2D01A

Wild type photoactive yellow protein, p65 form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
124
Chain Sequence
EHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the R52Q Mutant Demonstrates a Role for R52 in Chromophore pK(a) Regulation in Photoactive Yellow Protein
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
molecule keywords Photoactive yellow protein
total genus 35
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2d01A00
4LPZA 3FG8A 2Z6DA 4LLOB 4EETB 3UE6A 3F1OA 1T1BA 1T18A 3HJIA 3LI9A 4I3IA 1OTDA 3LIAA 5J4EA 2VV6A 1S1ZA 4LRZE 5IS1A 3EEHA 3E4QA 1DP6A 4LRXC 1P97A 2M1CA 2V1BA 2WKQA 2Z6CA 3CLOA 3A0VA 4I3AA 4PKYG 4BBTA 5A8BA 2ZBBA 1JNUA 1UWNX 2OWJA 1T1AA 2R78A 3VE3A 4E04A 3GDIA 4EEPA 4GS9B 1LT0A 3G6OA 4HJ6A 3H82B 4KQDA 4F3LA 3F1NB 3MR0A 1D7EA 2YKHA 2L4RA 2QJ7A 2KX6A 2D01A 4YWZA 4R70A 4HHDA 2PD8A 4WN5A 2QKPA 3K3CA 3H9WA 4MN5A 2L0WA 1DP8A 1TS7A 2ZOHA 4HJ4A 3UB9A 3CWFA 3UB6A 4HOIA 3LI8A 2V1AA 4GS9A 3VOLA 3P7NA 3LICA 1OT9A 3D72A 3NJAA 1V9ZA 4NXFA 3F1NA 4HP4A 5HDCA 5HDSA 2WKRA 3VE4A 2QHKA 5HSQA 5J3WA 5KIZA 5F6AA 3ICYA 4M4XA 2L1MA 2VV8A 5DJTA 2ZOIA 4HY8A 5DKKA 5HD5A 1EW0A 1LL8A 3A0SA 4MN6A 2PR6A 3H7WB 4H6JA 5HWVA 3MXQA 5F69A 1GSXA 3MQQA 2W27A 3LIFA 3UMEA 4DJ2A 1T19A 2P7JA 2QJ5A 3BY9A 1BYWA 2OOLA 2GJ3A 5DJUA 1OJGA 5AVFA 1UGUA 1OJ5A 5HDDA 4GHIB 4KUKA 4EXOA 1N9NA 2JHEA 2QWSA 3RH8B 1XFQA 5G4ZA 3OLOA 4JGRA 2V0UA 1V9YA 1D06A 1TS0A 1OT6A 1X0OA 3IBRA 3LIEA 3PHYA 1F9IA 3HJKA 4L9GA 2EA9A 4LRYC 2K7SA 5I5LA 2A24A 2VEAA 3LIBA 4RQ9A 5HD3A 3RTYA 2OWHA 2KDKA 4BBVA 1OTIA 3A0RA 3GECA 4I3JA 4I5SA 4NXEA 3IS2A 2VV7A 4EQ1A 4L9EA 5IU1A 3F1PB 4WLAA 4L9FA 4HP9A 4EW7A 3NOTC 4HQAA 2A24B 4HIAA 4GCZA 2JN7A 3C2WA 4JGPA 1XJ6A 1KOUA 1P0ZA 1LSWA 2B02A 2YKFA 3E4PA 1DP9A 5G4YA 4BBUA 2PYPA 3SW1A 3EWKA 4I38A 4R38A 3PYPA 3NOPC 4WUJA 3UB7A 4PKYA 3E4OA 3ZQ5A 2WKPA 1GSVA 1LSVA 2PDRA 1NWZA 3LUQA 1OTAA 4WL9A 1MZUA 1S66L 4EESA 1S4SA 5HZHA 1GSWA 4H6JB 2INWA 4JGOA 1G28A 2D02A 4JGQA 2W0NA 4XT2B 4XT2A 5EFWA 2J80A 4EEUA 3NOUC 4I39A 1S67L 1TS6A 3BY8A 3NHQA 1N9LA 2PD7A 4WF0A 3T50A 3MFXA 3B33A 1XJ4A 3BWLA 3UB8A 3IS2B 4EERA 1DRMA 2VLGA 4NXBA 5HWTA 4HJ3A 5TBMB 5J7EA 1XFNA 1ODVA 5HWWA 3F1OB 5F68A 4GHIA 1VB6A 4B9OA 4NXGA 2V9AA 4HNBA 3LIDA 1S4RA 4HH2A 3C8CA 4HH3A 4R3AA 5TBMA 1Y28A 4KUOA 1N9OA 3F1PA 3K3DA 1XJ2A 3H82A 3LYXA 4K08A 5F5YA 4F3LB 1WA9A 1LSXA 3H7WA 3MQOA 1T1CA 2PHYA 1OTBA 3KX0X 1TS8A 3MJQA 4HI4A 1OTEA 2V0WA 2PYRA 3UMDA 1XJ3A 4GW9A 4DJ3A 3CAXA 2PR5A 1F98A 4R6LA 2I9VA 2HV1A 1UWPX 5DKLA 5AVEA 3ULFA 2BASA 1S1YA 2CMNA 3FC7A 2H28A
chains in the Genus database with same CATH superfamily
3Q7VA 2ZC3B 2O99A 4I3IA 1K55C 3V50A 2W3DA 2PU2A 4O0PA 1UWNX 2OWJA 3FKWA 1D7EA 3VP3A 4WZ5A 4LV3A 4MN5A 1DP8A 3CMZA 4MEZA 3CWFA 3LR4A 5A90A 5CTNA 1I2WA 3S4XA 3NULA 3D72A 3O87A 3P7NA 5GLCA 5HSQA 3S7QA 2XFSA 5DKKA 4QB8A 3BJNA 5M19A 5F69A 1MC0A 4E04A 4X1MA 2EX8A 4CLCE 2LB5A 4ARZA 3NDGA 2ZQ7A 3FZCA 4ME4A 3SS5A 2QWSA 1YAXA 3IHBA 4E6XA 2ZQAA 2VGLM 4WZ4A 4MDZA 4S2OA 1S0WA 3IF6A 3VOYA 4JGPA 3D3OA 1MY8A 1CF0A 4Y0TA 1MWTA 2VGKA 2B18A 3C5AA 1S4SA 1Z09A 1LL9A 1TS6A 3BY8A 3WS0A 2HZ5A 3BEBA 3NECA 3I7JA 3FKVA 3LIDA 4S2KA 2EX6A 3EQVA 1K4FA 3V5MA 2Y2LA 4O7DA 5AQ7A 3DWZA 2XA7M 1L3LA 4HI4A 1BSGA 5K5BA 2V0WA 4ZRRA 4EQIA 3MS6A 3LEQA 2WKHA 1ONHA 2CMNA 3SS3A 3Q7VB 3F1OA 1GA9A 3QP1A 1TDGA 4PKYG 5A8BA 3A0VA 5AQBA 4DRTA 3GDIA 4GS9B 3G6OA 3W4QA 2VKSA 2QKPA 2L0WA 1TS7A 5EM0A 1I5QA 1N9BA 3E2KA 1C3BA 3LI8A 4LCMA 4UEYA 4QY6A 3IHAA 2QHKA 5J3WA 1AWIA 4K0WA 3LCEA 3ZG5A 4UA6A 3MXQA 4OQGA 3KSIA 5HAIA 4D60A 1YLWA 1XFQA 1MPLA 4DF6A 3IXGA 1G6OA 3PHYA 4MNRA 4L9GA 3GECA 4L9FA 3NOTC 4EBNA 2AVXA 4JF4A 3FWLA 1RP5A 4OPRA 5HDCA 1KOUA 4QU3A 2ZD8A 3O5YA 1QMEA 5FQIA 3CJMA 3Q07A 5HW3A 4XT2A 2QZ6A 1ACFA 3NOUC 4R4RA 2PD7A 3B33A 4ETXA 3CITA 2W1RA 4KZ8A 1XFNA 5GHXA 4NXGA 4HNBA 3N8LA 1YLZA 4KUOA 1PWCA 4OQIA 5FA7A 5L2FA 1F5MA 3PAEA 3LFVA 2W3EA 1PW8A 3BYDA 5AQAA 2KX6A 3G31A 1A0KA 3PR6A 3VOLA 3BW6A 4ZDXA 1CEFA 2HDQA 4QY5A 3ZFZA 1TDLA 5DVAA 1LL8A 2O9BA 2XRNA 3CPTA 4KENB 4XXRA 2HDSA 3BY9A 2J8YA 2V0UA 2Y2HA 1OT6A 4WL9A 1G5UA 2ZC5B 2DCFA 3TOIA 4LCLA 2WGWA 4BD0A 3FPVA 3AGDA 4DMZA 4NXFA 3M6BA 1ZKJA 3HLWA 2I72A 5HAQA 2A3UA 3UE3A 3GVBA 3HUNA 4RX2A 3IQAA 4FCFA 1OTAA 3EQUA 1S66L 1XXMA 1GSWA 4XT2B 2VGLS 4LGWA 4ZAMA 1BZAA 2HJEA 4LV1A 2C5WB 5E2HA 1Y54A 3T1RA 2G7UA 4MMNA 1VEUB 1K57C 2XDMA 3L9KA 3OPRA 1WA9A 1IELA 1T1CA 1OTBA 1M6KA 4NETA 1F98A 1XGIA 1E3UD 2Y8HA 5FI7A 1PFLA 2BASA 1L2SA 3N8RA 2M7UA 3IWQA 2HPBA 4KQRA 2Y2MA 2PT7A 4CPKA 3LI9A 3LIAA 1FCOA 2Y2JA 2WKQA 2Z6CA 1FCNA 4GKUA 1ESIA 3M2JA 3PBQA 1P9RA 2QMIA 1F2KA 2ZM0A 3LY4A 3RXXA 3ZG8B 4S2LA 3CUEC 5HL1A 3UB6A 3BQ8A 3HLDA 2J9PA 1RCJA 1JTDA 2X71A 5F6AA 5A91A 1Z6FA 3H7WB 3SZTA 3IWIA 4KG5A 3EGDC 1MKIA 2OSUA 4A5RA 1PIOA 2BG1A 2VGJA 1KDWA 1TS0A 5HX9A 2J3TC 3LIBA 5EE8A 3W4OA 1YSQA 4C6YA 3OPPA 2X02A 3U2AA 4HIAA 3BLMA 3UY6A 1XKZA 2Q9MA 2BTFP 2D02A 4UAAA 3NI9A 3P01A 2XH9A 4HJ3A 4OPQA 5F68A 4UA7A 1Y4OA 3CZDA 2A2LA 4S2IA 2FFFB 3KYEA 2H5SA 1JWZA 3CI6A 1GA0A 1O07A 1CI9A 3HLGA 2CC1A 5EV0A 3C38A 