2D02A

R52q mutant of photoactive yellow protein, p65 form
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGQDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the R52Q Mutant Demonstrates a Role for R52 in Chromophore pK(a) Regulation in Photoactive Yellow Protein
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
molecule keywords Photoactive yellow protein
total genus 34
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2d02A00
3H9WA 2CMNA 3IBRA 1D06A 2J80A 4GHIB 4I3IA 1S4RA 3F1NA 4L9EA 4I3AA 4K08A 4WF0A 3PYPA 3ULFA 2V0WA 3F1OA 4PKYA 3VOLA 2W27A 3F1OB 3VE4A 4I3JA 3LIEA 4HJ4A 4LRYC 3NOTC 2D02A 5F69A 2M1CA 5EFWA 1UGUA 3UMEA 3UMDA 5A8BA 4NXGA 1UWPX 4R38A 1F9IA 2D01A 1TS0A 1JNUA 2L0WA 2P7JA 3BY9A 2EA9A 3B33A 3IS2A 4HHDA 1Y28A 2WKPA 1LL8A 3LUQA 3MFXA 4R3AA 1GSVA 3LIFA 3BWLA 4BBUA 1DP9A 2YKFA 2V9AA 3UE6A 3LIBA 3ZQ5A 5HWVA 4B9OA 2ZBBA 3D72A 2PYPA 3UB9A 1NWZA 1OT9A 3CAXA 2QJ5A 3ICYA 1N9LA 1XJ4A 5AVEA 4EERA 4EXOA 1F98A 2KX6A 3F1NB 4BBVA 2PD8A 3MR0A 1T18A 1LT0A 4LRXC 1V9ZA 2V1BA 4YWZA 2VV6A 4JGOA 3BY8A 3UB7A 4EQ1A 1G28A 3H7WB 5HDCA 5TBMA 3SW1A 5DKKA 1N9NA 2YKHA 3LYXA 3OLOA 3NOPC 5F5YA 2GJ3A 1T1CA 3EEHA 4XT2B 4GCZA 4H6JA 4EEPA 5J7EA 3T50A 5AVFA 5HDDA 1TS8A 1UWNX 2H28A 4KQDA 4KUKA 3K3CA 3GECA 1GSXA 1OTDA 2K7SA 5HZHA 1LSXA 5G4ZA 4HY8A 5DJTA 4R70A 5HD3A 4E04A 1D7EA 1V9YA 2QJ7A 2Z6CA 1LSWA 3VE3A 1MZUA 2PYRA 3LICA 4MN6A 5IU1A 4L9FA 4EEUA 2QHKA 2JHEA 2PR6A 3H82A 3HJIA 1N9OA 3K3DA 4M4XA 2Z6DA 4XT2A 5J3WA 3C2WA 1OTEA 2V0UA 1S67L 2INWA 2PHYA 3CLOA 3H7WA 1WA9A 4HJ3A 4HIAA 3LIDA 3MJQA 3RTYA 4F3LA 3E4QA 1GSWA 1OTBA 2B02A 4JGPA 3P7NA 4F3LB 5DJUA 5IS1A 1OJGA 2VV7A 1OTIA 3CWFA 5HDSA 5HSQA 3C8CA 4DJ2A 2VV8A 4WUJA 1T1BA 4I38A 2A24B 4HJ6A 3PHYA 4WL9A 4HH3A 3LI8A 4GHIA 3LIAA 1BYWA 5G4YA 1DRMA 4JGQA 1DP6A 4MN5A 4HP9A 4GS9B 4JGRA 1DP8A 3A0RA 4RQ9A 5DKLA 4L9GA 2I9VA 2OWJA 3NJAA 4KUOA 1LSVA 3LI9A 5F6AA 1XJ6A 3KX0X 4EESA 2WKRA 4HP4A 4GW9A 3UB6A 4NXFA 1S66L 3MXQA 1OJ5A 2WKQA 2ZOIA 5I5LA 4HI4A 1VB6A 2A24A 5HWWA 2ZOHA 4HH2A 4DJ3A 1X0OA 3NHQA 2R78A 2PR5A 5TBMB 4LLOB 3FC7A 2VEAA 3MQOA 4GS9A 2OWHA 4I39A 4HQAA 4NXBA 4EW7A 4EETB 1EW0A 2PDRA 1TS6A 3UB8A 3GDIA 2QKPA 2V1AA 3A0VA 2W0NA 3E4OA 3H82B 3HJKA 4PKYG 5KIZA 1XJ2A 2OOLA 3EWKA 4WN5A 4HNBA 4WLAA 2JN7A 1P97A 1T19A 3F1PB 2BASA 3FG8A 4LPZA 1TS7A 1XJ3A 2L4RA 4R6LA 1ODVA 2KDKA 1XFNA 3E4PA 5J4EA 2L1MA 1S1ZA 3NOUC 2QWSA 3MQQA 5F68A 4H6JB 5HWTA 5HD5A 4I5SA 3RH8B 1XFQA 1OT6A 2VLGA 3A0SA 4LRZE 1KOUA 2HV1A 1S1YA 4BBTA 3G6OA 1S4SA 1P0ZA 1T1AA 3IS2B 3F1PA 1OTAA 2PD7A 4HOIA 4NXEA
chains in the Genus database with same CATH superfamily
2Y55A 3SS5A 2ZLYA 1L0DA 1BT5A 4JXWA 4NXGA 3TOIA 2JBFA 4A5RA 4B88A 4Z9QA 2PYPA 1JWZA 4LV0A 5CXWA 2OLVA 5AQ7A 4LV2A 4OQ0A 4CLCA 4JGOA 3BY8A 5D3OA 1BUEA 1PWGA 2EFUA 4EEPA 1NZUA 3T50A 3EQUA 1K56D 1ALQA 2X02A 3CI6A 2EX9A 4YNRA 4S2KA 1K4FA 1K0KA 4BL3A 5GHXA 3K3DA 3ITBA 2XEPA 4KENB 2V0UA 4QPRA 1ERMA 4S2OA 1FCNA 5EE8A 3UE0A 4DJ2A 2ZM8A 5DTTA 5EVIA 5HAIA 3RJUA 3NCKA 4HP9A 1DP8A 3N6IA 4RYEA 1BZAA 4OKPA 4JF4A 3BFGA 4MBHA 3A3JA 1KE4A 3B3XA 4JF6A 3GV9A 2H5SA 4Y7PA 3HVFA 4JKTA 3OPLA 3MFDA 1YLWA 2VZWA 1QMFA 1TD5A 5CGWA 2Y2IA 2W0NA 1KGFA 4ME4A 4U3TA 2ZC7A 2Y79A 2RL3A 4CQHA 5HFOA 4OPYA 2ZL1B 4KQRA 3G6OA 3BRMA 2VA0A 3F1PA 4O0PA 4NXEA 3VSLA 3F1NA 3F1OB 2Y4AA 4LRYC 3GQZA 5EFWA 4ESPA 4EUVA 5CEDA 4C75A 5EOEA 3JVUA 1IOUA 3UB9A 2GX5A 5HPIA 5DFYA 1FCOA 1T18A 4JPMA 4S2IA 5FAQA 1YMXA 3IH9A 5FEGA 3T1SA 1E3UD 4IHQA 5EUAA 3VMAA 2VX8A 4OP8A 5GLAA 2XH9A 2DNSA 5CTNA 3MJQA 3E4QA 1OJGA 4HESA 4WUJA 4QJGA 4KQQA 3MKEA 3NULA 4GHIA 2LB9A 3D3OA 3ZVTA 4K91A 5HWWA 4Q0HA 4NKPA 3LR3A 2XF3A 2Y91A 1EW0A 4D60A 3FPVA 1GHMA 3HJKA 3EWKA 4HNBA 1P97A 2LB5A 2WK0A 3JPUA 4LPZA 3MXSA 3IQAA 2B5RA 3BQ8A 3O87A 2ZC6B 1CK3A 2M7UA 3VOYA 2PD7A 4PKYA 5IT5A 3NY4A 4EBLA 4JLFA 1DJAA 3SOIA 1ES4A 4R38A 3V5MA 4RVAA 2VGJA 5HX9A 3P09A 3ZDJA 1FCMA 3DTEA 1ESUA 1XXMA 5CHMA 3G4PA 3ZNYA 4EXOA 1F98A 5EVID 2Y2LA 1V9ZA 5EECA 1K56A 3Q1FA 2WKEA 4XT2B 1MWTA 4KUKA 3E0YA 4DE3A 4R70A 2M7VA 1V9YA 2PBYA 4DN0A 4MN6A 2KLIA 3H82A 2JHEA 1W63Q 3CJMA 4JGPA 4E3OA 2ZQ7A 3E2KA 5HSQA 1BLPA 2V2FF 4S2MA 3IWOA 2JKFA 5FATA 2XRNA 4DKIA 2HDUA 4RQ9A 1M40A 4BENA 2K2NA 5GL9A 1OMEA 5U47A 4DJ3A 4LLOB 4OH0A 3WRZA 1Y4OA 3MZFA 5CHJA 3LCEA 2QKPA 3A0VA 2JN7A 3KYEA 3GVBA 3TW8A 3GSGA 3HUMA 4ARZA 2L1MA 1LL5A 1Z6FA 2QYBA 2QZ6A 3SZTA 4WM9A 1KOUA 4DDYA 5FEFA 3IS2B 3BJNA 1DY6A 1PFLA 2HP9A 3BFFA 5HWVA 3QP8A 3CUEC 3FZCA 5DF9A 3VE4A 4MEZA 3S7PA 1YAXA 2D02A 2ZQAA 2WYXA 5F82A 1TEMA 4HH2A 1QMEA 4S2PA 2ZL1A 3MFXA 4KQOA 4BBUA 2ZBBA 5CECA 1YLJA 4WEKA 2Y2PA 2FFFB 2ZMVA 4BJPA 1WYCA 1HZOA 1G28A 1IKIA 3G2ZA 4P6ZM 3PBQA 5TGFA 3NOPC 4OQGA 4OONA 3QP4A 3N7WA 3KYZA 3B47A 1DJCA 1LSXA 1VEUA 4HY8A 3BLSA 3VE3A 4L9FA 4MCWA 3UDFA 4QD4A 4F94A 2UV0E 4MMNA 4O8GA 3CZDA 4IVIA 1KGGA 4ETZA 4EUZA 4X1MA 1VEUB 1HD8A 3KX0X 2ZC4B 1S66L 4ZAMA 4R3JA 2H0TA 4E3NA 2VEAA 1L0EA 2R9XA 1NYYA 1NLYA 3O88A 3KSIA 3WS5A 3LY4A 3T1RA 3EOIA 5L07A 5IHVA 1XJ3A 2Z2MB 4OP5A 2Q9MA 3G35A 2QWSA 4FH2A 4KG5A 5EM1A 1XFQA 1XKZA 3BM6A 1T1AA 3C30A 3CHWP 