2D0AA

Crystal structure of bst-rnase hiii
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
308
Chain Sequence
SNYVIQADQQLLDALRAHYEGALSDRLPAGALFAVKRPDVVITAYRSGKVLFQGKAAEQEAAKWISGASASNETADHQPSALAAHQLGSLSAIGSDEVGTGDYFGPIVVAAAYVDRPHIAKIAALGVKDSKQLNDEAIKRIAPAIMETVPHAVTVLDNPQYNRWQRSGMPQTKMKALLHNRTLVKLVDAIAPAEPEAIIIDEFLKRDSYFRYLSDEDRIIRERVHCLPKAESVHVSVAAASIIARYVFLEEMEQLSRAVGLLLPKGAGAIVDEAAARIIRARGEEMLETCAKLHFANTKKALAIAKRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribonuclease HIII
publication title Crystal structure and structure-based mutational analyses of RNase HIII from Bacillus stearothermophilus: a new type 2 RNase H with TBP-like substrate-binding domain at the N terminus
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 100
structure length 308
sequence length 308
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
A PF11858 DUF3378 Domain of unknown function (DUF3378)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2d0aA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2d0aA02
3LAMA 3AVHA 1RBUA 4CJLA 2HHWA 3ZSQA 3SCXA 4W5QA 2ITGA 2Y1JA 3ZT0A 3O3GA 4DF8A 3AVAA 4DS4A 4Z0UA 3EZ5A 4PWDA 3OCIA 4I9LA 4IG3A 3TAMA 3SPYA 4B9MA 1KFDA 2OZSA 1WSFA 2FBVA 4MQ3A 3OC3C 4AHRA 1TL1A 3AO2A 4CGDA 3NH2A 3QETA 3NF8A 3DYAA 1IO2A 3O4QA 3HXMA 2A1RA 3VQ4A 3ZCMA 2RN2A 4KB1A 1LW0A 4CFDA 4FJ7A 3LP0A 4Z4GA 3VQAA 3M8QA 1ZBLA 4W5NA 1JLQA 4E0DA 1JLCA 4CJRA 4RG8A 1QSSA 2GBZA 3K5MA 2QKBA 4LY7A 4CHQA 5IYBP 3O3HA 3LZIA 1SL1A 4Q0BA 3TABA 4IBNA 4N47A 3I8DA 4CHOA 3KD1E 1ZBHA 1QNCA 3MXIA 2P51A 3U6FA 4FJHA 3OYJA 4CIGA 4JS5A 4F3TA 2NUBA 4DQIA 1HNIA 3WNFA 1XI1A 3AVIA 5CZ1A 1WN7A 2XHBA 4KHQA 1VSFA 3B6PA 3SUNA 1QN7A 1WSEA 1VTLE 3NE6A 4OLAA 3RMCA 3AA5X 3VQ8A 3S3OA 4FJLA 2HNYA 3G0ZA 1RTIA 4CFBA 4CEZA 1EKEA 3OS1A 3CM6A 2Z1JA 3NDKA 2ZE2A 4O0JA 4OPKA 3M8SA 1NJXA 2IV9A 2G8VA 3OYKA 3T3FA 3AVJA 4OKKA 1JLBA 3K2PA 3I0RA 4GVMA 1KVBA 1NOZA 4TSXA 3PV8A 1B9FA 3ZT4A 4JS4A 5HBMA 1QN8A 3DLRA 3LWMA 1KVCA 2B5JA 4FW2A 4CJTA 1UOCA 1YTAA 1A5VA 4KTZA 4Z4CA 3HT3A 4HTUA 4B8CA 3SQ0A 2P5GA 3KD5E 1VOKA 1TBPA 1Z25A 2DY4A 3AO4A 4O4GA 5I42A 3DLHA 3OYAA 1RT3A 1VK0A 2O4GA 1J53A 1S1WA 1KYUA 5J2MA 3V1RA 2XO7A 4OKJA 4AILC 2Z1IA 3SYZA 1S1TA 3DRPA 2RPIA 4NCGA 3OYNA 2QK9A 4ZHRA 1R0AA 1QTPA 2ZD1A 3KLIA 4LSNA 3RR7A 4KI4A 1FK9A 2F8TA 4OGEA 4RW9A 3RRGA 1NK7A 4C8LA 3JYTA 2YNFA 1IKWA 3LP1A 3ZSZA 4IDKA 3NBPA 1C1BA 1SKSA 4DTMA 3TI0A 2PYLA 4FZYA 3V9UA 4HUFA 3ALYA 4KV8A 5JS2A 2XY5A 2XRIA 2YHAA 3S3MA 2G8HA 4BDPA 4M3TA 1JKHA 1U48A 1RT6A 5HROA 1L3VA 2BDPA 4PUOA 3QINA 4CE9A 2VG5A 4DTPA 3K5NA 2HHVA 2EX3A 2YNIA 3VQCA 1QNEA 4CGIA 1X9MA 3OYHA 3PX0A 3DOKA 3M8PA 1KYDA 3SJJA 3EIKA 4DSJA 5KGWA 1E42A 1VSIA 4JRPA 1VOLB 2W42A 4HHTA 5I3UA 1TK5A 1TK8A 3E01A 3C6UA 3DI6A 4FLWA 3TAFA 2OPSA 3VA0A 5KRSA 2XY6A 3DMJA 1NKBA 4CHNA 5J1EA 1Q9YA 2QKKA 1RDCA 1TGHA 4Z4FA 3MECA 3ZSWA 4CHPA 1S1UA 2OPPA 1WLJA 4Y1DA 1TKZA 4PY5A 4B9SA 2FC0A 3AO5A 2DFHA 4BDZA 1RCHA 4HCBA 4OPJA 3AVMA 3D45A 1HJRA 1HQEA 1S1XA 2PY5A 3NF7A 3LPUA 1WNSA 3HS9A 3P83D 4CJUA 4FCYA 1D3UA 4OJRA 1C0MA 1NJYA 4AHVA 1RM1A 4CJ4A 4CJ5A 2FBYA 1BCOA 5IYDP 5FRNA 5DMRA 4J2AA 4CJFA 1KFSA 2F8SA 1BIZA 1RDBA 1YT3A 4FXDA 2Z8UA 4OLBA 2GV9A 4DTXA 3F73A 4FJKA 2YNGA 3V6DA 4C8MA 3AO3A 2G8UA 1IKXA 1J5OA 1S6PA 1LW2A 2FBXA 4K8ZA 3DLBA 4AH9A 5KI6A 4CEEA 4B9LA 4PA1A 2ZQBA 1EX4A 1X9WA 4I2PA 5FDLA 2IGIA 3PX4A 5E41A 2G8FA 5EU7A 1ASUA 4O0IA 4CF2A 3VN5A 1NK5A 4CIEA 4C8NA 3HP6A 4FLUA 4E7HA 4DTNA 1KRPA 3NH1A 3AO1A 1X9SA 1BIUA 3ISNC 1HPZA 3QIOA 4G1QA 1N6QA 2DTUA 1WAFA 4LH5A 2IDOA 3VQ9A 4W5TA 3TARA 1JFIC 1A5XA 1GOBA 3OYBA 1KVAA 3L2VA 1WAJA 3QEXA 1B9DA 2HHSA 4EZ6A 1MP9A 2JLEA 3VQDA 1NH2A 3KTQA 4K8XA 2KTQA 4DWIA 4H4OA 2KFZA 1XHZA 2G8KA 1EETA 4KHSA 5K14A 2AJQA 1W0HA 2B4JA 3V9XA 1ZYQA 4B08A 1QS4A 4BACA 1BQNA 3H08A 1VSJA 4ICLA 3DLGA 4CGJA 4DQRA 5D3GA 4F8RA 1Y97A 4DU4A 4R5PA 4RW6A 4CF0A 1VSKA 4BWJA 3S3NA 3NFAA 2G8IA 3AA4A 2BE2A 3OYMA 4DFMA 1MU2A 1U04A 2P1JA 4CEQA 4IKFA 4M42A 2EHGA 4FVMA 1JXEA 4O55A 4E7JA 1DLOA 3D0PA 1YVUA 1TKDA 2IAJA 2BANA 3NGZA 1T7PA 1Z26A 3OYIA 5CZ2A 1S9EA 3TAGA 2WOMA 2HHQA 1D5AA 3ITHA 1AISA 3NH0A 3KKSA 4CEOA 1JLAA 4FLXA 3DOLA 3DRRA 3DRSA 4CF9A 4DTOA 4DFJA 3SV3A 3V9ZA 2HB5A 3SPZA 1JL1A 1GOCA 4CK3A 5FROA 1KTQA 1TGOA 2IS3A 4DTSA 3RTVA 3SUOA 2HW3A 1QN6A 4Y1CA 4W5OA 3V4IA 4KO0A 4E1MA 4DSIA 1TL3A 1D9FA 1BISA 1QN9A 1VSLA 1IH7A 1C1CA 3QIPA 4KAZA 3AVCA 1VSDA 3NGYA 4E1NA 3V9SA 3DLEA 1LWFA 4BE2A 1TKTA 5C24A 1RDDA 1RTDA 3K57A 3IG1A 4Z4EA 2IOCA 1XHXA 5CY4A 4CEFA 3ULDA 2E6MA 1CLQA 1N5YA 1KCFA 4DTJA 4CIFA 1YTUA 3M8RA 3QEPA 3AA2A 1TV6A 2MJ7A 2VG6A 4CCHA 3MEGA 1LWEA 5FRMA 1VSHA 3HS8A 1RILA 4E89A 3RR8A 3V1QA 1TAUA 5J2PA 4BDYA 5T7BA 1RBRA 3OY9A 4JRQA 4KHUA 1RBTA 2HHTA 3QESA 4AHUA 4I9QA 3LZJA 1LAWA 1RNHA 3SQ2A 1T8EA 1NVPA 1SV5A 4FJNA 3CYMA 3K5LA 2D0BA 4E7KA 1KLNA 4KTWA 5HRPA 2HMIA 1L5UA 1A5WA 3AV9A 3SUQA 3VA3A 4LH4A 2R7YA 3S9HA 1NJZA 1D8YA 3LPTA 2KZZA 1WSHA 3LP2A 4DSKA 2OYQA 1KY6A 3ASMA 4CEDA 1NJWA 1D9DA 1UAXA 3U3YA 4ELTA 3HJFA 4CGHA 1CZ9A 1CXUA 3NCIA 1NKEA 1NOYA 4RW4A 1FKPA 4CFCA 2DFFA 3AVLA 1QHTA 3CFOA 4B9TA 4KHWA 3HPOA 4FLZA 3HPGA 1QN4A 4LD0A 3HVTA 1JLFA 1VRUA 3LAKA 4DU1A 4KRFA 4N76A 1RBVA 2Z1GA 3C94A 1T03A 4E7LA 1QTMA 3EY1A 5JS1A 1ASVA 1PZDA 4F2SA 1W80A 2HVIA 4ID1A 5HRNA 1S1VA 4DTRA 3NF9A 4ELVA 4KREA 1L3UA 2E4LA 1NK9A 1SL0A 3IS9A 1Q9XA 5HRSA 4C8OA 3LALA 4RW7A 4Z4HA 4IFVA 1SKWA 3PY8A 4GW6A 3AA3A 1BI4A 3HYFA 3VQ5A 1NK4A 4FJGA 4FJIA 1ITGA 2YKNA 4WZSD 3PX6A 2YHBA 2Y1IA 4M45A 4UQGA 2G30A 5HP1A 3HSTB 4B0AA 1GOAA 3KK1A 1HNVA 3BGRA 4KHNA 1YTFA 3SQ1A 2E6LA 3MAQA 2KZMA 4N41A 2IV8A 4BWMA 4F4KA 4KB0A 4NYFA 4HCCA 1RT5A 1XC9A 1S5JA 1U45A 4M3YA 3V1OA 3CG7A 3ZT3A 2HNZA 1RT1A 4M3WA 4DG1A 4DSFA 3K58A 5CYQA 1C0TA 1BQMA 1O1WA 3ZSYA 4KI6A 1QNAA 1HQUA 1RTHA 5KTQA 1UWBA 5J2NA 3TAEA 3IAYA 1IKVA 3SV4A 1QSLA 4FJ8A 3LDSA 3CFPA 2OZMA 1F21A 3U3GA 4BE0A 3QLHA 3QEVA 1NKCA 3AVNA 1L3SA 2HVHA 1B9KA 3L3VA 3PUFA 1U4BA 1SKRA 3KJVA 4HVJA 4CJEA 1CXQA 4DF4A 1BGXT 5IYCP 1G15A 1TVRA 1QNBA 3O4NA 4FJJA 2RKIA 3OYLA 4CJ3A 2D0AA 3KLGA 3NHGA 1K6YA 2DFEA 2B6AA 1S6QA 2OA8A 4CF1A 4O5BA 3FFIA 5SWMA 1LAVA 4RODB 1X1PA 3RMBA 3DLKA 3KK3A 1B92A 4FJ9A 1PCZA 2ATQA 3RWUA 4CECA 1KY7A 4CGGA 2P5OA 4FYDA 4M3ZA 2LSNA 3H1ZA 1NK6A 4FK4A 1R4XA 1C6VA 1RBSA 3OS2A 3L2UA 4CEAA 1NK8A 4AHSA 5SZTA 4RW8A 3L2RA 4GMJB 2QXFA 2XY7A 3KKRA 1I39A 1BHLA 3KIOA 3T1AA 1J9AA 4DFKA 2YKMA 4L8RB 4ELUA 1YTBA 4AHTA 4WE1A 1HRHA 1LWCA 3IRXA 4CJPA 4FJ5A 1ZBIA 1IG9A 3TWHA 4QOZB 2A1SA 3AVBA 4OGCA 3ZSOA 3OJSA 1WSIA 1IKYA 3B6OA 2XY8A 3C95A 2IC3A 3NGIA 5HRRA 1CDWA 1WSJA 3K59A 3CQ8A 1BI4B 1TAQA 4E7IA 1TKXA 3RMDA 3PO5A 2G8WA 1RT7A 4JLHA 3VQ7A 4KFBA 2KFNA 2YV0X 3ZT1A 1EXQA 1HMVA 3WNGA 1HYSA 2BGGA 2KW4A 3OYDA 4Z4IA 4CK2A 3WNHA 3EYZA 2JGUA 3TANA 2X6SA 1FKOA 2PYJA 1U47A 4OVLA 4B9UA 5DK5A 4CJVA 4M3UA 1JLEA 2VWKA 3A2FA 4CGFA 2VJ0A 3NAEA 3L8BA 5J2QA 3MXMA 4M3XA 1EP4A 1JXBA 1RT4A 3ZSXA 3AVKA 4FM2A 3SUPA 3KLHA 4EZ9A 1QE1A 2OPQA 3TAQA 1QN5A 4YFUA 4N56A 3L2WA 3TR8A 4FK0A 3K5OA 3ZSRA 4Q5VA 2GUIA 4E3SA 1L3TA 2D5RA 3HP9A 4KKOA 4KHYA 3L2QA 3P1GA 4QAGA 1TBAB 2KQ2A 4XIUA 1SUQA 4N5SA 4FW1A 4M3RA 1REVA 3SZ2A 2X74A 4NYNA 4HUGA 1NK0A 1QQCA 1QTSA 4B3OA 3LP3A 5C25A 2ETJA 