2D02A

R52q mutant of photoactive yellow protein, p65 form
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGQDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title The Crystal Structure of the R52Q Mutant Demonstrates a Role for R52 in Chromophore pK(a) Regulation in Photoactive Yellow Protein
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 34
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2d02A00
5IU1A 4F3LB 4PKYG 1V9ZA 5HD3A 4M4XA 2YKHA 4HOIA 2PR6A 3C2WA 3VE3A 3D72A 4I3JA 3UE6A 3LICA 5HSQA 4HIAA 5IS1A 4GHIB 5F68A 2QHKA 4EXOA 3IBRA 2K7SA 1EW0A 5A8BA 3IS2A 4NXGA 3NOTC 3UB6A 4BBVA 1T1BA 3FG8A 5EFWA 3K3DA 4EESA 1P0ZA 2JN7A 1XJ2A 3HJKA 4GCZA 4HY8A 4DJ3A 1OTBA 3E4QA 3CAXA 3NOUC 4EETB 2OWHA 2PYPA 4JGOA 2V9AA 4JGPA 1OTDA 4YWZA 1S4RA 3PYPA 4I3IA 1TS0A 3LIAA 2V0UA 5DKKA 3SW1A 1XJ4A 2GJ3A 4LPZA 5I5LA 1DRMA 4LRYC 4HQAA 5J7EA 4BBTA 3E4PA 2PYRA 3IS2B 1GSWA 2VV7A 4HH3A 2ZOHA 3P7NA 2PD7A 3UB7A 2V1AA 4EEPA 4WUJA 5HWVA 3B33A 4HP4A 3KX0X 1G28A 1TS8A 4DJ2A 1OTEA 1UGUA 4MN5A 5G4ZA 1OJGA 5AVFA 4HP9A 3MFXA 2CMNA 1S67L 4BBUA 1KOUA 4I38A 4GW9A 2HV1A 2YKFA 3GDIA 2ZOIA 2WKRA 3LI9A 4EEUA 2PHYA 4MN6A 4R70A 2W27A 4EERA 3MQQA 1TS6A 1DP9A 1MZUA 1XJ6A 5J4EA 3F1NA 2ZBBA 2JHEA 3BWLA 3CLOA 3MJQA 3UMEA 4L9FA 2H28A 1OJ5A 5AVEA 2P7JA 3A0RA 2V0WA 3EEHA 1S66L 5DJTA 1BYWA 5F69A 2L0WA 2Z6DA 4R38A 5KIZA 3ICYA 3CWFA 2W0NA 3E4OA 3LIDA 4XT2A 1OTAA 5HDCA 4R6LA 3LI8A 2QKPA 3K3CA 1NWZA 2EA9A 3MQOA 1S1ZA 3NOPC 4I39A 3MXQA 3F1NB 2PR5A 2OWJA 3LYXA 4WF0A 3GECA 2L4RA 4GS9B 4H6JA 5HDSA 1GSVA 2QWSA 5J3WA 1F98A 1D7EA 4JGRA 3F1PA 3FC7A 2KX6A 4L9EA 2V1BA 1DP8A 4LRZE 3A0VA 2VV8A 3RH8B 1GSXA 1XFNA 4XT2B 2I9VA 3BY9A 4HH2A 3G6OA 4HHDA 4LRXC 1Y28A 1WA9A 3RTYA 5TBMA 2D01A 2VV6A 4NXBA 3LUQA 3A0SA 3ZQ5A 2WKPA 5HWTA 4HNBA 3VOLA 4H6JB 5F6AA 3F1OA 4HI4A 2PD8A 1S4SA 5G4YA 1OT9A 3UB9A 4L9GA 4GS9A 3PHYA 1V9YA 4WN5A 2R78A 3F1PB 3MR0A 3LIEA 4PKYA 1T1AA 4RQ9A 5F5YA 3H82A 1N9NA 3H9WA 2B02A 2KDKA 1T18A 4KUOA 3ULFA 2A24A 3H7WA 1X0OA 1XFQA 1JNUA 3VE4A 2D02A 1LSWA 3LIFA 3HJIA 5TBMB 4EQ1A 3LIBA 4JGQA 1LSXA 4HJ3A 1N9OA 3UMDA 2M1CA 2BASA 3T50A 2PDRA 4K08A 2L1MA 2J80A 1XJ3A 1UWNX 5HWWA 3F1OB 1F9IA 1D06A 3BY8A 2QJ5A 2WKQA 1VB6A 4WL9A 1S1YA 3NHQA 5DKLA 4NXEA 4B9OA 4F3LA 4HJ4A 3H82B 4I3AA 1UWPX 5DJUA 3NJAA 2QJ7A 4EW7A 2A24B 3H7WB 1DP6A 4KUKA 4WLAA 4KQDA 1T1CA 4E04A 1ODVA 1TS7A 4HJ6A 4GHIA 4I5SA 1T19A 1P97A 1LSVA 3UB8A 3C8CA 2VLGA 5HD5A 2VEAA 4NXFA 1OTIA 1LT0A 1LL8A 4LLOB 2INWA 2Z6CA 2OOLA 3EWKA 5HDDA 4R3AA 3OLOA 1OT6A 5HZHA 1N9LA
chains in the Genus database with same CATH superfamily
2WGVA 4D60A 4F3LB 1V9ZA 3NECA 2YKHA 5TJJA 2P9VA 2QYBA 5A93A 3HLGA 1NZOA 2XF3A 1YT4A 2I72A 4ZJ1A 5EVLA 3BQAA 3UE6A 4E3NA 1YLZA 4HIAA 3VP0A 3EEAA 3W2ZA 5F68A 3Q81A 3ZG7B 3QP6A 1CEGA 4NG2A 2K7SA 1K55A 5FA7A 3SS5A 1TDLA 3IS2A 1O7EA 5FQIA 2Y2LA 3ZGAB 3EOIA 3T4QA 1VHMA 3W4OA 4N1HA 1ACFA 3SH8A 3ZYTA 1P0ZA 3W8KA 2BLSA 3DTKA 2J3TD 2JN7A 1JWZA 3MF0A 4QWOA 4GCZA 3N7WA 2FFYA 4MBFA 4DJ3A 1FR1A 1NXYA 3CAXA 4DN0A 5MC7A 1IYSA 1ESIA 3PAGA 2WAEA 4U0XA 4Q8IA 5DFXA 2V9AA 4JGPA 4E3JA 2P9VB 3CG5A 1GA9A 3T1QB 4PM5A 4DE2A 3QP8A 3AGDA 2WZZA 2IWDA 5L09A 5M1AA 3SW1A 2A2LA 4PHTA 4DE1A 1PI4A 3QP4A 3QNCA 4LRYC 3G2YA 1AWIA 4LCLA 3IS2B 4R3BA 4HH3A 1K25A 1RGYA 5JYOA 2PD7A 5DF9A 4EEPA 3FYZA 4N92A 4S2KA 5HWVA 3T4TA 3CITA 2ZQCA 1RGZA 4Y17A 1TD5A 4YFMA 1GHPA 3IQAA 3N8RA 1Q2QA 3CJMA 1OJGA 2PU4A 3BW6A 2Y2IA 1FQGA 1S67L 3OCNA 3OBFA 2HV1A 2KLIA 2XD5A 2XFTA 3LI9A 1XGIA 3FWLA 1L0GA 3GQZA 4O0PA 4B88A 5TR7A 2HP6A 4WZ5C 5AJGA 3IBJA 2R9XA 2GDNA 4B4XA 5U47A 1S0WA 1PW8A 1TS6A 3GMWA 4EBNA 4WEJA 4DXBA 1XJ6A 5CTNA 5J4EA 4O01A 2EX9A 3CUEA 4S2MA 1MY8A 2M7UA 3C4OA 2EX6A 3IF6C 4Q0JA 4S2NC 3UMEA 4LV3A 2H28A 2EXBA 1OJ5A 3VP4A 3MBZA 2C6WB 2ZQ8A 4R0QA 3GTCA 5FSRA 1N9BA 3B3XA 1Z09A 2XK1A 3EEHA 3HLEA 1W79A 3WS4A 4II7A 3P01A 5E2EA 3MS6A 4BJPA 3V67A 2VGKA 3HLWA 1BYWA 5F69A 2FFFB 4R38A 3GVBA 1YLJA 4DRTA 1PWDA 3N8LA 3MZFA 2W0NA 3E4OA 1BZAA 4ZTKA 1FSYA 1JTDA 4XT2A 4R4SA 2XEPA 5GHZA 4R6LA 3K2NA 5EOEA 4C3QA 4UHUA 5GLDA 2QKPA 3K3CA 2EA9A 3A3DA 1YLPA 2V1ZA 4GLQA 2PR5A 3O3VA 3LYXA 4Y0UA 1LLBA 3VFFA 4OH0A 1W8QA 1SDEA 4CPKA 5CGWA 1M6KA 1DJBA 5HDSA 5CGSA 3S7QA 3DBAA 4OPQA 5J3WA 4NEED 4KZ4A 2ZM0A 2WAFA 4A5RA 3F1PA 3FC7A 1K4EA 5GLAA 5CGXA 2PAVP 5EVIC 1H8YA 2K31A 2P74A 1FR6A 1GA0A 3LFVA 2G7UA 4X1LA 4XT2B 4HH2A 3G6OA 1KDWA 4LRXC 3WWXA 4Z9QA 3WRZA 5FI2A 3RTYA 5FQKA 1MXOA 3WS1A 3N6IA 4XUZA 3LUQA 2WGWA 4RA7A 2K2NA 5HAQA 3VOLA 4P6ZM 5AQ9A 4HBTA 2R9WA 4F94A 4Y15A 3PBRA 2JKTI 4PM8A 1OT9A 2X02A 3UB9A 3T4SA 1EWZA 4GS9A 3PHYA 2ZMAA 3F1PB 4X6TA 4CLCE 1K0KA 3TJZC 1MKIA 5F5YA 3SS3A 3BFEA 3H82A 3V3RA 3NULA 3EQUA 5FL3A 4KUOA 2PT7A 3IHAA 4N9KA 2O9BA 3OC2A 2OSUA 3OPLA 4G3WA 4YINA 3IWQA 3D3OA 4BMWA 1W8YA 4DDYA 1LSXA 1TEMA 4KZ3A 3R7WA 2A3UA 2JKRI 2M1CA 2BASA 3P98A 2O9CA 4MBKA 2WGWB 1XJ3A 3KYQA 3NY4A 1DJAA 4ME4A 1D06A 4RX2A 1F5MA 2WKQA 4FCFA 3EGXC 4G3KA 1YLWA 3ITBA 1IKIA 4PM6A 4OLDA 3H82B 1PNEA 5A90A 2J3WA 5HL1A 1MWTA 3AGFA 1DP6A 3MKFA 4WLAA 2HJEA 1T1CA 4E04A 1TS7A 2ZQ9A 5I94A 3I7JA 3GRJA 