 3NQ9A 1N0SA 3Q6LA 3P6FA 1QY1A 2LBAA 3NR3A 3PH6A 1DF3A 1UZ2X 4AZNA 1CBIA 5AQ6A 1XKIA 3BU1A
chains in the Genus database with same CATH superfamily
1PBOA 4Y0PA 1W5RA 4O9SA 2CZUA 4I3CA 2DM5A 4GZVA 3L4RA 1YWBA 5H9NA 1WUBA 4B55A 1SWNA 3E3CA 2WQ9A 4MVIA 3FENA 1QY2A 1SA8A 5B27A 3EM0A 3RDQA 3FELA 1IKEA 1I04A 1VWPB 3WXQA 1BRPA 1PEEA 2JMBA 1OSPO 4BQUA 4CDFA 4UU2A 4YFRA 1HQPA 4CPHA 2QO5A 1E2TA 1I4UA 4UU3A 1KT6A 3RY2A 3JQOA 1P6PA 1WBIA 1X89A 2P8GA 2WQAE 3B2JA 3N91A 4EDEA 1OBQA 4BX5A 2CBSA 2FR3A 2FT9A 3S5XA 4QGXA 3KFGA 5AEOA 1K3BA 4YBUA 2ZSCA 4HPDA 4TQ2A 1IW2A 2QOMA 1E02A 4GK9A 5CE4A 2IZHB 2XKLA 3Q34A 3SLJA 2QOSC 4BBOA 1LF7A 4ZR2A 5L3YA 2AVIA 2MM3A 3WZQA 5HWZA 5KHPA 4IMNA 4TKJA 2LFOA 5EEDA 4GRJA 1JYJA 2OVDA 5FAZA 4EXZA 1PMPA 2BC3A 2E4JA 4MEEA 3WYQA 3S26A 4N7CA 5D47A 2BLGA 1BBPA 1QQSA 1SY3A 1CRBA 1LDQA 2ANSA 3P6GA 5D48A 4O4OA 4OS0A 3RDUA 2IZAA 3BY0A 5HTDA 1QWDA 1MOYA 4GNYA 5DPQA 3T2WA 2RD7C 5LJEA 1Y53X 1Y9LA 1SWGA 2RTHB 4KH8A 5D4AA 3ZW1A 1SWDA 4IB8A 5H9KA 5F2BA 3ZQ3A 3VG3A 1BJ7A 5H9LA 1S2PA 1MUPA 3FW4A 1VWAB 3UEWA 4Y59A 3ZW0B 4YCHA 1SLDB 3KFIA 4WHIA 2ACPX 2QO6A 3CKGA 1NP1A 2IZCB 2OFBA 1DFVA 3RE6A 3NP1A 4EQAC 1D2UA 3TF6A 2OY5O 1AVGI 3CMPA 2K23A 5FQ8E 5HCEC 1KGLA 5CYBA 1LFOA 1VWEB 3PH5A 1SWHA 4U8UN 3VHIA 1DZMA 1FENA 1U17A 1SWQA 4JNJA 1LCVA 5F58A 1LIDA 2W2FA 1KOIA 2C4IA 5EDCA 4CK4A 1O1VA 4NP1A 1TOWA 2IZKA 4YKMA 2G5LA 4IB7A 1N4JA 2WUTA 4HPCA 4O4UA 4DQ4A 1DZJA 4OELA 3RE5A 4C5PA 1HMSA 2JGSA 2X8FA 3JS1A 1I06A 2HYSA 4OKAA 1OEKA 3CQRA 2GH7A 2RTEB 1QABE 3CKFA 3STNA 4Z6JA 1Y52X 1MX7A 5KICA 3HWEA 3RSWA 2L9CA 4KIIA 4L1NA 4IRWA 1LNMA 1GKAB 4YGHA 3JSQA 1IIUA 1A57A 3GE2A 4KC8A 2AT3X 4ORYA 1MX8A 1EW3A 1SXYA 1U0XA 1NGLA 2OVAA 3C77X 3KQ0A 1SREA 4WFUA 1NDJA 2OFRX 1EXSA 2RTIB 1O1UA 4CDEA 3WJEA 2O62A 2X32A 3BX8A 3FEKA 3APVA 3SZJA 3ELXA 5IRAA 5IO7A 2VFCA 1DZKA 5F7GA 3UEXA 3TGAA 1D3SA 1LPJA 2DJFA 4ZH6A 2GTLN 2FWVA 2L5PA 4TKBA 3T6FA 2A2GA 3RY1A 1EI5A 1SWLA 3RDOA 3EBWA 2JW1A 3FIQA 4MVEA 2G7BA 4ORXA 3TGBA 1G7NA 4QYPA 3WJBA 3FLLA 1ERBA 1CBQA 1S7DA 5K68A 5IXGA 5LJGA 1KZXA 2UYWA 4YH0A 2AT5X 2IZEB 1ICNA 1UYOX 2JU7A 5LJHA 3D97A 1Y0GA 1DF8A 1SY2A 5JR8A 3CQNA 1NBXA 3WOVA 3SAOA 3LTWA 4GDZA 3FIDA 3FR2A 3APUA 2QMIA 4A1HA 1STPA 1X71A 4ZFXA 3OE3A 5LKEA 1OBPA 3VG7A 2AH7X 1BSQA 1Z24A 4OS8A 5HZ6A 4Y5DA 4FBOA 4BX6B 4IAWA 3WJGA 2FRSA 3ZW0A 1DC9A 4HFOA 2NNEA 4I3DA 4ODDA 3PQSA 3T2XA 3OJYC 2JU8A 3EMMA 4ZHHA 5AJCA 2FHLA 4AZMA 5B5FA 3ZW2A 2Z4HA 1VYFA 1JYDA 2BS6A 3T6LA 4Z2PA 4LKPA 5LJDA 3ZUOA 1IFCA 2X46A 1SY1A 2AL0X 4O3XB 2GJ5A 4LZVA 2POAA 3PPTA 4IAXA 4ORSA 5HA1A 5HAEA 5LJBA 1ZNKA 1HQQA 4MIRA 2FKJA 1GT4A 3MX7A 5F1EA 2WEWA 3HK1A 4IBAA 1FDQA 1Y9TA 1GX3A 2WWPA 5L8IA 1LICA 4Y0QA 4EEJA 4YCEA 3IFBA 1FE3A 5B11O 3DSZA 2Q4NA 4YFQA 1ADLA 4YDBA 1N9YA 1OEEA 4U3QA 3BSZE 2ASNX 2LB6A 1R0UA 1QFTA 1SXUA 2KTDA 4AW8A 2QCBA 2ZAIA 4ZCBA 3VG5A 3VG6A 4IABA 2RTCB 1CJ5A 4NV8A 1PM1X 1E00A 4KT5A 1VWFB 2FTBA 1OPAA 1GKAA 3PEDA 4YMYA 3P6HA 1KL5A 4GETA 4QGWA 3UEVA 4I6SA 4CPFA 2FS6A 2BT9A 1LUQA 2X8SA 1KXOA 2JU3A 2LKKA 3ELZA 1RXJA 1SWEA 4GJVA 4IMOA 5H8TA 5H9AA 1RXHA 1G5WA 1LIFA 1VWOB 4AZOA 4LQZA 1JBHA 3VG4A 3DTQA 4GKCA 4ZHFA 1JMZA 3I17A 3RZYA 1AVDA 1X8QA 3QKGA 5FFHA 4GDAA 4GD9A 3PK2A 3CBCA 2OL7A 5L8OA 1GXAA 1BWYA 1ERXA 1SWKA 2RTAA 4OS3A 1LKEA 3U9PC 3AKMA 5EPQA 1SWAA 3D9WA 4YDAA 1GM6A 2MHDA 2WR6A 4XMHA 4YFPA 4FGIB 1VWNB 4TJZA 1KT4A 2R56A 3HWDA 3EC5A 4O3WA 3RDMA 4A1YA 4NV7A 4KCAA 1NQMA 2IZBA 1H91A 2Q9SA 1X8UA 1ACDA 1T0VA 2X55A 3I0AA 3VE1A 5LJCA 1DV9A 3NADA 5LKFA 2RTQB 3TZSA 2AF5A 3SLOA 2IZFB 1X8PA 1RBPA 2NNDA 3NX1A 2OF9A 4XMDA 1AB0A 2FKGA 2XSTA 4GE1A 1KQXA 3D95A 3FA8A 2CBRA 2UZ2A 1QY0A 1VYGA 1W6FA 1HBQA 2ALLX 2I5ZO 1SRHA 4CDCA 2CM9A 2KD2A 3CBSA 1GT1A 2FR2A 3VU1A 3G7XA 4BX6A 1GX9A 1LIEA 1HMTA 3KFFA 4QQ1A 3F9DA 1E5PA 4D6AA 5HA0A 1OPBA 3WJDA 4LZUA 4JGLA 2L68A 2OFAA 1K24A 4BCSA 2NNQA 3FR4A 1HN2A 1ZNGA 1JJXA 1IFBA 3V8UA 2L67A 3FA9A 3BDRA 5D8JA 2W2AA 4CSBA 3CR6A 1B0OA 3F8AA 2OF8A 1RAVA 1YWCA 2RN4A 1E06A 1G74A 1KT5A 2HNXA 3AEHA 4QZUA 4MVLA 2MF6A 1SLFB 5FQ6E 1NQNA 1B56A 4TKHA 1SWRA 1MM9A 2ACOA 2AT6X 3WJCA 2RTGB 1LIBA 2X8TA 4I3BA 4NW4A 3RKGA 3C78X 4QNIA 1N9MA 4GGZA 5EZ2A 1JJJA 3WBGA 2F73A 2X45A 4M7MA 1Y55X 4BJ8A 1SWBA 3MM0A 2RTRB 2A3FX 3B2HA 2K62A 4XMCA 3FYFA 2A2UA 4AZRA 3HTYA 3AKNA 2HKDA 3RDXA 4BVMA 3GAQA 2M4LA 4GGRA 1NP4A 2Y3FA 2WEXA 3EYCA 4I60A 3WYPA 1YUPA 1GT5A 1JJUA 3FR5A 2FGSA 2HZQA 3O19A 3STKA 2F09A 5F6BA 2OY7A 2AT0X 5HZQA 5B5GA 1ZNLA 5BVTA 5IRWA 2X4MA 5K67A 3EW1A 4ORUA 4RUUA 1N7YA 1JQPA 2IZLB 1AQBA 4GNWA 4INNA 4DQ3A 4AZQA 3B2KA 4NLJA 2OL6O 2CAMA 4O3ZA 1KT7A 4ES7A 1GX8A 2RTMA 2Y32A 1SWOA 1SRGA 4QZTA 5CHKA 3P02A 3PP6A 2CZTA 1LDOA 1IJ8A 2MJIA 1FELA 2GTFX 1DZPA 1MK5A 1ZNHA 3HPEA 3IA8A 3NPOA 1SWUA 1BEBA 1FTPA 2OVEA 2Q2MA 4O3YA 1X8NA 1SLEB 1SXWA 2IFBA 4GGTA 2A8GA 4AYHA 1YP6A 3O22A 3H3IA 5B2AO 2DJGA 2F01A 2YG2A 4NLIA 2C1SA 1IKJA 3BLGA 3HWFA 4AZPA 