2D02A

R52q mutant of photoactive yellow protein, p65 form
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
b'MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGQDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
molecule tags Signaling protein
source organism Halorhodospira halophila
publication title The Crystal Structure of the R52Q Mutant Demonstrates a Role for R52 in Chromophore pK(a) Regulation in Photoactive Yellow Protein
pubmed doi rcsb
total genus 34
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2d02A00
1D06A 5A8BA 1D7EA 2L4RA 4I5SA 3LIAA 4NXBA 5AVEA 5EFWA 3VE4A 2WKQA 1XJ4A 4HY8A 1GSXA 1Y28A 1LT0A 4GW9A 2KDKA 3F1PA 3GDIA 4PKYA 3LICA 5HDCA 4WL9A 4WLAA 1OTIA 1OJGA 1UWPX 4NXFA 3A0RA 4XT2A 2M1CA 3H7WB 3MR0A 4LPZA 1ODVA 1T19A 4R3AA 3FG8A 1LL8A 2QWSA 3LIFA 2P7JA 5F5YA 3F1NB 2V1BA 5HZHA 2PYPA 3IS2A 3MQQA 3K3DA 3UB6A 3OLOA 1XJ3A 4EETB 2PD7A 3K3CA 4H6JA 3H82A 4I39A 4K08A 2L1MA 3G6OA 4NXGA 4PKYG 3RH8B 2QHKA 2ZOHA 4JGQA 1S4RA 2H28A 4LRXC 1KOUA 1XJ6A 2OWHA 3UB9A 3UB7A 1TS0A 3LI9A 4EEUA 1T1BA 3MFXA 3NHQA 2PYRA 4HJ3A 1TS7A 3SW1A 4NXEA 5TBMA 5AVFA 3NOTC 4WUJA 4HHDA 1DP8A 1WA9A 4GHIB 1OJ5A 4JGRA 1DP9A 4GCZA 3T50A 5HD5A 5HWWA 3F1PB 3CAXA 3BY8A 2BASA 2I9VA 4EESA 3PYPA 3A0SA 3E4QA 5DKKA 2D02A 2Z6CA 5KIZA 1JNUA 2PR6A 2V0UA 1T1CA 4E04A 3F1NA 4WN5A 4LRZE 5F68A 4L9FA 5HWTA 3E4OA 3HJIA 1EW0A 2KX6A 3LYXA 4BBVA 5HWVA 4GS9B 5HDSA 1S67L 2D01A 5IS1A 2JHEA 5J3WA 1G28A 4L9EA 4H6JB 3H82B 2ZBBA 2YKFA 4JGOA 2VEAA 4JGPA 4L9GA 3ZQ5A 1GSWA 2EA9A 2PHYA 2W27A 3CWFA 4R6LA 4BBTA 4YWZA 1DP6A 3KX0X 4I3AA 3VE3A 4DJ3A 2B02A 3EWKA 3C8CA 1F9IA 5TBMB 3UMDA 2L0WA 2YKHA 1VB6A 2VV7A 3H7WA 5DKLA 4MN5A 4LRYC 5G4YA 3C2WA 1V9ZA 2QJ7A 3BWLA 1LSXA 1T18A 1N9LA 1F98A 4WF0A 2JN7A 4LLOB 4GS9A 1TS6A 1S1YA 3UMEA 2WKRA 1X0OA 1UGUA 5IU1A 3LUQA 2VLGA 4HP4A 5J4EA 1V9YA 3F1OA 3GECA 1MZUA 2QKPA 1TS8A 1S4SA 1XFQA 2GJ3A 2K7SA 3BY9A 3ICYA 3CLOA 4I3IA 5DJTA 2A24B 2OOLA 4HIAA 5G4ZA 1S66L 3NOUC 5HD3A 4EEPA 4F3LA 4HJ6A 2A24A 4F3LB 1NWZA 2V0WA 1OTAA 2J80A 2V1AA 4I38A 4KQDA 1S1ZA 2V9AA 1OTDA 3A0VA 3H9WA 1P0ZA 2HV1A 4GHIA 3D72A 3UE6A 2ZOIA 3IS2B 3RTYA 1LSVA 2OWJA 3LIEA 4HQAA 1T1AA 4HOIA 3UB8A 2Z6DA 1OT6A 3LIDA 4EQ1A 3IBRA 2PR5A 3MQOA 4EERA 1LSWA 1XFNA 2INWA 4HI4A 3NJAA 5F69A 3EEHA 4HP9A 3E4PA 4RQ9A 5HDDA 4BBUA 3P7NA 4R70A 3HJKA 4HH3A 4EW7A 4HNBA 3F1OB 4HH2A 2R78A 4MN6A 4KUKA 1BYWA 3MXQA 4KUOA 2CMNA 1DRMA 1OTBA 1P97A 2QJ5A 1XJ2A 5DJUA 4R38A 1UWNX 4XT2B 1OT9A 3FC7A 4DJ2A 3LI8A 4EXOA 3VOLA 2PDRA 3B33A 3PHYA 3ULFA 3LIBA 1GSVA 5I5LA 4HJ4A 4I3JA 5F6AA 5J7EA 5HSQA 2W0NA 3MJQA 4M4XA 1N9NA 2VV6A 4B9OA 2WKPA 1OTEA 2VV8A 1N9OA 2PD8A 3NOPC
chains in the Genus database with same CATH superfamily
4BJPA 3VE4A 3VSKA 2H0YA 1W63Q 4S2MA 3FPWA 5E2HA 3H7WB 4MBHA 3N6IA 3SH7A 1SKOB 4I39A 3UDFA 4HJ3A 5F1FA 3MBZA 1CJFA 1OJ5A 3L7HA 5TJJA 3BFCA 3A0SA 2WZZA 1JNUA 2V0UA 4IEDA 1BTLA 1SDNA 2P74A 1O07A 2GNXA 4Z9QA 5TBMB 1CQAA 3G30A 5CHMA 5G4YA 4LRYC 3MF0A 5EUAA 2ZJ9A 2EFXA 2OLVA 1X0OA 2ZQCA 3EGDC 3QNBA 2A24B 5HD3A 1XGIA 4OH0A 3QHYA 2V9AA 4GHIA 3QP4A 5FQMA 3D72A 3MZFA 2ZOIA 3IS2B 4HOIA 3LGOA 4U0TA 3V50A 4S2LA 2Y79A 3F1OB 1FILA 1VEUA 1ZC2A 3BW6A 5DJUA 3EGXC 1FR1A 1NRFA 4GB7A 2PRFA 4PM6A 4X6TA 5EVLA 2WUQA 3VOLA 1N9NA 1NY0A 3QP1A 1VQQA 5FDSA 2XFTA 3MZEA 4MMNA 5EM0A 3EOIA 1PI5A 5DF8A 3RJUA 4PM8A 2HP9A 3GDIA 3VP0A 1PWGA 3HREA 1ODVA 2DCFA 3DTEA 3IXBA 4JBFA 2PYPA 3LR3A 4ZJ2A 1KE4A 1XP4A 1AWIA 2PYRA 3BJNA 4HHDA 1MC0A 1PFLA 3D9YA 2W3HA 4S2PA 2VK3A 2IWDA 3OBFA 3PYPA 3VFHA 4E04A 4K0XA 1DJAA 3UY6A 1JWZA 3SZTA 2ZBBA 2PHYA 2OLUA 2O9AA 1W8YA 2PU4A 1MXOA 3EWKA 4IBXA 3GTCA 3A3JA 1TDLA 4MN5A 2KLIA 3BWLA 3KO6A 1T18A 5L2FA 4WF0A 1DJCA 2XRNA 1TS8A 1S66L 4Y7PA 2B5RA 4HJ6A 1OTAA 4E6XA 4PKYA 3A0VA 3C38A 4KZ7A 3R4KA 4HI4A 3Q07A 4RQ9A 1BLHA 4R70A 1K56D 3FV7A 3BYDA 3MFDA 2V8FA 4I3JA 4E3OA 3HLEA 4M4XA 2WKIA 1PRQA 5C5KA 5KSCA 4LV1A 1D7EA 3NULA 3OPHA 3M2KA 2X01A 3QP6A 3WS4A 1E25A 2QWSA 4DE3A 2HDSA 5U47A 5FEFA 5M1AA 1XJ3A 2XROA 2ZL1B 4U3TA 3OOVA 4JGQA 4U0XA 3E0YA 2ZQ8A 4EEUA 4B93A 3NCKA 3IX3A 4ID4A 3ZHHA 4H8RA 4JGRA 4GCZA 1E3UD 1L0DA 1MWUA 3E4QA 3TOIA 1T1CA 3B3XA 5HAQA 4K91A 5IS1A 3G31A 3BRMA 3ZQ5A 1K55C 5MC7A 1ZTUA 5F83A 2GZAA 3CZDA 1MBLA 1GHMA 3UE3A 3HBRA 3S7QA 4S2JA 5AJGA 4BWIA 1PWDA 3T4JA 5IU1A 3T4SA 4QPRA 2LB9A 3GV9A 3UNWA 4B4XA 5EOOA 3FKVA 4HIAA 4F3LB 4I38A 1PZPA 1OTDA 1IEMA 3UE6A 3SH8A 1LSVA 5FSRA 4LFUA 2JKTI 2Y2NA 5A8BA 1XFNA 2Y59A 4LCLA 2BLSA 5CEDA 4F94A 4X1LA 1FCMA 4UAAA 3IXHA 3DWKA 4HESA 3OPPA 3T1RA 4UA6A 3LI8A 2ZC5B 2XLNA 4QU3A 2XH9A 3N7WA 3IHBA 2VV6A 2OV5A 3WWXA 1OTEA 1NLYA 5HW3A 3ZDJA 4MLLA 1GA9A 3IWIA 1GSXA 4GW9A 3WRTA 5L09A 1OJGA 3A0RA 5I94A 4GZBA 5FL3A 1KDSA 2RCXA 3S1YA 4P6BA 3OLOA 4R6LA 2PT7A 3GMWA 1TEMA 4PMAA 2G2UA 4BLMA 2JE5A 4OPRA 3UN7A 1U60A 2Y2JA 3EEAA 5TBMA 3NOTC 1CK3A 2FFYA 3ZVTA 3IWQA 4ZJ1A 2UWXA 2JC7A 1RGYA 1K4EA 3HJIA 3Q7VA 1F5MA 3O5YA 2ZM8A 5CRFA 3H82B 3V67A 3LCEA 1DP6A 3NECA 3O87A 5A91A 2EX2A 2OAP1 1IYOA 3C4PA 1VB6A 3MKEA 3C2WA 3IQAA 5HPIA 3NIAA 3ITBA 4JF5A 1DY6A 3GECA 3A3IA 3S7PA 2A49A 1Z6FA 4ETXA 4F3LA 