3HL9A 1T1BA 2DRWA 2VV6A 3EEAA 5IS1A 4Q0IA 4FD8A 2ZQCA 4LRXC 1L0FA 1SHVA 1IFQA 4RA7A 3IH9A 4GNUA 3NCKA 2EWWA 4GLQA 2L4RA 3HLFA 3W4PA 3K3CA 3V39A 3DW0A 3IXBA 3DTEA 1D1JA 5DF9A 2WADA 2WKRA 2OLUA 2WGVA 4Q0JA 1KVMA 1K6SA 3C7VA 1YPRA 3LIFA 3V67A 2P7JA 4EV4A 4DE1A 3A3EA 1PNEA 1OJ5A 1VEUA 4Y15A 5EUAA 2IWBA 5CHMA 5G4ZA 3PAGA 5EVIB 3OLOA 4L0LA 3UB8A 4S2JA 2VEAA 4BL3A 4KG6A 2J3WA 4NXEA 3T4KA 4R4SA 2HP5A 4WLAA 4KQQA 1YLYA 3MQ0A 5L8MA 4BBUA 3NBLA 5EPHA 3BFDA 2XF3A 3GMWA 4DE3A 5KSCA 4R38A 3SH9A 2ZC7A 4P6ZM 4ID4A 2JE5A 3IBJA 2PBDP 3ITAA 3OC2A 1Q2QA 4PM7A 4QD4A 4FSFA 3PBOA 3OOVA 3NHQA 3VP4A 4BENA 2K2NA 2VLGA 5TBMB 2ZMAA 1HVBA 3BFCA 1BUEA 5L10A 3VV4A 1H8YA 1K56D 3ZYTA 3ITBA 1N9OA 3QNBA 1L0DA 1XJ2A 3LYXA 2Y4AA 5KMWA 1ONGA 4C3QA 3QP2A 4PAUA 4Q0HA 3C7UA 5FAQA 4MBHA 4LLOB 1T18A 3NDEA 4OQ0A 3TW8A 1DP6A 2V1ZA 4N1XA 1NJ4A 4NEED 5CEDA 4ZJ3A 3LEZA 3UE0A 2WGIA 3ZG0A 3BFEA 2V1AA 3D4FA 3FV7A 3LR5A 3ICYA 5HD5A 1DJAA 1NLYA 4CLCD 5J8XA 2JBFA 1WYCA 5HDDA 2E8JA 2IA2A 4DDSA 5I5LA 3HJKA 4Y5FA 5DF7A 3RTYA 3BLSA 4IEDA 3CHWP 2UV0E 4X25A 5GHYA 4Y7PA 5CECA 3F1PB 5E2EA 5G4YA 3PBTA 5HFOA 4EBLA 4WUJA 1VQQA 4KQOA 4E3IA 4JXWA 3T4LA 3CPTB 4JGOA 2UWXA 2GZAA 1YMSA 2DNSA 4MCWA 5TJJA 5HWWA 1J9MA 2OLVA 4Q8IA 3K2NA 1ES3A 1PI4A 1S4RA 1LI9A 3ZG9B 5HPFA 3K3DA 4KG2A 3MXSA 4P6BA 3EGXC 1ERQA 3MBZA 1NZUA 4R6LA 2GNXA 3IX8A 3T4QA 1NLZA 3JVVA 3UE6A 3A3FA 1U60A 3LY3A 2M1CA 2EFUA 4IUKA 1T1AA 3B42A 2YKHA 2PD8A 4B4ZA 1EROA 1NXYA 3VMAA 3C4PA 3F1NA 3SS4A 5D3OA 1FR6A 2L1MA 4HY8A 4S2MA 1LHYA 3VFHA 2QJ5A 1G6AA 5DJUA 5JYOA 3KSGA 4JGRA 3HBRA 2EX9A 2GDNA 1BLPA 3MZDA 1JVJA 3OPHA 3ZDJA 1H0MA 2LB9A 1HLUP 1VETB 4HQAA 5EM1A 1CQAA 1K25A 1XJ6A 3HUOA 2HJ9C 1DP9A 4CLCC 1IEMA 2G2UA 3SW1A 4LV2A 4X55A 1ZTUA 3VSLA 3UO9A 1YLJA 3UPPA 3IF6B 5E43A 5HL6A 2J80A 3HREA 3QP4A 1VHMA 2WUQA 1GHPA 3ZNTA 2JKFA 1K57A 2WAEA 2ZM2A 2J7VA 5DFYA 4B9OA 5TGFA 3RXWA 1NRJA 1TD5A 4X6TA 3VSKA 2ZL1B 4G3WA 1OTEA 1PZPA 4OP5A 4CLCB 1CJFA 4R1GA 3UN7A 3EOIA 3EEHA 3E4QA 1NRFA 3NIAA 5CEBA 3G4PA 1LT0A 3F1NB 2QJ7A 4U3TA 3DTIA 4YOFA 1MWSA 3T1XA 4HOIA 3BFFA 3G30A 3LICA 4HP4A 3L7HA 4B93A 3VE4A 3P09A 4DDYA 4MN6A 5HWVA 2PR6A 1GSXA 4D2OA 4JXVA 1OJGA 4IHQA 1H5XA 1TVFA 2KDKA 2VX8A 2V20A 3LO7A 1W8QA 4I3JA 3ZCZA 4PM8A 1YLTA 3IS2A 3A3JA 2OAP1 1ES4A 4GCZA 3C2WA 1K4EA 2NUTC 4I38A 1L0GA 5DTKA 3PYPA 3NOPC 3ZQ5A 4FTXA 2PDRA 5G18A 3TSGA 4I39A 1IYOA 1FSWA 4BMWA 1XJ4A 3B47A 4EERA 1KVLA 4Y0OA 1FOFA 2C6WB 4XUXA 1ALQA 4HH2A 3SOIA 1ZC2A 2O9AA 4ZJ2A 3H82A 2JKRM 1JTGA 2PYRA 4GW9A 4FH4A 1HZOA 2WZZA 3E2LA 5KZHA 3T1QB 5TR7A 3G32A 3SH8A 1ES2A 1N4OA 2V1BA 4UQIS 2WAFA 2HP9A 1HD8A 4E3JA 4JXGA 3WS2A 4WEJA 1FCMA 3A3IA 3UB5P 5GHZA 1YQSA 3N7WA 3S22A 3KO6A 1ESUA 1FR1A 2XD5A 4R3JA 1OT9A 5FQKA 2V8FA 4KZBA 3OPLA 3IWOA 2P04A 4H6JA 5CGSA 1K55A 1XX2A 3GR2A 4OOLA 2A49A 2R9WA 3QHYA 4UHUA 1V9YA 3MXRA 4RQ9A 4BBVA 4EQ1A 1W8YA 2HGVA 4P0MA 3T4JA 3WS5A 2P9VA 4UA9A 2B02A 3AGFA 2Y2KA 3P98A 3Q82A 3WRTA 3GSGA 3V3SA 3E4OA 4R3BA 3DTMA 3TJZC 1KE3A 1LLBA 1NYYA 2EX2A 1M40A 3T50A 1S67L 4F94A 4HESA 3MFXA 3ZGAB 4WELA 4E3LA 5L07A 2Y91A 4GHIA 3IF6C 3ZHHA 2JKTM 5TBMA 1K0KA 2HP6A 4EU0A 1KE0A 1O7EA 2ZMVA 3W8KA 4Y0UA 1JWPA 4H8RA 4NK3A 4JKTA 2XR0A 2Z6DA 3HLCA 4Z1WA 3S7NA 1OTDA 4BLMA 3VP1A 3VFFA 4JF6A 5EVIC 4JF5A 2ZJ9A 2Y2GA 3H82B 4QJGA 2D01A 3R7WB 2ZOHA 4OOYA 4N9LA 2NUPC 2IWDA 3IXHA 3FPWA 5C5KA 5DTTA 4IBXA 2O0YA 2M7VA 3O3VA 1FQGA 2XA7S 4N9KA 3MQQA 4O01A 4DJ2A 3T4TA 3WS4A 2JKRI 2FH5A 5CERA 3LIEA 3IBRA 3UNWA 3E98A 2H10A 2P9VB 3O86A 4KZAA 3N8SA 2OWHA 3ZVWA 2ZL1A 2OAQ1 4DE2A 3T12B 4L9EA 5FQQA 5AQ9A 3KSFA 2A24B 1P0ZA 1WYBA 4X56A 3HVFA 3MZFA 1NY0A 3DTKA 4OLDA 3AGEA 4JPMA 2INWA 1EWZA 1W63M 4Y3IA 4KZ6A 5EECA 3ZVTA 5CHJA 1XP4A 2WKIA 4R3AA 3Q1FA 5DFXA 1ZG6A 1MBLA 1Y28A 1YLPA 4UQIM 1YT4A 1KGGA 5DTSA 1ZHHB 3KX0X 3QNCA 2XD1A 3G2YA 1RGZA 2EXBA 5DKLA 3ULFA 1FSYA 4LPZA 2PBYA 1PYYA 3VOZA 5IHVA 4EEPA 4YNRA 3CLOA 4JXSA 4HJ6A 1MKMA 1YM1A 4PM9A 4KZ4A 1SCWA 3IXDA 4HJ4A 2JCHA 1BT5A 1Q2PA 1RGYA 1P9WA 3W2ZA 5FL3A 4BQMA 2WKEA 4CLCA 4M4XA 3RJUA 5F1FA 1K6RA 5F83A 2R9XA 2Y2QA 5AVFA 3Q7ZA 3IX4A 2Y2OA 3T1SA 4QPRA 2ZQ8A 3R7WA 2A24A 5HD3A 5FDHA 4I5SA 3QP8A 5IU1A 1IYSA 2VZWA 4MBKA 4Y2FA 3WRZA 4EBPA 2W1TB 3KYZA 4RVAA 1EI5A 5F1GA 5TFQA 3MKFA 1LSVA 5FATA 2Y2NA 4WZ5C 3HCYA 2V2FF 1PWDA 5HWTA 1K54A 3F1OB 1PWGA 3D9YA 1VB6A 4KZ3A 4KZ9A 2VK3A 5GLDA 3QP5A 3BQAA 4Y13A 4YINA 4F3LB 3BRMA 3CAXA 3NY4A 4FUWA 4PMAA 4JLFA 4E3NA 4OKPA 5EOOA 5EVEA 4GD6A 2BLSA 3VP2A 3O88A 5MC7A 3HJIA 4RYEA 3PXPA 3PBNA 3DAVA 4PHTA 2QYBA 2K31A 3VE3A 4IUHA 1CEGA 3VP0A 3UE1A 3MR0A 1IYQA 2XLNA 3HLBA 3ZG7B 3IX3A 4LENA 4XUZA 4CQHA 1G68A 5AJGA 1VETA 4U0TA 1AXBA 1T19A 4BWIA 4GHIB 2JHEA 4GJ4A 4QHCA 4PPRA 1MWUA 1SKFA 4O8GA 2WK0A 2EA9A 3BM6A 3A0RA 5M1AA 3OCLA 4G3KA 3E4PA 2B95A 3N6IA 2PYPA 4PKYA 3GV9A 4OLGA 2WKPA 3OBFA 1GSVA 1NWZA 4WYYA 5HZHA 4WEKA 4EESA 4H6JB 3TE8A 2XK1A 1BULA 4WF0A 3BWLA 1DRMA 1ODVA 5L09A 2KOIA 3JPUA 2FZ0A 2HDUA 5FEGA 2MJ6A 2H0TA 3JVUA 1LI0A 5E2FA 3F1PA 5F5YA 1ERMA 5FAOA 3LGOA 4GB7A 3MQOA 3MMHA 4Y17A 1DJCA 2IWCA 1SKOB 1PZOA 3ZNYA 5EOEA 5CX7A 4EETB 2G2WA 4BJPA 4I3AA 