1EPBA 5HCDC 2RTOB 3AUMO 1T68X 1JIWI 2G8CO 1HBPA 2R74A 4ARHA 1A3YA 4O4XA 2YMSA 1RXKA 4EKVA 3WZNA 2FHNX 1QFVA 4I95A 1LCZA 1ZNEA 3B2LA 3MBTA 2OVSA 3EW2A 1EUOA 1SRIA 2BSZA 3OD9A 4XMGA 4U9CA 3ZI8A 3NBXX 2KT4B 4HWMA 3WJFA 1KT3A 2NP1A 1SRJA 1GGLA 4EFGA 2Z4IA 4I9RA 4QAEA 4O49A 1BSYA 4OMWA 4PJ2A 1AELA 2AT8X 1BLRA 3SZHA 4IB6A 4YVBA 1QG5A 1RSUB 1VWRB 2VFBA 3BX7A 3VG2A 4WFVA 2RTKA 2RTDB 4BOEA 2QM9A 1YWAA 2HMBA 1PBYA 2A5BA 4D6BA 4ZHDA 2OYBO 3BRNA 4K19A 1VWIB 3PDFA 3HWGA 1HXLA 1RLBE 3LV4A 5IO5A 3P24A 1STRB 3QQ2A 4A8ZA 1JMXA 3SZIA 1KL4A 3U03A 4BX7B 1A18A 2LA7A 5F6ZA 3NQKA 2IZDB 4I9SA 1EALA 1I05A 4Y0RA 2PY1A 4YBPA 2R73A 4BGFA 2OZQA 5BVSA 3FA7A 4NYRA 1VYOA 2VDFA 1MVGA 1XCAA 5BYPA 2RCQA 2RCTA 4L3RA 1I9HA 4RUNA 4HPAA 4QYNA 2RTBB 3HOLA 4LKTA 3NX2A 4U8UM 5B3MO 1SLGB 3PQUA 1EPAA 4IB9A 4ORWA 3FW5A 5JD2A 1ML7A 3ZWEA 3T1DA 5KIDA 3BU9A 5IO6A 2X56A 3D4RA 5HBSA 4OEMA 2RTPB 3VHMA 1VWJB 1VWLB 1B8EA 4YKOA 1EIIA 1TVQA 4GH7A 3UEUA 1VWBB 2BHVA 4ZH9A 4FQBB 2KW1A 1STSB 5EDBA 2FS7A 2G79A 2OL8O 2OY8A 4JHQA 3WVMA 4ZJ0A 4NNTA 4XMEA 1B4MA 4CPEA 1ICMA 1S44A 1BM5A 2RA6A 4HPBA 1PTSA 1ALBA 3EBKA 2CM4A 5FENA 5LJKA 2QO4A 1EIOA 2FLJA 2HLVA 2Y3EA 1A2DA 2A13A 4ZHGA 2WPUA 4M6SA 3MG5A 3D96A 3SOTA 4CDDA 2RTNB 3KFHA 4TNNA 1GT3A 3MVFA 2JN3A 2KTSA 4R0BA 5DG4A 4GU8A 4ON1A 5BVQA 4OMXA 4KC7A 1LCWA 4Z2OA 4QGVA 1OEJA 1ZNDA 5C0NA 3U0DA 1HXZA 2RTJA 2JOZA 1N43A 2GTLM 4CPHB 1CBRA 1TOUA 4A60A 1VWQB 1FEMA 1EQDA 2ZAGA 3FMZA 3RDSA 3FA6A 2OY1O 3O2YA 1SY0A 3P6CA 4U8UO 2LBVA 3RWXA 1CBSA 4BX5B 3WZOA 4CPIA 1FJ1E 1VWHB 3HOEA 3KVNA 2AMMX 1TW4A 1VPRA 1SMPI 3UAQA 1X8OA 4ML7B 4DNEA 4YGZA 1VWGB 1SWSA 1BRQA 2IZJA 4YGGA 5B29A 1VWDB 3S5VA 2RTFB 2N93A 3S60A 3P6DA 1SWPA 1SRFA 1HMRA 4Z28A 5CSEA 1YP7A 2AKQA 3APWA 4NNSA 3VGWA 4COTA 1JV4A 1O8VA 1KZWA 1VWCB 4PSQA 2PI3O 1SWJA 2Q39A 1MDCA 4ZHCA 4CV7A 1SXXA 4Z27A 2W2BA 4Z2VA 1T8VA 1NC9A 4MVKA 4TLJA 2EU7X 2Q2PA 1G85A 5AJBA 4ZGFA 3BS2A 2A0AA 1KL3A 3NQ3A 4MISA 4Y0SA 5EEEA 1JZUA 2MWHA 3LHNA 4ALBA 1OBUA 1UREA 1YIVA 4BX7A 4ZGUA 3ZW1B 4FBRA 3K3LA 3CWKA 3ZUIA 2OFMX 5FQ7E 5HZ8A 1VWMB 4N7DA 3VPJE 3B2IA 1KQWA 3APXA 3F6ZB 4ORRA 5D45A 3KZAA 3RBYA 1BSOA 2A5CA 5HZ5A 5L8NA 2HZRA 3SLTA 1KFFA 1U18A 3OBLA 2X34A 3TGCA 4ALOA 2GTLO 5IRUA 2IZIA 3FDCA 5B10O 4DCBA 4O4SA 1HY2A 3X00A 4ID2A 1W4TA 1SWCA 1AVEA 1YWDA 4QRLA 4XMFA 1RSTB 2C1QA 3STMX 5HZ9A 1L6MA 1MEPA 3C76X 3FEPA 4FBVA 5K06A 3VE2A 2GC9A 2MO5A 2BS5A 2G78A 2I5VO 2IZGB 2RQ0A 2RTLA 4JO6A 1ZRYA 3P6EA 4U46A 3ZZVA 5HCCC 4GJSA 2WSJA 1TXLA 3WZPA 1UYNX 1LELA 4NYQA 4WBKA 5HTEA 3PECA 1SWFA 3NQ9A 1VWKB 1N0SA 3Q6LA 3P6FA 1QY1A 2LBAA 3NR3A 1SWTA 3PH6A 1I78A 1DF3A 1UZ2X 4AZNA 3VHHA 1CBIA 5AQ6A 1XKIA 3BU1A 4GUZA
chains in the Genus database with same CATH topology
1PBOA 4Y0PA 4O9SA 2CZUA 4I3CA 2DM5A 4GZVA 3L4RA 1YWBA 5H9NA 3E3CA 2WQ9A 4MVIA 3FENA 1QY2A 1SA8A 5B27A 3EM0A 3FELA 1IKEA 1I04A 3WXQA 1BRPA 1PEEA 2JMBA 4BQUA 4UU2A 1HQPA 2QO5A 1I4UA 4UU3A 1KT6A 3JQOA 1P6PA 3B2JA 1X89A 2P8GA 2WQAE 3N91A 4EDEA 1OBQA 2CBSA 2FR3A 2FT9A 3S5XA 4QGXA 3KFGA 5AEOA 4YBUA 4HPDA 4TQ2A 1IW2A 1E02A 4GK9A 5CE4A 2XKLA 2QOSC 1LF7A 4ZR2A 2MM3A 5HWZA 5KHPA 4IMNA 4TKJA 2LFOA 5EEDA 4GRJA 1JYJA 2OVDA 5FAZA 4EXZA 1PMPA 2E4JA 3S26A 4N7CA 5D47A 2BLGA 1BBPA 1QQSA 1SY3A 1CRBA 3P6GA 2ANSA 5D48A 4O4OA 4OS0A 3BY0A 5HTDA 1QWDA 4GNYA 5DPQA 2RD7C 5LJEA 1Y9LA 4KH8A 5D4AA 3ZW1A 3U0DA 4IB8A 5H9KA 3ZQ3A 3VG3A 1BJ7A 5H9LA 1S2PA 1MUPA 3FW4A 3UEWA 3ZW0B 4YCHA 3KFIA 4WHIA 2ACPX 2QO6A 1NP1A 1DFVA 3NP1A 4EQAC 1D2UA 3TF6A 1AVGI 3CMPA 2K23A 5FQ8E 5HCEC 1KGLA 5CYBA 1LFOA 3PH5A 4U8UN 1DZMA 1FENA 1U17A 5F58A 1LIDA 2W2FA 1KOIA 5EDCA 4CK4A 1O1VA 4NP1A 1TOWA 4YKMA 4IB7A 4HPCA 2WUTA 4O4UA 4DQ4A 1DZJA 1HMSA 2X8FA 3JS1A 1I06A 2HYSA 1OEKA 3CQRA 1QABE 3STNA 1MX7A 5KICA 3HWEA 3RSWA 2L9CA 4KIIA 4L1NA 1LNMA 1GKAB 4YGHA 3JSQA 1IIUA 1A57A 3GE2A 4KC8A 2AT3X 4ORYA 1MX8A 1EW3A 1SXYA 1U0XA 1NGLA 2OVAA 3C77X 3KQ0A 4WFUA 2OFRX 1EXSA 1O1UA 3WJEA 2O62A 3BX8A 3FEKA 3APVA 3ELXA 5IO7A 3UEXA 1DZKA 5F7GA 3TGAA 1D3SA 1LPJA 4ZH6A 2GTLN 2FWVA 2L5PA 4TKBA 2A2GA 1EI5A 3EBWA 2JW1A 3FIQA 4MVEA 2G7BA 4ORXA 3TGBA 1G7NA 4QYPA 3WJBA 3FLLA 1ERBA 1CBQA 1S7DA 5LJGA 1KZXA 4YH0A 2AT5X 1ICNA 2JU7A 5LJHA 3D97A 1SY2A 5JR8A 3CQNA 3WOVA 3SAOA 4GDZA 3FR2A 3APUA 2QMIA 4A1HA 4ZFXA 1X71A 3OE3A 5LKEA 1OBPA 3VG7A 2AH7X 1BSQA 1Z24A 4OS8A 5HZ6A 4FBOA 4IAWA 3WJGA 2FRSA 3ZW0A 1DC9A 4HFOA 2NNEA 4I3DA 4ODDA 3PQSA 3OJYC 2JU8A 3EMMA 4ZHHA 5AJCA 4AZMA 3ZW2A 2Z4HA 1VYFA 1JYDA 2BS6A 4LKPA 5LJDA 3ZUOA 1IFCA 2X46A 1SY1A 2AL0X 4O3XB 2GJ5A 4LZVA 2POAA 3PPTA 4IAXA 4ORSA 5HA1A 5HAEA 5LJBA 1ZNKA 4MIRA 1GT4A 3MX7A 5F1EA 2WEWA 3HK1A 4IBAA 1FDQA 1Y9TA 2WWPA 5L8IA 1LICA 4Y0QA 4EEJA 4YCEA 3IFBA 1FE3A 3DSZA 2Q4NA 4YFQA 1ADLA 4YDBA 4U3QA 1OEEA 3BSZE 2ASNX 2LB6A 1R0UA 1QFTA 1SXUA 2KTDA 4AW8A 2ZAIA 4ZCBA 3VG5A 3VG6A 4IABA 1CJ5A 1PM1X 1E00A 4KT5A 2FTBA 1OPAA 1GKAA 3PEDA 4YMYA 3P6HA 4GETA 4QGWA 3UEVA 