2D01A

Wild type photoactive yellow protein, p65 form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
124
Chain Sequence
EHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title The Crystal Structure of the R52Q Mutant Demonstrates a Role for R52 in Chromophore pK(a) Regulation in Photoactive Yellow Protein
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 35
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2d01A00
4NXEA 2ZBBA 2V0UA 5IU1A 4PKYG 3BWLA 4YWZA 1S67L 2K7SA 3K3CA 1DP6A 1N9OA 2L1MA 3E4PA 3H7WB 3F1OA 5F6AA 4GS9A 1P97A 4MN5A 3OLOA 4LRZE 3A0SA 4NXBA 3IBRA 3EWKA 2W0NA 3UE6A 3LUQA 2QKPA 3UB6A 1DRMA 1KOUA 3VE4A 1T1CA 2D02A 3F1NA 1EW0A 3NOPC 3CLOA 3NOTC 1MZUA 3E4QA 4BBVA 1UWPX 5A8BA 1TS7A 5IS1A 5J3WA 4DJ3A 4EESA 3MR0A 3UMEA 3NOUC 4R6LA 1BYWA 2V0WA 5F68A 5HWVA 2Z6CA 1T18A 2WKRA 5HWWA 3MFXA 3PYPA 3C2WA 4EEPA 1TS6A 2JN7A 2P7JA 3IS2B 5KIZA 5HD5A 3EEHA 4HNBA 4XT2A 1X0OA 2EA9A 2PR5A 2M1CA 4I38A 1T1BA 1TS8A 4H6JB 4F3LB 1OTAA 4WL9A 4HH3A 3ZQ5A 1S4SA 3CWFA 3HJKA 3VOLA 4JGPA 2YKHA 3FC7A 2OOLA 2VV6A 3A0RA 1LL8A 4HH2A 2KDKA 4WN5A 3MQOA 4B9OA 3GDIA 3MXQA 3VE3A 3UB9A 3D72A 4MN6A 2YKFA 4I3IA 2PR6A 4EQ1A 1D06A 4E04A 2QWSA 1LSXA 3MJQA 2V1BA 1TS0A 1DP8A 1T1AA 1V9ZA 3F1OB 3K3DA 4GS9B 2ZOHA 4I3JA 4I5SA 5HZHA 1N9NA 1NWZA 5J7EA 5TBMA 1OTEA 2WKQA 3A0VA 1OTDA 1UGUA 4L9FA 4LRXC 2V9AA 3H82B 3BY8A 1XJ2A 1OJ5A 2PDRA 1N9LA 4NXFA 4HJ3A 1XFQA 5HDSA 4HP9A 3E4OA 3F1NB 3MQQA 2R78A 1S4RA 4EETB 4KQDA 4HY8A 2V1AA 2A24A 4JGQA 1OJGA 4RQ9A 1T19A 1XJ3A 3F1PA 1OT6A 2JHEA 4KUKA 3RH8B 1LSVA 2WKPA 1V9YA 4GW9A 3C8CA 1LT0A 5J4EA 2ZOIA 2VV7A 4LLOB 4JGOA 2VLGA 3PHYA 2H28A 4GHIB 2OWJA 4PKYA 3ICYA 5HDCA 4EERA 1P0ZA 1WA9A 1XJ6A 4BBUA 1F9IA 1GSXA 1S1YA 1OTIA 4L9GA 2L4RA 4HJ4A 2KX6A 4HI4A 4XT2B 3LI8A 5DKLA 1DP9A 4GCZA 5DJUA 5HD3A 5HSQA 4F3LA 3GECA 3LIEA 4WUJA 4DJ2A 3LYXA 1ODVA 2HV1A 3G6OA 5G4YA 5AVFA 3NHQA 4BBTA 4LRYC 2OWHA 5I5LA 4R3AA 2Z6DA 4HHDA 4LPZA 2L0WA 4HOIA 3LIBA 3H7WA 3LIFA 1GSWA 4EW7A 2PYRA 3CAXA 4M4XA 1D7EA 3NJAA 3LIAA 2I9VA 4L9EA 1XFNA 2QJ5A 4KUOA 4I39A 5DKKA 4JGRA 5HWTA 4EEUA 5TBMB 1GSVA 2PD8A 4NXGA 3UB8A 3BY9A 5G4ZA 4HP4A 2GJ3A 2PHYA 3H82A 3H9WA 3P7NA 5AVEA 1F98A 2QHKA 2PYPA 2D01A 3LIDA 2J80A 1OTBA 4HJ6A 5EFWA 3LICA 2A24B 2VEAA 1S66L 3KX0X 4WLAA 5F69A 3F1PB 1OT9A 4R70A 2W27A 3UMDA 5HDDA 3FG8A 1UWNX 2B02A 4HIAA 2CMNA 3UB7A 2PD7A 2VV8A 1Y28A 2BASA 4K08A 3IS2A 4GHIA 5F5YA 1G28A 3HJIA 1JNUA 1VB6A 1S1ZA 3SW1A 2QJ7A 4WF0A 4R38A 5DJTA 4HQAA 2INWA 3T50A 4H6JA 3RTYA 4EXOA 1XJ4A 3B33A 3LI9A 3ULFA 4I3AA 1LSWA
chains in the Genus database with same CATH superfamily
2IWDA 4PKYG 3BWLA 3WRTA 3KSHA 1XXMA 3CG5A 1S67L 2K7SA 4D2OA 3K3CA 4N1HA 1DP6A 2L1MA 4JLFA 1FR6A 1YKDA 2EWWA 5F6AA 1JTGA 3W4OA 2P04A 2XEPA 3BQ8A 4BL3A 4LENA 3G32A 1BSGA 4WZ5C 3PXPA 3PAEA 1E25A 4DE3A 4RYEA 4NXBA 3ZGAB 1CQAA 3B47A 2BTFP 3IF5A 4CLCA 5GLDA 3LUQA 4RX2A 1G6OA 3ZG7B 4ARZB 2QPNA 3VE4A 3MZEA 5KSHA 3GV9A 1F2KA 4KZAA 2J8YA 3IT9A 3NOPC 4FSFA 3CLOA 1CF0A 5F82A 1MZUA 1DJCA 1S6RA 1WE4A 1MC0A 1UWPX 2HJ9C 3V50A 1HZOA 4RA7A 4QY6A 4QHCA 5J3WA 2ZMAA 2Y2PA 3VOYA 5D3OA 4G3WA 3D4FA 1FCOA 3MR0A 3PBNA 5K5BA 3M2KA 1H8YA 1YMXA 3I7JA 4LV3A 1K6SA 1ACFA 1PWGA 2WKRA 4ZBEA 2PBYA 2WAEA 3LEQA 5DF9A 1PZPA 3C2WA 4EEPA 3U2AA 1QMEA 4CQHA 3NY4A 5HD5A 4HNBA 3Q82A 3VFHA 3A3JA 2O9CA 2EA9A 3CMZA 5C5KA 3SS3A 4O7DA 2OLUA 2ZD8A 1PI5A 1TDGA 3C38A 3B42A 5EOEA 1BULA 4UQIS 4Q0JA 1CK3A 2KDKA 3GDIA 1SKOA 2WGWB 3MXQA 3UB9A 3D72A 3V3RA 2IWBA 1O07A 3CUEC 2PR6A 5FAQA 2DMWA 3HLGA 2HGVA 3DW0A 3UN7A 3E2LA 5MC7A 5LBRA 3BFCA 4OPZA 4IJGA 3TOIA 5IT5A 4OH0A 3ZNYA 1FR1A 1K56A 2PRFA 3W8KA 5HW3A 4OP8A 1CI9A 1OTDA 4DE0A 3NECA 3K2NA 3S7OA 1PFLA 4FTXA 4LRXC 2GX5A 1XJ2A 4GDNA 2VGJA 2PDRA 4ARZA 5KMWA 3KSFA 4KZ4A 1N9LA 4NXFA 2EXBA 5CHJA 1LI0A 3MSHA 1RGYA 3LO7A 3HUOA 1IEMA 1K54A 2OAP1 3ZCZA 4EWFA 3FKVA 2ZC3B 1SKFA 4D60A 2ZQAA 2A24A 3TE8A 3O88A 4N1XA 1OT6A 4S2IA 3RH8B 1V9YA 3KSGA 2NUTC 5IHVA 4Y17A 4GJ4A 3C8CA 1IKGA 5J4EA 5TFQA 1PW8A 4QJGA 4JGOA 3LGOA 4BWIA 1XPBA 4B4ZA 3OBFA 4YINA 5CXWA 5EV0A 5DFYA 4JPMA 3E98A 4WEKA 2XR0A 5E2EA 5FA7A 1Y54A 5FATA 1GSXA 4E3OA 1ZKJA 2B5RA 4L9GA 3LR4A 3T4JA 4IBRA 3Q07A 4XT2B 4IHQA 3SS4A 3DWZA 3QP2A 3WRZA 5CEBA 4GZBA 4DJ2A 3LYXA 4Y0TA 2WGWA 5L07A 1LLBA 5I5LA 5GLAA 5DVAA 2L0WA 3HLBA 5BOHA 3LIFA 1IYPA 1K4FA 4U0XA 1L3LA 4R3BA 4DE1A 2PYRA 2ZQ7A 3NJAA 5CRFA 2KOIA 1NZOA 1K6RA 2ACGA 3CPTB 1H8MA 2XFTA 1XFNA 3C5AA 1MWSA 5DKKA 4KQRA 5TBMB 4EBNA 1ZTUA 4LV0A 3VFFA 5FI6A 1VEUB 2J9PA 3BY9A 1PI4A 2PHYA 2W3HA 3NULA 4CLCC 1GHIA 4E3NA 2H0TA 5AVEA 1MKIA 1EROA 1XGIA 3C7UA 2G7UA 3TG9A 2PYPA 5DTTA 3LIDA 2FFYA 1VETA 2J80A 4XXRA 2HZ5A 4PHTA 5AQ7A 5FQQA 1LL5A 2GZAA 1YPRA 2ZC5B 5EFWA 1SHVA 1S66L 3T1RA 5FQKA 3F1PB 5CGWA 4QB8A 1DY6A 3UMDA 3FG8A 2VGLM 1RGZA 3EQVA 3FZCA 2CMNA 3WS2A 3IHBA 1Y28A 3PBOA 2O9AA 4EUVA 3G31A 3HL9A 3VSLA 3LR3A 1YT4A 4G3VA 2DNSA 3HJIA 1SZVA 4PM8A 3N8RA 4WF0A 4YNRA 2VGLS 5E43A 1KGEA 5AJGA 3IX3A 4LFUA 2BLSA 4H6JA 1TF1A 1ALQA 1HVBA 1YLTA 1HD8A 3RTYA 2C5WB 5FDSA 1XP4A 4S2MA 1DJBA 2PAVP 5M18A 5FEGA 2ZBBA 2V0UA 5IU1A 2WK0A 