2D01A

Wild type photoactive yellow protein, p65 form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
124
Chain Sequence
EHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title The Crystal Structure of the R52Q Mutant Demonstrates a Role for R52 in Chromophore pK(a) Regulation in Photoactive Yellow Protein
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 35
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2d01A00
1OT9A 4WLAA 2H28A 4JGOA 3VE4A 2W27A 3FC7A 1T1AA 1LSVA 1DP8A 1G28A 3F1NB 3E4PA 1LT0A 3LIBA 1UWPX 3A0RA 4JGQA 5DJUA 3E4QA 4HP4A 1JNUA 4I3IA 2YKFA 2V0UA 4HH3A 2V0WA 1N9LA 1OT6A 4WUJA 3HJKA 1OTEA 5G4YA 2I9VA 3MQQA 2D01A 2QJ5A 1UWNX 4KUOA 3MJQA 3UMEA 2ZOIA 4EEPA 4HJ3A 3T50A 1XFQA 3C2WA 3UB8A 4HY8A 4I3JA 1D7EA 2Z6DA 2OWHA 3NHQA 4HQAA 3PHYA 4NXGA 3NJAA 4DJ2A 2KDKA 5HSQA 4EETB 3NOTC 2QKPA 5HWTA 3CAXA 4DJ3A 1GSWA 3LI9A 2YKHA 3IBRA 5HDSA 1DRMA 1T19A 3CWFA 1LSWA 1S66L 4GHIB 1DP9A 1OJ5A 4LPZA 5I5LA 5AVFA 4EXOA 4I5SA 3VOLA 1N9NA 3F1PB 1XJ2A 1S4SA 4R6LA 3LI8A 2ZBBA 2VV6A 4HJ6A 1GSXA 4WL9A 5AVEA 3NOPC 3F1OB 2CMNA 2VV7A 1OJGA 2K7SA 4I3AA 3BY8A 5HWVA 5HDCA 3G6OA 2PD8A 5A8BA 3HJIA 2W0NA 4R70A 4YWZA 1VB6A 3GDIA 1Y28A 3IS2B 5J4EA 4GW9A 1V9ZA 5HDDA 5G4ZA 4GHIA 4R3AA 3PYPA 5F5YA 2B02A 3F1PA 2HV1A 3RTYA 1KOUA 4WF0A 1T18A 2PR5A 4H6JB 2QJ7A 3MFXA 1V9YA 2KX6A 3NOUC 3RH8B 3F1OA 1F9IA 4JGPA 4L9FA 3LIEA 5DJTA 4WN5A 3UMDA 1UGUA 2M1CA 3LIFA 3EWKA 1T1BA 3A0VA 2QHKA 2J80A 4KUKA 2WKQA 5IS1A 5J3WA 2L1MA 3LIDA 4L9EA 2V1BA 1DP6A 5F69A 3IS2A 5HD5A 3UB9A 2GJ3A 1MZUA 3FG8A 2JN7A 4HNBA 4RQ9A 1T1CA 4HJ4A 1OTAA 1TS7A 2D02A 4XT2B 3H9WA 1ODVA 4R38A 3MXQA 4NXBA 2WKRA 4E04A 2VLGA 4F3LB 4H6JA 1S1ZA 4EW7A 1TS6A 2PD7A 1XJ4A 5IU1A 4I39A 4GS9A 2EA9A 5HD3A 2WKPA 3ICYA 4BBTA 3KX0X 2PYRA 1S4RA 4LRYC 3H7WB 3A0SA 2V1AA 2BASA 3ULFA 2ZOHA 2PYPA 3D72A 1TS8A 4HOIA 4HP9A 2OWJA 3LUQA 5KIZA 1X0OA 3VE3A 1XJ3A 1BYWA 3SW1A 4BBUA 4B9OA 3H82B 3GECA 2A24B 4HHDA 3LICA 1N9OA 2Z6CA 4XT2A 2PDRA 4KQDA 5J7EA 1EW0A 3UB6A 4MN6A 3UB7A 3LIAA 1XFNA 1WA9A 5TBMB 5DKLA 3OLOA 3BWLA 2L0WA 4F3LA 1GSVA 4LLOB 4K08A 3B33A 2VV8A 2INWA 4GCZA 4HIAA 5HWWA 4GS9B 4EEUA 4MN5A 3H7WA 5HZHA 4EERA 4PKYA 2PHYA 4EQ1A 1LL8A 3BY9A 3UE6A 2VEAA 2OOLA 3C8CA 1D06A 2L4RA 3MQOA 3E4OA 1NWZA 3EEHA 3F1NA 4I38A 2R78A 2QWSA 1OTIA 4L9GA 5EFWA 3H82A 1F98A 2A24A 4PKYG 2JHEA 4EESA 3K3CA 1S1YA 1TS0A 2P7JA 5DKKA 3MR0A 3CLOA 4HI4A 4M4XA 5TBMA 1OTDA 4NXEA 1P0ZA 3P7NA 4NXFA 4JGRA 2V9AA 1XJ6A 1S67L 1P97A 2PR6A 5F68A 3ZQ5A 4HH2A 5F6AA 3LYXA 1OTBA 4LRZE 1LSXA 3K3DA 4LRXC 4BBVA
chains in the Genus database with same CATH superfamily
5CECA 3IF5A 3GSGA 1PNEA 2V20A 3LY4A 4OP8A 3F1NB 1ES3A 1ZKJA 4UHUA 2WAEA 3LIBA 4N1HA 1XA7A 3SS4A 1BLHA 1M6KA 4JGQA 2A3UA 5FQIA 5MC7A 4XXRA 2XH9A 3I7JA 3WS2A 2ZL1B 4IHQA 4X6TA 3IH9A 1N9LA 1HVBA 4WUJA 5HFOA 3HJKA 1W7FA 4ZAMA 4Y0UA 4IUHA 2Y2LA 4G3VA 3E2KA 3IHBA 2D01A 5FATA 3S7PA 3N4IA 4A5RA 4OH0A 5CGXA 2HP6A 1L0DA 2PBYA 1UWNX 4E3JA 3IBJA 2ZOIA 3VMAA 1SHVA 1JTDA 4NKPA 4UA7A 2OLVA 3T50A 3EGXC 4KZ5A 4YFMA 2O9AA 3C2WA 4HY8A 2H0YA 1LL9A 1DY6A 3MZEA 2W3GA 5DVAA 1VETA 5E2EA 1MWRA 3IWIA 4S2PA 3PHYA 2WGWB 2E8IA 4DJ2A 5EECA 1ES5A 3V3RA 3PAEA 5FDSA 3TJZC 3NOTC 2XF3A 1XPBA 2DCFA 3NECA 3Q07A 3LI9A 1BLSA 1K57A 4JXSA 1C3BA 2PU4A 5EVIC 3UE3A 1YMSA 5GHYA 3KSGA 4NG2A 1YSQA 3S7OA 1DP9A 1K56A 3BFCA 5FQJA 2WKEA 1MKMA 2ZMVA 3SZTA 4KZ6A 3T4TA 1E4DA 5CGSA 3EQUA 4GN2A 3WS4A 3LI8A 1Z09A 3ITAA 4KG5A 2ZBBA 3HBRA 2DMWA 3MSHA 1XGIA 1SKOA 2B5RA 1XXMA 4HJ6A 3HL9A 1DJCA 3B3XA 5AVEA 4CLCD 3F1OB 2LB5A 3W4OA 3IF6A 4OOYA 1IYPA 1H8MA 5FASA 1MY8A 1PW8A 4ETXA 4HBTA 2XDMA 3OPLA 1BZAA 2K2NA 3HUMA 4D60A 3K2NA 4JBFA 2ZC4B 1ONGA 3FWLA 1K4FA 1V9ZA 4Q0IA 4R3AA 3PYPA 1S0WA 5A90A 2ZMFA 3LR4A 1ERMA 2ZC7A 5E2FA 3CUEC 4GDBA 2KOIA 4JKTA 1YM1A 4NK3A 3OBFA 5EVID 2XGNA 3KYZA 5EOOA 4DXBA 3SS5A 4FOFA 2KX6A 4M3KA 4IEDA 3ZHHA 1G6OA 3R7WA 2PT7A 4JGPA 2O9CA 3KO6A 3UMDA 2ZM8A 1UGUA 4DE1A 1NRFA 3N8LA 1T1BA 3A0VA 4MNRA 3IH8A 4KQRA 2WGIA 2I72A 3LIDA 4L9EA 2V1BA 2IWBA 1PI5A 1CQAA 3T1SA 3S7QA 2GJ3A 1MZUA 4HNBA 2Y2PA 1M40A 5DTKA 4BWIA 4E3OA 2D02A 2J3WA 5L2FA 1KGEA 2XRNA 3HLWA 3MXQA 1SKFA 4Y15A 1FR6A 5FQMA 1PZPA 2UV0E 3A3DA 3KSHA 1QMEA 4Y3IA 2QMIA 4UAAA 4F3LB 3PXPA 5CX7A 1BULA 4EW7A 5IU1A 2A2LA 2EA9A 3T4QA 5K5BA 3Q1FA 2PYRA 1S4RA 3FPWA 2G2UA 3LR3A 3S7NA 3NC8A 2VKSA 4HP9A 1FOFA 2Y8HA 4PM7A 1PZOA 4CPKA 5FI7A 3Q7VA 3SW1A 2W1TB 4ZJ2A 4LV3A 4R4RA 5CHUA 1KE3A 1PYYA 1N9OA 4XT2A 4DDSA 2PDRA 3T1QB 1RCJA 4WMCD 3MMHA 4B4ZA 3UB6A 4FSFA 1WA9A 3BWLA 3PBOA 5IT5A 1BLCA 1GSVA 4LLOB 5HAIA 4U3TA 3TW8A 3ZYTA 2Q0OA 4Y0TA 5GLAA 4GCZA 3CG5A 5JYPA 1MC0A 1F2KA 4PM6A 4EQ1A 4OPRA 2ZQ9A 1MWTA 3DW0A 2EX8A 1ZC2A 1IOUA 1LL8A 2NUPC 2OOLA 2EX9A 3DWKA 3E4OA 3C4PA 3O5YA 2EWWA 1OTIA 4L9GA 2Y55A 5HAQA 1N4OA 1KGFA 3JVVA 2W1RA 2A24A 4EESA 1CJFA 1EWZA 4AFIA 2P7JA 1PW1A 1FSWA 3G35A 4HI4A 5TBMA 3QNCA 4NXEA 2GZAA 3PBTA 2J3TC 4QHCA 1P0ZA 4OKPA 3ZG5A 1HZOA 2Y2GA 4DRTA 3VOYA 1P97A 1K4EA 2PR6A 4R3BA 4IBXA 3ZQ5A 2WYXA 4HH2A 5F6AA 2XR0A 4O01A 4WZ4A 1YAXA 4LRZE 1L0GA 5TGFA 3P01A 1D1JA 1CEFA 1KVMA 5AQ7A 