4I6SA 2FS6A 2BT9A 2X8SA 1KXOA 2JU3A 2LKKA 3ELZA 4IMOA 5H8TA 1G5WA 5H9AA 1LIFA 4AZOA 4LQZA 1JBHA 3VG4A 3DTQA 4GKCA 4ZHFA 3RZYA 3I17A 1X8QA 3QKGA 5FFHA 3CBCA 5L8OA 1GXAA 1BWYA 1ERXA 4OS3A 1LKEA 3U9PC 3AKMA 5EPQA 4YDAA 1GM6A 2MHDA 2WR6A 4XMHA 4YFPA 4FGIB 4TJZA 1KT4A 2R56A 3HWDA 4O3WA 4A1YA 4KCAA 1H91A 2Q9SA 1X8UA 1ACDA 1T0VA 3VE1A 3I0AA 5LJCA 1DV9A 3NADA 5LKFA 3TZSA 1X8PA 1RBPA 2NNDA 3NX1A 4XMDA 1AB0A 2XSTA 4GE1A 1KQXA 3D95A 3FA8A 2CBRA 1QY0A 1VYGA 2ALLX 1HBQA 2CM9A 2KD2A 3CBSA 1GT1A 2FR2A 3VU1A 3G7XA 1GX9A 1LIEA 1HMTA 3KFFA 4QQ1A 3F9DA 1E5PA 4D6AA 5HA0A 1OPBA 3WJDA 4LZUA 4JGLA 2L68A 2NNQA 3FR4A 1HN2A 1ZNGA 1JJXA 1IFBA 3V8UA 2L67A 3FA9A 3BDRA 5D8JA 2W2AA 4CSBA 3CR6A 1B0OA 3F8AA 4QZUA 1YWCA 2RN4A 1E06A 1G74A 1KT5A 2HNXA 4MVLA 5FQ6E 4TKHA 1B56A 2ACOA 2AT6X 3WJCA 1LIBA 2X8TA 4I3BA 4NW4A 3RKGA 3C78X 4QNIA 5EZ2A 1JJJA 3WBGA 2F73A 2X45A 4M7MA 4XMCA 2A3FX 3B2HA 2K62A 3FYFA 2A2UA 4AZRA 3HTYA 3AKNA 4BVMA 3GAQA 2M4LA 1NP4A 2WEXA 3EYCA 1YUPA 1GT5A 3FR5A 3O19A 2HZQA 3STKA 2F09A 5F6BA 2AT0X 5HZQA 5BVTA 1ZNLA 4ORUA 4RUUA 1AQBA 4GNWA 4INNA 4DQ3A 4AZQA 3B2KA 4NLJA 4O3ZA 1KT7A 4ES7A 1GX8A 4QZTA 3P02A 3PP6A 2CZTA 2MJIA 1FELA 2GTFX 1DZPA 1ZNHA 3IA8A 3NPOA 1BEBA 1FTPA 2OVEA 2Q2MA 4O3YA 1X8NA 1SXWA 2IFBA 4AYHA 1YP6A 3O22A 3H3IA 2YG2A 4NLIA 1IKJA 3BLGA 3HWFA 4AZPA 1EPBA 5HCDC 1T68X 1JIWI 1HBPA 2R74A 4ARHA 1A3YA 4O4XA 2YMSA 1QFVA 4I95A 1ZNEA 3B2LA 3MBTA 2OVSA 1EUOA 4XMGA 3OD9A 3ZI8A 4U9CA 3NBXX 2KT4B 4HWMA 3WJFA 1KT3A 2NP1A 4EFGA 1GGLA 2Z4IA 4I9RA 4QAEA 4O49A 1BSYA 4OMWA 4PJ2A 1AELA 2AT8X 1BLRA 4IB6A 1QG5A 3BX7A 3VG2A 4WFVA 4BOEA 2QM9A 1YWAA 2HMBA 4D6BA 4ZHDA 3BRNA 4K19A 3HWGA 1RLBE 3LV4A 5IO5A 3P24A 4A8ZA 3U03A 1A18A 2LA7A 5F6ZA 3NQKA 4I9SA 1EALA 1I05A 4Y0RA 2PY1A 4YBPA 2R73A 2OZQA 5BVSA 3FA7A 4NYRA 1MVGA 1XCAA 5BYPA 2RCQA 2RCTA 4L3RA 4RUNA 4HPAA 4QYNA 3HOLA 4LKTA 3NX2A 4U8UM 4IB9A 3PQUA 1EPAA 4ORWA 3FW5A 1ML7A 3ZWEA 3T1DA 5KIDA 3BU9A 5IO6A 3D4RA 5HBSA 1B8EA 4YKOA 1EIIA 1TVQA 4GH7A 3UEUA 2BHVA 4ZH9A 4FQBB 2KW1A 5EDBA 2FS7A 2G79A 3WVMA 4ZJ0A 4NNTA 4XMEA 1B4MA 1ICMA 1S44A 1BM5A 2RA6A 4HPBA 1ALBA 3EBKA 2CM4A 5FENA 5LJKA 2QO4A 1EIOA 2FLJA 2HLVA 1A2DA 2A13A 4ZHGA 4M6SA 3D96A 3SOTA 3KFHA 4TNNA 1GT3A 3MVFA 2JN3A 2KTSA 4R0BA 5DG4A 4GU8A 4ON1A 5BVQA 4OMXA 4KC7A 4QGVA 1OEJA 1ZNDA 5C0NA 2JOZA 2GTLM 1CBRA 1TOUA 4A60A 1FEMA 1EQDA 2ZAGA 3FMZA 3FA6A 3O2YA 2LBVA 1SY0A 3P6CA 4U8UO 3RWXA 1CBSA 3HOEA 2AMMX 1TW4A 1VPRA 1SMPI 3UAQA 1X8OA 4ML7B 5B29A 4YGZA 1BRQA 4YGGA 3S60A 3S5VA 2N93A 3P6DA 1HMRA 1YP7A 2AKQA 3APWA 4NNSA 4COTA 1JV4A 1O8VA 1KZWA 4PSQA 2Q39A 1MDCA 4ZHCA 4CV7A 1SXXA 2W2BA 1T8VA 4MVKA 4TLJA 2EU7X 2Q2PA 1G85A 5AJBA 4ZGFA 3BS2A 2A0AA 3NQ3A 4MISA 4Y0SA 5EEEA 1JZUA 2MWHA 3LHNA 4ALBA 1OBUA 1UREA 1YIVA 4ZGUA 3ZW1B 4FBRA 3K3LA 3CWKA 3ZUIA 2OFMX 5FQ7E 5HZ8A 3VPJE 4N7DA 4YFRA 3B2IA 1KQWA 3APXA 3F6ZB 4ORRA 5D45A 3KZAA 3RBYA 1BSOA 5HZ5A 5L8NA 2HZRA 3TGCA 1U18A 3OBLA 4ALOA 2GTLO 4O4SA 4ID2A 1YWDA 5HZ9A 4QRLA 4XMFA 3STMX 1L6MA 4FBVA 3C76X 3FEPA 5K06A 3VE2A 2GC9A 2MO5A 2BS5A 2G78A 2RQ0A 5HCCC 1ZRYA 3P6EA 3ZZVA 2WSJA 1TXLA 4NYQA 4WBKA 5HTEA 3PECA 3NQ9A 1N0SA 3Q6LA 3P6FA 1QY1A 2LBAA 3NR3A 3PH6A 1DF3A 1UZ2X 4AZNA 1CBIA 5AQ6A 1XKIA 3BU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PBO A;  4Y0P A;  4O9S A;  2CZU A;  4I3C A;  2DM5 A;  3L4R A;  1YWB A;  5H9N A;  2WQ9 A;  4MVI A;  3FEN A;  1QY2 A;  1SA8 A;  5B27 A;  3EM0 A;  3FEL A;  1IKE A;  1I04 A;  3WXQ A;  1BRP A;  1PEE A;  4BQU A;  4UU2 A;  1HQP A;  2QO5 A;  1I4U A;  4UU3 A;  1KT6 A;  1P6P A;  3B2J A;  1X89 A;  2P8G A;  2WQA E;  4EDE A;  1OBQ A;  2CBS A;  2FR3 A;  2FT9 A;  4QGX A;  3KFG A;  4YBU A;  4HPD A;  4TQ2 A;  1IW2 A;  1E02 A;  5CE4 A;  2XKL A;  2QOS C;  1LF7 A;  4ZR2 A;  2MM3 A;  5HWZ A;  5KHP A;  4IMN A;  4TKJ A;  2LFO A;  5EED A;  4GRJ A;  1JYJ A;  2OVD A;  5FAZ A;  4EXZ A;  1PMP A;  2E4J A;  3S26 A;  4N7C A;  5D47 A;  2BLG A;  1BBP A;  1QQS A;  1SY3 A;  1CRB A;  3P6G A;  2ANS A;  5D48 A;  4OS0 A;  3BY0 A;  5HTD A;  1QWD A;  4GNY A;  5DPQ A;  2RD7 C;  5LJE A;  5D4A A;  3U0D A;  4IB8 A;  5H9K A;  3ZQ3 A;  3VG3 A;  1BJ7 A;  5H9L A;  1S2P A;  1MUP A;  3FW4 A;  3UEW A;  4YCH A;  3KFI A;  2ACP X;  2QO6 A;  1NP1 A;  1DFV A;  3NP1 A;  1D2U A;  3TF6 A;  1AVG I;  3CMP A;  2K23 A;  5HCE C;  1KGL A;  1LFO A;  3PH5 A;  1DZM A;  1FEN A;  1U17 A;  5F58 A;  1LID A;  2W2F A;  1KOI A;  5EDC A;  4CK4 A;  1O1V A;  4NP1 A;  1TOW A;  4YKM A;  4IB7 A;  4HPC A;  2WUT A;  4DQ4 A;  1DZJ A;  1HMS A;  3JS1 A;  1I06 A;  2HYS A;  1OEK A;  3CQR A;  1QAB E;  3STN A;  1MX7 A;  5KIC A;  3HWE A;  3RSW A;  2L9C A;  4KII A;  1LNM A;  1GKA B;  4YGH A;  3JSQ A;  1IIU A;  1A57 A;  4ORY A;  2AT3 X;  1MX8 A;  1EW3 A;  1SXY A;  1U0X A;  1NGL A;  2OVA A;  3C77 X;  3KQ0 A;  4WFU A;  2OFR X;  1EXS A;  1O1U A;  3WJE A;  2O62 A;  3BX8 A;  3FEK A;  3APV A;  3ELX A;  5IO7 