2D01A

Wild type photoactive yellow protein, p65 form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
124
Chain Sequence
b'EHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
molecule tags Signaling protein
source organism Halorhodospira halophila
publication title The Crystal Structure of the R52Q Mutant Demonstrates a Role for R52 in Chromophore pK(a) Regulation in Photoactive Yellow Protein
pubmed doi rcsb
total genus 35
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2d01A00
2JHEA 4I38A 5IU1A 3GDIA 1GSXA 3LIFA 3MQQA 4PKYA 4R70A 4WF0A 5F69A 5HDSA 5KIZA 3F1PB 1T1BA 1XJ3A 3CLOA 3D72A 4JGQA 4RQ9A 1F9IA 5DJTA 2V1AA 4EXOA 2QWSA 3LICA 1F98A 2PD8A 2WKRA 3CAXA 1S4RA 1DP9A 2PR5A 1P97A 5I5LA 1S67L 1T19A 1X0OA 3RTYA 4DJ3A 5HZHA 1LSVA 1XJ2A 1N9NA 4HNBA 5G4YA 3LI9A 1WA9A 3F1OB 1TS8A 2R78A 4NXFA 3K3DA 3C8CA 3H82B 4WLAA 2Z6DA 3B33A 1D7EA 1T1AA 2PYPA 3MQOA 1GSWA 3BWLA 1MZUA 3FG8A 1JNUA 3G6OA 1KOUA 3HJKA 3NHQA 4LLOB 4R3AA 4R38A 1N9LA 1XFQA 2M1CA 5EFWA 1S66L 5HDDA 3UB6A 1Y28A 2KX6A 2L0WA 2OWHA 2QJ5A 2PYRA 3H7WB 3KX0X 4EESA 1UWPX 2VV6A 4EW7A 2ZBBA 2H28A 1V9YA 4B9OA 1S4SA 1OTIA 1GSVA 4BBVA 4E04A 2A24B 2KDKA 2Z6CA 4HH2A 2V9AA 3F1NB 4LRXC 3NOTC 4GCZA 4EEUA 3BY9A 4WL9A 4NXEA 1OTBA 4WUJA 2CMNA 1OJGA 4EEPA 3ZQ5A 2J80A 2D01A 4GHIB 5AVEA 2OWJA 1TS7A 4KQDA 3EEHA 1ODVA 4JGPA 4HJ4A 1DRMA 1OTDA 4HI4A 3BY8A 3VOLA 2V0WA 4I3IA 3CWFA 2V0UA 5TBMB 4GHIA 4BBTA 3MXQA 2VLGA 1XJ6A 2W0NA 3MFXA 2ZOIA 3EWKA 3K3CA 3UMEA 3SW1A 3LYXA 4LRZE 4H6JB 4MN6A 4YWZA 1DP8A 4HP4A 1OT6A 1XFNA 1VB6A 2QHKA 2WKPA 4HOIA 3T50A 5HWTA 4EETB 4R6LA 2B02A 1V9ZA 3H9WA 1TS6A 1EW0A 4MN5A 5HWVA 5TBMA 2WKQA 3E4QA 4PKYG 3MJQA 1G28A 1TS0A 2PR6A 1OT9A 3PYPA 4GS9A 2D02A 4XT2B 4L9EA 4HQAA 3NOPC 4JGRA 4H6JA 2INWA 2V1BA 3E4OA 1D06A 2OOLA 3LIDA 4GW9A 2P7JA 2PD7A 2L4RA 2QKPA 4LRYC 1S1ZA 3UB7A 3P7NA 5F6AA 3FC7A 3MR0A 5F5YA 1P0ZA 2YKFA 3UE6A 4NXGA 3F1NA 3E4PA 5J4EA 4I5SA 1UWNX 2EA9A 3LIAA 3NOUC 4I39A 5DKKA 4JGOA 3OLOA 5IS1A 3RH8B 3ICYA 3UB9A 4I3JA 4I3AA 4HH3A 1LT0A 5F68A 4HIAA 4HP9A 5A8BA 1LL8A 1LSWA 1N9OA 3H82A 2PHYA 1S1YA 1UGUA 3LI8A 5DKLA 1T1CA 2A24A 4EQ1A 2L1MA 4HJ6A 2PDRA 2QJ7A 4HHDA 4K08A 2VEAA 1OTEA 4LPZA 4BBUA 2VV8A 2W27A 4GS9B 5HD3A 4F3LB 2K7SA 5DJUA 3VE4A 2BASA 4L9GA 3IS2A 2HV1A 2I9VA 4HY8A 3LIEA 4KUKA 5HDCA 2ZOHA 1NWZA 4NXBA 1LSXA 3A0RA 3NJAA 1OJ5A 3A0VA 5AVFA 5HD5A 3F1PA 3VE3A 4EERA 5J7EA 4XT2A 5G4ZA 4L9FA 4HJ3A 5HWWA 2YKHA 3A0SA 3LIBA 4M4XA 3IBRA 5J3WA 3H7WA 3ULFA 1T18A 3UMDA 3LUQA 3PHYA 4KUOA 3F1OA 3HJIA 2GJ3A 4WN5A 4F3LA 3GECA 4DJ2A 1BYWA 3C2WA 2VV7A 3UB8A 1OTAA 5HSQA 1DP6A 3IS2B 2JN7A 1XJ4A
chains in the Genus database with same CATH superfamily
4WF0A 4S2OA 3SS5A 3UE0A 2P9VA 3W4PA 3DAVA 1ES5A 1IYPA 1F9IA 1F98A 5FASA 5AQ9A 5KZHA 1H0MA 3N8RA 4CJNA 2JKRI 4GN2A 5E43A 4HNBA 4LENA 1XX2A 4DE2A 5L2FA 2ACGA 1GSWA 4FOFA 4RVAA 1JWPA 1S66L 1WYCA 3S4XA 2QJ5A 2QMIA 3ZG8B 3T4OA 2Y55A 3HUNA 2KDKA 3HUMA 4ZRRA 3NOTC 3BY9A 4O01A 3TSGA 1LI0A 1OJGA 3S7QA 3HLBA 4JGPA 3VOLA 5J8XA 4CLCC 5TBMB 3I7JA 2VLGA 1ZC2A 2EXBA 3B3XA 4PKYG 5E2FA 3PYPA 2E8IA 4U0TA 2INWA 2O99A 2V1BA 2Y4AA 3NULA 3L7HA 3FC7A 3UE6A 3E4PA 4WMCD 3GRJA 3O86A 4UA6A 1F5MA 5F68A 4HP9A 2WKHA 3DW0A 5IHVA 5MC7A 5HPIA 2L1MA 3BW6A 4B4XA 1VM1A 2VV8A 1GHIA 3WWXA 2PU4A 5DTTA 3G34A 2A3UA 3EGXC 1E4DA 5TJJA 1W8YA 3BFCA 2O9CA 4BWIA 1JTDA 3VP2A 4YINA 4Z9QA 1HTZA 3W8KA 3VSLA 3ISGA 1TDGA 4LGWA 2JBFA 3WS2A 4JBFA 4X68A 1MC0A 3CLOA 1RCJA 4R3JA 4KG5A 4OKPA 1DP9A 4MCWA 3VP4A 4Q0HA 3F1OB 1TS8A 5A90A 4D2OA 3ZHHA 4DN0A 4IUKA 3MQOA 1L0GA 3GMWA 5KSCA 5HDDA 1GHMA 3V50A 4GD8A 4LFUA 4CLCA 3P98A 1TVFA 4ETZA 2HDQA 1OTBA 2OWJA 5TGFA 3Q07A 3UMEA 4IUHA 3E2LA 3UO9A 3VFHA 2WKIA 4C75A 5CEDA 1I2SA 3MJQA 1KVLA 3T1QB 3SH7A 3BM6A 3DWZA 1FOFA 5HAPA 1I5QA 1TD5A 4JLFA 3S1YA 1NYMA 4NG2A 4E3IA 1MWRA 5EM1A 1IKGA 2A24A 3HVFA 5AQBA 4WMCA 4E3NA 1J3WA 2X02A 2ZOHA 1LSXA 5CHUA 2EFXA 5J7EA 5A93A 3A0SA 4ID4A 3GECA 5CECA 3PBQA 4P6ZS 4R4RA 3LGOA 4WBGA 3UN7A 4M3KA 1K6SA 3QNBA 1Y4OA 4II7A 4Q8IA 3O5YA 1LSVA 3HL9A 3JVUA 3N4IA 3D4FA 5I5LA 2XSSA 4RX3A 1NZUA 3IF5A 4S2NA 3V3RA 2Y91A 1YLJA 2HDSA 3ZQ5A 2PBYA 3LO7A 1XA1A 4P6ZM 3WRZA 3ITBA 2IWBA 3MXQA 3EWKA 3BFDA 4LV2A 1IEMA 4ETXA 3GSGA 2I72A 2E8JA 1OT6A 1VB6A 4HOIA 5HWTA 3ZG9B 3T1RA 1BZAA 2Y59A 4ZJ2A 3IF6A 1XXMA 2PR6A 2Y2NA 4PM5A 4ZTKA 3T1SA 4OOYA 4XUXA 5K5BA 4Y13A 1P0ZA 2XLNA 1FIKA 3QP4A 1SHVA 1G5UA 4KZ8A 4HH3A 1LT0A 1VEUA 1LSWA 3ZG5A 2EWWA 3CG5A 1YQSA 3MQ0A 4L9GA 2I9VA 3BYDA 1PZOA 1E25A 3OZHA 3WS0A 4WM9A 2Y2KA 2FFFB 4M4XA 3ULFA 1BLHA 5EV0A 3SH8A 3BQAA 1SKOB 4BD1A 1XJ4A 1ZG6A 4PKYA 2HGVA 1MXOA 5FQKA 1T1BA 3CITA 3S22A 4JGQA 3G31A 4DJ3A 4XXRA 5GHZA 3FPWA 3OPPA 2Z6DA 4RYEA 5HZHA 1N9LA 4BLMA 2L0WA 4K0XA 3A3DA 1CF0A 1S4SA 1GSVA 3IWQA 3CI6A 4LCLA 4LV0A 5I94A 4WYYA 4LRXC 4GDBA 2LB9A 1S0WA 3S7OA 2PBDP 4KQDA 4HI4A 2XA7S 3BY8A 3QP6A 1YLWA 3MSHA 2W3EA 4Y17A 3Q7VB 5EVIC 3AGFA 5HWVA 2HZ5A 4O8GA 2Y2IA 3TRCA 5E2HA 1OT9A 1D06A 1S1ZA 2K2NA 4E3MA 1ES3A 3NOUC 3ICYA 5FEGA 2W1TA 1S1YA 4PM9A 1T1CA 2WZXA 5FAQA 2JC7A 3SOIA 2VGLM 4GS9B 2EWVA 3D9YA 4ARZA 3UB5P 2IWDA 2CC1A 