2R9XA 1OT9A 3VFFA 2Y59A 3VE4A 2W27A 2JE5A 3O86A 3TE8A 1LT0A 1ALQA 4LENA 5HAPA 3ZFZA 4EWFA 4PAUA 3BLSA 3FZCA 3NBLA 2HF6A 1UWPX 3V67A 2Y2MA 3IXGA 3IXHA 2J9OA 5HARA 2P74A 4MCWA 3BM6A 5GHZA 5HPFA 1K55A 4BD0A 3EGDC 1OTEA 3QP5A 5G4YA 2WZXA 2VGLM 5L8MA 3PR6A 3QP1A 3IWOA 4P6BA 4HBUA 2X01A 3GRJA 5CTMA 2XFTA 2ZD8A 2J3TD 1I5QA 3UMEA 2CC1A 4EEPA 5CGWA 4FH4A 4WZ5C 3WWXA 4MLLA 4R1GA 5CXWA 1SKOB 4KQOA 3OPRA 3UDIA 4DMZA 1PWGA 4NXGA 4RX3A 3IF6B 2KDKA 5HSQA 1ESUA 3ZNYA 3DBAA 3UO9A 2QKPA 3P09A 1GA0A 5AJGA 1XA1A 4OQGA 5E43A 3ZG7B 1VM1A 2GNXA 5KZHA 4K91A 4PMAA 2YKHA 1PIOA 2XA7M 5HDSA 3IXBA 4ZTKA 5F1GA 4UEYA 3NULA 3WS0A 1S66L 1NXYA 1Y54A 4IVKA 3FKVA 4LPZA 4WEJA 2HP5A 1TDGA 4EXOA 4I5SA 4D2OA 3T12B 3QP4A 1N9NA 2XSSA 1S4SA 4Y13A 2MJ6A 3UPOA 2GDNA 4GLQA 4O8GA 3WRZA 1YSPA 2HP9A 1PI4A 5D3OA 4X25A 4R23A 2VV7A 2J8YA 3MS6A 4Y5FA 3R7WB 2X71A 3IQAA 2WK0A 4ARZA 2H0TA 2K7SA 4QY6A 5HWVA 1G6AA 5HW3A 3BEBA 2ZQ7A 2PD8A 3WS1A 3A3FA 4ETZA 5LBRA 2W0NA 1K38A 4R70A 3T1XA 1VB6A 3GDIA 1G5UA 1I2SA 1Y28A 1YT4A 4U0TA 4JXGA 5EM1A 5FQ9A 1FQGA 3L7HA 4WEKA 4Y0OA 3VOZA 1PRQA 5GHXA 3HLBA 3GQZA 4GOGA 5G4ZA 4GHIA 3GR2A 3T4LA 1CEGA 1KE4A 3ZGAB 5F5YA 2VX8A 3PBNA 5FI2A 3F1PA 3IXDA 2JC7A 1IKGA 5GLDA 1KOUA 4WF0A 4X1MA 3C38A 2V2FF 1JWZA 4N9KA 4WBGA 3SH9A 4ZDXA 5A93A 1G68A 1V9YA 3RH8B 3GV9A 3DAVA 5GL9A 4WN5A 5KSCA 1FR1A 3QHYA 5FA7A 4ZRRA 2QHKA 3PBSA 2J80A 5CEBA 2WKIA 3Q81A 3UB5P 2ZC5B 4OPZA 3RXWA 3D3OA 4MMNA 2WADA 3HREA 3IS2A 5DTTA 4LV1A 4BL2A 3UB9A 3BRMA 3Q7VB 3UDFA 1ONHA 4RQ9A 4X68A 3ZG8B 4GD6A 5C5KA 1K57C 2ZQ8A 4RX2A 4XT2B 4RVAA 4Y2FA 1KDSA 4NXBA 2Y2NA 5FEFA 2WKRA 4OPQA 1RGZA 2JKGA 4E04A 4OLDA 4LCMA 4Q8IA 1P9RA 1NLYA 3MXSA 3HUOA 1VEUB 4GS9A 2FFYA 1GA9A 4UQIS 2FFFB 3ICYA 4BBTA 3KX0X 3N6IA 2GX5A 2V1AA 3MZDA 5M18A 4G3WA 3MKEA 3D72A 4CLCE 3SOIA 2P9VA 1FCNA 3IF6C 3G4PA 5I94A 1YLWA 4E3MA 4KQQA 4ESPA 4BBUA 3TRCA 1KGGA 3GECA 1L0EA 4L0LA 2A24B 3BFDA 4HHDA 1YQSA 3MFDA 2P08A 2Y2IA 2JKFA 4OLGA 5J7EA 2VZWA 3Q82A 1S6RA 5TBMB 1SCWA 3AGDA 1FSYA 2Y2KA 3ITBA 2B18A 2Y4AA 1HD8A 2OV5A 3H7WA 4CJNA 2QYBA 2WZZA 1JTGA 5FL3A 4PKYA 5AQ9A 5CTNA 4QD4A 2V1ZA 3BY9A 5E2HA 3UE6A 3BQAA 4P85A 5EE8A 3C4OA 2XQZA 1D06A 2L4RA 1O7EA 3UE1A 3MQOA 4QU3A 4R4SA 4KZ3A 2W3HA 3F1NA 2R78A 1E3UA 2Y79A 5EFWA 1NJ4A 1GHMA 2E8JA 1FCOA 4PKYG 4WMCA 2JHEA 2XLNA 4B88A 5EUAA 1Q2QA 4PM9A 4PPRA 3MR0A 2V8CA 4BQMA 4RYEA 3CLOA 3T4JA 3HLFA 4XUXA 4KZ4A 1LLBA 3VV4A 2VGJA 1YMXA 4NXFA 5BOHA 4S2MA 5A92A 4JGRA 4BENA 5F68A 3GTCA 3LEQA 1ZTUA 3LYXA 3UY6A 3G31A 4OOLA 3CHWP 4BL3A 3T4SA 4WYYA 1L2SA 3UPPA 4JF4A 5GLCA 4WLAA 2H28A 3W8KA 3FC7A 3IX3A 4HESA 3DTMA 1DP8A 3VSLA 3GVBA 3LGOA 3E4PA 3BLMA 1W8YA 1NRJA 3HUNA 3LY3A 4ZJ3A 3VP1A 1JNUA 2YKFA 4ME4A 3AGEA 4YOFA 4HH3A 4EU0A 2IWDA 4G3KA 1OT6A 4GKUA 5TR7A 4EUZA 1CK3A 2C6WB 4CQHA 2JCHA 4II7A 4JXVA 2I9VA 2EX6A 1YLJA 3G30A 2XROA 3FPVA 3MQQA 1FIKA 5U47A 2G7UA 3VSKA 3VFHA 1NY0A 2XD1A 4KUOA 3O88A 4KZBA 1ZG6A 4QJGA 1KE0A 5TFQA 3PTEA 1JVJA 2VGKA 3IX4A 3LFVA 2ZQDA 3A3EA 3JPUA 4HJ3A 3DWZA 1XFQA 3LO7A 5IHVA 4I3JA 4DF6A 1ESIA 1RP5A 4YINA 4Z1WA 3U4LP 2Z6DA 3LCEA 3OPPA 1NLZA 3MKFA 2OWHA 3NHQA 4HQAA 4UA9A 3MF0A 3NJAA 1IEMA 2XEPA 4X56A 4YNRA 4ARZB 3ZNTA 3M2KA 3HLDA 4EETB 1YLPA 2HDRA 3Q7ZA 3CAXA 2Y91A 3ZCZA 1A0KA 3IBRA 4JF6A 3IHAA 4IBRA 4KENB 1DRMA 5L07A 2Z2MB 1T19A 2G2WA 4OOMA 3HLCA 4LGWA 4GHIB 1OJ5A 1WYBA 4E3KA 4C75A 4KZ7A 1CI9A 4E6WA 3F1PB 3A3JA 1ES2A 1GHIA 5FAOA 1PWDA 3P98A 5F83A 3EQVA 4EBNA 2A49A 2PBDP 4P0MA 4C6YA 2VV6A 3MXRA 1DJAA 3UE0A 1KVLA 1XX2A 4WL9A 4X69A 5AQBA 2VJWA 3NOPC 3SH8A 1OJGA 1VETB 1YLTA 4I3AA 3V50A 5HDCA 4JF5A 3G6OA 2ZC6B 5E2GA 4OQ0A 4S2NA 4YWZA 4N1XA 1W63Q 2HDUA 1BUEA 2O0YA 5EOEA 2HZ5A 1W8QA 3IS2B 4PM8A 1K55C 3FKWA 1GCEA 5J4EA 2Y2HA 4GW9A 3ISGA 4H8RA 2QZ6A 1XGJA 1SDEA 2IA2A 2B95A 3C5AA 2EWVA 4BLMA 1Z6FA 3VP2A 2PR5A 1W79A 5HX9A 1IYOA 2QJ7A 3FYZA 3MFXA 3NOUC 1F9IA 3W4QA 3V3SA 3LIEA 3FV7A 2Q9MA 2M1CA 3LIFA 1K0KA 2EX2A 4IVIA 2P9VB 1DP6A 4EUVA 2JN7A 3UN7A 3T4OA 4KZAA 2H10A 3O87A 1K54A 1T1CA 4HJ4A 5AQAA 1OTAA 1BLPA 4LCLA 1TS7A 4E3NA 1ODVA 4R38A 3LEZA 4C3QA 3RXXA 2ACGA 5GLBA 2VLGA 3BW6A 4E6XA 2J9PA 3MZFA 4H6JA 4MDZA 2PD7A 3NI9A 4I39A 3ZVWA 4JPMA 4FCFA 5HL6A 4O0PA 4Y7PA 2PU2A 3V5MA 1ZHHB 1TVFA 4UA6A 1Q2PA 3H7WB 1P9WA 3A0SA 4LRYC 2HDSA 1PWCA 2BASA 4DE2A 5KMWA 1J9MA 3C7UA 1HTZA 2ZOHA 5FQKA 2DNSA 1TS8A 4HOIA 3VP0A 3KYQA 4WM9A 3BFEA 5FAQA 1X0OA 4BMWA 3VE3A 1XJ3A 1BYWA 2XK1A 4JXWA 2QPNA 1KDWA 1EROA 3LICA 2Z6CA 3DTEA 3VP3A 4KQDA 5DF9A 1AXBA 5L09A 3IWQA 3UPNA 4MN6A 3LIAA 5DKLA 4FUWA 3E0YA 2VV8A 4CLCA 2INWA 2Y2QA 4HIAA 3BQ8A 5F1FA 5HWWA 4MN5A 4FD8A 4U0XA 3UDXA 4PHTA 4CLCC 5HZHA 5FAPA 5EV0A 3QNBA 4EERA 2M7UA 1JWVA 1H5XA 2PHYA 1GHPA 2ZM0A 4OQHA 2M7VA 2C5WB 2VEAA 1Y4OA 2Q9NA 3S22A 5HL1A 2X02A 4DE3A 1NWZA 3EEHA 1LL5A 2W3DA 4NEED 3OCLA 4I38A 2QWSA 5KSHA 3SH7A 4QWOA 5CHMA 3H82A 4P87A 4N9LA 1BTLA 1LI0A 3CPTA 4K0WA 2NUTC 4HEFA 3KSFA 1MPLA 4X55A 1S1YA 4FH2A 5EVEA 1STZA 2ZLYA 4MBFA 1OTDA 3LR0A 4RA7A 5EVIA 3IT9A 4R0QA 2V9AA 2VA0A 1ES4A 1S67L 1MWUA 2HPBA 1IYQA 4KZ9A 1L0FA 2ZQAA 2R9WA 1EI5A 3TOIA 3ZG9B 1LSXA 4F94A 1BSGA 4LRXC 