5BOHA 2W3FA 3HLEA 4IVIA 1IYPA 3CUEA 3PBSA 4ZJ1A 5KSHA 4B88A 4F3LA 2JC7A 4OPZA 5FI6A 2QPNA 2FFYA 4OH0A 2XQZA 2ZC4B 3DWKA 5FQMA 3UB9A 3S1YA 1VM1A 2P74A 2RL3A 4DXCA 1V9ZA 4MBFA 5KIZA 5FDSA 4Z9QA 1W79A 1EW0A 1E25A 4NKPA 3UPOA 1YKDA 5HARA 3T4SA 3E0YA 2GJ3A 3N4IA 4ZBEA 3TRCA 4LV0A 3DBAA 2VV7A 2Y55A 4C75A 5FSRA 5IT5A 2E8IA 4OONA 4B4XA 2ZLYA 3MFDA 4DXBA 3UDIA 1G28A 3GQZA 1GHMA 5LBRA 5FQ9A 4M3KA 2V9AA 1KGEA 3C8CA 5I94A 2V8CA 3ISGA 3BFGA 4GD8A 5CXWA 1I2SA 5FAPA 5FQJA 1H3QA 1TS8A 2X01A 1NZOA 2Y79A 4DJ3A 2WZXA 1XPBA 1E4DA 3U4LP 2HV1A 3FC7A 2WYXA 3FG8A 2VJWA 1J3WA 4ARZB 5U47A 2EFXA 4YFMA 2W1TA 3G2ZA 1YMXA 2DMWA 4LRZE 3T4OA 4ETZA 2OV5A 2ZBBA 1JNUA 1IOUA 2R78A 4HHDA 3LR3A 4QWOA 4BL2A 2B5RA 5CGWA 4GS9A 5A93A 3NJAA 2VA0A 5HDSA 3WWXA 4ESPA 1TEMA 5DJTA 3G35A 2VV8A 4IBRA 3A0SA 1XA1A 2EWVA 2J3TD 4U0XA 2HF6A 3SH7A 1UGUA 2XEPA 2ZC6B 2W3HA 2PAVP 4OPYA 4LRYC 1LL5A 2Z2MB 3PTEA 4E6WA 1OTIA 2Q9NA 2ZQDA 3FYZA 4HP9A 4S2PA 1LSWA 5E2GA 3UB7A 1STZA 1SKOA 1K54C 2W3GA 4R23A 5GLBA 1DJBA 4X68A 2ZM8A 3OZHA 4RX3A 3TG9A 4EUZA 5J7EA 2J9OA 4JBFA 4II7A 4N92A 4FH2A 4HH3A 1GHIA 4DN0A 4E3MA 2ZMFA 3GTCA 4OP8A 2Y59A 3BECA 4K08A 5JYPA 3H7WA 4GDBA 3MJQA 4S2NA 5F82A 2PR5A 1K56A 1K38A 2I9VA 5AVEA 1UWPX 3MZEA 4LFUA 1SDEA 2XGNA 1L0EA 1ZG4A 5J4EA 1S1ZA 3IH8A 2ACGA 4BBTA 1IKIA 1KDSA 3S7PA 4KQDA 4HEFA 2XROA 2Y2PA 4OOMA 4YWZA 1PW1A 1NYMA 3JYIA 5A92A 1PI5A 4MN7A 4K91A 2XSSA 4X53A 4GOGA 2ZOIA 3RH8B 5HPIA 1FILA 3UMEA 1SDNA 1BYWA 2OOLA 2XFTA 1XA7A 3KSHA 1N9NA 5FASA 4GN2A 1F9IA 1GCEA 1YSPA 4R0QA 4E3KA 4X69A 4AFIA 2WGWB 4EW7A 3B3XA 5CTMA 4P87A 2YKFA 1H8MA 4BD1A 1OPXA 5DF8A 3EWKA 1KE4A 2JKTI 3GRJA 1MZUA 5EFWA 1BLCA 4JGQA 4EEUA 1FIKA 4MLLA 5CHUA 4N1HA 3UDXA 4EUVA 2PU4A 4X1LA 4WMCD 2GX5A 4KZ5A 4P6ZS 4ZTKA 3Q81A 1CK3A 1TF1A 2RCXA 5CGXA 3IF5A 1XGJA 1IKGA 3OCNA 3C4OA 1XJ3A 3QP6A 3LR0A 1OMEA 1W7FA 2KLIA 1BLHA 1MXOA 5HAPA 1S1YA 1LSXA 5EVIA 2H28A 4PM6A 1SZVA 3S7OA 5EVLA 4E3OA 2HDRA 3UDFA 4S2NC 1P97A 4HBTA 4GZBA 4GDNA 4FOFA 2ZQ9A 1S6RA 4P85A 4R70A 5EVID 4KZ7A 4WN5A 3H9WA 1E3UA 2PRFA 2EXAA 4PM5A 4OVDA 5M18A 4WBGA 4DKIA 5CRFA 1JWVA 3G34A 2W27A 1KGFA 1DY6A 3MKEA 4HBUA 3RFBA 4EXOA 3PBRA 4KUKA 3R4KA 1X0OA 1D06A 2K7SA 4K0XA 1W5DA 4OQHA 3C30A 1CI8A 4DE0A 2JN7A 1BTLA 3UPNA 2P08A 2JKGA 3MSHA 3CG5A 3IT9A 1H8ZA 3LUQA 4NG2A 3KYQA 4IVKA 5FEFA 3HUMA 2W0NA 3V3RA 4WM9A 3M6HA 1N9LA 4G3VA 1HTZA 1QMFA 1ES5A 3IS2B 4NXBA 4CJNA 5GLAA 2Y2IA 4IJGA 5FI2A 3M2KA 5GL9A 1BLSA 4WMCA 1MWRA 1WE4A 2O9CA 2Z2LB 2H0YA 1PRQA 2Q0OA 3NC8A 2PHYA 3UMDA 4EWFA 3MF0A 3WS1A 3A3DA 1W63Q
chains in the Genus database with same CATH topology
3C38A 5CX7A 4EETB 1T1BA 2O99A 4I3IA 2VV6A 3EEAA 5IS1A 4Q0IA 4LRXC 2W3DA 4BJPA 2V1BA 4UQIS 1IFQA 4I3AA 2W3FA 4O0PA 1UWNX 2OWJA 4WEJA 3CUEA 3PBSA 5KSHA 2EWWA 4F3LA 4GLQA 1D7EA 2L4RA 3K3CA 4MN5A 1DP8A 3KO6A 3UB9A 3CWFA 3LR4A 3P7NA 1OT9A 3D72A 5DF9A 1V9ZA 5KIZA 2WKRA 5HSQA 3S7QA 2P04A 5DKKA 1EW0A 4Q0JA 3BJNA 4H6JA 5F69A 1MC0A 4E04A 3LIFA 4NKPA 3V67A 1YKDA 2P7JA 3T4SA 3E0YA 2GJ3A 2LB5A 4CLCE 4OOLA 4ARZA 1OJ5A 4ME4A 2QWSA 5G4ZA 3OLOA 1V9YA 4L0LA 1YAXA 3UB8A 3TRCA 2VEAA 4RQ9A 2J3WA 2VGLM 4BBVA 4NXEA 3DBAA 4MDZA 3T4KA 2VV7A 4EQ1A 4WLAA 2HGVA 3T4JA 3MQ0A 4JGPA 3D3OA 5L8MA 2B02A 4BBUA 5IT5A 4R38A 3E4OA 4P6ZM 2B18A 3IBJA 3TJZC 3OC2A 1S4SA 1G28A 4FSFA 3PBOA 3OOVA 3T50A 1S67L 1TS6A 3BY8A 3NHQA 3MFXA 2K2NA 2VLGA 5TBMB 5LBRA 4WELA 3VV4A 4GHIA 2V9AA 3LIDA 3C8CA 2JKTM 5TBMA 3EQVA 3ZYTA 1N9OA 4EU0A 1XJ2A 3LYXA 2XA7M 1H3QA 4HI4A 1TS8A 2ZMVA 5K5BA 2V0WA 2Y79A 4ZRRA 4DJ3A 4PAUA 2HV1A 4Q0HA 2CMNA 3FC7A 3FG8A 2Z6DA 4LLOB 2VJWA 4Z1WA 3F1OA 4ARZB 1T18A 3S7NA 1OTDA 2W1TA 2DMWA 4LRZE 3TW8A 1DP6A 3T4OA 4PKYG 4ETZA 5A8BA 3A0VA 2ZBBA 1JNUA 1IOUA 2R78A 3GDIA 4GS9B 3G6OA 4NEED 3H82B 2D01A 3R7WB 4HHDA 3LR3A 2VKSA 2QKPA 2L0WA 2ZOHA 1TS7A 2NUPC 3FPWA 3LI8A 2V1AA 5C5KA 4GS9A 3NJAA 4UEYA 2VA0A 5HDSA 2QHKA 5J3WA 2O0YA 2M7VA 3LR5A 3ICYA 5DJTA 2VV8A 5HD5A 3A0SA 2EWVA 2J3TD 2XA7S 1NLYA 3MXQA 4CLCD 3MQQA 4O01A 4DJ2A 3T4TA 3KSIA 2HF6A 1UGUA 2JKRI 2FH5A 5HDDA 1XFQA 2W3HA 1G6OA 3LIEA 3IBRA 3PHYA 2IA2A 3E98A 3HJKA 4L9GA 4Y5FA 5I5LA 4LRYC 3RTYA 2OWHA 1OTIA 3GECA 2OAQ1 4L9EA 3F1PB 4L9FA 4HP9A 3NOTC 3KSFA 2A24B 5HDCA 5G4YA 1KOUA 1P0ZA 1LSWA 3PBTA 3O5YA 4WUJA 3UB7A 1STZA 2W3GA 4KQOA 3T4LA 2INWA 4JGOA 4XT2A 2GZAA 3NOUC 2PD7A 3B33A 4ETXA 4MCWA 5TJJA 3CITA 1W63M 2W1RA 4Y3IA 5J7EA 1XFNA 5HWWA 4II7A 3K2NA 4NXGA 4HNBA 1S4RA 4HH3A 4R3AA 4DN0A 5DFXA 2ZMFA 5HPFA 1Y28A 4UQIM 4KUOA 3K3DA 1ZHHB 4K08A 3H7WA 3KX0X 3MJQA 3EGXC 2PR5A 4R6LA 2I9VA 5DKLA 1UWPX 5AVEA 3ULFA 2GNXA 1F5MA 3T4QA 1NLZA 3LFVA 4LPZA 3JVVA 3UE6A 2W3EA 5J4EA 1S1ZA 4EEPA 4YNRA 2M1CA 3CLOA 4BBTA 4IUKA 1T1AA 4HJ6A 1MKMA 3S7PA 4KQDA 2XROA 3B42A 2YKHA 2KX6A 4OOMA 4YWZA 2PD8A 3PR6A 4HJ4A 4MN7A 3VOLA 3BW6A 1P9WA 2XSSA 3F1NA 3W2ZA 5FL3A 4CLCA 4M4XA 2L1MA 2ZOIA 4HY8A 3RH8B 5HPIA 1LL8A 2O9BA 2XRNA 3UMEA 2QJ5A 3BY9A 1BYWA 2OOLA 5DJUA 5AVFA 3KSHA 3KSGA 1N9NA 4QPRA 4JGRA 2V0UA 3R7WA 1OT6A 4WL9A 1F9IA 2A24A 5HD3A 1YSPA 4I5SA 2LB9A 4AFIA 5IU1A 3FPVA 4EW7A 4DMZA 2VZWA 4HQAA 4Y2FA 4NXFA 2W1TB 1XJ6A 3KYZA 2YKFA 