4YWZA 1PIOA 1MWUA 3FYZA 1ESIA 2O9BA 2R9WA 4P87A 1N9OA 3H7WB 3P98A 2H0YA 3F1OA 4MBKA 1PNEA 1CEFA 3BLMA 1NYMA 3EGDC 3EOIA 3V5MA 1YM1A 1NLYA 5FQJA 4X25A 4OLGA 4LRZE 3A0SA 3OZHA 3FKWA 2P9VB 3IBRA 1YAXA 2ZL1B 3UB5P 4UHUA 3LY3A 2QKPA 1KOUA 4QPRA 3ZHHA 3SH7A 4IBXA 5FDHA 3VP4A 2D02A 3F1NA 1NLZA 2ZC7A 1Z09A 3CI6A 4X6TA 1J9MA 3E4QA 3Q81A 4OQ0A 1K54C 1W79A 2C6WB 2A49A 1TS7A 2H5SA 2XQZA 3QP1A 3T4SA 5IS1A 3LR0A 1YSPA 3MMHA 4DJ3A 3VP3A 2XH9A 2Y2KA 3GRJA 1XX2A 3IX4A 1ERQA 3UMEA 3NOUC 4K0WA 3RXXA 1BYWA 2WADA 4YOFA 3NBLA 5F68A 5HWVA 1H3QA 1T18A 3MFXA 2W1TB 3S7QA 2W3FA 2X02A 5KIZA 3LCEA 2OSUA 3MF0A 3OPRA 4E3KA 1E3UD 4C6YA 3V39A 3UDIA 3KYEA 1X0OA 2QYBA 5EVIA 2XLNA 1GA0A 4KZ9A 1MBLA 1ZG6A 1W63M 1EWZA 5HX9A 4F3LB 3T4OA 3CITA 1S4SA 4KZ5A 2YKHA 3OPHA 3FC7A 4S2NC 5DTKA 3MQOA 3IH8A 4OOLA 4R4SA 3CZDA 1JTDA 3BEBA 1ES5A 2B95A 3N6IA 2P74A 3V3SA 3NDGA 3MFDA 4I3IA 4R4RA 4CJNA 2Y55A 4EQ1A 3T4LA 1ONHA 1W5DA 1LSXA 2V1BA 2QZ6A 1DP8A 3RXWA 1Q2QA 1RP5A 1T1AA 2Y79A 3K3DA 5FAPA 3SOIA 4GS9B 5FAOA 2ZOHA 2JCHA 4Y13A 3O86A 4WM9A 1OTEA 1ES3A 2E8IA 5U47A 3UPOA 1UGUA 5EM0A 4KG2A 1N4OA 2HJEA 4DF6A 2V9AA 5L10A 4NETA 1FSWA 4S2PA 3GQZA 3R7WB 2HDQA 1IFQA 4H8RA 4HP9A 5L2FA 4C3QA 4EQIA 5FQMA 3O5YA 3MQQA 1S4RA 4EETB 4KQDA 4GNUA 2PU2A 5GLBA 3NIAA 4RQ9A 3L7HA 2EXAA 3QNBA 1XJ3A 4Y5FA 3PR6A 1LSVA 2WKPA 1YQSA 4DDYA 4OKPA 3HUMA 1KDSA 2XFSA 4ME4A 1LT0A 4E3LA 3VP0A 4DRTA 4LLOB 2EX2A 3Q7VB 1L0GA 1ZC2A 2O99A 1K55A 4UQIM 4GHIB 1IYOA 2OWJA 1VHMA 2W1TA 2J9OA 4BLMA 2ZLYA 1WA9A 4E3IA 1FIKA 1GHMA 4UA6A 5GL9A 4RVAA 1OTIA 2JC7A 4U0TA 4HI4A 4KQQA 4MCWA 3HBRA 3LI8A 5DKLA 1ONGA 3TRCA 1WYCA 4F3LA 3T1QB 3MKFA 3MXSA 4GKUA 2XRNA 4BQMA 4WUJA 5GLCA 4N9KA 2R9XA 1BTLA 4JF6A 5M19A 1KVLA 3IH9A 3BFFA 4Y2FA 1SCWA 4LRYC 4O0PA 2OWHA 4IEDA 2Z6DA 4HHDA 3BFDA 1K0KA 4AFIA 4HOIA 1G6AA 3LIBA 2Y91A 1H5XA 1GSWA 2M7UA 4EW7A 2ZQCA 4O8GA 1AWIA 1D7EA 3BQAA 1YLYA 3BECA 3DWKA 4UA9A 5GHYA 3ZFZA 2W3GA 3G2YA 1Q2PA 1TD5A 3WWXA 5EVLA 3EEAA 4OOMA 3IF6C 3LFVA 3DTIA 4OQGA 4KZ8A 4BL2A 1YLPA 1JVJA 3MZFA 4KG6A 4OPRA 2GJ3A 3P7NA 4FCFA 4DDSA 1F5MA 2A2LA 2XA7S 1W8YA 2ZC4B 2QHKA 1TDLA 3RFBA 4MN7A 2JBFA 3G30A 4KZ7A 2HP5A 2RL3A 3MZDA 3IX8A 5F83A 4IVKA 5HDDA 4Z1WA 2O0YA 5EM1A 1LL9A 5KSCA 5F1FA 3DTKA 3UB7A 3EQUA 3Q7VA 2QMIA 1NY0A 2BASA 1KE4A 3GMWA 2ZM2A 1HLUP 5DF8A 2MJ6A 4GHIA 2HDSA 4JBFA 1G28A 3TSGA 1VB6A 1ZHHB 2J3TD 3ZVWA 2HDUA 4R38A 4WELA 4FUWA 3UE1A 5FQIA 5EUAA 1O7EA 2P08A 1HTZA 4PM5A 3JPUA 1IOUA 2ZQ8A 4MDZA 5DFXA 5EVIC 3QP4A 4EXOA 4DE2A 4E6XA 3IWOA 3B33A 3G4PA 3ULFA 3D3OA 1LSWA 3A3EA 4X69A 3SH8A 5HAIA 1K25A 3FV7A 1BLSA 4BD0A 3OOVA 4OOYA 4S2LA 3S22A 1GHPA 1P97A 4MN5A 1L0FA 2I72A 4LCLA 4KENB 4JKTA 2UV0E 1KE0A 5FL3A 3FWLA 3NCKA 3L9KA 2W0NA 2VGKA 2HP6A 4P6ZM 3UB6A 4R3JA 4Y15A 5TJJA 1DRMA 4GB7A 3WS4A 3BM6A 1T1CA 4G3KA 4S2JA 1EI5A 3NOTC 1CEGA 5EVEA 4GLQA 4P6ZS 3JVVA 2DRWA 4Y0UA 4QD4A 1ERMA 2XD5A 4ESPA 3OCNA 4EESA 1XGJA 2IWCA 4X1LA 5FI7A 4CLCE 4Q0HA 3E0YA 2EFXA 1NXYA 2V0WA 2EWVA 3C30A 3BYDA 2IA2A 1BT5A 4P6BA 2Z6CA 4ZTKA 5HWWA 2RCXA 4LCMA 3PYPA 4X56A 4KQOA 2JN7A 5E2FA 1I5QA 1KDWA 3IS2B 1K55C 5HL6A 3CHWP 4R0QA 5E2GA 4N92A 3EEHA 2Z2LB 3UE0A 2ZM0A 5L09A 4JXSA 2HF6A 4IUHA 4XT2A 2Y59A 4B88A 2M1CA 4I38A 3AGEA 4UAAA 1G5UA 4OPQA 4ZDXA 1OTAA 1N9BA 3GTCA 1VM1A 4HH3A 3ZQ5A 1ESUA 3VOLA 3RJUA 4JGPA 4LGWA 3VV4A 3IWIA 2VX8A 2OOLA 2VV6A 3A0RA 3G35A 4HH2A 1GCEA 4B9OA 4EUZA 3CUEA 4DMZA 2YKFA 1GA9A 2XK1A 4OLDA 2OLVA 5A92A 1D06A 2WYXA 4E04A 2QWSA 2ZJ9A 3MJQA 1TS0A 5HAQA 1FCMA 2CC1A 1SDEA 2V8FA 3CPTA 3ZG0A 2M7VA 2PT7A 4E6WA 3PAGA 4I3JA 5HZHA 3W4PA 1N9NA 1YLWA 5AQAA 1H8ZA 2B18A 5TBMA 4PMAA 1VEUA 2WKQA 3A0VA 2Y2JA 5JYPA 2Y2NA 2Q9NA 4E3MA 2LB9A 4CLCB 4NKPA 3H82B 1L0EA 1MWTA 1P9RA 3QP6A 1FOFA 2V20A 1NZUA 1FILA 5HDSA 3BW6A 3UNWA 4GN2A 2WZZA 4EV4A 4MNRA 2Y2QA 2Y2LA 1ES4A 4GDBA 5FASA 1BUEA 3GR2A 4A5RA 2Y2GA 4JGQA 1OJGA 3VP1A 3M6BA 3F1PA 4Y3IA 3HLDA 2UWXA 3ZYTA 2HPBA 4JXWA 4MLLA 4JF4A 5G18A 4PPRA 2ZC6B 4Q8IA 3R4KA 2ZOIA 2VV7A 1PZOA 5DTSA 3QP5A 3CJMA 2H28A 4PKYA 3WS5A 5HPIA 1I2SA 1P0ZA 1TEMA 3GVBA 4WMCD 4ZAMA 3DAVA 3HVFA 1XJ6A 1F9IA 1S1YA 4QY5A 3A3DA 1STZA 2L4RA 4JF5A 4HJ4A 3TW8A 2WKHA 4OP5A 5KZHA 5AQ9A 3VSKA 5HL1A 1DP9A 4GCZA 5DJUA 5HD3A 1NYYA 5HSQA 2AVXA 5EECA 4HBTA 3UO9A 3V67A 1K57A 3FPWA 3LEZA 2HV1A 4R23A 3G6OA 1PYYA 3C4PA 4S2OA 3KYQA 1SKOB 4ZRRA 5AVFA 2V8CA 5M1AA 1KE3A 3NHQA 4QU3A 4BBTA 3N7WA 1W7FA 4R3AA 3ISGA 2HDRA 2K2NA 3H7WA 1XA7A 3A3FA 4JXGA 4WZ4A 4Y0OA 4DKIA 3T4TA 2Z2MB 3T12B 1MWRA 2PBDP 1DJAA 1H0MA 1RCJA 1IYSA 2XDMA 2I9VA 5CTMA 2Y2MA 4I39A 3T4KA 2P9VA 4JGRA 4F94A 4LV1A 3QP8A 4EEUA 2ZL1A 4NXGA 4FOFA 2EX8A 3UB8A 2HP9A 2Y2OA 4R1GA 4K0XA 5G4ZA 5TR7A 3H82A 3UDFA 2VA0A 3S7NA 2A3UA 3H9WA 1FQGA 1AXBA 4EBLA 4P85A 3ZVTA 1XKZA 1CI8A 1JWVA 2EX9A 3B3XA 4WYYA 3OPPA 3LICA 3MKEA 4IVIA 2EFUA 2A24B 2VEAA 1YLZA 3OCLA 3AGFA 3KX0X 3IWQA 4OONA 1BLPA 1KGFA 4YFMA 5EVID 4R70A 4WEJA 4XUXA 2W27A 3ZG9B 1UWNX 4HIAA 3NDEA 2PD7A 3HUNA 5EOOA 4K08A 2JE5A 5CHMA 2XGNA 4E3JA 3ITBA 3LY4A 1S1ZA 5TGFA 4QWOA 2QJ7A 5CECA 4GD8A 5DJTA 2WZXA 4FH2A 3O87A 4HQAA 3T4QA 3FPVA 2BG1A 2ZMFA 3PBQA 