1LL9A 5HAPA 1C3BA 3VOZA 4LENA 3VP1A 1FCOA 3V39A 1T19A 1NLZA 4S2PA 3R7WB 1P97A 1LSVA 2VLGA 5GHXA 1XXMA 1LT0A 1K38A 1XA1A 2INWA 2EFXA 3FV7A 1LL5A 1XA7A 1TDGA 4ETZA 2OLUA 4WEKA 1FSWA 4WELA 4LGWA 2WADA 4Q0HA 3E0YA 1WYBA 3L9KA 2W1TA 2J3TC 1SKFA 2VGLM 4E3OA 5HD3A 3C7VA 4HOIA 3PAEA 3C2WA 4CLCD 1BLPA 2PU2A 1IKGA 1H8MA 4FUWA 2B18A 2JKRM 2XLNA 1P9RA 4NXGA 4OQHA 4BBVA 3G31A 4R3JA 4DXCA 3LO7A 3K3DA 2ZC4B 4EESA 4EUVA 4X56A 1NRFA 5FI7A 4BENA 5E43A 3HJKA 1XJ2A 4QY5A 4HY8A 2HPBA 2ZL1A 4RYEA 2W1TB 1NYMA 2WK0A 2JKGA 4MLLA 1IEMA 2PYPA 2OLVA 2J7VA 2JC7A 1W5DA 1PZOA 4CJNA 4EUZA 4D2OA 4YWZA 1S4RA 3PYPA 3TG9A 1ONHA 2Q9NA 4GDNA 1YSQA 5DKKA 2GJ3A 4LPZA 1DRMA 2P04A 5J7EA 4BBTA 3JVUA 1GSWA 1ES5A 1YPRA 3UE0A 3E2LA 1VM1A 4U3TA 3UB7A 2PBDP 3BJNA 4WUJA 1CI8A 4HP4A 3KX0X 3QHYA 2QPNA 1UGUA 4MN5A 4Y3IA 2B5RA 2ZL1B 4X69A 3G34A 3IXHA 4BBUA 3MFDA 4I38A 4KQQA 4HEFA 5FASA 4OPRA 5L2FA 3T12B 4R1GA 5J8XA 4OLGA 2LB9A 4K0XA 3UO9A 3G4PA 3S7OA 2WKRA 2WKHA 1STZA 3FPVA 3S22A 1VETA 2KOIA 4ZDXA 4WMCD 2J9PA 4ID4A 4MN6A 5HPFA 3UY6A 1DP9A 3Q7ZA 4U0TA 1K54A 1MZUA 4O8GA 1KGGA 3V3SA 2JHEA 2EFUA 3MJQA 3T4KA 3NCKA 2Y2JA 4RX3A 3NC8A 1TF1A 3HLCA 3QP5A 4IUHA 3JVVA 3BRMA 1U60A 5EPHA 1MKMA 1S66L 2ZQ7A 2HDUA 3HLDA 2GX5A 1BUEA 2L0WA 2BTFP 3UE1A 2Z6DA 5KIZA 2HGVA 5JYPA 4JKTA 3FKVA 1XGJA 2BG1A 1QMEA 1VETB 3LIDA 1HLUP 4KZBA 5HDCA 3TE8A 3LI8A 3NBLA 4JLFA 4Y2FA 2H0TA 4M3KA 1PWCA 4OONA 1S1ZA 4EBPA 3NOPC 3O87A 4OP5A 4EWFA 2W1RA 4GOGA 1Z6FA 1Q2PA 3GECA 4UQIS 3CUEC 4OOYA 2L4RA 4H6JA 5HW3A 5FI6A 3VSLA 3Q07A 4CQHA 1H8ZA 1KE0A 3OPHA 3IH8A 4N9LA 4ZAMA 5FAPA 1KVMA 2Y55A 1BTLA 1MBLA 1J3WA 1FOFA 5DFYA 2Y2OA 1DP8A 4DDSA 3C30A 2OAP1 3G30A 1GSXA 1YMXA 2I9VA 4IVIA 2V8CA 5AQAA 5FAQA 3OCLA 1HD8A 2XDMA 1YLTA 3CPTA 4HNBA 3LGOA 2VJWA 4H6JB 3F1OA 3JYIA 4HI4A 4S2JA 3RFBA 1BLSA 2WKEA 2UWXA 4Q0IA 1S6RA 2X01A 3JPUA 1E25A 4S2LA 2ACGA 2R78A 2GZAA 4KZ8A 4WM9A 1SZVA 3VFHA 2NUPC 1CK3A 3CMZA 3LIEA 4RQ9A 3PBNA 3VOYA 2VA0A 1WE4A 2B02A 4MMNA 3ZG5A 1VEUB 3LY4A 3M6HA 4FH4A 3H7WA 3HL9A 1XFQA 1JNUA 4NKPA 4P0MA 3BFDA 5A92A 3VE4A 5GHYA 2W3HA 3LIFA 5CX7A 4EQ1A 5E2HA 3IX8A 5L07A 3RXWA 4HJ3A 3LCEA 4IBXA 3UMDA 3S7NA 5FQQA 3FPWA 2PDRA 4K08A 2XR0A 1TVFA 3CPTB 1UWNX 1HZOA 1K57C 5HWWA 3BFCA 3F1OB 3MXRA 2QJ5A 4WZ5A 3IT9A 5C5KA 3DTIA 5DKLA 2XSSA 2VZWA 3BQ8A 2Y2KA 4YOFA 4DE0A 1UWPX 2XGNA 5DTSA 4C6YA 2J8YA 3H7WB 4JPMA 5KMWA 3IF6A 1ODVA 1IYOA 4HESA 4S2NA 3EGDC 4GHIA 3U4LP 3C7UA 3O86A 4I5SA 2Y2MA 2JKFA 4BD0A 4CLCC 4KG5A 2XA7M 3UB8A 3C8CA 2HF6A 3DWZA 1IYPA 2G2UA 4X55A 1OTIA 3DWKA 1Y4OA 4JXVA 2Z6CA 3R4KA 3EWKA 4E6XA 5HARA 5HZHA 3A3FA 1MWRA 2RL3A 4DMZA 5IU1A 1K6RA 1CQAA 5M18A 3L7HA 3VE3A 4I3JA 3UDXA 1O07A 2Y4AA 5HSQA 3IF6B 2EX8A 2HZ5A 1PIOA 3C4PA 1P9WA 4JBFA 4NETA 3HREA 4GHIB 3DW0A 3KSHA 4OPZA 2OV5A 2QHKA 4EXOA 1HVBA 3E98A 5IT5A 2HP9A 2VX8A 3TOIA 2Z2MB 5FEFA 2XRNA 3ZNYA 2LB5A 4GNUA 3PR6A 4KZ6A 3CHWP 3FG8A 1SHVA 5CEBA 1FCMA 3EQVA 5EVIA 3ZG0A 4B93A 1LHYA 5TFQA 1XP4A 5E2FA 5HFOA 1OTBA 4UA9A 3E4QA 3UN7A 4E3IA 5DVAA 3NOUC 4EETB 3WS5A 2OWHA 1W63Q 4JGOA 4NK3A 3UE3A 1OTDA 4KQOA 3Q1FA 4GB7A 1ZC2A 5FEGA 3HUNA 3LIAA 5L10A 3MMHA 4K0WA 4C75A 2B95A 2E8IA 2RCXA 3GV9A 4HQAA 4H8RA 4P6ZS 2WKIA 4UAAA 2ZOHA 1NYYA 3LR4A 2W3EA 2V1AA 3KSIA 5KSCA 1YQSA 3ZDJA 5EVIB 4BQMA 1SKOA 4ZBEA 1G28A 1TS8A 1OTEA 3ZVWA 5G4ZA 2Y91A 5AVFA 4GJ4A 5F1GA 4HP9A 2QMIA 2CMNA 4WZ4A 4UA6A 3M6BA 4IUKA 5DF8A 4OP8A 3UDFA 2XQZA 2ZC6B 2ZOIA 5EV0A 2Y8HA 1E3UA 1F2KA 1W63M 4EERA 4DE3A 4IHQA 5FATA 2WGIA 3F1NA 2ZC5B 1RP5A 1YSPA 4DKIA 3CLOA 4GZBA 3ZCZA 2X71A 4L9FA 4WYYA 2XH9A 3G35A 1HTZA 3O88A 1SKOB 2P7JA 2QZ6A 2ZLYA 4RVAA 2EXAA 2V0WA 4ETXA 2VGJA 3S1YA 3G32A 3TSGA 3CZDA 3PTEA 1PYYA 4LV2A 3D9YA 1QMFA 4IBRA 4E3MA 3MZEA 1OTAA 2HP5A 4IJGA 2E8JA 5GL9A 3V5MA 1PW1A 1L0EA 3V50A 3OPPA 4PM9A 4I39A 3U2AA 3F1NB 4Y7PA 2OWJA 4WF0A 3OOVA 2W3DA 4JXGA 2DNSA 2FZ0A 1K55C 2O0YA 5D3OA 2VGLS 2W3GA 1ES3A 1ZG4A 4JGRA 3A3IA 4AFIA 1BT5A 3A3EA 4LV0A 1OPXA 2V1BA 3T4OA 5CXWA 4UA7A 3SH7A 1IOUA 3NDGA 1CEFA 5G18A 3A0VA 1E3UD 5HX9A 1XFNA 3NIAA 4HHDA 2Y79A 5EE8A 1Y28A 1WA9A 4IEDA 1SCWA 2D01A 2OAQ1 4NXBA 3LR0A 4QY6A 3RXXA 1NRJA 2WKPA 3T1RA 5DTTA 2GNXA 4R23A 5F6AA 4BD1A 2ZQDA 2PD8A 4PPRA 3IXBA 2H10A 1V9YA 4O7DA 4BL3A 1K6SA 1FILA 1J9MA 3IWOA 3MR0A 4PKYA 1T1AA 4OQGA 5K5BA 3H9WA 3UPPA 1NY0A 1N4OA 1T18A 4EV4A 2H0YA 3BECA 1EROA 1PZPA 1IYQA 2ZJ9A 2W3FA 2ZM8A 2WUQA 3KYZA 1K4FA 1KDSA 2ZM2A 3HJIA 1MC0A 1XKZA 4MDZA 5GLCA 5GLBA 4JGQA 4DF6A 4BLMA 1N9OA 3S7PA 4LV1A 3PBSA 3IX4A 4IVKA 1MPLA 2L1MA 1H5XA 4Y0TA 3IF5A 4S2IA 1KE4A 5FQMA 3KSFA 1L0FA 3MXSA 2VKSA 3BY8A 3TRCA 3PBOA 3IXDA 2HJ9C 3MKEA 1VB6A 4MN7A 4WL9A 3NHQA 2ZQAA 2Q0OA 4ZJ2A 4OKPA 1ERMA 4B9OA 4EBLA 3BFFA 5LBRA 1PI5A 3SOIA 4I3AA 5F83A 4OQ0A 3WS0A 5DJUA 4FH2A 4GKUA 4X1MA 3HVFA 2ZMFA 1MWSA 1MWUA 5FDSA 3S4XA 5CEDA 4EW7A 4KUKA 1ZKJA 4KQDA 4Z1WA 4K91A 5IHVA 5HAIA 2Y59A 1VEUA 2WZXA 3ZVTA 3MSHA 4JF5A 5F1FA 1L0DA 4QJGA 4LCMA 4B4ZA 3SS4A 5TGFA 1KGEA 5EECA 3TW8A 1SDNA 4ZJ3A 1LL8A 2JE5A 3DTEA 3UPOA 3WS2A 1ES4A 3ZHHA 1G68A 5HL6A 3C5AA 5HDDA 2C5WB 3OLOA 4GN2A 1OT6A 1XX2A 4KZ9A 4QU3A 1M40A 1KGFA 