4KG6A 4BBVA 1NYMA 1LHYA 4JGOA 5EVLA 1T1AA 1LSVA 4B93A 3U2AA 1G28A 3M2JA 4GDNA 2W3FA 4GD8A 4EQIA 3GMWA 4DE0A 3BYDA 1DJBA 3A0RA 2Y2JA 5DJUA 3E4QA 4HP4A 3D4FA 4I3IA 2J7VA 2V0UA 3A3IA 2JBFA 2ZQCA 2V0WA 4XUZA 2PAVP 2KLIA 3T1RA 2BLSA 3NIAA 1E25A 1SDNA 1XKZA 3S4XA 4P6ZM 3CUEA 4X1LA 1YLYA 3BJNA 2WGVA 2QJ5A 1LI9A 3CI6A 1K56D 1NZOA 1U60A 2V8FA 3MJQA 1H3QA 5M1AA 1K6RA 3E98A 3W4PA 1RGYA 4GNUA 2UWXA 3UB8A 1K25A 1CF0A 4B4XA 2ZC3B 1SZVA 2RL3A 1D7EA 4OQIA 1W5DA 5DTSA 2OSUA 1N9BA 2O99A 3LR5A 4E3LA 4MBKA 2ZL1A 5JYOA 1AWIA 5HWTA 4DJ3A 2HJ9C 1XP4A 1GSWA 1H0MA 2VGLS 5TJJA 5DF7A 2VK3A 1HLUP 4KZ8A 3CJMA 3N7WA 3CWFA 1LSWA 4ID4A 4R3JA 1O07A 3KYEA 5FI6A 5I5LA 5AVFA 1BT5A 4OONA 3VOLA 5EPHA 3QP8A 1XJ2A 4LV2A 4R6LA 3T4KA 1TEMA 2W3EA 1GSXA 3OC2A 3V39A 3O3VA 2CMNA 2WGWA 3C7VA 4OP5A 5J8XA 2K31A 2EFUA 4S2OA 3JYIA 5CEDA 3BY8A 4LFUA 3ZVTA 3C30A 4MN7A 5A8BA 2IWCA 4BD1A 3EOIA 4EBPA 3HJIA 4MBHA 2Z2LB 1FCMA 2ZMAA 2JKRI 3M6BA 2XA7S 3SS3A 3W2ZA 1E3UD 5HDDA 1K6SA 3CZDA 3OPHA 4S2LA 4PM5A 5FQQA 1VQQA 2B02A 1F5MA 4NETA 5EM0A 5CERA 2PRFA 1CI8A 2EXAA 2HV1A 1TF1A 3HVFA 3EEAA 3RTYA 2DRWA 2XFSA 1VEUA 1T18A 2XD5A 4H6JB 3MQ0A 1JWPA 4GJ4A 1ZG4A 1WE4A 4UQIM 3KSIA 3DTIA 3D9YA 5M19A 2EXBA 3F1OA 3OOVA 3E2LA 4L9FA 1J3WA 5DJTA 4QPRA 3BFGA 2EFXA 3EWKA 1MBLA 4KUKA 5DFYA 3OCNA 4K0XA 2WKQA 5IS1A 5J3WA 4Y17A 2L1MA 2JKRM 3UNWA 3M6HA 5F69A 1W63M 1YLZA 5HD5A 3FG8A 1IFQA 4X53A 1I2WA 4ZJ1A 1H8YA 3VP4A 3PBRA 1IYSA 3H9WA 4N92A 4GZBA 1IELA 1L3LA 3R4KA 1MWSA 3TG9A 3G2ZA 1S1ZA 1TS6A 1XJ4A 2ZJ9A 3N8RA 5HD3A 3L9KA 2WKPA 1YPRA 1NYYA 4CLCB 4Z9QA 3BECA 4DXCA 2JKTI 1TDLA 1PFLA 3RFBA 3ULFA 2PYPA 5CHJA 3G2YA 1QMFA 2BTFP 3BFFA 4DDYA 2OWJA 3LUQA 5KIZA 4FTXA 3CITA 3IX8A 3G34A 4Q0HA 2WAFA 4IJGA 3B47A 4S2NC 4B9OA 2WUQA 1MXOA 2P04A 3H82B 3CMZA 3ZDJA 2WKHA 3CPTB 1TD5A 4WELA 2OAQ1 3PAGA 4Q0JA 4E3IA 4QY5A 1EW0A 3HLEA 2LB9A 3UB7A 4KG2A 1XFNA 3OLOA 2L0WA 3OZHA 4EV4A 4F3LA 3B42A 3TSGA 4K08A 5EVIB 3B33A 3G32A 1IKIA 3RJUA 3HLGA 4OPYA 3QP2A 2JKTM 4GS9B 5HPIA 4EEUA 5DFXA 2OLUA 4QB8A 3NCKA 4IUKA 3QP6A 3WS5A 4GB7A 4O7DA 3NY4A 5FDHA 4WZ5A 3NDGA 1ACFA 3C8CA 3PBQA 2HDQA 1OPXA 2FZ0A 1H8ZA 2H5SA 2Y2OA 5DF8A 4BJPA 2W1TA 1NZUA 1F98A 1OMEA 4S2KA 3DTKA 5G18A 1WYCA 4EBLA 5CRFA 5L10A 3K3CA 4DKIA 1TS0A 4LV0A 2OAP1 2BG1A 5DKKA 1MKIA 2HGVA 5A91A 4M4XA 1K54C 3N8SA 2FH5A 3S1YA 4DN0A 4ZBEA 3P7NA 4MEZA 3AGFA 4OVDA 1ERQA 2O9BA 1YKDA 3ZG0A 1XJ6A 1FILA 3NDEA 3WRTA 4S2JA 1OTBA 4P6ZS 4JLFA 2HJEA 3MBZA 3HCYA 3K3DA 5FEGA 2RCXA 1VHMA 2ZM2A 4S2IA 5F82A 3JVUA 5FSRA 2AVXA
chains in the Genus database with same CATH topology
1OT9A 4WLAA 2H28A 4JGOA 3VE4A 2W27A 3FC7A 1T1AA 1LSVA 4B93A 1DP8A 3U2AA 1G28A 3F1NB 3E4PA 3TE8A 2W3FA 1LT0A 3LIBA 1NRJA 4PAUA 2HF6A 1UWPX 3A0RA 3V67A 4JGQA 5DJUA 3E4QA 5MC7A 4HP4A 1JNUA 4I3IA 2YKFA 2V0UA 4ME4A 4MCWA 4YOFA 4HH3A 2V0WA 4EU0A 4IHQA 5HPFA 4G3KA 1N9LA 1OT6A 3EGDC 4WUJA 3HJKA 1OTEA 5G4YA 4CQHA 2VGLM 4IUHA 5L8MA 4II7A 2KLIA 2I9VA 3PR6A 2XROA 4G3VA 3FPVA 3MQQA 2G7UA 2D01A 3S7PA 4P6ZM 3CUEA 3BJNA 2QJ5A 1UWNX 4KUOA 3CI6A 2J3TD 3IBJA 3MJQA 1H3QA 3UMEA 2ZOIA 4EEPA 3E98A 3LFVA 4HJ3A 4NKPA 3T50A 3EGXC 1XFQA 2O9AA 3C2WA 3UB8A 4HY8A 4I3JA 4KQOA 1D7EA 4Z1WA 2Z6DA 2W3GA 4DMZA 1NLZA 2OWHA 3NHQA 4HQAA 3PHYA 4NXGA 3MF0A 3NJAA 4DJ2A 2O99A 3LR5A 4YNRA 2KDKA 4ARZB 5HSQA 3DBAA 4EETB 3TJZC 3NOTC 2QKPA 5AJGA 5HWTA 3CAXA 4DJ3A 2GNXA 2HJ9C 1GSWA 3LI9A 2YKHA 2VGLS 2XA7M 3IBRA 5TJJA 5HDSA 1DRMA 3UE3A 1T19A 3CWFA 4UEYA 4OOMA 3KSGA 1YSQA 1LSWA 1S66L 3S7OA 4GHIB 1DP9A 1OJ5A 4LPZA 4WEJA 1MKMA 2ZMVA 5I5LA 5AVFA 3T4TA 4EXOA 4I5SA 3VOLA 3EQUA 1N9NA 3F1PB 1XJ2A 2XSSA 1S4SA 4R6LA 3LI8A 2MJ6A 4GLQA 4O8GA 2ZBBA 3T4KA 3EQVA 2DMWA 2VV6A 1YSPA 4HJ6A 2W3EA 1GSXA 4WL9A 5AVEA 3OC2A 2VJWA 3NOPC 4CLCD 3F1OB 2CMNA 2LB5A 2VV7A 1OJGA 2K31A 4Y5FA 3R7WB 4ARZA 2K7SA 4I3AA 3BY8A 5HWVA 5HDCA 1H8MA 3G6OA 2PD8A 3C30A 4MN7A 5A8BA 3EOIA 4ETZA 4ETXA 5LBRA 3HJIA 2W0NA 4R70A 4YWZA 2K2NA 1W63Q 1VB6A 2O0YA 3GDIA 1Y28A 3IS2B 2JKRI 2XA7S 3K2NA 3W2ZA 5J4EA 4GW9A 4WEKA 1V9ZA 4Q0IA 5HDDA 5G4ZA 4GHIA 4R3AA 3T4LA 3PYPA 2IA2A 2ZMFA 5F5YA 2B02A 3LR4A 1F5MA 2VX8A 3PBNA 3F1PA 2HV1A 3CUEC 1TF1A 3EEAA 3RTYA 1KOUA 2KOIA 2EWVA 4WF0A 1T18A 3C38A 2PR5A 3OBFA 3MQ0A 4H6JB 4GJ4A 3KYZA 4UQIM 3KSIA 2QJ7A 3MFXA 1V9YA 4FOFA 2KX6A 3NOUC 3RH8B 3F1OA 3OOVA 1F9IA 1G6OA 3R7WA 2PT7A 4JGPA 4L9FA 3LIEA 5DJTA 2O9CA 3KO6A 4QPRA 4WN5A 3UMDA 1UGUA 2M1CA 3LIFA 3EWKA 1T1BA 3A0VA 4ZRRA 2QHKA 3PBSA 2J80A 4KUKA 5DFYA 3OCNA 2WKQA 5IS1A 5J3WA 2L1MA 3LIDA 4L9EA 2V1BA 2JKRM 1DP6A 3D3OA 4MMNA 5F69A 1W63M 3IS2A 4EUVA 5HD5A 3S7QA 3UB9A 2GJ3A 1MZUA 3FG8A 2JN7A 4HNBA 3T4OA 4RQ9A 1IFQA 5C5KA 1T1CA 4HJ4A 1OTAA 4BWIA 1TS7A 2D02A 2J3WA 4XT2B 3PBRA 3H9WA 1ODVA 4R38A 2XRNA 4Y2FA 3MXQA 4NXBA 3R4KA 2WKRA 3KSHA 4E04A 2VLGA 3BW6A 4Y3IA 1P9RA 1NLYA 4F3LB 4H6JA 3PXPA 5CX7A 1S1ZA 4MDZA 4EW7A 1TS6A 2PD7A 1XJ4A 5IU1A 4I39A 2A2LA 2EA9A 4GS9A 5HD3A 2WKPA 4UQIS 5HL6A 3T4QA 3ICYA 4O0PA 4BBTA 4CLCB 5K5BA 3KX0X 2PYRA 1ZHHB 1S4RA 3FPWA 4LRYC 3H7WB 1P9WA 3A0SA 2JKTI 2GX5A 2V1AA 3LR3A 2BASA 3S7NA 3RFBA 3ULFA 4G3WA 2ZOHA 2PYPA 3D72A 