A;  3UEX A;  1DZK A;  5F7G A;  3TGA A;  1D3S A;  1LPJ A;  4ZH6 A;  2FWV A;  2L5P A;  4TKB A;  2A2G A;  3EBW A;  4ORX A;  3FIQ A;  2G7B A;  3TGB A;  1G7N A;  4QYP A;  3WJB A;  3FLL A;  1ERB A;  1CBQ A;  1S7D A;  5LJG A;  1KZX A;  4YH0 A;  2AT5 X;  1ICN A;  2JU7 A;  5LJH A;  3D97 A;  1SY2 A;  5JR8 A;  3CQN A;  3SAO A;  3FR2 A;  3APU A;  4A1H A;  4ZFX A;  1X71 A;  5LKE A;  1OBP A;  3VG7 A;  2AH7 X;  1BSQ A;  1Z24 A;  4OS8 A;  5HZ6 A;  4IAW A;  3WJG A;  2FRS A;  1DC9 A;  4HFO A;  2NNE A;  4I3D A;  4ODD A;  3OJY C;  2JU8 A;  3EMM A;  4ZHH A;  4AZM A;  1VYF A;  1JYD A;  4LKP A;  5LJD A;  3ZUO A;  1IFC A;  2X46 A;  1SY1 A;  2AL0 X;  2GJ5 A;  4LZV A;  2POA A;  3PPT A;  4IAX A;  4ORS A;  5HA1 A;  5HAE A;  5LJB A;  1ZNK A;  1GT4 A;  5F1E A;  2WEW A;  3HK1 A;  4IBA A;  1FDQ A;  2WWP A;  5L8I A;  1LIC A;  4Y0Q A;  4EEJ A;  4YCE A;  3IFB A;  1FE3 A;  3DSZ A;  2Q4N A;  4YFQ A;  1ADL A;  4YDB A;  1OEE A;  3BSZ E;  2ASN X;  2LB6 A;  1R0U A;  1QFT A;  1SXU A;  2KTD A;  4AW8 A;  4ZCB A;  3VG5 A;  3VG6 A;  1CJ5 A;  1PM1 X;  1E00 A;  2FTB A;  1OPA A;  1GKA A;  3PED A;  4YMY A;  3P6H A;  4GET A;  4QGW A;  3UEV A;  2FS6 A;  1KXO A;  2JU3 A;  2LKK A;  3ELZ A;  4IMO A;  5H8T A;  1G5W A;  5H9A A;  1LIF A;  4AZO A;  1JBH A;  3VG4 A;  3DTQ A;  4GKC A;  4ZHF A;  3RZY A;  3I17 A;  1X8Q A;  3QKG A;  5FFH A;  3CBC A;  5L8O A;  1GXA A;  1BWY A;  1ERX A;  4OS3 A;  1LKE A;  3U9P C;  3AKM A;  5EPQ A;  4YDA A;  1GM6 A;  2WR6 A;  4XMH A;  4YFP A;  4TJZ A;  1KT4 A;  2R56 A;  3HWD A;  4A1Y A;  1H91 A;  2Q9S A;  1X8U A;  1ACD A;  1T0V A;  5LJC A;  3I0A A;  1DV9 A;  3NAD A;  5LKF A;  3TZS A;  1X8P A;  1RBP A;  2NND A;  3NX1 A;  4XMD A;  1AB0 A;  2XST A;  4GE1 A;  1KQX A;  3D95 A;  3FA8 A;  2CBR A;  1QY0 A;  1VYG A;  2ALL X;  1HBQ A;  2CM9 A;  3CBS A;  1GT1 A;  2FR2 A;  3G7X A;  1GX9 A;  1LIE A;  1HMT A;  3KFF A;  3F9D A;  1E5P A;  4D6A A;  5HA0 A;  1OPB A;  3WJD A;  4LZU A;  2L68 A;  2NNQ A;  3FR4 A;  1HN2 A;  1ZNG A;  1JJX A;  1IFB A;  2L67 A;  3FA9 A;  3BDR A;  5D8J A;  2W2A A;  3CR6 A;  1B0O A;  3F8A A;  4QZU A;  1YWC A;  1E06 A;  1G74 A;  1KT5 A;  2HNX A;  4MVL A;  4TKH A;  1B56 A;  2ACO A;  2AT6 X;  3WJC A;  1LIB A;  4I3B A;  3C78 X;  5EZ2 A;  1JJJ A;  3WBG A;  2F73 A;  2X45 A;  4M7M A;  4XMC A;  2A3F X;  3B2H A;  2K62 A;  2A2U A;  4AZR A;  3AKN A;  4BVM A;  3GAQ A;  1NP4 A;  2WEX A;  3EYC A;  1YUP A;  1GT5 A;  3FR5 A;  3O19 A;  2HZQ A;  3STK A;  5F6B A;  2AT0 X;  5HZQ A;  5BVT A;  1ZNL A;  4ORU A;  4RUU A;  1AQB A;  4GNW A;  4DQ3 A;  4AZQ A;  3B2K A;  4NLJ A;  1KT7 A;  4ES7 A;  1GX8 A;  4QZT A;  3PP6 A;  2CZT A;  2MJI A;  1FEL A;  2GTF X;  1DZP A;  1ZNH A;  3IA8 A;  3NPO A;  1BEB A;  1FTP A;  2OVE A;  2Q2M A;  1X8N A;  1SXW A;  2IFB A;  4AYH A;  1YP6 A;  3O22 A;  2YG2 A;  4NLI A;  1IKJ A;  3BLG A;  3HWF A;  4AZP A;  1EPB A;  5HCD C;  1T68 X;  1HBP A;  2R74 A;  4ARH A;  1A3Y A;  1QFV A;  1ZNE A;  3B2L A;  3MBT A;  1EUO A;  4XMG A;  4EFG A;  2KT4 B;  3WJF A;  1KT3 A;  2NP1 A;  1GGL A;  4I9R A;  4QAE A;  1BSY A;  4OMW A;  1AEL A;  1BLR A;  2AT8 X;  4IB6 A;  1QG5 A;  3BX7 A;  3VG2 A;  4WFV A;  4BOE A;  2QM9 A;  1YWA A;  2HMB A;  4D6B A;  4ZHD A;  3BRN A;  4K19 A;  3HWG A;  1RLB E;  5IO5 A;  4A8Z A;  3U03 A;  1A18 A;  5F6Z A;  4I9S A;  1EAL A;  1I05 A;  4Y0R A;  2PY1 A;  4YBP A;  2R73 A;  2OZQ A;  5BVS A;  3FA7 A;  4NYR A;  1MVG A;  1XCA A;  2RCQ A;  2RCT A;  4RUN A;  4HPA A;  4QYN A;  4LKT A;  3NX2 A;  4IB9 A;  1EPA A;  4ORW A;  3FW5 A;  1ML7 A;  3T1D A;  5KID A;  3BU9 A;  5IO6 A;  5HBS A;  1B8E A;  4YKO A;  1EII A;  1TVQ A;  4GH7 A;  3UEU A;  4ZH9 A;  5EDB A;  2FS7 A;  2G79 A;  3WVM A;  4ZJ0 A;  4NNT A;  4XME A;  1B4M A;  1ICM A;  1S44 A;  1BM5 A;  2RA6 A;  4HPB A;  1ALB A;  3EBK A;  2CM4 A;  5FEN A;  5LJK A;  2QO4 A;  1EIO A;  2FLJ A;  2HLV A;  1A2D A;  2A13 A;  4ZHG A;  4M6S A;  3D96 A;  3KFH A;  4TNN A;  1GT3 A;  3MVF A;  2JN3 A;  4R0B A;  5DG4 A;  5BVQ A;  4OMX A;  4QGV A;  1OEJ A;  1ZND A;  5C0N A;  2JOZ A;  1CBR A;  1TOU A;  4A60 A;  1FEM A;  1EQD A;  3FMZ A;  3FA6 A;  3O2Y A;  2LBV A;  1SY0 A;  3P6C A;  1CBS A;  2AMM X;  1TW4 A;  1VPR A;  1X8O A;  5B29 A;  4YGZ A;  1BRQ A;  4YGG A;  2N93 A;  3P6D A;  1HMR A;  1YP7 A;  2AKQ A;  3APW A;  4NNS A;  1JV4 A;  1O8V A;  1KZW A;  4PSQ A;  2Q39 A;  1MDC A;  4ZHC A;  1SXX A;  2W2B A;  1T8V A;  4MVK A;  4TLJ A;  2EU7 X;  2Q2P A;  1G85 A;  3BS2 A;  2A0A A;  3NQ3 A;  4Y0S A;  5EEE A;  1JZU A;  4ALB A;  1OBU A;  1URE A;  1YIV A;  4ZGU A;  3K3L A;  3CWK A;  3ZUI A;  2OFM X;  5HZ8 A;  4N7D A;  4YFR A;  3B2I A;  1KQW A;  3APX A;  4ORR A;  5HZ5 A;  5D45 A;  3KZA A;  5L8N A;  1BSO A;  2HZR A;  3TGC A;  1U18 A;  4ALO A;  1YWD A;  5HZ9 A;  4XMF A;  3STM X;  1L6M A;  3C76 X;  3FEP A;  5K06 A;  2GC9 A;  2RQ0 A;  2MO5 A;  2G78 A;  5HCC C;  1ZRY A;  3P6E A;  2WSJ A;  1TXL A;  4NYQ A;  4WBK A;  5HTE A;  3PEC A;  3NQ9 A;  1N0S A;  3Q6L A;  3P6F A;  1QY1 A;  2LBA A;  3NR3 A;  3PH6 A;  1DF3 A;  1UZ2 X;  4AZN A;  1CBI A;  5AQ6 A;  1XKI A;  3BU1 A; 