4L0LA 3N4IA 5HPFA 3T1XA 4C75A 3BLSA 4FD8A 2WGVA 2GDNA 4Y7PA 4EU0A 1MY8A 1FCNA 2G2UA 5J8XA 3U4LP 1XJ4A 3LI9A 4I3AA 1QMFA 4BMWA 3TJZC 4EBPA 1YMSA 3N8LA 4NXEA 4FH4A 4ID4A 3WS0A 4CLCD 1OMEA 2PU4A 1KGGA 3E4PA 1PRQA 3QNCA 3IXGA 2J7VA 4GS9A 4HEFA 3KO6A 2X71A 2V1ZA 2XA7M 3BRMA 3C7VA 2JKTI 3OLOA 3DBAA 4X55A 4ETZA 5CERA 1E4DA 2VK3A 3MS6A 3PBTA 3EWKA 2W3EA 4PM7A 3UE6A 1NRJA 5CHUA 3BFEA 4BD1A 4ETXA 3R7WA 2Q9MA 3LR5A 3NI9A 4HESA 2WAFA 1EW0A 4RX3A 1U60A 5E2HA 4BBVA 5A8BA 1VETB 2DCFA 2VKSA 3DTEA 1TVFA 2Y4AA 3OC2A 1J3WA 5A93A 2OV5A 5EPHA 1VQQA 5HFOA 4DXCA 4LV2A 3IBJA 4R6LA 3A3IA 3UE3A 2FFFB 2J3WA 4HBUA 2XROA 4JXVA 4S2KA 1JWPA 1TS6A 2FZ0A 4X68A 2P7JA 3OPLA 1PW1A 3GSGA 5JYOA 1NJ4A 4M3KA 4ZJ3A 1K4EA 5AQBA 3M6HA 5L8MA 3QHYA 3SZTA 4KZ3A 4PM9A 2PR5A 1T1BA 4P0MA 1TS8A 3EGXC 4H6JB 4NEED 4WL9A 3BJNA 5HAPA 3CWFA 1IKIA 3HJKA 1WYBA 4S2NA 1K38A 1XA1A 1LL8A 4WN5A 1K56D 4UA7A 4GD6A 3VE3A 3S7PA 4MN6A 1K57C 2XSSA 1A0KA 2JKRI 2OAQ1 3S4XA 3W2ZA 3IXBA 3ZDJA 4GOGA 1P9WA 4WZ5A 4DN0A 4DXBA 2K31A 3KSIA 3P01A 5GHXA 1V9ZA 3F1OB 2EX6A 4XUZA 1Z6FA 4X1MA 1G68A 4KG5A 4I5SA 4O01A 3IF6B 1NWZA 5J7EA 2JKTM 3MXRA 2XD1A 3N8SA 2H10A 4L9FA 3BY8A 4WBGA 1OJ5A 4UEYA 3IHAA 3W4QA 5CEDA 4HJ3A 5FEFA 1XFQA 1C3BA 3NC8A 3E4OA 3F1NB 2R78A 1PWCA 3HLCA 4HY8A 3HLWA 2V1AA 4KZBA 3MQ0A 1T19A 1M40A 2JHEA 1KVMA 1MXOA 3E2KA 4KUKA 2G2WA 4GW9A 3IXDA 3BFGA 4PM6A 1CJFA 2FH5A 4NK3A 4MBFA 2VLGA 4OQIA 5CX7A 2X01A 5A90A 3PHYA 3DTMA 4OPYA 4U3TA 2XF3A 3ICYA 5HDCA 4EERA 3IQAA 3MBZA 4ZJ1A 4Q0IA 2GNXA 3D9YA 3G34A 4BBUA 4II7A 4KZ6A 2VZWA 2KX6A 1BLHA 2ZM8A 3G2ZA 1LI9A 5EVIB 1W8QA 1S0WA 1ZG4A 3KYZA 1M6KA 3VP2A 5EE8A 4X53A 5CTNA 3GECA 3ZG8B 3LIEA 1YLJA 3HLEA 4MEZA 3IXHA 3HCYA 4ZJ2A 3VOZA 1ODVA 4CPKA 1BZAA 3Q7ZA 3AGDA 5G4YA 1E3UA 1W63Q 3VMAA 3UPNA 5CGXA 3ZG5A 4WMCA 2Y2IA 1OPXA 4IUKA 4LPZA 5FI2A 2J3TC 2W1RA 2JKRM 4OQHA 1JWZA 4B4XA 3T1SA 3CAXA 4M4XA 5CGSA 1PWDA 3LIAA 4K91A 2E8JA 2Q0OA 1Y4OA 2ZQ9A 3P09A 3O3VA 4L9EA 3Q1FA 2QJ5A 4KUOA 5DF7A 3IF6A 1YSQA 5HWTA 1GSVA 1SDNA 2PD8A 2KLIA 3PTEA 2JKGA 4HP4A 2W3DA 5I94A 1F98A 5A91A 1BLCA 4N9LA 3WS1A 4BJPA 2D01A 4MMNA 3PBSA 4PAUA 3M2JA 1OTBA 2NUPC 2WKIA 3PBRA 3SH9A 4HJ6A 3HREA 5GHZA 2Y2HA 5FSRA 3UDXA 5HARA 4NG2A 2ZQDA 4WLAA 3ITAA 5F69A 2WKEA 3SS5A 1IELA 1OT9A 3JYIA 1IYQA 1LHYA 2LB5A 4OVDA 3UPPA 2B02A 5FQ9A 1MPLA 3HLFA 1ES2A 2VV8A 1L2SA 1L0DA 3IS2A 5F5YA 1JNUA 3SW1A 3UY6A 1NRFA 2JKFA 2WGIA 3C4OA 4Z9QA 2INWA 4B93A 4MBHA 3T50A 1MKMA 3ZNTA 2WUQA 2VJWA 2ZMVA 3JVUA 1D1JA 2V2FF 5F1GA 1I2WA 2Y8HA 3S1YA 1FSYA 4BENA
chains in the Genus database with same CATH topology
4BMWA 3TJZC 4NXEA 2ZBBA 2V0UA 5IU1A 4PKYG 4CLCD 3BWLA 4YWZA 3KSHA 1S67L 2O9BA 3OOVA 2K7SA 3K3CA 1DP6A 1N9OA 2L1MA 3E4PA 3H7WB 3F1OA 1YKDA 2EWWA 5F6AA 2P04A 4GS9A 3EGDC 3EOIA 1P97A 3BQ8A 4MN5A 3KO6A 1NLYA 2XA7M 3PXPA 2JKTI 3OLOA 3DBAA 4ETZA 5FL3A 4LRZE 3A0SA 4NXBA 3IBRA 1YAXA 3B47A 3PBTA 3EWKA 2W0NA 2W3EA 4CLCA 3UE6A 3LUQA 1NRJA 4P6ZM 1G6OA 2QKPA 3UB6A 4ARZB 5TJJA 1DRMA 3R7WA 1KOUA 4QPRA 3VE4A 4ETXA 5KSHA 1T1CA 2D02A 3LR5A 4G3KA 3F1NA 1EW0A 1NLZA 3NOPC 4FSFA 3CLOA 3NOTC 3CI6A 1MZUA 3E4QA 1MC0A 4BBVA 1UWPX 4GLQA 5A8BA 2HJ9C 4P6ZS 2VKSA 1TS7A 5IS1A 3T4SA 5J3WA 3OC2A 3LR0A 1YSPA 3JVVA 3MMHA 4DJ3A 3OCNA 4G3WA 4EESA 3MR0A 3PBNA 3UMEA 5K5BA 3NOUC 4CLCE 4R6LA 3IBJA 4Q0HA 3E0YA 1BYWA 3UE3A 4YOFA 2J3WA 2V0WA 2EWVA 3C30A 2IA2A 5F68A 5HWVA 1H3QA 2XROA 2Z6CA 1T18A 2WKRA 5HWWA 3MFXA 2W1TB 3PYPA 5DF9A 3S7QA 2W3FA 4KQOA 3C2WA 4EEPA 2FZ0A 1TS6A 3U2AA 2JN7A 4CQHA 2P7JA 3IS2B 5KIZA 5HL6A 5HD5A 3MF0A 3EEHA 4HNBA 2O9CA 5L8MA 2HF6A 4IUHA 4XT2A 1X0OA 2QYBA 2EA9A 2PR5A 2M1CA 4I38A 5C5KA 1T1BA 1W63M 1TS8A 3EGXC 4H6JB 4F3LB 1OTAA 3T4OA 3CITA 4NEED 3C38A 4WL9A 3BJNA 4HH3A 3B42A 3ZQ5A 1S4SA 4UQIS 3CWFA 4Q0JA 3HJKA 3VOLA 4JGPA 2YKHA 3VV4A 3FC7A 2VX8A 2OOLA 2VV6A 3A0RA 1LL8A 4HH2A 2KDKA 4WN5A 3MQOA 4B9OA 4OOLA 3GDIA 3MXQA 3VE3A 3S7PA 3UB9A 3CUEA 3D72A 4MN6A 4DMZA 3CUEC 2XSSA 2YKFA 4I3IA 2PR6A 2DMWA 2JKRI 4EQ1A 1D06A 4E04A 2HGVA 3T4LA 2QWSA 2OAQ1 1LSXA 3MJQA 3W2ZA 5MC7A 2V1BA 5LBRA 1TS0A 1DP8A 1P9WA 4DN0A 1T1AA 2K31A 3KSIA 3P01A 2M7VA 1V9ZA 2Y79A 3F1OB 3K3DA 4IJGA 2PT7A 4GS9B 2ZOHA 4I3JA 5IT5A 4I5SA 4O01A 5HZHA 1N9NA 1NWZA 2B18A 5J7EA 5TBMA 1OTEA 2WKQA 3A0VA 1OTDA 2JKTM 1UGUA 3S7OA 3K2NA 2LB9A 2HJEA 4CLCB 4L9FA 4LRXC 2GX5A 2V9AA 3BY8A 3H82B 4NKPA 1XJ2A 1OJ5A 4UEYA 1P9RA 2PDRA 4ARZA 3KSFA 1N9LA 4NXFA 4HJ3A 1XFQA 3R7WB 1IFQA 5HDSA 4HP9A 3BW6A 3E4OA 2OAP1 3F1NB 3O5YA 3MQQA 2R78A 1S4RA 4EETB 4KQDA 4HY8A 2V1AA 2A24A 4JGQA 1OJGA 3TE8A 3MQ0A 4RQ9A 1T19A 1XJ3A 3F1PA 4Y3IA 4Y5FA 1OT6A 3PR6A 2JHEA 3ZYTA 4KUKA 3RH8B 1LSVA 2WKPA 1V9YA 3KSGA 4GW9A 2NUTC 4GJ4A 3C8CA 4ME4A 1LT0A 5J4EA 3R4KA 2ZOIA 2VV7A 2FH5A 4LLOB 4JGOA 4BWIA 2VLGA 5CX7A 3OBFA 3PHYA 2O99A 4UQIM 2H28A 4GHIB 2OWJA 4PKYA 5DFYA 5HPIA 3ICYA 5HDCA 1VHMA 2W1TA 4EERA 3E98A 4WEKA 1P0ZA 4Q0IA 2GNXA 1WA9A 1XJ6A 4BBUA 1F9IA 1GSXA 1S1YA 4II7A 1OTIA 4L9GA 1STZA 2L4RA 2VZWA 3LR4A 4HJ4A 3T4JA 2KX6A 3TW8A 4HI4A 4MCWA 4XT2B 3LI8A 4IHQA 3KYZA 5DKLA 1DP9A 4GCZA 5DJUA 5HD3A 5HSQA 3TRCA 4F3LA 3GECA 2XRNA 3LIEA 