2HJ9C 1DP9A 1H8MA 4CLCC 3UE3A 1OPXA 3SW1A 3EWKA 1ZTUA 2JKTI 1LSVA 1OTAA 3EQUA 1MZUA 1S66L 3HCYA 1GSWA 4XT2B 4JGQA 2VGLS 5EFWA 4EEUA 5HL6A 2J80A 1VHMA 5HWTA 2HJEA 3F1OB 4EUVA 1VB6A 2G7UA 5DFYA 4B9OA 2GX5A 4MMNA 4P6ZS 1NRJA 1TD5A 1TF1A 3BQAA 4F3LB 1WA9A 3OCNA 1T1CA 1OTBA 4G3WA 1OTEA 1XJ3A 4CLCB 3LR0A 3CAXA 1F98A 2KLIA 2Y8HA 2BASA 1S1YA 1LSXA 2M7UA 2H28A 5MC7A 2PT7A 3EOIA 3S7OA 3HJIA 3LI9A 3LIAA 3EEHA 3PXPA 3PBNA 4PHTA 3E4QA 2QYBA 1P97A 2WKQA 2Z6CA 2K31A 3VE3A 4IUHA 4FOFA 1LT0A 3F1NB 3MR0A 3PBQA 1P9RA 2QJ7A 4R70A 4WN5A 4YOFA 3H9WA 3CUEC 3UB6A 3BQ8A 4HOIA 4CQHA 3LICA 5AJGA 4HP4A 4B93A 3VE4A 5F6AA 4MN6A 5HWVA 2PR6A 3H7WB 1GSXA 2W27A 1T19A 3EGDC 1OJGA 3RFBA 4EXOA 4BWIA 3PBRA 4GHIB 4IHQA 4KUKA 2JHEA 4GJ4A 3R4KA 1X0OA 1D06A 1TS0A 4O8GA 2J3TC 2EA9A 2K7SA 3LIBA 2KDKA 2VX8A 3A0RA 4I3JA 3IS2A 1YSQA 3C30A 3OCLA 2OAP1 4G3KA 3U2AA 4HIAA 4GCZA 2JN7A 3C2WA 3E4PA 2NUTC 2P08A 2PYPA 4I38A 3PYPA 3NOPC 4PKYA 3ZQ5A 2WKPA 3OBFA 1GSVA 2PDRA 1NWZA 3LUQA 5HZHA 3KYQA 4WEKA 4EESA 4H6JB 2D02A 3TE8A 2W0NA 4I39A 3P01A 4WF0A 1N9LA 4G3VA 4BMWA 1XJ4A 3BWLA 3B47A 3IS2B 4EERA 1DRMA 4NXBA 4HJ3A 4IJGA 1ODVA 2KOIA 5F68A 2FZ0A 2A2LA 2O9CA 4HH2A 2MJ6A 3JVUA 2O9AA 3CI6A 3F1PA 5F5YA 3H82A 3MQOA 2PHYA 3MMHA 2JKRM 2PYRA 3UMDA 4GW9A 3MF0A 1W63Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LPZ A;  3FG8 A;  2Z6D A;  4LLO B;  4EET B;  3UE6 A;  3F1O A;  1T1B A;  1T18 A;  3HJI A;  3LI9 A;  4I3I A;  1OTD A;  3LIA A;  5J4E A;  2VV6 A;  1S1Z A;  4LRZ E;  5IS1 A;  3EEH A;  3E4Q A;  1DP6 A;  4LRX C;  1P97 A;  2M1C A;  2V1B A;  2WKQ A;  2Z6C A;  3CLO A;  3A0V A;  4I3A A;  4PKY G;  4BBT A;  5A8B A;  2ZBB A;  1JNU A;  1UWN X;  2OWJ A;  1T1A A;  2R78 A;  3VE3 A;  4E04 A;  3GDI A;  4EEP A;  4GS9 B;  1LT0 A;  3G6O A;  4HJ6 A;  3H82 B;  4KQD A;  4F3L A;  3F1N B;  3MR0 A;  1D7E A;  2YKH A;  2L4R A;  2QJ7 A;  2KX6 A;  2D01 A;  4YWZ A;  4R70 A;  4HHD A;  2PD8 A;  4WN5 A;  2QKP A;  3K3C A;  3H9W A;  4MN5 A;  2L0W A;  1DP8 A;  1TS7 A;  2ZOH A;  4HJ4 A;  3UB9 A;  3CWF A;  3UB6 A;  4HOI A;  3LI8 A;  2V1A A;  4GS9 A;  3VOL A;  3P7N A;  3LIC A;  1OT9 A;  3D72 A;  3NJA A;  1V9Z A;  4NXF A;  3F1N A;  4HP4 A;  5HDC A;  5HDS A;  2WKR A;  3VE4 A;  2QHK A;  5HSQ A;  5J3W A;  5KIZ A;  5F6A A;  3ICY A;  4M4X A;  2L1M A;  2VV8 A;  5DJT A;  2ZOI A;  4HY8 A;  5DKK A;  5HD5 A;  1EW0 A;  1LL8 A;  3A0S A;  4MN6 A;  2PR6 A;  3H7W B;  4H6J A;  5HWV A;  3MXQ A;  5F69 A;  1GSX A;  3MQQ A;  2W27 A;  3LIF A;  3UME A;  4DJ2 A;  1T19 A;  2P7J A;  2QJ5 A;  3BY9 A;  1BYW A;  2OOL A;  2GJ3 A;  5DJU A;  1OJG A;  5AVF A;  1UGU A;  1OJ5 A;  5HDD A;  4GHI B;  4KUK A;  4EXO A;  1N9N A;  2JHE A;  2QWS A;  3RH8 B;  1XFQ A;  5G4Z A;  3OLO A;  4JGR A;  2V0U A;  1V9Y A;  1D06 A;  1TS0 A;  1OT6 A;  1X0O A;  3IBR A;  3LIE A;  3PHY A;  1F9I A;  3HJK A;  4L9G A;  2EA9 A;  4LRY C;  2K7S A;  5I5L A;  2A24 A;  2VEA A;  3LIB A;  4RQ9 A;  5HD3 A;  3RTY A;  2OWH A;  2KDK A;  4BBV A;  1OTI A;  3A0R A;  3GEC A;  4I3J A;  4I5S A;  4NXE A;  3IS2 A;  2VV7 A;  4EQ1 A;  4L9E A;  5IU1 A;  3F1P B;  4WLA A;  4L9F A;  4HP9 A;  4EW7 A;  3NOT C;  4HQA A;  2A24 B;  4HIA A;  4GCZ A;  2JN7 A;  3C2W A;  4JGP A;  1XJ6 A;  1KOU A;  1P0Z A;  1LSW A;  2B02 A;  2YKF A;  3E4P A;  1DP9 A;  5G4Y A;  4BBU A;  2PYP A;  3SW1 A;  3EWK A;  4I38 A;  4R38 A;  3PYP A;  3NOP C;  4WUJ A;  3UB7 A;  4PKY A;  3E4O A;  3ZQ5 A;  2WKP A;  1GSV A;  1LSV A;  2PDR A;  1NWZ A;  3LUQ A;  1OTA A;  4WL9 A;  1MZU A;  1S66 L;  4EES A;  1S4S A;  5HZH A;  1GSW A;  4H6J B;  2INW A;  4JGO A;  1G28 A;  2D02 A;  4JGQ A;  2W0N A;  4XT2 B;  4XT2 A;  5EFW A;  2J80 A;  4EEU A;  3NOU C;  4I39 A;  1S67 L;  1TS6 A;  3BY8 A;  3NHQ A;  1N9L A;  2PD7 A;  4WF0 A;  3T50 A;  3MFX A;  3B33 A;  1XJ4 A;  3BWL A;  3UB8 A;  3IS2 B;  4EER A;  1DRM A;  2VLG A;  4NXB A;  5HWT A;  4HJ3 A;  5TBM B;  5J7E A;  1XFN A;  1ODV A;  5HWW A;  3F1O B;  5F68 A;  4GHI A;  1VB6 A;  4B9O A;  4NXG A;  2V9A A;  4HNB A;  3LID A;  1S4R A;  4HH2 A;  3C8C A;  4HH3 A;  4R3A A;  5TBM A;  1Y28 A;  4KUO A;  1N9O A;  3F1P A;  3K3D A;  1XJ2 A;  3H82 A;  3LYX A;  4K08 A;  5F5Y A;  4F3L B;  1WA9 A;  1LSX A;  3H7W A;  3MQO A;  1T1C A;  2PHY A;  1OTB A;  3KX0 X;  1TS8 A;  3MJQ A;  4HI4 A;  1OTE A;  2V0W A;  2PYR A;  3UMD A;  1XJ3 A;  4GW9 A;  4DJ3 A;  3CAX A;  2PR5 A;  1F98 A;  4R6L A;  2I9V A;  2HV1 A;  1UWP X;  5DKL A;  5AVE A;  3ULF A;  2BAS A;  1S1Y A;  2CMN A;  3FC7 A;  2H28 A; 
#chains in the Genus database with same CATH topology