4PHTA 1C3BA 3P01A 1M6KA 2K31A 2WGIA 1IFQA 5E2EA 1TDLA 4ZJ2A 4LFUA 5L8MA 3UMDA 1VHMA 3BY9A 2EA9A 3B33A 3A3FA 4WZ5A 1CF0A 1GSVA 4GDNA 1NRFA 2ZMAA 1VQQA 5FQKA 4QB8A 4PAUA 1YLPA 2WGVA 1KVLA 1N9NA 4YFMA 2UWXA 4KQDA 5EV0A 1H5XA 3BFEA 1IYPA 4EEUA 1FILA 2FFYA 4MBKA 1N9OA 3NDEA 1I2WA 3H7WA 3S4XA 5E2GA 2HGVA 2R9WA 3OPPA 5CGXA 4OQIA 4E3IA 1DJBA 4FOFA 1K4EA 3OPRA 3N4IA 3HREA 1PW1A 5AQ9A 1SZVA 3FV7A 3MQOA 1YPRA 4EETB 1L3LA 2PDRA 4X25A 4JXVA 3UNWA 1MKMA 3T4LA 1N4OA 1BULA 2BASA 2G7UA 5FQJA 3PBRA 4WZ5C 3G31A 3RH8B 3A0SA 2HV1A 2J80A 4KZ4A 2GNXA 3HLFA 1S6RA 1KVMA 3L7HA 5HPFA 4BBVA 1SKFA 1JNUA 1G5UA 3T4SA 3C4PA 3D72A 3BFDA 3JYIA 3AGDA 1XJ4A 3CPTA 3PBNA 5DTSA 1U60A 3IX3A 4LRXC 5CX7A 2A49A 5CHUA 5HDCA 5TBMA 4LCLA 1O7EA 3FPWA 3OLOA 2WKHA 2EX6A 3UO9A 1P9WA 5M18A 5HD3A 1RGZA 4S2LA 2P74A 4S2JA 1SDEA 1P9RA 1ZG4A 3KSHA 2PHYA 2INWA 2RCXA 4GNUA 4F3LA 4HIAA 3LIDA 5HL1A 1H8YA 1OTBA 1ONHA 4QHCA 2VV8A 1BLHA 2HDRA 1BYWA 3NIAA 1DP6A 4Y13A 3S7NA 1YLTA 2OLUA 3Q7VB 4Y15A 3NI9A 3MKFA 3HLDA 4ZBEA 3NHQA 1YLZA 2ZMFA 4X1LA 5FA7A 4HBTA 2OAQ1 3H82B 2JE5A 5HW3A 3DTIA 3OC2A 3FG8A 4WEJA 4UA7A 1J3WA 3W4OA 4QU3A 1VETA 4ZJ3A 3MXRA 3UMEA 5KSHA 1OTAA 3LUQA 2P9VB 2WAEA 3ULFA 2O99A 4JBFA 4WMCD 2XD1A 1XA1A 5J8XA 3LY3A 2OSUA 3ISGA 3QP2A 4P87A 4R23A 1PI4A 5A8BA 2P7JA 1XPBA 2ZM2A 1IYSA 2JCHA 2V9AA 1WE4A 1N9LA 2KX6A 1PRQA 2W3HA 4NETA 1KE3A 3H7WB 4GN2A 3VV4A 1SCWA 2PRFA 3EGXC 5J7EA 3VP1A 3UB5P 5HZHA 2J3TC 1H3QA 2W3GA 4E3JA 5CEBA 2PYRA 4ID4A 4M4XA 2BG1A 5KZHA 4AFIA 2HDQA 1S67L 3O86A 1XX2A 2HJ9C 3IF5A 3VP4A 3LIAA 4O7DA 4DXBA 3ITAA 1N9BA 1HTZA 5FDSA 3BYDA 2ZOHA 2IA2A 3LEZA 4NXBA 1ES5A 4XXRA 3V39A 3V50A 3KYQA 4B4XA 1TS6A 3GDIA 1HVBA 3E4OA 1ONGA 4CJNA 4ETXA 1K57C 4BD0A 4ARZB 5HARA 4R6LA 2Y59A 3PBTA 3NOUC 3IF6A 3HLBA 5HWTA 2X01A 1CQAA 1OT6A 5EVIB 1S1YA 2X71A 3O3VA 5F1FA 2A2LA 1F2KA 2W27A 5EOOA 4HJ4A 2W3EA 2EXBA 3SS4A 3ZG7B 2L0WA 1W8QA 3UY6A 3MQ0A 4HHDA 1TDGA 4OPRA 5KSCA 3UE6A 3LGOA 3Q07A 4UAAA 4EERA 1ACFA 4LGWA 4OVDA 4GKUA 3IWQA 4ZTKA 2GJ3A 2ZC3B 3SH8A 1K25A 1E4DA 5JYOA 2Y2NA 1YMSA 5G4ZA 2ZQ8A 4E04A 2Q9NA 1EI5A 4ZJ1A 2WUQA 3NBLA 3JVVA 2XGNA 5L2FA 5GHZA 2NUPC 1ZHHB 5DJUA 2VV7A 3LO7A 4HJ6A 3VFHA 5G4YA 3W8KA 1JWPA 3AGEA 5DKLA 5CGSA 4UA9A 5DFXA 2GDNA 4HP4A 3UB6A 4Y2FA 5I5LA 3IXBA 3DBAA 3PXPA 4N9LA 4QWOA 3DWKA 1PIOA 1FIKA 4RA7A 5GLCA 3M2KA 3Q82A 1XJ2A 4Y17A 3HLWA 5FAOA 5FQQA 4GJ4A 5L10A 2WZXA 3E4PA 4BL2A 5FQMA 5TR7A 4BQMA 1MBLA 3OPHA 5K5BA 1NJ4A 4LRZE 4HEFA 5CRFA 3IT9A 3UDIA 1MKIA 4IEDA 3HLEA 3U4LP 3T4OA 1CI9A 3C5AA 5F69A 4R1GA 2WKPA 1L2SA 3LIBA 4X69A 2ZJ9A 1NWZA 4KG6A 3U2AA 3IX8A 1G6OA 3MR0A 4GZBA 1LT0A 3IF6C 1FR1A 1PZPA 4L0LA 3Q7ZA 1KDSA 3LR5A 3R7WA 3EEHA 5HL6A 1VETB 2B95A 4C3QA 1K55C 4Y5FA 1LL9A 3UN7A 4DRTA 2V20A 2EX8A 2QPNA 3OZHA 1ZC2A 4UEYA 3HUNA 3ZCZA 3NDGA 3W2ZA 2ACGA 2VKSA 5AQAA 3ZG5A 3T4QA 1E25A 5LBRA 2B02A 2J9PA 2PT7A 3IHBA 1STZA 4OLDA 2J3WA 4FUWA 2IWDA 4JGRA 2EWVA 5A93A 1XGIA 3MXQA 1D1JA 5MC7A 3IXDA 3CUEA 3AGFA 4OPQA 4KZAA 4Y0OA 4GS9A 4I39A 5F83A 4ZRRA 1FR6A 3I7JA 5KIZA 2OOLA 2O9CA 3CMZA 1HLUP 1TF1A 3TG9A 3FKVA 1ODVA 4Q0IA 5AJGA 5HD5A 3T4TA 1P0ZA 3TE8A 2ZM0A 4BWIA 2J7VA 3A3EA 3ZG8B 4L9EA 1S4RA 2EXAA 3D9YA 5EM0A 3F1OA 2JKTI 3MS6A 4EWFA 3LEQA 1CEGA 2B18A 2M1CA 1CJFA 4UHUA 4E3KA 2WZZA 1JWVA 3FKWA 3KSGA 4KZ9A 3IHAA 3SH9A 3UPNA 4GLQA 5FSRA 4JXGA 3UPPA 1MXOA 3MSHA 2HF6A 2VV6A 2W1TB 1H8ZA 1K38A 3SW1A 1NZOA 5F5YA 2HPBA 4OPZA 5EVLA 4DE2A 1UWNX 3QP1A 3IX4A 3GECA 5FDHA 1PWDA 1SKOB 3HJIA 4NG2A 5HAQA 1PWCA 3C2WA 3G32A 3CLOA 4HJ3A 2XSSA 3D4FA 5IS1A 3P7NA 1MY8A 1OTIA 2XR0A 3LI8A 2ZQ9A 2I9VA 3NJAA 2XDMA 4KUOA 3ZYTA 5F6AA 2Z2LB 4WELA 5AQBA 3OOVA 1G68A 3IF6B 2A24A 2WGWB 3OCNA 3VOZA 4EBPA 2PR5A 3DW0A 3ZFZA 4Z1WA 2XFSA 4X6TA 4S2NA 3C7UA 1YKDA 3CPTB 4WBGA 3UE3A 3A3DA 1I2SA 1LLBA 3OBFA 4GB7A 3F1PB 4EBNA 1TS7A 3Q7VA 2KDKA 4FCFA 4OOLA 5EPHA 3A3IA 4NK3A 2Y2GA 4H8RA 4G3KA 3GRJA 3NECA 1D06A 2PBDP 1KGEA 3VOLA 1K57A 4P0MA 3BQAA 1LI9A 2XD5A 1W79A 3LR4A 1UWPX 3IS2A 5J4EA 4LV1A 3LIFA 3M6HA 3IWIA 1XA7A 4B9OA 1OT9A 3WS0A 5FQ9A 1GHPA 2V1BA 5A92A 4WYYA 4E3LA 3V3SA 1VM1A 1PZOA 3K3CA 4Y0UA 3P98A 3RXWA 4BLMA 5IU1A 1L0FA 3C7VA 3MZDA 2WADA 5FASA 1GA9A 4GD8A 4UA6A 1T1BA 4WL9A 4MLLA 2O0YA 4MN5A 4DDSA 1IELA 1YSPA 2C5WB 4CPKA 2V1ZA 2WKRA 3TRCA 4X55A 4B4ZA 2PU2A 1PI5A 3SS3A 2HZ5A 2IWBA 4X53A 1WYBA 2Y2OA 5C5KA 2VGKA 1MWRA 4EW7A 4YINA 2G2WA 3SH7A 2OV5A 5FI7A 2L4RA 3QHYA 4MDZA 5I94A 4XUZA 3K2NA 4O01A 4H6JB 5F68A 4IBRA 2HJEA 2JKTM 3N8RA 1S4SA 4IVKA 5DKKA 1K54C 5FAPA 3H9WA 2CMNA 5EVEA 1K55A 4I3AA 1A0KA 4LENA 1JTGA 4PM8A 5FI6A 2Y2QA 4R4RA 3NOTC 1F5MA 4II7A 1F9IA 1TS0A 2VK3A 2V8FA 2QJ5A 5DF7A 3S7QA 1OPXA 1W63M 3ZGAB 3VP2A 2YKHA 4U0XA 4X68A 2KOIA 2VGLM 4GD6A 4GCZA 4OOYA 3PBSA 4LCMA 1Q2PA 3RFBA 2H0YA 1OTDA 2AVXA 4E3MA 1XP4A 5FL3A 1MWUA 3B42A 4RX3A 4EV4A 1LSWA 3E2LA 3LICA 3CITA 1MPLA 2PR6A 2Z6DA 4UQIM 3VP3A 4Y0TA 1WA9A 4OLGA 3RTYA 5M1AA 3C8CA 3WS4A 3M2JA 4M3KA 2Y2KA 5E43A 2JC7A 3PAGA 3A0RA 3S1YA 2OWJA 4KZBA 4EESA 4Q8IA 4GW9A 3M6BA 3HUOA 3VSKA 2W1RA 3PTEA 5TBMB 1AWIA 1Q2QA 1ESIA 2CC1A 2V1AA 2XLNA 4WLAA 3QP5A 1KE0A 2JKGA 1S1ZA 