2ZMFA 2Z2LB 3HUMA 4ZAMA 5CECA 3W4QA 3WS5A 4JF4A 1SKFA 4A5RA 3IBRA 4MEZA 3UDIA 3HJKA 2W1TB 4MN6A 2QJ5A 1XJ2A 3EQUA 4MCWA 5CGWA 3V3SA 5EM1A 3R7WA 3IBJA 1A0KA 2WK0A 3MJQA 4RX3A 4R4RA 1MY8A 2ZM0A 4ARZB 1K6SA 1K6RA 3OCLA 4HY8A 1LT0A 4LV3A 3UE1A 2KOIA 1J3WA 3BFDA 3LIFA 2V1BA 5HZHA 4EETB 3IS2A 5FA7A 4KZAA 3M6HA 2QHKA 2O0YA 2ZOHA 1G6AA 4KG2A 2E8IA 3LI9A 4KZ8A 3MFXA 4EUZA 3SW1A 2Y2GA 4KZ5A 1PW1A 3BEBA 4NK3A 5BOHA 5D3OA 4K0WA 3T50A 1P9WA 5CTNA 3SH9A 4YOFA 1IKIA 5KIZA 3Q7VB 1Z09A 1NZOA 3E2KA 2HGVA 4L9FA 4HEFA 5HWVA 5HDSA 3HLWA 4QY5A 5EVEA 3NDEA 4L9GA 2Z2MB 5E2GA 1J9MA 3MQ0A 3KX0X 4I3AA 4DJ3A 4OQGA 2VV7A 2P9VB 5FASA 2O9CA 4G3VA 2WKRA 3UDXA 5A92A 1G5UA 1V9YA 2VGLS 2QKPA 1W5DA 5GHXA 1L0GA 2VJWA 5LBRA 2HV1A 3BECA 3RFBA 4D2OA 2A3UA 2OWJA 4FCFA 4X55A 5DTTA 1KE0A 4E3JA 4HP9A 3T1SA 5FAPA 2XSSA 3GVBA 4EWFA 1XA7A 2HP5A 4R3BA 4FH4A 1DRMA 1OMEA 4JXGA 5DTKA 3MZDA 4IUHA 2H0TA 3B33A 1GSVA 1JVJA 2ZL1A 4HJ4A 4NKPA 4IBRA 2AVXA 4MNRA 2P04A 1Y28A 4N1HA 3A3DA 4FH2A 5GL9A 5F82A 5DFXA 5HL6A 1LI9A 2WGIA 4P6ZS 2HJ9C 2BTFP 4E6WA 1D1JA 2L1MA 3DBAA 3UB7A 3Q7ZA 4D60A 1JWVA 1L0FA 4HBTA 4OPYA 1NRJA 1PW8A 4O7DA 2XEPA 1VETA 2I72A 1S67L 2W3GA 1HVBA 2XA7S 4Q0JA 2CC1A 4C6YA 3C7UA 5EVIB 5AQ7A 4OVDA 3ZNYA 4JXWA 4OQIA 1M6KA 3AGEA 3GRJA 4GNUA 3M2JA 1LSXA 2OSUA 1JTDA 1W63M 2FH5A 5FAOA 2GJ3A 1S4SA 2W1RA 3VOZA 2R9WA 4N9LA 2XR0A 2V8CA 3QP8A 3OZHA 4WEKA 3RTYA 4EERA 4GKUA 3NJAA 1HD8A 4P87A 4ZDXA 4BBUA 1O7EA 2R78A 4KUKA 1BYWA 3DTMA 5GLDA 4FOFA 3IF5A 4QD4A 4S2NC 1NLZA 4WMCD 5GHZA 2MJ6A 4CQHA 3ZYTA 2O99A 4MN7A 4IUKA 2WKPA 4L0LA 1D06A 1ES4A 4NXBA 2HP6A 4BD1A 1SHVA 2J3TC 2ZM2A 1MKIA 1UWPX 5K5BA 4NXFA 1FCOA 3MR0A 1T19A 3JYIA 1TF1A 4WELA 3HUOA 3KSGA 1YAXA 1YKDA 1KVLA 2PD7A 4JXVA 3FPVA 2WGVA 2WYXA 4E3MA 1S0WA 2ZQ9A 1XA1A 1HTZA 1EW0A 2HJEA 3IX8A 1G28A 4DMZA 1GSWA 4LENA 3CWFA 4QJGA 3VE3A 4Y3IA 1H8YA 2W3DA 3WS0A 1K54C 2HDQA 2XDMA 2NUPC 4PM9A 1TS6A 4P85A 1S1YA 3IX4A 4DN0A 2VLGA 1XKZA 3ICYA 2WZXA 3EQVA 5KSHA 1E3UA 3W4OA 1IKGA 2P9VA 1BUEA 3W8KA 3U4LP 4E3IA 4LV2A 3S7OA 4EBPA 1NJ4A 5FATA 3G2ZA 2PDRA 4WM9A 3ULFA 1I5QA 1QMEA 4YFMA 1ZHHB 2IA2A 3LIAA 3GQZA 5EFWA 3E2LA 2R9XA 3B47A 4X56A 5TFQA 2M1CA 3MMHA 3V5MA 3PBQA 2P7JA 2JKRI 2Y2PA 1FR6A 4K08A 3RH8B 3G6OA 3T12B 1S4RA 3BFEA 4PM7A 3VSLA 5AQAA 3S7NA 1EWZA 1H3QA 1TD5A 5HFOA 3UB5P 4JXSA 3NDGA 4Y5FA 2HF6A 1PI4A 5M18A 4ME4A 4NEED 2KX6A 3CITA 5J8XA 4RX2A 1KGEA 4UQIS 4DDYA 1K0KA 2Y2OA 4OQHA 1ERQA 2WADA 4ETZA 1YT4A 3CPTB 4LGWA 3SS3A 5EVID 5CGSA 1N9LA 4WBGA 1GA0A 2OAQ1 4HP4A 1MZUA 1RGZA 4Z1WA 3U2AA 5EVIA 5G4ZA 2VGKA 4CPKA 4Y13A 1NWZA 1YMSA 2J80A 3E98A 5FI7A 4HQAA 1Y4OA 3LIDA 4KZ4A 2INWA 2W1TA 1GHIA 4HH2A 1YLJA 3CI6A 1OTBA 4BL2A 3P01A 2ZD8A 3VV4A 2EWVA 4DRTA 2W0NA 2Y2IA 3UPNA 5AVEA 2J9PA 1ES3A 4R4SA 3TG9A 4R3AA 2DNSA 1LL8A 4EQIA 1PIOA 1NYMA 3K3DA 2W3EA 3CUEC 5HPFA 4C75A 4CLCA 2Y2QA 1CI9A 3NBLA 5FI6A 2J3TD 1DP8A 1WA9A 1DP9A 5HD5A 2BASA 2G2WA 1H0MA 3KSHA 3W2ZA 1BLPA 2PR6A 1I2WA 4CJNA 4Q0HA 4LRZE 4QWOA 3M6BA 2JHEA 3HLGA 2EX8A 2VA0A 2WKHA 2A2LA 2ACGA 3ZG9B 2PBYA 4UHUA 2QJ7A 1IYPA 1IELA 5FQKA 1LHYA 1CEGA 4LLOB 2XD5A 2WGWB 1ES2A 3NI9A 5J4EA 4DDSA 4I3IA 3UPPA 4WZ5A 2Y4AA 4S2IA 2EWWA 3H9WA 2H5SA 2GX5A 3IWOA 2GDNA 1ALQA 5GLCA 4N1XA 4C3QA 3LEZA 4EQ1A 3ZGAB 5HL1A 3MXSA 5TR7A 1AXBA 2WAEA 2QZ6A 2QMIA 1LL9A 3PHYA 4KQQA 2HPBA 1TDGA 3QP2A 4WZ5C 2Y2KA 1FOFA 5F1GA 4Q0IA 2VV8A 4KQOA 1L3LA 3GSGA 1LLBA 2JKFA 3IHAA 3BLMA 4WLAA 3G32A 2Q9NA 5CGXA 3Q1FA 4E3NA 5DF9A 3ZG5A 3IF6B 4BQMA 3IXDA 2ZQDA 4EBNA 3D3OA 3OPLA 3KYQA 3NHQA 3VP2A 1F2KA 3W4PA 2B18A 3PBOA 5DKKA 2J9OA 2ZC3B 2H10A 3BFFA 3LYXA 4OPZA 1HZOA 4QB8A 2EA9A 2W27A 1STZA 2HZ5A 3VP1A 2M7UA 3IXGA 3BQ8A 3UMDA 2IWBA 1ERMA 1NXYA 4N9KA 2JBFA 2YKHA 5EE8A 5FEGA 1K57C 5HAPA 1UGUA 3L9KA 5EOEA 2G7UA 5DJTA 3ZNTA 3CJMA 1OPXA 4EEPA 3T1XA 4AFIA 4EW7A 4KG6A 5JYPA 4DE2A 1ESUA 1FQGA 2VKSA 3IT9A 3T4QA 3UB8A 5A93A 4WEJA 4B4ZA 4JF6A 2HDUA 4KUOA 3PBNA 3VOYA 4IHQA 2DRWA 3FC7A 1BT5A 3OPRA 3PBTA 4EXOA 2XGNA 3PXPA 3MS6A 4R23A 3C30A 4PM5A 4KZ9A 4GD6A 1YPRA 4WMCA 3LO7A 1PNEA 1OTIA 3G34A 4XT2A 2IWCA 3TJZC 2J3WA 2EXAA 5FI2A 3TW8A 5F5YA 3F1NB 1MWRA 3KYZA 4H6JA 4OLGA 2PU2A 1KOUA 1IOUA 5FQ9A 3UE0A 1TS7A 1JWPA 3C4OA 3T4TA 1Q2PA 3LY3A 2VGJA 3OCNA 3R7WB 4G3WA 1MPLA 3E4OA 3CHWP 2JCHA 3HLDA 1CI8A 4ZJ3A 3JPUA 1ACFA 3QP5A 4H6JB 1KGFA 4FSFA 3PAGA 1K38A 4YWZA 2QYBA 3C8CA 3K2NA 4UEYA 4E3LA 5EVIC 2EFUA 3G4PA 4O8GA 5DVAA 3T4KA 3JVVA 5GLBA 1C3BA 3CLOA 3RXXA 4DXCA 1FCNA 4KG5A 3TSGA 2V1AA 1RP5A 3NC8A 3C5AA 1ZKJA 1OT6A 1WYCA 1YLZA 5EV0A 3HL9A 3SS5A 3LFVA 4OLDA 4R38A 3PBRA 2ZC6B 1IYQA 4CLCC 2JKTM 3FYZA 3CUEA 4CLCB 1K4FA 1FSYA 5J7EA 1BULA 3O88A 4GN2A 2WKQA 4JKTA 4GLQA 5CTMA 1N4OA 2EXBA 1PWCA 1NYYA 3KSIA 4LPZA 1VHMA 4Y0TA 3A3EA 4LRXC 4Q8IA 2VZWA 5FDHA 3B42A 1TS0A 4LCMA 2RL3A 5E2FA 5AVFA 1IFQA 4OPQA 1H8MA 1YMXA 1BSGA 2Q9MA 3CAXA 1NZUA 2Y55A 2D02A 2Z6CA 4EBLA 5FAQA 4Y2FA 5HWTA 3ZG7B 3PTEA 4S2OA 1YSQA 2WGWA 3P09A 2K31A 2Y2MA 4IVKA 2ZC7A 1G6OA 2B02A 4PPRA 3HLFA 5EECA 3Q81A 4X25A 4BL3A 2E8JA 1V9ZA 4XUXA 4EUVA 5CHUA 3I7JA 3F1OA 4OOMA 4Y15A 4ESPA 3HVFA 2K7SA 1KE3A 1K54A 1P9RA 2V0WA 3LR5A 