4OPYA 1PFLA 4KZ7A 1PWGA 4QB8A 2EWVA 2HDSA 1L3LA 4PKYG 4JXWA 4M4XA 2Y2PA 3N4IA 1WYCA 2PR6A 3KYEA 3VMAA 3D72A 1YMSA 3LICA 4PAUA 4OVDA 5CRFA 3A3JA 4ESPA 1FCNA 1H3QA 4PMAA 5IS1A 1E4DA 1JVJA 3ZNTA 3VSKA 3IBRA 1EW0A 1YLYA 4QD4A 3BFGA 5A8BA 3W4QA 5E2GA 3NOTC 4ZRRA 4X25A 3UB6A 2DCFA 1T1BA 2DMWA 5EFWA 5FDHA 3UPNA 5AQBA 2XD1A 3OZHA 5CHMA 3T4LA 2EX2A 1VQQA 3E2KA 1KVLA 3IHBA 1GHMA 5L8MA 3LY3A 1BLCA 3M2KA 2V20A 1ZHHB 3B47A 1BSGA 1LI0A 1EI5A 4I3IA 1TS0A 4MNRA 3LR5A 4P87A 2V0UA 1XPBA 5FQ9A 2IA2A 1XJ4A 5I5LA 4GD6A 3MQ0A 3NDEA 3E4PA 2PYRA 1FIKA 1ES2A 1Y54A 2VV7A 3AGEA 3CI6A 3P7NA 1ONGA 3T4JA 3BLMA 5KZHA 3B33A 3FZCA 4OQIA 5CHJA 2XROA 4DJ2A 3HLFA 3OPRA 5FAOA 4KG6A 4S2OA 3MFXA 2NUTC 1KOUA 4GW9A 4X68A 1LI9A 3W4PA 3ZFZA 2YKFA 3GDIA 1I5QA 1L2SA 3N8SA 3KO6A 4EEUA 2J9OA 3D4FA 5CHUA 1ALQA 4FOFA 2PHYA 4R70A 5KSHA 2W27A 3MQQA 5AQ7A 4Y13A 1K57A 2ZMVA 2VK3A 3P09A 1H0MA 2ZBBA 2FH5A 3BWLA 1PRQA 2JCHA 2HDQA 3NI9A 1BLHA 2O99A 1G5UA 5AVEA 2HDRA 3IH9A 3A0RA 1YAXA 3LR3A 3UB5P 5DJTA 3T1SA 3UDIA 1NZUA 3ICYA 3HLBA 4OOLA 3CWFA 4CLCA 3UNWA 2V8FA 1DJCA 5CECA 1D1JA 2PRFA 2XA7S 4P6BA 1NWZA 4YNRA 3ISGA 3C38A 3MQOA 2IWBA 2Y2QA 3T1XA 3MXQA 4E3KA 1ZG6A 1I2WA 4MBHA 2PBYA 1DY6A 1K56A 4GS9B 1GSVA 2QWSA 3QP2A 1ESUA 1OMEA 2ZD8A 4JF4A 1F98A 3BYDA 3B42A 2A49A 5EVEA 1I2SA 5A91A 1D7EA 2UV0E 2ZC7A 4GDBA 4XUXA 2KX6A 4L9EA 4E6WA 1CJFA 3Q82A 4CLCB 4LRZE 5M19A 4OOMA 3M2JA 4JF6A 2VV8A 3ZG9B 3RH8B 4HBUA 3BY9A 3HUOA 4P85A 4MEZA 4FD8A 3HCYA 2G2WA 1CF0A 5TBMA 2P08A 3QP1A 2VV6A 5DF7A 3Q7VA 3LEZA 2AVXA 5EM1A 3A0SA 1A0KA 3LEQA 4QHCA 3ZQ5A 2JKTM 5HWTA 3GR2A 4PM7A 3PXPA 4QPRA 2Y2GA 4L0LA 4E3LA 3VP3A 3PBTA 5EOOA 1S4SA 5G4YA 4BWIA 4KQRA 5EVID 4L9GA 3SZTA 4R4RA 4WN5A 2XFSA 1JWVA 1CI9A 2O9AA 4WBGA 1GHIA 4Y5FA 1YKDA 1N9NA 3SH9A 2KDKA 4WMCA 3GSGA 5CERA 3ZG8B 2Z2LB 2A24A 3ULFA 1X0OA 4ARZA 4GD8A 1AXBA 2IWCA 4EU0A 5EM0A 2D02A 3RJUA 1LSWA 2Q9MA 4BL2A 1KE3A 5TBMB 1JTGA 3LIBA 3KSGA 5DTKA 3Q7VB 3IX3A 2JBFA 1K56D 3T50A 4KG2A 2J80A 1ZTUA 5BOHA 1F9IA 1NLYA 4X53A 3WRTA 1K54C 3DTMA 2MJ6A 3IXGA 5EUAA 3MZDA 3HUMA 1S1YA 3O5YA 2DRWA 5CTMA 4EQIA 3VV4A 4MCWA 2ZC3B 4NXEA 2CC1A 4G3VA 4F3LA 4HJ4A 4Y0OA 1BULA 2H5SA 1G6OA 4KZAA 5FQJA 3NJAA 2QJ7A 1JWPA 2A24B 1IFQA 1YM1A 4ARZB 5F82A 3BM6A 2Y2HA 5HPIA 3DAVA 1IELA 4HJ6A 3BLSA 3IWIA 1NJ4A 4N1XA 1W7FA 2EWWA 2Y2NA 4JXSA 4XXRA 3BEBA 1GCEA 2V2FF 3HBRA 3PBQA 3ITAA 5HD5A 2VEAA 4NXFA 4FTXA 1RCJA 4UEYA 4LLOB 4LFUA 4FSFA 4KENB 2OOLA 3QNBA 4UQIM 3G2ZA 4R3AA 4KZ5A 1ERQA 2WYXA 1G6AA 1N9LA 2M7VA 3VP2A 3FKWA
chains in the Genus database with same CATH topology
2EWVA 5IU1A 2J3TC 2VGLM 4F3LB 4PKYG 1V9ZA 5HD3A 4M4XA 2YKHA 4HOIA 5TJJA 2PR6A 2QYBA 3C2WA 3VE3A 3D72A 4I3JA 3UE6A 3BQAA 3LICA 4PAUA 5HSQA 4HIAA 4CLCD 3EEAA 1H3QA 1P9WA 3W2ZA 5IS1A 4GHIB 5F68A 3KSHA 2QHKA 1H8MA 4EXOA 3IBRA 2K7SA 3E98A 5IT5A 1EW0A 2VX8A 2B18A 2JKRM 5A8BA 3IS2A 1P9RA 4NXGA 2XRNA 3NOTC 4ZRRA 2LB5A 3PR6A 3UB6A 4BBVA 3EOIA 3T4QA 1T1BA 1VHMA 3FG8A 2DMWA 5EFWA 3K3DA 4EESA 4EUVA 3EQVA 3ZYTA 1P0ZA 4B93A 2J3TD 2JN7A 1XJ2A 3HJKA 3MF0A 4GCZA 3T4LA 4HY8A 4DJ3A 1OTBA 3E4QA 3CAXA 2W1TB 5L8MA 4DN0A 5MC7A 3NOUC 4EETB 2OWHA 1ZHHB 2PYPA 1W63Q 3B47A 4JGOA 5DFXA 2V9AA 4JGPA 3UE3A 1OTDA 4KQOA 4YWZA 1S4RA 3PYPA 4I3IA 1TS0A 3LIAA 3MMHA 3LR5A 1YSQA 2V0UA 5DKKA 3SW1A 2A2LA 2IA2A 4PHTA 1XJ4A 2GJ3A 4LPZA 5I5LA 1DRMA 2P04A 4LRYC 3MQ0A 4HQAA 4BBTA 3E4PA 5J7EA 3JVUA 2PYRA 3IS2B 1GSWA 4P6ZS 2VV7A 4HH3A 3CI6A 2ZOHA 3P7NA 3LR4A 2PD7A 2W3EA 3UB7A 2V1AA 3T4JA 3KSIA 5DF9A 4EEPA 3BJNA 4WUJA 5HWVA 3T4TA 3CITA 3B33A 4HP4A 3KX0X 1TD5A 2XROA 1G28A 1TS8A 4DJ2A 1OTEA 1UGUA 4MN5A 4Y3IA 5G4ZA 1OJGA 5AVFA 4GJ4A 4HP9A 3BW6A 3MFXA 2NUTC 2CMNA 1S67L 4BBUA 3OCNA 1KOUA 4I38A 4GW9A 3OBFA 2HV1A 2KLIA 2YKFA 3GDIA 4IUKA 2LB9A 3KO6A 3S7OA 2ZOIA 2WKRA 3LI9A 4O0PA 1STZA 3FPVA 4EEUA 2KOIA 2Y8HA 5AJGA 3IBJA 4FOFA 2PHYA 4MN6A 4R70A 1W63M 5KSHA 2W27A 4EERA 3MQQA 2ZMVA 4IHQA 1TS6A 5HPFA 1DP9A 4WEJA 1MZUA 4O8GA 1XJ6A 5J4EA 4O01A 3F1NA 3CUEA 2ZBBA 2JHEA 2FH5A 3BWLA 1YSPA 2M7UA 3CLOA 4Q0JA 3MJQA 3T4KA 3UMEA 4L9FA 2H28A 1OJ5A 2O99A 5AVEA 1TF1A 2P7JA 4IUHA 3JVVA 3A0RA 2V0WA 4ETXA 3EEHA 1YAXA 3LR3A 1MKMA 3P01A 4II7A 1S66L 4BJPA 5DJTA 3V67A 1BYWA 5F69A 2GX5A 2L0WA 2Z6DA 4R38A 5KIZA 2HGVA 3ICYA 4OOLA 3CWFA 4CLCA 2W0NA 3E4OA 3LIDA 4XT2A 1OTAA 5HDCA 3TE8A 4R6LA 4IJGA 3K2NA 3LI8A 2XA7S 4Y2FA 2QKPA 3K3CA 1NWZA 2EA9A 4YNRA 3C38A 3MQOA 1S1ZA 3NOPC 4I39A 3MXQA 3U2AA 2W1RA 3F1NB 4GLQA 2PR5A 2OWJA 3LYXA 4WF0A 3OOVA 3GECA 2W3DA 4UQIS 3CUEC 2L4RA 4GS9B 4H6JA 5HDSA 1GSVA 2FZ0A 3S7QA 3DBAA 2QWSA 5J3WA 4NEED 2O0YA 1F98A 3B42A 2VGLS 4CQHA 2W3GA 1D7EA 4JGRA 3F1PA 3FC7A 2KX6A 4AFIA 4L9EA 1OPXA 2V1BA 3T4OA 5DFYA 1DP8A 2K31A 1IOUA 3C30A 4CLCB 4LRZE 2OAP1 4OOMA 3A0VA 3LFVA 2VV8A 2G7UA 3RH8B 1GSXA 1XFNA 4XT2B 2I9VA 3BY9A 4HH2A 3G6OA 4HHDA 4LRXC 2Y79A 1Y28A 1WA9A 3HCYA 3RTYA 5TBMA 2P08A 2D01A 3OCLA 2VV6A 2OAQ1 4NXBA 3LR0A 3LUQA 3A0SA 1NRJA 2K2NA 3ZQ5A 2JKTM 2WKPA 5HWTA 4HNBA 2GNXA 2VJWA 4H6JB 3PXPA 4P6ZM 5F6AA 3VOLA 3F1OA 4HI4A 4QPRA 3RFBA 2PD8A 4L0LA 3PBTA 3PBRA 1S4SA 5G4YA 4BWIA 2JKTI 4Q0IA 1OT9A 