1DTQA 2VG7A 4DMNA 1J54A 3I0SA 3DM2A 4FLTA 2OPRA 1CZBA 4C8KA 4KPYA 1RT2A 4NCAA 3ZSVA 1VTOA 3HPHA 4I7FA 3MEEA 3MXJA 4CJQA 3AVGA 1BL3A 3L3UA 4DSLA 2HHUA 1BCMA 3F9KA 4J2EA 3WNEA 1KSPA 4OKEA 3OYCA 3UIQA 2WONA 4B9VA 4DQPA 1ZBFA 3QNOA 1VSEA 1FXXA 4CHYA 3HL8A 3G10A 4M41A 4ZTJA 5CYMA 4CFAA 2HNDA 5KRTA 4DTUA 1T05A 3KLEA 3PO4A 4LSLA 3SI6A 4J2DA 3AVFA 4QCLA 1RDAA 1I3AA 1JL2A 1S9GA 4CEBA 1Q8IA 2F96A 4IFYA 4EP4A 3VQ6A 1JLGA 4CK1A 3NF6A 4W5RA 3OJUA 1KYFA 1KLMA 3THVA 1U49A 1QSYA 4NCBA 1LV5A 3ZT2A 4FZXC 2X6NA 4YNQA 2FBTA 1HYVA 4J2BA 3OVNA 4DQSA 4CERA 3TAPA 4B9NA 4FM0A 1HYZA 4DFPA 4F2RA 3QNNA 4H4MA 3O3FA 1WSGA 4DLGA 3LANA 1VSMA 3HM9A 1C9BB 3C6TA 4H8KA 3T19A 3QEWA 1NGMA 1QN3A 3OYGA 1ZBUA 1UA1A 4DLEA 2O4IA 5C42A 3SQ4A 4FZZA 4ROEB 1C1AA 3CFRA 3HO1A 2PZSA 1DTTA 3OS0A 3SNNA 3JSMA 1VRTA 5KGXA 3V81A 3RRHA 3RMAA 4PQUA 2Z1HA 4CESA 4CJSA 4DS5A 1ASWA 3OYEA 3VQQA 3KK2A 4CJKA 3HVRA 3LWLA 2X78A 3VQBA 4EP5A 3HK2A 1RTJA 3QEIA 4E19A 4FLYA 4ZTFA 2Q3SA 1TK0A 3P5JA 3CM5A 4ROCB 1W9HA 4BE1A 1SL2A 4CJWA 5HLFA 4FJMA 4B8AB 3QERA 3MEDA 1XWLA 3QO9A 2D0CA 4CF8A 3V9WA 4I2QA 1UA0A 3OYFA 4FM1A 1C0UA 2HHXA 2YNHA 3VQPA 4KTQA 4O44A 2RF2A 4FK2A 4AHCA 2VWJA 4IG0A 3BDPA 4FJXA 4MFBA 4DU3A 4F3OA 4CHZA 4HUEA 4DQQA 4FLVA 2I5JA 4ID5A 3VQEA 3KLFA 4DSEA
chains in the Genus database with same CATH superfamily
1I94K 1YXQA 4A62A 5JLFA 3ZSQA 4CZFA 1OH7A 4RTFD 4DV6K 3AVAA 4I9LA 2JWKA 3LL3A 4Y0WA 5AQQA 3SPYA 2OZSA 4JD2B 4ELTA 3OC3C 3QETA 5LMNK 3LDNA 3I8BA 2A1RA 1C4GA 1N3AA 3LP0A 4Z4GA 3M8QA 1ZBLA 4PHTX 4E0DA 4EAJA 3D2EB 3O3HA 3I33A 4JNEA 4N47A 3I8DA 4YOVA 3HI0A 3U6FA 4FJHA 4IEEA 2OCEA 1HNIA 5KPZA 1NGAA 3VPZA 1UL7A 1N8RO 5ADXH 3RMCA 4EALA 1VQ4N 2HNYA 1RTIA 3I55N 4O0JA 2IV9A 4Q11A 4H5VA 4JK7A 3OYKA 3T3FA 3M5RA 1JLBA 3K9JA 4MRQA 5AQYA 3UKRA 1KVBA 5JN5A 4TSXA 1B9FA 1J3MA 3DLRA 3LWMA 4FW2A 3M6GA 4Z4CA 3HT3A 4B8CA 1VOKA 3AO4A 3DLHA 3J7AP 3RVCA 2O4GA 1KYUA 2XO7A 4OKJA 4AILC 3DRPA 2HBMA 4NCGA 1T3VA 1FW6A 2QK9A 1VQNN 1R0AA 3KLIA 4I8OA 4LSNA 3RR7A 4X66K 1FK9A 4KI4A 3RRGA 1IBMK 5AQXA 2YNFA 4D7RA 3NBPA 3P39A 1C1BA 1TUOA 3TI0A 4FOEA 4HUFA 4H0OA 3SMSA 4CI6A 4QS9A 2W40A 4B3RK 1YI2N 3A5NC 3QINA 3PDKA 3VQCA 3QFPA 4HHTA 3EE9A 2Y8LA 2XY6A 4H5NA 1RDCA 4ILHA 4XH5A 4ILGB 1S1UA 2KLAA 3EZWA 4B9SA 2EWSA 3AO5A 1GLAG 2FC0A 4IDHA 1LOTB 4NXNK 4OPJA 1HKGA 1OH6A 1HQEA 1BO5O 1XQSC 3LPUA 4BRKA 1VQ9N 3P83D 4OJRA 1NJYA 1C0MA 2UU9K 5GIPA 1RM1A 4J2AA 2F8SA 1HNXK 1RDBA 1YT3A 4JHDB 1NNEA 2Z8UA 3H1VX 2NRRA 1ILYA 2YNGA 3V6DA 2HL8A 3AO3A 3BP8A 1J5OA 1S6PA 4PKGA 3DLBA 5JMVA 4ILJA 1E4GT 2ZQBA 3LM9A 5AZJA 3I0WA 1ASUA 2ZM6K 3VN5A 2D4WA 4C8NA 4E7HA 4DTNA 1KRPA 1BIUA 2Z0FA 4FWKA 4LH5A 1GLDG 4K0KK 1GOBA 2HHSA 3L2VA 3QEXA 3OA9A 2KTQA 3KTQA 5AQSA 4EJYA 3TE5A 4HTLA 3FE1A 1W0HA 1FN7A 1ZYQA 4EAIA 1BQNA 1VSJA 2ZJRL 3OH9A 3UB5A 2OTLN 5AQFA 4JK8A 4CF0A 2HZSA 1VSKA 3KK7A 4DQ8A 2O8FB 4V19S 4M42A 1ESVA 3OYIA 1S9EA 3TAGA 2WOMA 4A61A 3HTVA 3ITHA 5EPCA 3WXLA 2P9PA 3VF4A 3SV3A 3V9ZA 4CBXA 1GOCA 5FROA 1KTQA 3C04A 2IS3A 3RTVA 1QN6A 5C2DA 3V4IA 4BGAA 1D9FA 4BRPA 4E1NA 3K57A 5M1OA 3IG1A 3A5MC 4Z4EA 5CY4A 3QBXA 2P9LB 4PKIA 2E6MA 1CLQA 3UE5A 1KFQA 3QEPA 1YQMA 2NRHA 5FRMA 3CQXA 2QREA 2QXLA 4JRQA 3OY9A 3ULEA 2OTJN 2ZF5O 4B1XB 3WXIA 4F9OA 3ENOC 2WUSA 1RNHA 4EHUA 1T8EA 3LDPA 2D0BA 4JKBA 4KTWA 5HRPA 3TPQA 3SUQA 3GOIA 4LH4A 1D8YA 1BA1A 5E26A 4DSKA 1KY6A 3AY9A 3U3YA 4GNIA 4B1UB 2O3OA 2ASPA 1CZ9A 4IXCA 3NCIA 5DM7L 2AA4A 3EAYA 2DFFA 1QHTA 2RHKA 3CFOA 3FZKA 3HPGA 4KRFA 5I9EB 1DGKN 3C94A 1T03A 1ASVA 1W80A 1K35A 4ID1A 4DTRA 4BRFA 4KREA 1HR0K 4C8OA 4GKKK 4LF5K 3PY8A 3VQ5A 3AA3A 3HYFA 5EOYA 1K2YX 4B0AA 1NGCA 2PWWA 2QR1A 3TSPA 2E6LA 3MAQA 4BWMA 3THWB 2HBLA 1T6AA 1RT5A 1XC9A 1S5JA 2UYTA 2HNZA 2P9SB 2QWQA 1R59O 5LY3A 3ATUA 4M3WA 3B8AX 1O1WA 3ZSYA 1HQUA 1X3NA 2I7NA 1BG3A 1XUPO 3TAEA 4C1NK 1F21A 2HVHA 3CWUA 1SKRA 3BUZB 3KJVA 4HVJA 1G15A 1TVRA 3MDQA 1IG8A 1VKLA 4CJ3A 1DIZA 1NGEA 5BPLA 2BH1A 1DEJA 1X1PA 4BRCA 2I7PA 1PCZA 2P5OA 4WQ5C 3ENOA 1E3MA 3H1ZA 1C6VA 1QQNA 1RBSA 4I6MB 4BG8A 4RW8A 4GMJB 4K42A 4C1NI 1YIJN 3NVMA 2HF4A 1J9AA 3T1AA 4DFKA 3U8XA 4ELUA 4GVEA 2FSJA 4AHTA 4WE1A 2F4VK 3TWHA 4OGCA 2P9NB 4BRMA 1IKYA 3NGIA 2IC3A 4M63C 5GINA 3MWTA 4WFNL 3RMDA 3E9PA 4PL7A 3UKUB 3CCMN 3VQ7A 2WFBA 1RFQA 2YV0X 4C7PA 3ZT1A 5E84A 1W7AA 3OYDA 2W6KA 2JGUA 4WXAA 2X6SA 1FKOA 4B1ZA 1HX1A 3H45C 2E1ZA 3CCVN 2O8EA 3A2FA 2QA4N 4M7YA 3NAEA 3L8BA 1NM1A 1RT4A 5AZJB 3ZSXA 3AVKA 4FM2A 3SUPA 3KLHA 1KAYA 4JKFA 3CC7N 4EZ9A 1KC8O 3IMXA 3BZCA 3K5OA 4B3SK 3AAPA 4E3SA 2Q36A 2WC9A 1L3TA 5TKYA 4KKOA 3L2QA 3P1GA 1SUQA 3SZ2A 4M3RA 4DV2K 2GELA 3CJ9A 4O5FA 3MN5A 3F10A 2YHYA 2VCPA 1DTQA 2VG7A 4HWIA 1VQMN 1EO1A 1ZC6A 1VTOA 1OH5A 3MEEA 1T6CA 3MXJA 4DSLA 3AVGA 2HHUA 5BN8A 3GG4A 4OKEA 3UIQA 4B9VA 1M3HA 3QNOA 2HNDA 5KRTA 3VETA 5BR9A 3KLEA 4WQ5A 3PO4A 4NXMK 1JL2A 1S9GA 3A5OC 3CJCA 3OJUA 1JLGA 1QSYA 3NF6A 2HW3A 3ZT2A 4YNQA 3J80O 4FSVA 4BRQA 2NOBA 2Q0RA 4DFPA 1E4FT 1ZXOA 3O3FA 4DLGA 3VEZA 4NB4A 3D2EA 2GX9A 2E88A 1C9BB 2HBJA 4DUZK 1NGMA 2IIRA 4DKWA 4YY3K 4H0XB 4DLEA 2UXDK 3VERA 3OSTA 3RMAA 5ADXA 4KH6A 2QWLA 3CVSA 5H1SQ 3HVRA 3LWLA 1H1VA 3C65A 3VQBA 1RTJA 4E19A 4FLYA 3P5JA 2A5XA 4BE1A 1V4TA 5HLFA 1XWLA 4DR4K 2D0CA 4CD3A 2HSTA 4IG0A 3BDPA 3FR0A 2IVPA 4CHZA 1NMDA 4FLVA 3A8YA 2I5JA 3VQEA 3MCAB 1V5SA 1M3QA 1ZBSA 4A2BA 4JI0K 2HHWA 3SCXA 4W5QA 3KZBA 3SNSA 2Y1JA 3ZT0A 4DF8A 4PWDA 2ZWHA 2HKPA 2DKAA 3RPJA 1KFDA 2FBVA 5GAGP 4AHRA 1TL1A 3AO2A 4ISEA 3CVTA 4EJZA 3U9ZA 3BKQX 3HXMA 1YJWN 1OVQA 3VOVA 2RN2A 4BY9C 5AQGA 1HU0A 3P38A 4JKEA 4DR1K 4W5NA 4IZ9A 4H5TA 3UW2A 3CJ1A 4RG8A 1SS6A 2GBZA 4FVUA 1RDUA 5EX5A 4LY7A 2QKBA 2ZFDB 3TABA 4AM6A 3KWIA 3MXIA 2EHBD 4JS5A 1KFIA 1V4SA 4DQIA 3WNFA 3BF1A 2XHBA 4KHQA 4UY8O 1VSFA 3B6PA 3NE6A 4OLAA 3S3OA 4CZGA 4CEZA 3OS1A 2Z1JA 2GUPA 4OPKA 3BY5A 3I0RA 2E2QA 2UXBK 4GVMA 1NOZA 3FZLA 5C12A 1YTAA 4KTZA 3EEQA 2P5GA 3KD5E 3AGRA 2DY4A 4H03B 4O4GA 5I42A 1BOTO 3V1RA 3DLLL 1S1TA 5JLHA 2ZD1A 4RW9A 4C8LA 3LP1A 3GL1A 4IDKA 1P8ZA 4JKGB 4FZYA 2G8HA 3ALYA 3S3MA 5JS2A 2XRIA 3CCEN 3DXMA 5HROA 4BRIA 2VWBA 4PUOA 2EX3A 1QNEA 3K9KA 1KYDA 5I3UA 3ZX2A 4JRPA 1TK8A 2W42A 3E01A 3C6UA 3IKMA 3CCJN 3DI6A 5AQVA 2ZGZA 3E1YA 4CHNA 3CCQN 4X65K 3FZMA 1WLJA 4PY5A 4BDZA 5M1NA 2NRWA 2H3GX 2Q2RA 4U7BA 1S1XA 3O08A 4FCYA 4AM7A 4CJ4A 2FBYA 1OKJA 5FRNA 5DMRA 4LF8K 3THYB 2HHHK 2Q0UA 4FXDA 3FZHA 4OLBA 4DTXA 3R8EA 3SBGA 4FJKA 2G8UA 1IKXA 1NGFA 2HOEA 2P9LA 5BREA 4LC9B 4PA1A 1X9WA 4I2PA 1X9JA 3EKUA 2FSNA 4CIEA 3NH1A 1G99A 3AO1A 4BVOA 1HPZA 4W5TA 1U6ZA 3GBTA 1YQKA 1B9DA 3VGMA 1NH2A 4FOIA 4H4OA 1GLCG 1XHZA 4IJNA 5CHIA 4BACA 2LAEA 3H08A 1YUWA 4ICLA 5D3GA 3DLGA 4CGJA 4DQRA 3AAQA 4F8RA 3O8MA 3MN7A 3AA4A 2BE2A 5JICA 3OYMA 3J7ZO 3R1XA 3H3OB 4KH4A 4IKFA 1CZAN 4FVMA 4E7JA 1DLOA 3D0PA 1YVUA 1TKDA 2IAJA 2O8BA 3NGZA 1D5AA 3NH0A 2IVOA 4FLXA 5C15A 1JLAA 3K0SA 1TUYA 3F2KA 4CBUA 4WFBL 4W5OA 4JKDA 4JI5K 4E1MA 1TL3A 1BISA 3FZFA 3SAFA 2ZJPL 1IH7A 3MN9A 5JMVD 4KAZA 3DLEA 5GAHP 3WUHA 3THWA 5MLCQ 2IOCA 1XHXA 3A5LC 1K73O 4CEFA 5AQLA 1N5YA 4WQ4C 1YTUA 2P9SA 4BR2A 1NMNA 3G6EN 3MEGA 1LWEA 2QWMA 2ZJQL 4E89A 5A2QO 3V1QA 5FPEA 3T69A 3R3LA 3QESA 4I9QA 3LZJA 1HNWK 1SV5A 4FJNA 1N34K 4OX9K 4K25A 4EFHA 5AFUH 1KLNA 1C0GA 4FWRA 5LL6Z 1L5UA 3GDQA 4BROA 