1TS8A 4HOIA 2VKSA 4HP9A 4CLCE 3KYQA 2OWJA 2Y8HA 3LUQA 5KIZA 1X0OA 3CITA 4Q0HA 4BMWA 3VE3A 1XJ3A 1BYWA 3SW1A 4BBUA 3TRCA 2W1TB 4IJGA 3B47A 4B9OA 2P04A 3H82B 4L0LA 3GECA 2A24B 4HHDA 3LICA 1TD5A 1N9OA 2Z6CA 4XT2A 4WELA 2OAQ1 4Q0JA 2PDRA 2P08A 4KQDA 5DF9A 5J7EA 3MMHA 1EW0A 2VZWA 2LB9A 3UB6A 4FSFA 4MN6A 3UB7A 3LIAA 1XFNA 1WA9A 5TBMB 5DKLA 3OLOA 3BWLA 3PBOA 2L0WA 5IT5A 4F3LA 3B42A 1GSVA 4LLOB 4K08A 3B33A 3TW8A 3ZYTA 3E0YA 2VV8A 4CLCA 2INWA 2B18A 4GCZA 3BQ8A 4HIAA 2JKTM 5HWWA 4GS9B 5HPIA 1MC0A 4EEUA 4MN5A 5DFXA 3H7WA 4PHTA 4CLCC 5HZHA 2QYBA 4IUKA 5FL3A 4EERA 4PKYA 2M7UA 2PHYA 4EQ1A 1IOUA 1LL8A 3BY9A 2M7VA 3UE6A 3BQAA 2NUPC 2VEAA 2OOLA 3C8CA 3PBQA 1D06A 2L4RA 1OPXA 3MQOA 3E4OA 1NWZA 3EEHA 2FZ0A 2W3DA 3O5YA 2W3HA 4NEED 3F1NA 3OCLA 2R78A 2EWWA 4I38A 2QWSA 1OTIA 5KSHA 2Y79A 4L9GA 5EFWA 4BJPA 2W1TA 3H82A 3JVVA 2W1RA 1F98A 2A24A 4PKYG 2JHEA 2NUTC 4EESA 3KSFA 3K3CA 1S1YA 1TS0A 4AFIA 2OAP1 2P7JA 5DKKA 3MR0A 1STZA 3CLOA 2HGVA 3T4JA 4HI4A 4M4XA 5TBMA 1OTDA 3LR0A 4NXEA 2GZAA 3PBTA 3VV4A 2FH5A 4DN0A 2J3TC 1P0ZA 3P7NA 4NXFA 4JGRA 2V9AA 2VA0A 2O9BA 1YKDA 1XJ6A 1S67L 1P97A 2PR6A 5F68A 1ZTUA 4HH2A 3ZQ5A 5F6AA 3LYXA 1OTBA 4P6ZS 4O01A 2HJEA 1YAXA 4LRZE 4OOLA 1LSXA 3HCYA 3K3DA 3T4SA 3P01A 1VHMA 4LRXC 4BBVA 3JVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OT9 A;  4WLA A;  2H28 A;  4JGO A;  3VE4 A;  2W27 A;  3FC7 A;  1T1A A;  1LSV A;  1DP8 A;  1G28 A;  3F1N B;  3E4P A;  1LT0 A;  3LIB A;  1UWP X;  3A0R A;  4JGQ A;  5DJU A;  3E4Q A;  4HP4 A;  1JNU A;  4I3I A;  2YKF A;  2V0U A;  4HH3 A;  2V0W A;  1N9L A;  1OT6 A;  4WUJ A;  3HJK A;  1OTE A;  5G4Y A;  2I9V A;  3MQQ A;  2D01 A;  2QJ5 A;  1UWN X;  4KUO A;  3MJQ A;  3UME A;  2ZOI A;  4EEP A;  4HJ3 A;  3T50 A;  1XFQ A;  3C2W A;  3UB8 A;  4HY8 A;  4I3J A;  1D7E A;  2Z6D A;  2OWH A;  3NHQ A;  4HQA A;  3PHY A;  4NXG A;  3NJA A;  4DJ2 A;  2KDK A;  5HSQ A;  4EET B;  3NOT C;  2QKP A;  5HWT A;  3CAX A;  4DJ3 A;  1GSW A;  3LI9 A;  2YKH A;  3IBR A;  5HDS A;  1DRM A;  1T19 A;  3CWF A;  1LSW A;  1S66 L;  4GHI B;  1DP9 A;  1OJ5 A;  4LPZ A;  5I5L A;  5AVF A;  4EXO A;  4I5S A;  3VOL A;  1N9N A;  3F1P B;  1XJ2 A;  1S4S A;  4R6L A;  3LI8 A;  2ZBB A;  2VV6 A;  4HJ6 A;  1GSX A;  4WL9 A;  5AVE A;  3NOP C;  3F1O B;  2CMN A;  2VV7 A;  1OJG A;  2K7S A;  4I3A A;  3BY8 A;  5HWV A;  5HDC A;  3G6O A;  2PD8 A;  5A8B A;  3HJI A;  2W0N A;  4R70 A;  4YWZ A;  1VB6 A;  3GDI A;  1Y28 A;  3IS2 B;  5J4E A;  4GW9 A;  1V9Z A;  5HDD A;  5G4Z A;  4GHI A;  4R3A A;  3PYP A;  5F5Y A;  2B02 A;  3F1P A;  2HV1 A;  3RTY A;  1KOU A;  4WF0 A;  1T18 A;  2PR5 A;  4H6J B;  2QJ7 A;  3MFX A;  1V9Y A;  2KX6 A;  3NOU C;  3RH8 B;  3F1O A;  1F9I A;  4JGP A;  4L9F A;  3LIE A;  5DJT A;  4WN5 A;  3UMD A;  1UGU A;  2M1C A;  3LIF A;  3EWK A;  1T1B A;  3A0V A;  2QHK A;  2J80 A;  4KUK A;  2WKQ A;  5IS1 A;  5J3W A;  2L1M A;  3LID A;  4L9E A;  2V1B A;  1DP6 A;  5F69 A;  3IS2 A;  5HD5 A;  3UB9 A;  2GJ3 A;  1MZU A;  3FG8 A;  2JN7 A;  4HNB A;  4RQ9 A;  1T1C A;  4HJ4 A;  1OTA A;  1TS7 A;  2D02 A;  4XT2 B;  3H9W A;  1ODV A;  4R38 A;  3MXQ A;  4NXB A;  2WKR A;  4E04 A;  2VLG A;  4F3L B;  4H6J A;  1S1Z A;  4EW7 A;  1TS6 A;  2PD7 A;  1XJ4 A;  5IU1 A;  4I39 A;  4GS9 A;  2EA9 A;  5HD3 A;  2WKP A;  3ICY A;  4BBT A;  3KX0 X;  2PYR A;  1S4R A;  4LRY C;  3H7W B;  3A0S A;  2V1A A;  2BAS A;  3ULF A;  2ZOH A;  2PYP A;  3D72 A;  1TS8 A;  4HOI A;  4HP9 A;  2OWJ A;  3LUQ A;  5KIZ A;  1X0O A;  3VE3 A;  1XJ3 A;  1BYW A;  3SW1 A;  4BBU A;  4B9O A;  3H82 B;  3GEC A;  2A24 B;  4HHD A;  3LIC A;  1N9O A;  2Z6C A;  4XT2 A;  2PDR A;  4KQD A;  5J7E A;  1EW0 A;  3UB6 A;  4MN6 A;  3UB7 A;  3LIA A;  1XFN A;  1WA9 A;  5TBM B;  5DKL A;  3OLO A;  3BWL A;  2L0W A;  4F3L A;  1GSV A;  4LLO B;  4K08 A;  3B33 A;  2VV8 A;  2INW A;  4GCZ A;  4HIA A;  5HWW A;  4GS9 B;  4EEU A;  4MN5 A;  3H7W A;  5HZH A;  4EER A;  4PKY A;  2PHY A;  4EQ1 A;  1LL8 A;  3BY9 A;  3UE6 A;  2VEA A;  2OOL A;  3C8C A;  1D06 A;  2L4R A;  3MQO A;  3E4O A;  1NWZ A;  3EEH A;  3F1N A;  4I38 A;  2R78 A;  2QWS A;  1OTI A;  4L9G A;  5EFW A;  3H82 A;  1F98 A;  2A24 A;  4PKY G;  2JHE A;  4EES A;  3K3C A;  1S1Y A;  1TS0 A;  2P7J A;  5DKK A;  3MR0 A;  3CLO A;  4HI4 A;  4M4X A;  5TBM A;  1OTD A;  4NXE A;  1P0Z A;  3P7N A;  4NXF A;  4JGR A;  2V9A A;  1XJ6 A;  1S67 L;  1P97 A;  2PR6 A;  5F68 A;  3ZQ5 A;  4HH2 A;  5F6A A;  3LYX A;  1OTB A;  4LRZ E;  1LSX A;  3K3D A;  4LRX C;  4BBV A; 
#chains in the Genus database with same CATH topology