5DF8A 3MZEA 2P08A 4HBUA 1BTLA 4BBTA 4WZ4A 1ES3A 1L0GA 4HOIA 5CERA 4IUHA 4I3IA 4GHIB 4RX2A 1E3UA 1GA0A 2Q0OA 1K6SA 3LIEA 2XK1A 3WRTA 1W5DA 1UGUA 1XGJA 4DE0A 2XA7S 1MC0A 4DF6A 2Y2JA 4YOFA 4KZ8A 2PD8A 4E6XA 4K0XA 4YWZA 4G3WA 5DTKA 2NUTC 3V3RA 4K0WA 3T4JA 3ZHHA 2H28A 3IBJA 2BTFP 2K7SA 3DTMA 2IWCA 4KG2A 4LV3A 2DCFA 2QJ7A 1CEFA 3O5YA 5A90A 5L09A 4IBXA 4NEED 1OTEA 3C4OA 2V8CA 2HDSA 3TSGA 4F3LB 1G6AA 5HDSA 2I72A 4N9KA 2XQZA 2XROA 4NXFA 3ZNTA 4KZ5A 5G18A 1JTDA 3G30A 2OWHA 4HQAA 4QY6A 2FZ0A 4X56A 1J9MA 4PKYG 4GOGA 2P9VA 3FYZA 4CLCB 1KDWA 2P04A 3PR6A 1XFNA 3UPOA 5E2FA 3NC8A 4P6BA 4U0TA 1W8YA 1NLZA 3BLMA 2XFTA 5EVIC 3HL9A 4PMAA 2HP5A 3IXHA 3PYPA 1SHVA 3QP6A 5GLBA 4XUXA 3QNCA 5FI2A 3EQVA 2W3FA 3HBRA 4DMZA 3HLCA 1YT4A 3E98A 1ZTUA 2DMWA 4IUKA 3UB7A 2Y2HA 3LYXA 2O9BA 1T1CA 3MBZA 4C6YA 4GDBA 2Y8HA 2E8IA 1TS8A 2WAFA 5DJTA 2BLSA 1D7EA 4R0QA 3WWXA 3Q81A 1BLSA 1YLYA 3BECA 3GR2A 2QHKA 4XT2A 1IYQA 2G2UA 3KO6A 1PW8A 3N8LA 2ZQCA 2OAP1 1IYOA 4KZ6A 2O9AA 4N1HA 3MMHA 3PHYA 1W7FA 4E6WA 1YM1A 4JGQA 4PPRA 4GS9B 1JVJA 1LSVA 4PM5A 1K54A 2ZOIA 4MBFA 1VB6A 3EEAA 4FTXA 3S22A 3CG5A 1YSQA 3T1QB 2W1TA 1T19A 1ZG6A 1YQSA 4N92A 1IEMA 3VP0A 4KZ7A 1FSWA 3MQQA 2QMIA 4I5SA 1SDNA 3V67A 1NY0A 4MN7A 2WKIA 5JYPA 3IBRA 4WF0A 3ZG0A 1IKGA 4K08A 2JKRM 1ES2A 2WGWA 2GZAA 4I3JA 2PU4A 1EWZA 3GMWA 2VGLS 4BMWA 3W4PA 1Y28A 3FWLA 3BFCA 4R3AA 4QY5A 3BWLA 1O07A 4DXCA 1Z09A 3CAXA 4Q0JA 3G2YA 4MNRA 2H10A 3IXGA 2MJ6A 4FH4A 5E2HA 1FSYA 2C6WB 1PNEA 4H6JA 3W4QA 5TFQA 4JXSA 3VFFA 1ERQA 2J9OA 3T1XA 1MWSA 1SKOA 1MZUA 1AXBA 4N1XA 1H0MA 1I5QA 5AVFA 2FH5A 4EU0A 3CWFA 4FSFA 4OQHA 3DWZA 2A24B 4JF5A 1ZKJA 2E8JA 2VJWA 4CLCC 3S7OA 4D2OA 4PM6A 3PBOA 4BD1A 3T12B 3WS1A 4CLCE 4KZ3A 3LI9A 1K6RA 2HP6A 4P85A 1OJ5A 2WKQA 3ZG9B 3QNBA 3TJZC 1GCEA 3R7WB 1X0OA 1LI0A 5BOHA 5GLDA 3LFVA 3R4KA 2ZD8A 4Y3IA 4R4SA 2EX2A 3UB8A 4P6ZS 1S0WA 1FQGA 1GHIA 4R3BA 3BW6A 4UQIS 1NRJA 4S2NC 4PM7A 5DVAA 4CLCD 3WS2A 2VLGA 4PM9A 1FOFA 4WMCA 4EQIA 5KMWA 4IJGA 5J3WA 5GHYA 3T4KA 1BLCA 1BSGA 2V0WA 1RCJA 2J8YA 2D01A 1LL8A 3LR0A 2XA7M 3HLGA 1DP9A 2YKFA 3ZQ5A 5M19A 2PAVP 1H8MA 3ICYA 5AVEA 5F1GA 3F1NB 2Y2MA 4EQ1A 4FD8A 3RXXA 3HCYA 2EFXA 1CI8A 1EROA 4G3VA 5A91A 5HDDA 3OCLA 1GSXA 4B93A 4DE1A 2JKRI 1PYYA 2Z6CA 3UDXA 3IH8A 1Y54A 3ZVWA 3C38A 3UE1A 1GSWA 5FQIA 2DRWA 1LHYA 3MF0A 4I38A 2ZC5B 4HH3A 2ZQDA 1DRMA 3BEBA 4L9GA 4OOMA 4ZDXA 2EWWA 1XJ6A 1RP5A 3EGDC 4HI4A 3PAEA 2A3UA 2R78A 3KSFA 5HAPA 3FC7A 1TVFA 1RGYA 4WN5A 3DAVA 3DTKA 5TJJA 3N8SA 5CTMA 2J3TD 3G34A 2W3DA 1NXYA 3L9KA 3GTCA 1NYMA
chains in the Genus database with same CATH topology
4IUHA 4I3IA 4GHIB 4PHTA 3P01A 2K31A 1IFQA 3LIEA 3T4OA 5F69A 5L8MA 1UGUA 3UMDA 1VHMA 4NXGA 3BY9A 2EA9A 3B33A 2WKPA 1GSVA 3LIBA 2XA7S 1MC0A 2PYPA 1NWZA 4YOFA 3U2AA 1G6OA 2PD8A 3MR0A 4PAUA 1LT0A 4L0LA 4CLCA 4YWZA 4JGOA 3BY8A 4G3WA 2NUTC 1N9NA 3LR5A 3R7WA 3T4JA 3EEHA 5HL6A 4EEPA 3T50A 3EQUA 2H28A 4KQDA 3IBJA 2K7SA 4Y5FA 3CI6A 4YNRA 2QJ7A 3O5YA 4EEUA 3K3DA 4UEYA 1N9OA 4NEED 3W2ZA 1OTEA 3H7WA 2V0UA 2VKSA 3T4QA 4QPRA 5LBRA 2B02A 4F3LB 2HGVA 5HDSA 4DJ2A 2PT7A 1STZA 2J3WA 2XROA 4FOFA 4HP9A 4JGRA 1DP8A 2EWVA 4NXFA 3MXQA 5MC7A 3CUEA 3MQOA 4GS9A 2OWHA 4I39A 4HQAA 4EETB 2FZ0A 2PDRA 2VZWA 1TD5A 4ZRRA 1MKMA 2W0NA 4PKYG 5KIZA 3T4LA 2OOLA 2O9CA 4ME4A 4CLCB 1TF1A 2BASA 2P04A 1ODVA 3PR6A 1XFNA 4Q0IA 5AJGA 2Y79A 2G7UA 4CQHA 3PBRA 5HD5A 1NLZA 3RH8B 3A0SA 2HV1A 3T4TA 3G6OA 2VA0A 1P0ZA 3TE8A 3F1PA 4O0PA 4BWIA 4NXEA 2J80A 4L9EA 1S4RA 3F1NA 3PYPA 3F1OA 2JKTI 2GNXA 3F1OB 4LRYC 2B18A 2M1CA 5EFWA 5HPFA 4BBVA 1JNUA 4EUVA 3KSGA 3EQVA 3T4SA 2W3FA 3JVUA 4GLQA 3D72A 1IOUA 3UB9A 2GX5A 5HPIA 1XJ4A 3PBNA 4DMZA 5DFYA 3E98A 1ZTUA 2DMWA 1T18A 4IUKA 2HF6A 4LRXC 5CX7A 3UB7A 2VV6A 2W1TB 5HDCA 5TBMA 3SW1A 3FPWA 3LYXA 3OLOA 5F5YA 2O9BA 1T1CA 2Y8HA 1UWNX 1TS8A 1P9WA 3GECA 4IHQA 5HD3A 5DJTA 1D7EA 2VX8A 2QHKA 4XT2A 3HJIA 1P9RA 3KSHA 3C2WA 3KO6A 2PHYA 2INWA 3CLOA 4HJ3A 2XSSA 4F3LA 4HIAA 3LIDA 3MJQA 2OAP1 1OTBA 3E4QA 5IS1A 3P7NA 1OJGA 1OTIA 2VV8A 2O9AA 4WUJA 3MMHA 3PHYA 3LI8A 4GHIA 1BYWA 2LB9A 4JGQA 1DP6A 4GS9B 3S7NA 2I9VA 3NJAA 3ZYTA 4KUOA 1LSVA 3D3OA 5F6AA 4WELA 3OOVA 2ZOIA 5HWWA 1VB6A 2A24A 3EEAA 3OCNA 4Q0HA 3NHQA 4NKPA 2PR5A 3LR3A 2ZMFA 4Z1WA 1EW0A 1YKDA 3FPVA 3UE3A 2OAQ1 3H82B 3HJKA 1YSQA 3EWKA 3OBFA 4HNBA 2W1TA 1P97A 1T19A 3F1PB 3OC2A 2LB5A 3FG8A 4LPZA 4WEJA 1TS7A 2KDKA 3MQQA 3BQ8A 4OOLA 4I5SA 3V67A 2M7UA 4G3KA 4MN7A 3UMEA 5KSHA 3LUQA 1OTAA 2PD7A 4PKYA 5IT5A 3IBRA 1D06A 4WF0A 3ULFA 2O99A 4K08A 3VOLA 2JKRM 2GZAA 4I3JA 3BQAA 2VGLS 3LR4A 5A8BA 4R38A 1UWPX 4BMWA 3IS2A 5J4EA 2P7JA 1Y28A 4R3AA 3LIFA 3BWLA 2V9AA 4B9OA 1OT9A 3CAXA 4Q0JA 4EXOA 1N9LA 1F98A 2KX6A 2MJ6A 1V9ZA 2V1BA 2W3HA 3H7WB 3VV4A 4XT2B 4H6JA 3EGXC 5J7EA 4KUKA 3K3CA 5HZHA 3E0YA 2J3TC 1H3QA 4R70A 2W3GA 2M7VA 1V9YA 4DN0A 1MZUA 2PYRA 4MN6A 2KLIA 5IU1A 3H82A 2JHEA 1W63Q 4M4XA 4AFIA 1S67L 5AVFA 2FH5A 4JGPA 4EU0A 2HJ9C 3CWFA 4FSFA 5HSQA 1T1BA 2A24B 4WL9A 2VJWA 3LIAA 2XRNA 2O0YA 4CLCC 4MN5A 3S7OA 4RQ9A 3PBOA 1YSPA 4CLCE 3LI9A 2WKRA 2K2NA 1OJ5A 2WKQA 3TRCA 3TJZC 2ZOHA 4DJ3A 2IA2A 1X0OA 3R7WB 4LLOB 