3UB9A 4L9GA 4GS9A 3T4SA 3PHYA 1V9YA 4WN5A 2R78A 2GZAA 3F1PB 4CLCE 2NUPC 3MR0A 2O9AA 3TJZC 3LIEA 4PKYA 1T1AA 4RQ9A 5F5YA 3PBNA 4Y5FA 5K5BA 2VA0A 3H82A 1YKDA 1N9NA 3H9WA 2B02A 4MMNA 2KDKA 1T18A 3EQUA 5FL3A 4KUOA 2PT7A 2A24A 3ULFA 3H7WA 2O9BA 1X0OA 1XFQA 1JNUA 2W3FA 3OC2A 4NKPA 4ARZA 3KYZA 4EU0A 4G3WA 3VE4A 2D02A 1LSWA 2W3HA 3LIFA 5CX7A 3HJIA 3D3OA 1MC0A 5TBMB 4EQ1A 4MDZA 3LIBA 3KSGA 4BMWA 4JGQA 1LSXA 4HJ3A 3R7WA 1N9OA 3S7PA 2JKRI 3UMDA 2M1CA 3PBSA 2BASA 3S7NA 2O9CA 3FPWA 3T50A 2PDRA 4K08A 2L1MA 2J80A 1XJ3A 3KYQA 1ZTUA 1UWNX 5HWWA 3F1OB 1F9IA 1NLYA 3KSFA 4ME4A 1D06A 2VKSA 3BY8A 3TRCA 3PBOA 1F5MA 2MJ6A 2HJ9C 2QJ5A 2WKQA 1VB6A 4MN7A 4WL9A 1S1YA 3NHQA 3O5YA 3EGXC 5DKLA 5C5KA 4G3KA 3VV4A 4MCWA 4NXEA 4B9OA 2XSSA 2VZWA 3BQ8A 4G3VA 4F3LA 5LBRA 4HJ4A 3H82B 4YOFA 1G6OA 4I3AA 1UWPX 5DJUA 2J3WA 3NJAA 2ZMFA 2QJ7A 4EW7A 2A24B 3H7WB 1DP6A 4KUKA 4WLAA 1IFQA 4KQDA 4ARZB 2HJEA 4Z1WA 1T1CA 4E04A 1ODVA 1TS7A 5HPIA 4HJ6A 3EGDC 4GHIA 4I5SA 1T19A 1NLZA 2EWWA 4CLCC 2XA7M 3R7WB 1P97A 1LSVA 3UB8A 3C8CA 2HF6A 3PBQA 2VLGA 5HD5A 2VEAA 4NXFA 3TW8A 1OTIA 1LT0A 1LL8A 4UEYA 4LLOB 2INWA 2Z6CA 4FSFA 2OOLA 3R4KA 3EWKA 5HL6A 4UQIM 5HDDA 4R3AA 4ETZA 3OLOA 1OT6A 4WEKA 5HZHA 4WELA 1N9LA 4Q0HA 2M7VA 3E0YA 4DMZA 2W1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IU1 A;  4F3L B;  4PKY G;  1V9Z A;  5HD3 A;  4M4X A;  2YKH A;  4HOI A;  2PR6 A;  3C2W A;  3VE3 A;  3D72 A;  4I3J A;  3UE6 A;  3LIC A;  5HSQ A;  4HIA A;  5IS1 A;  4GHI B;  5F68 A;  2QHK A;  4EXO A;  3IBR A;  2K7S A;  1EW0 A;  5A8B A;  3IS2 A;  4NXG A;  3NOT C;  3UB6 A;  4BBV A;  1T1B A;  3FG8 A;  5EFW A;  3K3D A;  4EES A;  1P0Z A;  2JN7 A;  1XJ2 A;  3HJK A;  4GCZ A;  4HY8 A;  4DJ3 A;  1OTB A;  3E4Q A;  3CAX A;  3NOU C;  4EET B;  2OWH A;  2PYP A;  4JGO A;  2V9A A;  4JGP A;  1OTD A;  4YWZ A;  1S4R A;  3PYP A;  4I3I A;  1TS0 A;  3LIA A;  2V0U A;  5DKK A;  3SW1 A;  1XJ4 A;  2GJ3 A;  4LPZ A;  5I5L A;  1DRM A;  4LRY C;  4HQA A;  5J7E A;  4BBT A;  3E4P A;  2PYR A;  3IS2 B;  1GSW A;  2VV7 A;  4HH3 A;  2ZOH A;  3P7N A;  2PD7 A;  3UB7 A;  2V1A A;  4EEP A;  4WUJ A;  5HWV A;  3B33 A;  4HP4 A;  3KX0 X;  1G28 A;  1TS8 A;  4DJ2 A;  1OTE A;  1UGU A;  4MN5 A;  5G4Z A;  1OJG A;  5AVF A;  4HP9 A;  3MFX A;  2CMN A;  1S67 L;  4BBU A;  1KOU A;  4I38 A;  4GW9 A;  2HV1 A;  2YKF A;  3GDI A;  2ZOI A;  2WKR A;  3LI9 A;  4EEU A;  2PHY A;  4MN6 A;  4R70 A;  2W27 A;  4EER A;  3MQQ A;  1TS6 A;  1DP9 A;  1MZU A;  1XJ6 A;  5J4E A;  3F1N A;  2ZBB A;  2JHE A;  3BWL A;  3CLO A;  3MJQ A;  3UME A;  4L9F A;  2H28 A;  1OJ5 A;  5AVE A;  2P7J A;  3A0R A;  2V0W A;  3EEH A;  1S66 L;  5DJT A;  1BYW A;  5F69 A;  2L0W A;  2Z6D A;  4R38 A;  5KIZ A;  3ICY A;  3CWF A;  2W0N A;  3E4O A;  3LID A;  4XT2 A;  1OTA A;  5HDC A;  4R6L A;  3LI8 A;  2QKP A;  3K3C A;  1NWZ A;  2EA9 A;  3MQO A;  1S1Z A;  3NOP C;  4I39 A;  3MXQ A;  3F1N B;  2PR5 A;  2OWJ A;  3LYX A;  4WF0 A;  3GEC A;  2L4R A;  4GS9 B;  4H6J A;  5HDS A;  1GSV A;  2QWS A;  5J3W A;  1F98 A;  1D7E A;  4JGR A;  3F1P A;  3FC7 A;  2KX6 A;  4L9E A;  2V1B A;  1DP8 A;  4LRZ E;  3A0V A;  2VV8 A;  3RH8 B;  1GSX A;  1XFN A;  4XT2 B;  2I9V A;  3BY9 A;  4HH2 A;  3G6O A;  4HHD A;  4LRX C;  1Y28 A;  1WA9 A;  3RTY A;  5TBM A;  2D01 A;  2VV6 A;  4NXB A;  3LUQ A;  3A0S A;  3ZQ5 A;  2WKP A;  5HWT A;  4HNB A;  3VOL A;  4H6J B;  5F6A A;  3F1O A;  4HI4 A;  2PD8 A;  1S4S A;  5G4Y A;  1OT9 A;  3UB9 A;  4L9G A;  4GS9 A;  3PHY A;  1V9Y A;  4WN5 A;  2R78 A;  3F1P B;  3MR0 A;  3LIE A;  4PKY A;  1T1A A;  4RQ9 A;  5F5Y A;  3H82 A;  1N9N A;  3H9W A;  2B02 A;  2KDK A;  1T18 A;  4KUO A;  3ULF A;  2A24 A;  3H7W A;  1X0O A;  1XFQ A;  1JNU A;  3VE4 A;  2D02 A;  1LSW A;  3LIF A;  3HJI A;  5TBM B;  4EQ1 A;  3LIB A;  4JGQ A;  1LSX A;  4HJ3 A;  1N9O A;  3UMD A;  2M1C A;  2BAS A;  3T50 A;  2PDR A;  4K08 A;  2L1M A;  2J80 A;  1XJ3 A;  1UWN X;  5HWW A;  3F1O B;  1F9I A;  1D06 A;  3BY8 A;  2QJ5 A;  2WKQ A;  1VB6 A;  4WL9 A;  1S1Y A;  3NHQ A;  5DKL A;  4NXE A;  4B9O A;  4F3L A;  4HJ4 A;  3H82 B;  4I3A A;  1UWP X;  5DJU A;  3NJA A;  2QJ7 A;  4EW7 A;  2A24 B;  3H7W B;  1DP6 A;  4KUK A;  4WLA A;  4KQD A;  1T1C A;  4E04 A;  1ODV A;  1TS7 A;  4HJ6 A;  4GHI A;  4I5S A;  1T19 A;  1P97 A;  1LSV A;  3UB8 A;  3C8C A;  2VLG A;  5HD5 A;  2VEA A;  4NXF A;  1OTI A;  1LT0 A;  1LL8 A;  4LLO B;  2INW A;  2Z6C A;  2OOL A;  3EWK A;  5HDD A;  4R3A A;  3OLO A;  1OT6 A;  5HZH A;  1N9L A; 
#chains in the Genus database with same CATH topology