5IT5A 3IH8A 1K56A 3T1QB 3VFFA 3LR4A 4Y17A 3MQOA 2Y2HA 4BENA 3PR6A 4YINA 1FIKA 3PAEA 1UWNX 1OT9A 3CG5A 5F6AA 5CERA 1H5XA 4B88A 3IH9A 2J7VA 5HDDA 4HH3A 4I5SA 5FQIA 3MKFA 3HUNA 1PYYA 3CPTA 3FZCA 1JTGA 5E2EA 4X68A 1BLSA 4XXRA 2V20A 5TGFA 3VP4A 3LR0A 4OP5A 3UB6A 4MDZA 3K3CA 5FQQA 1SKOA 4NXGA 4E3KA 3BLSA 2H28A 5KMWA 4IVIA 4NG2A 1MKMA 4WUJA 3DAVA 1VEUB 5HWWA 3ISGA 2EX6A 5IHVA 1XPBA 4IJGA 4BBVA 4GS9B 1VETB 5KZHA 5J3WA 2HDRA 4L9EA 3ZG0A 1SCWA 4JGOA 2JKRM 4JGPA 4MBFA 3C7VA 4BBTA 4GD8A 3VP3A 2M7VA 2WKEA 3P98A 4RA7A 3O86A 3SS4A 3BY9A 2EX9A 2W3FA 4GJ4A 2J8YA 1S6RA 1CF0A 1Y54A 1LL5A 3DTKA 4FD8A 1YLYA 1BLCA 1L2SA 3WS1A 3HLCA 5L07A 3BQAA 4LV0A 2ZLYA 4BD0A 3UO9A 3P7NA 4BMWA 2WAFA 1QMFA 4HNBA 4EU0A 1ZG6A 1YSPA 1ES5A 3HCYA 2B95A 3MXQA 4KQRA 1P97A 1GCEA 2X02A 5DF7A 3AGFA 2XFSA 3LIBA 4JPMA 1Q2QA 3ZFZA 4EESA 1N9OA 4DE1A 3NOPC 4OP8A 4HBUA 1KGGA 5JYOA 3G35A 3NY4A 4YNRA 1L0EA 5AQBA 2K2NA 1XJ6A 5DTSA 4GHIB 1DJBA 2BG1A 4ZBEA 1SDEA 3HLBA 3BY8A 4KZBA 2I9VA 3N8SA 4RVAA 5L8MA 4DKIA 1IYSA 2Q0OA 4DE0A 3A3FA 4CLCD 5G18A 4FUWA 5AQ9A 1G68A 2VGLM 3AGDA 3FWLA 1M40A 4CLCE 2VX8A 3N4IA 5M19A 2ZQAA 1WE4A 1F98A 3WRZA 3UMEA 3RXWA 1XFQA 2UV0E 1H8ZA 2OOLA 3NOUC 3GR2A 1S1ZA 4X53A 1ONGA 4ZTKA 3QNCA 1T1AA 4O0PA 4X69A 1LSWA 3KYEA 3LY4A 3EEHA 1MWTA 4OONA 4G3KA 4S2NA 4PHTA 3D4FA 2CMNA 4GDBA 1XX2A 4JLFA 3VMAA 5L10A 4Y0UA 2XA7M 1FSWA 1N9BA 4KZ6A 4O01A 1ZG4A 4DXBA 5HSQA 3Q82A 2L4RA 3KSFA 1XJ4A 3IF6C 2KDKA 3F1PA 4QY6A 4N92A 1K25A 5HDCA 2JKGA 3JVUA 4UQIM 4OKPA 2X71A 3ZG8B 5HARA 4R1GA 5CXWA 1EROA 1K57A 3H82A 4PKYG 1BZAA 4Y0OA 2OWHA 4P6ZM 2XQZA 2V1ZA 5GLAA 1T1BA 2PAVP 4NXEA 4OQ0A 2XK1A 3F1PB 1W7FA 4XUZA 2XF3A 4WN5A 3UB9A 5F68A 2ZQ7A 2PBDP 1LI0A 1VM1A 2D01A 3O3VA 5HX9A 3V3RA 4FTXA 2C6WB 4KZ3A 3WS2A 1KVMA 2L0WA 3MXRA 4WYYA 5EPHA 1HLUP 3H7WA 1ESIA 5CX7A 2ZMAA 4GS9A 4RYEA 4S2KA 3TE8A 1EI5A 3LUQA 5A90A 1XXMA 4P0MA 5CHJA 1ONHA 4DF6A 2DMWA 4KQDA 3UPOA 4QHCA 2ZC4B 1KDWA 2V2FF 3BM6A 5FQJA 5CEBA 2PR5A 3E4PA 4ARZA 1W79A 2Y91A 4M3KA 1CEFA 2P08A 4GDNA 4DJ2A 2FZ0A 2C5WB 1RCJA 5I5LA 1YLTA 3SOIA 4R3JA 2PD8A 2Y8HA 4UA9A 2Y2LA 3TRCA 1I2SA 3LICA 4WL9A 3PBSA 2FFFB 3FG8A 1YM1A 4ZRRA 3MQQA 1K55A 1WYBA 4NETA 3N8LA 1YLPA 4X1MA 5E43A 3MSHA 4UA7A 2XD1A 1W8QA 4PAUA 1SZVA 4WZ4A 3V39A 3S22A 3F1NA 3T4OA 1YQSA 1E4DA 1GHPA 2YKFA 2VEAA 3BFGA 4GOGA 3LEQA 1XGJA 2QPNA 1F9IA 3ZCZA 5DFYA 1PZOA 5HAIA 5DKLA 2LB5A 2JN7A 3IF6A 4MBKA 3FKWA 4R0QA 5GHYA 4EV4A 3DTIA 1MWSA 3DWZA 2A24A 4B9OA 1P0ZA 3S4XA 3LIEA 3DW0A 2Z6DA 3OC2A 2ZMVA 5F69A 3CMZA 3ZVWA 1TVFA 4XT2B 1YLWA 3T4LA 3N8RA 3G2YA 2O9BA 3ITAA 2NUTC 4II7A 4OOLA 4OOYA 4KENB
chains in the Genus database with same CATH topology
4BJPA 4I5SA 3VE4A 5AVEA 1W63Q 4ARZB 3OCLA 4HY8A 1LT0A 3FPWA 2KOIA 3H7WB 4R3AA 1LL8A 3LIFA 2V1BA 5HZHA 3LR0A 3IS2A 3UB6A 3K3DA 4EETB 2W3EA 4MDZA 3K3CA 3CUEC 4I39A 5HPFA 4NXGA 4CLCA 2QHKA 2O0YA 2ZOHA 2H28A 3LI9A 3MFXA 3SW1A 4HJ3A 1MKMA 4WUJA 2J3TD 1DP8A 1WA9A 1OJ5A 5TJJA 1DP9A 5HWWA 3T50A 5HD5A 1P9WA 2BASA 3A0SA 4YOFA 3KSHA 3W2ZA 5KIZA 1JNUA 2PR6A 2V0UA 4Q0HA 4LRZE 2HGVA 4L9FA 4IJGA 4BBVA 5HWVA 4GS9B 5HDSA 2JHEA 5J3WA 4L9EA 4JGOA 2JKRM 4JGPA 4L9GA 2VA0A 4BBTA 2GNXA 3MQ0A 3KX0X 2A2LA 4I3AA 4DJ3A 5TBMB 2M7VA 2VV7A 5G4YA 4LRYC 3MF0A 2QJ7A 2O9CA 4G3VA 4LLOB 2WKRA 1X0OA 5J4EA 1V9YA 2VGLS 2QKPA 3BY9A 4I3IA 2W3FA 3EGDC 4GJ4A 2A24B 5HD3A 2VJWA 2V9AA 2EWWA 3H9WA 4GHIA 5LBRA 2HV1A 3D72A 3RFBA 2ZOIA 3IS2B 2GX5A 2OWJA 4HOIA 3BQAA 4EQ1A 4HP9A 2Y79A 4BMWA 2XSSA 3P7NA 4HNBA 3F1OB 4EU0A 1YSPA 3MXQA 3HCYA 1DRMA 1P97A 3BW6A 5DJUA 3EGXC 4IUHA 3VOLA 3B33A 3PHYA 3LIBA 1GSVA 4HJ4A 1N9NA 4NKPA 4Q0IA 4EESA 2VV8A 4KQOA 1N9OA 4MMNA 3NOPC 3EOIA 2P04A 1Y28A 3GDIA 4WLAA 5DFXA 5HL6A 1ODVA 4P6ZS 2HJ9C 5DF9A 2PYPA 3LR3A 4YNRA 2L1MA 3DBAA 2K2NA 1XJ6A 3UB7A 3D3OA 3KYQA 3NHQA 2PYRA 3BJNA 4HHDA 1MC0A 2B18A 4GHIB 1NRJA 2W3HA 3PBOA 3BY8A 2I9VA 3OBFA 3PYPA 5DKKA 5L8MA 4E04A 3LYXA 4CLCD 1S67L 2W3GA 2XA7S 4Q0JA 2ZBBA 2VGLM 2EA9A 2PHYA 2W27A 2O9AA 1STZA 2M7UA 4CLCE 3EWKA 2VX8A 3BQ8A 3UMDA 2YKHA 4MN5A 2KLIA 3BWLA 3KO6A 1LSXA 1T18A 1F98A 4WF0A 3UMEA 1UGUA 1W63M 2XRNA 2FH5A 1TS8A 1S4SA 1XFQA 2G7UA 2GJ3A 2W1RA 5DJTA 2OOLA 1S66L 3NOUC 1OPXA 4EEPA 4HJ6A 1OTAA 4PKYA 4AFIA 1S1ZA 4EW7A 3A0VA 3C38A 4WEKA 3R4KA 2VKSA 3RTYA 1T1AA 3T4QA 4O0PA 3UB8A 4WEJA 4EERA 1LSWA 4HI4A 3NJAA 3EEHA 4RQ9A 4G3KA 4BBUA 4R70A 4PHTA 2R78A 4KUKA 1BYWA 4KUOA 3PBNA 2CMNA 4IHQA 4FOFA 3FC7A 3PBTA 4EXOA 2XA7M 1NLZA 3PXPA 4I3JA 2MJ6A 4CQHA 3ZYTA 2O99A 4M4XA 4MN7A 4O01A 3C30A 5C5KA 4IUKA 2WKPA 4L0LA 1D06A 5HSQA 1D7EA 2L4RA 4NXBA 3KSFA 1XJ4A 2KDKA 2J3TC 3F1PA 5HDCA 1OTIA 1UWPX 5K5BA 3JVUA 4UQIM 4NXFA 4XT2A 3MR0A 1T19A 1TF1A 3TJZC 2J3WA 4WELA 2QWSA 3TW8A 3KSGA 5F5YA 3F1NB 1YAXA 3KYZA 1XJ3A 1YKDA 2PD7A 4H6JA 4PKYG 3H82A 2XROA 3OOVA 4JGQA 3FPVA 1KOUA 1IOUA 2OWHA 3E0YA 4P6ZM 4EEUA 1T1BA 4B93A 1TS7A 4NXEA 3T4TA 4JGRA 4GCZA 3F1PB 3OCNA 3E4QA 3R7WB 4G3WA 1T1CA 4WN5A 3UB9A 5F68A 3E4OA 1EW0A 2HJEA 2D01A 5IS1A 1G28A 4H6JB 4FSFA 3ZQ5A 4DMZA 1GSWA 3CWFA 5MC7A 4YWZA 2QYBA 3VE3A 1ZTUA 3C8CA 4Y3IA 2GZAA 3K2NA 2L0WA 4UEYA 2W3DA 3H7WA 3UE3A 5CX7A 3S7QA 