 3Q7V A;  2ZC3 B;  2O99 A;  4I3I A;  1K55 C;  3V50 A;  2W3D A;  2PU2 A;  4O0P A;  1UWN X;  2OWJ A;  3FKW A;  1D7E A;  3VP3 A;  4WZ5 A;  4LV3 A;  4MN5 A;  1DP8 A;  3CMZ A;  4MEZ A;  3CWF A;  3LR4 A;  5A90 A;  5CTN A;  1I2W A;  3S4X A;  3NUL A;  3D72 A;  3O87 A;  3P7N A;  5GLC A;  5HSQ A;  3S7Q A;  2XFS A;  5DKK A;  4QB8 A;  3BJN A;  5M19 A;  5F69 A;  1MC0 A;  4E04 A;  4X1M A;  2EX8 A;  4CLC E;  2LB5 A;  4ARZ A;  3NDG A;  2ZQ7 A;  3FZC A;  4ME4 A;  3SS5 A;  2QWS A;  1YAX A;  3IHB A;  4E6X A;  2ZQA A;  2VGL M;  4WZ4 A;  4MDZ A;  4S2O A;  1S0W A;  3IF6 A;  3VOY A;  4JGP A;  3D3O A;  1MY8 A;  1CF0 A;  4Y0T A;  1MWT A;  2VGK A;  2B18 A;  3C5A A;  1S4S A;  1Z09 A;  1LL9 A;  1TS6 A;  3BY8 A;  3WS0 A;  2HZ5 A;  3BEB A;  3NEC A;  3I7J A;  3FKV A;  3LID A;  4S2K A;  2EX6 A;  3EQV A;  1K4F A;  3V5M A;  2Y2L A;  4O7D A;  5AQ7 A;  3DWZ A;  2XA7 M;  1L3L A;  4HI4 A;  1BSG A;  5K5B A;  2V0W A;  4ZRR A;  4EQI A;  3MS6 A;  3LEQ A;  2WKH A;  1ONH A;  2CMN A;  3SS3 A;  3Q7V B;  3F1O A;  1GA9 A;  3QP1 A;  1TDG A;  4PKY G;  5A8B A;  3A0V A;  5AQB A;  4DRT A;  3GDI A;  4GS9 B;  3G6O A;  3W4Q A;  2VKS A;  2QKP A;  2L0W A;  1TS7 A;  5EM0 A;  1I5Q A;  1N9B A;  3E2K A;  1C3B A;  3LI8 A;  4LCM A;  4UEY A;  4QY6 A;  3IHA A;  2QHK A;  5J3W A;  1AWI A;  4K0W A;  3LCE A;  3ZG5 A;  4UA6 A;  3MXQ A;  4OQG A;  3KSI A;  5HAI A;  4D60 A;  1YLW A;  1XFQ A;  1MPL A;  4DF6 A;  3IXG A;  1G6O A;  3PHY A;  4MNR A;  4L9G A;  3GEC A;  4L9F A;  3NOT C;  4EBN A;  2AVX A;  4JF4 A;  3FWL A;  1RP5 A;  4OPR A;  5HDC A;  1KOU A;  4QU3 A;  2ZD8 A;  3O5Y A;  1QME A;  5FQI A;  3CJM A;  3Q07 A;  5HW3 A;  4XT2 A;  2QZ6 A;  1ACF A;  3NOU C;  4R4R A;  2PD7 A;  3B33 A;  4ETX A;  3CIT A;  2W1R A;  4KZ8 A;  1XFN A;  5GHX A;  4NXG A;  4HNB A;  3N8L A;  1YLZ A;  4KUO A;  1PWC A;  4OQI A;  5FA7 A;  5L2F A;  1F5M A;  3PAE A;  3LFV A;  2W3E A;  1PW8 A;  3BYD A;  5AQA A;  2KX6 A;  3G31 A;  1A0K A;  3PR6 A;  3VOL A;  3BW6 A;  4ZDX A;  1CEF A;  2HDQ A;  4QY5 A;  3ZFZ A;  1TDL A;  5DVA A;  1LL8 A;  2O9B A;  2XRN A;  3CPT A;  4KEN B;  4XXR A;  2HDS A;  3BY9 A;  2J8Y A;  2V0U A;  2Y2H A;  1OT6 A;  4WL9 A;  1G5U A;  2ZC5 B;  2DCF A;  3TOI A;  4LCL A;  2WGW A;  4BD0 A;  3FPV A;  3AGD A;  4DMZ A;  4NXF A;  3M6B A;  1ZKJ A;  3HLW A;  2I72 A;  5HAQ A;  2A3U A;  3UE3 A;  3GVB A;  3HUN A;  4RX2 A;  3IQA A;  4FCF A;  1OTA A;  3EQU A;  1S66 L;  1XXM A;  1GSW A;  4XT2 B;  2VGL S;  4LGW A;  4ZAM A;  1BZA A;  2HJE A;  4LV1 A;  2C5W B;  5E2H A;  1Y54 A;  3T1R A;  2G7U A;  4MMN A;  1VEU B;  1K57 C;  2XDM A;  3L9K A;  3OPR A;  1WA9 A;  1IEL A;  1T1C A;  1OTB A;  1M6K A;  4NET A;  1F98 A;  1XGI A;  1E3U D;  2Y8H A;  5FI7 A;  1PFL A;  2BAS A;  1L2S A;  3N8R A;  2M7U A;  3IWQ A;  2HPB A;  4KQR A;  2Y2M A;  2PT7 A;  4CPK A;  3LI9 A;  3LIA A;  1FCO A;  2Y2J A;  2WKQ A;  2Z6C A;  1FCN A;  4GKU A;  1ESI A;  3M2J A;  3PBQ A;  1P9R A;  2QMI A;  1F2K A;  2ZM0 A;  3LY4 A;  3RXX A;  3ZG8 B;  4S2L A;  3CUE C;  5HL1 A;  3UB6 A;  3BQ8 A;  3HLD A;  2J9P A;  1RCJ A;  1JTD A;  2X71 A;  5F6A A;  5A91 A;  1Z6F A;  3H7W B;  3SZT A;  3IWI A;  4KG5 A;  3EGD C;  1MKI A;  2OSU A;  4A5R A;  1PIO A;  2BG1 A;  2VGJ A;  1KDW A;  1TS0 A;  5HX9 A;  2J3T C;  3LIB A;  5EE8 A;  3W4O A;  1YSQ A;  4C6Y A;  3OPP A;  2X02 A;  3U2A A;  4HIA A;  3BLM A;  3UY6 A;  1XKZ A;  2Q9M A;  2BTF P;  2D02 A;  4UAA A;  3NI9 A;  3P01 A;  2XH9 A;  4HJ3 A;  4OPQ A;  5F68 A;  4UA7 A;  1Y4O A;  3CZD A;  2A2L A;  4S2I A;  2FFF B;  3KYE A;  2H5S A;  1JWZ A;  3CI6 A;  1GA0 A;  1O07 A;  1CI9 A;  3HLG A;  2CC1 A;  5EV0 A;  3C38 A;  3HL9 A;  1T1B A;  2DRW A;  2VV6 A;  3EEA A;  5IS1 A;  4Q0I A;  4FD8 A;  2ZQC A;  4LRX C;  1L0F A;  1SHV A;  1IFQ A;  4RA7 A;  3IH9 A;  4GNU A;  3NCK A;  2EWW A;  4GLQ A;  2L4R A;  3HLF A;  3W4P A;  3K3C A;  3V39 A;  3DW0 A;  3IXB A;  3DTE A;  1D1J A;  5DF9 A;  2WAD A;  2WKR A;  2OLU A;  2WGV A;  4Q0J A;  1KVM A;  1K6S A;  3C7V A;  1YPR A;  3LIF A;  3V67 A;  2P7J A;  4EV4 A;  4DE1 A;  3A3E A;  1PNE A;  1OJ5 A;  1VEU A;  4Y15 A;  5EUA A;  2IWB A;  5CHM A;  5G4Z A;  3PAG A;  5EVI B;  3OLO A;  4L0L A;  3UB8 A;  4S2J A;  2VEA A;  4BL3 A;  4KG6 A;  2J3W A;  4NXE A;  3T4K A;  4R4S A;  2HP5 A;  4WLA A;  4KQQ A;  1YLY A;  3MQ0 A;  5L8M A;  4BBU A;  3NBL A;  5EPH A;  3BFD A;  2XF3 A;  3GMW A;  4DE3 A;  5KSC A;  4R38 A;  3SH9 A;  2ZC7 A;  4P6Z M;  4ID4 A;  2JE5 A;  3IBJ A;  2PBD P;  3ITA A;  3OC2 A;  1Q2Q A;  4PM7 A;  4QD4 A;  4FSF A;  3PBO A;  3OOV A;  3NHQ A;  3VP4 A;  4BEN A;  2K2N A;  2VLG A;  5TBM B;  2ZMA A;  1HVB A;  3BFC A;  1BUE A;  5L10 A;  3VV4 A;  1H8Y A;  1K56 D;  3ZYT A;  3ITB A;  1N9O A;  3QNB A;  1L0D A;  1XJ2 A;  3LYX A;  2Y4A A;  5KMW A;  1ONG A;  4C3Q A;  3QP2 A;  4PAU A;  4Q0H A;  3C7U A;  5FAQ A;  4MBH A;  4LLO B;  1T18 A;  3NDE A;  4OQ0 A;  3TW8 A;  1DP6 A;  2V1Z A;  4N1X A;  1NJ4 A;  4NEE D;  5CED A;  4ZJ3 A;  3LEZ A;  3UE0 A;  2WGI A;  3ZG0 A;  3BFE A;  2V1A A;  3D4F A;  3FV7 A;  3LR5 A;  3ICY A;  5HD5 A;  1DJA A;  1NLY A;  4CLC D;  5J8X A;  2JBF A;  1WYC A;  5HDD A;  2E8J A;  2IA2 A;  4DDS A;  5I5L A;  3HJK A;  4Y5F A;  5DF7 A;  3RTY A;  3BLS A;  4IED A;  3CHW P;  2UV0 E;  4X25 A;  5GHY A;  4Y7P A;  5CEC A;  3F1P B;  5E2E A;  5G4Y A;  3PBT A;  5HFO A;  4EBL A;  4WUJ A;  1VQQ A;  4KQO A;  4E3I A;  4JXW A;  3T4L A;  3CPT B;  4JGO A;  2UWX A;  2GZA A;  1YMS A;  2DNS A;  4MCW A;  5TJJ A;  5HWW A;  1J9M A;  2OLV A;  4Q8I A;  3K2N A;  1ES3 A;  1PI4 A;  1S4R A;  1LI9 A;  3ZG9 B;  5HPF A;  3K3D A;  4KG2 A;  3MXS A;  