 2WGV A;  4D60 A;  4F3L B;  1V9Z A;  3NEC A;  2YKH A;  5TJJ A;  2P9V A;  2QYB A;  5A93 A;  3HLG A;  1NZO A;  2XF3 A;  1YT4 A;  2I72 A;  4ZJ1 A;  5EVL A;  3BQA A;  3UE6 A;  4E3N A;  1YLZ A;  4HIA A;  3VP0 A;  3EEA A;  3W2Z A;  5F68 A;  3Q81 A;  3ZG7 B;  3QP6 A;  1CEG A;  4NG2 A;  2K7S A;  1K55 A;  5FA7 A;  3SS5 A;  1TDL A;  3IS2 A;  1O7E A;  5FQI A;  2Y2L A;  3ZGA B;  3EOI A;  3T4Q A;  1VHM A;  3W4O A;  4N1H A;  1ACF A;  3SH8 A;  3ZYT A;  1P0Z A;  3W8K A;  2BLS A;  3DTK A;  2J3T D;  2JN7 A;  1JWZ A;  3MF0 A;  4QWO A;  4GCZ A;  3N7W A;  2FFY A;  4MBF A;  4DJ3 A;  1FR1 A;  1NXY A;  3CAX A;  4DN0 A;  5MC7 A;  1IYS A;  1ESI A;  3PAG A;  2WAE A;  4U0X A;  4Q8I A;  5DFX A;  2V9A A;  4JGP A;  4E3J A;  2P9V B;  3CG5 A;  1GA9 A;  3T1Q B;  4PM5 A;  4DE2 A;  3QP8 A;  3AGD A;  2WZZ A;  2IWD A;  5L09 A;  5M1A A;  3SW1 A;  2A2L A;  4PHT A;  4DE1 A;  1PI4 A;  3QP4 A;  3QNC A;  4LRY C;  3G2Y A;  1AWI A;  4LCL A;  3IS2 B;  4R3B A;  4HH3 A;  1K25 A;  1RGY A;  5JYO A;  2PD7 A;  5DF9 A;  4EEP A;  3FYZ A;  4N92 A;  4S2K A;  5HWV A;  3T4T A;  3CIT A;  2ZQC A;  1RGZ A;  4Y17 A;  1TD5 A;  4YFM A;  1GHP A;  3IQA A;  3N8R A;  1Q2Q A;  3CJM A;  1OJG A;  2PU4 A;  3BW6 A;  2Y2I A;  1FQG A;  1S67 L;  3OCN A;  3OBF A;  2HV1 A;  2KLI A;  2XD5 A;  2XFT A;  3LI9 A;  1XGI A;  3FWL A;  1L0G A;  3GQZ A;  4O0P A;  4B88 A;  5TR7 A;  2HP6 A;  4WZ5 C;  5AJG A;  3IBJ A;  2R9X A;  2GDN A;  4B4X A;  5U47 A;  1S0W A;  1PW8 A;  1TS6 A;  3GMW A;  4EBN A;  4WEJ A;  4DXB A;  1XJ6 A;  5CTN A;  5J4E A;  4O01 A;  2EX9 A;  3CUE A;  4S2M A;  1MY8 A;  2M7U A;  3C4O A;  2EX6 A;  3IF6 C;  4Q0J A;  4S2N C;  3UME A;  4LV3 A;  2H28 A;  2EXB A;  1OJ5 A;  3VP4 A;  3MBZ A;  2C6W B;  2ZQ8 A;  4R0Q A;  3GTC A;  5FSR A;  1N9B A;  3B3X A;  1Z09 A;  2XK1 A;  3EEH A;  3HLE A;  1W79 A;  3WS4 A;  4II7 A;  3P01 A;  5E2E A;  3MS6 A;  4BJP A;  3V67 A;  2VGK A;  3HLW A;  1BYW A;  5F69 A;  2FFF B;  4R38 A;  3GVB A;  1YLJ A;  4DRT A;  1PWD A;  3N8L A;  3MZF A;  2W0N A;  3E4O A;  1BZA A;  4ZTK A;  1FSY A;  1JTD A;  4XT2 A;  4R4S A;  2XEP A;  5GHZ A;  4R6L A;  3K2N A;  5EOE A;  4C3Q A;  4UHU A;  5GLD A;  2QKP A;  3K3C A;  2EA9 A;  3A3D A;  1YLP A;  2V1Z A;  4GLQ A;  2PR5 A;  3O3V A;  3LYX A;  4Y0U A;  1LLB A;  3VFF A;  4OH0 A;  1W8Q A;  1SDE A;  4CPK A;  5CGW A;  1M6K A;  1DJB A;  5HDS A;  5CGS A;  3S7Q A;  3DBA A;  4OPQ A;  5J3W A;  4NEE D;  4KZ4 A;  2ZM0 A;  2WAF A;  4A5R A;  3F1P A;  3FC7 A;  1K4E A;  5GLA A;  5CGX A;  2PAV P;  5EVI C;  1H8Y A;  2K31 A;  2P74 A;  1FR6 A;  1GA0 A;  3LFV A;  2G7U A;  4X1L A;  4XT2 B;  4HH2 A;  3G6O A;  1KDW A;  4LRX C;  3WWX A;  4Z9Q A;  3WRZ A;  5FI2 A;  3RTY A;  5FQK A;  1MXO A;  3WS1 A;  3N6I A;  4XUZ A;  3LUQ A;  2WGW A;  4RA7 A;  2K2N A;  5HAQ A;  3VOL A;  4P6Z M;  5AQ9 A;  4HBT A;  2R9W A;  4F94 A;  4Y15 A;  3PBR A;  2JKT I;  4PM8 A;  1OT9 A;  2X02 A;  3UB9 A;  3T4S A;  1EWZ A;  4GS9 A;  3PHY A;  2ZMA A;  3F1P B;  4X6T A;  4CLC E;  1K0K A;  3TJZ C;  1MKI A;  5F5Y A;  3SS3 A;  3BFE A;  3H82 A;  3V3R A;  3NUL A;  3EQU A;  5FL3 A;  4KUO A;  2PT7 A;  3IHA A;  4N9K A;  2O9B A;  3OC2 A;  2OSU A;  3OPL A;  4G3W A;  4YIN A;  3IWQ A;  3D3O A;  4BMW A;  1W8Y A;  4DDY A;  1LSX A;  1TEM A;  4KZ3 A;  3R7W A;  2A3U A;  2JKR I;  2M1C A;  2BAS A;  3P98 A;  2O9C A;  4MBK A;  2WGW B;  1XJ3 A;  3KYQ A;  3NY4 A;  1DJA A;  4ME4 A;  1D06 A;  4RX2 A;  1F5M A;  2WKQ A;  4FCF A;  3EGX C;  4G3K A;  1YLW A;  3ITB A;  1IKI A;  4PM6 A;  4OLD A;  3H82 B;  1PNE A;  5A90 A;  2J3W A;  5HL1 A;  1MWT A;  3AGF A;  1DP6 A;  3MKF A;  4WLA A;  2HJE A;  1T1C A;  4E04 A;  1TS7 A;  2ZQ9 A;  5I94 A;  3I7J A;  3GRJ A;  1LL9 A;  5HAP A;  1C3B A;  3VOZ A;  4LEN A;  3VP1 A;  1FCO A;  3V39 A;  1T19 A;  1NLZ A;  4S2P A;  3R7W B;  1P97 A;  1LSV A;  2VLG A;  5GHX A;  1XXM A;  1LT0 A;  1K38 A;  1XA1 A;  2INW A;  2EFX A;  3FV7 A;  1LL5 A;  1XA7 A;  1TDG A;  4ETZ A;  2OLU A;  4WEK A;  1FSW A;  4WEL A;  4LGW A;  2WAD A;  4Q0H A;  3E0Y A;  1WYB A;  3L9K A;  2W1T A;  2J3T C;  1SKF A;  2VGL M;  4E3O A;  5HD3 A;  3C7V A;  4HOI A;  3PAE A;  3C2W A;  4CLC D;  1BLP A;  2PU2 A;  1IKG A;  1H8M A;  4FUW A;  2B18 A;  2JKR M;  2XLN A;  1P9R A;  4NXG A;  4OQH A;  4BBV A;  3G31 A;  4R3J A;  4DXC A;  3LO7 A;  3K3D A;  2ZC4 B;  4EES A;  4EUV A;  4X56 A;  1NRF A;  5FI7 A;  4BEN A;  5E43 A;  3HJK A;  1XJ2 A;  4QY5 A;  4HY8 A;  2HPB A;  2ZL1 A;  4RYE A;  2W1T B;  1NYM A;  2WK0 A;  2JKG A;  4MLL A;  1IEM A;  2PYP A;  2OLV A;  2J7V A;  2JC7 A;  1W5D A;  1PZO A;  4CJN A;  4EUZ A;  4D2O A;  4YWZ A;  1S4R A;  3PYP A;  3TG9 A;  1ONH A;  2Q9N A;  4GDN A;  1YSQ A;  5DKK A;  2GJ3 A;  4LPZ A;  1DRM A;  2P04 A;  5J7E A;  4BBT A;  3JVU A;  1GSW A;  1ES5 A;  1YPR A;  3UE0 A;  3E2L A;  1VM1 A;  4U3T A;  3UB7 A;  2PBD P;  3BJN A;  4WUJ A;  1CI8 A;  4HP4 A;  3KX0 X;  3QHY A;  2QPN A;  1UGU A;  4MN5 A;  4Y3I A;  2B5R A;  2ZL1 B;  4X69 A;  3G34 A;  3IXH A;  4BBU A;  3MFD A;  4I38 A;  4KQQ A;  4HEF A;  5FAS A;  4OPR A;  5L2F A;  3T12 B;  4R1G A;  5J8X A;  4OLG A;  2LB9 A;  4K0X A;  3UO9 A;  3G4P A;  3S7O A;  2WKR A;  2WKH A;  1STZ A;  3FPV A;  3S22 A;  1VET A;  2KOI A;  4ZDX A;  4WMC D;  2J9P A;  4ID4 A;  4MN6 A;  5HPF A;  3UY6 A;  1DP9 A;  3Q7Z A;  4U0T A;  1K54 A;  1MZU A;  4O8G A;  1KGG A;  3V3S A;  2JHE A;  2EFU A;  3MJQ A;  3T4K A;  3NCK A;  2Y2J A;  4RX3 A;  3NC8 A;  1TF1 A;  3HLC A;  3QP5 A;  4IUH A;  3JVV A;  3BRM A;  1U60 A;  5EPH A;  1MKM A;  1S66 L;  2ZQ7 A;  2HDU A;  3HLD A;  2GX5 A;  1BUE A;  2L0W A;  2BTF P;  3UE1 A;  2Z6D A;  5KIZ A;  2HGV A;  5JYP A;  4JKT A;  3FKV A;  1XGJ A;  2BG1 A;  1QME A;  1VET B;  3LID A;  1HLU P;  4KZB A;  5HDC A;  3TE8 A;  3LI8 A;  3NBL A;  4JLF A;  4Y2F A;  2H0T A;  4M3K A;  1PWC A;  4OON A;  1S1Z A;  4EBP A;  3NOP C;  3O87 A;  4OP5 A;  4EWF A;  2W1R A;  4GOG A;  1Z6F A;  1Q2P A;  3GEC A;  4UQI S;  3CUE C;  4OOY A;  2L4R A;  4H6J A;  5HW3 A;  5FI6 A;  3VSL A;  3Q07 A;  4CQH A;  1H8Z A;  1KE0 A;  3OPH A;  3IH8 A;  4N9L A;  4ZAM A;  5FAP A;  1KVM A;  2Y55 A;  1BTL A;  1MBL A;  1J3W A;  1FOF A;  5DFY A;  2Y2O A;  1DP8 A;  4DDS A;  3C30 A;  2OAP 1;  3G30 A;  1GSX A;  1YMX A;  2I9V A;  4IVI A;  2V8C A;  5AQA A;  5FAQ A;  3OCL A;  1HD8 A;  2XDM A;  1YLT A;  3CPT A;  4HNB A;  3LGO A;  2VJW A;  4H6J B;  3F1O A;  3JYI A;  4HI4 A;  4S2J A;  3RFB A;  1BLS A;  2WKE A;  2UWX A;  4Q0I A;  1S6R A;  2X01 A;  3JPU A;  1E25 A;  4S2L A;  2ACG A;  2R78 A;  2GZA A;  4KZ8 A;  4WM9 A;  1SZV A;  3VFH A;  2NUP C;  1CK3 A;  3CMZ A;  3LIE A;  4RQ9 A;  3PBN A;  3VOY A;  2VA0 A;  1WE4 A;  2B02 A;  4MMN A;  3ZG5 A;  1VEU B;  3LY4 A;  3M6H A;  4FH4 A;  3H7W A;  3HL9 A;  1XFQ A;  1JNU A;  4NKP A;  4P0M A;  3BFD A;  5A92 A;  3VE4 A;  5GHY A;  2W3H A;  3LIF A;  5CX7 A;  4EQ1 A;  5E2H A;  3IX8 A;  5L07 A;  3RXW A;  4HJ3 A;  3LCE A;  4IBX A;  3UMD A;  3S7N A;  5FQQ A;  3FPW A;  2PDR A;  4K08 A;  2XR0 A;  1TVF A;  3CPT B;  1UWN X;  1HZO A;  1K57 C;  5HWW A;  3BFC A;  3F1O B;  3MXR A;  2QJ5 A;  4WZ5 A;  3IT9 A;  5C5K A;  3DTI A;  5DKL A;  2XSS A;  2VZW A;  3BQ8 A;  2Y2K A;  4YOF A;  4DE0 A;  1UWP X;  2XGN A;  5DTS A;  4C6Y A;  2J8Y A;  3H7W B;  4JPM A;  5KMW A;  3IF6 A;  1ODV A;  1IYO A;  4HES A;  4S2N A;  3EGD C;  4GHI A;  3U4L P;  3C7U A;  3O86 A;  4I5S A;  2Y2M A;  2JKF A;  4BD0 A;  4CLC C;  4KG5 A;  2XA7 M;  3UB8 A;  3C8C A;  2HF6 A;  3DWZ A;  1IYP A;  2G2U A;  4X55 A;  1OTI A;  3DWK A;  1Y4O A;  4JXV A;  2Z6C A;  3R4K A;  3EWK A;  4E6X A;  5HAR A;  5HZH A;  3A3F A;  1MWR A;  2RL3 A;  4DMZ A;  5IU1 A;  1K6R A;  1CQA A;  5M18 A;  3L7H A;  3VE3 A;  4I3J A;  3UDX A;  1O07 A;  2Y4A A;  5HSQ A;  3IF6 B;  2EX8 A;  2HZ5 A;  1PIO A;  3C4P A;  1P9W A;  4JBF A;  4NET A;  3HRE A;  4GHI B;  3DW0 A;  3KSH A;  4OPZ A;  2OV5 A;  2QHK A;  4EXO A;  1HVB A;  3E98 A;  5IT5 A;  2HP9 A;  2VX8 A;  3TOI A;  2Z2M B;  5FEF A;  2XRN A;  3ZNY A;  2LB5 A;  4GNU A;  3PR6 A;  4KZ6 A;  3CHW P;  3FG8 A;  1SHV A;  5CEB A;  1FCM A;  3EQV A;  5EVI A;  3ZG0 A;  4B93 A;  1LHY A;  5TFQ A;  1XP4 A;  5E2F A;  5HFO A;  1OTB A;  4UA9 A;  3E4Q A;  3UN7 A;  4E3I A;  5DVA A;  3NOU C;  4EET B;  3WS5 A;  2OWH A;  1W63 Q;  4JGO A;  4NK3 A;  3UE3 A;  1OTD A;  4KQO A;  3Q1F A;  4GB7 A;  1ZC2 A;  5FEG A;  3HUN A;  3LIA A;  5L10 A;  3MMH A;  4K0W A;  4C75 A;  2B95 A;  2E8I A;  2RCX A;  3GV9 A;  4HQA A;  4H8R A;  4P6Z S;  2WKI A;  4UAA A;  2ZOH A;  1NYY A;  3LR4 A;  2W3E A;  2V1A A;  3KSI A;  5KSC A;  1YQS A;  3ZDJ A;  5EVI B;  4BQM A;  1SKO A;  4ZBE A;  1G28 A;  1TS8 A;  1OTE A;  3ZVW A;  5G4Z A;  2Y91 A;  5AVF A;  4GJ4 A;  5F1G A;  4HP9 A;  2QMI A;  2CMN A;  4WZ4 A;  4UA6 A;  3M6B A;  4IUK A;  5DF8 A;  4OP8 A;  3UDF A;  2XQZ A;  2ZC6 B;  2ZOI A;  5EV0 A;  2Y8H A;  1E3U A;  1F2K A;  1W63 M;  4EER A;  4DE3 A;  4IHQ A;  5FAT A;  2WGI A;  3F1N A;  2ZC5 B;  1RP5 A;  1YSP A;  4DKI A;  3CLO A;  4GZB A;  3ZCZ A;  2X71 A;  4L9F A;  4WYY A;  2XH9 A;  3G35 A;  1HTZ A;  3O88 A;  1SKO B;  2P7J A;  2QZ6 A;  2ZLY A;  4RVA A;  2EXA A;  2V0W A;  4ETX A;  2VGJ A;  3S1Y A;  3G32 A;  3TSG A;  3CZD A;  3PTE A;  1PYY A;  4LV2 A;  3D9Y A;  1QMF A;  4IBR A;  4E3M A;  3MZE A;  1OTA A;  2HP5 A;  4IJG A;  2E8J A;  5GL9 A;  3V5M A;  1PW1 A;  1L0E A;  3V50 A;  3OPP A;  4PM9 A;  4I39 A;  3U2A A;  3F1N B;  4Y7P A;  2OWJ A;  4WF0 A;  3OOV A;  2W3D A;  4JXG A;  2DNS A;  2FZ0 A;  1K55 C;  2O0Y A;  5D3O A;  2VGL S;  2W3G A;  1ES3 A;  1ZG4 A;  4JGR A;  3A3I A;  4AFI A;  1BT5 A;  3A3E A;  4LV0 A;  1OPX A;  2V1B A;  3T4O A;  5CXW A;  4UA7 A;  3SH7 A;  1IOU A;  3NDG A;  1CEF A;  5G18 A;  3A0V A;  1E3U D;  5HX9 A;  1XFN A;  3NIA A;  4HHD A;  2Y79 A;  5EE8 A;  1Y28 A;  1WA9 A;  4IED A;  1SCW A;  2D01 A;  2OAQ 1;  4NXB A;  3LR0 A;  4QY6 A;  3RXX A;  1NRJ A;  2WKP A;  3T1R A;  5DTT A;  2GNX A;  4R23 A;  5F6A A;  4BD1 A;  2ZQD A;  2PD8 A;  4PPR A;  3IXB A;  2H10 A;  1V9Y A;  4O7D A;  4BL3 A;  1K6S A;  1FIL A;  1J9M A;  3IWO A;  3MR0 A;  4PKY A;  1T1A A;  4OQG A;  5K5B A;  3H9W A;  3UPP A;  1NY0 A;  1N4O A;  1T18 A;  4EV4 A;  2H0Y A;  3BEC A;  1ERO A;  1PZP A;  1IYQ A;  2ZJ9 A;  2W3F A;  2ZM8 A;  2WUQ A;  3KYZ A;  1K4F A;  1KDS A;  2ZM2 A;  3HJI A;  1MC0 A;  1XKZ A;  4MDZ A;  5GLC A;  5GLB A;  4JGQ A;  4DF6 A;  4BLM A;  1N9O A;  3S7P A;  4LV1 A;  3PBS A;  3IX4 A;  4IVK A;  1MPL A;  2L1M A;  1H5X A;  4Y0T A;  3IF5 A;  4S2I A;  1KE4 A;  5FQM A;  3KSF A;  1L0F A;  3MXS A;  2VKS A;  3BY8 A;  3TRC A;  3PBO A;  3IXD A;  2HJ9 C;  3MKE A;  1VB6 A;  4MN7 A;  4WL9 A;  3NHQ A;  2ZQA A;  2Q0O A;  4ZJ2 A;  4OKP A;  1ERM A;  4B9O A;  4EBL A;  3BFF