#chains in the Genus database with same CATH topology
 1PBO A;  4Y0P A;  1W5R A;  4O9S A;  2CZU A;  4I3C A;  2DM5 A;  4GZV A;  3L4R A;  1YWB A;  5H9N A;  1WUB A;  4B55 A;  1SWN A;  3E3C A;  2WQ9 A;  4MVI A;  3FEN A;  1QY2 A;  1SA8 A;  5B27 A;  3EM0 A;  3RDQ A;  3FEL A;  1IKE A;  1I04 A;  1VWP B;  3WXQ A;  1BRP A;  1PEE A;  2JMB A;  1OSP O;  4BQU A;  4CDF A;  4UU2 A;  4YFR A;  1HQP A;  4CPH A;  2QO5 A;  1E2T A;  1I4U A;  4UU3 A;  1KT6 A;  3RY2 A;  3JQO A;  1P6P A;  1WBI A;  1X89 A;  2P8G A;  2WQA E;  3B2J A;  3N91 A;  4EDE A;  1OBQ A;  4BX5 A;  2CBS A;  2FR3 A;  2FT9 A;  3S5X A;  4QGX A;  3KFG A;  5AEO A;  1K3B A;  4YBU A;  2ZSC A;  4HPD A;  4TQ2 A;  1IW2 A;  2QOM A;  1E02 A;  4GK9 A;  5CE4 A;  2IZH B;  2XKL A;  3Q34 A;  3SLJ A;  2QOS C;  4BBO A;  1LF7 A;  4ZR2 A;  5L3Y A;  2AVI A;  2MM3 A;  3WZQ A;  5HWZ A;  5KHP A;  4IMN A;  4TKJ A;  2LFO A;  5EED A;  4GRJ A;  1JYJ A;  2OVD A;  5FAZ A;  4EXZ A;  1PMP A;  2BC3 A;  2E4J A;  4MEE A;  3WYQ A;  3S26 A;  4N7C A;  5D47 A;  2BLG A;  1BBP A;  1QQS A;  1SY3 A;  1CRB A;  1LDQ A;  2ANS A;  3P6G A;  5D48 A;  4O4O A;  4OS0 A;  3RDU A;  2IZA A;  3BY0 A;  5HTD A;  1QWD A;  1MOY A;  4GNY A;  5DPQ A;  3T2W A;  2RD7 C;  5LJE A;  1Y53 X;  1Y9L A;  1SWG A;  2RTH B;  4KH8 A;  5D4A A;  3ZW1 A;  1SWD A;  4IB8 A;  5H9K A;  5F2B A;  3ZQ3 A;  3VG3 A;  1BJ7 A;  5H9L A;  1S2P A;  1MUP A;  3FW4 A;  1VWA B;  3UEW A;  4Y59 A;  3ZW0 B;  4YCH A;  1SLD B;  3KFI A;  4WHI A;  2ACP X;  2QO6 A;  3CKG A;  1NP1 A;  2IZC B;  2OFB A;  1DFV A;  3RE6 A;  3NP1 A;  4EQA C;  1D2U A;  3TF6 A;  2OY5 O;  1AVG I;  3CMP A;  2K23 A;  5FQ8 E;  5HCE C;  1KGL A;  5CYB A;  1LFO A;  1VWE B;  3PH5 A;  1SWH A;  4U8U N;  3VHI A;  1DZM A;  1FEN A;  1U17 A;  1SWQ A;  4JNJ A;  1LCV A;  5F58 A;  1LID A;  2W2F A;  1KOI A;  2C4I A;  5EDC A;  4CK4 A;  1O1V A;  4NP1 A;  1TOW A;  2IZK A;  4YKM A;  2G5L A;  4IB7 A;  1N4J A;  2WUT A;  4HPC A;  4O4U A;  4DQ4 A;  1DZJ A;  4OEL A;  3RE5 A;  4C5P A;  1HMS A;  2JGS A;  2X8F A;  3JS1 A;  1I06 A;  2HYS A;  4OKA A;  1OEK A;  3CQR A;  2GH7 A;  2RTE B;  1QAB E;  3CKF A;  3STN A;  4Z6J A;  1Y52 X;  1MX7 A;  5KIC A;  3HWE A;  3RSW A;  2L9C A;  4KII A;  4L1N A;  4IRW A;  1LNM A;  1GKA B;  4YGH A;  3JSQ A;  1IIU A;  1A57 A;  3GE2 A;  4KC8 A;  2AT3 X;  4ORY A;  1MX8 A;  1EW3 A;  1SXY A;  1U0X A;  1NGL A;  2OVA A;  3C77 X;  3KQ0 A;  1SRE A;  4WFU A;  1NDJ A;  2OFR X;  1EXS A;  2RTI B;  1O1U A;  4CDE A;  3WJE A;  2O62 A;  2X32 A;  3BX8 A;  3FEK A;  3APV A;  3SZJ A;  3ELX A;  5IRA A;  5IO7 A;  2VFC A;  1DZK A;  5F7G A;  3UEX A;  3TGA A;  1D3S A;  1LPJ A;  2DJF A;  4ZH6 A;  2GTL N;  2FWV A;  2L5P A;  4TKB A;  3T6F A;  2A2G A;  3RY1 A;  1EI5 A;  1SWL A;  3RDO A;  3EBW A;  2JW1 A;  3FIQ A;  4MVE A;  2G7B A;  4ORX A;  3TGB A;  1G7N A;  4QYP A;  3WJB A;  3FLL A;  1ERB A;  1CBQ A;  1S7D A;  5K68 A;  5IXG A;  5LJG A;  1KZX A;  2UYW A;  4YH0 A;  2AT5 X;  2IZE B;  1ICN A;  1UYO X;  2JU7 A;  5LJH A;  3D97 A;  1Y0G A;  1DF8 A;  1SY2 A;  5JR8 A;  3CQN A;  1NBX A;  3WOV A;  3SAO A;  3LTW A;  4GDZ A;  3FID A;  3FR2 A;  3APU A;  2QMI A;  4A1H A;  1STP A;  1X71 A;  4ZFX A;  3OE3 A;  5LKE A;  1OBP A;  3VG7 A;  2AH7 X;  1BSQ A;  1Z24 A;  4OS8 A;  5HZ6 A;  4Y5D A;  4FBO A;  4BX6 B;  4IAW A;  3WJG A;  2FRS A;  3ZW0 A;  1DC9 A;  4HFO A;  2NNE A;  4I3D A;  4ODD A;  3PQS A;  3T2X A;  3OJY C;  2JU8 A;  3EMM A;  4ZHH A;  5AJC A;  2FHL A;  4AZM A;  5B5F A;  3ZW2 A;  2Z4H A;  1VYF A;  1JYD A;  2BS6 A;  3T6L A;  4Z2P A;  4LKP A;  5LJD A;  3ZUO A;  1IFC A;  2X46 A;  1SY1 A;  2AL0 X;  4O3X B;  2GJ5 A;  4LZV A;  2POA A;  3PPT A;  4IAX A;  4ORS A;  5HA1 A;  5HAE A;  5LJB A;  1ZNK A;  1HQQ A;  4MIR A;  2FKJ A;  1GT4 A;  3MX7 A;  5F1E A;  2WEW A;  3HK1 A;  4IBA A;  1FDQ A;  1Y9T A;  1GX3 A;  2WWP A;  5L8I A;  1LIC A;  4Y0Q A;  4EEJ A;  4YCE A;  3IFB A;  1FE3 A;  5B11 O;  3DSZ A;  2Q4N A;  4YFQ A;  1ADL A;  4YDB A;  1N9Y A;  1OEE A;  4U3Q A;  3BSZ E;  2ASN X;  2LB6 A;  1R0U A;  1QFT A;  1SXU A;  2KTD A;  4AW8 A;  2QCB A;  2ZAI A;  4ZCB A;  3VG5 A;  3VG6 A;  4IAB A;  2RTC B;  1CJ5 A;  4NV8 A;  1PM1 X;  1E00 A;  4KT5 A;  1VWF B;  2FTB A;  1OPA A;  1GKA A;  3PED A;  4YMY A;  3P6H A;  1KL5 A;  4GET A;  4QGW A;  3UEV A;  4I6S A;  4CPF A;  2FS6 A;  2BT9 A;  1LUQ A;  2X8S A;  1KXO A;  2JU3 A;  2LKK A;  3ELZ A;  1RXJ A;  1SWE A;  4GJV A;  4IMO A;  5H8T A;  5H9A A;  1RXH A;  1G5W A;  1LIF A;  1VWO B;  4AZO A;  4LQZ A;  1JBH A;  3VG4 A;  3DTQ A;  4GKC A;  4ZHF A;  1JMZ A;  3I17 A;  3RZY A;  1AVD A;  1X8Q A;  3QKG A;  5FFH A;  4GDA A;  4GD9 A;  3PK2 A;  3CBC A;  2OL7 A;  5L8O