4NXBA 5C5KA 3LFVA 4EW7A 3R4KA 3KYQA 4Y3IA 1TS6A 3UB8A 3GDIA 2QKPA 3A0VA 4P6ZS 3E4OA 4ETXA 2JN7A 3BW6A 3TW8A 4UQIS 1NRJA 4ARZB 2L4RA 4R6LA 4ARZA 2L1MA 3PBTA 3NOUC 4MDZA 3K2NA 2QYBA 4O01A 4H6JB 5F68A 5HWTA 4CLCD 2HJEA 2JKTM 1OT6A 2VLGA 1KOUA 1S1YA 3IS2B 3BJNA 1S4SA 5DKKA 4IJGA 5J3WA 3H9WA 2CMNA 5HWVA 3T4KA 2A2LA 3CUEC 4I3AA 2V0WA 2W27A 5DF9A 3VE4A 3S7PA 1YAXA 4HJ4A 3NOTC 2D02A 2W3EA 1F5MA 4II7A 1F9IA 2D01A 1TS0A 2L0WA 4HH2A 3MQ0A 4HHDA 1LL8A 3LR0A 2XA7M 3MFXA 4KQOA 4BBUA 1DP9A 2YKFA 3UE6A 3ZQ5A 2ZBBA 1H8MA 2QJ5A 3ICYA 5AVEA 4EERA 3S7QA 3F1NB 4WEKA 1OPXA 1W63M 2ZMVA 4BJPA 4EQ1A 1G28A 4P6ZM 2YKHA 3PBQA 3NOPC 2GJ3A 3HCYA 2KOIA 2VGLM 4GCZA 3PBSA 4G3VA 3KYZA 5HDDA 3RFBA 3B47A 1GSXA 1OTDA 3OCLA 1LSXA 5FL3A 4HY8A 5G4ZA 3B42A 4B93A 4E04A 2JKRI 2Z6CA 1LSWA 3VE3A 3LICA 3CITA 4L9FA 4MCWA 2PR6A 3JVVA 2Z6DA 4UQIM 1WA9A 3C38A 3RTYA 2NUPC 1GSWA 1ZHHB 4MMNA 5DJUA 2VV7A 3MF0A 3C8CA 4O8GA 4I38A 4HJ6A 4HH3A 5G4YA 1DRMA 4ETZA 3A0RA 5DKLA 4L9GA 4OOMA 2OWJA 2EWWA 5DFXA 1XJ6A 3KX0X 4EESA 4HP4A 4GW9A 3UB6A 1S66L 3EGDC 4Y2FA 5I5LA 4HI4A 3DBAA 3PXPA 2R78A 2W1RA 5TBMB 3KSFA 3FC7A 2VEAA 2V1AA 1NLYA 3KSIA 1XJ2A 4WN5A 4WLAA 3EOIA 5TJJA 4GJ4A 1XJ3A 3E4PA 1S1ZA 2QWSA 2P08A 5K5BA 1XFQA 2J3TD 4LRZE 2W3DA 4BBTA 1T1AA 3C30A 4HOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H9W A;  2CMN A;  3IBR A;  1D06 A;  2J80 A;  4GHI B;  4I3I A;  1S4R A;  3F1N A;  4L9E A;  4I3A A;  4K08 A;  4WF0 A;  3PYP A;  3ULF A;  2V0W A;  3F1O A;  4PKY A;  3VOL A;  2W27 A;  3F1O B;  3VE4 A;  4I3J A;  3LIE A;  4HJ4 A;  4LRY C;  3NOT C;  2D02 A;  5F69 A;  2M1C A;  5EFW A;  1UGU A;  3UME A;  3UMD A;  5A8B A;  4NXG A;  1UWP X;  4R38 A;  1F9I A;  2D01 A;  1TS0 A;  1JNU A;  2L0W A;  2P7J A;  3BY9 A;  2EA9 A;  3B33 A;  3IS2 A;  4HHD A;  1Y28 A;  2WKP A;  1LL8 A;  3LUQ A;  3MFX A;  4R3A A;  1GSV A;  3LIF A;  3BWL A;  4BBU A;  1DP9 A;  2YKF A;  2V9A A;  3UE6 A;  3LIB A;  3ZQ5 A;  5HWV A;  4B9O A;  2ZBB A;  3D72 A;  2PYP A;  3UB9 A;  1NWZ A;  1OT9 A;  3CAX A;  2QJ5 A;  3ICY A;  1N9L A;  1XJ4 A;  5AVE A;  4EER A;  4EXO A;  1F98 A;  2KX6 A;  3F1N B;  4BBV A;  2PD8 A;  3MR0 A;  1T18 A;  1LT0 A;  4LRX C;  1V9Z A;  2V1B A;  4YWZ A;  2VV6 A;  4JGO A;  3BY8 A;  3UB7 A;  4EQ1 A;  1G28 A;  3H7W B;  5HDC A;  5TBM A;  3SW1 A;  5DKK A;  1N9N A;  2YKH A;  3LYX A;  3OLO A;  3NOP C;  5F5Y A;  2GJ3 A;  1T1C A;  3EEH A;  4XT2 B;  4GCZ A;  4H6J A;  4EEP A;  5J7E A;  3T50 A;  5AVF A;  5HDD A;  1TS8 A;  1UWN X;  2H28 A;  4KQD A;  4KUK A;  3K3C A;  3GEC A;  1GSX A;  1OTD A;  2K7S A;  5HZH A;  1LSX A;  5G4Z A;  4HY8 A;  5DJT A;  4R70 A;  5HD3 A;  4E04 A;  1D7E A;  1V9Y A;  2QJ7 A;  2Z6C A;  1LSW A;  3VE3 A;  1MZU A;  2PYR A;  3LIC A;  4MN6 A;  5IU1 A;  4L9F A;  4EEU A;  2QHK A;  2JHE A;  2PR6 A;  3H82 A;  3HJI A;  1N9O A;  3K3D A;  4M4X A;  2Z6D A;  4XT2 A;  5J3W A;  3C2W A;  1OTE A;  2V0U A;  1S67 L;  2INW A;  2PHY A;  3CLO A;  3H7W A;  1WA9 A;  4HJ3 A;  4HIA A;  3LID A;  3MJQ A;  3RTY A;  4F3L A;  3E4Q A;  1GSW A;  1OTB A;  2B02 A;  4JGP A;  3P7N A;  4F3L B;  5DJU A;  5IS1 A;  1OJG A;  2VV7 A;  1OTI A;  3CWF A;  5HDS A;  5HSQ A;  3C8C A;  4DJ2 A;  2VV8 A;  4WUJ A;  1T1B A;  4I38 A;  2A24 B;  4HJ6 A;  3PHY A;  4WL9 A;  4HH3 A;  3LI8 A;  4GHI A;  3LIA A;  1BYW A;  5G4Y A;  1DRM A;  4JGQ A;  1DP6 A;  4MN5 A;  4HP9 A;  4GS9 B;  4JGR A;  1DP8 A;  3A0R A;  4RQ9 A;  5DKL A;  4L9G A;  2I9V A;  2OWJ A;  3NJA A;  4KUO A;  1LSV A;  3LI9 A;  5F6A A;  1XJ6 A;  3KX0 X;  4EES A;  2WKR A;  4HP4 A;  4GW9 A;  3UB6 A;  4NXF A;  1S66 L;  3MXQ A;  1OJ5 A;  2WKQ A;  2ZOI A;  5I5L A;  4HI4 A;  1VB6 A;  2A24 A;  5HWW A;  2ZOH A;  4HH2 A;  4DJ3 A;  1X0O A;  3NHQ A;  2R78 A;  2PR5 A;  5TBM B;  4LLO B;  3FC7 A;  2VEA A;  3MQO A;  4GS9 A;  2OWH A;  4I39 A;  4HQA A;  4NXB A;  4EW7 A;  4EET B;  1EW0 A;  2PDR A;  1TS6 A;  3UB8 A;  3GDI A;  2QKP A;  2V1A A;  3A0V A;  2W0N A;  3E4O A;  3H82 B;  3HJK A;  4PKY G;  5KIZ A;  1XJ2 A;  2OOL A;  3EWK A;  4WN5 A;  4HNB A;  4WLA A;  2JN7 A;  1P97 A;  1T19 A;  3F1P B;  2BAS A;  3FG8 A;  4LPZ A;  1TS7 A;  1XJ3 A;  2L4R A;  4R6L A;  1ODV A;  2KDK A;  1XFN A;  3E4P A;  5J4E A;  2L1M A;  1S1Z A;  3NOU C;  2QWS A;  3MQQ A;  5F68 A;  4H6J B;  5HWT A;  5HD5 A;  4I5S A;  3RH8 B;  1XFQ A;  1OT6 A;  2VLG A;  3A0S A;  4LRZ E;  1KOU A;  2HV1 A;  1S1Y A;  4BBT A;  3G6O A;  1S4S A;  1P0Z A;  1T1A A;  3IS2 B;  3F1P A;  1OTA A;  2PD7 A;  4HOI A;  4NXE A; 
#chains in the Genus database with same CATH topology