1MBLA 3FKWA 1BLPA 3S7NA 3IHAA 4JF6A 4KQQA 5G4ZA 3A3JA 2P74A 4OVDA 5AQAA 3UMDA 3FZCA 3BLMA 2FH5A 1ES4A 3UE1A 4S2MA 3CPTB 2DNSA 1GSXA 5F69A 2OAQ1 2IA2A 1PZPA 3WS4A 3T4TA 1YMSA 4JXVA 4ZAMA 3T1XA 3V39A 4O0PA 4Q0IA 2HP6A 1RP5A 1WA9A 2XROA 4NXFA 1NZOA 3QNCA 1BT5A 3B33A 3MKFA 4PM8A 2UV0E 1KOUA 3IXDA 4LLOB 3MXSA 2M1CA 1PI4A 5GLAA 3H7WB 1DJBA 1OPXA 4DXCA 1GCEA 4BL3A 1HZOA 1GA0A 1W5DA 2FZ0A 2HP9A 5CTNA 5FQJA 1DRMA 3ZCZA 4I3IA 4DE3A 3LR5A 1KE0A 3K3CA 2J3TC 5EVIB 4JF5A 4MBFA 2P08A 4KG6A 3OBFA 4R6LA 2WKQA 3OOVA 4ZBEA 2Y2PA 3LIDA 3IXGA 1PW8A 2OLVA 3G35A 2M7VA 4QB8A 2JKTM 1W63M 2XEPA 1I2WA 5TFQA 1YAXA 3ZG0A 2PHYA 3VP1A 3OPHA 2PDRA 2WKEA 1TF1A 5JYOA 3C4OA 2G2WA 1YSPA 1Z09A 1YLTA 3CPTA 5AVFA 4Z1WA 2Y2JA 4XT2A 3IBRA 3UY6A 4GD6A 4C6YA 3VOZA 2RCXA 1ESIA 1PNEA 3C2WA 3UB8A 1DP6A 3TW8A 2HDUA 2ZC6B 1PRQA 3UNWA 4WELA 3TE8A 5CGWA 3CAXA 2PR5A 5GLDA 1AXBA 4CQHA 5G4YA 1K54C 5HARA 2W1TB 4RA7A 3NHQA 3BWLA 5FQIA 4OP8A 3Q82A 3QHYA 2ZBBA 4EV4A 4G3KA 4IJGA 1L0EA 4D60A 1BTLA 2VKSA 1NLYA 5F83A 3MBZA 2D01A 1PFLA 2BG1A 4P87A 3K2NA 2JKTI 3MFXA 1KVMA 4LRZE 4DE1A 2J7VA 2ZM8A 4X55A 1KE3A 1G28A 4GS9A 4L9EA 4H6JA 2O9AA 4GW9A 1GA9A 3UDIA 3UPOA 2L4RA 3T4SA 4UHUA 5FQ9A 4CPKA 1XKZA 4EETB 4LPZA 4KENB 3KSHA 2J9PA 4N1HA 4HY8A 3LIEA 2MJ6A 5EVEA 4EERA 2PU2A 3R7WA 3S7PA 5HWWA 3KYQA 1S6RA 2GJ3A 1XP4A 1OMEA 3LIFA 4QY5A 2ZJ9A 2DMWA 3D72A 4EXOA 3MFDA 3V3SA 1BLSA 4S2IA 2WKRA 4KZ7A 3C30A 3UDFA 1N9NA 5CERA 5TR7A 3B42A 1IYQA 3H82B 1O07A 3FG8A 4ZJ3A 5GLBA 3NBLA 3KO6A 3PBSA 4S2KA 1K38A 4EW7A 4YNRA 4BJPA 2HPBA 2XA7M 2A24B 2XD1A 4GJ4A 1ODVA 1ES2A 1W8QA 4DMZA 2H10A 4GDNA 1VHMA 3TOIA 3SW1A 3Q1FA 4YWZA 1XA7A 3IT9A 4UQIS 2XFSA 2WGIA 2P7JA 2H5SA 3DTKA 4HEFA 3FWLA 2EA9A 3LIAA 2PAVP 2WADA 3C4PA 4I3AA 5EVLA 3UPPA 1P9WA 3LCEA 4GKUA 5DJUA 1TDLA 1H8YA 4WZ5A 2EFUA 1FCOA 5CGXA 3RFBA 2OLUA 1T18A 4MEZA 4EUVA 1BLCA 1N9BA 2VV7A 4DF6A 3UB7A 5HSQA 2JN7A 2XQZA 5DJTA 2G2UA 3ZVTA 3T12B 5GHYA 3BRMA 2XF3A 1XJ2A 4N1XA 3KSIA 2DRWA 3VSKA 2B18A 4I3JA 5GHXA 4MBHA 4R38A 1CQAA 3PAEA 3DTMA 1UWPX 4GZBA 4G3VA 4G3WA 2Y79A 3IH9A 2ZD8A 3FPVA 2VGKA 3QP8A 2WAFA 1ERMA 1VETA 3HREA 4JKTA 3EEHA 1K57A 4O7DA 2VX8A 4DDSA 4DKIA 4KG2A 2V0UA 1ONGA 2A49A 3LY3A 3LYXA 5DTKA 3HUOA 5HPFA 1XFNA 1F2KA 4ESPA 3JYIA 2B02A 3SH9A 4X53A 4HQAA 3NOPC 3UDXA 2V20A 4ARZB 5M19A 4P0MA 2M7UA 4Y2FA 4GLQA 4OH0A 3A3IA 4F94A 3F1NA 1UWNX 3OLOA 3UE3A 3UB9A 4Y0UA 3T4JA 5FI2A 2WAEA 1YLPA 1N4OA 4HJ6A 1FSWA 2ZC5B 4K08A 4U3TA 4IVKA 4CLCE 1W7FA 3CHWP 4LCMA 5M1AA 4S2PA 4F3LA 1O7EA 1NXYA 3IX8A 2O9BA 5CHMA 1MWTA 3CJMA 3MQQA 4R70A 2Y2HA 1BUEA 3F1PB 1K6RA 3EOIA 5EVIA 3LICA 1LL9A 4FH4A 1P97A 3ZVWA 1X0OA 4KZ5A 1MPLA 1YSQA 3C8CA 3SS3A 2ZL1B 2WUQA 1OTIA 2EXAA 2HDRA 4PM6A 5HL6A 2V9AA 2Y2GA 4GCZA 3A3EA 2J80A 1Q2PA 1Z6FA 2GDNA 1SKOA 4N9KA 4BBTA 4Y15A 2ZMFA 2GNXA 1NY0A 3BECA 4X56A 4Y3IA 4HP4A 1D1JA 2ZMAA 1GHPA 3OPRA 4Y7PA 2H0YA 4LV1A 5BOHA 5DVAA 3N6IA 4LRYC 5J4EA 1K25A 5DKKA 4JGOA 4YOFA 1M40A 3LR3A 5A8BA 1J9MA 3NY4A 4OOMA 2QPNA 4AFIA 3BFEA 1FCMA 2K31A 3A0RA 2VGJA 3F1PA 3AGEA 3EGDC 2OAP1 4R3BA 5J3WA 1FILA 1IKIA 1LHYA 4KZ3A 4WN5A 3F1OA 2IWCA 3E2KA 4ZDXA 2BTFP 3N8SA 2JHEA 1K57C 3NI9A 4C3QA 4DXBA 2ZQ8A 3JPUA 4E6XA 1Q2QA 3RTYA 2FFYA 3FV7A 1ALQA 3C7UA 4N9LA 3K3DA 5A92A 1XPBA 5EVID 1D7EA 4E3LA 1JNUA 4MLLA 5HDCA 4E3JA 3UPNA 1K55C 1Y28A 3RJUA 2ZMVA 4R23A 3MF0A 3DBAA 3MZFA 4X6TA 3IHBA 1Y54A 4KQRA 3E0YA 5AVEA 3G2ZA 4HJ4A 1YMXA 2HJEA 5EOEA 5HAIA 2ZOIA 3VP3A 4GOGA 3IWOA 3IX4A 5EM0A 1KDSA 3OCNA 5L07A 3CUEC 3Q7VA 2Q0OA 3HLDA 3QP5A 3N8LA 2PD7A 4H8RA 5F5YA 2V8CA 3KSGA 5FEFA 1ONHA 3MZEA 5DTSA 2W3DA 4P85A 4BBUA 3RXWA 3VE4A 2W3FA 5IT5A 2H0TA 3BLSA 2HV1A 3QP2A 3LEQA 3G2YA 2QYBA 4HJ3A 3T4KA 4XUZA 3IF6B 2ZQAA 4B9OA 2VA0A 5HAQA 3O3VA 2XDMA 3HLEA 3OPLA 4OONA 2XRNA 4QPRA 5KMWA 4QD4A 4E3OA 1T19A 2Y8HA 5FQMA 4K0WA 1CEFA 1NYYA 1FR1A 4JXWA 5EOOA 5FSRA 2PYPA 3C38A 1MZUA 1LI9A 4PHTA 4R3AA 3LEZA 4BMWA 1XFQA 2Y2QA 2KX6A 2EX6A 5EPHA 5CXWA 2H28A 2G7UA 4E04A 1FR6A 3AGDA 2Z6CA 3HBRA 5FI6A 1H3QA 3GTCA 1EROA 3T4LA 3EQVA 3KYEA 1TS7A 4HBUA 4PAUA 3PBTA 5HL1A 4GHIA 3PAGA 2W3GA 5AJGA 2VJWA 3O87A 2ZL1A 3HLCA 3EEAA 1G68A 2QHKA 3ZGAB 3Q81A 5DF7A 1V9ZA 1EW0A 1PIOA 3E4QA 3GR2A 1HLUP 2D02A 3R4KA 3ZNYA 2QKPA 4OPRA 3P7NA 2KOIA 4MNRA 3RH8B 1W79A 3H82A 4IHQA 2NUPC 1OTEA 5FATA 1YM1A 4F3LB 3LR0A 1YLZA 2K7SA 1DJCA 4QWOA 3NJAA 1OJ5A 4L9FA 3HLWA 4QHCA 1FQGA 1K56D 4UA7A 1OTAA 2AVXA 4CLCD 3NDEA 1CEGA 2DCFA 1YKDA 3VV4A 3NDGA 2V1AA 2QWSA 2A2LA 1HD8A 1ERQA 2J8YA 1NLZA 4K91A 2JE5A 3NIAA 3BEBA 4CLCB 1T1AA 2NUTC 4WZ5C 4PPRA 2C5WB 2OWHA 3DWKA 1VETB 4EESA 3P01A 1KDWA 4GNUA 2UWXA 4BBVA 4BQMA 4Y0OA 2ZQDA 3E98A 1MKIA 2W1RA 2P9VB 4WUJA 3W2ZA 1L0DA 1L3LA 1KGGA 3CWFA 5E2GA 4S2NC 4NETA 2WKPA 3T50A 1PWDA 1MWUA 1TS6A 3IF6C 4L0LA 1TS0A 2O0YA 2WGVA 2J3TD 4OQGA 3MR0A 4EBPA 4IVIA 1N9OA 2XR0A 2W27A 2B95A 3ZYTA 1WYBA 1AWIA 2BASA 4S2JA 2Y2OA 4QU3A 3ZNTA 4FTXA 1IOUA 1NRJA 1K4EA 1PWCA 2Z2MB 5CGSA 3PHYA 1L0FA 2ZC7A 3DTEA 4DE0A 4OP5A 3LY4A 3IS2B 3MZDA 4BENA 4RQ9A 1IELA 3GQZA 4KQOA 5CX7A 1L2SA 5F82A 3TJZC 4Y0TA 5F1GA 2W3HA 4R1GA 4JXGA 2V2FF 1VQQA 3V67A 1K55A 4IEDA 