4WUJA 3V67A 4DJ2A 3HCYA 3FPWA 3LYXA 1ODVA 2HV1A 3G6OA 5G4YA 3KYQA 1W63Q 4ZRRA 5AVFA 4Y2FA 3NHQA 4BBTA 4LRYC 4O0PA 2OWHA 5I5LA 4R3AA 2Z6DA 1OPXA 4HHDA 4IUKA 4LPZA 4AFIA 2L0WA 4HOIA 3LIBA 3H7WA 2K2NA 1GSWA 3LIFA 2J3TC 2M7UA 4EW7A 2W1RA 2JKRM 3T4TA 4O8GA 2PYRA 3CAXA 4M4XA 1D7EA 3NJAA 2KOIA 3BQAA 3LIAA 1H8MA 2I9VA 4L9EA 2W3GA 1XFNA 2QJ5A 4KUOA 4I39A 3T4KA 5DKKA 1TD5A 4JGRA 3EEAA 4OOMA 3LFVA 1YSQA 5HWTA 4EEUA 5TBMB 1ZTUA 1GSVA 2PD8A 2KLIA 4NXGA 4FOFA 3UB8A 3BY9A 5G4ZA 4HP4A 2GJ3A 2PHYA 2W3HA 3H82A 2W3DA 4CLCC 2VA0A 3S7NA 3H9WA 3P7NA 5AVEA 1F98A 1F5MA 2A2LA 2XA7S 2G7UA 4BJPA 2QHKA 2PYPA 2D01A 4MMNA 3PBSA 3LIDA 4PAUA 3RFBA 2J80A 4PHTA 1OTBA 2NUPC 2GZAA 4MN7A 3PBRA 4HJ6A 5EFWA 3LICA 2A24B 2VEAA 3OCLA 1S66L 3KX0X 4WLAA 5F69A 3F1PB 1OT9A 4R70A 4WEJA 2W27A 3UMDA 5HDDA 3FG8A 2LB5A 2VGLM 4Z1WA 3EQVA 2O0YA 1UWNX 2B02A 4HIAA 2CMNA 3UB7A 2PD7A 2VV8A 1Y28A 3EQUA 3PBOA 2BASA 2O9AA 4EUVA 4K08A 3IS2A 3LR3A 2MJ6A 4GHIA 4G3VA 5F5YA 1G28A 3HJIA 1VB6A 1JNUA 1S1ZA 1ZHHB 2J3TD 3SW1A 2QJ7A 4WF0A 4R38A 4WELA 5DJTA 4YNRA 2VGLS 5AJGA 4HQAA 3T4QA 2INWA 4B93A 3FPVA 3T50A 2P08A 2ZMFA 3PBQA 1TF1A 4H6JA 4L0LA 1MKMA 5HPFA 3RTYA 1IOUA 4MDZA 5DFXA 4EXOA 2VJWA 2ZMVA 4EU0A 3JVUA 1XJ4A 3B33A 3LI9A 2Y8HA 3ULFA 3D3OA 4I3AA 1LSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXE A;  2ZBB A;  2V0U A;  5IU1 A;  4PKY G;  3BWL A;  4YWZ A;  1S67 L;  2K7S A;  3K3C A;  1DP6 A;  1N9O A;  2L1M A;  3E4P A;  3H7W B;  3F1O A;  5F6A A;  4GS9 A;  1P97 A;  4MN5 A;  3OLO A;  4LRZ E;  3A0S A;  4NXB A;  3IBR A;  3EWK A;  2W0N A;  3UE6 A;  3LUQ A;  2QKP A;  3UB6 A;  1DRM A;  1KOU A;  3VE4 A;  1T1C A;  2D02 A;  3F1N A;  1EW0 A;  3NOP C;  3CLO A;  3NOT C;  1MZU A;  3E4Q A;  4BBV A;  1UWP X;  5A8B A;  1TS7 A;  5IS1 A;  5J3W A;  4DJ3 A;  4EES A;  3MR0 A;  3UME A;  3NOU C;  4R6L A;  1BYW A;  2V0W A;  5F68 A;  5HWV A;  2Z6C A;  1T18 A;  2WKR A;  5HWW A;  3MFX A;  3PYP A;  3C2W A;  4EEP A;  1TS6 A;  2JN7 A;  2P7J A;  3IS2 B;  5KIZ A;  5HD5 A;  3EEH A;  4HNB A;  4XT2 A;  1X0O A;  2EA9 A;  2PR5 A;  2M1C A;  4I38 A;  1T1B A;  1TS8 A;  4H6J B;  4F3L B;  1OTA A;  4WL9 A;  4HH3 A;  3ZQ5 A;  1S4S A;  3CWF A;  3HJK A;  3VOL A;  4JGP A;  2YKH A;  3FC7 A;  2OOL A;  2VV6 A;  3A0R A;  1LL8 A;  4HH2 A;  2KDK A;  4WN5 A;  3MQO A;  4B9O A;  3GDI A;  3MXQ A;  3VE3 A;  3UB9 A;  3D72 A;  4MN6 A;  2YKF A;  4I3I A;  2PR6 A;  4EQ1 A;  1D06 A;  4E04 A;  2QWS A;  1LSX A;  3MJQ A;  2V1B A;  1TS0 A;  1DP8 A;  1T1A A;  1V9Z A;  3F1O B;  3K3D A;  4GS9 B;  2ZOH A;  4I3J A;  4I5S A;  5HZH A;  1N9N A;  1NWZ A;  5J7E A;  5TBM A;  1OTE A;  2WKQ A;  3A0V A;  1OTD A;  1UGU A;  4L9F A;  4LRX C;  2V9A A;  3H82 B;  3BY8 A;  1XJ2 A;  1OJ5 A;  2PDR A;  1N9L A;  4NXF A;  4HJ3 A;  1XFQ A;  5HDS A;  4HP9 A;  3E4O A;  3F1N B;  3MQQ A;  2R78 A;  1S4R A;  4EET B;  4KQD A;  4HY8 A;  2V1A A;  2A24 A;  4JGQ A;  1OJG A;  4RQ9 A;  1T19 A;  1XJ3 A;  3F1P A;  1OT6 A;  2JHE A;  4KUK A;  3RH8 B;  1LSV A;  2WKP A;  1V9Y A;  4GW9 A;  3C8C A;  1LT0 A;  5J4E A;  2ZOI A;  2VV7 A;  4LLO B;  4JGO A;  2VLG A;  3PHY A;  2H28 A;  4GHI B;  2OWJ A;  4PKY A;  3ICY A;  5HDC A;  4EER A;  1P0Z A;  1WA9 A;  1XJ6 A;  4BBU A;  1F9I A;  1GSX A;  1S1Y A;  1OTI A;  4L9G A;  2L4R A;  4HJ4 A;  2KX6 A;  4HI4 A;  4XT2 B;  3LI8 A;  5DKL A;  1DP9 A;  4GCZ A;  5DJU A;  5HD3 A;  5HSQ A;  4F3L A;  3GEC A;  3LIE A;  4WUJ A;  4DJ2 A;  3LYX A;  1ODV A;  2HV1 A;  3G6O A;  5G4Y A;  5AVF A;  3NHQ A;  4BBT A;  4LRY C;  2OWH A;  5I5L A;  4R3A A;  2Z6D A;  4HHD A;  4LPZ A;  2L0W A;  4HOI A;  3LIB A;  3H7W A;  3LIF A;  1GSW A;  4EW7 A;  2PYR A;  3CAX A;  4M4X A;  1D7E A;  3NJA A;  3LIA A;  2I9V A;  4L9E A;  1XFN A;  2QJ5 A;  4KUO A;  4I39 A;  5DKK A;  4JGR A;  5HWT A;  4EEU A;  5TBM B;  1GSV A;  2PD8 A;  4NXG A;  3UB8 A;  3BY9 A;  5G4Z A;  4HP4 A;  2GJ3 A;  2PHY A;  3H82 A;  3H9W A;  3P7N A;  5AVE A;  1F98 A;  2QHK A;  2PYP A;  2D01 A;  3LID A;  2J80 A;  1OTB A;  4HJ6 A;  5EFW A;  3LIC A;  2A24 B;  2VEA A;  1S66 L;  3KX0 X;  4WLA A;  5F69 A;  3F1P B;  1OT9 A;  4R70 A;  2W27 A;  3UMD A;  5HDD A;  3FG8 A;  1UWN X;  2B02 A;  4HIA A;  2CMN A;  3UB7 A;  2PD7 A;  2VV8 A;  1Y28 A;  2BAS A;  4K08 A;  3IS2 A;  4GHI A;  5F5Y A;  1G28 A;  3HJI A;  1JNU A;  1VB6 A;  1S1Z A;  3SW1 A;  2QJ7 A;  4WF0 A;  4R38 A;  5DJT A;  4HQA A;  2INW A;  3T50 A;  4H6J A;  3RTY A;  4EXO A;  1XJ4 A;  3B33 A;  3LI9 A;  3ULF A;  4I3A A;  1LSW A; 
#chains in the Genus database with same CATH topology