A;  5LBR A;  1PI5 A;  3SOI A;  4I3A A;  5F83 A;  4OQ0 A;  3WS0 A;  5DJU A;  4FH2 A;  4GKU A;  4X1M A;  3HVF A;  2ZMF A;  1MWS A;  1MWU A;  5FDS A;  3S4X A;  5CED A;  4EW7 A;  4KUK A;  1ZKJ A;  4KQD A;  4Z1W A;  4K91 A;  5IHV A;  5HAI A;  2Y59 A;  1VEU A;  2WZX A;  3ZVT A;  3MSH A;  4JF5 A;  5F1F A;  1L0D A;  4QJG A;  4LCM A;  4B4Z A;  3SS4 A;  5TGF A;  1KGE A;  5EEC A;  3TW8 A;  1SDN A;  4ZJ3 A;  1LL8 A;  2JE5 A;  3DTE A;  3UPO A;  3WS2 A;  1ES4 A;  3ZHH A;  1G68 A;  5HL6 A;  3C5A A;  5HDD A;  2C5W B;  3OLO A;  4GN2 A;  1OT6 A;  1XX2 A;  4KZ9 A;  4QU3 A;  1M40 A;  1KGF A;  4OPY A;  1PFL A;  4KZ7 A;  1PWG A;  4QB8 A;  2EWV A;  2HDS A;  1L3L A;  4PKY G;  4JXW A;  4M4X A;  2Y2P A;  3N4I A;  1WYC A;  2PR6 A;  3KYE A;  3VMA A;  3D72 A;  1YMS A;  3LIC A;  4PAU A;  4OVD A;  5CRF A;  3A3J A;  4ESP A;  1FCN A;  1H3Q A;  4PMA A;  5IS1 A;  1E4D A;  1JVJ A;  3ZNT A;  3VSK A;  3IBR A;  1EW0 A;  1YLY A;  4QD4 A;  3BFG A;  5A8B A;  3W4Q A;  5E2G A;  3NOT C;  4ZRR A;  4X25 A;  3UB6 A;  2DCF A;  1T1B A;  2DMW A;  5EFW A;  5FDH A;  3UPN A;  5AQB A;  2XD1 A;  3OZH A;  5CHM A;  3T4L A;  2EX2 A;  1VQQ A;  3E2K A;  1KVL A;  3IHB A;  1GHM A;  5L8M A;  3LY3 A;  1BLC A;  3M2K A;  2V20 A;  1ZHH B;  3B47 A;  1BSG A;  1LI0 A;  1EI5 A;  4I3I A;  1TS0 A;  4MNR A;  3LR5 A;  4P87 A;  2V0U A;  1XPB A;  5FQ9 A;  2IA2 A;  1XJ4 A;  5I5L A;  4GD6 A;  3MQ0 A;  3NDE A;  3E4P A;  2PYR A;  1FIK A;  1ES2 A;  1Y54 A;  2VV7 A;  3AGE A;  3CI6 A;  3P7N A;  1ONG A;  3T4J A;  3BLM A;  5KZH A;  3B33 A;  3FZC A;  4OQI A;  5CHJ A;  2XRO A;  4DJ2 A;  3HLF A;  3OPR A;  5FAO A;  4KG6 A;  4S2O A;  3MFX A;  2NUT C;  1KOU A;  4GW9 A;  4X68 A;  1LI9 A;  3W4P A;  3ZFZ A;  2YKF A;  3GDI A;  1I5Q A;  1L2S A;  3N8S A;  3KO6 A;  4EEU A;  2J9O A;  3D4F A;  5CHU A;  1ALQ A;  4FOF A;  2PHY A;  4R70 A;  5KSH A;  2W27 A;  3MQQ A;  5AQ7 A;  4Y13 A;  1K57 A;  2ZMV A;  2VK3 A;  3P09 A;  1H0M A;  2ZBB A;  2FH5 A;  3BWL A;  1PRQ A;  2JCH A;  2HDQ A;  3NI9 A;  1BLH A;  2O99 A;  1G5U A;  5AVE A;  2HDR A;  3IH9 A;  3A0R A;  1YAX A;  3LR3 A;  3UB5 P;  5DJT A;  3T1S A;  3UDI A;  1NZU A;  3ICY A;  3HLB A;  4OOL A;  3CWF A;  4CLC A;  3UNW A;  2V8F A;  1DJC A;  5CEC A;  1D1J A;  2PRF A;  2XA7 S;  4P6B A;  1NWZ A;  4YNR A;  3ISG A;  3C38 A;  3MQO A;  2IWB A;  2Y2Q A;  3T1X A;  3MXQ A;  4E3K A;  1ZG6 A;  1I2W A;  4MBH A;  2PBY A;  1DY6 A;  1K56 A;  4GS9 B;  1GSV A;  2QWS A;  3QP2 A;  1ESU A;  1OME A;  2ZD8 A;  4JF4 A;  1F98 A;  3BYD A;  3B42 A;  2A49 A;  5EVE A;  1I2S A;  5A91 A;  1D7E A;  2UV0 E;  2ZC7 A;  4GDB A;  4XUX A;  2KX6 A;  4L9E A;  4E6W A;  1CJF A;  3Q82 A;  4CLC B;  4LRZ E;  5M19 A;  4OOM A;  3M2J A;  4JF6 A;  2VV8 A;  3ZG9 B;  3RH8 B;  4HBU A;  3BY9 A;  3HUO A;  4P85 A;  4MEZ A;  4FD8 A;  3HCY A;  2G2W A;  1CF0 A;  5TBM A;  2P08 A;  3QP1 A;  2VV6 A;  5DF7 A;  3Q7V A;  3LEZ A;  2AVX A;  5EM1 A;  3A0S A;  1A0K A;  3LEQ A;  4QHC A;  3ZQ5 A;  2JKT M;  5HWT A;  3GR2 A;  4PM7 A;  3PXP A;  4QPR A;  2Y2G A;  4L0L A;  4E3L A;  3VP3 A;  3PBT A;  5EOO A;  1S4S A;  5G4Y A;  4BWI A;  4KQR A;  5EVI D;  4L9G A;  3SZT A;  4R4R A;  4WN5 A;  2XFS A;  1JWV A;  1CI9 A;  2O9A A;  4WBG A;  1GHI A;  4Y5F A;  1YKD A;  1N9N A;  3SH9 A;  2KDK A;  4WMC A;  3GSG A;  5CER A;  3ZG8 B;  2Z2L B;  2A24 A;  3ULF A;  1X0O A;  4ARZ A;  4GD8 A;  1AXB A;  2IWC A;  4EU0 A;  5EM0 A;  2D02 A;  3RJU A;  1LSW A;  2Q9M A;  4BL2 A;  1KE3 A;  5TBM B;  1JTG A;  3LIB A;  3KSG A;  5DTK A;  3Q7V B;  3IX3 A;  2JBF A;  1K56 D;  3T50 A;  4KG2 A;  2J80 A;  1ZTU A;  5BOH A;  1F9I A;  1NLY A;  4X53 A;  3WRT A;  1K54 C;  3DTM A;  2MJ6 A;  3IXG A;  5EUA A;  3MZD A;  3HUM A;  1S1Y A;  3O5Y A;  2DRW A;  5CTM A;  4EQI A;  3VV4 A;  4MCW A;  2ZC3 B;  4NXE A;  2CC1 A;  4G3V A;  4F3L A;  4HJ4 A;  4Y0O A;  1BUL A;  2H5S A;  1G6O A;  4KZA A;  5FQJ A;  3NJA A;  2QJ7 A;  1JWP A;  2A24 B;  1IFQ A;  1YM1 A;  4ARZ B;  5F82 A;  3BM6 A;  2Y2H A;  5HPI A;  3DAV A;  1IEL A;  4HJ6 A;  3BLS A;  3IWI A;  1NJ4 A;  4N1X A;  1W7F A;  2EWW A;  2Y2N A;  4JXS A;  4XXR A;  3BEB A;  1GCE A;  2V2F F;  3HBR A;  3PBQ A;  3ITA A;  5HD5 A;  2VEA A;  4NXF A;  4FTX A;  1RCJ A;  4UEY A;  4LLO B;  4LFU A;  4FSF A;  4KEN B;  2OOL A;  3QNB A;  4UQI M;  3G2Z A;  4R3A A;  4KZ5 A;  1ERQ A;  2WYX A;  1G6A A;  1N9L A;  2M7V A;  3VP2 A;  3FKW A; 
#chains in the Genus database with same CATH homology