4KZ6A 1EI5A 2PYRA 3HCYA 3FYZA 1V9YA 2ZQ9A 4EBNA 3NCKA 2WGWB 3A3FA 3PBRA 3F1NB 4WL9A 4NXEA 4OQHA 4EEPA 3GV9A 1CK3A 3IH8A 1OTDA 3BQ8A 3LFVA 1H8ZA 4P6BA 1JWZA 3WS5A 1CI9A 1XJ6A 1IYOA 1G6AA 1QMEA 2Z2LB 1NJ4A 4EBLA 3H9WA 1XGJA 5LBRA 5TBMA 4EU0A 4A5RA 1KE4A 1WE4A 4LV3A 3U4LP 4E3KA 5G18A 2YKFA 4NKPA 5FL3A 4OLGA 5DKLA 1LLBA 2QJ7A 4HHDA 2RL3A 2VEAA 5D3OA 3IQAA 2XD5A 3IS2A 4KUKA 4NXBA 5AQ7A 5FI7A 5FQQA 5F1FA 5HD5A 5CEBA 1SCWA 5GL9A 3LUQA 3HJIA 1DJAA 4DJ2A 2HP5A 1SDNA 1SZVA 2XK1A 1E3UA 3M6BA 4I38A 2PT7A 5IU1A 2EX2A 3IBJA 5KIZA 4N92A 2Q9NA 3TG9A 1CJFA 1S4RA 2X71A 2WK0A 4BD0A 3VMAA 4IBXA 4OPYA 3RXXA 2XH9A 3LI9A 4KZ9A 2B5RA 1ZKJA 3G6OA 1A0KA 3HJKA 5L09A 2J3WA 1JWVA 5DF8A 3UB6A 3WS1A 4JF4A 3OCLA 2OSUA 3IX3A 4NK3A 1G6OA 3OC2A 4MDZA 1MWSA 2J9OA 2V1ZA 3U2AA 1K0KA 2Y2LA 1VEUB 2W0NA 3KYZA 1JVJA 1MY8A 4UAAA 4KZ4A 3IWIA 4IBRA 4KZBA 4MBKA 1XGIA 3CZDA 4E6WA 4JGRA 3E4OA 4FCFA 1H5XA 3PBOA 1TEMA 4EWFA 4RX2A 4Y5FA 4I39A 5HX9A 4QY6A 1LL5A 1LL8A 5KSHA 1ZTUA 4EQ1A 3CMZA 5M18A 5HD3A 3IXHA 4KZAA 4YFMA 5FDHA 2GX5A 1YT4A 4UA9A 4FD8A 2X01A 1PYYA 3LIBA 5GLCA 1IFQA 2BLSA 3WRTA 3N7WA 2OV5A 3BJNA 5EUAA 3V5MA 3PR6A 3SS4A 3O88A 1FCNA 3KSFA 4HESA 5DFXA 5HDSA 3JVVA 3ZDJA 1W63Q 3L9KA 1XJ3A 2PD8A 2WYXA 4DDYA 1S67L 5L10A 2JKRM 3M2JA 3R7WB 3LR4A 3CUEA 1K54A 2R78A 2EX8A 4OQIA 4WLAA 3Q7ZA 2WZZA 4WEJA 5FAPA 2JKGA 1M6KA 5EFWA 4WZ4A 3P09A 2EX9A 5FA7A 1BSGA 2ZM2A 4HH2A 5CTMA 4U0XA 2LB5A 4EEUA 5JYPA 4GHIB 2WGWA 2V0WA 3M6HA 5L8MA 5U47A 4MMNA 4MN5A 1CI8A 2ZC3B 2Q9MA 5A91A 5DF9A 2R9WA 1IYSA 4GB7A 4PM7A 4FSFA 1RGZA 1DY6A 2QZ6A 4OPZA 2JCHA 2OOLA 1SDEA 1MKMA 5F6AA 2C6WB 3D3OA 3PBNA 4NXGA 3C7VA 4I5SA 5IS1A 2HJ9C 3VOYA 3T4QA 2XFTA 2V8FA 3HLFA 1UGUA 1ZG4A 1QMFA 3FKVA 1SKFA 4PMAA 4ZJ1A 3EQUA 4FUWA 3PXPA 3A0VA 4UQIM 1KGEA 3VE3A 4JXSA 2YKHA 3PTEA 3H7WA 2VK3A 3BFFA 4EQIA 4WEKA 1BYWA 3GDIA 1PI5A 3MMHA 3ZFZA 4OLDA 3BFGA 1JTGA 2HF6A 1YLYA 3ITAA 2VGLS 3VP0A 3MS6A 2ZC4B 4S2LA 1FSYA 4NEED 4OOLA 5HW3A 1RGYA 4OQ0A 1U60A 3W4OA 4ME4A 2ZLYA 1PWGA 4HBTA 4B88A 4B4ZA 3ZG7B 3KX0X 2VV6A 4Q0JA 1E3UD 3G32A 4R4SA 5HFOA 3DTIA 1YPRA 1KGFA 2ZQ7A 4EUZA 2CMNA 1STZA 1NRFA 3NECA 5DFYA 2R9XA 4OPQA 1ACFA 3SZTA 4H6JB 4MN6A 2P04A 4X1MA 1K4FA 3HLGA 1DP8A 5EE8A 5FDSA 4MN7A 1ZHHB 3C5AA 4BL2A 3NC8A 1PW1A 4XT2B 4QJGA 3G30A 1H8MA 1BULA 2PRFA 2Y2MA 4DRTA 5CHJA 4X69A 2KLIA 2VZWA 1HVBA 4HIAA 2JKFA 1ESUA 3W4QA 3LI8A 3G4PA 3MKEA 4B93A 3GVBA 2ZM0A 2XGNA 4JPMA 4X1LA 1NWZA 1P9RA 4UEYA 4X25A 2ZQCA 5CRFA 2GZAA 4FH2A 4R0QA 1K56A 3MXRA 4KUOA 5E2EA 5EECA 3QP1A 3IXBA 3VFFA 1EWZA 5FAOA 5C5KA 3M2KA 3B47A 1C3BA
chains in the Genus database with same CATH topology
1GSXA 3MQQA 4R70A 4WF0A 5F69A 2OAQ1 2IA2A 3F1PB 4RQ9A 3EOIA 1F9IA 3T4TA 3LICA 1F98A 4KQOA 1P97A 5CX7A 2JKRI 3TJZC 1X0OA 4O0PA 4Q0IA 2W3HA 4HNBA 1WA9A 2XROA 4NXFA 1YSQA 3C8CA 3B33A 1GSWA 4FOFA 3V67A 1KOUA 4LLOB 2M1CA 1S66L 2QJ5A 3H7WB 2PYRA 3HCYA 1OPXA 3T4OA 1V9YA 1OTIA 5HL6A 2KDKA 2V9AA 3PBRA 3F1NB 4ZRRA 3NOTC 4GCZA 3BY9A 4O01A 4NXEA 2FZ0A 4WL9A 1OJGA 4EEPA 2J80A 3S7QA 4JGPA 1DRMA 1OTDA 3VOLA 3BQ8A 3LFVA 4I3IA 4CLCC 5TBMB 4BBTA 3LR5A 2VLGA 1XJ6A 3K3CA 2ZMFA 2GNXA 2J3TC 2P08A 4Y3IA 4HP4A 3OBFA 4R6LA 3H9WA 5LBRA 5TBMA 2WKQA 4PKYG 4EU0A 3OOVA 3PYPA 2INWA 2O99A 2V1BA 3LIDA 4LRYC 3FC7A 3UE6A 2M7VA 2YKFA 4NKPA 5FL3A 5J4EA 3E4PA 5DKKA 4JGOA 2JKTM 4YOFA 1W63M 1F5MA 3LR3A 5F68A 4HP9A 5A8BA 1YAXA 2PHYA 5MC7A 5DKLA 5HPIA 2L1MA 3BW6A 2PDRA 2QJ7A 4HHDA 4OOMA 2VEAA 2VV8A 1TF1A 1YSPA 4AFIA 3IS2A 4KUKA 3EGXC 2K31A 4NXBA 5AVFA 3A0RA 5HD5A 4Z1WA 5TJJA 3F1PA 2O9CA 2OAP1 3EGDC 4XT2A 4BWIA 5J3WA 3IBRA 3LUQA 4WN5A 3F1OA 3HJIA 4DJ2A 3C2WA 3UB8A 1DP6A 2JHEA 4I38A 2PT7A 5IU1A 3TW8A 3IBJA 5KIZA 1MC0A 3CLOA 4WELA 3TE8A 3CAXA 1S4RA 1DP9A 2PR5A 4MCWA 3RTYA 4CQHA 5G4YA 3LI9A 4Q0HA 3F1OB 1TS8A 3K3DA 2W1TB 4DN0A 4IUKA 1D7EA 3MQOA 3NHQA 3BWLA 3G6OA 3HJKA 1JNUA 5HDCA 2J3WA 3UB6A 5HDDA 1Y28A 4CLCA 2ZMVA 2ZBBA 4ETZA 3OCLA 4G3KA 4IJGA 3MF0A 3DBAA 1G6OA 3OC2A 2VKSA 1NLYA 4MDZA 1OTBA 3E0YA 2D01A 5AVEA 2OWJA 4HJ4A 3U2AA 2HJEA 3K2NA 2JKTI 2W0NA 3MFXA 2ZOIA 3UMEA 3KYZA 4LRZE 4IUHA 3OCNA 3MJQA 1G28A 3CUEC 4GS9A 4L9EA 4JGRA 4H6JA 2O9AA 3E4OA 3PBOA 4GW9A 2PD7A 1TD5A 2L4RA 5F5YA 3KSGA 4Y5FA 3T4SA 4I39A 1LL8A 2W3DA 5KSHA 2A24A 1ZTUA 4EQ1A 4BBUA 4EETB 4LPZA 5HD3A 3KSHA 3VE4A 2W3FA 5IT5A 4HY8A 2HV1A 3LIEA 2MJ6A 2ZOHA 2GX5A 1LSXA 4EERA 5J7EA 2QYBA 3S7PA 3R7WA 4HJ3A 5HWWA 3A0SA 3LIBA 1IFQA 3KYQA 3T4KA 2GJ3A 3BJNA 3GECA 3PBQA 3PR6A 4P6ZS 4B9OA 2VA0A 3KSFA 3LIFA 5DFXA 5HDSA 2DMWA 3JVVA 1W63Q 3D72A 1XJ3A 4EXOA 2XRNA 4QPRA 2PD8A 2WKRA 3C30A 4II7A 1S67L 2JKRM 1T19A 3R7WB 3LR4A 3CUEA 3O5YA 1LSVA 2Y8HA 3JVUA 1N9NA 2R78A 3B42A 3H82B 4WLAA 4WEJA 2PYPA 3C38A 1MZUA 3FG8A 5I5LA 2XSSA 4PHTA 4R3AA 4BMWA 1XFQA 5EFWA 3PBSA 3KO6A 2KX6A 4EW7A 2H28A 4YNRA 4BJPA 2XA7M 2G7UA 4E04A 2A24B 4HH2A 2Z6CA 2LB5A 1H3QA 4EEUA 4GJ4A 3ZQ5A 4GHIB 3T4LA 3EQVA 1TS7A 4PAUA 1ODVA 3PBTA 4P6ZM 2V0WA 4DMZA 4GHIA 3MXQA 5AJGA 2W3GA 3EWKA 4ETXA 2VJWA 1VHMA 3SW1A 4YWZA 5L8MA 4MMNA 3EEAA 1OT6A 1VB6A 2QHKA 4HOIA 5HWTA 1V9ZA 4MN5A 1EW0A 3E4QA 5DF9A 2PR6A 2D02A 3R4KA 4FSFA 