4P6B A;  3EGX C;  1ERQ A;  3MBZ A;  1NZU A;  4R6L A;  2GNX A;  3IX8 A;  3T4Q A;  1NLZ A;  3JVV A;  3UE6 A;  3A3F A;  1U60 A;  3LY3 A;  2M1C A;  2EFU A;  4IUK A;  1T1A A;  3B42 A;  2YKH A;  2PD8 A;  4B4Z A;  1ERO A;  1NXY A;  3VMA A;  3C4P A;  3F1N A;  3SS4 A;  5D3O A;  1FR6 A;  2L1M A;  4HY8 A;  4S2M A;  1LHY A;  3VFH A;  2QJ5 A;  1G6A A;  5DJU A;  5JYO A;  3KSG A;  4JGR A;  3HBR A;  2EX9 A;  2GDN A;  1BLP A;  3MZD A;  1JVJ A;  3OPH A;  3ZDJ A;  1H0M A;  2LB9 A;  1HLU P;  1VET B;  4HQA A;  5EM1 A;  1CQA A;  1K25 A;  1XJ6 A;  3HUO A;  2HJ9 C;  1DP9 A;  4CLC C;  1IEM A;  2G2U A;  3SW1 A;  4LV2 A;  4X55 A;  1ZTU A;  3VSL A;  3UO9 A;  1YLJ A;  3UPP A;  3IF6 B;  5E43 A;  5HL6 A;  2J80 A;  3HRE A;  3QP4 A;  1VHM A;  2WUQ A;  1GHP A;  3ZNT A;  2JKF A;  1K57 A;  2WAE A;  2ZM2 A;  2J7V A;  5DFY A;  4B9O A;  5TGF A;  3RXW A;  1NRJ A;  1TD5 A;  4X6T A;  3VSK A;  2ZL1 B;  4G3W A;  1OTE A;  1PZP A;  4OP5 A;  4CLC B;  1CJF A;  4R1G A;  3UN7 A;  3EOI A;  3EEH A;  3E4Q A;  1NRF A;  3NIA A;  5CEB A;  3G4P A;  1LT0 A;  3F1N B;  2QJ7 A;  4U3T A;  3DTI A;  4YOF A;  1MWS A;  3T1X A;  4HOI A;  3BFF A;  3G30 A;  3LIC A;  4HP4 A;  3L7H A;  4B93 A;  3VE4 A;  3P09 A;  4DDY A;  4MN6 A;  5HWV A;  2PR6 A;  1GSX A;  4D2O A;  4JXV A;  1OJG A;  4IHQ A;  1H5X A;  1TVF A;  2KDK A;  2VX8 A;  2V20 A;  3LO7 A;  1W8Q A;  4I3J A;  3ZCZ A;  4PM8 A;  1YLT A;  3IS2 A;  3A3J A;  2OAP 1;  1ES4 A;  4GCZ A;  3C2W A;  1K4E A;  2NUT C;  4I38 A;  1L0G A;  5DTK A;  3PYP A;  3NOP C;  3ZQ5 A;  4FTX A;  2PDR A;  5G18 A;  3TSG A;  4I39 A;  1IYO A;  1FSW A;  4BMW A;  1XJ4 A;  3B47 A;  4EER A;  1KVL A;  4Y0O A;  1FOF A;  2C6W B;  4XUX A;  1ALQ A;  4HH2 A;  3SOI A;  1ZC2 A;  2O9A A;  4ZJ2 A;  3H82 A;  2JKR M;  1JTG A;  2PYR A;  4GW9 A;  4FH4 A;  1HZO A;  2WZZ A;  3E2L A;  5KZH A;  3T1Q B;  5TR7 A;  3G32 A;  3SH8 A;  1ES2 A;  1N4O A;  2V1B A;  4UQI S;  2WAF A;  2HP9 A;  1HD8 A;  4E3J A;  4JXG A;  3WS2 A;  4WEJ A;  1FCM A;  3A3I A;  3UB5 P;  5GHZ A;  1YQS A;  3N7W A;  3S22 A;  3KO6 A;  1ESU A;  1FR1 A;  2XD5 A;  4R3J A;  1OT9 A;  5FQK A;  2V8F A;  4KZB A;  3OPL A;  3IWO A;  2P04 A;  4H6J A;  5CGS A;  1K55 A;  1XX2 A;  3GR2 A;  4OOL A;  2A49 A;  2R9W A;  3QHY A;  4UHU A;  1V9Y A;  3MXR A;  4RQ9 A;  4BBV A;  4EQ1 A;  1W8Y A;  2HGV A;  4P0M A;  3T4J A;  3WS5 A;  2P9V A;  4UA9 A;  2B02 A;  3AGF A;  2Y2K A;  3P98 A;  3Q82 A;  3WRT A;  3GSG A;  3V3S A;  3E4O A;  4R3B A;  3DTM A;  3TJZ C;  1KE3 A;  1LLB A;  1NYY A;  2EX2 A;  1M40 A;  3T50 A;  1S67 L;  4F94 A;  4HES A;  3MFX A;  3ZGA B;  4WEL A;  4E3L A;  5L07 A;  2Y91 A;  4GHI A;  3IF6 C;  3ZHH A;  2JKT M;  5TBM A;  1K0K A;  2HP6 A;  4EU0 A;  1KE0 A;  1O7E A;  2ZMV A;  3W8K A;  4Y0U A;  1JWP A;  4H8R A;  4NK3 A;  4JKT A;  2XR0 A;  2Z6D A;  3HLC A;  4Z1W A;  3S7N A;  1OTD A;  4BLM A;  3VP1 A;  3VFF A;  4JF6 A;  5EVI C;  4JF5 A;  2ZJ9 A;  2Y2G A;  3H82 B;  4QJG A;  2D01 A;  3R7W B;  2ZOH A;  4OOY A;  4N9L A;  2NUP C;  2IWD A;  3IXH A;  3FPW A;  5C5K A;  5DTT A;  4IBX A;  2O0Y A;  2M7V A;  3O3V A;  1FQG A;  2XA7 S;  4N9K A;  3MQQ A;  4O01 A;  4DJ2 A;  3T4T A;  3WS4 A;  2JKR I;  2FH5 A;  5CER A;  3LIE A;  3IBR A;  3UNW A;  3E98 A;  2H10 A;  2P9V B;  3O86 A;  4KZA A;  3N8S A;  2OWH A;  3ZVW A;  2ZL1 A;  2OAQ 1;  4DE2 A;  3T12 B;  4L9E A;  5FQQ A;  5AQ9 A;  3KSF A;  2A24 B;  1P0Z A;  1WYB A;  4X56 A;  3HVF A;  3MZF A;  1NY0 A;  3DTK A;  4OLD A;  3AGE A;  4JPM A;  2INW A;  1EWZ A;  1W63 M;  4Y3I A;  4KZ6 A;  5EEC A;  3ZVT A;  5CHJ A;  1XP4 A;  2WKI A;  4R3A A;  3Q1F A;  5DFX A;  1ZG6 A;  1MBL A;  1Y28 A;  1YLP A;  4UQI M;  1YT4 A;  1KGG A;  5DTS A;  1ZHH B;  3KX0 X;  3QNC A;  2XD1 A;  3G2Y A;  1RGZ A;  2EXB A;  5DKL A;  3ULF A;  1FSY A;  4LPZ A;  2PBY A;  1PYY A;  3VOZ A;  5IHV A;  4EEP A;  4YNR A;  3CLO A;  4JXS A;  4HJ6 A;  1MKM A;  1YM1 A;  4PM9 A;  4KZ4 A;  1SCW A;  3IXD A;  4HJ4 A;  2JCH A;  1BT5 A;  1Q2P A;  1RGY A;  1P9W A;  3W2Z A;  5FL3 A;  4BQM A;  2WKE A;  4CLC A;  4M4X A;  3RJU A;  5F1F A;  1K6R A;  5F83 A;  2R9X A;  2Y2Q A;  5AVF A;  3Q7Z A;  3IX4 A;  2Y2O A;  3T1S A;  4QPR A;  2ZQ8 A;  3R7W A;  2A24 A;  5HD3 A;  5FDH A;  4I5S A;  3QP8 A;  5IU1 A;  1IYS A;  2VZW A;  4MBK A;  4Y2F A;  3WRZ A;  4EBP A;  2W1T B;  3KYZ A;  4RVA A;  1EI5 A;  5F1G A;  5TFQ A;  3MKF A;  1LSV A;  5FAT A;  2Y2N A;  4WZ5 C;  3HCY A;  2V2F F;  1PWD A;  5HWT A;  1K54 A;  3F1O B;  1PWG A;  3D9Y A;  1VB6 A;  4KZ3 A;  4KZ9 A;  2VK3 A;  5GLD A;  3QP5 A;  3BQA A;  4Y13 A;  4YIN A;  4F3L B;  3BRM A;  3CAX A;  3NY4 A;  4FUW A;  4PMA A;  4JLF A;  4E3N A;  4OKP A;  5EOO A;  5EVE A;  4GD6 A;  2BLS A;  3VP2 A;  3O88 A;  5MC7 A;  3HJI A;  4RYE A;  3PXP A;  3PBN A;  3DAV A;  4PHT A;  2QYB A;  2K31 A;  3VE3 A;  4IUH A;  1CEG A;  3VP0 A;  3UE1 A;  3MR0 A;  1IYQ A;  2XLN A;  3HLB A;  3ZG7 B;  3IX3 A;  4LEN A;  4XUZ A;  4CQH A;  1G68 A;  5AJG A;  1VET A;  4U0T A;  1AXB A;  1T19 A;  4BWI A;  4GHI B;  2JHE A;  4GJ4 A;  4QHC A;  4PPR A;  1MWU A;  1SKF A;  4O8G A;  2WK0 