4FWNA 4FPBA 1UT7A 4BVPA 2R7YA 2KZZA 3LPTA 1HKBA 1WSHA 2HZMA 3HJFA 1NJWA 5KPTA 3H3NO 4EHTA 3QDKA 4CJ7A 4B9TA 5AQUA 1IBLK 4KHWA 4I6MA 5M1PA 4LD0A 1Q86O 2V8QA 2A42A 1RBVA 3O4WA 3HZ6A 1VQON 4MLEA 5BN9A 1QTMA 5JS1A 3VGKA 1N3CA 1S1VA 4ELVA 2OANA 1SL0A 1Q9XA 2P9NA 4A57A 3LALA 1SKWA 4GW6A 3VF6A 3PIPL 2WTUA 4K8ZA 2YKNA 2NNWA 3UKUA 2Y1IA 4M45A 2NRVA 2G30A 4UQGA 5HP1A 5KL0A 3CCLN 1GOAA 3BGRA 5IWAK 1YTFA 3SQ1A 2KZMA 2DPNA 1MPGA 4F4KA 4KB0A 3W0LA 4NYFA 3G4SN 4M3YA 3MWPA 2P9UB 3MMVA 1RT1A 4DG1A 4FPAA 1QZ5A 1RTHA 4GY2B 1NGIA 5J2NA 3ENHA 3KWGA 3SV4A 3KTUA 3LDSA 3CFPA 1NKCA 2DTUA 3QLHA 1B9KA 3LDQA 3ENBA 1BGXT 2KKZA 5IYCP 1QNBA 4FJJA 4LFCK 3NHGA 2D0AA 3DXMB 4IEIA 2B6AA 3O9RA 5SWMA 3KK3A 4TPSA 3AARA 2ATQA 3RWUA 1KY7A 2QM1A 3C6HA 4BREA 4FYDA 2NZTA 4M3ZA 4FK4A 1BA0A 1R4XA 2O8DA 3OS2A 3Q7CA 1NK8A 5SZTA 2AP1A 4BQZA 4BC4A 1I39A 3KIOA 1HRHA 3IRXA 4CJPA 4FJ5A 4QOZB 2A1SA 3ZSOA 3N4PA 4AF1A 1VQKN 3OJSA 3FFKB 5HRRA 3SJHA 1D4XA 5FPMA 2G8WA 5BRFA 1EWQA 4FWLA 2CH5A 3O6WA 3ZEUA 2FUVA 4R79A 4X62K 3TANA 2PYJA 4OVLA 5DK5A 4CJVA 2VWKA 4CGFA 3O5BA 4CZLA 4LFAK 4NLBA 4M7XA 3E9OA 4WF9L 2HMPA 3DXKB 4N56A 2YHWA 2GUIA 1WBDA 5KQ8A 2QTDA 3LDLA 4XIUA 3I0XA 3A0IX 4NYNA 1NK0A 1QQCA 1RGIA 3LP3A 2ETJA 4DV4K 1J54A 3DPUA 3DM2A 4FLTA 3FGUA 1RT2A 2E2NA 4KPYA 1RDWX 1T6DA 4I7FA 4CVNE 1BL3A 1ATNA 4DQPA 5HSHA 2O8BB 1VSEA 3IDHA 3EO3A 5CE3A 1PCMX 3VMFB 3SI6A 4J2DA 5AZIB 3DAWA 3VEOA 3OLPA 1RDAA 4BRDA 4QCLA 4W5RA 3VQ6A 4CK1A 2NLVA 2QLVA 3OBWA 1KYFA 1LV5A 4FZXC 2X6NA 4CERA 4WYBA 4B9NA 2D0OA 3AGKA 3QNNA 4CFFA 4H4MA 2JWLA 1WSGA 2MZ8A 3HM9A 4H8KA 3T19A 3CJ7A 3S41A 3DWLA 4FL9A 2JHNA 1ZBUA 3QFUA 3WEEB 1UA1A 2O4IA 3CWTA 1WJWA 3PMGA 3L0QA 1N33K 1DTTA 3OS0A 1JJ2M 3JSMA 1VRTA 3CJAA 3OYEA 3KK2A 2FGTA 4CJKA 3DPTA 4PL8A 5AQJA 3J81O 3L6QA 3SAGA 1LWVA 2PBDA 3CWSA 3O9QA 4A5BA 1TK0A 2Q3SA 3CM5A 1W9HA 4CZKA 4CJWA 4FJMA 4B8AB 3D7QA 3M3ZA 1KO9A 3VEXA 3TTDA 4KHPK 4MFBA 3CC2N 3RSEB 4DSEA 3LAMA 3AVHA 1NGGA 3SAHA 1RBUA 4CJLA 2O8CA 2A41A 1NG9A 3W3DA 2FKMX 4DS4A 3ZYYX 3OCIA 4IG3A 4B9MA 4JKGA 3NH2A 3CETA 4YOWA 1TYQB 3DYAA 2V9JA 1VQ8N 3VQ4A 3ZCMA 1LW0A 3EKSA 4CFDA 2E20A 3K5MA 3CCSN 5IYBP 3LZIA 4YOUA 4IBNA 3IUCA 4CHOA 1ZBHA 4F3TA 2BTFA 1YQLA 4DV5K 3P31A 3CW7A 1XI1A 3AVIA 5CZ1A 1WN7A 3CQYA 5C0YA 3T7ZA 1MDUB 3C7NA 2Q31A 3SUNA 3QMLA 1HPMA 3AA5X 3VQ8A 3G0ZA 4CFBA 2E1YA 1Z6RA 3CM6A 2ZE2A 3M8SA 2G8VA 1KXPA 3AVJA 4OKKA 3TTCA 3K2PA 1YQRA 1C47A 3THYA 3THXA 1W97L 1X3MA 1JDYA 3PV8A 3GE1A 3WXMB 5HBMA 1QN8A 2B5JA 4CJTA 1UOCA 2V52B 4YHHK 2OOYA 1TBPA 1VQLN 3H6EA 2UUBK 1VK0A 1J53A 5J2MA 2O8DB 5M1QA 3SYZA 2NLXA 2RPIA 3OYNA 4ZHRA 1QTPA 4HJHA 3E66A 1NLVA 3JYTA 2NVMA 2V7ZA 1SKSA 4DTMA 2PYLA 1ATSA 3V9UA 1HLUA 1UT4A 2XY5A 2CH6A 4M3TA 4BDPA 1JKHA 3T4NA 2BDPA 2V7YA 4E1JA 1PVSA 3F0ZA 4CE9A 2VG5A 4DTPA 3TU5A 3K5NA 1YHQN 2KFZA 3VTIA 3OYHA 3F9MA 4XH1A 3PX0A 3SJJA 4DSJA 5LMUK 3ZEUB 2VGMA 1VSIA 1VOLB 3N89A 3RSMA 4FLWA 3TAFA 2OPSA 2FF6A 3VA0A 2D0PA 1NKBA 3JXUA 2YI1A 2QKKA 1TGHA 4Z4FA 3VEWA 3ZSWA 4Y1DA 4LF6K 1WUAA 2A3ZA 2DFHA 1RCHA 2FF3B 4HCBA 3HSCA 2E8AA 4JI4K 2OOXA 2PY5A 4A5AA 2UXCK 3HS9A 2YA3A 1SZ2A 4AHVA 4YOTA 4CJ5A 1KFSA 1BIZA 3EN9A 2FXUA 2GV9A 5C2FA 3F73A 1LW2A 2FBXA 5IT9O 4AH9A 1HKCA 1EX4A 3CWAA 2IGIA 5E41A 2J4RA 5EU7A 1QVFM 4CF2A 3HP6A 4FLUA 1X9SA 3ISNC 4G1QA 3QIOA 4MDAA 3MK6A 2IDOA 4H0YB 3VQ9A 1A5XA 2Y8QA 3OYBA 1KVAA 1GLEG 1WAJA 4DR5K 4EZ6A 2JLEA 3VQDA 4JYAK 4BG9A 4FWOA 4DWIA 2G8KA 1EETA 3V9XA 1JCEA 4CD1A 2NRZA 2VYPA 4IO8A 1Y97A 4DU4A 3LDOA 4R5PA 4DR3K 3S3NA 4YDUC 2G8IA 3NFAA 4PKHA 4DFMA 1MU2A 1U04A 2P1JA 4CEQA 2EHGA 3R6MA 4O55A 5BMNA 5C10A 3ID8A 3SMPA 2HHQA 3TDHA 3KHYA 4QS8A 4CF9A 2ITMA 1NGBA 4GV3A 1QZ6A 2HB5A 1JL1A 4CK3A 4DTSA 4B3TK 4Y1CA 5HOOA 4KO0A 4DSIA 3CXCM 2GTDA 3QIPA 1VSLA 1C1CA 4B1VA 3AVCA 3NGYA 3V9SA 1QVGM 4JKHA 4BE2A 1TKTA 1IJJA 1RDDA 5AN4A 4KH5A 5C24A 4BR9A 1RTDA 4A2AA 1KD1O 1KCFA 2P9UA 4CIFA 4DV3K 3M8RA 1TV6A 2NOEA 2MJ7A 2VG6A 3OTOK 1VSHA 2O8CB 4JEPA 4BDYA 1RBRA 4KHUA 1N32K 1RBTA 3C6AA 2HHTA 3SBTA 3SQ2A 1NVPA 3NMUA 3K5LA 3CIPA 1IV0A 3AV9A 3CCUN 3VA3A 2V92A 1N39A 4WFAL 3SK3A 2OYQA 4CEDA 1UAXA 3CERA 1LCUA 1CXUA 3O1WA 1NOYA 2QW9A 4RW4A 3R9PA 2RE2A 4DCHA 3HPOA 5AQRA 2D1KA 1VRUA 3LAKA 4DU1A 4QS7A 4N76A 2Z1GA 4E7LA 3DJCA 2DKDA 3O9TA 1GLBG 2HVIA 3OSEA 4YDUA 5HRNA 3C7NB 4MDBA 4LF4K 1L3UA 3WXKA 5HRSA 1Q9UA 4RW7A 1Y64A 4IFVA 3D2FB 3VESA 3VEVA 4WZSD 3PX6A 2YHBA 5F0XA 3HSTB 1HNVA 3MX5A 4KHNA 3THXB 2FLOA 4DR2K 2IV8A 1Q18A 4B9QA 5AQHA 2H4LX 4GV6A 1WQAA 4GKJK 3V1OA 3CG7A 1WB9A 3ZT3A 3F5TA 4Z94A 2VQFK 1C0TA 4KI6A 1FJGK 3IFRA 1VQ5N 4X64K 3H1QA 2JPIA 1UWBA 1IKVA 4YOXA 4FJ8A 3CMAN 4FWPA 2YCHA 4IWVA 1L3SA 3H46O 3QEVA 2OZMA 3AVNA 1TAUA 3PUFA 3L3VA 3PLAA 3DXKA 4CJEA 4DF4A 3L4QA 3NVKA 1JCFA 3KLGA 1K6YA 1S6QA 5M1KA 2YHXA 2OA8A 1K8KB 3FLCO 4CF1A 3FFIA 1LAVA 1OH8A 3RMBA 4CECA 4CGGA 5GIOA 1NK6A 3MCPA 3VENA 1XMOK 3C0BA 4AHSA 2QXFA 2VGNA 4BR7A 3CHWA 2WBNA 4CZIA 2GEMA 1IG9A 3AVBA 3HOTA 1QHAA 5AZIA 1WSIA 3K59A 2XY8A 1CDWA 1WSJA 1BI4B 5ELZA 3ENCA 3PO5A 4BR5A 1NU0A 2F7LA 1RT7A 5LJVA 2KFNA 2HBKA 2P9KB 5BPNA 1EXQA 3CPEA 4YOYA 1HYSA 2BGGA 1U2VA 2KW4A 4O8UA 3VGLA 4Z4IA 4RWTA 3WNHA 3EYZA 1C0FA 4B9UA 2UUCK 3BF3A 3WEEA 4WX8A 5J2QA 3MXMA 1NGJA 1JXBA 4K41A 5KPRA 3ZETB 2NRTA 1QE1A 3TAQA 1QN5A 4YFUA 3L2WA 4FK0A 3TR8A 4BGBA 3ZSRA 2IVNA 3BEXA 5JVGL 1HUXA 4KHYA 1TBAB 2KQ2A 4N5SA 2FSKA 1REVA 1QTSA 4B3OA 4DHYA 3TSQA 4DMNA 3I0SA 4JV5K 3G71N 4WCEL 4C8KA 4MO4A 3ZSVA 3OW2M 4EAHD 4CJQA 3L3UA 3F9KA 3QBWA 1KSPA 1GLLO 3RSEA 5M1FA 2WONA 2NRXA 1XNRK 3HL8A 3G10A 4BRAA 5CYMA 5LJWA 4LSLA 3AVFA 4J8FA 1MWMA 4IFYA 1Q8IA 1NGHA 3THVA 4NLCA 4NCBA 1TYQA 4XEIA 5AQNA 4IOXA 1HYVA 3MX2A 3OVNA 4DQSA 1QQMA 1J5EK 1HYZA 4F2RA 2NOIA 2F9TA 3LANA 2R5XA 1VSMA 1BWFO 2QWPA 4O8KA 1MA9B 1SQKA 2QWRA 4FWSA 1QN3A 5KQDA 2P9IA 3OYGA 3WQTA 4RCHA 4B1WB 2NOHA 4FZZA 4ROEB 3CFRA 3HO1A 3CF5L 4CZHA 3SNNA 3V81A 3RRHA 2Z1HA 5GADP 3CC4N 4CESA 4CJSA 1GLFO 1ASWA 4DB3A 4FWMA 4BRGA 2X78A 2W41A 3QEIA 4WQ4A 1S72N 4ISGA 3JS6A 5B8HA 3QERA 3OGDA 3V9WA 4I2QA 3CCRN 3ZX0A 1UA0A 2BUPA 4EAKA 2A6AA 2HHXA 2YNHA 3VQPA 4KTQA 4FK2A 4AHCA 3PSIA 4DU3A 5BPMA 4ID5A 3KLFA 5F2RA 4BRHA 2JHJA 1XNQK 2ITGA 2GWKA 2NOFA 3O3GA 4Z0UA 3EZ5A 3JAMO 1W2BM 3TAMA 4B1YB 1WSFA 4MQ3A 3LM2A 4CGDA 1M1KO 4B3MK 3QICA 3NF8A 1IO2A 3O4QA 5TKWA 4KB1A 1S3XA 3VQAA 1NGDA 1LXTA 4CZEA 4DV1K 1JLQA 4G9ZA 1JLCA 4CJRA 3G25A 1QSSA 3PSFA 1BDGA 4CHQA 1SL1A 3PIOL 4Q0BA 3OHRA 3TSUA 3KD1E 1QNCA 4IOCL 2P51A 3OYJA 4CIGA 2NUBA 4IOAL 2Q1NA 1QN7A 1WSEA 1VTLE 3SLCA 5AQZA 4FJLA 4CBWA 2A40A 3M1FA 1EKEA 3NDKA 1NWKA 1NJXA 4H5WA 3U4LA 1VAZA 3ATVA 4JKCA 4JS4A 3ZT4A 4OO1J 1KVCA 3SQ0A 1A5VA 3EE8A 4HTUA 2QI2A 4OPHA 1Z25A 1YJ9N 3HOSA 3OYAA 1RT3A 1KAZA 1S1WA 1PCJX 2Z1IA 1XMQK 1NJIO 5AQIA 4JI2K 1P5GX 3T1YK 1VQPN 4NO7A 2F8TA 4OGEA 2HF3A 1NK7A 1IKWA 3ZSZA 1YITN 3NA5A 4KV8A 5EXWA 2YHAA 3O1BA 1U48A 1L3VA 1RT6A 1XC3A 4L3QA 3WT0A 2HHVA 4CGIA 2YNIA 1X9MA 2QRDA 3DOKA 3M8PA 3EIKA 5KGWA 1E42A 1TK5A 1U2VB 2ASOA 4DUYK 3E9LA 4U67L 1DKGD 3OBYA 5KRSA 3DMJA 2CGKA 3KRMA 5J1EA 1Q9YA 4AQYK 3MECA 4CHPA 2OPPA 5BMPA 3P4IA 1TKZA 3U9DA 1OVYA 2QEXN 1P5DX 1KQSM 3I3WA 3AVMA 3D45A 1O13A 1HJRA 3NF7A 1WNSA 4CJUA 5AQKA 1D3UA 2PFUA 1BCOA 5IYDP 4CZMA 3UKRB 1Q81O 4DR7K 4CJFA 4C23A 3I56N 4BRNA 1ATRA 