4UQIS 2OOLA 5K5BA 2P7JA 2QKPA 1MKMA 3P7NA 5F6AA 3D3OA 1P0ZA 3PBNA 4NXGA 4I5SA 3LIAA 2EA9A 2HJ9C 5IS1A 2KOIA 3RH8B 3T4QA 4I3AA 4HH3A 1LT0A 1LSWA 3H82A 4IHQA 1UGUA 1P9WA 2NUPC 1OTEA 4F3LB 2EWWA 3LR0A 2K7SA 5DJUA 3MQ0A 4L9GA 2I9VA 3EQUA 3NJAA 3PXPA 1OJ5A 3A0VA 4UQIM 3VE3A 4L9FA 3RFBA 2YKHA 4M4XA 3H7WA 3ULFA 1T18A 4WEKA 3BQAA 4EUVA 1BYWA 2VV7A 1OTAA 3UB7A 5HSQA 2JN7A 1XJ4A 4CLCD 3GDIA 4PKYA 2HGVA 3MMHA 1YKDA 1T1BA 3CITA 3VV4A 4JGQA 5DJTA 2V1AA 2QWSA 2A2LA 2HF6A 4DJ3A 2VGLS 1NLZA 1XJ2A 3KSIA 4NEED 3FPWA 4OOLA 2Z6DA 2B18A 4CLCB 1T1AA 4I3JA 5HZHA 2NUTC 4ME4A 4R38A 1N9LA 2L0WA 2OWHA 3KX0X 4EESA 1UWPX 2VV6A 4Q0JA 4G3VA 4G3WA 2Y79A 3P01A 1S4SA 1GSVA 4BBVA 3CI6A 3FPVA 3E98A 2W1RA 4LRXC 2LB9A 4WUJA 2CMNA 3S7OA 1STZA 3W2ZA 4KQDA 3EEHA 2VX8A 4HI4A 2XA7S 3BY8A 3CWFA 2V0UA 5DFYA 2W3EA 3LYXA 4H6JB 4MN6A 5HPFA 2P04A 1DP8A 2WKPA 1XFNA 3T50A 5HWVA 2B02A 4O8GA 1TS6A 4L0LA 1ZHHB 4MN7A 3TRCA 1TS0A 4XT2B 1OT9A 4HQAA 3NOPC 4ARZB 2O0YA 1H8MA 1D06A 2M7UA 4Y2FA 4GLQA 2J3TD 1S1ZA 3MR0A 2K2NA 3F1NA 1UWNX 2KLIA 2VZWA 3NOUC 3OLOA 3UE3A 3ICYA 3UB9A 4HIAA 3T4JA 2W1TA 1N9OA 1S1YA 3LI8A 1T1CA 4HJ6A 4K08A 2W27A 2VGLM 4GS9B 4B93A 2EWVA 3ZYTA 4ARZA 2BASA 4CLCE 1NWZA 1P9RA 4UEYA 3S7NA 1IOUA 5G4ZA 2GZAA 3UMDA 1NRJA 3PHYA 4KUOA 4F3LA 2FH5A 2O9BA 5C5KA 3B47A 3IS2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JHE A;  4I38 A;  5IU1 A;  3GDI A;  1GSX A;  3LIF A;  3MQQ A;  4PKY A;  4R70 A;  4WF0 A;  5F69 A;  5HDS A;  5KIZ A;  3F1P B;  1T1B A;  1XJ3 A;  3CLO A;  3D72 A;  4JGQ A;  4RQ9 A;  1F9I A;  5DJT A;  2V1A A;  4EXO A;  2QWS A;  3LIC A;  1F98 A;  2PD8 A;  2WKR A;  3CAX A;  1S4R A;  1DP9 A;  2PR5 A;  1P97 A;  5I5L A;  1S67 L;  1T19 A;  1X0O A;  3RTY A;  4DJ3 A;  5HZH A;  1LSV A;  1XJ2 A;  1N9N A;  4HNB A;  5G4Y A;  3LI9 A;  1WA9 A;  3F1O B;  1TS8 A;  2R78 A;  4NXF A;  3K3D A;  3C8C A;  3H82 B;  4WLA A;  2Z6D A;  3B33 A;  1D7E A;  1T1A A;  2PYP A;  3MQO A;  1GSW A;  3BWL A;  1MZU A;  3FG8 A;  1JNU A;  3G6O A;  1KOU A;  3HJK A;  3NHQ A;  4LLO B;  4R3A A;  4R38 A;  1N9L A;  1XFQ A;  2M1C A;  5EFW A;  1S66 L;  5HDD A;  3UB6 A;  1Y28 A;  2KX6 A;  2L0W A;  2OWH A;  2QJ5 A;  2PYR A;  3H7W B;  3KX0 X;  4EES A;  1UWP X;  2VV6 A;  4EW7 A;  2ZBB A;  2H28 A;  1V9Y A;  4B9O A;  1S4S A;  1OTI A;  1GSV A;  4BBV A;  4E04 A;  2A24 B;  2KDK A;  2Z6C A;  4HH2 A;  2V9A A;  3F1N B;  4LRX C;  3NOT C;  4GCZ A;  4EEU A;  3BY9 A;  4WL9 A;  4NXE A;  1OTB A;  4WUJ A;  2CMN A;  1OJG A;  4EEP A;  3ZQ5 A;  2J80 A;  2D01 A;  4GHI B;  5AVE A;  2OWJ A;  1TS7 A;  4KQD A;  3EEH A;  1ODV A;  4JGP A;  4HJ4 A;  1DRM A;  1OTD A;  4HI4 A;  3BY8 A;  3VOL A;  2V0W A;  4I3I A;  3CWF A;  2V0U A;  5TBM B;  4GHI A;  4BBT A;  3MXQ A;  2VLG A;  1XJ6 A;  2W0N A;  3MFX A;  2ZOI A;  3EWK A;  3K3C A;  3UME A;  3SW1 A;  3LYX A;  4LRZ E;  4H6J B;  4MN6 A;  4YWZ A;  1DP8 A;  4HP4 A;  1OT6 A;  1XFN A;  1VB6 A;  2QHK A;  2WKP A;  4HOI A;  3T50 A;  5HWT A;  4EET B;  4R6L A;  2B02 A;  1V9Z A;  3H9W A;  1TS6 A;  1EW0 A;  4MN5 A;  5HWV A;  5TBM A;  2WKQ A;  3E4Q A;  4PKY G;  3MJQ A;  1G28 A;  1TS0 A;  2PR6 A;  1OT9 A;  3PYP A;  4GS9 A;  2D02 A;  4XT2 B;  4L9E A;  4HQA A;  3NOP C;  4JGR A;  4H6J A;  2INW A;  2V1B A;  3E4O A;  1D06 A;  2OOL A;  3LID A;  4GW9 A;  2P7J A;  2PD7 A;  2L4R A;  2QKP A;  4LRY C;  1S1Z A;  3UB7 A;  3P7N A;  5F6A A;  3FC7 A;  3MR0 A;  5F5Y A;  1P0Z A;  2YKF A;  3UE6 A;  4NXG A;  3F1N A;  3E4P A;  5J4E A;  4I5S A;  1UWN X;  2EA9 A;  3LIA A;  3NOU C;  4I39 A;  5DKK A;  4JGO A;  3OLO A;  5IS1 A;  3RH8 B;  3ICY A;  3UB9 A;  4I3J A;  4I3A A;  4HH3 A;  1LT0 A;  5F68 A;  4HIA A;  4HP9 A;  5A8B A;  1LL8 A;  1LSW A;  1N9O A;  3H82 A;  2PHY A;  1S1Y A;  1UGU A;  3LI8 A;  5DKL A;  1T1C A;  2A24 A;  4EQ1 A;  2L1M A;  4HJ6 A;  2PDR A;  2QJ7 A;  4HHD A;  4K08 A;  2VEA A;  1OTE A;  4LPZ A;  4BBU A;  2VV8 A;  2W27 A;  4GS9 B;  5HD3 A;  4F3L B;  2K7S A;  5DJU A;  3VE4 A;  2BAS A;  4L9G A;  3IS2 A;  2HV1 A;  2I9V A;  4HY8 A;  3LIE A;  4KUK A;  5HDC A;  2ZOH A;  1NWZ A;  4NXB A;  1LSX A;  3A0R A;  3NJA A;  1OJ5 A;  3A0V A;  5AVF A;  5HD5 A;  3F1P A;  3VE3 A;  4EER A;  5J7E A;  4XT2 A;  5G4Z A;  4L9F A;  4HJ3 A;  5HWW A;  2YKH A;  3A0S A;  3LIB A;  4M4X A;  3IBR A;  5J3W A;  3H7W A;  3ULF A;  1T18 A;  3UMD A;  3LUQ A;  3PHY A;  4KUO A;  3F1O A;  3HJI A;  2GJ3 A;  4WN5 A;  4F3L A;  3GEC A;  4DJ2 A;  1BYW A;  3C2W A;  2VV7 A;  3UB8 A;  1OTA A;  5HSQ A;  1DP6 A;  3IS2 B;  2JN7 A;  1XJ4 A; 
#chains in the Genus database with same CATH topology
 4WF0 A;  4S2O A;  3SS5 A;  3UE0 A;  2P9V A;  3W4P A;  3DAV A;  1ES5 A;  1IYP A;  1F9I A;  1F98 A;  5FAS A;  5AQ9 A;  5KZH A;  1H0M A;  3N8R A;  4CJN A;  2JKR I;  4GN2 A;  5E43 A;  4HNB A;  4LEN A;  1XX2 A;  4DE2 A;  5L2F A;  2ACG A;  1GSW A;  4FOF A;  4RVA A;  1JWP A;  1S66 L;  1WYC A;  3S4X A;  2QJ5 A;  2QMI A;  3ZG8 B;  3T4O A;  2Y55 A;  3HUN A;  2KDK A;  3HUM A;  4ZRR A;  3NOT C;  3BY9 A;  4O01 A;  3TSG A;  1LI0 A;  1OJG A;  3S7Q A;  3HLB A;  4JGP A;  3VOL A;  5J8X A;  4CLC C;  5TBM B;  3I7J A;  2VLG A;  1ZC2 A;  2EXB A;  3B3X A;  4PKY G;  5E2F A;  3PYP A;  2E8I A;  4U0T A;  2INW A;  2O99 A;  2V1B A;  2Y4A A;  3NUL A;  3L7H A;  3FC7 A;  3UE6 A;  3E4P A;  4WMC D;  3GRJ A;  3O86 A;  4UA6 A;  1F5M A;  5F68 A;  4HP9 A;  2WKH A;  3DW0 A;  5IHV A;  5MC7 A;  5HPI A;  2L1M A;  3BW6 A;  4B4X A;  1VM1 A;  2VV8 A;  1GHI A;  3WWX A;  2PU4 A;  5DTT A;  3G34 A;  2A3U A;  3EGX C;  1E4D A;  5TJJ A;  1W8Y A;  3BFC A;  2O9C A;  4BWI A;  1JTD A;  3VP2 A;  4YIN A;  4Z9Q A;  1HTZ A;  3W8K A;  3VSL A;  3ISG A;  1TDG A;  4LGW A;  2JBF A;  3WS2 A;  4JBF A;  4X68 A;  1MC0 A;  3CLO A;  1RCJ A;  4R3J A;  4KG5 A;  4OKP A;  1DP9 A;  4MCW A;  3VP4 A;  4Q0H A;  3F1O B;  1TS8 A;  5A90 A;  4D2O A;  3ZHH A;  4DN0 A;  4IUK A;  3MQO A;  1L0G A;  3GMW A;  5KSC A;  5HDD A;  1GHM A;  3V50 A;  4GD8 A;  4LFU A;  4CLC A;  3P98 A;  1TVF A;  4ETZ A;  2HDQ A;  1OTB A;  2OWJ A;  5TGF A;  3Q07 A;  3UME A;  4IUH A;  3E2L A;  3UO9 A;  3VFH A;  2WKI A;  4C75 A;  5CED A;  1I2S A;  3MJQ A;  1KVL A;  3T1Q B;  3SH7 A;  3BM6 A;  3DWZ A;  1FOF A;  5HAP A;  1I5Q A;  1TD5 A;  4JLF A;  3S1Y A;  1NYM A;  4NG2 A;  4E3I A;  1MWR A;  5EM1 A;  1IKG A;  2A24 A;  3HVF A;  5AQB A;  4WMC A;  4E3N A;  1J3W A;  2X02 A;  2ZOH A;  1LSX A;  5CHU A;  2EFX A;  5J7E A;  5A93 A;  3A0S A;  4ID4 A;  3GEC A;  5CEC A;  3PBQ A;  4P6Z S;  4R4R A;  3LGO A;  4WBG A;  3UN7 A;  4M3K A;  1K6S A;  3QNB A;  1Y4O A;  4II7 A;  4Q8I A;  3O5Y A;  1LSV A;  3HL9 A;  3JVU A;  3N4I A;  3D4F A;  5I5L A;  2XSS A;  4RX3 A;  1NZU A;  3IF5 A;  4S2N A;  3V3R A;  2Y91 A;  1YLJ A;  2HDS A;  3ZQ5 A;  2PBY A;  3LO7 A;  1XA1 A;  4P6Z M;  3WRZ A;  3ITB A;  2IWB A;  3MXQ A;  3EWK A;  3BFD A;  4LV2 A;  1IEM A;  4ETX A;  3GSG A;  2I72 A;  2E8J A;  1OT6 A;  1VB6 A;  4HOI A;  5HWT A;  3ZG9 B;  3T1R A;  1BZA A;  2Y59 A;  4ZJ2 A;  3IF6 A;  1XXM A;  2PR6 A;  2Y2N A;  4PM5 A;  4ZTK A;  3T1S A;  4OOY A;  4XUX A;  5K5B A;  4Y13 A;  1P0Z A;  2XLN A;  1FIK A;  3QP4 A;  1SHV A;  1G5U A;  4KZ8 A;  4HH3 A;  1LT0 A;  1VEU A;  1LSW A;  3ZG5 A;  2EWW A;  3CG5 A;  1YQS A;  3MQ0 A;  4L9G A;  2I9V A;  3BYD A;  1PZO A;  1E25 A;  3OZH A;  3WS0 A;  4WM9 A;  2Y2K A;  2FFF B;  4M4X A;  3ULF A;  1BLH A;  5EV0 A;  3SH8 A;  3BQA A;  1SKO B;  4BD1 A;  1XJ4 A;  1ZG6 A;  4PKY A;  2HGV A;  1MXO A;  5FQK A;  1T1B A;  3CIT A;  3S22 A;  4JGQ A;  3G31 A;  4DJ3 A;  4XXR A;  5GHZ A;  3FPW A;  3OPP A;  2Z6D A;  4RYE A;  5HZH A;  1N9L A;  4BLM A;  2L0W A;  4K0X A;  3A3D A;  1CF0 A;  1S4S A;  1GSV A;  3IWQ A;  3CI6 A;  4LCL A;  4LV0 A;  5I94 A;  4WYY A;  4LRX C;  4GDB A;  2LB9 A;  1S0W A;  3S7O A;  2PBD P;  4KQD A;  4HI4 A;  2XA7 S;  3BY8 A;  3QP6 A;  1YLW A;  3MSH A;  2W3E A;  4Y17 A;  3Q7V B;  5EVI C;  3AGF A;  5HWV A;  2HZ5 A;  4O8G A;  2Y2I A;  3TRC A;  5E2H A;  1OT9 A;  1D06 A;  1S1Z A;  2K2N A;  4E3M A;  1ES3 A;  3NOU C;  3ICY A;  5FEG A;  2W1T A;  1S1Y A;  4PM9 A;  1T1C A;  2WZX A;  5FAQ A;  2JC7 A;  3SOI A;  2VGL M;  4GS9 B;  2EWV A;  3D9Y A;  4ARZ A;  3UB5 P;  2IWD A;  2CC1 A;  1MBL A;  3FKW A;  1BLP A;  3S7N A;  3IHA A;  4JF6 A;  4KQQ A;  5G4Z A;  3A3J A;  2P74 A;  4OVD A;  5AQA A;  3UMD A;  3FZC A;  3BLM A;  2FH5 A;  1ES4 A;  3UE1 A;  4S2M A;  3CPT B;  2DNS A;  1GSX A;  5F69 A;  2OAQ 1;  2IA2 A;  1PZP A;  3WS4 A;  3T4T A;  1YMS A;  4JXV A;  4ZAM A;  3T1X A;  3V39 A;  4O0P A;  4Q0I A;  2HP6 A;  1RP5 A;  1WA9 A;  2XRO A;  4NXF A;  1NZO A;  3QNC A;  1BT5 A;  3B33 A;  3MKF A;  4PM8 A;  2UV0 E;  1KOU A;  3IXD A;  4LLO B;  3MXS A;  2M1C A;  1PI4 A;  5GLA A;  3H7W B;  1DJB A;  1OPX A;  4DXC A;  1GCE A;  4BL3 A;  1HZO A;  1GA0 A;  1W5D A;  2FZ0 A;  2HP9 A;  5CTN A;  5FQJ A;  1DRM A;  3ZCZ A;  4I3I A;  4DE3 A;  3LR5 A;  1KE0 A;  3K3C A;  2J3T C;  5EVI B;  4JF5 A;  4MBF A;  2P08 A;  4KG6 A;  3OBF A;  4R6L A;  2WKQ A;  3OOV A;  4ZBE A;  2Y2P A;  3LID A;  3IXG A;  1PW8 A;  2OLV A;  3G35 A;  2M7V A;  4QB8 A;  2JKT M;  1W63 M;  2XEP A;  1I2W A;  5TFQ A;  1YAX A;  3ZG0 A;  2PHY A;  3VP1 A;  3OPH A;  2PDR A;  2WKE A;  1TF1 A;  5JYO A;  3C4O A;  2G2W A;  1YSP A;  1Z09 A;  1YLT A;  3CPT A;  5AVF A;  4Z1W A;  2Y2J A;  4XT2 A;  3IBR A;  3UY6 A;  4GD6 A;  4C6Y A;  3VOZ A;  2RCX A;  1ESI A;  1PNE A;  3C2W A;  3UB8 A;  1DP6 A;  3TW8 A;  2HDU A;  2ZC6 B;  1PRQ A;  3UNW A;  4WEL A;  3TE8 A;  5CGW A;  3CAX A;  2PR5 A;  5GLD A;  1AXB A;  4CQH A;  5G4Y A;  1K54 C;  5HAR A;  2W1T B;  4RA7 A;  3NHQ A;  3BWL A;  5FQI A;  4OP8 A;  3Q82 A;  3QHY A;  2ZBB A;  4EV4 A;  4G3K A;  4IJG A;  1L0E A;  4D60 A;  1BTL A;  2VKS A;  1NLY A;  5F83 A;  3MBZ A;  2D01 A;  1PFL A;  2BG1 A;  4P87 A;  3K2N A;  2JKT I;  3MFX A;  1KVM A;  4LRZ E;  4DE1 A;  2J7V A;  2ZM8 A;  4X55 A;  1KE3 A;  1G28 A;  4GS9 A;  4L9E A;  4H6J A;  2O9A A;  4GW9 A;  1GA9 A;  3UDI A;  3UPO A;  2L4R A;  3T4S A;  4UHU A;  5FQ9 A;  4CPK A;  1XKZ A;  4EET B;  4LPZ A;  4KEN B;  3KSH A;  2J9P A;  4N1H A;  4HY8 A;  3LIE A;  2MJ6 A;  5EVE A;  4EER A;  2PU2 A;  3R7W A;  3S7P A;  5HWW A;  3KYQ A;  1S6R A;  2GJ3 