A;  1GXA A;  1BWY A;  1ERX A;  1SWK A;  2RTA A;  4OS3 A;  1LKE A;  3U9P C;  3AKM A;  5EPQ A;  1SWA A;  3D9W A;  4YDA A;  1GM6 A;  2MHD A;  2WR6 A;  4XMH A;  4YFP A;  4FGI B;  1VWN B;  4TJZ A;  1KT4 A;  2R56 A;  3HWD A;  3EC5 A;  4O3W A;  3RDM A;  4A1Y A;  4NV7 A;  4KCA A;  1NQM A;  2IZB A;  1H91 A;  2Q9S A;  1X8U A;  1ACD A;  1T0V A;  2X55 A;  3I0A A;  3VE1 A;  5LJC A;  1DV9 A;  3NAD A;  5LKF A;  2RTQ B;  3TZS A;  2AF5 A;  3SLO A;  2IZF B;  1X8P A;  1RBP A;  2NND A;  3NX1 A;  2OF9 A;  4XMD A;  1AB0 A;  2FKG A;  2XST A;  4GE1 A;  1KQX A;  3D95 A;  3FA8 A;  2CBR A;  2UZ2 A;  1QY0 A;  1VYG A;  1W6F A;  1HBQ A;  2ALL X;  2I5Z O;  1SRH A;  4CDC A;  2CM9 A;  2KD2 A;  3CBS A;  1GT1 A;  2FR2 A;  3VU1 A;  3G7X A;  4BX6 A;  1GX9 A;  1LIE A;  1HMT A;  3KFF A;  4QQ1 A;  3F9D A;  1E5P A;  4D6A A;  5HA0 A;  1OPB A;  3WJD A;  4LZU A;  4JGL A;  2L68 A;  2OFA A;  1K24 A;  4BCS A;  2NNQ A;  3FR4 A;  1HN2 A;  1ZNG A;  1JJX A;  1IFB A;  3V8U A;  2L67 A;  3FA9 A;  3BDR A;  5D8J A;  2W2A A;  4CSB A;  3CR6 A;  1B0O A;  3F8A A;  2OF8 A;  1RAV A;  1YWC A;  2RN4 A;  1E06 A;  1G74 A;  1KT5 A;  2HNX A;  3AEH A;  4QZU A;  4MVL A;  2MF6 A;  1SLF B;  5FQ6 E;  1NQN A;  1B56 A;  4TKH A;  1SWR A;  1MM9 A;  2ACO A;  2AT6 X;  3WJC A;  2RTG B;  1LIB A;  2X8T A;  4I3B A;  4NW4 A;  3RKG A;  3C78 X;  4QNI A;  1N9M A;  4GGZ A;  5EZ2 A;  1JJJ A;  3WBG A;  2F73 A;  2X45 A;  4M7M A;  1Y55 X;  4BJ8 A;  1SWB A;  3MM0 A;  2RTR B;  2A3F X;  3B2H A;  2K62 A;  4XMC A;  3FYF A;  2A2U A;  4AZR A;  3HTY A;  3AKN A;  2HKD A;  3RDX A;  4BVM A;  3GAQ A;  2M4L A;  4GGR A;  1NP4 A;  2Y3F A;  2WEX A;  3EYC A;  4I60 A;  3WYP A;  1YUP A;  1GT5 A;  1JJU A;  3FR5 A;  2FGS A;  2HZQ A;  3O19 A;  3STK A;  2F09 A;  5F6B A;  2OY7 A;  2AT0 X;  5HZQ A;  5B5G A;  1ZNL A;  5BVT A;  5IRW A;  2X4M A;  5K67 A;  3EW1 A;  4ORU A;  4RUU A;  1N7Y A;  1JQP A;  2IZL B;  1AQB A;  4GNW A;  4INN A;  4DQ3 A;  4AZQ A;  3B2K A;  4NLJ A;  2OL6 O;  2CAM A;  4O3Z A;  1KT7 A;  4ES7 A;  1GX8 A;  2RTM A;  2Y32 A;  1SWO A;  1SRG A;  4QZT A;  5CHK A;  3P02 A;  3PP6 A;  2CZT A;  1LDO A;  1IJ8 A;  2MJI A;  1FEL A;  2GTF X;  1DZP A;  1MK5 A;  1ZNH A;  3HPE A;  3IA8 A;  3NPO A;  1SWU A;  1BEB A;  1FTP A;  2OVE A;  2Q2M A;  4O3Y A;  1X8N A;  1SLE B;  1SXW A;  2IFB A;  4GGT A;  2A8G A;  4AYH A;  1YP6 A;  3O22 A;  3H3I A;  5B2A O;  2DJG A;  2F01 A;  2YG2 A;  4NLI A;  2C1S A;  1IKJ A;  3BLG A;  3HWF A;  4AZP A;  1EPB A;  5HCD C;  2RTO B;  3AUM O;  1T68 X;  1JIW I;  2G8C O;  1HBP A;  2R74 A;  4ARH A;  1A3Y A;  4O4X A;  2YMS A;  1RXK A;  4EKV A;  3WZN A;  2FHN X;  1QFV A;  4I95 A;  1LCZ A;  1ZNE A;  3B2L A;  3MBT A;  2OVS A;  3EW2 A;  1EUO A;  1SRI A;  2BSZ A;  3OD9 A;  4XMG A;  4U9C A;  3ZI8 A;  3NBX X;  2KT4 B;  4HWM A;  3WJF A;  1KT3 A;  2NP1 A;  1SRJ A;  1GGL A;  4EFG A;  2Z4I A;  4I9R A;  4QAE A;  4O49 A;  1BSY A;  4OMW A;  4PJ2 A;  1AEL A;  2AT8 X;  1BLR A;  3SZH A;  4IB6 A;  4YVB A;  1QG5 A;  1RSU B;  1VWR B;  2VFB A;  3BX7 A;  3VG2 A;  4WFV A;  2RTK A;  2RTD B;  4BOE A;  2QM9 A;  1YWA A;  2HMB A;  1PBY A;  2A5B A;  4D6B A;  4ZHD A;  2OYB O;  3BRN A;  4K19 A;  1VWI B;  3PDF A;  3HWG A;  1HXL A;  1RLB E;  3LV4 A;  5IO5 A;  3P24 A;  1STR B;  3QQ2 A;  4A8Z A;  1JMX A;  3SZI A;  1KL4 A;  3U03 A;  4BX7 B;  1A18 A;  2LA7 A;  5F6Z A;  3NQK A;  2IZD B;  4I9S A;  1EAL A;  1I05 A;  4Y0R A;  2PY1 A;  4YBP A;  2R73 A;  4BGF A;  2OZQ A;  5BVS A;  3FA7 A;  4NYR A;  1VYO A;  2VDF A;  1MVG A;  1XCA A;  5BYP A;  2RCQ A;  2RCT A;  4L3R A;  1I9H A;  4RUN A;  4HPA A;  4QYN A;  2RTB B;  3HOL A;  4LKT A;  3NX2 A;  4U8U M;  5B3M O;  1SLG B;  3PQU A;  1EPA A;  4IB9 A;  4ORW A;  3FW5 A;  5JD2 A;  1ML7 A;  3ZWE A;  3T1D A;  5KID A;  3BU9 A;  5IO6 A;  2X56 A;  3D4R A;  5HBS A;  4OEM A;  2RTP B;  3VHM A;  1VWJ B;  1VWL B;  1B8E A;  4YKO A;  1EII A;  1TVQ A;  4GH7 A;  3UEU A;  1VWB B;  2BHV A;  4ZH9 A;  4FQB B;  2KW1 A;  1STS B;  5EDB A;  2FS7 A;  2G79 A;  2OL8 O;  2OY8 A;  4JHQ A;  3WVM A;  4ZJ0 A;  4NNT A;  4XME A;  1B4M A;  4CPE A;  1ICM A;  1S44 A;  1BM5 A;  2RA6 A;  4HPB A;  1PTS A;  1ALB A;  3EBK A;  2CM4 A;  5FEN A;  5LJK A;  2QO4 A;  1EIO A;  2FLJ A;  2HLV A;  2Y3E A;  1A2D A;  2A13 A;  4ZHG A;  2WPU A;  4M6S A;  3MG5 A;  3D96 A;  3SOT A;  4CDD A;  2RTN B;  3KFH A;  4TNN A;  1GT3 A;  3MVF A;  2JN3 A;  2KTS A;  4R0B A;  5DG4 A;  4GU8 A;  4ON1 A;  5BVQ A;  4OMX A;  4KC7 A;  1LCW A;  4Z2O A;  4QGV A;  1OEJ A;  1ZND A;  5C0N A;  3U0D A;  1HXZ A;  2RTJ A;  2JOZ A;  1N43 A;  2GTL M;  4CPH B;  1CBR A;  1TOU A;  4A60 A;  1VWQ B;  1FEM A;  1EQD A;  2ZAG A;  3FMZ A;  3RDS A;  3FA6 A;  2OY1 O;  3O2Y A;  1SY0 A;  3P6C A;  4U8U O;  2LBV A;  3RWX A;  1CBS A;  4BX5 B;  3WZO A;  4CPI A;  1FJ1 E;  1VWH B;  3HOE A;  3KVN A;  2AMM X;  1TW4 A;  1VPR A;  1SMP I;  3UAQ A;  1X8O