 2Y55 A;  3SS5 A;  2ZLY A;  1L0D A;  1BT5 A;  4JXW A;  4NXG A;  3TOI A;  2JBF A;  4A5R A;  4B88 A;  4Z9Q A;  2PYP A;  1JWZ A;  4LV0 A;  5CXW A;  2OLV A;  5AQ7 A;  4LV2 A;  4OQ0 A;  4CLC A;  4JGO A;  3BY8 A;  5D3O A;  1BUE A;  1PWG A;  2EFU A;  4EEP A;  1NZU A;  3T50 A;  3EQU A;  1K56 D;  1ALQ A;  2X02 A;  3CI6 A;  2EX9 A;  4YNR A;  4S2K A;  1K4F A;  1K0K A;  4BL3 A;  5GHX A;  3K3D A;  3ITB A;  2XEP A;  4KEN B;  2V0U A;  4QPR A;  1ERM A;  4S2O A;  1FCN A;  5EE8 A;  3UE0 A;  4DJ2 A;  2ZM8 A;  5DTT A;  5EVI A;  5HAI A;  3RJU A;  3NCK A;  4HP9 A;  1DP8 A;  3N6I A;  4RYE A;  1BZA A;  4OKP A;  4JF4 A;  3BFG A;  4MBH A;  3A3J A;  1KE4 A;  3B3X A;  4JF6 A;  3GV9 A;  2H5S A;  4Y7P A;  3HVF A;  4JKT A;  3OPL A;  3MFD A;  1YLW A;  2VZW A;  1QMF A;  1TD5 A;  5CGW A;  2Y2I A;  2W0N A;  1KGF A;  4ME4 A;  4U3T A;  2ZC7 A;  2Y79 A;  2RL3 A;  4CQH A;  5HFO A;  4OPY A;  2ZL1 B;  4KQR A;  3G6O A;  3BRM A;  2VA0 A;  3F1P A;  4O0P A;  4NXE A;  3VSL A;  3F1N A;  3F1O B;  2Y4A A;  4LRY C;  3GQZ A;  5EFW A;  4ESP A;  4EUV A;  5CED A;  4C75 A;  5EOE A;  3JVU A;  1IOU A;  3UB9 A;  2GX5 A;  5HPI A;  5DFY A;  1FCO A;  1T18 A;  4JPM A;  4S2I A;  5FAQ A;  1YMX A;  3IH9 A;  5FEG A;  3T1S A;  1E3U D;  4IHQ A;  5EUA A;  3VMA A;  2VX8 A;  4OP8 A;  5GLA A;  2XH9 A;  2DNS A;  5CTN A;  3MJQ A;  3E4Q A;  1OJG A;  4HES A;  4WUJ A;  4QJG A;  4KQQ A;  3MKE A;  3NUL A;  4GHI A;  2LB9 A;  3D3O A;  3ZVT A;  4K91 A;  5HWW A;  4Q0H A;  4NKP A;  3LR3 A;  2XF3 A;  2Y91 A;  1EW0 A;  4D60 A;  3FPV A;  1GHM A;  3HJK A;  3EWK A;  4HNB A;  1P97 A;  2LB5 A;  2WK0 A;  3JPU A;  4LPZ A;  3MXS A;  3IQA A;  2B5R A;  3BQ8 A;  3O87 A;  2ZC6 B;  1CK3 A;  2M7U A;  3VOY A;  2PD7 A;  4PKY A;  5IT5 A;  3NY4 A;  4EBL A;  4JLF A;  1DJA A;  3SOI A;  1ES4 A;  4R38 A;  3V5M A;  4RVA A;  2VGJ A;  5HX9 A;  3P09 A;  3ZDJ A;  1FCM A;  3DTE A;  1ESU A;  1XXM A;  5CHM A;  3G4P A;  3ZNY A;  4EXO A;  1F98 A;  5EVI D;  2Y2L A;  1V9Z A;  5EEC A;  1K56 A;  3Q1F A;  2WKE A;  4XT2 B;  1MWT A;  4KUK A;  3E0Y A;  4DE3 A;  4R70 A;  2M7V A;  1V9Y A;  2PBY A;  4DN0 A;  4MN6 A;  2KLI A;  3H82 A;  2JHE A;  1W63 Q;  3CJM A;  4JGP A;  4E3O A;  2ZQ7 A;  3E2K A;  5HSQ A;  1BLP A;  2V2F F;  4S2M A;  3IWO A;  2JKF A;  5FAT A;  2XRN A;  4DKI A;  2HDU A;  4RQ9 A;  1M40 A;  4BEN A;  2K2N A;  5GL9 A;  1OME A;  5U47 A;  4DJ3 A;  4LLO B;  4OH0 A;  3WRZ A;  1Y4O A;  3MZF A;  5CHJ A;  3LCE A;  2QKP A;  3A0V A;  2JN7 A;  3KYE A;  3GVB A;  3TW8 A;  3GSG A;  3HUM A;  4ARZ A;  2L1M A;  1LL5 A;  1Z6F A;  2QYB A;  2QZ6 A;  3SZT A;  4WM9 A;  1KOU A;  4DDY A;  5FEF A;  3IS2 B;  3BJN A;  1DY6 A;  1PFL A;  2HP9 A;  3BFF A;  5HWV A;  3QP8 A;  3CUE C;  3FZC A;  5DF9 A;  3VE4 A;  4MEZ A;  3S7P A;  1YAX A;  2D02 A;  2ZQA A;  2WYX A;  5F82 A;  1TEM A;  4HH2 A;  1QME A;  4S2P A;  2ZL1 A;  3MFX A;  4KQO A;  4BBU A;  2ZBB A;  5CEC A;  1YLJ A;  4WEK A;  2Y2P A;  2FFF B;  2ZMV A;  4BJP A;  1WYC A;  1HZO A;  1G28 A;  1IKI A;  3G2Z A;  4P6Z M;  3PBQ A;  5TGF A;  3NOP C;  4OQG A;  4OON A;  3QP4 A;  3N7W A;  3KYZ A;  3B47 A;  1DJC A;  1LSX A;  1VEU A;  4HY8 A;  3BLS A;  3VE3 A;  4L9F A;  4MCW A;  3UDF A;  4QD4 A;  4F94 A;  2UV0 E;  4MMN A;  4O8G A;  3CZD A;  4IVI A;  1KGG A;  4ETZ A;  4EUZ A;  4X1M A;  1VEU B;  1HD8 A;  3KX0 X;  2ZC4 B;  1S66 L;  4ZAM A;  4R3J A;  2H0T A;  4E3N A;  2VEA A;  1L0E A;  2R9X A;  1NYY A;  1NLY A;  3O88 A;  3KSI A;  3WS5 A;  3LY4 A;  3T1R A;  3EOI A;  5L07 A;  5IHV A;  1XJ3 A;  2Z2M B;  4OP5 A;  2Q9M A;  3G35 A;  2QWS A;  4FH2 A;  4KG5 A;  5EM1 A;  1XFQ A;  1XKZ A;  3BM6 A;  1T1A A;  3C30 A;  3CHW P;  4PHT A;  1C3B A;  3P01 A;  1M6K A;  2K31 A;  2WGI A;  1IFQ A;  5E2E A;  1TDL A;  4ZJ2 A;  4LFU A;  5L8M A;  3UMD A;  1VHM A;  3BY9 A;  2EA9 A;  3B33 A;  3A3F A;  4WZ5 A;  1CF0 A;  1GSV A;  4GDN A;  1NRF A;  2ZMA A;  1VQQ A;  5FQK A;  4QB8 A;  4PAU A;  1YLP A;  2WGV A;  1KVL A;  1N9N A;  4YFM A;  2UWX A;  4KQD A;  5EV0 A;  1H5X A;  3BFE A;  1IYP A;  4EEU A;  1FIL A;  2FFY A;  4MBK A;  1N9O A;  3NDE A;  1I2W A;  3H7W A;  3S4X A;  5E2G A;  2HGV A;  2R9W A;  3OPP A;  5CGX A;  4OQI A;  4E3I A;  1DJB A;  4FOF A;  1K4E A;  3OPR A;  3N4I A;  3HRE A;  1PW1 A;  5AQ9 A;  1SZV A;  3FV7 A;  3MQO A;  1YPR A;  4EET B;  1L3L A;  2PDR A;  4X25 A;  4JXV A;  3UNW A;  1MKM A;  3T4L A;  1N4O A;  1BUL A;  2BAS A;  2G7U A;  5FQJ A;  3PBR A;  4WZ5 C;  3G31 A;  3RH8 B;  3A0S A;  2HV1 A;  2J80 A;  4KZ4 A;  2GNX A;  3HLF A;  1S6R A;  1KVM A;  3L7H A;  5HPF A;  4BBV A;  1SKF A;  1JNU A;  1G5U A;  3T4S A;  3C4P A;  3D72 A;  3BFD A;  3JYI A;  3AGD A;  1XJ4 A;  3CPT A;  3PBN A;  5DTS A;  1U60 A;  3IX3 A;  4LRX C;  5CX7 A;  2A49 A;  5CHU A;  5HDC A;  5TBM A;  4LCL A;  1O7E A;  3FPW A;  3OLO A;  2WKH A;  2EX6 A;  3UO9 A;  1P9W A;  5M18 A;  5HD3 A;  1RGZ A;  4S2L A;  2P74 A;  4S2J A;  1SDE A;  1P9R A;  1ZG4 A;  3KSH A;  2PHY A;  2INW A;  2RCX A;  4GNU A;  4F3L A;  4HIA A;  3LID A;  5HL1 A;  1H8Y A;  1OTB A;  1ONH A;  4QHC A;  2VV8 A;  1BLH A;  2HDR A;  1BYW A;  3NIA A;  1DP6 A;  4Y13 A;  3S7N A;  1YLT A;  2OLU A;  3Q7V B;  4Y15 A;  3NI9 A;  3MKF A;  3HLD A;  4ZBE A;  3NHQ A;  1YLZ A;  2ZMF A;  4X1L A;  5FA7 A;  4HBT A;  2OAQ 1;  3H82 B;  2JE5 A;  5HW3 A;  3DTI A;  3OC2 A;  3FG8 A;  4WEJ A;  4UA7 A;  1J3W A;  3W4O A;  4QU3 A;  1VET A;  4ZJ3 A;  3MXR A;  3UME A;  5KSH A;  1OTA A;  3LUQ A;  2P9V B;  2WAE A;  3ULF A;  2O99 A;  4JBF A;  4WMC D;  2XD1 A;  1XA1 A;  5J8X A;  3LY3 A;  2OSU A;  3ISG A;  3QP2 A;  4P87 A;  4R23 A;  1PI4 A;  5A8B A;  2P7J