 2IWD A;  4PKY G;  3BWL A;  3WRT A;  3KSH A;  1XXM A;  3CG5 A;  1S67 L;  2K7S A;  4D2O A;  3K3C A;  4N1H A;  1DP6 A;  2L1M A;  4JLF A;  1FR6 A;  1YKD A;  2EWW A;  5F6A A;  1JTG A;  3W4O A;  2P04 A;  2XEP A;  3BQ8 A;  4BL3 A;  4LEN A;  3G32 A;  1BSG A;  4WZ5 C;  3PXP A;  3PAE A;  1E25 A;  4DE3 A;  4RYE A;  4NXB A;  3ZGA B;  1CQA A;  3B47 A;  2BTF P;  3IF5 A;  4CLC A;  5GLD A;  3LUQ A;  4RX2 A;  1G6O A;  3ZG7 B;  4ARZ B;  2QPN A;  3VE4 A;  3MZE A;  5KSH A;  3GV9 A;  1F2K A;  4KZA A;  2J8Y A;  3IT9 A;  3NOP C;  4FSF A;  3CLO A;  1CF0 A;  5F82 A;  1MZU A;  1DJC A;  1S6R A;  1WE4 A;  1MC0 A;  1UWP X;  2HJ9 C;  3V50 A;  1HZO A;  4RA7 A;  4QY6 A;  4QHC A;  5J3W A;  2ZMA A;  2Y2P A;  3VOY A;  5D3O A;  4G3W A;  3D4F A;  1FCO A;  3MR0 A;  3PBN A;  5K5B A;  3M2K A;  1H8Y A;  1YMX A;  3I7J A;  4LV3 A;  1K6S A;  1ACF A;  1PWG A;  2WKR A;  4ZBE A;  2PBY A;  2WAE A;  3LEQ A;  5DF9 A;  1PZP A;  3C2W A;  4EEP A;  3U2A A;  1QME A;  4CQH A;  3NY4 A;  5HD5 A;  4HNB A;  3Q82 A;  3VFH A;  3A3J A;  2O9C A;  2EA9 A;  3CMZ A;  5C5K A;  3SS3 A;  4O7D A;  2OLU A;  2ZD8 A;  1PI5 A;  1TDG A;  3C38 A;  3B42 A;  5EOE A;  1BUL A;  4UQI S;  4Q0J A;  1CK3 A;  2KDK A;  3GDI A;  1SKO A;  2WGW B;  3MXQ A;  3UB9 A;  3D72 A;  3V3R A;  2IWB A;  1O07 A;  3CUE C;  2PR6 A;  5FAQ A;  2DMW A;  3HLG A;  2HGV A;  3DW0 A;  3UN7 A;  3E2L A;  5MC7 A;  5LBR A;  3BFC A;  4OPZ A;  4IJG A;  3TOI A;  5IT5 A;  4OH0 A;  3ZNY A;  1FR1 A;  1K56 A;  2PRF A;  3W8K A;  5HW3 A;  4OP8 A;  1CI9 A;  1OTD A;  4DE0 A;  3NEC A;  3K2N A;  3S7O A;  1PFL A;  4FTX A;  4LRX C;  2GX5 A;  1XJ2 A;  4GDN A;  2VGJ A;  2PDR A;  4ARZ A;  5KMW A;  3KSF A;  4KZ4 A;  1N9L A;  4NXF A;  2EXB A;  5CHJ A;  1LI0 A;  3MSH A;  1RGY A;  3LO7 A;  3HUO A;  1IEM A;  1K54 A;  2OAP 1;  3ZCZ A;  4EWF A;  3FKV A;  2ZC3 B;  1SKF A;  4D60 A;  2ZQA A;  2A24 A;  3TE8 A;  3O88 A;  4N1X A;  1OT6 A;  4S2I A;  3RH8 B;  1V9Y A;  3KSG A;  2NUT C;  5IHV A;  4Y17 A;  4GJ4 A;  3C8C A;  1IKG A;  5J4E A;  5TFQ A;  1PW8 A;  4QJG A;  4JGO A;  3LGO A;  4BWI A;  1XPB A;  4B4Z A;  3OBF A;  4YIN A;  5CXW A;  5EV0 A;  5DFY A;  4JPM A;  3E98 A;  4WEK A;  2XR0 A;  5E2E A;  5FA7 A;  1Y54 A;  5FAT A;  1GSX A;  4E3O A;  1ZKJ A;  2B5R A;  4L9G A;  3LR4 A;  3T4J A;  4IBR A;  3Q07 A;  4XT2 B;  4IHQ A;  3SS4 A;  3DWZ A;  3QP2 A;  3WRZ A;  5CEB A;  4GZB A;  4DJ2 A;  3LYX A;  4Y0T A;  2WGW A;  5L07 A;  1LLB A;  5I5L A;  5GLA A;  5DVA A;  2L0W A;  3HLB A;  5BOH A;  3LIF A;  1IYP A;  1K4F A;  4U0X A;  1L3L A;  4R3B A;  4DE1 A;  2PYR A;  2ZQ7 A;  3NJA A;  5CRF A;  2KOI A;  1NZO A;  1K6R A;  2ACG A;  3CPT B;  1H8M A;  2XFT A;  1XFN A;  3C5A A;  1MWS A;  5DKK A;  4KQR A;  5TBM B;  4EBN A;  1ZTU A;  4LV0 A;  3VFF A;  5FI6 A;  1VEU B;  2J9P A;  3BY9 A;  1PI4 A;  2PHY A;  2W3H A;  3NUL A;  4CLC C;  1GHI A;  4E3N A;  2H0T A;  5AVE A;  1MKI A;  1ERO A;  1XGI A;  3C7U A;  2G7U A;  3TG9 A;  2PYP A;  5DTT A;  3LID A;  2FFY A;  1VET A;  2J80 A;  4XXR A;  2HZ5 A;  4PHT A;  5AQ7 A;  5FQQ A;  1LL5 A;  2GZA A;  1YPR A;  2ZC5 B;  5EFW A;  1SHV A;  1S66 L;  3T1R A;  5FQK A;  3F1P B;  5CGW A;  4QB8 A;  1DY6 A;  3UMD A;  3FG8 A;  2VGL M;  1RGZ A;  3EQV A;  3FZC A;  2CMN A;  3WS2 A;  3IHB A;  1Y28 A;  3PBO A;  2O9A A;  4EUV A;  3G31 A;  3HL9 A;  3VSL A;  3LR3 A;  1YT4 A;  4G3V A;  2DNS A;  3HJI A;  1SZV A;  4PM8 A;  3N8R A;  4WF0 A;  4YNR A;  2VGL S;  5E43 A;  1KGE A;  5AJG A;  3IX3 A;  4LFU A;  2BLS A;  4H6J A;  1TF1 A;  1ALQ A;  1HVB A;  1YLT A;  1HD8 A;  3RTY A;  2C5W B;  5FDS A;  1XP4 A;  4S2M A;  1DJB A;  2PAV P;  5M18 A;  5FEG A;  2ZBB A;  2V0U A;  5IU1 A;  2WK0 A;  4YWZ A;  1PIO A;  1MWU A;  3FYZ A;  1ESI A;  2O9B A;  2R9W A;  4P87 A;  1N9O A;  3H7W B;  3P98 A;  2H0Y A;  3F1O A;  4MBK A;  1PNE A;  1CEF A;  3BLM A;  1NYM A;  3EGD C;  3EOI A;  3V5M A;  1YM1 A;  1NLY A;  5FQJ A;  4X25 A;  4OLG A;  4LRZ E;  3A0S A;  3OZH A;  3FKW A;  2P9V B;  3IBR A;  1YAX A;  2ZL1 B;  3UB5 P;  4UHU A;  3LY3 A;  2QKP A;  1KOU A;  4QPR A;  3ZHH A;  3SH7 A;  4IBX A;  5FDH A;  3VP4 A;  2D02 A;  3F1N A;  1NLZ A;  2ZC7 A;  1Z09 A;  3CI6 A;  4X6T A;  1J9M A;  3E4Q A;  3Q81 A;  4OQ0 A;  1K54 C;  1W79 A;  2C6W B;  2A49 A;  1TS7 A;  2H5S A;  2XQZ A;  3QP1 A;  3T4S A;  5IS1 A;  3LR0 A;  1YSP A;  3MMH A;  4DJ3 A;  3VP3 A;  2XH9 A;  2Y2K A;  3GRJ A;  1XX2 A;  3IX4 A;  1ERQ A;  3UME A;  3NOU C;  4K0W A;  3RXX A;  1BYW A;  2WAD A;  4YOF A;  3NBL A;  5F68 A;  5HWV A;  1H3Q A;  1T18 A;  3MFX A;  2W1T B;  3S7Q A;  2W3F A;  2X02 A;  5KIZ A;  3LCE A;  2OSU A;  3MF0 A;  3OPR A;  4E3K A;  1E3U D;  4C6Y A;  3V39 A;  3UDI A;  3KYE A;  1X0O A;  2QYB A;  5EVI A;  2XLN A;  1GA0 A;  4KZ9 A;  1MBL A;  1ZG6 A;  1W63 M;  1EWZ A;  5HX9 A;  4F3L B;  3T4O A;  3CIT A;  1S4S A;  4KZ5 A;  2YKH A;  3OPH A;  3FC7 A;  4S2N C;  5DTK A;  3MQO A;  3IH8 A;  4OOL A;  4R4S A;  3CZD A;  1JTD A;  3BEB A;  1ES5 A;  2B95 A;  3N6I A;  2P74 A;  3V3S A;  3NDG A;  3MFD A;  4I3I A;  4R4R A;  4CJN A;  2Y55 A;  4EQ1 A;  3T4L A;  1ONH A;  1W5D A;  1LSX A;  2V1B A;  2QZ6 A;  1DP8 A;  3RXW A;  1Q2Q A;  1RP5 A;  1T1A A;  2Y79 A;  3K3D A;  5FAP A;  3SOI A;  4GS9 B;  5FAO A;  2ZOH A;  2JCH A;  4Y13 A;  3O86 A;  4WM9 A;  1OTE A;  1ES3 A;  2E8I A;  5U47 A;  3UPO A;  1UGU A;  5EM0 A;  4KG2 A;  1N4O A;  2HJE A;  4DF6 A;  2V9A A;  5L10 A;  4NET A;  1FSW A;  4S2P A;  3GQZ A;  3R7W B;  2HDQ A;  1IFQ A;  4H8R A;  4HP9 A;  5L2F A;  4C3Q A;  4EQI A;  5FQM A;  3O5Y A;  3MQQ A;  1S4R A;  4EET B;  4KQD A;  4GNU A;  2PU2 A;  5GLB A;  3NIA A;  4RQ9 A;  