4C8MA 1VHXA 5KI6A 1EUVA 3N4QA 4CEEA 4B9LA 5FDLA 3PX4A 2G8FA 1YVNA 4O0IA 2YJEA 1NK5A 2GWJA 1T44A 5BRHA 4H0VB 5AQOA 1N6QA 2HL9A 1WAFA 4MO5A 3TARA 1JFIC 1P90A 1MP9A 4CW7B 5HL7L 3J8AA 4K8XA 2CGJA 5CR4A 1IBKK 2AJQA 1NBWA 4FWQA 5K14A 4KHSA 2B4JA 4B08A 1QS4A 4LF7K 3D4VA 5FLXO 2QWOA 4RW6A 4BWJA 5F1XA 4BR0A 4BC5A 1JXEA 3IH7A 2P9IB 1WBBA 2BANA 1Q82O 1T7PA 1QQOA 1Z26A 5CZ2A 4DR6K 1AISA 3KKSA 4CEOA 3DOLA 3DRRA 3DRSA 4DTOA 4DFJA 4BC2A 3SPZA 4FJ7A 1TGOA 3SUOA 3D2FA 2V51B 4IL8A 3ULXA 1QN9A 3VTHA 1VSDA 3O80A 1LWFA 2ASMA 2F9WA 3ULDA 4DTJA 1BUPA 4BJUA 3AA2A 4BRLA 4CCHA 3HS8A 1RILA 3RR8A 4JKAA 3L4IA 5J2PA 5T7BA 2QWNA 4AHUA 3OH6A 1LAWA 2NWVA 2VQEK 3CYMA 4E7KA 4BC3A 4JI6K 2HMIA 1A5WA 4JI3K 4DULA 3S9HA 1NJZA 1K8AO 1K8KA 3LP2A 3ASMA 1D9DA 3VF2A 4CGHA 2YX6A 1VQ7N 4XH4A 1NKEA 3CD6N 1DT9A 1FKPA 3AVLA 4CFCA 5EVZA 1Q7YO 4H5RA 4FLZA 4JK9A 1QN4A 3HVTA 1JLFA 2ZGYA 4D7QA 3MN6A 4LFBK 2E2PA 1BU6O 3EY1A 4K43A 1PZDA 4F2SA 2P9PB 3NF9A 4JD2A 2E4LA 1NK9A 3IS9A 4IJAA 1LWYA 4Z4HA 3HBTA 3QB0A 1NK4A 1BI4A 4FJIA 4FJGA 1ITGA 2P9KA 3KK1A 3HM8A 4N41A 2XHIA 4JN4A 5FPNA 4HCCA 1U45A 4H0PA 3T1HK 5AJ3K 2I5WA 4DSFA 3K58A 5CYQA 3ZLJA 1BQMA 1QNAA 5KTQA 5AQTA 5BR8K 3IAYA 1VQ6N 1QSLA 3ZETA 3ULEB 1KAXA 4H0TB 3U3GA 4BE0A 4LF9K 4MLHA 1U4BA 4YORA 4BQLA 4IO9L 1CXQA 5AFUA 3O4NA 3O9SA 1EBMA 2RKIA 3OYLA 2DFEA 2E2OA 4O5BA 4RODB 3DLKA 1M90O 1B92A 2Q97A 4FJ9A 2KHOA 3VEYA 2LSNA 5FPDA 1YJNN 3L2UA 4CEAA 1LWWA 4JI1K 4CZJA 3L2RA 3BZKA 2XY7A 3KKRA 1BHLA 4DV0K 2YKMA 4L8RB 1YTBA 2H5AX 3HRGA 1LWCA 1ZBIA 1YAGA 2E5LK 3B6OA 3C95A 3CQ8A 4E7IA 1TAQA 1TKXA 2UUAK 3D6RA 2CGLA 4JLHA 5GAEP 4KFBA 3CMEN 2NOZA 2NOLA 1HMVA 3WNGA 3D7EO 3ID6A 4CK2A 1U47A 5F9CA 3CI5A 5AR0A 2PAVA 4M3UA 1JLEA 2VJ0A 4A59A 4M3XA 1EP4A 5AQPA 2OPQA 1HNZK 5DM6L 4Q5VA 5AQMA 4OPAA 2D5RA 3HP9A 4QAGA 1J6ZA 3OSMA 1EQYA 4FW1A 5AQWA 2X74A 4JHDA 3ZX3A 3Q7BA 4HUGA 5C25A 1S22A 2OPRA 1CZBA 4NCAA 3HPHA 2W6LA 3WXJA 1BCMA 4J2EA 3WNEA 4JI7K 3OYCA 2FKFA 1ZBFA 1FXXA 2F7TA 4CHYA 4M41A 1JCGA 4ZTJA 4CFAA 4DTUA 1T05A 3KVGA 5EY4A 1I3AA 4CEBA 2DKCA 4EP4A 2F96A 4IFEA 3WQUA 1U49A 1KLMA 3EL2A 2FBTA 1Z05A 4J2BA 3CPWM 3TAPA 1TUUA 4FM0A 2O8FA 4QG5A 3TTFA 1GLJO 2YH5A 3C6TA 3QEWA 4JAXA 4ISFA 2O8EB 4BR4A 5C42A 4GV9A 3CJBA 3SQ4A 4JI8K 4FO0A 1N36K 1C1AA 2PZSA 4DV7K 1YF5L 2YJFA 5KGXA 4PQUA 1K9MO 4EIAA 4DS5A 3VQQA 1XSZA 4EP5A 3HK2A 3J7YP 4ZTFA 4KBOA 4ROCB 1MWKA 1SL2A 2QRCA 3MEDA 3O9UA 3QO9A 4CF8A 4EAGA 1HJOA 1EWRA 3OYFA 4FM1A 1C0UA 1SAZA 1WOQA 4O44A 2RF2A 2VWJA 5BRDA 4FJXA 4F3OA 4HUEA 4DQQA 5JVHL 2JOIA 1M5Q1
chains in the Genus database with same CATH topology
3LAMA 3AVHA 1RBUA 4CJLA 2HHWA 3ZSQA 3SCXA 4W5QA 2ITGA 3SNSA 2Y1JA 2NOFA 3ZT0A 3O3GA 4DF8A 3AVAA 4DS4A 4Z0UA 3EZ5A 4PWDA 3OCIA 4I9LA 4IG3A 3TAMA 3SPYA 4B9MA 3RPJA 1KFDA 1WSFA 2FBVA 4MQ3A 3OC3C 4AHRA 1TL1A 3AO2A 4CGDA 3NH2A 3QETA 4EJZA 3NF8A 3DYAA 1IO2A 3O4QA 3HXMA 2A1RA 3VQ4A 3ZCMA 1N3AA 2RN2A 4KB1A 1LW0A 4CFDA 1HU0A 3LP0A 4FJ7A 3VQAA 4Z4GA 3M8QA 1ZBLA 4W5NA 1JLQA 4E0DA 1JLCA 4CJRA 4RG8A 1QSSA 2GBZA 3K5MA 2QKBA 4LY7A 4CHQA 5IYBP 3O3HA 3LZIA 1SL1A 4Q0BA 3TABA 4IBNA 4N47A 3I8DA 4CHOA 3KD1E 1ZBHA 1QNCA 3MXIA 2P51A 3U6FA 4FJHA 3OYJA 4CIGA 4JS5A 4F3TA 1YQLA 2NUBA 4DQIA 1HNIA 3WNFA 1XI1A 3AVIA 5CZ1A 1WN7A 2XHBA 4KHQA 1VSFA 3B6PA 3SUNA 1QN7A 1WSEA 1VTLE 3NE6A 4OLAA 3RMCA 3AA5X 3VQ8A 3S3OA 4FJLA 2HNYA 3G0ZA 1RTIA 4CFBA 4CEZA 1EKEA 3OS1A 3CM6A 2Z1JA 3NDKA 2ZE2A 4O0JA 4OPKA 3M8SA 1NJXA 2IV9A 4Q11A 3OYKA 3T3FA 3AVJA 2G8VA 4OKKA 1JLBA 3K2PA 3I0RA 1YQRA 4GVMA 1KVBA 1NOZA 4TSXA 3PV8A 1B9FA 3ZT4A 4JS4A 5HBMA 1QN8A 3DLRA 3LWMA 1KVCA 2B5JA 4FW2A 4CJTA 1UOCA 1YTAA 1A5VA 4KTZA 4Z4CA 3HT3A 4HTUA 4B8CA 3SQ0A 2P5GA 3KD5E 1VOKA 1TBPA 1Z25A 2DY4A 3AO4A 4O4GA 5I42A 3DLHA 3OYAA 1RT3A 1VK0A 2O4GA 1J53A 1S1WA 1KYUA 5J2MA 3V1RA 2XO7A 4OKJA 4AILC 2Z1IA 3SYZA 1S1TA 3DRPA 2RPIA 4NCGA 3OYNA 2QK9A 4ZHRA 1R0AA 1QTPA 4I8OA 2ZD1A 3KLIA 4LSNA 3RR7A 4KI4A 1FK9A 2F8TA 4OGEA 4RW9A 3RRGA 1NK7A 4C8LA 3JYTA 2YNFA 1IKWA 3LP1A 3ZSZA 4IDKA 3NBPA 1C1BA 1SKSA 4DTMA 3TI0A 2PYLA 4FZYA 3V9UA 4HUFA 1UT4A 3ALYA 4KV8A 5JS2A 2XRIA 2YHAA 2XY5A 3S3MA 2G8HA 4BDPA 4M3TA 1JKHA 1U48A 1RT6A 5HROA 1L3VA 2BDPA 4PUOA 3QINA 3F0ZA 4CE9A 2VG5A 4DTPA 3K5NA 2HHVA 2EX3A 2YNIA 3VQCA 1QNEA 4CGIA 1X9MA 3OYHA 3PX0A 3DOKA 3M8PA 1KYDA 3SJJA 3EIKA 4DSJA 5KGWA 1E42A 1VSIA 4JRPA 1VOLB 2W42A 4HHTA 5I3UA 1TK5A 1TK8A 3E01A 3N89A 3C6UA 3DI6A 4FLWA 3TAFA 2OPSA 3VA0A 5KRSA 2XY6A 3DMJA 1NKBA 4CHNA 3KRMA 5J1EA 1Q9YA 1RDCA 2QKKA 1TGHA 4Z4FA 3MECA 3ZSWA 4CHPA 1S1UA 2OPPA 1WLJA 4Y1DA 1TKZA 4PY5A 4B9SA 2FC0A 3AO5A 2DFHA 4BDZA 1RCHA 4HCBA 4OPJA 3AVMA 3D45A 1HJRA 1HQEA 1S1XA 2PY5A 3NF7A 3LPUA 1WNSA 3HS9A 3P83D 4CJUA 4FCYA 1D3UA 4OJRA 1C0MA 1NJYA 4AHVA 1RM1A 4CJ4A 4CJ5A 2FBYA 1BCOA 5IYDP 5FRNA 5DMRA 4J2AA 4CJFA 1KFSA 2F8SA 1BIZA 1RDBA 1YT3A 4FXDA 2Z8UA 4OLBA 2GV9A 4DTXA 3F73A 4FJKA 2YNGA 3V6DA 4C8MA 3AO3A 2G8UA 1IKXA 1J5OA 1S6PA 1LW2A 2FBXA 4K8ZA 3DLBA 4AH9A 5KI6A 4CEEA 4B9LA 4PA1A 2ZQBA 1EX4A 1X9WA 4I2PA 5FDLA 2IGIA 3PX4A 5E41A 2G8FA 5EU7A 3I0WA 1ASUA 4O0IA 4CF2A 3VN5A 1NK5A 4CIEA 4C8NA 3HP6A 4FLUA 4E7HA 4DTNA 1KRPA 3NH1A 3AO1A 1X9SA 1BIUA 3ISNC 1HPZA 3QIOA 4G1QA 1N6QA 2DTUA 1WAFA 4LH5A 2IDOA 3VQ9A 4W5TA 3TARA 1JFIC 1A5XA 1GOBA 3OYBA 1KVAA 3L2VA 1WAJA 1YQKA 1B9DA 3QEXA 2HHSA 4EZ6A 1MP9A 2JLEA 3VQDA 1NH2A 3KTQA 4K8XA 2KTQA 4DWIA 4EJYA 4H4OA 2KFZA 1XHZA 2G8KA 1EETA 4KHSA 5K14A 2AJQA 1W0HA 1FN7A 2B4JA 3V9XA 1ZYQA 4B08A 1QS4A 2LAEA 1BQNA 3H08A 1VSJA 4ICLA 3DLGA 4CGJA 4BACA 4DQRA 5D3GA 4F8RA 1Y97A 4DU4A 4R5PA 4RW6A 4CF0A 2HZSA 1VSKA 4BWJA 3NFAA 3S3NA 2G8IA 3AA4A 2BE2A 3OYMA 4DFMA 1MU2A 1U04A 2P1JA 4CEQA 4IKFA 4M42A 2EHGA 4FVMA 1JXEA 3IH7A 4O55A 1DLOA 3D0PA 4E7JA 1YVUA 1TKDA 2IAJA 2BANA 3NGZA 1T7PA 1Z26A 3OYIA 5CZ2A 1S9EA 3TAGA 2WOMA 2HHQA 1D5AA 3ITHA 1AISA 3NH0A 3KKSA 4CEOA 1JLAA 4FLXA 3DOLA 3DRRA 3DRSA 4CF9A 4DTOA 4DFJA 3SV3A 3V9ZA 2HB5A 3SPZA 1JL1A 1GOCA 4CK3A 5FROA 1KTQA 1TGOA 2IS3A 4DTSA 3RTVA 3SUOA 2HW3A 1QN6A 4Y1CA 4W5OA 3V4IA 4KO0A 4E1MA 4DSIA 1TL3A 1D9FA 1BISA 3ULXA 1QN9A 1IH7A 1C1CA 1VSLA 3QIPA 3AVCA 1VSDA 3NGYA 4E1NA 3V9SA 3DLEA 1LWFA 4BE2A 1TKTA 5C24A 1RDDA 5AN4A 1RTDA 3K57A 3IG1A 4Z4EA 2IOCA 1XHXA 5CY4A 4CEFA 3ULDA 2E6MA 1CLQA 1N5YA 1KCFA 4DTJA 4CIFA 1YTUA 3M8RA 3QEPA 3AA2A 1YQMA 1TV6A 2NOEA 2MJ7A 2VG6A 4CCHA 3MEGA 1LWEA 5FRMA 1VSHA 3HS8A 1RILA 4E89A 3RR8A 3V1QA 1TAUA 5J2PA 4BDYA 5T7BA 1RBRA 3OY9A 4JRQA 4KHUA 1RBTA 2HHTA 3QESA 4AHUA 4I9QA 3LZJA 1LAWA 1RNHA 3SQ2A 1T8EA 1NVPA 1SV5A 4FJNA 3CYMA 3K5LA 2D0BA 4E7KA 1KLNA 4KTWA 5HRPA 2HMIA 1L5UA 1A5WA 3AV9A 3SUQA 4DULA 3VA3A 1UT7A 1N39A 4LH4A 2R7YA 3S9HA 1NJZA 1D8YA 3LPTA 2KZZA 1WSHA 3LP2A 4DSKA 2OYQA 1KY6A 2HZMA 3ASMA 4CEDA 1NJWA 1UAXA 3U3YA 1D9DA 4ELTA 4CGHA 2O3OA 1CZ9A 1CXUA 3NCIA 1NKEA 1NOYA 4RW4A 1FKPA 4CFCA 2DFFA 3AVLA 1QHTA 3CFOA 4B9TA 4KHWA 3HPOA 4FLZA 3HPGA 1QN4A 4LD0A 3HVTA 1JLFA 1VRUA 3LAKA 4DU1A 4KRFA 4N76A 1RBVA 2Z1GA 3C94A 1T03A 4E7LA 1QTMA 3EY1A 5JS1A 1ASVA 1PZDA 4F2SA 1W80A 2HVIA 1N3CA 4ID1A 5HRNA 1S1VA 4DTRA 3NF9A 4ELVA 4KREA 1L3UA 2E4LA 1NK9A 1SL0A 3IS9A 1Q9XA 5HRSA 4C8OA 1LWYA 3LALA 4RW7A 4Z4HA 4IFVA 1SKWA 3PY8A 4GW6A 3AA3A 1BI4A 3HYFA 3VQ5A 1NK4A 4FJGA 4FJIA 1ITGA 2YKNA 4WZSD 3PX6A 2YHBA 2Y1IA 4M45A 