 5CEC A;  3IF5 A;  3GSG A;  1PNE A;  2V20 A;  3LY4 A;  4OP8 A;  3F1N B;  1ES3 A;  1ZKJ A;  4UHU A;  2WAE A;  3LIB A;  4N1H A;  1XA7 A;  3SS4 A;  1BLH A;  1M6K A;  4JGQ A;  2A3U A;  5FQI A;  5MC7 A;  4XXR A;  2XH9 A;  3I7J A;  3WS2 A;  2ZL1 B;  4IHQ A;  4X6T A;  3IH9 A;  1N9L A;  1HVB A;  4WUJ A;  5HFO A;  3HJK A;  1W7F A;  4ZAM A;  4Y0U A;  4IUH A;  2Y2L A;  4G3V A;  3E2K A;  3IHB A;  2D01 A;  5FAT A;  3S7P A;  3N4I A;  4A5R A;  4OH0 A;  5CGX A;  2HP6 A;  1L0D A;  2PBY A;  1UWN X;  4E3J A;  3IBJ A;  2ZOI A;  3VMA A;  1SHV A;  1JTD A;  4NKP A;  4UA7 A;  2OLV A;  3T50 A;  3EGX C;  4KZ5 A;  4YFM A;  2O9A A;  3C2W A;  4HY8 A;  2H0Y A;  1LL9 A;  1DY6 A;  3MZE A;  2W3G A;  5DVA A;  1VET A;  5E2E A;  1MWR A;  3IWI A;  4S2P A;  3PHY A;  2WGW B;  2E8I A;  4DJ2 A;  5EEC A;  1ES5 A;  3V3R A;  3PAE A;  5FDS A;  3TJZ C;  3NOT C;  2XF3 A;  1XPB A;  2DCF A;  3NEC A;  3Q07 A;  3LI9 A;  1BLS A;  1K57 A;  4JXS A;  1C3B A;  2PU4 A;  5EVI C;  3UE3 A;  1YMS A;  5GHY A;  3KSG A;  4NG2 A;  1YSQ A;  3S7O A;  1DP9 A;  1K56 A;  3BFC A;  5FQJ A;  2WKE A;  1MKM A;  2ZMV A;  3SZT A;  4KZ6 A;  3T4T A;  1E4D A;  5CGS A;  3EQU A;  4GN2 A;  3WS4 A;  3LI8 A;  1Z09 A;  3ITA A;  4KG5 A;  2ZBB A;  3HBR A;  2DMW A;  3MSH A;  1XGI A;  1SKO A;  2B5R A;  1XXM A;  4HJ6 A;  3HL9 A;  1DJC A;  3B3X A;  5AVE A;  4CLC D;  3F1O B;  2LB5 A;  3W4O A;  3IF6 A;  4OOY A;  1IYP A;  1H8M A;  5FAS A;  1MY8 A;  1PW8 A;  4ETX A;  4HBT A;  2XDM A;  3OPL A;  1BZA A;  2K2N A;  3HUM A;  4D60 A;  3K2N A;  4JBF A;  2ZC4 B;  1ONG A;  3FWL A;  1K4F A;  1V9Z A;  4Q0I A;  4R3A A;  3PYP A;  1S0W A;  5A90 A;  2ZMF A;  3LR4 A;  1ERM A;  2ZC7 A;  5E2F A;  3CUE C;  4GDB A;  2KOI A;  4JKT A;  1YM1 A;  4NK3 A;  3OBF A;  5EVI D;  2XGN A;  3KYZ A;  5EOO A;  4DXB A;  3SS5 A;  4FOF A;  2KX6 A;  4M3K A;  4IED A;  3ZHH A;  1G6O A;  3R7W A;  2PT7 A;  4JGP A;  2O9C A;  3KO6 A;  3UMD A;  2ZM8 A;  1UGU A;  4DE1 A;  1NRF A;  3N8L A;  1T1B A;  3A0V A;  4MNR A;  3IH8 A;  4KQR A;  2WGI A;  2I72 A;  3LID A;  4L9E A;  2V1B A;  2IWB A;  1PI5 A;  1CQA A;  3T1S A;  3S7Q A;  2GJ3 A;  1MZU A;  4HNB A;  2Y2P A;  1M40 A;  5DTK A;  4BWI A;  4E3O A;  2D02 A;  2J3W A;  5L2F A;  1KGE A;  2XRN A;  3HLW A;  3MXQ A;  1SKF A;  4Y15 A;  1FR6 A;  5FQM A;  1PZP A;  2UV0 E;  3A3D A;  3KSH A;  1QME A;  4Y3I A;  2QMI A;  4UAA A;  4F3L B;  3PXP A;  5CX7 A;  1BUL A;  4EW7 A;  5IU1 A;  2A2L A;  2EA9 A;  3T4Q A;  5K5B A;  3Q1F A;  2PYR A;  1S4R A;  3FPW A;  2G2U A;  3LR3 A;  3S7N A;  3NC8 A;  2VKS A;  4HP9 A;  1FOF A;  2Y8H A;  4PM7 A;  1PZO A;  4CPK A;  5FI7 A;  3Q7V A;  3SW1 A;  2W1T B;  4ZJ2 A;  4LV3 A;  4R4R A;  5CHU A;  1KE3 A;  1PYY A;  1N9O A;  4XT2 A;  4DDS A;  2PDR A;  3T1Q B;  1RCJ A;  4WMC D;  3MMH A;  4B4Z A;  3UB6 A;  4FSF A;  1WA9 A;  3BWL A;  3PBO A;  5IT5 A;  1BLC A;  1GSV A;  4LLO B;  5HAI A;  4U3T A;  3TW8 A;  3ZYT A;  2Q0O A;  4Y0T A;  5GLA A;  4GCZ A;  3CG5 A;  5JYP A;  1MC0 A;  1F2K A;  4PM6 A;  4EQ1 A;  4OPR A;  2ZQ9 A;  1MWT A;  3DW0 A;  2EX8 A;  1ZC2 A;  1IOU A;  1LL8 A;  2NUP C;  2OOL A;  2EX9 A;  3DWK A;  3E4O A;  3C4P A;  3O5Y A;  2EWW A;  1OTI A;  4L9G A;  2Y55 A;  5HAQ A;  1N4O A;  1KGF A;  3JVV A;  2W1R A;  2A24 A;  4EES A;  1CJF A;  1EWZ A;  4AFI A;  2P7J A;  1PW1 A;  1FSW A;  3G35 A;  4HI4 A;  5TBM A;  3QNC A;  4NXE A;  2GZA A;  3PBT A;  2J3T C;  4QHC A;  1P0Z A;  4OKP A;  3ZG5 A;  1HZO A;  2Y2G A;  4DRT A;  3VOY A;  1P97 A;  1K4E A;  2PR6 A;  4R3B A;  4IBX A;  3ZQ5 A;  2WYX A;  4HH2 A;  5F6A A;  2XR0 A;  4O01 A;  4WZ4 A;  1YAX A;  4LRZ E;  1L0G A;  5TGF A;  3P01 A;  1D1J A;  1CEF A;  1KVM A;  5AQ7 A;  2R9X A;  1OT9 A;  3VFF A;  2Y59 A;  3VE4 A;  2W27 A;  2JE5 A;  3O86 A;  3TE8 A;  1LT0 A;  1ALQ A;  4LEN A;  5HAP A;  3ZFZ A;  4EWF A;  4PAU A;  3BLS A;  3FZC A;  3NBL A;  2HF6 A;  1UWP X;  3V67 A;  2Y2M A;  3IXG A;  3IXH A;  2J9O A;  5HAR A;  2P74 A;  4MCW A;  3BM6 A;  5GHZ A;  5HPF A;  1K55 A;  4BD0 A;  3EGD C;  1OTE A;  3QP5 A;  5G4Y A;  2WZX A;  2VGL M;  5L8M A;  3PR6 A;  3QP1 A;  3IWO A;  4P6B A;  4HBU A;  2X01 A;  3GRJ A;  5CTM A;  2XFT A;  2ZD8 A;  2J3T D;  1I5Q A;  3UME A;  2CC1 A;  4EEP A;  5CGW A;  4FH4 A;  4WZ5 C;  3WWX A;  4MLL A;  4R1G A;  5CXW A;  1SKO B;  4KQO A;  3OPR A;  3UDI A;  4DMZ A;  1PWG A;  4NXG A;  4RX3 A;  3IF6 B;  2KDK A;  5HSQ A;  1ESU A;  3ZNY A;  3DBA A;  3UO9 A;  2QKP A;  3P09 A;  1GA0 A;  5AJG A;  1XA1 A;  4OQG A;  5E43 A;  3ZG7 B;  1VM1 A;  2GNX A;  5KZH A;  4K91 A;  4PMA A;  2YKH A;  1PIO A;  2XA7 M;  5HDS A;  3IXB A;  4ZTK A;  5F1G A;  4UEY A;  3NUL A;  3WS0 A;  1S66 L;  1NXY A;  1Y54 A;  4IVK A;  3FKV A;  4LPZ A;  4WEJ A;  2HP5 A;  1TDG A;  4EXO A;  4I5S A;  4D2O A;  3T12 B;  3QP4 A;  1N9N A;  2XSS A;  1S4S A;  4Y13 A;  2MJ6 A;  3UPO A;  2GDN A;  4GLQ A;  4O8G A;  3WRZ A;  1YSP A;  2HP9 A;  1PI4 A;  5D3O A;  4X25 A;  4R23 A;  2VV7 A;  2J8Y A;  3MS6 A;  4Y5F A;  3R7W B;  2X71 A;  3IQA A;  2WK0 A;  4ARZ A;  2H0T A;  2K7S A;  4QY6 A;  5HWV A;  1G6A A;  5HW3 A;  3BEB A;  2ZQ7 A;  2PD8 A;  3WS1 A;  3A3F A;  4ETZ A;  5LBR A;  2W0N A;  1K38 A;  4R70 A;  3T1X A;  1VB6 A;  3GDI A;  1G5U A;  1I2S A;  1Y28 A;  1YT4 A;  4U0T A;  4JXG A;  5EM1 A;  5FQ9 A;  1FQG A;  3L7H A;  4WEK A;  4Y0O A;  3VOZ A;  1PRQ A;  5GHX A;  3HLB A;  3GQZ A;  4GOG A;  5G4Z A;  4GHI A;  3GR2 A;  3T4L A;  1CEG A;  1KE4 A;  3ZGA B;  5F5Y A;  2VX8 A;  3PBN A;  5FI2 A;  3F1P A;  3IXD A;  2JC7 A;  1IKG A;  5GLD A;  1KOU A;  4WF0 A;  4X1M A;  3C38 A;  2V2F F;  1JWZ A;  4N9K A;  4WBG A;  3SH9 A;  4ZDX A;  