A;  1XPB A;  2ZM2 A;  1IYS A;  2JCH A;  2V9A A;  1WE4 A;  1N9L A;  2KX6 A;  1PRQ A;  2W3H A;  4NET A;  1KE3 A;  3H7W B;  4GN2 A;  3VV4 A;  1SCW A;  2PRF A;  3EGX C;  5J7E A;  3VP1 A;  3UB5 P;  5HZH A;  2J3T C;  1H3Q A;  2W3G A;  4E3J A;  5CEB A;  2PYR A;  4ID4 A;  4M4X A;  2BG1 A;  5KZH A;  4AFI A;  2HDQ A;  1S67 L;  3O86 A;  1XX2 A;  2HJ9 C;  3IF5 A;  3VP4 A;  3LIA A;  4O7D A;  4DXB A;  3ITA A;  1N9B A;  1HTZ A;  5FDS A;  3BYD A;  2ZOH A;  2IA2 A;  3LEZ A;  4NXB A;  1ES5 A;  4XXR A;  3V39 A;  3V50 A;  3KYQ A;  4B4X A;  1TS6 A;  3GDI A;  1HVB A;  3E4O A;  1ONG A;  4CJN A;  4ETX A;  1K57 C;  4BD0 A;  4ARZ B;  5HAR A;  4R6L A;  2Y59 A;  3PBT A;  3NOU C;  3IF6 A;  3HLB A;  5HWT A;  2X01 A;  1CQA A;  1OT6 A;  5EVI B;  1S1Y A;  2X71 A;  3O3V A;  5F1F A;  2A2L A;  1F2K A;  2W27 A;  5EOO A;  4HJ4 A;  2W3E A;  2EXB A;  3SS4 A;  3ZG7 B;  2L0W A;  1W8Q A;  3UY6 A;  3MQ0 A;  4HHD A;  1TDG A;  4OPR A;  5KSC A;  3UE6 A;  3LGO A;  3Q07 A;  4UAA A;  4EER A;  1ACF A;  4LGW A;  4OVD A;  4GKU A;  3IWQ A;  4ZTK A;  2GJ3 A;  2ZC3 B;  3SH8 A;  1K25 A;  1E4D A;  5JYO A;  2Y2N A;  1YMS A;  5G4Z A;  2ZQ8 A;  4E04 A;  2Q9N A;  1EI5 A;  4ZJ1 A;  2WUQ A;  3NBL A;  3JVV A;  2XGN A;  5L2F A;  5GHZ A;  2NUP C;  1ZHH B;  5DJU A;  2VV7 A;  3LO7 A;  4HJ6 A;  3VFH A;  5G4Y A;  3W8K A;  1JWP A;  3AGE A;  5DKL A;  5CGS A;  4UA9 A;  5DFX A;  2GDN A;  4HP4 A;  3UB6 A;  4Y2F A;  5I5L A;  3IXB A;  3DBA A;  3PXP A;  4N9L A;  4QWO A;  3DWK A;  1PIO A;  1FIK A;  4RA7 A;  5GLC A;  3M2K A;  3Q82 A;  1XJ2 A;  4Y17 A;  3HLW A;  5FAO A;  5FQQ A;  4GJ4 A;  5L10 A;  2WZX A;  3E4P A;  4BL2 A;  5FQM A;  5TR7 A;  4BQM A;  1MBL A;  3OPH A;  5K5B A;  1NJ4 A;  4LRZ E;  4HEF A;  5CRF A;  3IT9 A;  3UDI A;  1MKI A;  4IED A;  3HLE A;  3U4L P;  3T4O A;  1CI9 A;  3C5A A;  5F69 A;  4R1G A;  2WKP A;  1L2S A;  3LIB A;  4X69 A;  2ZJ9 A;  1NWZ A;  4KG6 A;  3U2A A;  3IX8 A;  1G6O A;  3MR0 A;  4GZB A;  1LT0 A;  3IF6 C;  1FR1 A;  1PZP A;  4L0L A;  3Q7Z A;  1KDS A;  3LR5 A;  3R7W A;  3EEH A;  5HL6 A;  1VET B;  2B95 A;  4C3Q A;  1K55 C;  4Y5F A;  1LL9 A;  3UN7 A;  4DRT A;  2V20 A;  2EX8 A;  2QPN A;  3OZH A;  1ZC2 A;  4UEY A;  3HUN A;  3ZCZ A;  3NDG A;  3W2Z A;  2ACG A;  2VKS A;  5AQA A;  3ZG5 A;  3T4Q A;  1E25 A;  5LBR A;  2B02 A;  2J9P A;  2PT7 A;  3IHB A;  1STZ A;  4OLD A;  2J3W A;  4FUW A;  2IWD A;  4JGR A;  2EWV A;  5A93 A;  1XGI A;  3MXQ A;  1D1J A;  5MC7 A;  3IXD A;  3CUE A;  3AGF A;  4OPQ A;  4KZA A;  4Y0O A;  4GS9 A;  4I39 A;  5F83 A;  4ZRR A;  1FR6 A;  3I7J A;  5KIZ A;  2OOL A;  2O9C A;  3CMZ A;  1HLU P;  1TF1 A;  3TG9 A;  3FKV A;  1ODV A;  4Q0I A;  5AJG A;  5HD5 A;  3T4T A;  1P0Z A;  3TE8 A;  2ZM0 A;  4BWI A;  2J7V A;  3A3E A;  3ZG8 B;  4L9E A;  1S4R A;  2EXA A;  3D9Y A;  5EM0 A;  3F1O A;  2JKT I;  3MS6 A;  4EWF A;  3LEQ A;  1CEG A;  2B18 A;  2M1C A;  1CJF A;  4UHU A;  4E3K A;  2WZZ A;  1JWV A;  3FKW A;  3KSG A;  4KZ9 A;  3IHA A;  3SH9 A;  3UPN A;  4GLQ A;  5FSR A;  4JXG A;  3UPP A;  1MXO A;  3MSH A;  2HF6 A;  2VV6 A;  2W1T B;  1H8Z A;  1K38 A;  3SW1 A;  1NZO A;  5F5Y A;  2HPB A;  4OPZ A;  5EVL A;  4DE2 A;  1UWN X;  3QP1 A;  3IX4 A;  3GEC A;  5FDH A;  1PWD A;  1SKO B;  3HJI A;  4NG2 A;  5HAQ A;  1PWC A;  3C2W A;  3G32 A;  3CLO A;  4HJ3 A;  2XSS A;  3D4F A;  5IS1 A;  3P7N A;  1MY8 A;  1OTI A;  2XR0 A;  3LI8 A;  2ZQ9 A;  2I9V A;  3NJA A;  2XDM A;  4KUO A;  3ZYT A;  5F6A A;  2Z2L B;  4WEL A;  5AQB A;  3OOV A;  1G68 A;  3IF6 B;  2A24 A;  2WGW B;  3OCN A;  3VOZ A;  4EBP A;  2PR5 A;  3DW0 A;  3ZFZ A;  4Z1W A;  2XFS A;  4X6T A;  4S2N A;  3C7U A;  1YKD A;  3CPT B;  4WBG A;  3UE3 A;  3A3D A;  1I2S A;  1LLB A;  3OBF A;  4GB7 A;  3F1P B;  4EBN A;  1TS7 A;  3Q7V A;  2KDK A;  4FCF A;  4OOL A;  5EPH A;  3A3I A;  4NK3 A;  2Y2G A;  4H8R A;  4G3K A;  3GRJ A;  3NEC A;  1D06 A;  2PBD P;  1KGE A;  3VOL A;  1K57 A;  4P0M A;  3BQA A;  1LI9 A;  2XD5 A;  1W79 A;  3LR4 A;  1UWP X;  3IS2 A;  5J4E A;  4LV1 A;  3LIF A;  3M6H A;  3IWI A;  1XA7 A;  4B9O A;  1OT9 A;  3WS0 A;  5FQ9 A;  1GHP A;  2V1B A;  5A92 A;  4WYY A;  4E3L A;  3V3S A;  1VM1 A;  1PZO A;  3K3C A;  4Y0U A;  3P98 A;  3RXW A;  4BLM A;  5IU1 A;  1L0F A;  3C7V A;  3MZD A;  2WAD A;  5FAS A;  1GA9 A;  4GD8 A;  4UA6 A;  1T1B A;  4WL9 A;  4MLL A;  2O0Y A;  4MN5 A;  4DDS A;  1IEL A;  1YSP A;  2C5W B;  4CPK A;  2V1Z A;  2WKR A;  3TRC A;  4X55 A;  4B4Z A;  2PU2 A;  1PI5 A;  3SS3 A;  2HZ5 A;  2IWB A;  4X53 A;  1WYB A;  2Y2O A;  5C5K A;  2VGK A;  1MWR A;  4EW7 A;  4YIN A;  2G2W A;  3SH7 A;  2OV5 A;  5FI7 A;  2L4R A;  3QHY A;  4MDZ A;  5I94 A;  4XUZ A;  3K2N A;  4O01 A;  4H6J B;  5F68 A;  4IBR A;  2HJE A;  2JKT M;  3N8R A;  1S4S A;  4IVK A;  5DKK A;  1K54 C;  5FAP A;  3H9W A;  2CMN A;  5EVE A;  1K55 A;  4I3A A;  1A0K A;  4LEN A;  1JTG A;  4PM8 A;  5FI6 A;  2Y2Q A;  4R4R A;  3NOT C;  1F5M A;  4II7 A;  1F9I A;  1TS0 A;  2VK3 A;  2V8F A;  2QJ5 A;  5DF7 A;  3S7Q A;  1OPX A;  1W63 M;  3ZGA B;  3VP2 A;  2YKH A;  4U0X A;  4X68 A;  2KOI A;  2VGL M;  4GD6 A;  