A;  2EA9 A;  3BM6 A;  3A0R A;  5M1A A;  3OCL A;  4G3K A;  3E4P A;  2B95 A;  3N6I A;  2PYP A;  4PKY A;  3GV9 A;  4OLG A;  2WKP A;  3OBF A;  1GSV A;  1NWZ A;  4WYY A;  5HZH A;  4WEK A;  4EES A;  4H6J B;  3TE8 A;  2XK1 A;  1BUL A;  4WF0 A;  3BWL A;  1DRM A;  1ODV A;  5L09 A;  2KOI A;  3JPU A;  2FZ0 A;  2HDU A;  5FEG A;  2MJ6 A;  2H0T A;  3JVU A;  1LI0 A;  5E2F A;  3F1P A;  5F5Y A;  1ERM A;  5FAO A;  3LGO A;  4GB7 A;  3MQO A;  3MMH A;  4Y17 A;  1DJC A;  2IWC A;  1SKO B;  1PZO A;  3ZNY A;  5EOE A;  5CX7 A;  4EET B;  2G2W A;  4BJP A;  4I3A A;  5BOH A;  2W3F A;  3HLE A;  4IVI A;  1IYP A;  3CUE A;  3PBS A;  4ZJ1 A;  5KSH A;  4B88 A;  4F3L A;  2JC7 A;  4OPZ A;  5FI6 A;  2QPN A;  2FFY A;  4OH0 A;  2XQZ A;  2ZC4 B;  3DWK A;  5FQM A;  3UB9 A;  3S1Y A;  1VM1 A;  2P74 A;  2RL3 A;  4DXC A;  1V9Z A;  4MBF A;  5KIZ A;  5FDS A;  4Z9Q A;  1W79 A;  1EW0 A;  1E25 A;  4NKP A;  3UPO A;  1YKD A;  5HAR A;  3T4S A;  3E0Y A;  2GJ3 A;  3N4I A;  4ZBE A;  3TRC A;  4LV0 A;  3DBA A;  2VV7 A;  2Y55 A;  4C75 A;  5FSR A;  5IT5 A;  2E8I A;  4OON A;  4B4X A;  2ZLY A;  3MFD A;  4DXB A;  3UDI A;  1G28 A;  3GQZ A;  1GHM A;  5LBR A;  5FQ9 A;  4M3K A;  2V9A A;  1KGE A;  3C8C A;  5I94 A;  2V8C A;  3ISG A;  3BFG A;  4GD8 A;  5CXW A;  1I2S A;  5FAP A;  5FQJ A;  1H3Q A;  1TS8 A;  2X01 A;  1NZO A;  2Y79 A;  4DJ3 A;  2WZX A;  1XPB A;  1E4D A;  3U4L P;  2HV1 A;  3FC7 A;  2WYX A;  3FG8 A;  2VJW A;  1J3W A;  4ARZ B;  5U47 A;  2EFX A;  4YFM A;  2W1T A;  3G2Z A;  1YMX A;  2DMW A;  4LRZ E;  3T4O A;  4ETZ A;  2OV5 A;  2ZBB A;  1JNU A;  1IOU A;  2R78 A;  4HHD A;  3LR3 A;  4QWO A;  4BL2 A;  2B5R A;  5CGW A;  4GS9 A;  5A93 A;  3NJA A;  2VA0 A;  5HDS A;  3WWX A;  4ESP A;  1TEM A;  5DJT A;  3G35 A;  2VV8 A;  4IBR A;  3A0S A;  1XA1 A;  2EWV A;  2J3T D;  4U0X A;  2HF6 A;  3SH7 A;  1UGU A;  2XEP A;  2ZC6 B;  2W3H A;  2PAV P;  4OPY A;  4LRY C;  1LL5 A;  2Z2M B;  3PTE A;  4E6W A;  1OTI A;  2Q9N A;  2ZQD A;  3FYZ A;  4HP9 A;  4S2P A;  1LSW A;  5E2G A;  3UB7 A;  1STZ A;  1SKO A;  1K54 C;  2W3G A;  4R23 A;  5GLB A;  1DJB A;  4X68 A;  2ZM8 A;  3OZH A;  4RX3 A;  3TG9 A;  4EUZ A;  5J7E A;  2J9O A;  4JBF A;  4II7 A;  4N92 A;  4FH2 A;  4HH3 A;  1GHI A;  4DN0 A;  4E3M A;  2ZMF A;  3GTC A;  4OP8 A;  2Y59 A;  3BEC A;  4K08 A;  5JYP A;  3H7W A;  4GDB A;  3MJQ A;  4S2N A;  5F82 A;  2PR5 A;  1K56 A;  1K38 A;  2I9V A;  5AVE A;  1UWP X;  3MZE A;  4LFU A;  1SDE A;  2XGN A;  1L0E A;  1ZG4 A;  5J4E A;  1S1Z A;  3IH8 A;  2ACG A;  4BBT A;  1IKI A;  1KDS A;  3S7P A;  4KQD A;  4HEF A;  2XRO A;  2Y2P A;  4OOM A;  4YWZ A;  1PW1 A;  1NYM A;  3JYI A;  5A92 A;  1PI5 A;  4MN7 A;  4K91 A;  2XSS A;  4X53 A;  4GOG A;  2ZOI A;  3RH8 B;  5HPI A;  1FIL A;  3UME A;  1SDN A;  1BYW A;  2OOL A;  2XFT A;  1XA7 A;  3KSH A;  1N9N A;  5FAS A;  4GN2 A;  1F9I A;  1GCE A;  1YSP A;  4R0Q A;  4E3K A;  4X69 A;  4AFI A;  2WGW B;  4EW7 A;  3B3X A;  5CTM A;  4P87 A;  2YKF A;  1H8M A;  4BD1 A;  1OPX A;  5DF8 A;  3EWK A;  1KE4 A;  2JKT I;  3GRJ A;  1MZU A;  5EFW A;  1BLC A;  4JGQ A;  4EEU A;  1FIK A;  4MLL A;  5CHU A;  4N1H A;  3UDX A;  4EUV A;  2PU4 A;  4X1L A;  4WMC D;  2GX5 A;  4KZ5 A;  4P6Z S;  4ZTK A;  3Q81 A;  1CK3 A;  1TF1 A;  2RCX A;  5CGX A;  3IF5 A;  1XGJ A;  1IKG A;  3OCN A;  3C4O A;  1XJ3 A;  3QP6 A;  3LR0 A;  1OME A;  1W7F A;  2KLI A;  1BLH A;  1MXO A;  5HAP A;  1S1Y A;  1LSX A;  5EVI A;  2H28 A;  4PM6 A;  1SZV A;  3S7O A;  5EVL A;  4E3O A;  2HDR A;  3UDF A;  4S2N C;  1P97 A;  4HBT A;  4GZB A;  4GDN A;  4FOF A;  2ZQ9 A;  1S6R A;  4P85 A;  4R70 A;  5EVI D;  4KZ7 A;  4WN5 A;  3H9W A;  1E3U A;  2PRF A;  2EXA A;  4PM5 A;  4OVD A;  5M18 A;  4WBG A;  4DKI A;  5CRF A;  1JWV A;  3G34 A;  2W27 A;  1KGF A;  1DY6 A;  3MKE A;  4HBU A;  3RFB A;  4EXO A;  3PBR A;  4KUK A;  3R4K A;  1X0O A;  1D06 A;  2K7S A;  4K0X A;  1W5D A;  4OQH A;  3C30 A;  1CI8 A;  4DE0 A;  2JN7 A;  1BTL A;  3UPN A;  2P08 A;  2JKG A;  3MSH A;  3CG5 A;  3IT9 A;  1H8Z A;  3LUQ A;  4NG2 A;  3KYQ A;  4IVK A;  5FEF A;  3HUM A;  2W0N A;  3V3R A;  4WM9 A;  3M6H A;  1N9L A;  4G3V A;  1HTZ A;  1QMF A;  1ES5 A;  3IS2 B;  4NXB A;  4CJN A;  5GLA A;  2Y2I A;  4IJG A;  5FI2 A;  3M2K A;  5GL9 A;  1BLS A;  4WMC A;  1MWR A;  1WE4 A;  2O9C A;  2Z2L B;  2H0Y A;  1PRQ A;  2Q0O A;  3NC8 A;  2PHY A;  3UMD A;  4EWF A;  3MF0 A;  3WS1 A;  3A3D A;  1W63 Q; 
#chains in the Genus database with same CATH homology