A;  1XP4 A;  1OME A;  3LIF A;  4QY5 A;  2ZJ9 A;  2DMW A;  3D72 A;  4EXO A;  3MFD A;  3V3S A;  1BLS A;  4S2I A;  2WKR A;  4KZ7 A;  3C30 A;  3UDF A;  1N9N A;  5CER A;  5TR7 A;  3B42 A;  1IYQ A;  3H82 B;  1O07 A;  3FG8 A;  4ZJ3 A;  5GLB A;  3NBL A;  3KO6 A;  3PBS A;  4S2K A;  1K38 A;  4EW7 A;  4YNR A;  4BJP A;  2HPB A;  2XA7 M;  2A24 B;  2XD1 A;  4GJ4 A;  1ODV A;  1ES2 A;  1W8Q A;  4DMZ A;  2H10 A;  4GDN A;  1VHM A;  3TOI A;  3SW1 A;  3Q1F A;  4YWZ A;  1XA7 A;  3IT9 A;  4UQI S;  2XFS A;  2WGI A;  2P7J A;  2H5S A;  3DTK A;  4HEF A;  3FWL A;  2EA9 A;  3LIA A;  2PAV P;  2WAD A;  3C4P A;  4I3A A;  5EVL A;  3UPP A;  1P9W A;  3LCE A;  4GKU A;  5DJU A;  1TDL A;  1H8Y A;  4WZ5 A;  2EFU A;  1FCO A;  5CGX A;  3RFB A;  2OLU A;  1T18 A;  4MEZ A;  4EUV A;  1BLC A;  1N9B A;  2VV7 A;  4DF6 A;  3UB7 A;  5HSQ A;  2JN7 A;  2XQZ A;  5DJT A;  2G2U A;  3ZVT A;  3T12 B;  5GHY A;  3BRM A;  2XF3 A;  1XJ2 A;  4N1X A;  3KSI A;  2DRW A;  3VSK A;  2B18 A;  4I3J A;  5GHX A;  4MBH A;  4R38 A;  1CQA A;  3PAE A;  3DTM A;  1UWP X;  4GZB A;  4G3V A;  4G3W A;  2Y79 A;  3IH9 A;  2ZD8 A;  3FPV A;  2VGK A;  3QP8 A;  2WAF A;  1ERM A;  1VET A;  3HRE A;  4JKT A;  3EEH A;  1K57 A;  4O7D A;  2VX8 A;  4DDS A;  4DKI A;  4KG2 A;  2V0U A;  1ONG A;  2A49 A;  3LY3 A;  3LYX A;  5DTK A;  3HUO A;  5HPF A;  1XFN A;  1F2K A;  4ESP A;  3JYI A;  2B02 A;  3SH9 A;  4X53 A;  4HQA A;  3NOP C;  3UDX A;  2V20 A;  4ARZ B;  5M19 A;  4P0M A;  2M7U A;  4Y2F A;  4GLQ A;  4OH0 A;  3A3I A;  4F94 A;  3F1N A;  1UWN X;  3OLO A;  3UE3 A;  3UB9 A;  4Y0U A;  3T4J A;  5FI2 A;  2WAE A;  1YLP A;  1N4O A;  4HJ6 A;  1FSW A;  2ZC5 B;  4K08 A;  4U3T A;  4IVK A;  4CLC E;  1W7F A;  3CHW P;  4LCM A;  5M1A A;  4S2P A;  4F3L A;  1O7E A;  1NXY A;  3IX8 A;  2O9B A;  5CHM A;  1MWT A;  3CJM A;  3MQQ A;  4R70 A;  2Y2H A;  1BUE A;  3F1P B;  1K6R A;  3EOI A;  5EVI A;  3LIC A;  1LL9 A;  4FH4 A;  1P97 A;  3ZVW A;  1X0O A;  4KZ5 A;  1MPL A;  1YSQ A;  3C8C A;  3SS3 A;  2ZL1 B;  2WUQ A;  1OTI A;  2EXA A;  2HDR A;  4PM6 A;  5HL6 A;  2V9A A;  2Y2G A;  4GCZ A;  3A3E A;  2J80 A;  1Q2P A;  1Z6F A;  2GDN A;  1SKO A;  4N9K A;  4BBT A;  4Y15 A;  2ZMF A;  2GNX A;  1NY0 A;  3BEC A;  4X56 A;  4Y3I A;  4HP4 A;  1D1J A;  2ZMA A;  1GHP A;  3OPR A;  4Y7P A;  2H0Y A;  4LV1 A;  5BOH A;  5DVA A;  3N6I A;  4LRY C;  5J4E A;  1K25 A;  5DKK A;  4JGO A;  4YOF A;  1M40 A;  3LR3 A;  5A8B A;  1J9M A;  3NY4 A;  4OOM A;  2QPN A;  4AFI A;  3BFE A;  1FCM A;  2K31 A;  3A0R A;  2VGJ A;  3F1P A;  3AGE A;  3EGD C;  2OAP 1;  4R3B A;  5J3W A;  1FIL A;  1IKI A;  1LHY A;  4KZ3 A;  4WN5 A;  3F1O A;  2IWC A;  3E2K A;  4ZDX A;  2BTF P;  3N8S A;  2JHE A;  1K57 C;  3NI9 A;  4C3Q A;  4DXB A;  2ZQ8 A;  3JPU A;  4E6X A;  1Q2Q A;  3RTY A;  2FFY A;  3FV7 A;  1ALQ A;  3C7U A;  4N9L A;  3K3D A;  5A92 A;  1XPB A;  5EVI D;  1D7E A;  4E3L A;  1JNU A;  4MLL A;  5HDC A;  4E3J A;  3UPN A;  1K55 C;  1Y28 A;  3RJU A;  2ZMV A;  4R23 A;  3MF0 A;  3DBA A;  3MZF A;  4X6T A;  3IHB A;  1Y54 A;  4KQR A;  3E0Y A;  5AVE A;  3G2Z A;  4HJ4 A;  1YMX A;  2HJE A;  5EOE A;  5HAI A;  2ZOI A;  3VP3 A;  4GOG A;  3IWO A;  3IX4 A;  5EM0 A;  1KDS A;  3OCN A;  5L07 A;  3CUE C;  3Q7V A;  2Q0O A;  3HLD A;  3QP5 A;  3N8L A;  2PD7 A;  4H8R A;  5F5Y A;  2V8C A;  3KSG A;  5FEF A;  1ONH A;  3MZE A;  5DTS A;  2W3D A;  4P85 A;  4BBU A;  3RXW A;  3VE4 A;  2W3F A;  5IT5 A;  2H0T A;  3BLS A;  2HV1 A;  3QP2 A;  3LEQ A;  3G2Y A;  2QYB A;  4HJ3 A;  3T4K A;  4XUZ A;  3IF6 B;  2ZQA A;  4B9O A;  2VA0 A;  5HAQ A;  3O3V A;  2XDM A;  3HLE A;  3OPL A;  4OON A;  2XRN A;  4QPR A;  5KMW A;  4QD4 A;  4E3O A;  1T19 A;  2Y8H A;  5FQM A;  4K0W A;  1CEF A;  1NYY A;  1FR1 A;  4JXW A;  5EOO A;  5FSR A;  2PYP A;  3C38 A;  1MZU A;  1LI9 A;  4PHT A;  4R3A A;  3LEZ A;  4BMW A;  1XFQ A;  2Y2Q A;  2KX6 A;  2EX6 A;  5EPH A;  5CXW A;  2H28 A;  2G7U A;  4E04 A;  1FR6 A;  3AGD A;  2Z6C A;  3HBR A;  5FI6 A;  1H3Q A;  3GTC A;  1ERO A;  3T4L A;  3EQV A;  3KYE A;  1TS7 A;  4HBU A;  4PAU A;  3PBT A;  5HL1 A;  4GHI A;  3PAG A;  2W3G A;  5AJG A;  2VJW A;  3O87 A;  2ZL1 A;  3HLC A;  3EEA A;  1G68 A;  2QHK A;  3ZGA B;  3Q81 A;  5DF7 A;  1V9Z A;  1EW0 A;  1PIO A;  3E4Q A;  3GR2 A;  1HLU P;  2D02 A;  3R4K A;  3ZNY A;  2QKP A;  4OPR A;  3P7N A;  2KOI A;  4MNR A;  3RH8 B;  1W79 A;  3H82 A;  4IHQ A;  2NUP C;  1OTE A;  5FAT A;  1YM1 A;  4F3L B;  3LR0 A;  1YLZ A;  2K7S A;  1DJC A;  4QWO A;  3NJA A;  1OJ5 A;  4L9F A;  3HLW A;  4QHC A;  1FQG A;  1K56 D;  4UA7 A;  1OTA A;  2AVX A;  4CLC D;  3NDE A;  1CEG A;  2DCF A;  1YKD A;  3VV4 A;  3NDG A;  2V1A A;  2QWS A;  2A2L A;  1HD8 A;  1ERQ A;  2J8Y A;  1NLZ A;  4K91 A;  2JE5 A;  3NIA A;  3BEB A;  4CLC B;  1T1A A;  2NUT C;  4WZ5 C;  4PPR A;  2C5W B;  2OWH A;  3DWK A;  1VET B;  4EES A;  3P01 A;  1KDW A;  4GNU A;  2UWX A;  4BBV A;  4BQM A;  4Y0O A;  2ZQD A;  3E98 A;  1MKI A;  2W1R A;  2P9V B;  4WUJ A;  3W2Z A;  1L0D A;  1L3L A;  1KGG A;  3CWF A;  5E2G A;  4S2N C;  4NET A;  2WKP A;  3T50 A;  1PWD A;  1MWU A;  1TS6 