5A93 A;  1G68 A;  1V9Y A;  3RH8 B;  3GV9 A;  3DAV A;  5GL9 A;  4WN5 A;  5KSC A;  1FR1 A;  3QHY A;  5FA7 A;  4ZRR A;  2QHK A;  3PBS A;  2J80 A;  5CEB A;  2WKI A;  3Q81 A;  3UB5 P;  2ZC5 B;  4OPZ A;  3RXW A;  3D3O A;  4MMN A;  2WAD A;  3HRE A;  3IS2 A;  5DTT A;  4LV1 A;  4BL2 A;  3UB9 A;  3BRM A;  3Q7V B;  3UDF A;  1ONH A;  4RQ9 A;  4X68 A;  3ZG8 B;  4GD6 A;  5C5K A;  1K57 C;  2ZQ8 A;  4RX2 A;  4XT2 B;  4RVA A;  4Y2F A;  1KDS A;  4NXB A;  2Y2N A;  5FEF A;  2WKR A;  4OPQ A;  1RGZ A;  2JKG A;  4E04 A;  4OLD A;  4LCM A;  4Q8I A;  1P9R A;  1NLY A;  3MXS A;  3HUO A;  1VEU B;  4GS9 A;  2FFY A;  1GA9 A;  4UQI S;  2FFF B;  3ICY A;  4BBT A;  3KX0 X;  3N6I A;  2GX5 A;  2V1A A;  3MZD A;  5M18 A;  4G3W A;  3MKE A;  3D72 A;  4CLC E;  3SOI A;  2P9V A;  1FCN A;  3IF6 C;  3G4P A;  5I94 A;  1YLW A;  4E3M A;  4KQQ A;  4ESP A;  4BBU A;  3TRC A;  1KGG A;  3GEC A;  1L0E A;  4L0L A;  2A24 B;  3BFD A;  4HHD A;  1YQS A;  3MFD A;  2P08 A;  2Y2I A;  2JKF A;  4OLG A;  5J7E A;  2VZW A;  3Q82 A;  1S6R A;  5TBM B;  1SCW A;  3AGD A;  1FSY A;  2Y2K A;  3ITB A;  2B18 A;  2Y4A A;  1HD8 A;  2OV5 A;  3H7W A;  4CJN A;  2QYB A;  2WZZ A;  1JTG A;  5FL3 A;  4PKY A;  5AQ9 A;  5CTN A;  4QD4 A;  2V1Z A;  3BY9 A;  5E2H A;  3UE6 A;  3BQA A;  4P85 A;  5EE8 A;  3C4O A;  2XQZ A;  1D06 A;  2L4R A;  1O7E A;  3UE1 A;  3MQO A;  4QU3 A;  4R4S A;  4KZ3 A;  2W3H A;  3F1N A;  2R78 A;  1E3U A;  2Y79 A;  5EFW A;  1NJ4 A;  1GHM A;  2E8J A;  1FCO A;  4PKY G;  4WMC A;  2JHE A;  2XLN A;  4B88 A;  5EUA A;  1Q2Q A;  4PM9 A;  4PPR A;  3MR0 A;  2V8C A;  4BQM A;  4RYE A;  3CLO A;  3T4J A;  3HLF A;  4XUX A;  4KZ4 A;  1LLB A;  3VV4 A;  2VGJ A;  1YMX A;  4NXF A;  5BOH A;  4S2M A;  5A92 A;  4JGR A;  4BEN A;  5F68 A;  3GTC A;  3LEQ A;  1ZTU A;  3LYX A;  3UY6 A;  3G31 A;  4OOL A;  3CHW P;  4BL3 A;  3T4S A;  4WYY A;  1L2S A;  3UPP A;  4JF4 A;  5GLC A;  4WLA A;  2H28 A;  3W8K A;  3FC7 A;  3IX3 A;  4HES A;  3DTM A;  1DP8 A;  3VSL A;  3GVB A;  3LGO A;  3E4P A;  3BLM A;  1W8Y A;  1NRJ A;  3HUN A;  3LY3 A;  4ZJ3 A;  3VP1 A;  1JNU A;  2YKF A;  4ME4 A;  3AGE A;  4YOF A;  4HH3 A;  4EU0 A;  2IWD A;  4G3K A;  1OT6 A;  4GKU A;  5TR7 A;  4EUZ A;  1CK3 A;  2C6W B;  4CQH A;  2JCH A;  4II7 A;  4JXV A;  2I9V A;  2EX6 A;  1YLJ A;  3G30 A;  2XRO A;  3FPV A;  3MQQ A;  1FIK A;  5U47 A;  2G7U A;  3VSK A;  3VFH A;  1NY0 A;  2XD1 A;  4KUO A;  3O88 A;  4KZB A;  1ZG6 A;  4QJG A;  1KE0 A;  5TFQ A;  3PTE A;  1JVJ A;  2VGK A;  3IX4 A;  3LFV A;  2ZQD A;  3A3E A;  3JPU A;  4HJ3 A;  3DWZ A;  1XFQ A;  3LO7 A;  5IHV A;  4I3J A;  4DF6 A;  1ESI A;  1RP5 A;  4YIN A;  4Z1W A;  3U4L P;  2Z6D A;  3LCE A;  3OPP A;  1NLZ A;  3MKF A;  2OWH A;  3NHQ A;  4HQA A;  4UA9 A;  3MF0 A;  3NJA A;  1IEM A;  2XEP A;  4X56 A;  4YNR A;  4ARZ B;  3ZNT A;  3M2K A;  3HLD A;  4EET B;  1YLP A;  2HDR A;  3Q7Z A;  3CAX A;  2Y91 A;  3ZCZ A;  1A0K A;  3IBR A;  4JF6 A;  3IHA A;  4IBR A;  4KEN B;  1DRM A;  5L07 A;  2Z2M B;  1T19 A;  2G2W A;  4OOM A;  3HLC A;  4LGW A;  4GHI B;  1OJ5 A;  1WYB A;  4E3K A;  4C75 A;  4KZ7 A;  1CI9 A;  4E6W A;  3F1P B;  3A3J A;  1ES2 A;  1GHI A;  5FAO A;  1PWD A;  3P98 A;  5F83 A;  3EQV A;  4EBN A;  2A49 A;  2PBD P;  4P0M A;  4C6Y A;  2VV6 A;  3MXR A;  1DJA A;  3UE0 A;  1KVL A;  1XX2 A;  4WL9 A;  4X69 A;  5AQB A;  2VJW A;  3NOP C;  3SH8 A;  1OJG A;  1VET B;  1YLT A;  4I3A A;  3V50 A;  5HDC A;  4JF5 A;  3G6O A;  2ZC6 B;  5E2G A;  4OQ0 A;  4S2N A;  4YWZ A;  4N1X A;  1W63 Q;  2HDU A;  1BUE A;  2O0Y A;  5EOE A;  2HZ5 A;  1W8Q A;  3IS2 B;  4PM8 A;  1K55 C;  3FKW A;  1GCE A;  5J4E A;  2Y2H A;  4GW9 A;  3ISG A;  4H8R A;  2QZ6 A;  1XGJ A;  1SDE A;  2IA2 A;  2B95 A;  3C5A A;  2EWV A;  4BLM A;  1Z6F A;  3VP2 A;  2PR5 A;  1W79 A;  5HX9 A;  1IYO A;  2QJ7 A;  3FYZ A;  3MFX A;  3NOU C;  1F9I A;  3W4Q A;  3V3S A;  3LIE A;  3FV7 A;  2Q9M A;  2M1C A;  3LIF A;  1K0K A;  2EX2 A;  4IVI A;  2P9V B;  1DP6 A;  4EUV A;  2JN7 A;  3UN7 A;  3T4O A;  4KZA A;  2H10 A;  3O87 A;  1K54 A;  1T1C A;  4HJ4 A;  5AQA A;  1OTA A;  1BLP A;  4LCL A;  1TS7 A;  4E3N A;  1ODV A;  4R38 A;  3LEZ A;  4C3Q A;  3RXX A;  2ACG A;  5GLB A;  2VLG A;  3BW6 A;  4E6X A;  2J9P A;  3MZF A;  4H6J A;  4MDZ A;  2PD7 A;  3NI9 A;  4I39 A;  3ZVW A;  4JPM A;  4FCF A;  5HL6 A;  4O0P A;  4Y7P A;  2PU2 A;  3V5M A;  1ZHH B;  1TVF A;  4UA6 A;  1Q2P A;  3H7W B;  1P9W A;  3A0S A;  4LRY C;  2HDS A;  1PWC A;  2BAS A;  4DE2 A;  5KMW A;  1J9M A;  3C7U A;  1HTZ A;  2ZOH A;  5FQK A;  2DNS A;  1TS8 A;  4HOI A;  3VP0 A;  3KYQ A;  4WM9 A;  3BFE A;  5FAQ A;  1X0O A;  4BMW A;  3VE3 A;  1XJ3 A;  1BYW A;  2XK1 A;  4JXW A;  2QPN A;  1KDW A;  1ERO A;  3LIC A;  2Z6C A;  3DTE A;  3VP3 A;  4KQD A;  5DF9 A;  1AXB A;  5L09 A;  3IWQ A;  3UPN A;  4MN6 A;  3LIA A;  5DKL A;  4FUW A;  3E0Y A;  2VV8 A;  4CLC A;  2INW A;  2Y2Q A;  4HIA A;  3BQ8 A;  5F1F A;  5HWW A;  4MN5 A;  4FD8 A;  4U0X A;  3UDX A;  4PHT A;  4CLC C;  5HZH A;  5FAP A;  5EV0 A;  3QNB A;  4EER A;  2M7U A;  1JWV A;  1H5X A;  2PHY A;  1GHP A;  2ZM0 A;  4OQH