4BWIA 5AJGA 2NUPC 4O8GA 4GS9A 1TS6A 3T4KA 1S1YA 3T4JA 3JVVA 3LUQA 2VLGA 4QPRA 2LB9A 5IU1A 3T4SA 3TE8A 4DN0A 3ICYA 3CLOA 4HIAA 4F3LB 2DMWA 3EQVA 4KQDA 5KSHA 2V1AA 4I38A 1OTDA 3UE6A 1LSVA 1OT6A 2JKTI 2PR5A 5A8BA 1XFNA 3E4PA 4ARZA 3S7OA 3LFVA 2P08A 4R38A 3PBRA 4DJ2A 2FZ0A 3LI8A 2PDRA 3ULFA 4CLCC 2JKTM 5I5LA 3CUEA 4CLCB 5J7EA 2VV6A 1ZHHB 1OTEA 1NLYA 2PD8A 2Y8HA 2IA2A 3LIAA 5EFWA 2WKQA 4GLQA 1GSXA 4GW9A 3TRCA 3LICA 4WL9A 3B47A 1OJGA 3A0RA 3KSIA 3PBSA 2M1CA 3MMHA 4LPZA 1VHMA 3FG8A 3PBQA 5FL3A 2P7JA 2JKRI 4ZRRA 3MQQA 3OLOA 4R6LA 4K08A 3RH8B 2PT7A 3G6OA 4LRXC 1S4RA 2VZWA 3B42A 1TS0A 3EEAA 5TBMA 3S7NA 5AVFA 3NOTC 1IFQA 1H3QA 1TD5A 4PAUA 1H8MA 3CAXA 4Y5FA 2HF6A 2D02A 2Z6CA 3F1NA 4ME4A 4NEED 4Y2FA 3HJIA 5HWTA 3T4OA 2KX6A 3CITA 1F5MA 1YSQA 3O5YA 2K31A 3H82B 3V67A 2YKFA 2VEAA 4UQIS 1DP6A 1G6OA 2B02A 4ETZA 1F9IA 5DFYA 2OAP1 1VB6A 5DKLA 2LB5A 3C2WA 1V9ZA 5HPIA 1N9LA 2JN7A 4EUVA 2OAQ1 4HP4A 3F1OA 3GECA 1MZUA 4OOMA 4Z1WA 3S7PA 2K7SA 3U2AA 4ETXA 5G4ZA 4F3LA 2ZMFA 2A24A 1P9RA 1NWZA 2V0WA 4B9OA 2J80A 3LR5A 1P0ZA 5IT5A 3E98A 3LIEA 4HQAA 3LR4A 2Z6DA 3LIDA 3IBRA 3MQOA 3OC2A 2INWA 2ZMVA 5F69A 2W1TA 3PR6A 3HJKA 2W1TB 4HH2A 4MN6A 3CI6A 1OTBA 3P01A 2QJ5A 1XJ2A 3EQUA 4MCWA 1UWNX 4XT2B 1OT9A 3VV4A 3T4LA 3R7WA 2EWVA 3IBJA 5F6AA 2W0NA 3MJQA 2O9BA 2NUTC 4II7A 4OOLA 5HDDA 4HH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D06 A;  5A8B A;  1D7E A;  2L4R A;  4I5S A;  3LIA A;  4NXB A;  5AVE A;  5EFW A;  3VE4 A;  2WKQ A;  1XJ4 A;  4HY8 A;  1GSX A;  1Y28 A;  1LT0 A;  4GW9 A;  2KDK A;  3F1P A;  3GDI A;  4PKY A;  3LIC A;  5HDC A;  4WL9 A;  4WLA A;  1OTI A;  1OJG A;  1UWP X;  4NXF A;  3A0R A;  4XT2 A;  2M1C A;  3H7W B;  3MR0 A;  4LPZ A;  1ODV A;  1T19 A;  4R3A A;  3FG8 A;  1LL8 A;  2QWS A;  3LIF A;  2P7J A;  5F5Y A;  3F1N B;  2V1B A;  5HZH A;  2PYP A;  3IS2 A;  3MQQ A;  3K3D A;  3UB6 A;  3OLO A;  1XJ3 A;  4EET B;  2PD7 A;  3K3C A;  4H6J A;  3H82 A;  4I39 A;  4K08 A;  2L1M A;  3G6O A;  4NXG A;  4PKY G;  3RH8 B;  2QHK A;  2ZOH A;  4JGQ A;  1S4R A;  2H28 A;  4LRX C;  1KOU A;  1XJ6 A;  2OWH A;  3UB9 A;  3UB7 A;  1TS0 A;  3LI9 A;  4EEU A;  1T1B A;  3MFX A;  3NHQ A;  2PYR A;  4HJ3 A;  1TS7 A;  3SW1 A;  4NXE A;  5TBM A;  5AVF A;  3NOT C;  4WUJ A;  4HHD A;  1DP8 A;  1WA9 A;  4GHI B;  1OJ5 A;  4JGR A;  1DP9 A;  4GCZ A;  3T50 A;  5HD5 A;  5HWW A;  3F1P B;  3CAX A;  3BY8 A;  2BAS A;  2I9V A;  4EES A;  3PYP A;  3A0S A;  3E4Q A;  5DKK A;  2D02 A;  2Z6C A;  5KIZ A;  1JNU A;  2PR6 A;  2V0U A;  1T1C A;  4E04 A;  3F1N A;  4WN5 A;  4LRZ E;  5F68 A;  4L9F A;  5HWT A;  3E4O A;  3HJI A;  1EW0 A;  2KX6 A;  3LYX A;  4BBV A;  5HWV A;  4GS9 B;  5HDS A;  1S67 L;  2D01 A;  5IS1 A;  2JHE A;  5J3W A;  1G28 A;  4L9E A;  4H6J B;  3H82 B;  2ZBB A;  2YKF A;  4JGO A;  2VEA A;  4JGP A;  4L9G A;  3ZQ5 A;  1GSW A;  2EA9 A;  2PHY A;  2W27 A;  3CWF A;  4R6L A;  4BBT A;  4YWZ A;  1DP6 A;  3KX0 X;  4I3A A;  3VE3 A;  4DJ3 A;  2B02 A;  3EWK A;  3C8C A;  1F9I A;  5TBM B;  3UMD A;  2L0W A;  2YKH A;  1VB6 A;  2VV7 A;  3H7W A;  5DKL A;  4MN5 A;  4LRY C;  5G4Y A;  3C2W A;  1V9Z A;  2QJ7 A;  3BWL A;  1LSX A;  1T18 A;  1N9L A;  1F98 A;  4WF0 A;  2JN7 A;  4LLO B;  4GS9 A;  1TS6 A;  1S1Y A;  3UME A;  2WKR A;  1X0O A;  1UGU A;  5IU1 A;  3LUQ A;  2VLG A;  4HP4 A;  5J4E A;  1V9Y A;  3F1O A;  3GEC A;  1MZU A;  2QKP A;  1TS8 A;  1S4S A;  1XFQ A;  2GJ3 A;  2K7S A;  3BY9 A;  3ICY A;  3CLO A;  4I3I A;  5DJT A;  2A24 B;  2OOL A;  4HIA A;  5G4Z A;  1S66 L;  3NOU C;  5HD3 A;  4EEP A;  4F3L A;  4HJ6 A;  2A24 A;  4F3L B;  1NWZ A;  2V0W A;  1OTA A;  2J80 A;  2V1A A;  4I38 A;  4KQD A;  1S1Z A;  2V9A A;  1OTD A;  3A0V A;  3H9W A;  1P0Z A;  2HV1 A;  4GHI A;  3D72 A;  3UE6 A;  2ZOI A;  3IS2 B;  3RTY A;  1LSV A;  2OWJ A;  3LIE A;  4HQA A;  1T1A A;  4HOI A;  3UB8 A;  2Z6D A;  1OT6 A;  3LID A;  4EQ1 A;  3IBR A;  2PR5 A;  3MQO A;  4EER A;  1LSW A;  1XFN A;  2INW A;  4HI4 A;  3NJA A;  5F69 A;  3EEH A;  4HP9 A;  3E4P A;  4RQ9 A;  5HDD A;  4BBU A;  3P7N A;  4R70 A;  3HJK A;  4HH3 A;  4EW7 A;  4HNB A;  3F1O B;  4HH2 A;  2R78 A;  4MN6 A;  4KUK A;  1BYW A;  3MXQ A;  4KUO A;  2CMN A;  1DRM A;  1OTB A;  1P97 A;  2QJ5 A;  1XJ2 A;  5DJU A;  4R38 A;  1UWN X;  4XT2 B;  1OT9 A;  3FC7 A;  4DJ2 A;  3LI8 A;  4EXO A;  3VOL A;  2PDR A;  3B33 A;  3PHY A;  3ULF A;  3LIB A;  1GSV A;  5I5L A;  4HJ4 A;  4I3J A;  5F6A A;  5J7E A;  5HSQ A;  2W0N A;  3MJQ A;  4M4X A;  1N9N A;  2VV6 A;  4B9O A;  2WKP A;  1OTE A;  2VV8 A;  1N9O A;  2PD8 A;  3NOP C; 
#chains in the Genus database with same CATH topology