3L7H A;  2EXA A;  3QNB A;  1XJ3 A;  4Y5F A;  3PR6 A;  1LSV A;  2WKP A;  1YQS A;  4DDY A;  4OKP A;  3HUM A;  1KDS A;  2XFS A;  4ME4 A;  1LT0 A;  4E3L A;  3VP0 A;  4DRT A;  4LLO B;  2EX2 A;  3Q7V B;  1L0G A;  1ZC2 A;  2O99 A;  1K55 A;  4UQI M;  4GHI B;  1IYO A;  2OWJ A;  1VHM A;  2W1T A;  2J9O A;  4BLM A;  2ZLY A;  1WA9 A;  4E3I A;  1FIK A;  1GHM A;  4UA6 A;  5GL9 A;  4RVA A;  1OTI A;  2JC7 A;  4U0T A;  4HI4 A;  4KQQ A;  4MCW A;  3HBR A;  3LI8 A;  5DKL A;  1ONG A;  3TRC A;  1WYC A;  4F3L A;  3T1Q B;  3MKF A;  3MXS A;  4GKU A;  2XRN A;  4BQM A;  4WUJ A;  5GLC A;  4N9K A;  2R9X A;  1BTL A;  4JF6 A;  5M19 A;  1KVL A;  3IH9 A;  3BFF A;  4Y2F A;  1SCW A;  4LRY C;  4O0P A;  2OWH A;  4IED A;  2Z6D A;  4HHD A;  3BFD A;  1K0K A;  4AFI A;  4HOI A;  1G6A A;  3LIB A;  2Y91 A;  1H5X A;  1GSW A;  2M7U A;  4EW7 A;  2ZQC A;  4O8G A;  1AWI A;  1D7E A;  3BQA A;  1YLY A;  3BEC A;  3DWK A;  4UA9 A;  5GHY A;  3ZFZ A;  2W3G A;  3G2Y A;  1Q2P A;  1TD5 A;  3WWX A;  5EVL A;  3EEA A;  4OOM A;  3IF6 C;  3LFV A;  3DTI A;  4OQG A;  4KZ8 A;  4BL2 A;  1YLP A;  1JVJ A;  3MZF A;  4KG6 A;  4OPR A;  2GJ3 A;  3P7N A;  4FCF A;  4DDS A;  1F5M A;  2A2L A;  2XA7 S;  1W8Y A;  2ZC4 B;  2QHK A;  1TDL A;  3RFB A;  4MN7 A;  2JBF A;  3G30 A;  4KZ7 A;  2HP5 A;  2RL3 A;  3MZD A;  3IX8 A;  5F83 A;  4IVK A;  5HDD A;  4Z1W A;  2O0Y A;  5EM1 A;  1LL9 A;  5KSC A;  5F1F A;  3DTK A;  3UB7 A;  3EQU A;  3Q7V A;  2QMI A;  1NY0 A;  2BAS A;  1KE4 A;  3GMW A;  2ZM2 A;  1HLU P;  5DF8 A;  2MJ6 A;  4GHI A;  2HDS A;  4JBF A;  1G28 A;  3TSG A;  1VB6 A;  1ZHH B;  2J3T D;  3ZVW A;  2HDU A;  4R38 A;  4WEL A;  4FUW A;  3UE1 A;  5FQI A;  5EUA A;  1O7E A;  2P08 A;  1HTZ A;  4PM5 A;  3JPU A;  1IOU A;  2ZQ8 A;  4MDZ A;  5DFX A;  5EVI C;  3QP4 A;  4EXO A;  4DE2 A;  4E6X A;  3IWO A;  3B33 A;  3G4P A;  3ULF A;  3D3O A;  1LSW A;  3A3E A;  4X69 A;  3SH8 A;  5HAI A;  1K25 A;  3FV7 A;  1BLS A;  4BD0 A;  3OOV A;  4OOY A;  4S2L A;  3S22 A;  1GHP A;  1P97 A;  4MN5 A;  1L0F A;  2I72 A;  4LCL A;  4KEN B;  4JKT A;  2UV0 E;  1KE0 A;  5FL3 A;  3FWL A;  3NCK A;  3L9K A;  2W0N A;  2VGK A;  2HP6 A;  4P6Z M;  3UB6 A;  4R3J A;  4Y15 A;  5TJJ A;  1DRM A;  4GB7 A;  3WS4 A;  3BM6 A;  1T1C A;  4G3K A;  4S2J A;  1EI5 A;  3NOT C;  1CEG A;  5EVE A;  4GLQ A;  4P6Z S;  3JVV A;  2DRW A;  4Y0U A;  4QD4 A;  1ERM A;  2XD5 A;  4ESP A;  3OCN A;  4EES A;  1XGJ A;  2IWC A;  4X1L A;  5FI7 A;  4CLC E;  4Q0H A;  3E0Y A;  2EFX A;  1NXY A;  2V0W A;  2EWV A;  3C30 A;  3BYD A;  2IA2 A;  1BT5 A;  4P6B A;  2Z6C A;  4ZTK A;  5HWW A;  2RCX A;  4LCM A;  3PYP A;  4X56 A;  4KQO A;  2JN7 A;  5E2F A;  1I5Q A;  1KDW A;  3IS2 B;  1K55 C;  5HL6 A;  3CHW P;  4R0Q A;  5E2G A;  4N92 A;  3EEH A;  2Z2L B;  3UE0 A;  2ZM0 A;  5L09 A;  4JXS A;  2HF6 A;  4IUH A;  4XT2 A;  2Y59 A;  4B88 A;  2M1C A;  4I38 A;  3AGE A;  4UAA A;  1G5U A;  4OPQ A;  4ZDX A;  1OTA A;  1N9B A;  3GTC A;  1VM1 A;  4HH3 A;  3ZQ5 A;  1ESU A;  3VOL A;  3RJU A;  4JGP A;  4LGW A;  3VV4 A;  3IWI A;  2VX8 A;  2OOL A;  2VV6 A;  3A0R A;  3G35 A;  4HH2 A;  1GCE A;  4B9O A;  4EUZ A;  3CUE A;  4DMZ A;  2YKF A;  1GA9 A;  2XK1 A;  4OLD A;  2OLV A;  5A92 A;  1D06 A;  2WYX A;  4E04 A;  2QWS A;  2ZJ9 A;  3MJQ A;  1TS0 A;  5HAQ A;  1FCM A;  2CC1 A;  1SDE A;  2V8F A;  3CPT A;  3ZG0 A;  2M7V A;  2PT7 A;  4E6W A;  3PAG A;  4I3J A;  5HZH A;  3W4P A;  1N9N A;  1YLW A;  5AQA A;  1H8Z A;  2B18 A;  5TBM A;  4PMA A;  1VEU A;  2WKQ A;  3A0V A;  2Y2J A;  5JYP A;  2Y2N A;  2Q9N A;  4E3M A;  2LB9 A;  4CLC B;  4NKP A;  3H82 B;  1L0E A;  1MWT A;  1P9R A;  3QP6 A;  1FOF A;  2V20 A;  1NZU A;  1FIL A;  5HDS A;  3BW6 A;  3UNW A;  4GN2 A;  2WZZ A;  4EV4 A;  4MNR A;  2Y2Q A;  2Y2L A;  1ES4 A;  4GDB A;  5FAS A;  1BUE A;  3GR2 A;  4A5R A;  2Y2G A;  4JGQ A;  1OJG A;  3VP1 A;  3M6B A;  3F1P A;  4Y3I A;  3HLD A;  2UWX A;  3ZYT A;  2HPB A;  4JXW A;  4MLL A;  4JF4 A;  5G18 A;  4PPR A;  2ZC6 B;  4Q8I A;  3R4K A;  2ZOI A;  2VV7 A;  1PZO A;  5DTS A;  3QP5 A;  3CJM A;  2H28 A;  4PKY A;  3WS5 A;  5HPI A;  1I2S A;  1P0Z A;  1TEM A;  3GVB A;  4WMC D;  4ZAM A;  3DAV A;  3HVF A;  1XJ6 A;  1F9I A;  1S1Y A;  4QY5 A;  3A3D A;  1STZ A;  2L4R A;  4JF5 A;  4HJ4 A;  3TW8 A;  2WKH A;  4OP5 A;  5KZH A;  5AQ9 A;  3VSK A;  5HL1 A;  1DP9 A;  4GCZ A;  5DJU A;  5HD3 A;  1NYY A;  5HSQ A;  2AVX A;  5EEC A;  4HBT A;  3UO9 A;  3V67 A;  1K57 A;  3FPW A;  3LEZ A;  2HV1 A;  4R23 A;  3G6O A;  1PYY A;  3C4P A;  4S2O A;  3KYQ A;  1SKO B;  4ZRR A;  5AVF A;  2V8C A;  5M1A A;  1KE3 A;  3NHQ A;  4QU3 A;  4BBT A;  3N7W A;  1W7F A;  4R3A A;  3ISG A;  2HDR A;  2K2N A;  3H7W A;  1XA7 A;  3A3F A;  4JXG A;  4WZ4 A;  4Y0O A;  4DKI A;  3T4T A;  2Z2M B;  3T12 B;  1MWR A;  2PBD P;  1DJA A;  1H0M A;  1RCJ A;  1IYS A;  2XDM A;  2I9V A;  5CTM A;  2Y2M A;  4I39 A;  3T4K A;  2P9V A;  4JGR A;  4F94 A;  4LV1 A;  3QP8 A;  4EEU A;  2ZL1 A;  4NXG A;  4FOF A;  2EX8 A;  3UB8 A;  2HP9 A;  2Y2O A;  4R1G A;  4K0X A;  5G4Z A;  5TR7 A;  3H82 A;  3UDF A;  2VA0 A;  3S7N A;  2A3U A;  3H9W