A;  2M7V A;  2C5W B;  2VEA A;  1Y4O A;  2Q9N A;  3S22 A;  5HL1 A;  2X02 A;  4DE3 A;  1NWZ A;  3EEH A;  1LL5 A;  2W3D A;  4NEE D;  3OCL A;  4I38 A;  2QWS A;  5KSH A;  3SH7 A;  4QWO A;  5CHM A;  3H82 A;  4P87 A;  4N9L A;  1BTL A;  1LI0 A;  3CPT A;  4K0W A;  2NUT C;  4HEF A;  3KSF A;  1MPL A;  4X55 A;  1S1Y A;  4FH2 A;  5EVE A;  1STZ A;  2ZLY A;  4MBF A;  1OTD A;  3LR0 A;  4RA7 A;  5EVI A;  3IT9 A;  4R0Q A;  2V9A A;  2VA0 A;  1ES4 A;  1S67 L;  1MWU A;  2HPB A;  1IYQ A;  4KZ9 A;  1L0F A;  2ZQA A;  2R9W A;  1EI5 A;  3TOI A;  3ZG9 B;  1LSX A;  4F94 A;  1BSG A;  4LRX C;  4KG6 A;  4BBV A;  1NYM A;  1LHY A;  4JGO A;  5EVL A;  1T1A A;  1LSV A;  4B93 A;  3U2A A;  1G28 A;  3M2J A;  4GDN A;  2W3F A;  4GD8 A;  4EQI A;  3GMW A;  4DE0 A;  3BYD A;  1DJB A;  3A0R A;  2Y2J A;  5DJU A;  3E4Q A;  4HP4 A;  3D4F A;  4I3I A;  2J7V A;  2V0U A;  3A3I A;  2JBF A;  2ZQC A;  2V0W A;  4XUZ A;  2PAV P;  2KLI A;  3T1R A;  2BLS A;  3NIA A;  1E25 A;  1SDN A;  1XKZ A;  3S4X A;  4P6Z M;  3CUE A;  4X1L A;  1YLY A;  3BJN A;  2WGV A;  2QJ5 A;  1LI9 A;  3CI6 A;  1K56 D;  1NZO A;  1U60 A;  2V8F A;  3MJQ A;  1H3Q A;  5M1A A;  1K6R A;  3E98 A;  3W4P A;  1RGY A;  4GNU A;  2UWX A;  3UB8 A;  1K25 A;  1CF0 A;  4B4X A;  2ZC3 B;  1SZV A;  2RL3 A;  1D7E A;  4OQI A;  1W5D A;  5DTS A;  2OSU A;  1N9B A;  2O99 A;  3LR5 A;  4E3L A;  4MBK A;  2ZL1 A;  5JYO A;  1AWI A;  5HWT A;  4DJ3 A;  2HJ9 C;  1XP4 A;  1GSW A;  1H0M A;  2VGL S;  5TJJ A;  5DF7 A;  2VK3 A;  1HLU P;  4KZ8 A;  3CJM A;  3N7W A;  3CWF A;  1LSW A;  4ID4 A;  4R3J A;  1O07 A;  3KYE A;  5FI6 A;  5I5L A;  5AVF A;  1BT5 A;  4OON A;  3VOL A;  5EPH A;  3QP8 A;  1XJ2 A;  4LV2 A;  4R6L A;  3T4K A;  1TEM A;  2W3E A;  1GSX A;  3OC2 A;  3V39 A;  3O3V A;  2CMN A;  2WGW A;  3C7V A;  4OP5 A;  5J8X A;  2K31 A;  2EFU A;  4S2O A;  3JYI A;  5CED A;  3BY8 A;  4LFU A;  3ZVT A;  3C30 A;  4MN7 A;  5A8B A;  2IWC A;  4BD1 A;  3EOI A;  4EBP A;  3HJI A;  4MBH A;  2Z2L B;  1FCM A;  2ZMA A;  2JKR I;  3M6B A;  2XA7 S;  3SS3 A;  3W2Z A;  1E3U D;  5HDD A;  1K6S A;  3CZD A;  3OPH A;  4S2L A;  4PM5 A;  5FQQ A;  1VQQ A;  2B02 A;  1F5M A;  4NET A;  5EM0 A;  5CER A;  2PRF A;  1CI8 A;  2EXA A;  2HV1 A;  1TF1 A;  3HVF A;  3EEA A;  3RTY A;  2DRW A;  2XFS A;  1VEU A;  1T18 A;  2XD5 A;  4H6J B;  3MQ0 A;  1JWP A;  4GJ4 A;  1ZG4 A;  1WE4 A;  4UQI M;  3KSI A;  3DTI A;  3D9Y A;  5M19 A;  2EXB A;  3F1O A;  3OOV A;  3E2L A;  4L9F A;  1J3W A;  5DJT A;  4QPR A;  3BFG A;  2EFX A;  3EWK A;  1MBL A;  4KUK A;  5DFY A;  3OCN A;  4K0X A;  2WKQ A;  5IS1 A;  5J3W A;  4Y17 A;  2L1M A;  2JKR M;  3UNW A;  3M6H A;  5F69 A;  1W63 M;  1YLZ A;  5HD5 A;  3FG8 A;  1IFQ A;  4X53 A;  1I2W A;  4ZJ1 A;  1H8Y A;  3VP4 A;  3PBR A;  1IYS A;  3H9W A;  4N92 A;  4GZB A;  1IEL A;  1L3L A;  3R4K A;  1MWS A;  3TG9 A;  3G2Z A;  1S1Z A;  1TS6 A;  1XJ4 A;  2ZJ9 A;  3N8R A;  5HD3 A;  3L9K A;  2WKP A;  1YPR A;  1NYY A;  4CLC B;  4Z9Q A;  3BEC A;  4DXC A;  2JKT I;  1TDL A;  1PFL A;  3RFB A;  3ULF A;  2PYP A;  5CHJ A;  3G2Y A;  1QMF A;  2BTF P;  3BFF A;  4DDY A;  2OWJ A;  3LUQ A;  5KIZ A;  4FTX A;  3CIT A;  3IX8 A;  3G34 A;  4Q0H A;  2WAF A;  4IJG A;  3B47 A;  4S2N C;  4B9O A;  2WUQ A;  1MXO A;  2P04 A;  3H82 B;  3CMZ A;  3ZDJ A;  2WKH A;  3CPT B;  1TD5 A;  4WEL A;  2OAQ 1;  3PAG A;  4Q0J A;  4E3I A;  4QY5 A;  1EW0 A;  3HLE A;  2LB9 A;  3UB7 A;  4KG2 A;  1XFN A;  3OLO A;  2L0W A;  3OZH A;  4EV4 A;  4F3L A;  3B42 A;  3TSG A;  4K08 A;  5EVI B;  3B33 A;  3G32 A;  1IKI A;  3RJU A;  3HLG A;  4OPY A;  3QP2 A;  2JKT M;  4GS9 B;  5HPI A;  4EEU A;  5DFX A;  2OLU A;  4QB8 A;  3NCK A;  4IUK A;  3QP6 A;  3WS5 A;  4GB7 A;  4O7D A;  3NY4 A;  5FDH A;  4WZ5 A;  3NDG A;  1ACF A;  3C8C A;  3PBQ A;  2HDQ A;  1OPX A;  2FZ0 A;  1H8Z A;  2H5S A;  2Y2O A;  5DF8 A;  4BJP A;  2W1T A;  1NZU A;  1F98 A;  1OME A;  4S2K A;  3DTK A;  5G18 A;  1WYC A;  4EBL A;  5CRF A;  5L10 A;  3K3C A;  4DKI A;  1TS0 A;  4LV0 A;  2OAP 1;  2BG1 A;  5DKK A;  1MKI A;  2HGV A;  5A91 A;  4M4X A;  1K54 C;  3N8S A;  2FH5 A;  3S1Y A;  4DN0 A;  4ZBE A;  3P7N A;  4MEZ A;  3AGF A;  4OVD A;  1ERQ A;  2O9B A;  1YKD A;  3ZG0 A;  1XJ6 A;  1FIL A;  3NDE A;  3WRT A;  4S2J A;  1OTB A;  4P6Z S;  4JLF A;  2HJE A;  3MBZ A;  3HCY A;  3K3D A;  5FEG A;  2RCX A;  1VHM A;  2ZM2 A;  4S2I A;  5F82 A;  3JVU A;  5FSR A;  2AVX A; 
#chains in the Genus database with same CATH homology