4GCZ A;  4OOY A;  3PBS A;  4LCM A;  1Q2P A;  3RFB A;  2H0Y A;  1OTD A;  2AVX A;  4E3M A;  1XP4 A;  5FL3 A;  1MWU A;  3B42 A;  4RX3 A;  4EV4 A;  1LSW A;  3E2L A;  3LIC A;  3CIT A;  1MPL A;  2PR6 A;  2Z6D A;  4UQI M;  3VP3 A;  4Y0T A;  1WA9 A;  4OLG A;  3RTY A;  5M1A A;  3C8C A;  3WS4 A;  3M2J A;  4M3K A;  2Y2K A;  5E43 A;  2JC7 A;  3PAG A;  3A0R A;  3S1Y A;  2OWJ A;  4KZB A;  4EES A;  4Q8I A;  4GW9 A;  3M6B A;  3HUO A;  3VSK A;  2W1R A;  3PTE A;  5TBM B;  1AWI A;  1Q2Q A;  1ESI A;  2CC1 A;  2V1A A;  2XLN A;  4WLA A;  3QP5 A;  1KE0 A;  2JKG A;  1S1Z A;  5DF8 A;  3MZE A;  2P08 A;  4HBU A;  1BTL A;  4BBT A;  4WZ4 A;  1ES3 A;  1L0G A;  4HOI A;  5CER A;  4IUH A;  4I3I A;  4GHI B;  4RX2 A;  1E3U A;  1GA0 A;  2Q0O A;  1K6S A;  3LIE A;  2XK1 A;  3WRT A;  1W5D A;  1UGU A;  1XGJ A;  4DE0 A;  2XA7 S;  1MC0 A;  4DF6 A;  2Y2J A;  4YOF A;  4KZ8 A;  2PD8 A;  4E6X A;  4K0X A;  4YWZ A;  4G3W A;  5DTK A;  2NUT C;  3V3R A;  4K0W A;  3T4J A;  3ZHH A;  2H28 A;  3IBJ A;  2BTF P;  2K7S A;  3DTM A;  2IWC A;  4KG2 A;  4LV3 A;  2DCF A;  2QJ7 A;  1CEF A;  3O5Y A;  5A90 A;  5L09 A;  4IBX A;  4NEE D;  1OTE A;  3C4O A;  2V8C A;  2HDS A;  3TSG A;  4F3L B;  1G6A A;  5HDS A;  2I72 A;  4N9K A;  2XQZ A;  2XRO A;  4NXF A;  3ZNT A;  4KZ5 A;  5G18 A;  1JTD A;  3G30 A;  2OWH A;  4HQA A;  4QY6 A;  2FZ0 A;  4X56 A;  1J9M A;  4PKY G;  4GOG A;  2P9V A;  3FYZ A;  4CLC B;  1KDW A;  2P04 A;  3PR6 A;  1XFN A;  3UPO A;  5E2F A;  3NC8 A;  4P6B A;  4U0T A;  1W8Y A;  1NLZ A;  3BLM A;  2XFT A;  5EVI C;  3HL9 A;  4PMA A;  2HP5 A;  3IXH A;  3PYP A;  1SHV A;  3QP6 A;  5GLB A;  4XUX A;  3QNC A;  5FI2 A;  3EQV A;  2W3F A;  3HBR A;  4DMZ A;  3HLC A;  1YT4 A;  3E98 A;  1ZTU A;  2DMW A;  4IUK A;  3UB7 A;  2Y2H A;  3LYX A;  2O9B A;  1T1C A;  3MBZ A;  4C6Y A;  4GDB A;  2Y8H A;  2E8I A;  1TS8 A;  2WAF A;  5DJT A;  2BLS A;  1D7E A;  4R0Q A;  3WWX A;  3Q81 A;  1BLS A;  1YLY A;  3BEC A;  3GR2 A;  2QHK A;  4XT2 A;  1IYQ A;  2G2U A;  3KO6 A;  1PW8 A;  3N8L A;  2ZQC A;  2OAP 1;  1IYO A;  4KZ6 A;  2O9A A;  4N1H A;  3MMH A;  3PHY A;  1W7F A;  4E6W A;  1YM1 A;  4JGQ A;  4PPR A;  4GS9 B;  1JVJ A;  1LSV A;  4PM5 A;  1K54 A;  2ZOI A;  4MBF A;  1VB6 A;  3EEA A;  4FTX A;  3S22 A;  3CG5 A;  1YSQ A;  3T1Q B;  2W1T A;  1T19 A;  1ZG6 A;  1YQS A;  4N92 A;  1IEM A;  3VP0 A;  4KZ7 A;  1FSW A;  3MQQ A;  2QMI A;  4I5S A;  1SDN A;  3V67 A;  1NY0 A;  4MN7 A;  2WKI A;  5JYP A;  3IBR A;  4WF0 A;  3ZG0 A;  1IKG A;  4K08 A;  2JKR M;  1ES2 A;  2WGW A;  2GZA A;  4I3J A;  2PU4 A;  1EWZ A;  3GMW A;  2VGL S;  4BMW A;  3W4P A;  1Y28 A;  3FWL A;  3BFC A;  4R3A A;  4QY5 A;  3BWL A;  1O07 A;  4DXC A;  1Z09 A;  3CAX A;  4Q0J A;  3G2Y A;  4MNR A;  2H10 A;  3IXG A;  2MJ6 A;  4FH4 A;  5E2H A;  1FSY A;  2C6W B;  1PNE A;  4H6J A;  3W4Q A;  5TFQ A;  4JXS A;  3VFF A;  1ERQ A;  2J9O A;  3T1X A;  1MWS A;  1SKO A;  1MZU A;  1AXB A;  4N1X A;  1H0M A;  1I5Q A;  5AVF A;  2FH5 A;  4EU0 A;  3CWF A;  4FSF A;  4OQH A;  3DWZ A;  2A24 B;  4JF5 A;  1ZKJ A;  2E8J A;  2VJW A;  4CLC C;  3S7O A;  4D2O A;  4PM6 A;  3PBO A;  4BD1 A;  3T12 B;  3WS1 A;  4CLC E;  4KZ3 A;  3LI9 A;  1K6R A;  2HP6 A;  4P85 A;  1OJ5 A;  2WKQ A;  3ZG9 B;  3QNB A;  3TJZ C;  1GCE A;  3R7W B;  1X0O A;  1LI0 A;  5BOH A;  5GLD A;  3LFV A;  3R4K A;  2ZD8 A;  4Y3I A;  4R4S A;  2EX2 A;  3UB8 A;  4P6Z S;  1S0W A;  1FQG A;  1GHI A;  4R3B A;  3BW6 A;  4UQI S;  1NRJ A;  4S2N C;  4PM7 A;  5DVA A;  4CLC D;  3WS2 A;  2VLG A;  4PM9 A;  1FOF A;  4WMC A;  4EQI A;  5KMW A;  4IJG A;  5J3W A;  5GHY A;  3T4K A;  1BLC A;  1BSG A;  2V0W A;  1RCJ A;  2J8Y A;  2D01 A;  1LL8 A;  3LR0 A;  2XA7 M;  3HLG A;  1DP9 A;  2YKF A;  3ZQ5 A;  5M19 A;  2PAV P;  1H8M A;  3ICY A;  5AVE A;  5F1G A;  3F1N B;  2Y2M A;  4EQ1 A;  4FD8 A;  3RXX A;  3HCY A;  2EFX A;  1CI8 A;  1ERO A;  4G3V A;  5A91 A;  5HDD A;  3OCL A;  1GSX A;  4B93 A;  4DE1 A;  2JKR I;  1PYY A;  2Z6C A;  3UDX A;  3IH8 A;  1Y54 A;  3ZVW A;  3C38 A;  3UE1 A;  1GSW A;  5FQI A;  2DRW A;  1LHY A;  3MF0 A;  4I38 A;  2ZC5 B;  4HH3 A;  2ZQD A;  1DRM A;  3BEB A;  4L9G A;  4OOM A;  4ZDX A;  2EWW A;  1XJ6 A;  1RP5 A;  3EGD C;  4HI4 A;  3PAE A;  2A3U A;  2R78 A;  3KSF A;  5HAP A;  3FC7 A;  1TVF A;  1RGY A;  4WN5 A;  3DAV A;  3DTK A;  5TJJ A;  3N8S A;  5CTM A;  2J3T D;  3G34 A;  2W3D A;  1NXY A;  3L9K A;  3GTC A;  1NYM A; 
#chains in the Genus database with same CATH homology