 4BJP A;  3VE4 A;  3VSK A;  2H0Y A;  1W63 Q;  4S2M A;  3FPW A;  5E2H A;  3H7W B;  4MBH A;  3N6I A;  3SH7 A;  1SKO B;  4I39 A;  3UDF A;  4HJ3 A;  5F1F A;  3MBZ A;  1CJF A;  1OJ5 A;  3L7H A;  5TJJ A;  3BFC A;  3A0S A;  2WZZ A;  1JNU A;  2V0U A;  4IED A;  1BTL A;  1SDN A;  2P74 A;  1O07 A;  2GNX A;  4Z9Q A;  5TBM B;  1CQA A;  3G30 A;  5CHM A;  5G4Y A;  4LRY C;  3MF0 A;  5EUA A;  2ZJ9 A;  2EFX A;  2OLV A;  1X0O A;  2ZQC A;  3EGD C;  3QNB A;  2A24 B;  5HD3 A;  1XGI A;  4OH0 A;  3QHY A;  2V9A A;  4GHI A;  3QP4 A;  5FQM A;  3D72 A;  3MZF A;  2ZOI A;  3IS2 B;  4HOI A;  3LGO A;  4U0T A;  3V50 A;  4S2L A;  2Y79 A;  3F1O B;  1FIL A;  1VEU A;  1ZC2 A;  3BW6 A;  5DJU A;  3EGX C;  1FR1 A;  1NRF A;  4GB7 A;  2PRF A;  4PM6 A;  4X6T A;  5EVL A;  2WUQ A;  3VOL A;  1N9N A;  1NY0 A;  3QP1 A;  1VQQ A;  5FDS A;  2XFT A;  3MZE A;  4MMN A;  5EM0 A;  3EOI A;  1PI5 A;  5DF8 A;  3RJU A;  4PM8 A;  2HP9 A;  3GDI A;  3VP0 A;  1PWG A;  3HRE A;  1ODV A;  2DCF A;  3DTE A;  3IXB A;  4JBF A;  2PYP A;  3LR3 A;  4ZJ2 A;  1KE4 A;  1XP4 A;  1AWI A;  2PYR A;  3BJN A;  4HHD A;  1MC0 A;  1PFL A;  3D9Y A;  2W3H A;  4S2P A;  2VK3 A;  2IWD A;  3OBF A;  3PYP A;  3VFH A;  4E04 A;  4K0X A;  1DJA A;  3UY6 A;  1JWZ A;  3SZT A;  2ZBB A;  2PHY A;  2OLU A;  2O9A A;  1W8Y A;  2PU4 A;  1MXO A;  3EWK A;  4IBX A;  3GTC A;  3A3J A;  1TDL A;  4MN5 A;  2KLI A;  3BWL A;  3KO6 A;  1T18 A;  5L2F A;  4WF0 A;  1DJC A;  2XRN A;  1TS8 A;  1S66 L;  4Y7P A;  2B5R A;  4HJ6 A;  1OTA A;  4E6X A;  4PKY A;  3A0V A;  3C38 A;  4KZ7 A;  3R4K A;  4HI4 A;  3Q07 A;  4RQ9 A;  1BLH A;  4R70 A;  1K56 D;  3FV7 A;  3BYD A;  3MFD A;  2V8F A;  4I3J A;  4E3O A;  3HLE A;  4M4X A;  2WKI A;  1PRQ A;  5C5K A;  5KSC A;  4LV1 A;  1D7E A;  3NUL A;  3OPH A;  3M2K A;  2X01 A;  3QP6 A;  3WS4 A;  1E25 A;  2QWS A;  4DE3 A;  2HDS A;  5U47 A;  5FEF A;  5M1A A;  1XJ3 A;  2XRO A;  2ZL1 B;  4U3T A;  3OOV A;  4JGQ A;  4U0X A;  3E0Y A;  2ZQ8 A;  4EEU A;  4B93 A;  3NCK A;  3IX3 A;  4ID4 A;  3ZHH A;  4H8R A;  4JGR A;  4GCZ A;  1E3U D;  1L0D A;  1MWU A;  3E4Q A;  3TOI A;  1T1C A;  3B3X A;  5HAQ A;  4K91 A;  5IS1 A;  3G31 A;  3BRM A;  3ZQ5 A;  1K55 C;  5MC7 A;  1ZTU A;  5F83 A;  2GZA A;  3CZD A;  1MBL A;  1GHM A;  3UE3 A;  3HBR A;  3S7Q A;  4S2J A;  5AJG A;  4BWI A;  1PWD A;  3T4J A;  5IU1 A;  3T4S A;  4QPR A;  2LB9 A;  3GV9 A;  3UNW A;  4B4X A;  5EOO A;  3FKV A;  4HIA A;  4F3L B;  4I38 A;  1PZP A;  1OTD A;  1IEM A;  3UE6 A;  3SH8 A;  1LSV A;  5FSR A;  4LFU A;  2JKT I;  2Y2N A;  5A8B A;  1XFN A;  2Y59 A;  4LCL A;  2BLS A;  5CED A;  4F94 A;  4X1L A;  1FCM A;  4UAA A;  3IXH A;  3DWK A;  4HES A;  3OPP A;  3T1R A;  4UA6 A;  3LI8 A;  2ZC5 B;  2XLN A;  4QU3 A;  2XH9 A;  3N7W A;  3IHB A;  2VV6 A;  2OV5 A;  3WWX A;  1OTE A;  1NLY A;  5HW3 A;  3ZDJ A;  4MLL A;  1GA9 A;  3IWI A;  1GSX A;  4GW9 A;  3WRT A;  5L09 A;  1OJG A;  3A0R A;  5I94 A;  4GZB A;  5FL3 A;  1KDS A;  2RCX A;  3S1Y A;  4P6B A;  3OLO A;  4R6L A;  2PT7 A;  3GMW A;  1TEM A;  4PMA A;  2G2U A;  4BLM A;  2JE5 A;  4OPR A;  3UN7 A;  1U60 A;  2Y2J A;  3EEA A;  5TBM A;  3NOT C;  1CK3 A;  2FFY A;  3ZVT A;  3IWQ A;  4ZJ1 A;  2UWX A;  2JC7 A;  1RGY A;  1K4E A;  3HJI A;  3Q7V A;  1F5M A;  3O5Y A;  2ZM8 A;  5CRF A;  3H82 B;  3V67 A;  3LCE A;  1DP6 A;  3NEC A;  3O87 A;  5A91 A;  2EX2 A;  2OAP 1;  1IYO A;  3C4P A;  1VB6 A;  3MKE A;  3C2W A;  3IQA A;  5HPI A;  3NIA A;  3ITB A;  4JF5 A;  1DY6 A;  3GEC A;  3A3I A;  3S7P A;  2A49 A;  1Z6F A;  4ETX A;  4F3L A;  2ZMF A;  2Z2L B;  3HUM A;  4ZAM A;  5CEC A;  3W4Q A;  3WS5 A;  4JF4 A;  1SKF A;  4A5R A;  3IBR A;  4MEZ A;  3UDI A;  3HJK A;  2W1T B;  4MN6 A;  2QJ5 A;  1XJ2 A;  3EQU A;  4MCW A;  5CGW A;  3V3S A;  5EM1 A;  3R7W A;  3IBJ A;  1A0K A;  2WK0 A;  3MJQ A;  4RX3 A;  4R4R A;  1MY8 A;  2ZM0 A;  4ARZ B;  1K6S A;  1K6R A;  3OCL A;  4HY8 A;  1LT0 A;  4LV3 A;  3UE1 A;  2KOI A;  1J3W A;  3BFD A;  3LIF A;  2V1B A;  5HZH A;  4EET B;  3IS2 A;  5FA7 A;  4KZA A;  3M6H A;  2QHK A;  2O0Y A;  2ZOH A;  1G6A A;  4KG2 A;  2E8I A;  3LI9 A;  4KZ8 A;  3MFX A;  4EUZ A;  3SW1 A;  2Y2G A;  4KZ5 A;  1PW1 A;  3BEB A;  4NK3 A;  5BOH A;  5D3O A;  4K0W A;  3T50 A;  1P9W A;  5CTN A;  3SH9 A;  4YOF A;  1IKI A;  5KIZ A;  3Q7V B;  1Z09 A;  1NZO A;  3E2K A;  2HGV A;  4L9F A;  4HEF A;  5HWV A;  5HDS A;  3HLW A;  4QY5 A;  5EVE A;  3NDE A;  4L9G A;  2Z2M B;  5E2G A;  1J9M A;  3MQ0 A;  3KX0 X;  4I3A A;  4DJ3 A;  4OQG A;  2VV7 A;  2P9V B;  5FAS A;  2O9C A;  4G3V A;  2WKR A;  3UDX A;  5A92 A;  1G5U A;  1V9Y A;  2VGL S;  2QKP A;  1W5D A;  5GHX A;  1L0G A;  2VJW A;  5LBR A;  2HV1 A;  3BEC A;  3RFB A;  4D2O A;  2A3U A;  2OWJ A;  4FCF A;  4X55 A;  5DTT A;  1KE0 A;  4E3J A;  4HP9 A;  3T1S A;  5FAP A;  2XSS A;  3GVB A;  4EWF A;  1XA7 A;  2HP5 A;  4R3B A;  4FH4 A;  1DRM A;  1OME A;  4JXG A;  5DTK A;  3MZD A;  4IUH A;  2H0T A;  3B33 A;  1GSV A;  1JVJ A;  2ZL1 A;  4HJ4 A;  4NKP A;  4IBR A;  2AVX A;  4MNR A;  2P04 A;  1Y28 A;  4N1H A;  3A3D A;  4FH2 A;  5GL9 A;  5F82 A;  5DFX A;  5HL6 A;  1LI9 A;  2WGI A;  4P6Z S;  2HJ9 C;  2BTF P;  4E6W A;  1D1J A;  2L1M A;  3DBA A;  3UB7 A;  3Q7Z A;  4D60 A;  1JWV A;  1L0F A;  4HBT A;  4OPY A;  1NRJ A;  1PW8 A;  4O7D A;  2XEP A;  1VET A;  2I72 A;  1S67 L;  2W3G A;  1HVB A;  2XA7 S;  4Q0J A;  2CC1 A;  4C6Y A;  3C7U A;  5EVI B;  5AQ7 A;  4OVD A;  3ZNY A;  4JXW A;  4OQI A;  1M6K A;  3AGE A;  3GRJ A;  4GNU A;  3M2J A;  1LSX A;  2OSU A;  1JTD A;  1W63 M;  2FH5 A;  5FAO A;  2GJ3 A;  1S4S A;  2W1R A;  3VOZ A;  2R9W A;  