A;  1FQG A;  1AXB A;  4EBL A;  4P85 A;  3ZVT A;  1XKZ A;  1CI8 A;  1JWV A;  2EX9 A;  3B3X A;  4WYY A;  3OPP A;  3LIC A;  3MKE A;  4IVI A;  2EFU A;  2A24 B;  2VEA A;  1YLZ A;  3OCL A;  3AGF A;  3KX0 X;  3IWQ A;  4OON A;  1BLP A;  1KGF A;  4YFM A;  5EVI D;  4R70 A;  4WEJ A;  4XUX A;  2W27 A;  3ZG9 B;  1UWN X;  4HIA A;  3NDE A;  2PD7 A;  3HUN A;  5EOO A;  4K08 A;  2JE5 A;  5CHM A;  2XGN A;  4E3J A;  3ITB A;  3LY4 A;  1S1Z A;  5TGF A;  4QWO A;  2QJ7 A;  5CEC A;  4GD8 A;  5DJT A;  2WZX A;  4FH2 A;  3O87 A;  4HQA A;  3T4Q A;  3FPV A;  2BG1 A;  2ZMF A;  3PBQ A;  4L0L A;  3N4I A;  5HPF A;  3T1X A;  4C75 A;  3BLS A;  4FD8 A;  2WGV A;  2GDN A;  4Y7P A;  4EU0 A;  1MY8 A;  1FCN A;  2G2U A;  5J8X A;  3U4L P;  1XJ4 A;  3LI9 A;  4I3A A;  1QMF A;  4BMW A;  3TJZ C;  4EBP A;  1YMS A;  3N8L A;  4NXE A;  4FH4 A;  4ID4 A;  3WS0 A;  4CLC D;  1OME A;  2PU4 A;  1KGG A;  3E4P A;  1PRQ A;  3QNC A;  3IXG A;  2J7V A;  4GS9 A;  4HEF A;  3KO6 A;  2X71 A;  2V1Z A;  2XA7 M;  3BRM A;  3C7V A;  2JKT I;  3OLO A;  3DBA A;  4X55 A;  4ETZ A;  5CER A;  1E4D A;  2VK3 A;  3MS6 A;  3PBT A;  3EWK A;  2W3E A;  4PM7 A;  3UE6 A;  1NRJ A;  5CHU A;  3BFE A;  4BD1 A;  4ETX A;  3R7W A;  2Q9M A;  3LR5 A;  3NI9 A;  4HES A;  2WAF A;  1EW0 A;  4RX3 A;  1U60 A;  5E2H A;  4BBV A;  5A8B A;  1VET B;  2DCF A;  2VKS A;  3DTE A;  1TVF A;  2Y4A A;  3OC2 A;  1J3W A;  5A93 A;  2OV5 A;  5EPH A;  1VQQ A;  5HFO A;  4DXC A;  4LV2 A;  3IBJ A;  4R6L A;  3A3I A;  3UE3 A;  2FFF B;  2J3W A;  4HBU A;  2XRO A;  4JXV A;  4S2K A;  1JWP A;  1TS6 A;  2FZ0 A;  4X68 A;  2P7J A;  3OPL A;  1PW1 A;  3GSG A;  5JYO A;  1NJ4 A;  4M3K A;  4ZJ3 A;  1K4E A;  5AQB A;  3M6H A;  5L8M A;  3QHY A;  3SZT A;  4KZ3 A;  4PM9 A;  2PR5 A;  1T1B A;  4P0M A;  1TS8 A;  3EGX C;  4H6J B;  4NEE D;  4WL9 A;  3BJN A;  5HAP A;  3CWF A;  1IKI A;  3HJK A;  1WYB A;  4S2N A;  1K38 A;  1XA1 A;  1LL8 A;  4WN5 A;  1K56 D;  4UA7 A;  4GD6 A;  3VE3 A;  3S7P A;  4MN6 A;  1K57 C;  2XSS A;  1A0K A;  2JKR I;  2OAQ 1;  3S4X A;  3W2Z A;  3IXB A;  3ZDJ A;  4GOG A;  1P9W A;  4WZ5 A;  4DN0 A;  4DXB A;  2K31 A;  3KSI A;  3P01 A;  5GHX A;  1V9Z A;  3F1O B;  2EX6 A;  4XUZ A;  1Z6F A;  4X1M A;  1G68 A;  4KG5 A;  4I5S A;  4O01 A;  3IF6 B;  1NWZ A;  5J7E A;  2JKT M;  3MXR A;  2XD1 A;  3N8S A;  2H10 A;  4L9F A;  3BY8 A;  4WBG A;  1OJ5 A;  4UEY A;  3IHA A;  3W4Q A;  5CED A;  4HJ3 A;  5FEF A;  1XFQ A;  1C3B A;  3NC8 A;  3E4O A;  3F1N B;  2R78 A;  1PWC A;  3HLC A;  4HY8 A;  3HLW A;  2V1A A;  4KZB A;  3MQ0 A;  1T19 A;  1M40 A;  2JHE A;  1KVM A;  1MXO A;  3E2K A;  4KUK A;  2G2W A;  4GW9 A;  3IXD A;  3BFG A;  4PM6 A;  1CJF A;  2FH5 A;  4NK3 A;  4MBF A;  2VLG A;  4OQI A;  5CX7 A;  2X01 A;  5A90 A;  3PHY A;  3DTM A;  4OPY A;  4U3T A;  2XF3 A;  3ICY A;  5HDC A;  4EER A;  3IQA A;  3MBZ A;  4ZJ1 A;  4Q0I A;  2GNX A;  3D9Y A;  3G34 A;  4BBU A;  4II7 A;  4KZ6 A;  2VZW A;  2KX6 A;  1BLH A;  2ZM8 A;  3G2Z A;  1LI9 A;  5EVI B;  1W8Q A;  1S0W A;  1ZG4 A;  3KYZ A;  1M6K A;  3VP2 A;  5EE8 A;  4X53 A;  5CTN A;  3GEC A;  3ZG8 B;  3LIE A;  1YLJ A;  3HLE A;  4MEZ A;  3IXH A;  3HCY A;  4ZJ2 A;  3VOZ A;  1ODV A;  4CPK A;  1BZA A;  3Q7Z A;  3AGD A;  5G4Y A;  1E3U A;  1W63 Q;  3VMA A;  3UPN A;  5CGX A;  3ZG5 A;  4WMC A;  2Y2I A;  1OPX A;  4IUK A;  4LPZ A;  5FI2 A;  2J3T C;  2W1R A;  2JKR M;  4OQH A;  1JWZ A;  4B4X A;  3T1S A;  3CAX A;  4M4X A;  5CGS A;  1PWD A;  3LIA A;  4K91 A;  2E8J A;  2Q0O A;  1Y4O A;  2ZQ9 A;  3P09 A;  3O3V A;  4L9E A;  3Q1F A;  2QJ5 A;  4KUO A;  5DF7 A;  3IF6 A;  1YSQ A;  5HWT A;  1GSV A;  1SDN A;  2PD8 A;  2KLI A;  3PTE A;  2JKG A;  4HP4 A;  2W3D A;  5I94 A;  1F98 A;  5A91 A;  1BLC A;  4N9L A;  3WS1 A;  4BJP A;  2D01 A;  4MMN A;  3PBS A;  4PAU A;  3M2J A;  1OTB A;  2NUP C;  2WKI A;  3PBR A;  3SH9 A;  4HJ6 A;  3HRE A;  5GHZ A;  2Y2H A;  5FSR A;  3UDX A;  5HAR A;  4NG2 A;  2ZQD A;  4WLA A;  3ITA A;  5F69 A;  2WKE A;  3SS5 A;  1IEL A;  1OT9 A;  3JYI A;  1IYQ A;  1LHY A;  2LB5 A;  4OVD A;  3UPP A;  2B02 A;  5FQ9 A;  1MPL A;  3HLF A;  1ES2 A;  2VV8 A;  1L2S A;  1L0D A;  3IS2 A;  5F5Y A;  1JNU A;  3SW1 A;  3UY6 A;  1NRF A;  2JKF A;  2WGI A;  3C4O A;  4Z9Q A;  2INW A;  4B93 A;  4MBH A;  3T50 A;  1MKM A;  3ZNT A;  2WUQ A;  2VJW A;  2ZMV A;  3JVU A;  1D1J A;  2V2F F;  5F1G A;  1I2W A;  2Y8H A;  3S1Y A;  1FSY A;  4BEN A; 
#chains in the Genus database with same CATH homology