 1OT9 A;  4WLA A;  2H28 A;  4JGO A;  3VE4 A;  2W27 A;  3FC7 A;  1T1A A;  1LSV A;  4B93 A;  1DP8 A;  3U2A A;  1G28 A;  3F1N B;  3E4P A;  3TE8 A;  2W3F A;  1LT0 A;  3LIB A;  1NRJ A;  4PAU A;  2HF6 A;  1UWP X;  3A0R A;  3V67 A;  4JGQ A;  5DJU A;  3E4Q A;  5MC7 A;  4HP4 A;  1JNU A;  4I3I A;  2YKF A;  2V0U A;  4ME4 A;  4MCW A;  4YOF A;  4HH3 A;  2V0W A;  4EU0 A;  4IHQ A;  5HPF A;  4G3K A;  1N9L A;  1OT6 A;  3EGD C;  4WUJ A;  3HJK A;  1OTE A;  5G4Y A;  4CQH A;  2VGL M;  4IUH A;  5L8M A;  4II7 A;  2KLI A;  2I9V A;  3PR6 A;  2XRO A;  4G3V A;  3FPV A;  3MQQ A;  2G7U A;  2D01 A;  3S7P A;  4P6Z M;  3CUE A;  3BJN A;  2QJ5 A;  1UWN X;  4KUO A;  3CI6 A;  2J3T D;  3IBJ A;  3MJQ A;  1H3Q A;  3UME A;  2ZOI A;  4EEP A;  3E98 A;  3LFV A;  4HJ3 A;  4NKP A;  3T50 A;  3EGX C;  1XFQ A;  2O9A A;  3C2W A;  3UB8 A;  4HY8 A;  4I3J A;  4KQO A;  1D7E A;  4Z1W A;  2Z6D A;  2W3G A;  4DMZ A;  1NLZ A;  2OWH A;  3NHQ A;  4HQA A;  3PHY A;  4NXG A;  3MF0 A;  3NJA A;  4DJ2 A;  2O99 A;  3LR5 A;  4YNR A;  2KDK A;  4ARZ B;  5HSQ A;  3DBA A;  4EET B;  3TJZ C;  3NOT C;  2QKP A;  5AJG A;  5HWT A;  3CAX A;  4DJ3 A;  2GNX A;  2HJ9 C;  1GSW A;  3LI9 A;  2YKH A;  2VGL S;  2XA7 M;  3IBR A;  5TJJ A;  5HDS A;  1DRM A;  3UE3 A;  1T19 A;  3CWF A;  4UEY A;  4OOM A;  3KSG A;  1YSQ A;  1LSW A;  1S66 L;  3S7O A;  4GHI B;  1DP9 A;  1OJ5 A;  4LPZ A;  4WEJ A;  1MKM A;  2ZMV A;  5I5L A;  5AVF A;  3T4T A;  4EXO A;  4I5S A;  3VOL A;  3EQU A;  1N9N A;  3F1P B;  1XJ2 A;  2XSS A;  1S4S A;  4R6L A;  3LI8 A;  2MJ6 A;  4GLQ A;  4O8G A;  2ZBB A;  3T4K A;  3EQV A;  2DMW A;  2VV6 A;  1YSP A;  4HJ6 A;  2W3E A;  1GSX A;  4WL9 A;  5AVE A;  3OC2 A;  2VJW A;  3NOP C;  4CLC D;  3F1O B;  2CMN A;  2LB5 A;  2VV7 A;  1OJG A;  2K31 A;  4Y5F A;  3R7W B;  4ARZ A;  2K7S A;  4I3A A;  3BY8 A;  5HWV A;  5HDC A;  1H8M A;  3G6O A;  2PD8 A;  3C30 A;  4MN7 A;  5A8B A;  3EOI A;  4ETZ A;  4ETX A;  5LBR A;  3HJI A;  2W0N A;  4R70 A;  4YWZ A;  2K2N A;  1W63 Q;  1VB6 A;  2O0Y A;  3GDI A;  1Y28 A;  3IS2 B;  2JKR I;  2XA7 S;  3K2N A;  3W2Z A;  5J4E A;  4GW9 A;  4WEK A;  1V9Z A;  4Q0I A;  5HDD A;  5G4Z A;  4GHI A;  4R3A A;  3T4L A;  3PYP A;  2IA2 A;  2ZMF A;  5F5Y A;  2B02 A;  3LR4 A;  1F5M A;  2VX8 A;  3PBN A;  3F1P A;  2HV1 A;  3CUE C;  1TF1 A;  3EEA A;  3RTY A;  1KOU A;  2KOI A;  2EWV A;  4WF0 A;  1T18 A;  3C38 A;  2PR5 A;  3OBF A;  3MQ0 A;  4H6J B;  4GJ4 A;  3KYZ A;  4UQI M;  3KSI A;  2QJ7 A;  3MFX A;  1V9Y A;  4FOF A;  2KX6 A;  3NOU C;  3RH8 B;  3F1O A;  3OOV A;  1F9I A;  1G6O A;  3R7W A;  2PT7 A;  4JGP A;  4L9F A;  3LIE A;  5DJT A;  2O9C A;  3KO6 A;  4QPR A;  4WN5 A;  3UMD A;  1UGU A;  2M1C A;  3LIF A;  3EWK A;  1T1B A;  3A0V A;  4ZRR A;  2QHK A;  3PBS A;  2J80 A;  4KUK A;  5DFY A;  3OCN A;  2WKQ A;  5IS1 A;  5J3W A;  2L1M A;  3LID A;  4L9E A;  2V1B A;  2JKR M;  1DP6 A;  3D3O A;  4MMN A;  5F69 A;  1W63 M;  3IS2 A;  4EUV A;  5HD5 A;  3S7Q A;  3UB9 A;  2GJ3 A;  1MZU A;  3FG8 A;  2JN7 A;  4HNB A;  3T4O A;  4RQ9 A;  1IFQ A;  5C5K A;  1T1C A;  4HJ4 A;  1OTA A;  4BWI A;  1TS7 A;  2D02 A;  2J3W A;  4XT2 B;  3PBR A;  3H9W A;  1ODV A;  4R38 A;  2XRN A;  4Y2F A;  3MXQ A;  4NXB A;  3R4K A;  2WKR A;  3KSH A;  4E04 A;  2VLG A;  3BW6 A;  4Y3I A;  1P9R A;  1NLY A;  4F3L B;  4H6J A;  3PXP A;  5CX7 A;  1S1Z A;  4MDZ A;  4EW7 A;  1TS6 A;  2PD7 A;  1XJ4 A;  5IU1 A;  4I39 A;  2A2L A;  2EA9 A;  4GS9 A;  5HD3 A;  2WKP A;  4UQI S;  5HL6 A;  3T4Q A;  3ICY A;  4O0P A;  4BBT A;  4CLC B;  5K5B A;  3KX0 X;  2PYR A;  1ZHH B;  1S4R A;  3FPW A;  4LRY C;  3H7W B;  1P9W A;  3A0S A;  2JKT I;  2GX5 A;  2V1A A;  3LR3 A;  2BAS A;  3S7N A;  3RFB A;  3ULF A;  4G3W A;  2ZOH A;  2PYP A;  3D72 A;  1TS8 A;  4HOI A;  2VKS A;  4HP9 A;  4CLC E;  3KYQ A;  2OWJ A;  2Y8H A;  3LUQ A;  5KIZ A;  1X0O A;  3CIT A;  4Q0H A;  4BMW A;  3VE3 A;  1XJ3 A;  1BYW A;  3SW1 A;  4BBU A;  3TRC A;  2W1T B;  4IJG A;  3B47 A;  4B9O A;  2P04 A;  3H82 B;  4L0L A;  3GEC A;  2A24 B;  4HHD A;  3LIC A;  1TD5 A;  1N9O A;  2Z6C A;  4XT2 A;  4WEL A;  2OAQ 1;  4Q0J A;  2PDR A;  2P08 A;  4KQD A;  5DF9 A;  5J7E A;  3MMH A;  1EW0 A;  2VZW A;  2LB9 A;  3UB6 A;  4FSF A;  4MN6 A;  3UB7 A;  3LIA A;  1XFN A;  1WA9 A;  5TBM B;  5DKL A;  3OLO A;  3BWL A;  3PBO A;  2L0W A;  5IT5 A;  4F3L A;  3B42 A;  1GSV A;  4LLO B;  4K08 A;  3B33 A;  3TW8 A;  3ZYT A;  3E0Y A;  2VV8 A;  4CLC A;  2INW A;  2B18 A;  4GCZ A;  3BQ8 A;  4HIA A;  2JKT M;  5HWW A;  4GS9 B;  5HPI A;  1MC0 A;  4EEU A;  4MN5 A;  5DFX A;  3H7W A;  4PHT A;  4CLC C;  5HZH A;  2QYB A;  4IUK A;  5FL3 A;  4EER A;  4PKY A;  2M7U A;  2PHY A;  4EQ1 A;  1IOU A;  1LL8 A;  3BY9 A;  2M7V A;  3UE6 A;  3BQA A;  2NUP C;  2VEA A;  2OOL A;  3C8C A;  3PBQ A;  1D06 A;  2L4R A;  1OPX A;  3MQO A;  3E4O A;  1NWZ A;  3EEH A;  2FZ0 A;  2W3D A;  3O5Y A;  2W3H A;  4NEE D;  3F1N A;  3OCL A;  2R78 A;  2EWW A;  4I38 A;  2QWS A;  1OTI A;  5KSH A;  2Y79 A;  4L9G A;  5EFW A;  4BJP A;  2W1T A;  3H82 A;  3JVV A;  2W1R A;  1F98 A;  2A24 A;  4PKY G;  2JHE A;  2NUT C;  4EES A;  3KSF A;  3K3C A;  1S1Y A;  1TS0 A;  4AFI A;  2OAP 1;  2P7J A;  5DKK A;  3MR0 A;  1STZ A;  3CLO A;  2HGV A;  3T4J A;  4HI4 A;  4M4X A;  5TBM A;  1OTD A;  3LR0 A;  4NXE A;  2GZA A;  3PBT A;  3VV4 A;  2FH5 A;  4DN0 A;  2J3T C;  1P0Z A;  3P7N A;  4NXF A;  4JGR A;  2V9A A;  2VA0 A;  2O9B A;  1YKD A;  1XJ6 A;  1S67 L;  1P97 A;  2PR6 A;  5F68 A;  1ZTU A;  4HH2 A;  3ZQ5 A;  5F6A A;  3LYX A;  1OTB A;  4P6Z S;  4O01 A;  2HJE A;  1YAX A;  4LRZ E;  4OOL A;  1LSX A;  3HCY A;  3K3D A;  3T4S A;  3P01 A;  1VHM A;  4LRX C;  4BBV A;  3JVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...