4N9L A;  2XR0 A;  2V8C A;  3QP8 A;  3OZH A;  4WEK A;  3RTY A;  4EER A;  4GKU A;  3NJA A;  1HD8 A;  4P87 A;  4ZDX A;  4BBU A;  1O7E A;  2R78 A;  4KUK A;  1BYW A;  3DTM A;  5GLD A;  4FOF A;  3IF5 A;  4QD4 A;  4S2N C;  1NLZ A;  4WMC D;  5GHZ A;  2MJ6 A;  4CQH A;  3ZYT A;  2O99 A;  4MN7 A;  4IUK A;  2WKP A;  4L0L A;  1D06 A;  1ES4 A;  4NXB A;  2HP6 A;  4BD1 A;  1SHV A;  2J3T C;  2ZM2 A;  1MKI A;  1UWP X;  5K5B A;  4NXF A;  1FCO A;  3MR0 A;  1T19 A;  3JYI A;  1TF1 A;  4WEL A;  3HUO A;  3KSG A;  1YAX A;  1YKD A;  1KVL A;  2PD7 A;  4JXV A;  3FPV A;  2WGV A;  2WYX A;  4E3M A;  1S0W A;  2ZQ9 A;  1XA1 A;  1HTZ A;  1EW0 A;  2HJE A;  3IX8 A;  1G28 A;  4DMZ A;  1GSW A;  4LEN A;  3CWF A;  4QJG A;  3VE3 A;  4Y3I A;  1H8Y A;  2W3D A;  3WS0 A;  1K54 C;  2HDQ A;  2XDM A;  2NUP C;  4PM9 A;  1TS6 A;  4P85 A;  1S1Y A;  3IX4 A;  4DN0 A;  2VLG A;  1XKZ A;  3ICY A;  2WZX A;  3EQV A;  5KSH A;  1E3U A;  3W4O A;  1IKG A;  2P9V A;  1BUE A;  3W8K A;  3U4L P;  4E3I A;  4LV2 A;  3S7O A;  4EBP A;  1NJ4 A;  5FAT A;  3G2Z A;  2PDR A;  4WM9 A;  3ULF A;  1I5Q A;  1QME A;  4YFM A;  1ZHH B;  2IA2 A;  3LIA A;  3GQZ A;  5EFW A;  3E2L A;  2R9X A;  3B47 A;  4X56 A;  5TFQ A;  2M1C A;  3MMH A;  3V5M A;  3PBQ A;  2P7J A;  2JKR I;  2Y2P A;  1FR6 A;  4K08 A;  3RH8 B;  3G6O A;  3T12 B;  1S4R A;  3BFE A;  4PM7 A;  3VSL A;  5AQA A;  3S7N A;  1EWZ A;  1H3Q A;  1TD5 A;  5HFO A;  3UB5 P;  4JXS A;  3NDG A;  4Y5F A;  2HF6 A;  1PI4 A;  5M18 A;  4ME4 A;  4NEE D;  2KX6 A;  3CIT A;  5J8X A;  4RX2 A;  1KGE A;  4UQI S;  4DDY A;  1K0K A;  2Y2O A;  4OQH A;  1ERQ A;  2WAD A;  4ETZ A;  1YT4 A;  3CPT B;  4LGW A;  3SS3 A;  5EVI D;  5CGS A;  1N9L A;  4WBG A;  1GA0 A;  2OAQ 1;  4HP4 A;  1MZU A;  1RGZ A;  4Z1W A;  3U2A A;  5EVI A;  5G4Z A;  2VGK A;  4CPK A;  4Y13 A;  1NWZ A;  1YMS A;  2J80 A;  3E98 A;  5FI7 A;  4HQA A;  1Y4O A;  3LID A;  4KZ4 A;  2INW A;  2W1T A;  1GHI A;  4HH2 A;  1YLJ A;  3CI6 A;  1OTB A;  4BL2 A;  3P01 A;  2ZD8 A;  3VV4 A;  2EWV A;  4DRT A;  2W0N A;  2Y2I A;  3UPN A;  5AVE A;  2J9P A;  1ES3 A;  4R4S A;  3TG9 A;  4R3A A;  2DNS A;  1LL8 A;  4EQI A;  1PIO A;  1NYM A;  3K3D A;  2W3E A;  3CUE C;  5HPF A;  4C75 A;  4CLC A;  2Y2Q A;  1CI9 A;  3NBL A;  5FI6 A;  2J3T D;  1DP8 A;  1WA9 A;  1DP9 A;  5HD5 A;  2BAS A;  2G2W A;  1H0M A;  3KSH A;  3W2Z A;  1BLP A;  2PR6 A;  1I2W A;  4CJN A;  4Q0H A;  4LRZ E;  4QWO A;  3M6B A;  2JHE A;  3HLG A;  2EX8 A;  2VA0 A;  2WKH A;  2A2L A;  2ACG A;  3ZG9 B;  2PBY A;  4UHU A;  2QJ7 A;  1IYP A;  1IEL A;  5FQK A;  1LHY A;  1CEG A;  4LLO B;  2XD5 A;  2WGW B;  1ES2 A;  3NI9 A;  5J4E A;  4DDS A;  4I3I A;  3UPP A;  4WZ5 A;  2Y4A A;  4S2I A;  2EWW A;  3H9W A;  2H5S A;  2GX5 A;  3IWO A;  2GDN A;  1ALQ A;  5GLC A;  4N1X A;  4C3Q A;  3LEZ A;  4EQ1 A;  3ZGA B;  5HL1 A;  3MXS A;  5TR7 A;  1AXB A;  2WAE A;  2QZ6 A;  2QMI A;  1LL9 A;  3PHY A;  4KQQ A;  2HPB A;  1TDG A;  3QP2 A;  4WZ5 C;  2Y2K A;  1FOF A;  5F1G A;  4Q0I A;  2VV8 A;  4KQO A;  1L3L A;  3GSG A;  1LLB A;  2JKF A;  3IHA A;  3BLM A;  4WLA A;  3G32 A;  2Q9N A;  5CGX A;  3Q1F A;  4E3N A;  5DF9 A;  3ZG5 A;  3IF6 B;  4BQM A;  3IXD A;  2ZQD A;  4EBN A;  3D3O A;  3OPL A;  3KYQ A;  3NHQ A;  3VP2 A;  1F2K A;  3W4P A;  2B18 A;  3PBO A;  5DKK A;  2J9O A;  2ZC3 B;  2H10 A;  3BFF A;  3LYX A;  4OPZ A;  1HZO A;  4QB8 A;  2EA9 A;  2W27 A;  1STZ A;  2HZ5 A;  3VP1 A;  2M7U A;  3IXG A;  3BQ8 A;  3UMD A;  2IWB A;  1ERM A;  1NXY A;  4N9K A;  2JBF A;  2YKH A;  5EE8 A;  5FEG A;  1K57 C;  5HAP A;  1UGU A;  3L9K A;  5EOE A;  2G7U A;  5DJT A;  3ZNT A;  3CJM A;  1OPX A;  4EEP A;  3T1X A;  4AFI A;  4EW7 A;  4KG6 A;  5JYP A;  4DE2 A;  1ESU A;  1FQG A;  2VKS A;  3IT9 A;  3T4Q A;  3UB8 A;  5A93 A;  4WEJ A;  4B4Z A;  4JF6 A;  2HDU A;  4KUO A;  3PBN A;  3VOY A;  4IHQ A;  2DRW A;  3FC7 A;  1BT5 A;  3OPR A;  3PBT A;  4EXO A;  2XGN A;  3PXP A;  3MS6 A;  4R23 A;  3C30 A;  4PM5 A;  4KZ9 A;  4GD6 A;  1YPR A;  4WMC A;  3LO7 A;  1PNE A;  1OTI A;  3G34 A;  4XT2 A;  2IWC A;  3TJZ C;  2J3W A;  2EXA A;  5FI2 A;  3TW8 A;  5F5Y A;  3F1N B;  1MWR A;  3KYZ A;  4H6J A;  4OLG A;  2PU2 A;  1KOU A;  1IOU A;  5FQ9 A;  3UE0 A;  1TS7 A;  1JWP A;  3C4O A;  3T4T A;  1Q2P A;  3LY3 A;  2VGJ A;  3OCN A;  3R7W B;  4G3W A;  1MPL A;  3E4O A;  3CHW P;  2JCH A;  3HLD A;  1CI8 A;  4ZJ3 A;  3JPU A;  1ACF A;  3QP5 A;  4H6J B;  1KGF A;  4FSF A;  3PAG A;  1K38 A;  4YWZ A;  2QYB A;  3C8C A;  3K2N A;  4UEY A;  4E3L A;  5EVI C;  2EFU A;  3G4P A;  4O8G A;  5DVA A;  3T4K A;  3JVV A;  5GLB A;  1C3B A;  3CLO A;  3RXX A;  4DXC A;  1FCN A;  4KG5 A;  3TSG A;  2V1A A;  1RP5 A;  3NC8 A;  3C5A A;  1ZKJ A;  1OT6 A;  1WYC A;  1YLZ A;  5EV0 A;  3HL9 A;  3SS5 A;  3LFV A;  4OLD A;  4R38 A;  3PBR A;  2ZC6 B;  1IYQ A;  4CLC C;  2JKT M;  3FYZ A;  3CUE A;  4CLC B;  1K4F A;  1FSY A;  5J7E A;  1BUL A;  3O88 A;  4GN2 A;  2WKQ A;  4JKT A;  4GLQ A;  5CTM A;  1N4O A;  2EXB A;  1PWC A;  1NYY A;  3KSI A;  4LPZ A;  1VHM A;  4Y0T A;  3A3E A;  4LRX C;  4Q8I A;  2VZW A;  5FDH A;  3B42 A;  1TS0 A;  4LCM