4UQGA 2G30A 5HP1A 3HSTB 4B0AA 1GOAA 3KK1A 1HNVA 3BGRA 4KHNA 1YTFA 3SQ1A 2E6LA 3MAQA 2KZMA 4N41A 2IV8A 2XHIA 4BWMA 4F4KA 4KB0A 4NYFA 4HCCA 1RT5A 1XC9A 1S5JA 1U45A 4M3YA 3V1OA 3CG7A 3ZT3A 2HNZA 1RT1A 4M3WA 2I5WA 4DG1A 4DSFA 3K58A 5CYQA 1C0TA 1BQMA 1O1WA 3ZSYA 4KI6A 1QNAA 1HQUA 1RTHA 5KTQA 1UWBA 5J2NA 3TAEA 3IAYA 1IKVA 3SV4A 1QSLA 3KTUA 4FJ8A 3LDSA 3CFPA 2OZMA 1F21A 3U3GA 4BE0A 3QLHA 3QEVA 1NKCA 3AVNA 1L3SA 2HVHA 1B9KA 3L3VA 3PUFA 1U4BA 2OZSA 1SKRA 3KJVA 4HVJA 4CJEA 1CXQA 4DF4A 1BGXT 5IYCP 1G15A 1TVRA 1QNBA 3O4NA 1EBMA 4FJJA 2RKIA 3OYLA 4CJ3A 2D0AA 3KLGA 3NHGA 1K6YA 2DFEA 2B6AA 1S6QA 2OA8A 4CF1A 4O5BA 3FFIA 5SWMA 1LAVA 4RODB 1X1PA 3RMBA 3DLKA 3KK3A 4TPSA 1B92A 4FJ9A 4DSEA 1PCZA 2ATQA 3RWUA 4CECA 1KY7A 4CGGA 2P5OA 4FYDA 4M3ZA 3H1ZA 2LSNA 1NK6A 4FK4A 1R4XA 1C6VA 1RBSA 3OS2A 3L2UA 4CEAA 1NK8A 1LWWA 4AHSA 5SZTA 4RW8A 3L2RA 4GMJB 2QXFA 2XY7A 3KKRA 1I39A 1BHLA 3KIOA 3T1AA 1J9AA 4DFKA 2YKMA 4L8RB 4ELUA 1YTBA 4AHTA 4WE1A 1HRHA 1LWCA 3IRXA 4CJPA 4FJ5A 1ZBIA 1IG9A 3TWHA 4QOZB 2A1SA 3AVBA 4OGCA 3ZSOA 3OJSA 1WSIA 1IKYA 3B6OA 2XY8A 3C95A 2IC3A 3NGIA 5HRRA 1CDWA 1WSJA 3K59A 3CQ8A 1BI4B 1TAQA 4E7IA 1TKXA 3RMDA 3PO5A 2G8WA 1RT7A 4JLHA 3VQ7A 4KFBA 2KFNA 2YV0X 3ZT1A 2NOZA 2NOLA 1EXQA 1HMVA 3WNGA 1HYSA 2BGGA 2KW4A 3OYDA 4Z4IA 4CK2A 3WNHA 3EYZA 2JGUA 3TANA 2X6SA 1FKOA 2PYJA 1U47A 4OVLA 4B9UA 5DK5A 4CJVA 4M3UA 1JLEA 2VWKA 3A2FA 4CGFA 2VJ0A 3NAEA 3L8BA 5J2QA 3MXMA 4M3XA 1EP4A 1JXBA 1RT4A 3ZSXA 3AVKA 4FM2A 3SUPA 3KLHA 4EZ9A 1QE1A 2OPQA 3TAQA 1QN5A 4YFUA 4N56A 3L2WA 3TR8A 4FK0A 3K5OA 3ZSRA 4Q5VA 2GUIA 4E3SA 1L3TA 2D5RA 3HP9A 4KKOA 4KHYA 3L2QA 3P1GA 4QAGA 1TBAB 2KQ2A 4XIUA 3OSMA 1SUQA 4FW1A 3I0XA 1REVA 4M3RA 4N5SA 3SZ2A 2X74A 4NYNA 4HUGA 1NK0A 1QQCA 1QTSA 4B3OA 3F10A 3LP3A 5C25A 2ETJA 1DTQA 2VG7A 4DMNA 1J54A 3I0SA 3DPUA 3DM2A 4FLTA 2OPRA 1CZBA 4C8KA 4KPYA 1RT2A 4NCAA 3ZSVA 1VTOA 3HPHA 4I7FA 3MEEA 3MXJA 4CJQA 3AVGA 1BL3A 3L3UA 4DSLA 2HHUA 1BCMA 3F9KA 4J2EA 3WNEA 1KSPA 4OKEA 3OYCA 3UIQA 2WONA 4B9VA 4DQPA 1M3HA 1ZBFA 3QNOA 1VSEA 1FXXA 4CHYA 3HL8A 3G10A 4M41A 4ZTJA 5CYMA 4CFAA 2HNDA 5KRTA 4DTUA 1T05A 3KLEA 3PO4A 4LSLA 3SI6A 4J2DA 3AVFA 4QCLA 1RDAA 1I3AA 1JL2A 1S9GA 4CEBA 1Q8IA 2F96A 4IFYA 4EP4A 3VQ6A 1JLGA 4CK1A 3NF6A 4W5RA 3OJUA 1KYFA 1KLMA 3THVA 1U49A 1QSYA 4NCBA 1LV5A 3ZT2A 4FZXC 2X6NA 4YNQA 2FBTA 1HYVA 4J2BA 3OVNA 4DQSA 4CERA 2NOBA 3TAPA 4B9NA 4FM0A 1HYZA 4DFPA 4F2RA 3QNNA 4H4MA 3O3FA 2NOIA 1WSGA 2MZ8A 4DLGA 3LANA 1VSMA 2YH5A 1C9BB 3C6TA 4H8KA 3T19A 3HM9A 3QEWA 1NGMA 1QN3A 3OYGA 1ZBUA 1UA1A 4DLEA 2O4IA 5C42A 3SQ4A 2NOHA 4FZZA 4ROEB 1C1AA 3CFRA 3HO1A 2PZSA 1DTTA 3OSTA 3OS0A 3SNNA 3JSMA 1VRTA 5KGXA 3V81A 3RRHA 3RMAA 4PQUA 2Z1HA 4CESA 4CJSA 4DS5A 1ASWA 3OYEA 3VQQA 2FGTA 3KK2A 4CJKA 3HVRA 3DPTA 3LWLA 4KAZA 2X78A 3VQBA 1LWVA 4EP5A 3HK2A 1RTJA 3QEIA 4E19A 4FLYA 4ZTFA 2Q3SA 1TK0A 3P5JA 3CM5A 4ROCB 1W9HA 4BE1A 1SL2A 4CJWA 5HLFA 4FJMA 4B8AB 3QERA 3MEDA 1XWLA 3QO9A 2D0CA 4CF8A 3V9WA 4I2QA 1KO9A 1UA0A 3OYFA 4FM1A 1C0UA 2HHXA 2YNHA 3VQPA 4KTQA 4O44A 2RF2A 4FK2A 4AHCA 2VWJA 4IG0A 3BDPA 4FJXA 3HJFA 4MFBA 4DU3A 4F3OA 4CHZA 4HUEA 4DQQA 4FLVA 2I5JA 4ID5A 3VQEA 3KLFA 2JOIA 1M3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LAM A;  3AVH A;  1RBU A;  4CJL A;  2HHW A;  3ZSQ A;  3SCX A;  4W5Q A;  2ITG A;  2Y1J A;  3ZT0 A;  3O3G A;  4DF8 A;  3AVA A;  4DS4 A;  4Z0U A;  3EZ5 A;  4PWD A;  3OCI A;  4I9L A;  4IG3 A;  3TAM A;  3SPY A;  4B9M A;  1KFD A;  2OZS A;  1WSF A;  2FBV A;  4MQ3 A;  3OC3 C;  4AHR A;  1TL1 A;  3AO2 A;  4CGD A;  3NH2 A;  3QET A;  3NF8 A;  3DYA A;  1IO2 A;  3O4Q A;  3HXM A;  2A1R A;  3VQ4 A;  3ZCM A;  2RN2 A;  4KB1 A;  1LW0 A;  4CFD A;  4FJ7 A;  3LP0 A;  4Z4G A;  3VQA A;  3M8Q A;  1ZBL A;  4W5N A;  1JLQ A;  4E0D A;  1JLC A;  4CJR A;  4RG8 A;  1QSS A;  2GBZ A;  3K5M A;  2QKB A;  4LY7 A;  4CHQ A;  5IYB P;  3O3H A;  3LZI A;  1SL1 A;  4Q0B A;  3TAB A;  4IBN A;  4N47 A;  3I8D A;  4CHO A;  3KD1 E;  1ZBH A;  1QNC A;  3MXI A;  2P51 A;  3U6F A;  4FJH A;  3OYJ A;  4CIG A;  4JS5 A;  4F3T A;  2NUB A;  4DQI A;  1HNI A;  3WNF A;  1XI1 A;  3AVI A;  5CZ1 A;  1WN7 A;  2XHB A;  4KHQ A;  1VSF A;  3B6P A;  3SUN A;  1QN7 A;  1WSE A;  1VTL E;  3NE6 A;  4OLA A;  3RMC A;  3AA5 X;  3VQ8 A;  3S3O A;  4FJL A;  2HNY A;  3G0Z A;  1RTI A;  4CFB A;  4CEZ A;  1EKE A;  3OS1 A;  3CM6 A;  2Z1J A;  3NDK A;  2ZE2 A;  4O0J A;  4OPK A;  3M8S A;  1NJX A;  2IV9 A;  2G8V A;  3OYK A;  3T3F A;  3AVJ A;  4OKK A;  1JLB A;  3K2P A;  3I0R A;  4GVM A;  1KVB A;  1NOZ A;  4TSX A;  3PV8 A;  1B9F A;  3ZT4 A;  4JS4 A;  5HBM A;  1QN8 A;  3DLR A;  3LWM A;  1KVC A;  2B5J A;  4FW2 A;  4CJT A;  1UOC A;  1YTA A;  1A5V A;  4KTZ A;  4Z4C A;  3HT3 A;  4HTU A;  4B8C A;  3SQ0 A;  2P5G A;  3KD5 E;  1VOK A;  1TBP A;  1Z25 A;  2DY4 A;  3AO4 A;  4O4G A;  5I42 A;  3DLH A;  3OYA A;  1RT3 A;  1VK0 A;  2O4G A;  1J53 A;  1S1W A;  1KYU A;  5J2M A;  3V1R A;  2XO7 A;  4OKJ A;  4AIL C;  2Z1I A;  3SYZ A;  1S1T A;  3DRP A;  2RPI A;  4NCG A;  3OYN A;  2QK9 A;  4ZHR A;  1R0A A;  1QTP A;  2ZD1 A;  3KLI A;  4LSN A;  3RR7 A;  4KI4 A;  1FK9 A;  2F8T A;  4OGE A;  4RW9 A;  3RRG A;  1NK7 A;  4C8L A;  3JYT A;  2YNF A;  1IKW A;  3LP1 A;  3ZSZ A;  4IDK A;  3NBP A;  1C1B A;  1SKS A;  4DTM A;  3TI0 A;  2PYL A;  4FZY A;  3V9U A;  4HUF A;  3ALY A;  4KV8 A;  5JS2 A;  2XY5 A;  2XRI A;  2YHA A;  3S3M A;  2G8H A;  4BDP A;  4M3T A;  1JKH A;  1U48 A;  1RT6 A;  5HRO A;  1L3V A;  2BDP A;  4PUO A;  3QIN A;  4CE9 A;  2VG5 A;  4DTP A;  3K5N A;  2HHV A;  2EX3 A;  2YNI A;  3VQC A;  1QNE A;  4CGI A;  1X9M A;  3OYH A;  3PX0 A;  3DOK A;  3M8P A;  1KYD A;  3SJJ A;  3EIK A;  4DSJ A;  5KGW A;  1E42 A;  1VSI A;  4JRP A;  1VOL B;  2W42 A;  4HHT A;  5I3U A;  1TK5 A;  1TK8 A;  3E01 A;  3C6U A;  3DI6 A;  4FLW A;  3TAF A;  2OPS A;  3VA0 A;  5KRS A;  2XY6 A;  3DMJ A;  1NKB A;  4CHN A;  5J1E A;  1Q9Y A;  2QKK A;  1RDC A;  1TGH A;  4Z4F A;  3MEC A;  3ZSW A;  4CHP A;  1S1U A;  2OPP A;  1WLJ A;  4Y1D A;  1TKZ A;  4PY5 A;  4B9S A;  2FC0 A;  3AO5 A;  2DFH A;  4BDZ A;  1RCH A;  4HCB A;  4OPJ A;  3AVM A;  3D45 A;  1HJR A;  1HQE A;  1S1X A;  2PY5 A;  3NF7 A;  3LPU A;  1WNS A;  3HS9 A;  3P83 D;  4CJU A;  4FCY A;  1D3U A;  4OJR A;  1C0M A;  1NJY A;  4AHV A;  1RM1 A;  4CJ4 A;  4CJ5 A;  2FBY A;  1BCO A;  5IYD P;  5FRN A;  5DMR A;  4J2A A;  4CJF A;  1KFS A;  2F8S A;  1BIZ A;  1RDB A;  1YT3 A;  4FXD A;  2Z8U A;  4OLB A;  2GV9 A;  4DTX A;  3F73 A;  4FJK A;  2YNG A;  3V6D A;  4C8M A;  3AO3 A;  2G8U A;  1IKX A;  1J5O A;  1S6P A;  1LW2 A;  2FBX A;  4K8Z A;  3DLB A;  4AH9 A;  5KI6 A;  4CEE A;  4B9L A;  4PA1 A;  2ZQB A;  1EX4 A;  1X9W A;  4I2P A;  5FDL A;  2IGI A;  3PX4 A;  5E41 A;  2G8F A;  5EU7 A;  1ASU A;  4O0I A;  4CF2 A;  3VN5 A;  1NK5 A;  4CIE A;  4C8N A;  3HP6 A;  4FLU A;  4E7H A;  4DTN A;  1KRP A;  3NH1 A;  3AO1 A;  1X9S A;  1BIU A;  3ISN C;  1HPZ A;  3QIO A;  4G1Q A;  1N6Q A;  2DTU A;  1WAF A;  4LH5 A;  2IDO A;  3VQ9 A;  4W5T A;  3TAR A;  1JFI C;  1A5X A;  1GOB A;  3OYB A;  1KVA A;  3L2V A;  1WAJ A;  3QEX A;  1B9D A;  2HHS A;  4EZ6 A;  1MP9 A;  2JLE A;  3VQD A;  1NH2 A;  3KTQ A;  4K8X A;  2KTQ A;  4DWI A;  4H4O A;  2KFZ A;  1XHZ A;  2G8K A;  