 2EWV A;  5IU1 A;  2J3T C;  2VGL M;  4F3L B;  4PKY G;  1V9Z A;  5HD3 A;  4M4X A;  2YKH A;  4HOI A;  5TJJ A;  2PR6 A;  2QYB A;  3C2W A;  3VE3 A;  3D72 A;  4I3J A;  3UE6 A;  3BQA A;  3LIC A;  4PAU A;  5HSQ A;  4HIA A;  4CLC D;  3EEA A;  1H3Q A;  1P9W A;  3W2Z A;  5IS1 A;  4GHI B;  5F68 A;  3KSH A;  2QHK A;  1H8M A;  4EXO A;  3IBR A;  2K7S A;  3E98 A;  5IT5 A;  1EW0 A;  2VX8 A;  2B18 A;  2JKR M;  5A8B A;  3IS2 A;  1P9R A;  4NXG A;  2XRN A;  3NOT C;  4ZRR A;  2LB5 A;  3PR6 A;  3UB6 A;  4BBV A;  3EOI A;  3T4Q A;  1T1B A;  1VHM A;  3FG8 A;  2DMW A;  5EFW A;  3K3D A;  4EES A;  4EUV A;  3EQV A;  3ZYT A;  1P0Z A;  4B93 A;  2J3T D;  2JN7 A;  1XJ2 A;  3HJK A;  3MF0 A;  4GCZ A;  3T4L A;  4HY8 A;  4DJ3 A;  1OTB A;  3E4Q A;  3CAX A;  2W1T B;  5L8M A;  4DN0 A;  5MC7 A;  3NOU C;  4EET B;  2OWH A;  1ZHH B;  2PYP A;  1W63 Q;  3B47 A;  4JGO A;  5DFX A;  2V9A A;  4JGP A;  3UE3 A;  1OTD A;  4KQO A;  4YWZ A;  1S4R A;  3PYP A;  4I3I A;  1TS0 A;  3LIA A;  3MMH A;  3LR5 A;  1YSQ A;  2V0U A;  5DKK A;  3SW1 A;  2A2L A;  2IA2 A;  4PHT A;  1XJ4 A;  2GJ3 A;  4LPZ A;  5I5L A;  1DRM A;  2P04 A;  4LRY C;  3MQ0 A;  4HQA A;  4BBT A;  3E4P A;  5J7E A;  3JVU A;  2PYR A;  3IS2 B;  1GSW A;  4P6Z S;  2VV7 A;  4HH3 A;  3CI6 A;  2ZOH A;  3P7N A;  3LR4 A;  2PD7 A;  2W3E A;  3UB7 A;  2V1A A;  3T4J A;  3KSI A;  5DF9 A;  4EEP A;  3BJN A;  4WUJ A;  5HWV A;  3T4T A;  3CIT A;  3B33 A;  4HP4 A;  3KX0 X;  1TD5 A;  2XRO A;  1G28 A;  1TS8 A;  4DJ2 A;  1OTE A;  1UGU A;  4MN5 A;  4Y3I A;  5G4Z A;  1OJG A;  5AVF A;  4GJ4 A;  4HP9 A;  3BW6 A;  3MFX A;  2NUT C;  2CMN A;  1S67 L;  4BBU A;  3OCN A;  1KOU A;  4I38 A;  4GW9 A;  3OBF A;  2HV1 A;  2KLI A;  2YKF A;  3GDI A;  4IUK A;  2LB9 A;  3KO6 A;  3S7O A;  2ZOI A;  2WKR A;  3LI9 A;  4O0P A;  1STZ A;  3FPV A;  4EEU A;  2KOI A;  2Y8H A;  5AJG A;  3IBJ A;  4FOF A;  2PHY A;  4MN6 A;  4R70 A;  1W63 M;  5KSH A;  2W27 A;  4EER A;  3MQQ A;  2ZMV A;  4IHQ A;  1TS6 A;  5HPF A;  1DP9 A;  4WEJ A;  1MZU A;  4O8G A;  1XJ6 A;  5J4E A;  4O01 A;  3F1N A;  3CUE A;  2ZBB A;  2JHE A;  2FH5 A;  3BWL A;  1YSP A;  2M7U A;  3CLO A;  4Q0J A;  3MJQ A;  3T4K A;  3UME A;  4L9F A;  2H28 A;  1OJ5 A;  2O99 A;  5AVE A;  1TF1 A;  2P7J A;  4IUH A;  3JVV A;  3A0R A;  2V0W A;  4ETX A;  3EEH A;  1YAX A;  3LR3 A;  1MKM A;  3P01 A;  4II7 A;  1S66 L;  4BJP A;  5DJT A;  3V67 A;  1BYW A;  5F69 A;  2GX5 A;  2L0W A;  2Z6D A;  4R38 A;  5KIZ A;  2HGV A;  3ICY A;  4OOL A;  3CWF A;  4CLC A;  2W0N A;  3E4O A;  3LID A;  4XT2 A;  1OTA A;  5HDC A;  3TE8 A;  4R6L A;  4IJG A;  3K2N A;  3LI8 A;  2XA7 S;  4Y2F A;  2QKP A;  3K3C A;  1NWZ A;  2EA9 A;  4YNR A;  3C38 A;  3MQO A;  1S1Z A;  3NOP C;  4I39 A;  3MXQ A;  3U2A A;  2W1R A;  3F1N B;  4GLQ A;  2PR5 A;  2OWJ A;  3LYX A;  4WF0 A;  3OOV A;  3GEC A;  2W3D A;  4UQI S;  3CUE C;  2L4R A;  4GS9 B;  4H6J A;  5HDS A;  1GSV A;  2FZ0 A;  3S7Q A;  3DBA A;  2QWS A;  5J3W A;  4NEE D;  2O0Y A;  1F98 A;  3B42 A;  2VGL S;  4CQH A;  2W3G A;  1D7E A;  4JGR A;  3F1P A;  3FC7 A;  2KX6 A;  4AFI A;  4L9E A;  1OPX A;  2V1B A;  3T4O A;  5DFY A;  1DP8 A;  2K31 A;  1IOU A;  3C30 A;  4CLC B;  4LRZ E;  2OAP 1;  4OOM A;  3A0V A;  3LFV A;  2VV8 A;  2G7U A;  3RH8 B;  1GSX A;  1XFN A;  4XT2 B;  2I9V A;  3BY9 A;  4HH2 A;  3G6O A;  4HHD A;  4LRX C;  2Y79 A;  1Y28 A;  1WA9 A;  3HCY A;  3RTY A;  5TBM A;  2P08 A;  2D01 A;  3OCL A;  2VV6 A;  2OAQ 1;  4NXB A;  3LR0 A;  3LUQ A;  3A0S A;  1NRJ A;  2K2N A;  3ZQ5 A;  2JKT M;  2WKP A;  5HWT A;  4HNB A;  2GNX A;  2VJW A;  4H6J B;  3PXP A;  4P6Z M;  5F6A A;  3VOL A;  3F1O A;  4HI4 A;  4QPR A;  3RFB A;  2PD8 A;  4L0L A;  3PBT A;  3PBR A;  1S4S A;  5G4Y A;  4BWI A;  2JKT I;  4Q0I A;  1OT9 A;  3UB9 A;  4L9G A;  4GS9 A;  3T4S A;  3PHY A;  1V9Y A;  4WN5 A;  2R78 A;  2GZA A;  3F1P B;  4CLC E;  2NUP C;  3MR0 A;  2O9A A;  3TJZ C;  3LIE A;  4PKY A;  1T1A A;  4RQ9 A;  5F5Y A;  3PBN A;  4Y5F A;  5K5B A;  2VA0 A;  3H82 A;  1YKD A;  1N9N A;  3H9W A;  2B02 A;  4MMN A;  2KDK A;  1T18 A;  3EQU A;  5FL3 A;  4KUO A;  2PT7 A;  2A24 A;  3ULF A;  3H7W A;  2O9B A;  1X0O A;  1XFQ A;  1JNU A;  2W3F A;  3OC2 A;  4NKP A;  4ARZ A;  3KYZ A;  4EU0 A;  4G3W A;  3VE4 A;  2D02 A;  1LSW A;  2W3H A;  3LIF A;  5CX7 A;  3HJI A;  3D3O A;  1MC0 A;  5TBM B;  4EQ1 A;  4MDZ A;  3LIB A;  3KSG A;  4BMW A;  4JGQ A;  1LSX A;  4HJ3 A;  3R7W A;  1N9O A;  3S7P A;  2JKR I;  3UMD A;  2M1C A;  3PBS A;  2BAS A;  3S7N A;  2O9C A;  3FPW A;  3T50 A;  2PDR A;  4K08 A;  2L1M A;  2J80 A;  1XJ3 A;  3KYQ A;  1ZTU A;  1UWN X;  5HWW A;  3F1O B;  1F9I A;  1NLY A;  3KSF A;  4ME4 A;  1D06 A;  2VKS A;  3BY8 A;  3TRC A;  3PBO A;  1F5M A;  2MJ6 A;  2HJ9 C;  2QJ5 A;  2WKQ A;  1VB6 A;  4MN7 A;  4WL9 A;  1S1Y A;  3NHQ A;  3O5Y A;  3EGX C;  5DKL A;  5C5K A;  4G3K A;  3VV4 A;  4MCW A;  4NXE A;  4B9O A;  2XSS A;  2VZW A;  3BQ8 A;  4G3V A;  4F3L A;  5LBR A;  4HJ4 A;  3H82 B;  4YOF A;  1G6O A;  4I3A A;  1UWP X;  5DJU A;  2J3W A;  3NJA A;  2ZMF A;  2QJ7 A;  4EW7 A;  2A24 B;  3H7W B;  1DP6 A;  4KUK A;  4WLA A;  1IFQ A;  4KQD A;  4ARZ B;  2HJE A;  4Z1W A;  1T1C A;  4E04 A;  1ODV A;  1TS7 A;  5HPI A;  4HJ6 A;  3EGD C;  4GHI A;  4I5S A;  1T19 A;  1NLZ A;  2EWW A;  4CLC C;  2XA7 M;  3R7W B;  1P97 A;  1LSV A;  3UB8 A;  3C8C A;  2HF6 A;  3PBQ A;  2VLG A;  5HD5 A;  2VEA A;  4NXF A;  3TW8 A;  1OTI A;  1LT0 A;  1LL8 A;  4UEY A;  4LLO B;  2INW A;  2Z6C A;  4FSF A;  2OOL A;  3R4K A;  3EWK A;  5HL6 A;  4UQI M;  5HDD A;  4R3A A;  4ETZ A;  3OLO A;  1OT6 A;  4WEK A;  5HZH A;  4WEL A;  1N9L A;  4Q0H A;  2M7V A;  3E0Y A;  4DMZ A;  2W1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...