A;  4ML7 B;  4DNE A;  4YGZ A;  1VWG B;  1SWS A;  1BRQ A;  2IZJ A;  4YGG A;  5B29 A;  1VWD B;  3S5V A;  2RTF B;  2N93 A;  3S60 A;  3P6D A;  1SWP A;  1SRF A;  1HMR A;  4Z28 A;  5CSE A;  1YP7 A;  2AKQ A;  3APW A;  4NNS A;  3VGW A;  4COT A;  1JV4 A;  1O8V A;  1KZW A;  1VWC B;  4PSQ A;  2PI3 O;  1SWJ A;  2Q39 A;  1MDC A;  4ZHC A;  4CV7 A;  1SXX A;  4Z27 A;  2W2B A;  4Z2V A;  1T8V A;  1NC9 A;  4MVK A;  4TLJ A;  2EU7 X;  2Q2P A;  1G85 A;  5AJB A;  4ZGF A;  3BS2 A;  2A0A A;  1KL3 A;  3NQ3 A;  4MIS A;  4Y0S A;  5EEE A;  1JZU A;  2MWH A;  3LHN A;  4ALB A;  1OBU A;  1URE A;  1YIV A;  4BX7 A;  4ZGU A;  3ZW1 B;  4FBR A;  3K3L A;  3CWK A;  3ZUI A;  2OFM X;  5FQ7 E;  5HZ8 A;  1VWM B;  4N7D A;  3VPJ E;  3B2I A;  1KQW A;  3APX A;  3F6Z B;  4ORR A;  5D45 A;  3KZA A;  3RBY A;  1BSO A;  2A5C A;  5HZ5 A;  5L8N A;  2HZR A;  3SLT A;  1KFF A;  1U18 A;  3OBL A;  2X34 A;  3TGC A;  4ALO A;  2GTL O;  5IRU A;  2IZI A;  3FDC A;  5B10 O;  4DCB A;  4O4S A;  1HY2 A;  3X00 A;  4ID2 A;  1W4T A;  1SWC A;  1AVE A;  1YWD A;  4QRL A;  4XMF A;  1RST B;  2C1Q A;  3STM X;  5HZ9 A;  1L6M A;  1MEP A;  3C76 X;  3FEP A;  4FBV A;  5K06 A;  3VE2 A;  2GC9 A;  2MO5 A;  2BS5 A;  2G78 A;  2I5V O;  2IZG B;  2RQ0 A;  2RTL A;  4JO6 A;  1ZRY A;  3P6E A;  4U46 A;  3ZZV A;  5HCC C;  4GJS A;  2WSJ A;  1TXL A;  3WZP A;  1UYN X;  1LEL A;  4NYQ A;  4WBK A;  5HTE A;  3PEC A;  1SWF A;  3NQ9 A;  1VWK B;  1N0S A;  3Q6L A;  3P6F A;  1QY1 A;  2LBA A;  3NR3 A;  1SWT A;  3PH6 A;  1I78 A;  1DF3 A;  1UZ2 X;  4AZN A;  3VHH A;  1CBI A;  5AQ6 A;  1XKI A;  3BU1 A;  4GUZ A; 
#chains in the Genus database with same CATH homology
 1PBO A;  4Y0P A;  4O9S A;  2CZU A;  4I3C A;  2DM5 A;  4GZV A;  3L4R A;  1YWB A;  5H9N A;  3E3C A;  2WQ9 A;  4MVI A;  3FEN A;  1QY2 A;  1SA8 A;  5B27 A;  3EM0 A;  3FEL A;  1IKE A;  1I04 A;  3WXQ A;  1BRP A;  1PEE A;  2JMB A;  4BQU A;  4UU2 A;  1HQP A;  2QO5 A;  1I4U A;  4UU3 A;  1KT6 A;  3JQO A;  1P6P A;  3B2J A;  1X89 A;  2P8G A;  2WQA E;  3N91 A;  4EDE A;  1OBQ A;  2CBS A;  2FR3 A;  2FT9 A;  3S5X A;  4QGX A;  3KFG A;  5AEO A;  4YBU A;  4HPD A;  4TQ2 A;  1IW2 A;  1E02 A;  4GK9 A;  5CE4 A;  2XKL A;  2QOS C;  1LF7 A;  4ZR2 A;  2MM3 A;  5HWZ A;  5KHP A;  4IMN A;  4TKJ A;  2LFO A;  5EED A;  4GRJ A;  1JYJ A;  2OVD A;  5FAZ A;  4EXZ A;  1PMP A;  2E4J A;  3S26 A;  4N7C A;  5D47 A;  2BLG A;  1BBP A;  1QQS A;  1SY3 A;  1CRB A;  3P6G A;  2ANS A;  5D48 A;  4O4O A;  4OS0 A;  3BY0 A;  5HTD A;  1QWD A;  4GNY A;  5DPQ A;  2RD7 C;  5LJE A;  1Y9L A;  4KH8 A;  5D4A A;  3ZW1 A;  3U0D A;  4IB8 A;  5H9K A;  3ZQ3 A;  3VG3 A;  1BJ7 A;  5H9L A;  1S2P A;  1MUP A;  3FW4 A;  3UEW A;  3ZW0 B;  4YCH A;  3KFI A;  4WHI A;  2ACP X;  2QO6 A;  1NP1 A;  1DFV A;  3NP1 A;  4EQA C;  1D2U A;  3TF6 A;  1AVG I;  3CMP A;  2K23 A;  5FQ8 E;  5HCE C;  1KGL A;  5CYB A;  1LFO A;  3PH5 A;  4U8U N;  1DZM A;  1FEN A;  1U17 A;  5F58 A;  1LID A;  2W2F A;  1KOI A;  5EDC A;  4CK4 A;  1O1V A;  4NP1 A;  1TOW A;  4YKM A;  4IB7 A;  4HPC A;  2WUT A;  4O4U A;  4DQ4 A;  1DZJ A;  1HMS A;  2X8F A;  3JS1 A;  1I06 A;  2HYS A;  1OEK A;  3CQR A;  1QAB E;  3STN A;  1MX7 A;  5KIC A;  3HWE A;  3RSW A;  2L9C A;  4KII A;  4L1N A;  1LNM A;  1GKA B;  4YGH A;  3JSQ A;  1IIU A;  1A57 A;  3GE2 A;  4KC8 A;  2AT3 X;  4ORY A;  1MX8 A;  1EW3 A;  1SXY A;  1U0X A;  1NGL A;  2OVA A;  3C77 X;  3KQ0 A;  4WFU A;  2OFR X;  1EXS A;  1O1U A;  3WJE A;  2O62 A;  3BX8 A;  3FEK A;  3APV A;  3ELX A;  5IO7 A;  3UEX A;  1DZK A;  5F7G A;  3TGA A;  1D3S A;  1LPJ A;  4ZH6 A;  2GTL N;  2FWV A;  2L5P A;  4TKB A;  2A2G A;  1EI5 A;  3EBW A;  2JW1 A;  3FIQ A;  4MVE A;  2G7B A;  4ORX A;  3TGB A;  1G7N A;  4QYP A;  3WJB A;  3FLL A;  1ERB A;  1CBQ A;  1S7D A;  5LJG A;  1KZX A;  4YH0 A;  2AT5 X;  1ICN A;  2JU7 A;  5LJH A;  3D97 A;  1SY2 A;  5JR8 A;  3CQN A;  3WOV A;  3SAO A;  4GDZ A;  3FR2 A;  3APU A;  2QMI A;  4A1H A;  4ZFX A;  1X71 A;  3OE3 A;  5LKE A;  1OBP A;  3VG7 A;  2AH7 X;  1BSQ A;  1Z24 A;  4OS8 A;  5HZ6 A;  4FBO A;  4IAW A;  3WJG A;  2FRS A;  3ZW0 A;  1DC9 A;  4HFO A;  2NNE A;  4I3D A;  4ODD A;  3PQS A;  3OJY C;  2JU8 A;  3EMM A;  4ZHH A;  5AJC A;  4AZM A;  3ZW2 A;  2Z4H A;  1VYF A;  1JYD A;  2BS6 A;  4LKP A;  5LJD A;  3ZUO A;  1IFC A;  2X46 A;  1SY1 A;  2AL0 X;  4O3X B;  2GJ5 A;  4LZV A;  2POA A;  3PPT A;  4IAX A;  4ORS A;  5HA1 A;  5HAE A;  5LJB A;  1ZNK A;  4MIR A;  1GT4 A;  3MX7 A;  5F1E A;  2WEW A;  3HK1 A;  4IBA A;  1FDQ A;  1Y9T A;  2WWP A;  5L8I A;  1LIC A;  4Y0Q A;  4EEJ A;  4YCE A;  3IFB A;  1FE3 A;  3DSZ A;  2Q4N A;  4YFQ A;  1ADL A;  4YDB A;  4U3Q A;  1OEE A;  3BSZ E;  2ASN X;  2LB6 A;  1R0U A;  1QFT A;  1SXU A;  2KTD A;  4AW8 A;  2ZAI A;  4ZCB A;  3VG5 A;  3VG6 A;  4IAB A;  1CJ5 A;  1PM1 X;  1E00 A;  4KT5 A;  2FTB A;  1OPA A;  1GKA A;  3PED A;  4YMY A;  3P6H A;  4GET A;  4QGW