1EET A;  4KHS A;  5K14 A;  2AJQ A;  1W0H A;  2B4J A;  3V9X A;  1ZYQ A;  4B08 A;  1QS4 A;  4BAC A;  1BQN A;  3H08 A;  1VSJ A;  4ICL A;  3DLG A;  4CGJ A;  4DQR A;  5D3G A;  4F8R A;  1Y97 A;  4DU4 A;  4R5P A;  4RW6 A;  4CF0 A;  1VSK A;  4BWJ A;  3S3N A;  3NFA A;  2G8I A;  3AA4 A;  2BE2 A;  3OYM A;  4DFM A;  1MU2 A;  1U04 A;  2P1J A;  4CEQ A;  4IKF A;  4M42 A;  2EHG A;  4FVM A;  1JXE A;  4O55 A;  4E7J A;  1DLO A;  3D0P A;  1YVU A;  1TKD A;  2IAJ A;  2BAN A;  3NGZ A;  1T7P A;  1Z26 A;  3OYI A;  5CZ2 A;  1S9E A;  3TAG A;  2WOM A;  2HHQ A;  1D5A A;  3ITH A;  1AIS A;  3NH0 A;  3KKS A;  4CEO A;  1JLA A;  4FLX A;  3DOL A;  3DRR A;  3DRS A;  4CF9 A;  4DTO A;  4DFJ A;  3SV3 A;  3V9Z A;  2HB5 A;  3SPZ A;  1JL1 A;  1GOC A;  4CK3 A;  5FRO A;  1KTQ A;  1TGO A;  2IS3 A;  4DTS A;  3RTV A;  3SUO A;  2HW3 A;  1QN6 A;  4Y1C A;  4W5O A;  3V4I A;  4KO0 A;  4E1M A;  4DSI A;  1TL3 A;  1D9F A;  1BIS A;  1QN9 A;  1VSL A;  1IH7 A;  1C1C A;  3QIP A;  4KAZ A;  3AVC A;  1VSD A;  3NGY A;  4E1N A;  3V9S A;  3DLE A;  1LWF A;  4BE2 A;  1TKT A;  5C24 A;  1RDD A;  1RTD A;  3K57 A;  3IG1 A;  4Z4E A;  2IOC A;  1XHX A;  5CY4 A;  4CEF A;  3ULD A;  2E6M A;  1CLQ A;  1N5Y A;  1KCF A;  4DTJ A;  4CIF A;  1YTU A;  3M8R A;  3QEP A;  3AA2 A;  1TV6 A;  2MJ7 A;  2VG6 A;  4CCH A;  3MEG A;  1LWE A;  5FRM A;  1VSH A;  3HS8 A;  1RIL A;  4E89 A;  3RR8 A;  3V1Q A;  1TAU A;  5J2P A;  4BDY A;  5T7B A;  1RBR A;  3OY9 A;  4JRQ A;  4KHU A;  1RBT A;  2HHT A;  3QES A;  4AHU A;  4I9Q A;  3LZJ A;  1LAW A;  1RNH A;  3SQ2 A;  1T8E A;  1NVP A;  1SV5 A;  4FJN A;  3CYM A;  3K5L A;  2D0B A;  4E7K A;  1KLN A;  4KTW A;  5HRP A;  2HMI A;  1L5U A;  1A5W A;  3AV9 A;  3SUQ A;  3VA3 A;  4LH4 A;  2R7Y A;  3S9H A;  1NJZ A;  1D8Y A;  3LPT A;  2KZZ A;  1WSH A;  3LP2 A;  4DSK A;  2OYQ A;  1KY6 A;  3ASM A;  4CED A;  1NJW A;  1D9D A;  1UAX A;  3U3Y A;  4ELT A;  3HJF A;  4CGH A;  1CZ9 A;  1CXU A;  3NCI A;  1NKE A;  1NOY A;  4RW4 A;  1FKP A;  4CFC A;  2DFF A;  3AVL A;  1QHT A;  3CFO A;  4B9T A;  4KHW A;  3HPO A;  4FLZ A;  3HPG A;  1QN4 A;  4LD0 A;  3HVT A;  1JLF A;  1VRU A;  3LAK A;  4DU1 A;  4KRF A;  4N76 A;  1RBV A;  2Z1G A;  3C94 A;  1T03 A;  4E7L A;  1QTM A;  3EY1 A;  5JS1 A;  1ASV A;  1PZD A;  4F2S A;  1W80 A;  2HVI A;  4ID1 A;  5HRN A;  1S1V A;  4DTR A;  3NF9 A;  4ELV A;  4KRE A;  1L3U A;  2E4L A;  1NK9 A;  1SL0 A;  3IS9 A;  1Q9X A;  5HRS A;  4C8O A;  3LAL A;  4RW7 A;  4Z4H A;  4IFV A;  1SKW A;  3PY8 A;  4GW6 A;  3AA3 A;  1BI4 A;  3HYF A;  3VQ5 A;  1NK4 A;  4FJG A;  4FJI A;  1ITG A;  2YKN A;  4WZS D;  3PX6 A;  2YHB A;  2Y1I A;  4M45 A;  4UQG A;  2G30 A;  5HP1 A;  3HST B;  4B0A A;  1GOA A;  3KK1 A;  1HNV A;  3BGR A;  4KHN A;  1YTF A;  3SQ1 A;  2E6L A;  3MAQ A;  2KZM A;  4N41 A;  2IV8 A;  4BWM A;  4F4K A;  4KB0 A;  4NYF A;  4HCC A;  1RT5 A;  1XC9 A;  1S5J A;  1U45 A;  4M3Y A;  3V1O A;  3CG7 A;  3ZT3 A;  2HNZ A;  1RT1 A;  4M3W A;  4DG1 A;  4DSF A;  3K58 A;  5CYQ A;  1C0T A;  1BQM A;  1O1W A;  3ZSY A;  4KI6 A;  1QNA A;  1HQU A;  1RTH A;  5KTQ A;  1UWB A;  5J2N A;  3TAE A;  3IAY A;  1IKV A;  3SV4 A;  1QSL A;  4FJ8 A;  3LDS A;  3CFP A;  2OZM A;  1F21 A;  3U3G A;  4BE0 A;  3QLH A;  3QEV A;  1NKC A;  3AVN A;  1L3S A;  2HVH A;  1B9K A;  3L3V A;  3PUF A;  1U4B A;  1SKR A;  3KJV A;  4HVJ A;  4CJE A;  1CXQ A;  4DF4 A;  1BGX T;  5IYC P;  1G15 A;  1TVR A;  1QNB A;  3O4N A;  4FJJ A;  2RKI A;  3OYL A;  4CJ3 A;  2D0A A;  3KLG A;  3NHG A;  1K6Y A;  2DFE A;  2B6A A;  1S6Q A;  2OA8 A;  4CF1 A;  4O5B A;  3FFI A;  5SWM A;  1LAV A;  4ROD B;  1X1P A;  3RMB A;  3DLK A;  3KK3 A;  1B92 A;  4FJ9 A;  1PCZ A;  2ATQ A;  3RWU A;  4CEC A;  1KY7 A;  4CGG A;  2P5O A;  4FYD A;  4M3Z A;  2LSN A;  3H1Z A;  1NK6 A;  4FK4 A;  1R4X A;  1C6V A;  1RBS A;  3OS2 A;  3L2U A;  4CEA A;  1NK8 A;  4AHS A;  5SZT A;  4RW8 A;  3L2R A;  4GMJ B;  2QXF A;  2XY7 A;  3KKR A;  1I39 A;  1BHL A;  3KIO A;  3T1A A;  1J9A A;  4DFK A;  2YKM A;  4L8R B;  4ELU A;  1YTB A;  4AHT A;  4WE1 A;  1HRH A;  1LWC A;  3IRX A;  4CJP A;  4FJ5 A;  1ZBI A;  1IG9 A;  3TWH A;  4QOZ B;  2A1S A;  3AVB A;  4OGC A;  3ZSO A;  3OJS A;  1WSI A;  1IKY A;  3B6O A;  2XY8 A;  3C95 A;  2IC3 A;  3NGI A;  5HRR A;  1CDW A;  1WSJ A;  3K59 A;  3CQ8 A;  1BI4 B;  1TAQ A;  4E7I A;  1TKX A;  3RMD A;  3PO5 A;  2G8W A;  1RT7 A;  4JLH A;  3VQ7 A;  4KFB A;  2KFN A;  2YV0 X;  3ZT1 A;  1EXQ A;  1HMV A;  3WNG A;  1HYS A;  2BGG A;  2KW4 A;  3OYD A;  4Z4I A;  4CK2 A;  3WNH A;  3EYZ A;  2JGU A;  3TAN A;  2X6S A;  1FKO A;  2PYJ A;  1U47 A;  4OVL A;  4B9U A;  5DK5 A;  4CJV A;  4M3U A;  1JLE A;  2VWK A;  3A2F A;  4CGF A;  2VJ0 A;  3NAE A;  3L8B A;  5J2Q A;  3MXM A;  4M3X A;  1EP4 A;  1JXB A;  1RT4 A;  3ZSX A;  3AVK A;  4FM2 A;  3SUP A;  3KLH A;  4EZ9 A;  1QE1 A;  2OPQ A;  3TAQ A;  1QN5 A;  4YFU A;  4N56 A;  3L2W A;  3TR8 A;  4FK0 A;  3K5O A;  3ZSR A;  4Q5V A;  2GUI A;  4E3S A;  1L3T A;  2D5R A;  3HP9 A;  4KKO A;  4KHY A;  3L2Q A;  3P1G A;  4QAG A;  1TBA B;  2KQ2 A;  4XIU A;  1SUQ A;  4N5S A;  4FW1 A;  4M3R A;  1REV A;  3SZ2 A;  2X74 A;  4NYN A;  4HUG A;  1NK0 A;  1QQC A;  1QTS A;  4B3O A;  3LP3 A;  5C25 A;  2ETJ A;  1DTQ A;  2VG7 A;  4DMN A;  1J54 A;  3I0S A;  3DM2 A;  4FLT A;  2OPR A;  1CZB A;  4C8K A;  4KPY A;  1RT2 A;  4NCA A;  3ZSV A;  1VTO A;  3HPH A;  4I7F A;  3MEE A;  3MXJ A;  4CJQ A;  3AVG A;  1BL3 A;  3L3U A;  4DSL A;  2HHU A;  1BCM A;  3F9K A;  4J2E A;  3WNE A;  1KSP A;  4OKE A;  3OYC A;  3UIQ A;  2WON A;  4B9V A;  4DQP A;  1ZBF A;  3QNO A;  1VSE A;  1FXX A;  4CHY A;  3HL8 A;  3G10 A;  4M41 A;  4ZTJ A;  5CYM A;  4CFA A;  2HND A;  5KRT A;  4DTU A;  1T05 A;  3KLE A;  3PO4 A;  4LSL A;  3SI6 A;  4J2D A;  3AVF A;  4QCL A;  1RDA A;  1I3A A;  1JL2 A;  1S9G A;  4CEB A;  1Q8I A;  2F96 A;  4IFY A;  4EP4 A;  3VQ6 A;  1JLG A;  4CK1 A;  3NF6 A;  4W5R A;  3OJU A;  1KYF A;  1KLM A;  3THV A;  1U49 A;  1QSY A;  4NCB A;  1LV5 A;  3ZT2 A;  4FZX C;  2X6N A;  4YNQ A;  2FBT A;  1HYV A;  4J2B A;  3OVN A;  4DQS A;  4CER A;  3TAP A;  4B9N A;  4FM0 A;  1HYZ A;  4DFP A;  4F2R A;  3QNN A;  4H4M A;  3O3F A;  1WSG A;  4DLG A;  3LAN A;  1VSM A;  3HM9 A;  1C9B B;  3C6T A;  4H8K A;  3T19 A;  3QEW A;  1NGM A;  1QN3 A;  3OYG A;  1ZBU A;  1UA1 A;  4DLE A;  2O4I A;  5C42 A;  3SQ4 A;  4FZZ A;  4ROE B;  1C1A A;  3CFR A;  3HO1 A;  2PZS A;  1DTT A;  3OS0 A;  3SNN A;  3JSM A;  1VRT A;  5KGX A;  3V81 A;  3RRH A;  3RMA A;  4PQU A;  2Z1H A;  4CES A;  4CJS A;  4DS5 A;  1ASW A;  3OYE A;  3VQQ A;  3KK2 A;  4CJK A;  3HVR A;  3LWL A;  2X78 A;  3VQB A;  4EP5 A;  3HK2 A;  1RTJ A;  3QEI A;  4E19 A;  4FLY A;  4ZTF A;  2Q3S A;  1TK0 A;  3P5J A;  3CM5 A;  4ROC B;  1W9H A;  4BE1 A;  1SL2 A;  4CJW A;  5HLF A;  4FJM A;  4B8A B;  3QER A;  3MED A;  1XWL A;  3QO9 A;  2D0C A;  4CF8 A;  3V9W A;  4I2Q A;  1UA0 A;  3OYF A;  4FM1 A;  1C0U A;  2HHX A;  2YNH A;  3VQP A;  4KTQ A;  4O44 A;  2RF2 A;  4FK2 A;  4AHC A;  2VWJ A;  4IG0 A;  3BDP A;  4FJX A;  4MFB A;  4DU3 A;  4F3O A;  4CHZ A;  4HUE A;  4DQQ A;  4FLV A;  2I5J A;  4ID5 A;  3VQE A;  3KLF A;  4DSE A; 
#chains in the Genus database with same CATH topology