A;  3IF6 C;  4L0L A;  1TS0 A;  2O0Y A;  2WGV A;  2J3T D;  4OQG A;  3MR0 A;  4EBP A;  4IVI A;  1N9O A;  2XR0 A;  2W27 A;  2B95 A;  3ZYT A;  1WYB A;  1AWI A;  2BAS A;  4S2J A;  2Y2O A;  4QU3 A;  3ZNT A;  4FTX A;  1IOU A;  1NRJ A;  1K4E A;  1PWC A;  2Z2M B;  5CGS A;  3PHY A;  1L0F A;  2ZC7 A;  3DTE A;  4DE0 A;  4OP5 A;  3LY4 A;  3IS2 B;  3MZD A;  4BEN A;  4RQ9 A;  1IEL A;  3GQZ A;  4KQO A;  5CX7 A;  1L2S A;  5F82 A;  3TJZ C;  4Y0T A;  5F1G A;  2W3H A;  4R1G A;  4JXG A;  2V2F F;  1VQQ A;  3V67 A;  1K55 A;  4IED A;  4KZ6 A;  1EI5 A;  2PYR A;  3HCY A;  3FYZ A;  1V9Y A;  2ZQ9 A;  4EBN A;  3NCK A;  2WGW B;  3A3F A;  3PBR A;  3F1N B;  4WL9 A;  4NXE A;  4OQH A;  4EEP A;  3GV9 A;  1CK3 A;  3IH8 A;  1OTD A;  3BQ8 A;  3LFV A;  1H8Z A;  4P6B A;  1JWZ A;  3WS5 A;  1CI9 A;  1XJ6 A;  1IYO A;  1G6A A;  1QME A;  2Z2L B;  1NJ4 A;  4EBL A;  3H9W A;  1XGJ A;  5LBR A;  5TBM A;  4EU0 A;  4A5R A;  1KE4 A;  1WE4 A;  4LV3 A;  3U4L P;  4E3K A;  5G18 A;  2YKF A;  4NKP A;  5FL3 A;  4OLG A;  5DKL A;  1LLB A;  2QJ7 A;  4HHD A;  2RL3 A;  2VEA A;  5D3O A;  3IQA A;  2XD5 A;  3IS2 A;  4KUK A;  4NXB A;  5AQ7 A;  5FI7 A;  5FQQ A;  5F1F A;  5HD5 A;  5CEB A;  1SCW A;  5GL9 A;  3LUQ A;  3HJI A;  1DJA A;  4DJ2 A;  2HP5 A;  1SDN A;  1SZV A;  2XK1 A;  1E3U A;  3M6B A;  4I38 A;  2PT7 A;  5IU1 A;  2EX2 A;  3IBJ A;  5KIZ A;  4N92 A;  2Q9N A;  3TG9 A;  1CJF A;  1S4R A;  2X71 A;  2WK0 A;  4BD0 A;  3VMA A;  4IBX A;  4OPY A;  3RXX A;  2XH9 A;  3LI9 A;  4KZ9 A;  2B5R A;  1ZKJ A;  3G6O A;  1A0K A;  3HJK A;  5L09 A;  2J3W A;  1JWV A;  5DF8 A;  3UB6 A;  3WS1 A;  4JF4 A;  3OCL A;  2OSU A;  3IX3 A;  4NK3 A;  1G6O A;  3OC2 A;  4MDZ A;  1MWS A;  2J9O A;  2V1Z A;  3U2A A;  1K0K A;  2Y2L A;  1VEU B;  2W0N A;  3KYZ A;  1JVJ A;  1MY8 A;  4UAA A;  4KZ4 A;  3IWI A;  4IBR A;  4KZB A;  4MBK A;  1XGI A;  3CZD A;  4E6W A;  4JGR A;  3E4O A;  4FCF A;  1H5X A;  3PBO A;  1TEM A;  4EWF A;  4RX2 A;  4Y5F A;  4I39 A;  5HX9 A;  4QY6 A;  1LL5 A;  1LL8 A;  5KSH A;  1ZTU A;  4EQ1 A;  3CMZ A;  5M18 A;  5HD3 A;  3IXH A;  4KZA A;  4YFM A;  5FDH A;  2GX5 A;  1YT4 A;  4UA9 A;  4FD8 A;  2X01 A;  1PYY A;  3LIB A;  5GLC A;  1IFQ A;  2BLS A;  3WRT A;  3N7W A;  2OV5 A;  3BJN A;  5EUA A;  3V5M A;  3PR6 A;  3SS4 A;  3O88 A;  1FCN A;  3KSF A;  4HES A;  5DFX A;  5HDS A;  3JVV A;  3ZDJ A;  1W63 Q;  3L9K A;  1XJ3 A;  2PD8 A;  2WYX A;  4DDY A;  1S67 L;  5L10 A;  2JKR M;  3M2J A;  3R7W B;  3LR4 A;  3CUE A;  1K54 A;  2R78 A;  2EX8 A;  4OQI A;  4WLA A;  3Q7Z A;  2WZZ A;  4WEJ A;  5FAP A;  2JKG A;  1M6K A;  5EFW A;  4WZ4 A;  3P09 A;  2EX9 A;  5FA7 A;  1BSG A;  2ZM2 A;  4HH2 A;  5CTM A;  4U0X A;  2LB5 A;  4EEU A;  5JYP A;  4GHI B;  2WGW A;  2V0W A;  3M6H A;  5L8M A;  5U47 A;  4MMN A;  4MN5 A;  1CI8 A;  2ZC3 B;  2Q9M A;  5A91 A;  5DF9 A;  2R9W A;  1IYS A;  4GB7 A;  4PM7 A;  4FSF A;  1RGZ A;  1DY6 A;  2QZ6 A;  4OPZ A;  2JCH A;  2OOL A;  1SDE A;  1MKM A;  5F6A A;  2C6W B;  3D3O A;  3PBN A;  4NXG A;  3C7V A;  4I5S A;  5IS1 A;  2HJ9 C;  3VOY A;  3T4Q A;  2XFT A;  2V8F A;  3HLF A;  1UGU A;  1ZG4 A;  1QMF A;  3FKV A;  1SKF A;  4PMA A;  4ZJ1 A;  3EQU A;  4FUW A;  3PXP A;  3A0V A;  4UQI M;  1KGE A;  3VE3 A;  4JXS A;  2YKH A;  3PTE A;  3H7W A;  2VK3 A;  3BFF A;  4EQI A;  4WEK A;  1BYW A;  3GDI A;  1PI5 A;  3MMH A;  3ZFZ A;  4OLD A;  3BFG A;  1JTG A;  2HF6 A;  1YLY A;  3ITA A;  2VGL S;  3VP0 A;  3MS6 A;  2ZC4 B;  4S2L A;  1FSY A;  4NEE D;  4OOL A;  5HW3 A;  1RGY A;  4OQ0 A;  1U60 A;  3W4O A;  4ME4 A;  2ZLY A;  1PWG A;  4HBT A;  4B88 A;  4B4Z A;  3ZG7 B;  3KX0 X;  2VV6 A;  4Q0J A;  1E3U D;  3G32 A;  4R4S A;  5HFO A;  3DTI A;  1YPR A;  1KGF A;  2ZQ7 A;  4EUZ A;  2CMN A;  1STZ A;  1NRF A;  3NEC A;  5DFY A;  2R9X A;  4OPQ A;  1ACF A;  3SZT A;  4H6J B;  4MN6 A;  2P04 A;  4X1M A;  1K4F A;  3HLG A;  1DP8 A;  5EE8 A;  5FDS A;  4MN7 A;  1ZHH B;  3C5A A;  4BL2 A;  3NC8 A;  1PW1 A;  4XT2 B;  4QJG A;  3G30 A;  1H8M A;  1BUL A;  2PRF A;  2Y2M A;  4DRT A;  5CHJ A;  4X69 A;  2KLI A;  2VZW A;  1HVB A;  4HIA A;  2JKF A;  1ESU A;  3W4Q A;  3LI8 A;  3G4P A;  3MKE A;  4B93 A;  3GVB A;  2ZM0 A;  2XGN A;  4JPM A;  4X1L A;  1NWZ A;  1P9R A;  4UEY A;  4X25 A;  2ZQC A;  5CRF A;  2GZA A;  4FH2 A;  4R0Q A;  1K56 A;  3MXR A;  4KUO A;  5E2E A;  5EEC A;  3QP1 A;  3IXB A;  3VFF A;  1EWZ A;  5FAO A;  5C5K A;  3M2K A;  3B47 A;  1C3B A; 
#chains in the Genus database with same CATH homology