 4IUH A;  4I3I A;  4GHI B;  4PHT A;  3P01 A;  2K31 A;  1IFQ A;  3LIE A;  3T4O A;  5F69 A;  5L8M A;  1UGU A;  3UMD A;  1VHM A;  4NXG A;  3BY9 A;  2EA9 A;  3B33 A;  2WKP A;  1GSV A;  3LIB A;  2XA7 S;  1MC0 A;  2PYP A;  1NWZ A;  4YOF A;  3U2A A;  1G6O A;  2PD8 A;  3MR0 A;  4PAU A;  1LT0 A;  4L0L A;  4CLC A;  4YWZ A;  4JGO A;  3BY8 A;  4G3W A;  2NUT C;  1N9N A;  3LR5 A;  3R7W A;  3T4J A;  3EEH A;  5HL6 A;  4EEP A;  3T50 A;  3EQU A;  2H28 A;  4KQD A;  3IBJ A;  2K7S A;  4Y5F A;  3CI6 A;  4YNR A;  2QJ7 A;  3O5Y A;  4EEU A;  3K3D A;  4UEY A;  1N9O A;  4NEE D;  3W2Z A;  1OTE A;  3H7W A;  2V0U A;  2VKS A;  3T4Q A;  4QPR A;  5LBR A;  2B02 A;  4F3L B;  2HGV A;  5HDS A;  4DJ2 A;  2PT7 A;  1STZ A;  2J3W A;  2XRO A;  4FOF A;  4HP9 A;  4JGR A;  1DP8 A;  2EWV A;  4NXF A;  3MXQ A;  5MC7 A;  3CUE A;  3MQO A;  4GS9 A;  2OWH A;  4I39 A;  4HQA A;  4EET B;  2FZ0 A;  2PDR A;  2VZW A;  1TD5 A;  4ZRR A;  1MKM A;  2W0N A;  4PKY G;  5KIZ A;  3T4L A;  2OOL A;  2O9C A;  4ME4 A;  4CLC B;  1TF1 A;  2BAS A;  2P04 A;  1ODV A;  3PR6 A;  1XFN A;  4Q0I A;  5AJG A;  2Y79 A;  2G7U A;  4CQH A;  3PBR A;  5HD5 A;  1NLZ A;  3RH8 B;  3A0S A;  2HV1 A;  3T4T A;  3G6O A;  2VA0 A;  1P0Z A;  3TE8 A;  3F1P A;  4O0P A;  4BWI A;  4NXE A;  2J80 A;  4L9E A;  1S4R A;  3F1N A;  3PYP A;  3F1O A;  2JKT I;  2GNX A;  3F1O B;  4LRY C;  2B18 A;  2M1C A;  5EFW A;  5HPF A;  4BBV A;  1JNU A;  4EUV A;  3KSG A;  3EQV A;  3T4S A;  2W3F A;  3JVU A;  4GLQ A;  3D72 A;  1IOU A;  3UB9 A;  2GX5 A;  5HPI A;  1XJ4 A;  3PBN A;  4DMZ A;  5DFY A;  3E98 A;  1ZTU A;  2DMW A;  1T18 A;  4IUK A;  2HF6 A;  4LRX C;  5CX7 A;  3UB7 A;  2VV6 A;  2W1T B;  5HDC A;  5TBM A;  3SW1 A;  3FPW A;  3LYX A;  3OLO A;  5F5Y A;  2O9B A;  1T1C A;  2Y8H A;  1UWN X;  1TS8 A;  1P9W A;  3GEC A;  4IHQ A;  5HD3 A;  5DJT A;  1D7E A;  2VX8 A;  2QHK A;  4XT2 A;  3HJI A;  1P9R A;  3KSH A;  3C2W A;  3KO6 A;  2PHY A;  2INW A;  3CLO A;  4HJ3 A;  2XSS A;  4F3L A;  4HIA A;  3LID A;  3MJQ A;  2OAP 1;  1OTB A;  3E4Q A;  5IS1 A;  3P7N A;  1OJG A;  1OTI A;  2VV8 A;  2O9A A;  4WUJ A;  3MMH A;  3PHY A;  3LI8 A;  4GHI A;  1BYW A;  2LB9 A;  4JGQ A;  1DP6 A;  4GS9 B;  3S7N A;  2I9V A;  3NJA A;  3ZYT A;  4KUO A;  1LSV A;  3D3O A;  5F6A A;  4WEL A;  3OOV A;  2ZOI A;  5HWW A;  1VB6 A;  2A24 A;  3EEA A;  3OCN A;  4Q0H A;  3NHQ A;  4NKP A;  2PR5 A;  3LR3 A;  2ZMF A;  4Z1W A;  1EW0 A;  1YKD A;  3FPV A;  3UE3 A;  2OAQ 1;  3H82 B;  3HJK A;  1YSQ A;  3EWK A;  3OBF A;  4HNB A;  2W1T A;  1P97 A;  1T19 A;  3F1P B;  3OC2 A;  2LB5 A;  3FG8 A;  4LPZ A;  4WEJ A;  1TS7 A;  2KDK A;  3MQQ A;  3BQ8 A;  4OOL A;  4I5S A;  3V67 A;  2M7U A;  4G3K A;  4MN7 A;  3UME A;  5KSH A;  3LUQ A;  1OTA A;  2PD7 A;  4PKY A;  5IT5 A;  3IBR A;  1D06 A;  4WF0 A;  3ULF A;  2O99 A;  4K08 A;  3VOL A;  2JKR M;  2GZA A;  4I3J A;  3BQA A;  2VGL S;  3LR4 A;  5A8B A;  4R38 A;  1UWP X;  4BMW A;  3IS2 A;  5J4E A;  2P7J A;  1Y28 A;  4R3A A;  3LIF A;  3BWL A;  2V9A A;  4B9O A;  1OT9 A;  3CAX A;  4Q0J A;  4EXO A;  1N9L A;  1F98 A;  2KX6 A;  2MJ6 A;  1V9Z A;  2V1B A;  2W3H A;  3H7W B;  3VV4 A;  4XT2 B;  4H6J A;  3EGX C;  5J7E A;  4KUK A;  3K3C A;  5HZH A;  3E0Y A;  2J3T C;  1H3Q A;  4R70 A;  2W3G A;  2M7V A;  1V9Y A;  4DN0 A;  1MZU A;  2PYR A;  4MN6 A;  2KLI A;  5IU1 A;  3H82 A;  2JHE A;  1W63 Q;  4M4X A;  4AFI A;  1S67 L;  5AVF A;  2FH5 A;  4JGP A;  4EU0 A;  2HJ9 C;  3CWF A;  4FSF A;  5HSQ A;  1T1B A;  2A24 B;  4WL9 A;  2VJW A;  3LIA A;  2XRN A;  2O0Y A;  4CLC C;  4MN5 A;  3S7O A;  4RQ9 A;  3PBO A;  1YSP A;  4CLC E;  3LI9 A;  2WKR A;  2K2N A;  1OJ5 A;  2WKQ A;  3TRC A;  3TJZ C;  2ZOH A;  4DJ3 A;  2IA2 A;  1X0O A;  3R7W B;  4LLO B;  4NXB A;  5C5K A;  3LFV A;  4EW7 A;  3R4K A;  3KYQ A;  4Y3I A;  1TS6 A;  3UB8 A;  3GDI A;  2QKP A;  3A0V A;  4P6Z S;  3E4O A;  4ETX A;  2JN7 A;  3BW6 A;  3TW8 A;  4UQI S;  1NRJ A;  4ARZ B;  2L4R A;  4R6L A;  4ARZ A;  2L1M A;  3PBT A;  3NOU C;  4MDZ A;  3K2N A;  2QYB A;  4O01 A;  4H6J B;  5F68 A;  5HWT A;  4CLC D;  2HJE A;  2JKT M;  1OT6 A;  2VLG A;  1KOU A;  1S1Y A;  3IS2 B;  3BJN A;  1S4S A;  5DKK A;  4IJG A;  5J3W A;  3H9W A;  2CMN A;  5HWV A;  3T4K A;  2A2L A;  3CUE C;  4I3A A;  2V0W A;  2W27 A;  5DF9 A;  3VE4 A;  3S7P A;  1YAX A;  4HJ4 A;  3NOT C;  2D02 A;  2W3E A;  1F5M A;  4II7 A;  1F9I A;  2D01 A;  1TS0 A;  2L0W A;  4HH2 A;  3MQ0 A;  4HHD A;  1LL8 A;  3LR0 A;  2XA7 M;  3MFX A;  4KQO A;  4BBU A;  1DP9 A;  2YKF A;  3UE6 A;  3ZQ5 A;  2ZBB A;  1H8M A;  2QJ5 A;  3ICY A;  5AVE A;  4EER A;  3S7Q A;  3F1N B;  4WEK A;  1OPX A;  1W63 M;  2ZMV A;  4BJP A;  4EQ1 A;  1G28 A;  4P6Z M;  2YKH A;  3PBQ A;  3NOP C;  2GJ3 A;  3HCY A;  2KOI A;  2VGL M;  4GCZ A;  3PBS A;  4G3V A;  3KYZ A;  5HDD A;  3RFB A;  3B47 A;  1GSX A;  1OTD A;  3OCL A;  1LSX A;  5FL3 A;  4HY8 A;  5G4Z A;  3B42 A;  4B93 A;  4E04 A;  2JKR I;  2Z6C A;  1LSW A;  3VE3 A;  3LIC A;  3CIT A;  4L9F A;  4MCW A;  2PR6 A;  3JVV A;  2Z6D A;  4UQI M;  1WA9 A;  3C38 A;  3RTY A;  2NUP C;  1GSW A;  1ZHH B;  4MMN A;  5DJU A;  2VV7 A;  3MF0 A;  3C8C A;  4O8G A;  4I38 A;  4HJ6 A;  4HH3 A;  5G4Y A;  1DRM A;  4ETZ A;  3A0R A;  5DKL A;  4L9G A;  4OOM A;  2OWJ A;  2EWW A;  5DFX A;  1XJ6 A;  3KX0 X;  4EES A;  4HP4 A;  4GW9 A;  3UB6 A;  1S66 L;  3EGD C;  4Y2F A;  5I5L A;  4HI4 A;  3DBA A;  3PXP A;  2R78 A;  2W1R A;  5TBM B;  3KSF A;  3FC7 A;  2VEA A;  2V1A A;  1NLY A;  3KSI A;  1XJ2 A;  4WN5 A;  4WLA A;  3EOI A;  5TJJ A;  4GJ4 A;  1XJ3 A;  3E4P A;  1S1Z A;  2QWS A;  2P08 A;  5K5B A;  1XFQ A;  2J3T D;  4LRZ E;  2W3D A;  4BBT A;  1T1A A;  3C30 A;  4HOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...