 1I94 K;  1YXQ A;  4A62 A;  5JLF A;  3ZSQ A;  4CZF A;  1OH7 A;  4RTF D;  4DV6 K;  3AVA A;  4I9L A;  2JWK A;  3LL3 A;  4Y0W A;  5AQQ A;  3SPY A;  2OZS A;  4JD2 B;  4ELT A;  3OC3 C;  3QET A;  5LMN K;  3LDN A;  3I8B A;  2A1R A;  1C4G A;  1N3A A;  3LP0 A;  4Z4G A;  3M8Q A;  1ZBL A;  4PHT X;  4E0D A;  4EAJ A;  3D2E B;  3O3H A;  3I33 A;  4JNE A;  4N47 A;  3I8D A;  4YOV A;  3HI0 A;  3U6F A;  4FJH A;  4IEE A;  2OCE A;  1HNI A;  5KPZ A;  1NGA A;  3VPZ A;  1UL7 A;  1N8R O;  5ADX H;  3RMC A;  4EAL A;  1VQ4 N;  2HNY A;  1RTI A;  3I55 N;  4O0J A;  2IV9 A;  4Q11 A;  4H5V A;  4JK7 A;  3OYK A;  3T3F A;  3M5R A;  1JLB A;  3K9J A;  4MRQ A;  5AQY A;  3UKR A;  1KVB A;  5JN5 A;  4TSX A;  1B9F A;  1J3M A;  3DLR A;  3LWM A;  4FW2 A;  3M6G A;  4Z4C A;  3HT3 A;  4B8C A;  1VOK A;  3AO4 A;  3DLH A;  3J7A P;  3RVC A;  2O4G A;  1KYU A;  2XO7 A;  4OKJ A;  4AIL C;  3DRP A;  2HBM A;  4NCG A;  1T3V A;  1FW6 A;  2QK9 A;  1VQN N;  1R0A A;  3KLI A;  4I8O A;  4LSN A;  3RR7 A;  4X66 K;  1FK9 A;  4KI4 A;  3RRG A;  1IBM K;  5AQX A;  2YNF A;  4D7R A;  3NBP A;  3P39 A;  1C1B A;  1TUO A;  3TI0 A;  4FOE A;  4HUF A;  4H0O A;  3SMS A;  4CI6 A;  4QS9 A;  2W40 A;  4B3R K;  1YI2 N;  3A5N C;  3QIN A;  3PDK A;  3VQC A;  3QFP A;  4HHT A;  3EE9 A;  2Y8L A;  2XY6 A;  4H5N A;  1RDC A;  4ILH A;  4XH5 A;  4ILG B;  1S1U A;  2KLA A;  3EZW A;  4B9S A;  2EWS A;  3AO5 A;  1GLA G;  2FC0 A;  4IDH A;  1LOT B;  4NXN K;  4OPJ A;  1HKG A;  1OH6 A;  1HQE A;  1BO5 O;  1XQS C;  3LPU A;  4BRK A;  1VQ9 N;  3P83 D;  4OJR A;  1NJY A;  1C0M A;  2UU9 K;  5GIP A;  1RM1 A;  4J2A A;  2F8S A;  1HNX K;  1RDB A;  1YT3 A;  4JHD B;  1NNE A;  2Z8U A;  3H1V X;  2NRR A;  1ILY A;  2YNG A;  3V6D A;  2HL8 A;  3AO3 A;  3BP8 A;  1J5O A;  1S6P A;  4PKG A;  3DLB A;  5JMV A;  4ILJ A;  1E4G T;  2ZQB A;  3LM9 A;  5AZJ A;  3I0W A;  1ASU A;  2ZM6 K;  3VN5 A;  2D4W A;  4C8N A;  4E7H A;  4DTN A;  1KRP A;  1BIU A;  2Z0F A;  4FWK A;  4LH5 A;  1GLD G;  4K0K K;  1GOB A;  2HHS A;  3L2V A;  3QEX A;  3OA9 A;  2KTQ A;  3KTQ A;  5AQS A;  4EJY A;  3TE5 A;  4HTL A;  3FE1 A;  1W0H A;  1FN7 A;  1ZYQ A;  4EAI A;  1BQN A;  1VSJ A;  2ZJR L;  3OH9 A;  3UB5 A;  2OTL N;  5AQF A;  4JK8 A;  4CF0 A;  2HZS A;  1VSK A;  3KK7 A;  4DQ8 A;  2O8F B;  4V19 S;  4M42 A;  1ESV A;  3OYI A;  1S9E A;  3TAG A;  2WOM A;  4A61 A;  3HTV A;  3ITH A;  5EPC A;  3WXL A;  2P9P A;  3VF4 A;  3SV3 A;  3V9Z A;  4CBX A;  1GOC A;  5FRO A;  1KTQ A;  3C04 A;  2IS3 A;  3RTV A;  1QN6 A;  5C2D A;  3V4I A;  4BGA A;  1D9F A;  4BRP A;  4E1N A;  3K57 A;  5M1O A;  3IG1 A;  3A5M C;  4Z4E A;  5CY4 A;  3QBX A;  2P9L B;  4PKI A;  2E6M A;  1CLQ A;  3UE5 A;  1KFQ A;  3QEP A;  1YQM A;  2NRH A;  5FRM A;  3CQX A;  2QRE A;  2QXL A;  4JRQ A;  3OY9 A;  3ULE A;  2OTJ N;  2ZF5 O;  4B1X B;  3WXI A;  4F9O A;  3ENO C;  2WUS A;  1RNH A;  4EHU A;  1T8E A;  3LDP A;  2D0B A;  4JKB A;  4KTW A;  5HRP A;  3TPQ A;  3SUQ A;  3GOI A;  4LH4 A;  1D8Y A;  1BA1 A;  5E26 A;  4DSK A;  1KY6 A;  3AY9 A;  3U3Y A;  4GNI A;  4B1U B;  2O3O A;  2ASP A;  1CZ9 A;  4IXC A;  3NCI A;  5DM7 L;  2AA4 A;  3EAY A;  2DFF A;  1QHT A;  2RHK A;  3CFO A;  3FZK A;  3HPG A;  4KRF A;  5I9E B;  1DGK N;  3C94 A;  1T03 A;  1ASV A;  1W80 A;  1K35 A;  4ID1 A;  4DTR A;  4BRF A;  4KRE A;  1HR0 K;  4C8O A;  4GKK K;  4LF5 K;  3PY8 A;  3VQ5 A;  3AA3 A;  3HYF A;  5EOY A;  1K2Y X;  4B0A A;  1NGC A;  2PWW A;  2QR1 A;  3TSP A;  2E6L A;  3MAQ A;  4BWM A;  3THW B;  2HBL A;  1T6A A;  1RT5 A;  1XC9 A;  1S5J A;  2UYT A;  2HNZ A;  2P9S B;  2QWQ A;  1R59 O;  5LY3 A;  3ATU A;  4M3W A;  3B8A X;  1O1W A;  3ZSY A;  1HQU A;  1X3N A;  2I7N A;  1BG3 A;  1XUP O;  3TAE A;  4C1N K;  1F21 A;  2HVH A;  3CWU A;  1SKR A;  3BUZ B;  3KJV A;  4HVJ A;  1G15 A;  1TVR A;  3MDQ A;  1IG8 A;  1VKL A;  4CJ3 A;  1DIZ A;  1NGE A;  5BPL A;  2BH1 A;  1DEJ A;  1X1P A;  4BRC A;  2I7P A;  1PCZ A;  2P5O A;  4WQ5 C;  3ENO A;  1E3M A;  3H1Z A;  1C6V A;  1QQN A;  1RBS A;  4I6M B;  4BG8 A;  4RW8 A;  4GMJ B;  4K42 A;  4C1N I;  1YIJ N;  3NVM A;  2HF4 A;  1J9A A;  3T1A A;  4DFK A;  3U8X A;  4ELU A;  4GVE A;  2FSJ A;  4AHT A;  4WE1 A;  2F4V K;  3TWH A;  4OGC A;  2P9N B;  4BRM A;  1IKY A;  3NGI A;  2IC3 A;  4M63 C;  5GIN A;  3MWT A;  4WFN L;  3RMD A;  3E9P A;  4PL7 A;  3UKU B;  3CCM N;  3VQ7 A;  2WFB A;  1RFQ A;  2YV0 X;  4C7P A;  3ZT1 A;  5E84 A;  1W7A A;  3OYD A;  2W6K A;  2JGU A;  4WXA A;  2X6S A;  1FKO A;  4B1Z A;  1HX1 A;  3H45 C;  2E1Z A;  3CCV N;  2O8E A;  3A2F A;  2QA4 N;  4M7Y A;  3NAE A;  3L8B A;  1NM1 A;  1RT4 A;  5AZJ B;  3ZSX A;  3AVK A;  4FM2 A;  3SUP A;  3KLH A;  1KAY A;  4JKF A;  3CC7 N;  4EZ9 A;  1KC8 O;  3IMX A;  3BZC A;  3K5O A;  4B3S K;  3AAP A;  4E3S A;  2Q36 A;  2WC9 A;  1L3T A;  5TKY A;  4KKO A;  3L2Q A;  3P1G A;  1SUQ A;  3SZ2 A;  4M3R A;  4DV2 K;  2GEL A;  3CJ9 A;  4O5F A;  3MN5 A;  3F10 A;  2YHY A;  2VCP A;  1DTQ A;  2VG7 A;  4HWI A;  1VQM N;  1EO1 A;  1ZC6 A;  1VTO A;  1OH5 A;  3MEE A;  1T6C A;  3MXJ A;  4DSL A;  3AVG A;  2HHU A;  5BN8 A;  3GG4 A;  4OKE A;  3UIQ A;  4B9V A;  1M3H A;  3QNO A;  2HND A;  5KRT A;  3VET A;  5BR9 A;  3KLE A;  4WQ5 A;  3PO4 A;  4NXM K;  1JL2 A;  1S9G A;  3A5O C;  3CJC A;  3OJU A;  1JLG A;  1QSY A;  3NF6 A;  2HW3 A;  3ZT2 A;  4YNQ A;  3J80 O;  4FSV A;  4BRQ A;  2NOB A;  2Q0R A;  4DFP A;  1E4F T;  1ZXO A;  3O3F A;  4DLG A;  3VEZ A;  4NB4 A;  3D2E A;  2GX9 A;  2E88 A;  1C9B B;  2HBJ A;  4DUZ K;  1NGM A;  2IIR A;  4DKW A;  4YY3 K;  4H0X B;  4DLE A;  2UXD K;  3VER A;  3OST A;  3RMA A;  5ADX A;  4KH6 A;  2QWL A;  3CVS A;  5H1S Q;  3HVR A;  3LWL A;  1H1V A;  3C65 A;  3VQB A;  1RTJ A;  4E19 A;  4FLY A;  3P5J A;  2A5X A;  4BE1 A;  1V4T A;  5HLF A;  1XWL A;  4DR4 K;  2D0C A;  4CD3 A;  2HST A;  4IG0 A;  3BDP A;  3FR0 A;  2IVP A;  4CHZ A;  1NMD A;  4FLV A;  3A8Y A;  2I5J A;  3VQE A;  3MCA B;  1V5S A;  1M3Q A;  1ZBS A;  4A2B A;  4JI0 K;  2HHW A;  3SCX A;  4W5Q A;  3KZB A;  3SNS A;  2Y1J A;  3ZT0 A;  4DF8 A;  4PWD A;  2ZWH A;  2HKP A;  2DKA A;  3RPJ A;  1KFD A;  2FBV A;  5GAG P;  4AHR A;  1TL1 A;  3AO2 A;  4ISE A;  3CVT A;  4EJZ A;  3U9Z A;  3BKQ X;  3HXM A;  1YJW N;  1OVQ A;  3VOV A;  2RN2 A;  4BY9 C;  5AQG A;  1HU0 A;  3P38 A;  4JKE A;  4DR1 K;  4W5N A;  4IZ9 A;  4H5T A;  3UW2 A;  3CJ1 A;  4RG8 A;  1SS6 A;  2GBZ A;  4FVU A;  1RDU A;  5EX5 A;  4LY7 A;  2QKB A;  2ZFD B;  3TAB A;  4AM6 A;  3KWI A;  3MXI A;  2EHB D;  4JS5 A;  1KFI A;  1V4S A;  4DQI A;  3WNF A;  3BF1 A;  2XHB A;  4KHQ A;  4UY8 O;  1VSF A;  3B6P A;  3NE6 A;  4OLA A;  3S3O A;  4CZG A;  4CEZ A;  3OS1 A;  2Z1J A;  2GUP A;  4OPK A;  3BY5 A;  3I0R A;  2E2Q A;  2UXB K;  4GVM A;  1NOZ A;  3FZL A;  5C12 A;  1YTA A;  4KTZ A;  3EEQ A;  2P5G A;  3KD5 E;  3AGR A;  2DY4 A;  4H03 B;  4O4G A;  5I42 A;  1BOT O;  3V1R A;  3DLL L;  1S1T A;  5JLH A;  2ZD1 A;  4RW9 A;  4C8L A;  3LP1 A;  3GL1 A;  4IDK A;  1P8Z A;  4JKG B;  4FZY A;  2G8H A;  3ALY A;  3S3M A;  5JS2 A;  2XRI A;  3CCE N;  3DXM A;  5HRO A;  4BRI A;  2VWB A;  4PUO A;  2EX3 A;  1QNE A;  3K9K A;  1KYD A;  5I3U A;  3ZX2 A;  4JRP A;  1TK8 A;  2W42 A;  3E01 A;  3C6U A;  3IKM A;  3CCJ N;  3DI6 A;  5AQV A;  2ZGZ A;  3E1Y A;  4CHN A;  3CCQ N;  4X65 