A;  3UEV A;  4I6S A;  2FS6 A;  2BT9 A;  2X8S A;  1KXO A;  2JU3 A;  2LKK A;  3ELZ A;  4IMO A;  5H8T A;  1G5W A;  5H9A A;  1LIF A;  4AZO A;  4LQZ A;  1JBH A;  3VG4 A;  3DTQ A;  4GKC A;  4ZHF A;  3RZY A;  3I17 A;  1X8Q A;  3QKG A;  5FFH A;  3CBC A;  5L8O A;  1GXA A;  1BWY A;  1ERX A;  4OS3 A;  1LKE A;  3U9P C;  3AKM A;  5EPQ A;  4YDA A;  1GM6 A;  2MHD A;  2WR6 A;  4XMH A;  4YFP A;  4FGI B;  4TJZ A;  1KT4 A;  2R56 A;  3HWD A;  4O3W A;  4A1Y A;  4KCA A;  1H91 A;  2Q9S A;  1X8U A;  1ACD A;  1T0V A;  3VE1 A;  3I0A A;  5LJC A;  1DV9 A;  3NAD A;  5LKF A;  3TZS A;  1X8P A;  1RBP A;  2NND A;  3NX1 A;  4XMD A;  1AB0 A;  2XST A;  4GE1 A;  1KQX A;  3D95 A;  3FA8 A;  2CBR A;  1QY0 A;  1VYG A;  2ALL X;  1HBQ A;  2CM9 A;  2KD2 A;  3CBS A;  1GT1 A;  2FR2 A;  3VU1 A;  3G7X A;  1GX9 A;  1LIE A;  1HMT A;  3KFF A;  4QQ1 A;  3F9D A;  1E5P A;  4D6A A;  5HA0 A;  1OPB A;  3WJD A;  4LZU A;  4JGL A;  2L68 A;  2NNQ A;  3FR4 A;  1HN2 A;  1ZNG A;  1JJX A;  1IFB A;  3V8U A;  2L67 A;  3FA9 A;  3BDR A;  5D8J A;  2W2A A;  4CSB A;  3CR6 A;  1B0O A;  3F8A A;  4QZU A;  1YWC A;  2RN4 A;  1E06 A;  1G74 A;  1KT5 A;  2HNX A;  4MVL A;  5FQ6 E;  4TKH A;  1B56 A;  2ACO A;  2AT6 X;  3WJC A;  1LIB A;  2X8T A;  4I3B A;  4NW4 A;  3RKG A;  3C78 X;  4QNI A;  5EZ2 A;  1JJJ A;  3WBG A;  2F73 A;  2X45 A;  4M7M A;  4XMC A;  2A3F X;  3B2H A;  2K62 A;  3FYF A;  2A2U A;  4AZR A;  3HTY A;  3AKN A;  4BVM A;  3GAQ A;  2M4L A;  1NP4 A;  2WEX A;  3EYC A;  1YUP A;  1GT5 A;  3FR5 A;  3O19 A;  2HZQ A;  3STK A;  2F09 A;  5F6B A;  2AT0 X;  5HZQ A;  5BVT A;  1ZNL A;  4ORU A;  4RUU A;  1AQB A;  4GNW A;  4INN A;  4DQ3 A;  4AZQ A;  3B2K A;  4NLJ A;  4O3Z A;  1KT7 A;  4ES7 A;  1GX8 A;  4QZT A;  3P02 A;  3PP6 A;  2CZT A;  2MJI A;  1FEL A;  2GTF X;  1DZP A;  1ZNH A;  3IA8 A;  3NPO A;  1BEB A;  1FTP A;  2OVE A;  2Q2M A;  4O3Y A;  1X8N A;  1SXW A;  2IFB A;  4AYH A;  1YP6 A;  3O22 A;  3H3I A;  2YG2 A;  4NLI A;  1IKJ A;  3BLG A;  3HWF A;  4AZP A;  1EPB A;  5HCD C;  1T68 X;  1JIW I;  1HBP A;  2R74 A;  4ARH A;  1A3Y A;  4O4X A;  2YMS A;  1QFV A;  4I95 A;  1ZNE A;  3B2L A;  3MBT A;  2OVS A;  1EUO A;  4XMG A;  3OD9 A;  3ZI8 A;  4U9C A;  3NBX X;  2KT4 B;  4HWM A;  3WJF A;  1KT3 A;  2NP1 A;  4EFG A;  1GGL A;  2Z4I A;  4I9R A;  4QAE A;  4O49 A;  1BSY A;  4OMW A;  4PJ2 A;  1AEL A;  2AT8 X;  1BLR A;  4IB6 A;  1QG5 A;  3BX7 A;  3VG2 A;  4WFV A;  4BOE A;  2QM9 A;  1YWA A;  2HMB A;  4D6B A;  4ZHD A;  3BRN A;  4K19 A;  3HWG A;  1RLB E;  3LV4 A;  5IO5 A;  3P24 A;  4A8Z A;  3U03 A;  1A18 A;  2LA7 A;  5F6Z A;  3NQK A;  4I9S A;  1EAL A;  1I05 A;  4Y0R A;  2PY1 A;  4YBP A;  2R73 A;  2OZQ A;  5BVS A;  3FA7 A;  4NYR A;  1MVG A;  1XCA A;  5BYP A;  2RCQ A;  2RCT A;  4L3R A;  4RUN A;  4HPA A;  4QYN A;  3HOL A;  4LKT A;  3NX2 A;  4U8U M;  4IB9 A;  3PQU A;  1EPA A;  4ORW A;  3FW5 A;  1ML7 A;  3ZWE A;  3T1D A;  5KID A;  3BU9 A;  5IO6 A;  3D4R A;  5HBS A;  1B8E A;  4YKO A;  1EII A;  1TVQ A;  4GH7 A;  3UEU A;  2BHV A;  4ZH9 A;  4FQB B;  2KW1 A;  5EDB A;  2FS7 A;  2G79 A;  3WVM A;  4ZJ0 A;  4NNT A;  4XME A;  1B4M A;  1ICM A;  1S44 A;  1BM5 A;  2RA6 A;  4HPB A;  1ALB A;  3EBK A;  2CM4 A;  5FEN A;  5LJK A;  2QO4 A;  1EIO A;  2FLJ A;  2HLV A;  1A2D A;  2A13 A;  4ZHG A;  4M6S A;  3D96 A;  3SOT A;  3KFH A;  4TNN A;  1GT3 A;  3MVF A;  2JN3 A;  2KTS A;  4R0B A;  5DG4 A;  4GU8 A;  4ON1 A;  5BVQ A;  4OMX A;  4KC7 A;  4QGV A;  1OEJ A;  1ZND A;  5C0N A;  2JOZ A;  2GTL M;  1CBR A;  1TOU A;  4A60 A;  1FEM A;  1EQD A;  2ZAG A;  3FMZ A;  3FA6 A;  3O2Y A;  2LBV A;  1SY0 A;  3P6C A;  4U8U O;  3RWX A;  1CBS A;  3HOE A;  2AMM X;  1TW4 A;  1VPR A;  1SMP I;  3UAQ A;  1X8O A;  4ML7 B;  5B29 A;  4YGZ A;  1BRQ A;  4YGG A;  3S60 A;  3S5V A;  2N93 A;  3P6D A;  1HMR A;  1YP7 A;  2AKQ A;  3APW A;  4NNS A;  4COT A;  1JV4 A;  1O8V A;  1KZW A;  4PSQ A;  2Q39 A;  1MDC A;  4ZHC A;  4CV7 A;  1SXX A;  2W2B A;  1T8V A;  4MVK A;  4TLJ A;  2EU7 X;  2Q2P A;  1G85 A;  5AJB A;  4ZGF A;  3BS2 A;  2A0A A;  3NQ3 A;  4MIS A;  4Y0S A;  5EEE A;  1JZU A;  2MWH A;  3LHN A;  4ALB A;  1OBU A;  1URE A;  1YIV A;  4ZGU A;  3ZW1 B;  4FBR A;  3K3L A;  3CWK A;  3ZUI A;  2OFM X;  5FQ7 E;  5HZ8 A;  3VPJ E;  4N7D A;  4YFR A;  3B2I A;  1KQW A;  3APX A;  3F6Z B;  4ORR A;  5D45 A;  3KZA A;  3RBY A;  1BSO A;  5HZ5 A;  5L8N A;  2HZR A;  3TGC A;  1U18 A;  3OBL A;  4ALO A;  2GTL O;  4O4S A;  4ID2 A;  1YWD A;  5HZ9 A;  4QRL A;  4XMF A;  3STM X;  1L6M A;  4FBV A;  3C76 X;  3FEP A;  5K06 A;  3VE2 A;  2GC9 A;  2MO5 A;  2BS5 A;  2G78 A;  2RQ0 A;  5HCC C;  1ZRY A;  3P6E A;  3ZZV A;  2WSJ A;  1TXL A;  4NYQ A;  4WBK A;  5HTE A;  3PEC A;  3NQ9 A;  1N0S A;  3Q6L A;  3P6F A;  1QY1 A;  2LBA A;  3NR3 A;  3PH6 A;  1DF3 A;  1UZ2 X;  4AZN A;  1CBI A;  5AQ6 A;  1XKI A;  3BU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...