 4BMW A;  3TJZ C;  4NXE A;  2ZBB A;  2V0U A;  5IU1 A;  4PKY G;  4CLC D;  3BWL A;  4YWZ A;  3KSH A;  1S67 L;  2O9B A;  3OOV A;  2K7S A;  3K3C A;  1DP6 A;  1N9O A;  2L1M A;  3E4P A;  3H7W B;  3F1O A;  1YKD A;  2EWW A;  5F6A A;  2P04 A;  4GS9 A;  3EGD C;  3EOI A;  1P97 A;  3BQ8 A;  4MN5 A;  3KO6 A;  1NLY A;  2XA7 M;  3PXP A;  2JKT I;  3OLO A;  3DBA A;  4ETZ A;  5FL3 A;  4LRZ E;  3A0S A;  4NXB A;  3IBR A;  1YAX A;  3B47 A;  3PBT A;  3EWK A;  2W0N A;  2W3E A;  4CLC A;  3UE6 A;  3LUQ A;  1NRJ A;  4P6Z M;  1G6O A;  2QKP A;  3UB6 A;  4ARZ B;  5TJJ A;  1DRM A;  3R7W A;  1KOU A;  4QPR A;  3VE4 A;  4ETX A;  5KSH A;  1T1C A;  2D02 A;  3LR5 A;  4G3K A;  3F1N A;  1EW0 A;  1NLZ A;  3NOP C;  4FSF A;  3CLO A;  3NOT C;  3CI6 A;  1MZU A;  3E4Q A;  1MC0 A;  4BBV A;  1UWP X;  4GLQ A;  5A8B A;  2HJ9 C;  4P6Z S;  2VKS A;  1TS7 A;  5IS1 A;  3T4S A;  5J3W A;  3OC2 A;  3LR0 A;  1YSP A;  3JVV A;  3MMH A;  4DJ3 A;  3OCN A;  4G3W A;  4EES A;  3MR0 A;  3PBN A;  3UME A;  5K5B A;  3NOU C;  4CLC E;  4R6L A;  3IBJ A;  4Q0H A;  3E0Y A;  1BYW A;  3UE3 A;  4YOF A;  2J3W A;  2V0W A;  2EWV A;  3C30 A;  2IA2 A;  5F68 A;  5HWV A;  1H3Q A;  2XRO A;  2Z6C A;  1T18 A;  2WKR A;  5HWW A;  3MFX A;  2W1T B;  3PYP A;  5DF9 A;  3S7Q A;  2W3F A;  4KQO A;  3C2W A;  4EEP A;  2FZ0 A;  1TS6 A;  3U2A A;  2JN7 A;  4CQH A;  2P7J A;  3IS2 B;  5KIZ A;  5HL6 A;  5HD5 A;  3MF0 A;  3EEH A;  4HNB A;  2O9C A;  5L8M A;  2HF6 A;  4IUH A;  4XT2 A;  1X0O A;  2QYB A;  2EA9 A;  2PR5 A;  2M1C A;  4I38 A;  5C5K A;  1T1B A;  1W63 M;  1TS8 A;  3EGX C;  4H6J B;  4F3L B;  1OTA A;  3T4O A;  3CIT A;  4NEE D;  3C38 A;  4WL9 A;  3BJN A;  4HH3 A;  3B42 A;  3ZQ5 A;  1S4S A;  4UQI S;  3CWF A;  4Q0J A;  3HJK A;  3VOL A;  4JGP A;  2YKH A;  3VV4 A;  3FC7 A;  2VX8 A;  2OOL A;  2VV6 A;  3A0R A;  1LL8 A;  4HH2 A;  2KDK A;  4WN5 A;  3MQO A;  4B9O A;  4OOL A;  3GDI A;  3MXQ A;  3VE3 A;  3S7P A;  3UB9 A;  3CUE A;  3D72 A;  4MN6 A;  4DMZ A;  3CUE C;  2XSS A;  2YKF A;  4I3I A;  2PR6 A;  2DMW A;  2JKR I;  4EQ1 A;  1D06 A;  4E04 A;  2HGV A;  3T4L A;  2QWS A;  2OAQ 1;  1LSX A;  3MJQ A;  3W2Z A;  5MC7 A;  2V1B A;  5LBR A;  1TS0 A;  1DP8 A;  1P9W A;  4DN0 A;  1T1A A;  2K31 A;  3KSI A;  3P01 A;  2M7V A;  1V9Z A;  2Y79 A;  3F1O B;  3K3D A;  4IJG A;  2PT7 A;  4GS9 B;  2ZOH A;  4I3J A;  5IT5 A;  4I5S A;  4O01 A;  5HZH A;  1N9N A;  1NWZ A;  2B18 A;  5J7E A;  5TBM A;  1OTE A;  2WKQ A;  3A0V A;  1OTD A;  2JKT M;  1UGU A;  3S7O A;  3K2N A;  2LB9 A;  2HJE A;  4CLC B;  4L9F A;  4LRX C;  2GX5 A;  2V9A A;  3BY8 A;  3H82 B;  4NKP A;  1XJ2 A;  1OJ5 A;  4UEY A;  1P9R A;  2PDR A;  4ARZ A;  3KSF A;  1N9L A;  4NXF A;  4HJ3 A;  1XFQ A;  3R7W B;  1IFQ A;  5HDS A;  4HP9 A;  3BW6 A;  3E4O A;  2OAP 1;  3F1N B;  3O5Y A;  3MQQ A;  2R78 A;  1S4R A;  4EET B;  4KQD A;  4HY8 A;  2V1A A;  2A24 A;  4JGQ A;  1OJG A;  3TE8 A;  3MQ0 A;  4RQ9 A;  1T19 A;  1XJ3 A;  3F1P A;  4Y3I A;  4Y5F A;  1OT6 A;  3PR6 A;  2JHE A;  3ZYT A;  4KUK A;  3RH8 B;  1LSV A;  2WKP A;  1V9Y A;  3KSG A;  4GW9 A;  2NUT C;  4GJ4 A;  3C8C A;  4ME4 A;  1LT0 A;  5J4E A;  3R4K A;  2ZOI A;  2VV7 A;  2FH5 A;  4LLO B;  4JGO A;  4BWI A;  2VLG A;  5CX7 A;  3OBF A;  3PHY A;  2O99 A;  4UQI M;  2H28 A;  4GHI B;  2OWJ A;  4PKY A;  5DFY A;  5HPI A;  3ICY A;  5HDC A;  1VHM A;  2W1T A;  4EER A;  3E98 A;  4WEK A;  1P0Z A;  4Q0I A;  2GNX A;  1WA9 A;  1XJ6 A;  4BBU A;  1F9I A;  1GSX A;  1S1Y A;  4II7 A;  1OTI A;  4L9G A;  1STZ A;  2L4R A;  2VZW A;  3LR4 A;  4HJ4 A;  3T4J A;  2KX6 A;  3TW8 A;  4HI4 A;  4MCW A;  4XT2 B;  3LI8 A;  4IHQ A;  3KYZ A;  5DKL A;  1DP9 A;  4GCZ A;  5DJU A;  5HD3 A;  5HSQ A;  3TRC A;  4F3L A;  3GEC A;  2XRN A;  3LIE A;  4WUJ A;  3V67 A;  4DJ2 A;  3HCY A;  3FPW A;  3LYX A;  1ODV A;  2HV1 A;  3G6O A;  5G4Y A;  3KYQ A;  1W63 Q;  4ZRR A;  5AVF A;  4Y2F A;  3NHQ A;  4BBT A;  4LRY C;  4O0P A;  2OWH A;  5I5L A;  4R3A A;  2Z6D A;  1OPX A;  4HHD A;  4IUK A;  4LPZ A;  4AFI A;  2L0W A;  4HOI A;  3LIB A;  3H7W A;  2K2N A;  1GSW A;  3LIF A;  2J3T C;  2M7U A;  4EW7 A;  2W1R A;  2JKR M;  3T4T A;  4O8G A;  2PYR A;  3CAX A;  4M4X A;  1D7E A;  3NJA A;  2KOI A;  3BQA A;  3LIA A;  1H8M A;  2I9V A;  4L9E A;  2W3G A;  1XFN A;  2QJ5 A;  4KUO A;  4I39 A;  3T4K A;  5DKK A;  1TD5 A;  4JGR A;  3EEA A;  4OOM A;  3LFV A;  1YSQ A;  5HWT A;  4EEU A;  5TBM B;  1ZTU A;  1GSV A;  2PD8 A;  2KLI A;  4NXG A;  4FOF A;  3UB8 A;  3BY9 A;  5G4Z A;  4HP4 A;  2GJ3 A;  2PHY A;  2W3H A;  3H82 A;  2W3D A;  4CLC C;  2VA0 A;  3S7N A;  3H9W A;  3P7N A;  5AVE A;  1F98 A;  1F5M A;  2A2L A;  2XA7 S;  2G7U A;  4BJP A;  2QHK A;  2PYP A;  2D01 A;  4MMN A;  3PBS A;  3LID A;  4PAU A;  3RFB A;  2J80 A;  4PHT A;  1OTB A;  2NUP C;  2GZA A;  4MN7 A;  3PBR A;  4HJ6 A;  5EFW A;  3LIC A;  2A24 B;  2VEA A;  3OCL A;  1S66 L;  3KX0 X;  4WLA A;  5F69 A;  3F1P B;  1OT9 A;  4R70 A;  4WEJ A;  2W27 A;  3UMD A;  5HDD A;  3FG8 A;  2LB5 A;  2VGL M;  4Z1W A;  3EQV A;  2O0Y A;  1UWN X;  2B02 A;  4HIA A;  2CMN A;  3UB7 A;  2PD7 A;  2VV8 A;  1Y28 A;  3EQU A;  3PBO A;  2BAS A;  2O9A A;  4EUV A;  4K08 A;  3IS2 A;  3LR3 A;  2MJ6 A;  4GHI A;  4G3V A;  5F5Y A;  1G28 A;  3HJI A;  1VB6 A;  1JNU A;  1S1Z A;  1ZHH B;  2J3T D;  3SW1 A;  2QJ7 A;  4WF0 A;  4R38 A;  4WEL A;  5DJT A;  4YNR A;  2VGL S;  5AJG A;  4HQA A;  3T4Q A;  2INW A;  4B93 A;  3FPV A;  3T50 A;  2P08 A;  2ZMF A;  3PBQ A;  1TF1 A;  4H6J A;  4L0L A;  1MKM A;  5HPF A;  3RTY A;  1IOU A;  4MDZ A;  5DFX A;  4EXO A;  2VJW A;  2ZMV A;  4EU0 A;  3JVU A;  1XJ4 A;  3B33 A;  3LI9 A;  2Y8H A;  3ULF A;  3D3O A;  4I3A A;  1LSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...