 3C38 A;  5CX7 A;  4EET B;  1T1B A;  2O99 A;  4I3I A;  2VV6 A;  3EEA A;  5IS1 A;  4Q0I A;  4LRX C;  2W3D A;  4BJP A;  2V1B A;  4UQI S;  1IFQ A;  4I3A A;  2W3F A;  4O0P A;  1UWN X;  2OWJ A;  4WEJ A;  3CUE A;  3PBS A;  5KSH A;  2EWW A;  4F3L A;  4GLQ A;  1D7E A;  2L4R A;  3K3C A;  4MN5 A;  1DP8 A;  3KO6 A;  3UB9 A;  3CWF A;  3LR4 A;  3P7N A;  1OT9 A;  3D72 A;  5DF9 A;  1V9Z A;  5KIZ A;  2WKR A;  5HSQ A;  3S7Q A;  2P04 A;  5DKK A;  1EW0 A;  4Q0J A;  3BJN A;  4H6J A;  5F69 A;  1MC0 A;  4E04 A;  3LIF A;  4NKP A;  3V67 A;  1YKD A;  2P7J A;  3T4S A;  3E0Y A;  2GJ3 A;  2LB5 A;  4CLC E;  4OOL A;  4ARZ A;  1OJ5 A;  4ME4 A;  2QWS A;  5G4Z A;  3OLO A;  1V9Y A;  4L0L A;  1YAX A;  3UB8 A;  3TRC A;  2VEA A;  4RQ9 A;  2J3W A;  2VGL M;  4BBV A;  4NXE A;  3DBA A;  4MDZ A;  3T4K A;  2VV7 A;  4EQ1 A;  4WLA A;  2HGV A;  3T4J A;  3MQ0 A;  4JGP A;  3D3O A;  5L8M A;  2B02 A;  4BBU A;  5IT5 A;  4R38 A;  3E4O A;  4P6Z M;  2B18 A;  3IBJ A;  3TJZ C;  3OC2 A;  1S4S A;  1G28 A;  4FSF A;  3PBO A;  3OOV A;  3T50 A;  1S67 L;  1TS6 A;  3BY8 A;  3NHQ A;  3MFX A;  2K2N A;  2VLG A;  5TBM B;  5LBR A;  4WEL A;  3VV4 A;  4GHI A;  2V9A A;  3LID A;  3C8C A;  2JKT M;  5TBM A;  3EQV A;  3ZYT A;  1N9O A;  4EU0 A;  1XJ2 A;  3LYX A;  2XA7 M;  1H3Q A;  4HI4 A;  1TS8 A;  2ZMV A;  5K5B A;  2V0W A;  2Y79 A;  4ZRR A;  4DJ3 A;  4PAU A;  2HV1 A;  4Q0H A;  2CMN A;  3FC7 A;  3FG8 A;  2Z6D A;  4LLO B;  2VJW A;  4Z1W A;  3F1O A;  4ARZ B;  1T18 A;  3S7N A;  1OTD A;  2W1T A;  2DMW A;  4LRZ E;  3TW8 A;  1DP6 A;  3T4O A;  4PKY G;  4ETZ A;  5A8B A;  3A0V A;  2ZBB A;  1JNU A;  1IOU A;  2R78 A;  3GDI A;  4GS9 B;  3G6O A;  4NEE D;  3H82 B;  2D01 A;  3R7W B;  4HHD A;  3LR3 A;  2VKS A;  2QKP A;  2L0W A;  2ZOH A;  1TS7 A;  2NUP C;  3FPW A;  3LI8 A;  2V1A A;  5C5K A;  4GS9 A;  3NJA A;  4UEY A;  2VA0 A;  5HDS A;  2QHK A;  5J3W A;  2O0Y A;  2M7V A;  3LR5 A;  3ICY A;  5DJT A;  2VV8 A;  5HD5 A;  3A0S A;  2EWV A;  2J3T D;  2XA7 S;  1NLY A;  3MXQ A;  4CLC D;  3MQQ A;  4O01 A;  4DJ2 A;  3T4T A;  3KSI A;  2HF6 A;  1UGU A;  2JKR I;  2FH5 A;  5HDD A;  1XFQ A;  2W3H A;  1G6O A;  3LIE A;  3IBR A;  3PHY A;  2IA2 A;  3E98 A;  3HJK A;  4L9G A;  4Y5F A;  5I5L A;  4LRY C;  3RTY A;  2OWH A;  1OTI A;  3GEC A;  2OAQ 1;  4L9E A;  3F1P B;  4L9F A;  4HP9 A;  3NOT C;  3KSF A;  2A24 B;  5HDC A;  5G4Y A;  1KOU A;  1P0Z A;  1LSW A;  3PBT A;  3O5Y A;  4WUJ A;  3UB7 A;  1STZ A;  2W3G A;  4KQO A;  3T4L A;  2INW A;  4JGO A;  4XT2 A;  2GZA A;  3NOU C;  2PD7 A;  3B33 A;  4ETX A;  4MCW A;  5TJJ A;  3CIT A;  1W63 M;  2W1R A;  4Y3I A;  5J7E A;  1XFN A;  5HWW A;  4II7 A;  3K2N A;  4NXG A;  4HNB A;  1S4R A;  4HH3 A;  4R3A A;  4DN0 A;  5DFX A;  2ZMF A;  5HPF A;  1Y28 A;  4UQI M;  4KUO A;  3K3D A;  1ZHH B;  4K08 A;  3H7W A;  3KX0 X;  3MJQ A;  3EGX C;  2PR5 A;  4R6L A;  2I9V A;  5DKL A;  1UWP X;  5AVE A;  3ULF A;  2GNX A;  1F5M A;  3T4Q A;  1NLZ A;  3LFV A;  4LPZ A;  3JVV A;  3UE6 A;  2W3E A;  5J4E A;  1S1Z A;  4EEP A;  4YNR A;  2M1C A;  3CLO A;  4BBT A;  4IUK A;  1T1A A;  4HJ6 A;  1MKM A;  3S7P A;  4KQD A;  2XRO A;  3B42 A;  2YKH A;  2KX6 A;  4OOM A;  4YWZ A;  2PD8 A;  3PR6 A;  4HJ4 A;  4MN7 A;  3VOL A;  3BW6 A;  1P9W A;  2XSS A;  3F1N A;  3W2Z A;  5FL3 A;  4CLC A;  4M4X A;  2L1M A;  2ZOI A;  4HY8 A;  3RH8 B;  5HPI A;  1LL8 A;  2O9B A;  2XRN A;  3UME A;  2QJ5 A;  3BY9 A;  1BYW A;  2OOL A;  5DJU A;  5AVF A;  3KSH A;  3KSG A;  1N9N A;  4QPR A;  4JGR A;  2V0U A;  3R7W A;  1OT6 A;  4WL9 A;  1F9I A;  2A24 A;  5HD3 A;  1YSP A;  4I5S A;  2LB9 A;  4AFI A;  5IU1 A;  3FPV A;  4EW7 A;  4DMZ A;  2VZW A;  4HQA A;  4Y2F A;  4NXF A;  2W1T B;  1XJ6 A;  3KYZ A;  2YKF A;  2HJ9 C;  1DP9 A;  1H8M A;  4CLC C;  3UE3 A;  1OPX A;  3SW1 A;  3EWK A;  1ZTU A;  2JKT I;  1LSV A;  1OTA A;  3EQU A;  1MZU A;  1S66 L;  3HCY A;  1GSW A;  4XT2 B;  4JGQ A;  2VGL S;  5EFW A;  4EEU A;  5HL6 A;  2J80 A;  1VHM A;  5HWT A;  2HJE A;  3F1O B;  4EUV A;  1VB6 A;  2G7U A;  5DFY A;  4B9O A;  2GX5 A;  4MMN A;  4P6Z S;  1NRJ A;  1TD5 A;  1TF1 A;  3BQA A;  4F3L B;  1WA9 A;  3OCN A;  1T1C A;  1OTB A;  4G3W A;  1OTE A;  1XJ3 A;  4CLC B;  3LR0 A;  3CAX A;  1F98 A;  2KLI A;  2Y8H A;  2BAS A;  1S1Y A;  1LSX A;  2M7U A;  2H28 A;  5MC7 A;  2PT7 A;  3EOI A;  3S7O A;  3HJI A;  3LI9 A;  3LIA A;  3EEH A;  3PXP A;  3PBN A;  4PHT A;  3E4Q A;  2QYB A;  1P97 A;  2WKQ A;  2Z6C A;  2K31 A;  3VE3 A;  4IUH A;  4FOF A;  1LT0 A;  3F1N B;  3MR0 A;  3PBQ A;  1P9R A;  2QJ7 A;  4R70 A;  4WN5 A;  4YOF A;  3H9W A;  3CUE C;  3UB6 A;  3BQ8 A;  4HOI A;  4CQH A;  3LIC A;  5AJG A;  4HP4 A;  4B93 A;  3VE4 A;  5F6A A;  4MN6 A;  5HWV A;  2PR6 A;  3H7W B;  1GSX A;  2W27 A;  1T19 A;  3EGD C;  1OJG A;  3RFB A;  4EXO A;  4BWI A;  3PBR A;  4GHI B;  4IHQ A;  4KUK A;  2JHE A;  4GJ4 A;  3R4K A;  1X0O A;  1D06 A;  1TS0 A;  4O8G A;  2J3T C;  2EA9 A;  2K7S A;  3LIB A;  2KDK A;  2VX8 A;  3A0R A;  4I3J A;  3IS2 A;  1YSQ A;  3C30 A;  3OCL A;  2OAP 1;  4G3K A;  3U2A A;  4HIA A;  4GCZ A;  2JN7 A;  3C2W A;  3E4P A;  2NUT C;  2P08 A;  2PYP A;  4I38 A;  3PYP A;  3NOP C;  4PKY A;  3ZQ5 A;  2WKP A;  3OBF A;  1GSV A;  2PDR A;  1NWZ A;  3LUQ A;  5HZH A;  3KYQ A;  4WEK A;  4EES A;  4H6J B;  2D02 A;  3TE8 A;  2W0N A;  4I39 A;  3P01 A;  4WF0 A;  1N9L A;  4G3V A;  4BMW A;  1XJ4 A;  3BWL A;  3B47 A;  3IS2 B;  4EER A;  1DRM A;  4NXB A;  4HJ3 A;  4IJG A;  1ODV A;  2KOI A;  5F68 A;  2FZ0 A;  2A2L A;  2O9C A;  4HH2 A;  2MJ6 A;  3JVU A;  2O9A A;  3CI6 A;  3F1P A;  5F5Y A;  3H82 A;  3MQO A;  2PHY A;  3MMH A;  2JKR M;  2PYR A;  3UMD A;  4GW9 A;  3MF0 A;  1W63 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...