 1GSX A;  3MQQ A;  4R70 A;  4WF0 A;  5F69 A;  2OAQ 1;  2IA2 A;  3F1P B;  4RQ9 A;  3EOI A;  1F9I A;  3T4T A;  3LIC A;  1F98 A;  4KQO A;  1P97 A;  5CX7 A;  2JKR I;  3TJZ C;  1X0O A;  4O0P A;  4Q0I A;  2W3H A;  4HNB A;  1WA9 A;  2XRO A;  4NXF A;  1YSQ A;  3C8C A;  3B33 A;  1GSW A;  4FOF A;  3V67 A;  1KOU A;  4LLO B;  2M1C A;  1S66 L;  2QJ5 A;  3H7W B;  2PYR A;  3HCY A;  1OPX A;  3T4O A;  1V9Y A;  1OTI A;  5HL6 A;  2KDK A;  2V9A A;  3PBR A;  3F1N B;  4ZRR A;  3NOT C;  4GCZ A;  3BY9 A;  4O01 A;  4NXE A;  2FZ0 A;  4WL9 A;  1OJG A;  4EEP A;  2J80 A;  3S7Q A;  4JGP A;  1DRM A;  1OTD A;  3VOL A;  3BQ8 A;  3LFV A;  4I3I A;  4CLC C;  5TBM B;  4BBT A;  3LR5 A;  2VLG A;  1XJ6 A;  3K3C A;  2ZMF A;  2GNX A;  2J3T C;  2P08 A;  4Y3I A;  4HP4 A;  3OBF A;  4R6L A;  3H9W A;  5LBR A;  5TBM A;  2WKQ A;  4PKY G;  4EU0 A;  3OOV A;  3PYP A;  2INW A;  2O99 A;  2V1B A;  3LID A;  4LRY C;  3FC7 A;  3UE6 A;  2M7V A;  2YKF A;  4NKP A;  5FL3 A;  5J4E A;  3E4P A;  5DKK A;  4JGO A;  2JKT M;  4YOF A;  1W63 M;  1F5M A;  3LR3 A;  5F68 A;  4HP9 A;  5A8B A;  1YAX A;  2PHY A;  5MC7 A;  5DKL A;  5HPI A;  2L1M A;  3BW6 A;  2PDR A;  2QJ7 A;  4HHD A;  4OOM A;  2VEA A;  2VV8 A;  1TF1 A;  1YSP A;  4AFI A;  3IS2 A;  4KUK A;  3EGX C;  2K31 A;  4NXB A;  5AVF A;  3A0R A;  5HD5 A;  4Z1W A;  5TJJ A;  3F1P A;  2O9C A;  2OAP 1;  3EGD C;  4XT2 A;  4BWI A;  5J3W A;  3IBR A;  3LUQ A;  4WN5 A;  3F1O A;  3HJI A;  4DJ2 A;  3C2W A;  3UB8 A;  1DP6 A;  2JHE A;  4I38 A;  2PT7 A;  5IU1 A;  3TW8 A;  3IBJ A;  5KIZ A;  1MC0 A;  3CLO A;  4WEL A;  3TE8 A;  3CAX A;  1S4R A;  1DP9 A;  2PR5 A;  4MCW A;  3RTY A;  4CQH A;  5G4Y A;  3LI9 A;  4Q0H A;  3F1O B;  1TS8 A;  3K3D A;  2W1T B;  4DN0 A;  4IUK A;  1D7E A;  3MQO A;  3NHQ A;  3BWL A;  3G6O A;  3HJK A;  1JNU A;  5HDC A;  2J3W A;  3UB6 A;  5HDD A;  1Y28 A;  4CLC A;  2ZMV A;  2ZBB A;  4ETZ A;  3OCL A;  4G3K A;  4IJG A;  3MF0 A;  3DBA A;  1G6O A;  3OC2 A;  2VKS A;  1NLY A;  4MDZ A;  1OTB A;  3E0Y A;  2D01 A;  5AVE A;  2OWJ A;  4HJ4 A;  3U2A A;  2HJE A;  3K2N A;  2JKT I;  2W0N A;  3MFX A;  2ZOI A;  3UME A;  3KYZ A;  4LRZ E;  4IUH A;  3OCN A;  3MJQ A;  1G28 A;  3CUE C;  4GS9 A;  4L9E A;  4JGR A;  4H6J A;  2O9A A;  3E4O A;  3PBO A;  4GW9 A;  2PD7 A;  1TD5 A;  2L4R A;  5F5Y A;  3KSG A;  4Y5F A;  3T4S A;  4I39 A;  1LL8 A;  2W3D A;  5KSH A;  2A24 A;  1ZTU A;  4EQ1 A;  4BBU A;  4EET B;  4LPZ A;  5HD3 A;  3KSH A;  3VE4 A;  2W3F A;  5IT5 A;  4HY8 A;  2HV1 A;  3LIE A;  2MJ6 A;  2ZOH A;  2GX5 A;  1LSX A;  4EER A;  5J7E A;  2QYB A;  3S7P A;  3R7W A;  4HJ3 A;  5HWW A;  3A0S A;  3LIB A;  1IFQ A;  3KYQ A;  3T4K A;  2GJ3 A;  3BJN A;  3GEC A;  3PBQ A;  3PR6 A;  4P6Z S;  4B9O A;  2VA0 A;  3KSF A;  3LIF A;  5DFX A;  5HDS A;  2DMW A;  3JVV A;  1W63 Q;  3D72 A;  1XJ3 A;  4EXO A;  2XRN A;  4QPR A;  2PD8 A;  2WKR A;  3C30 A;  4II7 A;  1S67 L;  2JKR M;  1T19 A;  3R7W B;  3LR4 A;  3CUE A;  3O5Y A;  1LSV A;  2Y8H A;  3JVU A;  1N9N A;  2R78 A;  3B42 A;  3H82 B;  4WLA A;  4WEJ A;  2PYP A;  3C38 A;  1MZU A;  3FG8 A;  5I5L A;  2XSS A;  4PHT A;  4R3A A;  4BMW A;  1XFQ A;  5EFW A;  3PBS A;  3KO6 A;  2KX6 A;  4EW7 A;  2H28 A;  4YNR A;  4BJP A;  2XA7 M;  2G7U A;  4E04 A;  2A24 B;  4HH2 A;  2Z6C A;  2LB5 A;  1H3Q A;  4EEU A;  4GJ4 A;  3ZQ5 A;  4GHI B;  3T4L A;  3EQV A;  1TS7 A;  4PAU A;  1ODV A;  3PBT A;  4P6Z M;  2V0W A;  4DMZ A;  4GHI A;  3MXQ A;  5AJG A;  2W3G A;  3EWK A;  4ETX A;  2VJW A;  1VHM A;  3SW1 A;  4YWZ A;  5L8M A;  4MMN A;  3EEA A;  1OT6 A;  1VB6 A;  2QHK A;  4HOI A;  5HWT A;  1V9Z A;  4MN5 A;  1EW0 A;  3E4Q A;  5DF9 A;  2PR6 A;  2D02 A;  3R4K A;  4FSF A;  4UQI S;  2OOL A;  5K5B A;  2P7J A;  2QKP A;  1MKM A;  3P7N A;  5F6A A;  3D3O A;  1P0Z A;  3PBN A;  4NXG A;  4I5S A;  3LIA A;  2EA9 A;  2HJ9 C;  5IS1 A;  2KOI A;  3RH8 B;  3T4Q A;  4I3A A;  4HH3 A;  1LT0 A;  1LSW A;  3H82 A;  4IHQ A;  1UGU A;  1P9W A;  2NUP C;  1OTE A;  4F3L B;  2EWW A;  3LR0 A;  2K7S A;  5DJU A;  3MQ0 A;  4L9G A;  2I9V A;  3EQU A;  3NJA A;  3PXP A;  1OJ5 A;  3A0V A;  4UQI M;  3VE3 A;  4L9F A;  3RFB A;  2YKH A;  4M4X A;  3H7W A;  3ULF A;  1T18 A;  4WEK A;  3BQA A;  4EUV A;  1BYW A;  2VV7 A;  1OTA A;  3UB7 A;  5HSQ A;  2JN7 A;  1XJ4 A;  4CLC D;  3GDI A;  4PKY A;  2HGV A;  3MMH A;  1YKD A;  1T1B A;  3CIT A;  3VV4 A;  4JGQ A;  5DJT A;  2V1A A;  2QWS A;  2A2L A;  2HF6 A;  4DJ3 A;  2VGL S;  1NLZ A;  1XJ2 A;  3KSI A;  4NEE D;  3FPW A;  4OOL A;  2Z6D A;  2B18 A;  4CLC B;  1T1A A;  4I3J A;  5HZH A;  2NUT C;  4ME4 A;  4R38 A;  1N9L A;  2L0W A;  2OWH A;  3KX0 X;  4EES A;  1UWP X;  2VV6 A;  4Q0J A;  4G3V A;  4G3W A;  2Y79 A;  3P01 A;  1S4S A;  1GSV A;  4BBV A;  3CI6 A;  3FPV A;  3E98 A;  2W1R A;  4LRX C;  2LB9 A;  4WUJ A;  2CMN A;  3S7O A;  1STZ A;  3W2Z A;  4KQD A;  3EEH A;  2VX8 A;  4HI4 A;  2XA7 S;  3BY8 A;  3CWF A;  2V0U A;  5DFY A;  2W3E A;  3LYX A;  4H6J B;  4MN6 A;  5HPF A;  2P04 A;  1DP8 A;  2WKP A;  1XFN A;  3T50 A;  5HWV A;  2B02 A;  4O8G A;  1TS6 A;  4L0L A;  1ZHH B;  4MN7 A;  3TRC A;  1TS0 A;  4XT2 B;  1OT9 A;  4HQA A;  3NOP C;  4ARZ B;  2O0Y A;  1H8M A;  1D06 A;  2M7U A;  4Y2F A;  4GLQ A;  2J3T D;  1S1Z A;  3MR0 A;  2K2N A;  3F1N A;  1UWN X;  2KLI A;  2VZW A;  3NOU C;  3OLO A;  3UE3 A;  3ICY A;  3UB9 A;  4HIA A;  3T4J A;  2W1T A;  1N9O A;  1S1Y A;  3LI8 A;  1T1C A;  4HJ6 A;  4K08 A;  2W27 A;  2VGL M;  4GS9 B;  4B93 A;  2EWV A;  3ZYT A;  4ARZ A;  2BAS A;  4CLC E;  1NWZ A;  1P9R A;  4UEY A;  3S7N A;  1IOU A;  5G4Z A;  2GZA A;  3UMD A;  1NRJ A;  3PHY A;  4KUO A;  4F3L A;  2FH5 A;  2O9B A;  5C5K A;  3B47 A;  3IS2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...