A;  2RL3 A;  5E2F A;  5AVF A;  1IFQ A;  4OPQ A;  1H8M A;  1YMX A;  1BSG A;  2Q9M A;  3CAX A;  1NZU A;  2Y55 A;  2D02 A;  2Z6C A;  4EBL A;  5FAQ A;  4Y2F A;  5HWT A;  3ZG7 B;  3PTE A;  4S2O A;  1YSQ A;  2WGW A;  3P09 A;  2K31 A;  2Y2M A;  4IVK A;  2ZC7 A;  1G6O A;  2B02 A;  4PPR A;  3HLF A;  5EEC A;  3Q81 A;  4X25 A;  4BL3 A;  2E8J A;  1V9Z A;  4XUX A;  4EUV A;  5CHU A;  3I7J A;  3F1O A;  4OOM A;  4Y15 A;  4ESP A;  3HVF A;  2K7S A;  1KE3 A;  1K54 A;  1P9R A;  2V0W A;  3LR5 A;  5IT5 A;  3IH8 A;  1K56 A;  3T1Q B;  3VFF A;  3LR4 A;  4Y17 A;  3MQO A;  2Y2H A;  4BEN A;  3PR6 A;  4YIN A;  1FIK A;  3PAE A;  1UWN X;  1OT9 A;  3CG5 A;  5F6A A;  5CER A;  1H5X A;  4B88 A;  3IH9 A;  2J7V A;  5HDD A;  4HH3 A;  4I5S A;  5FQI A;  3MKF A;  3HUN A;  1PYY A;  3CPT A;  3FZC A;  1JTG A;  5E2E A;  4X68 A;  1BLS A;  4XXR A;  2V20 A;  5TGF A;  3VP4 A;  3LR0 A;  4OP5 A;  3UB6 A;  4MDZ A;  3K3C A;  5FQQ A;  1SKO A;  4NXG A;  4E3K A;  3BLS A;  2H28 A;  5KMW A;  4IVI A;  4NG2 A;  1MKM A;  4WUJ A;  3DAV A;  1VEU B;  5HWW A;  3ISG A;  2EX6 A;  5IHV A;  1XPB A;  4IJG A;  4BBV A;  4GS9 B;  1VET B;  5KZH A;  5J3W A;  2HDR A;  4L9E A;  3ZG0 A;  1SCW A;  4JGO A;  2JKR M;  4JGP A;  4MBF A;  3C7V A;  4BBT A;  4GD8 A;  3VP3 A;  2M7V A;  2WKE A;  3P98 A;  4RA7 A;  3O86 A;  3SS4 A;  3BY9 A;  2EX9 A;  2W3F A;  4GJ4 A;  2J8Y A;  1S6R A;  1CF0 A;  1Y54 A;  1LL5 A;  3DTK A;  4FD8 A;  1YLY A;  1BLC A;  1L2S A;  3WS1 A;  3HLC A;  5L07 A;  3BQA A;  4LV0 A;  2ZLY A;  4BD0 A;  3UO9 A;  3P7N A;  4BMW A;  2WAF A;  1QMF A;  4HNB A;  4EU0 A;  1ZG6 A;  1YSP A;  1ES5 A;  3HCY A;  2B95 A;  3MXQ A;  4KQR A;  1P97 A;  1GCE A;  2X02 A;  5DF7 A;  3AGF A;  2XFS A;  3LIB A;  4JPM A;  1Q2Q A;  3ZFZ A;  4EES A;  1N9O A;  4DE1 A;  3NOP C;  4OP8 A;  4HBU A;  1KGG A;  5JYO A;  3G35 A;  3NY4 A;  4YNR A;  1L0E A;  5AQB A;  2K2N A;  1XJ6 A;  5DTS A;  4GHI B;  1DJB A;  2BG1 A;  4ZBE A;  1SDE A;  3HLB A;  3BY8 A;  4KZB A;  2I9V A;  3N8S A;  4RVA A;  5L8M A;  4DKI A;  1IYS A;  2Q0O A;  4DE0 A;  3A3F A;  4CLC D;  5G18 A;  4FUW A;  5AQ9 A;  1G68 A;  2VGL M;  3AGD A;  3FWL A;  1M40 A;  4CLC E;  2VX8 A;  3N4I A;  5M19 A;  2ZQA A;  1WE4 A;  1F98 A;  3WRZ A;  3UME A;  3RXW A;  1XFQ A;  2UV0 E;  1H8Z A;  2OOL A;  3NOU C;  3GR2 A;  1S1Z A;  4X53 A;  1ONG A;  4ZTK A;  3QNC A;  1T1A A;  4O0P A;  4X69 A;  1LSW A;  3KYE A;  3LY4 A;  3EEH A;  1MWT A;  4OON A;  4G3K A;  4S2N A;  4PHT A;  3D4F A;  2CMN A;  4GDB A;  1XX2 A;  4JLF A;  3VMA A;  5L10 A;  4Y0U A;  2XA7 M;  1FSW A;  1N9B A;  4KZ6 A;  4O01 A;  1ZG4 A;  4DXB A;  5HSQ A;  3Q82 A;  2L4R A;  3KSF A;  1XJ4 A;  3IF6 C;  2KDK A;  3F1P A;  4QY6 A;  4N92 A;  1K25 A;  5HDC A;  2JKG A;  3JVU A;  4UQI M;  4OKP A;  2X71 A;  3ZG8 B;  5HAR A;  4R1G A;  5CXW A;  1ERO A;  1K57 A;  3H82 A;  4PKY G;  1BZA A;  4Y0O A;  2OWH A;  4P6Z M;  2XQZ A;  2V1Z A;  5GLA A;  1T1B A;  2PAV P;  4NXE A;  4OQ0 A;  2XK1 A;  3F1P B;  1W7F A;  4XUZ A;  2XF3 A;  4WN5 A;  3UB9 A;  5F68 A;  2ZQ7 A;  2PBD P;  1LI0 A;  1VM1 A;  2D01 A;  3O3V A;  5HX9 A;  3V3R A;  4FTX A;  2C6W B;  4KZ3 A;  3WS2 A;  1KVM A;  2L0W A;  3MXR A;  4WYY A;  5EPH A;  1HLU P;  3H7W A;  1ESI A;  5CX7 A;  2ZMA A;  4GS9 A;  4RYE A;  4S2K A;  3TE8 A;  1EI5 A;  3LUQ A;  5A90 A;  1XXM A;  4P0M A;  5CHJ A;  1ONH A;  4DF6 A;  2DMW A;  4KQD A;  3UPO A;  4QHC A;  2ZC4 B;  1KDW A;  2V2F F;  3BM6 A;  5FQJ A;  5CEB A;  2PR5 A;  3E4P A;  4ARZ A;  1W79 A;  2Y91 A;  4M3K A;  1CEF A;  2P08 A;  4GDN A;  4DJ2 A;  2FZ0 A;  2C5W B;  1RCJ A;  5I5L A;  1YLT A;  3SOI A;  4R3J A;  2PD8 A;  2Y8H A;  4UA9 A;  2Y2L A;  3TRC A;  1I2S A;  3LIC A;  4WL9 A;  3PBS A;  2FFF B;  3FG8 A;  1YM1 A;  4ZRR A;  3MQQ A;  1K55 A;  1WYB A;  4NET A;  3N8L A;  1YLP A;  4X1M A;  5E43 A;  3MSH A;  4UA7 A;  2XD1 A;  1W8Q A;  4PAU A;  1SZV A;  4WZ4 A;  3V39 A;  3S22 A;  3F1N A;  3T4O A;  1YQS A;  1E4D A;  1GHP A;  2YKF A;  2VEA A;  3BFG A;  4GOG A;  3LEQ A;  1XGJ A;  2QPN A;  1F9I A;  3ZCZ A;  5DFY A;  1PZO A;  5HAI A;  5DKL A;  2LB5 A;  2JN7 A;  3IF6 A;  4MBK A;  3FKW A;  4R0Q A;  5GHY A;  4EV4 A;  3DTI A;  1MWS A;  3DWZ A;  2A24 A;  4B9O A;  1P0Z A;  3S4X A;  3LIE A;  3DW0 A;  2Z6D A;  3OC2 A;  2ZMV A;  5F69 A;  3CMZ A;  3ZVW A;  1TVF A;  4XT2 B;  1YLW A;  3T4L A;  3N8R A;  3G2Y A;  2O9B A;  3ITA A;  2NUT C;  4II7 A;  4OOL A;  4OOY A;  4KEN B; 
#chains in the Genus database with same CATH homology
 4BJP A;  4I5S A;  3VE4 A;  5AVE A;  1W63 Q;  4ARZ B;  3OCL A;  4HY8 A;  1LT0 A;  3FPW A;  2KOI A;  3H7W B;  4R3A A;  1LL8 A;  3LIF A;  2V1B A;  5HZH A;  3LR0 A;  3IS2 A;  3UB6 A;  3K3D A;  4EET B;  2W3E A;  4MDZ A;  3K3C A;  3CUE C;  4I39 A;  5HPF A;  4NXG A;  4CLC A;  2QHK A;  2O0Y A;  2ZOH A;  2H28 A;  3LI9 A;  3MFX A;  3SW1 A;  4HJ3 A;  1MKM A;  4WUJ A;  2J3T D;  1DP8 A;  1WA9 A;  1OJ5 A;  5TJJ A;  1DP9 A;  5HWW A;  3T50 A;  5HD5 A;  1P9W A;  2BAS A;  3A0S A;  4YOF A;  3KSH A;  3W2Z A;  5KIZ A;  1JNU A;  2PR6 A;  2V0U A;  4Q0H A;  4LRZ E;  2HGV A;  4L9F A;  4IJG A;  4BBV A;  5HWV A;  4GS9 B;  5HDS A;  2JHE A;  5J3W A;  4L9E A;  4JGO A;  2JKR M;  4JGP A;  4L9G A;  2VA0 A;  4BBT A;  2GNX A;  3MQ0 A;  3KX0 X;  2A2L A;  4I3A A;  4DJ3 A;  5TBM B;  2M7V A;  2VV7 A;  5G4Y A;  4LRY C;  3MF0 A;  2QJ7 A;  2O9C A;  4G3V A;  4LLO B;  2WKR A;  1X0O A;  5J4E A;  1V9Y A;  2VGL S;  2QKP A;  3BY9 A;  4I3I A;  2W3F A;  3EGD C;  4GJ4 A;  2A24 B;  5HD3 A;  2VJW A;  2V9A A;  2EWW A;  3H9W A;  4GHI A;  5LBR A;  2HV1 A;  3D72 A;  3RFB A;  2ZOI A;  3IS2 B;  2GX5 A;  2OWJ A;  4HOI A;  3BQA A;  4EQ1 A;  4HP9 A;  2Y79 A;  4BMW A;  2XSS A;  3P7N A;  4HNB A;  3F1O B;  4EU0 A;  1YSP A;  3MXQ A;  3HCY A;  1DRM A;  1P97 A;  3BW6 A;  5DJU A;  3EGX C;  4IUH A;  3VOL A;  3B33 A;  3PHY A;  3LIB A;  1GSV A;  4HJ4 A;  1N9N A;  4NKP A;  4Q0I A;  4EES A;  2VV8 A;  4KQO A;  1N9O A;  4MMN A;  3NOP C;  3EOI A;  2P04 A;  1Y28 A;  3GDI A;  4WLA A;  5DFX A;  5HL6 A;  1ODV A;  4P6Z S;  2HJ9 C;  5DF9 A;  2PYP A;  3LR3 A;  4YNR A;  2L1M A;  3DBA A;  2K2N A;  1XJ6 A;  3UB7 A;  3D3O A;  3KYQ A;  3NHQ A;  2PYR A;  3BJN A;  4HHD A;  1MC0 A;  2B18 A;  4GHI B;  1NRJ A;  2W3H A;  3PBO A;  3BY8 A;  2I9V A;  3OBF A;  3PYP A;  5DKK A;  5L8M A;  4E04 A;  3LYX A;  4CLC D;  1S67 L;  2W3G A;  2XA7 S;  4Q0J A;  2ZBB A;  2VGL M;  2EA9 A;  2PHY A;  2W27 A;  2O9A A;  1STZ A;  2M7U A;  4CLC E;  3EWK A;  2VX8 A;  3BQ8 A;  3UMD A;  2YKH A;  4MN5 A;  2KLI A;  3BWL A;  3KO6 A;  1LSX A;  1T18 A;  1F98 A;  4WF0 A;  3UME A;  1UGU A;  1W63 M;  2XRN A;  2FH5 A;  1TS8 A;  1S4S A;  1XFQ A;  2G7U A;  2GJ3 A;  2W1R A;  5DJT A;  2OOL A;  1S66 L;  3NOU C;  1OPX A;  4EEP A;  4HJ6 A;  1OTA A;  4PKY A;  4AFI A;  1S1Z A;  4EW7 A;  3A0V A;  3C38 A;  4WEK A;  3R4K A;  2VKS A;  3RTY A;  1T1A A;  3T4Q A;  4O0P A;  3UB8 A;  4WEJ A;  4EER A;  1LSW A;  4HI4 A;  3NJA A;  3EEH A;  4RQ9 A;  4G3K A;  4BBU A;  4R70 A;  4PHT A;  2R78 A;  4KUK A;  1BYW A;  4KUO A;  3PBN A;  2CMN A;  4IHQ A;  4FOF A;  3FC7 A;  3PBT A;  4EXO A;  2XA7 M;  1NLZ A;  3PXP A;  4I3J A;  2MJ6 A;  4CQH A;  3ZYT A;  2O99 A;  4M4X A;  4MN7 A;  4O01 A;  3C30 A;  5C5K A;  4IUK A;  2WKP A;  4L0L A;  1D06 A;  5HSQ A;  1D7E A;  2L4R A;  4NXB A;  3KSF A;  1XJ4 A;  2KDK A;  2J3T C;  3F1P A;  5HDC A;  1OTI A;  1UWP X;  5K5B A;  3JVU A;  4UQI M;  4NXF A;  4XT2 A;  3MR0 A;  1T19 A;  1TF1 A;  3TJZ C;  2J3W A;  4WEL A;  2QWS A;  3TW8 A;  3KSG A;  5F5Y A;  3F1N B;  1YAX A;  3KYZ A;  1XJ3 A;  1YKD A;  2PD7 A;  4H6J A;  4PKY G;  3H82 A;  2XRO A;  3OOV A;  4JGQ A;  3FPV A;  1KOU A;  1IOU A;  2OWH A;  3E0Y A;  4P6Z M;  4EEU A;  1T1B A;  4B93 A;  1TS7 A;  4NXE A;  3T4T A;  4JGR A;  4GCZ A;  3F1P B;  3OCN A;  3E4Q A;  3R7W B;  4G3W A;  1T1C A;  4WN5 A;  3UB9 A;  5F68 A;  3E4O A;  1EW0 A;  2HJE A;  2D01 A;  5IS1 A;  1G28 A;  4H6J B;  4FSF A;  3ZQ5 A;  4DMZ A;  1GSW A;  3CWF A;  5MC7 A;  4YWZ A;  2QYB A;  3VE3 A;  1ZTU A;  3C8C A;  4Y3I A;  2GZA A;  3K2N A;  2L0W A;  4UEY A;  2W3D A;  3H7W A;  3UE3 A;  5CX7 A;  3S7Q A;  4BWI A;  5AJG A;  2NUP C;  4O8G A;  4GS9 A;  1TS6 A;  3T4K A;  1S1Y A;  3T4J A;  3JVV A;  3LUQ A;  2VLG A;  4QPR A;  2LB9 A;  5IU1 A;  3T4S A;  3TE8 A;  4DN0 A;  3ICY A;  3CLO A;  4HIA A;  4F3L B;  2DMW A;  3EQV A;  4KQD A;  5KSH A;  2V1A A;  4I38 A;  1OTD A;  3UE6 A;  1LSV A;  1OT6 A;  2JKT I;  2PR5 A;  5A8B A;  1XFN A;  3E4P A;  4ARZ A;  3S7O A;  3LFV A;  2P08 A;  4R38 A;  3PBR A;  4DJ2 A;  2FZ0 A;  3LI8 A;  2PDR A;  3ULF A;  4CLC C;  2JKT M;  5I5L A;  3CUE A;  4CLC B;  5J7E A;  2VV6 A;  1ZHH B;  1OTE A;  1NLY A;  2PD8 A;  2Y8H A;  2IA2 A;  3LIA A;  5EFW A;  2WKQ A;  4GLQ A;  1GSX A;  4GW9 A;  3TRC A;  3LIC A;  4WL9 A;  3B47 A;  1OJG A;  3A0R A;  3KSI A;  3PBS A;  2M1C A;  3MMH A;  4LPZ A;  1VHM A;  3FG8 A;  3PBQ A;  5FL3 A;  2P7J A;  2JKR I;  4ZRR A;  3MQQ A;  3OLO A;  4R6L A;  4K08 A;  3RH8 B;  2PT7 A;  3G6O A;  4LRX C;  1S4R A;  2VZW A;  3B42 A;  1TS0 A;  3EEA A;  5TBM A;  3S7N A;  5AVF A;  3NOT C;  1IFQ A;  1H3Q A;  1TD5 A;  4PAU A;  1H8M A;  3CAX A;  4Y5F A;  2HF6 A;  2D02 A;  2Z6C A;  3F1N A;  4ME4 A;  4NEE D;  4Y2F A;  3HJI A;  5HWT A;  3T4O A;  2KX6 A;  3CIT A;  1F5M A;  1YSQ A;  3O5Y A;  2K31 A;  3H82 B;  3V67 A;  2YKF A;  2VEA A;  4UQI S;  1DP6 A;  1G6O A;  2B02 A;  4ETZ A;  1F9I A;  5DFY A;  2OAP 1;  1VB6 A;  5DKL A;  2LB5 A;  3C2W A;  1V9Z A;  5HPI A;  1N9L A;  2JN7 A;  4EUV A;  2OAQ 1;  4HP4 A;  3F1O A;  3GEC A;  1MZU A;  4OOM A;  4Z1W A;  3S7P A;  2K7S A;  3U2A A;  4ETX A;  5G4Z A;  4F3L A;  2ZMF A;  2A24 A;  1P9R A;  1NWZ A;  2V0W A;  4B9O A;  2J80 A;  3LR5 A;  1P0Z A;  5IT5 A;  3E98 A;  3LIE A;  4HQA A;  3LR4 A;  2Z6D A;  3LID A;  3IBR A;  3MQO A;  3OC2 A;  2INW A;  2ZMV A;  5F69 A;  2W1T A;  3PR6 A;  3HJK A;  2W1T B;  4HH2 A;  4MN6 A;  3CI6 A;  1OTB A;  3P01 A;  2QJ5 A;  1XJ2 A;  3EQU A;  4MCW A;  1UWN X;  4XT2 B;  1OT9 A;  3VV4 A;  3T4L A;  3R7W A;  2EWV A;  3IBJ A;  5F6A A;  2W0N A;  3MJQ A;  2O9B A;  2NUT C;  4II7 A;  4OOL A;  5HDD A;  4HH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...