K;  3FZM A;  1WLJ A;  4PY5 A;  4BDZ A;  5M1N A;  2NRW A;  2H3G X;  2Q2R A;  4U7B A;  1S1X A;  3O08 A;  4FCY A;  4AM7 A;  4CJ4 A;  2FBY A;  1OKJ A;  5FRN A;  5DMR A;  4LF8 K;  3THY B;  2HHH K;  2Q0U A;  4FXD A;  3FZH A;  4OLB A;  4DTX A;  3R8E A;  3SBG A;  4FJK A;  2G8U A;  1IKX A;  1NGF A;  2HOE A;  2P9L A;  5BRE A;  4LC9 B;  4PA1 A;  1X9W A;  4I2P A;  1X9J A;  3EKU A;  2FSN A;  4CIE A;  3NH1 A;  1G99 A;  3AO1 A;  4BVO A;  1HPZ A;  4W5T A;  1U6Z A;  3GBT A;  1YQK A;  1B9D A;  3VGM A;  1NH2 A;  4FOI A;  4H4O A;  1GLC G;  1XHZ A;  4IJN A;  5CHI A;  4BAC A;  2LAE A;  3H08 A;  1YUW A;  4ICL A;  5D3G A;  3DLG A;  4CGJ A;  4DQR A;  3AAQ A;  4F8R A;  3O8M A;  3MN7 A;  3AA4 A;  2BE2 A;  5JIC A;  3OYM A;  3J7Z O;  3R1X A;  3H3O B;  4KH4 A;  4IKF A;  1CZA N;  4FVM A;  4E7J A;  1DLO A;  3D0P A;  1YVU A;  1TKD A;  2IAJ A;  2O8B A;  3NGZ A;  1D5A A;  3NH0 A;  2IVO A;  4FLX A;  5C15 A;  1JLA A;  3K0S A;  1TUY A;  3F2K A;  4CBU A;  4WFB L;  4W5O A;  4JKD A;  4JI5 K;  4E1M A;  1TL3 A;  1BIS A;  3FZF A;  3SAF A;  2ZJP L;  1IH7 A;  3MN9 A;  5JMV D;  4KAZ A;  3DLE A;  5GAH P;  3WUH A;  3THW A;  5MLC Q;  2IOC A;  1XHX A;  3A5L C;  1K73 O;  4CEF A;  5AQL A;  1N5Y A;  4WQ4 C;  1YTU A;  2P9S A;  4BR2 A;  1NMN A;  3G6E N;  3MEG A;  1LWE A;  2QWM A;  2ZJQ L;  4E89 A;  5A2Q O;  3V1Q A;  5FPE A;  3T69 A;  3R3L A;  3QES A;  4I9Q A;  3LZJ A;  1HNW K;  1SV5 A;  4FJN A;  1N34 K;  4OX9 K;  4K25 A;  4EFH A;  5AFU H;  1KLN A;  1C0G A;  4FWR A;  5LL6 Z;  1L5U A;  3GDQ A;  4BRO A;  4FWN A;  4FPB A;  1UT7 A;  4BVP A;  2R7Y A;  2KZZ A;  3LPT A;  1HKB A;  1WSH A;  2HZM A;  3HJF A;  1NJW A;  5KPT A;  3H3N O;  4EHT A;  3QDK A;  4CJ7 A;  4B9T A;  5AQU A;  1IBL K;  4KHW A;  4I6M A;  5M1P A;  4LD0 A;  1Q86 O;  2V8Q A;  2A42 A;  1RBV A;  3O4W A;  3HZ6 A;  1VQO N;  4MLE A;  5BN9 A;  1QTM A;  5JS1 A;  3VGK A;  1N3C A;  1S1V A;  4ELV A;  2OAN A;  1SL0 A;  1Q9X A;  2P9N A;  4A57 A;  3LAL A;  1SKW A;  4GW6 A;  3VF6 A;  3PIP L;  2WTU A;  4K8Z A;  2YKN A;  2NNW A;  3UKU A;  2Y1I A;  4M45 A;  2NRV A;  2G30 A;  4UQG A;  5HP1 A;  5KL0 A;  3CCL N;  1GOA A;  3BGR A;  5IWA K;  1YTF A;  3SQ1 A;  2KZM A;  2DPN A;  1MPG A;  4F4K A;  4KB0 A;  3W0L A;  4NYF A;  3G4S N;  4M3Y A;  3MWP A;  2P9U B;  3MMV A;  1RT1 A;  4DG1 A;  4FPA A;  1QZ5 A;  1RTH A;  4GY2 B;  1NGI A;  5J2N A;  3ENH A;  3KWG A;  3SV4 A;  3KTU A;  3LDS A;  3CFP A;  1NKC A;  2DTU A;  3QLH A;  1B9K A;  3LDQ A;  3ENB A;  1BGX T;  2KKZ A;  5IYC P;  1QNB A;  4FJJ A;  4LFC K;  3NHG A;  2D0A A;  3DXM B;  4IEI A;  2B6A A;  3O9R A;  5SWM A;  3KK3 A;  4TPS A;  3AAR A;  2ATQ A;  3RWU A;  1KY7 A;  2QM1 A;  3C6H A;  4BRE A;  4FYD A;  2NZT A;  4M3Z A;  4FK4 A;  1BA0 A;  1R4X A;  2O8D A;  3OS2 A;  3Q7C A;  1NK8 A;  5SZT A;  2AP1 A;  4BQZ A;  4BC4 A;  1I39 A;  3KIO A;  1HRH A;  3IRX A;  4CJP A;  4FJ5 A;  4QOZ B;  2A1S A;  3ZSO A;  3N4P A;  4AF1 A;  1VQK N;  3OJS A;  3FFK B;  5HRR A;  3SJH A;  1D4X A;  5FPM A;  2G8W A;  5BRF A;  1EWQ A;  4FWL A;  2CH5 A;  3O6W A;  3ZEU A;  2FUV A;  4R79 A;  4X62 K;  3TAN A;  2PYJ A;  4OVL A;  5DK5 A;  4CJV A;  2VWK A;  4CGF A;  3O5B A;  4CZL A;  4LFA K;  4NLB A;  4M7X A;  3E9O A;  4WF9 L;  2HMP A;  3DXK B;  4N56 A;  2YHW A;  2GUI A;  1WBD A;  5KQ8 A;  2QTD A;  3LDL A;  4XIU A;  3I0X A;  3A0I X;  4NYN A;  1NK0 A;  1QQC A;  1RGI A;  3LP3 A;  2ETJ A;  4DV4 K;  1J54 A;  3DPU A;  3DM2 A;  4FLT A;  3FGU A;  1RT2 A;  2E2N A;  4KPY A;  1RDW X;  1T6D A;  4I7F A;  4CVN E;  1BL3 A;  1ATN A;  4DQP A;  5HSH A;  2O8B B;  1VSE A;  3IDH A;  3EO3 A;  5CE3 A;  1PCM X;  3VMF B;  3SI6 A;  4J2D A;  5AZI B;  3DAW A;  3VEO A;  3OLP A;  1RDA A;  4BRD A;  4QCL A;  4W5R A;  3VQ6 A;  4CK1 A;  2NLV A;  2QLV A;  3OBW A;  1KYF A;  1LV5 A;  4FZX C;  2X6N A;  4CER A;  4WYB A;  4B9N A;  2D0O A;  3AGK A;  3QNN A;  4CFF A;  4H4M A;  2JWL A;  1WSG A;  2MZ8 A;  3HM9 A;  4H8K A;  3T19 A;  3CJ7 A;  3S41 A;  3DWL A;  4FL9 A;  2JHN A;  1ZBU A;  3QFU A;  3WEE B;  1UA1 A;  2O4I A;  3CWT A;  1WJW A;  3PMG A;  3L0Q A;  1N33 K;  1DTT A;  3OS0 A;  1JJ2 M;  3JSM A;  1VRT A;  3CJA A;  3OYE A;  3KK2 A;  2FGT A;  4CJK A;  3DPT A;  4PL8 A;  5AQJ A;  3J81 O;  3L6Q A;  3SAG A;  1LWV A;  2PBD A;  3CWS A;  3O9Q A;  4A5B A;  1TK0 A;  2Q3S A;  3CM5 A;  1W9H A;  4CZK A;  4CJW A;  4FJM A;  4B8A B;  3D7Q A;  3M3Z A;  1KO9 A;  3VEX A;  3TTD A;  4KHP K;  4MFB A;  3CC2 N;  3RSE B;  4DSE A;  3LAM A;  3AVH A;  1NGG A;  3SAH A;  1RBU A;  4CJL A;  2O8C A;  2A41 A;  1NG9 A;  3W3D A;  2FKM X;  4DS4 A;  3ZYY X;  3OCI A;  4IG3 A;  4B9M A;  4JKG A;  3NH2 A;  3CET A;  4YOW A;  1TYQ B;  3DYA A;  2V9J A;  1VQ8 N;  3VQ4 A;  3ZCM A;  1LW0 A;  3EKS A;  4CFD A;  2E20 A;  3K5M A;  3CCS N;  5IYB P;  3LZI A;  4YOU A;  4IBN A;  3IUC A;  4CHO A;  1ZBH A;  4F3T A;  2BTF A;  1YQL A;  4DV5 K;  3P31 A;  3CW7 A;  1XI1 A;  3AVI A;  5CZ1 A;  1WN7 A;  3CQY A;  5C0Y A;  3T7Z A;  1MDU B;  3C7N A;  2Q31 A;  3SUN A;  3QML A;  1HPM A;  3AA5 X;  3VQ8 A;  3G0Z A;  4CFB A;  2E1Y A;  1Z6R A;  3CM6 A;  2ZE2 A;  3M8S A;  2G8V A;  1KXP A;  3AVJ A;  4OKK A;  3TTC A;  3K2P A;  1YQR A;  1C47 A;  3THY A;  3THX A;  1W97 L;  1X3M A;  1JDY A;  3PV8 A;  3GE1 A;  3WXM B;  5HBM A;  1QN8 A;  2B5J A;  4CJT A;  1UOC A;  2V52 B;  4YHH K;  2OOY A;  1TBP A;  1VQL N;  3H6E A;  2UUB K;  1VK0 A;  1J53 A;  5J2M A;  2O8D B;  5M1Q A;  3SYZ A;  2NLX A;  2RPI A;  3OYN A;  4ZHR A;  1QTP A;  4HJH A;  3E66 A;  1NLV A;  3JYT A;  2NVM A;  2V7Z A;  1SKS A;  4DTM A;  2PYL A;  1ATS A;  3V9U A;  1HLU A;  1UT4 A;  2XY5 A;  2CH6 A;  4M3T A;  4BDP A;  1JKH A;  3T4N A;  2BDP A;  2V7Y A;  4E1J A;  1PVS A;  3F0Z A;  4CE9 A;  2VG5 A;  4DTP A;  3TU5 A;  3K5N A;  1YHQ N;  2KFZ A;  3VTI A;  3OYH A;  3F9M A;  4XH1 A;  3PX0 A;  3SJJ A;  4DSJ A;  5LMU K;  3ZEU B;  2VGM A;  1VSI A;  1VOL B;  3N89 A;  3RSM A;  4FLW A;  3TAF A;  2OPS A;  2FF6 A;  3VA0 A;  2D0P A;  1NKB A;  3JXU A;  2YI1 A;  2QKK A;  1TGH A;  4Z4F A;  3VEW A;  3ZSW A;  4Y1D A;  4LF6 K;  1WUA A;  2A3Z A;  2DFH A;  1RCH A;  2FF3 B;  4HCB A;  3HSC A;  2E8A A;  4JI4 K;  2OOX A;  2PY5 A;  4A5A A;  2UXC K;  3HS9 A;  2YA3 A;  1SZ2 A;  4AHV A;  4YOT A;  4CJ5 A;  1KFS A;  1BIZ A;  3EN9 A;  2FXU A;  2GV9 A;  5C2F A;  3F73 A;  1LW2 A;  2FBX A;  5IT9 O;  4AH9 A;  1HKC A;  1EX4 A;  3CWA A;  2IGI A;  5E41 A;  2J4R A;  5EU7 A;  1QVF M;  4CF2 A;  3HP6 A;  4FLU A;  1X9S A;  3ISN C;  4G1Q A;  3QIO A;  4MDA A;  3MK6 A;  2IDO A;  4H0Y B;  3VQ9 A;  1A5X A;  2Y8Q A;  3OYB A;  1KVA A;  1GLE G;  1WAJ A;  4DR5 K;  4EZ6 A;  2JLE A;  3VQD A;  4JYA K;  4BG9 A;  4FWO A;  4DWI A;  2G8K A;  1EET A;  3V9X A;  1JCE A;  4CD1 A;  2NRZ A;  2VYP A;  4IO8 A;  1Y97 A;  4DU4 A;  3LDO A;  4R5P A;  4DR3 K;  3S3N A;  4YDU C;  2G8I A;  3NFA A;  4PKH A;  4DFM A;  1MU2 A;  1U04 A;  2P1J A;  4CEQ A;  2EHG A;  3R6M A;  4O55 A;  5BMN A;  5C10 A;  3ID8 A;  3SMP A;  2HHQ A;  3TDH A;  3KHY A;  4QS8 A;  4CF9 A;  2ITM A;  1NGB A;  4GV3 A;  1QZ6 A;  2HB5 A;  1JL1 A;  4CK3 A;  4DTS A;  4B3T K;  4Y1C A;  5HOO A;  4KO0 A;  4DSI A;  3CXC M;  2GTD A;  3QIP A;  1VSL A;  1C1C A;  4B1V A;  3AVC A;  3NGY A;  3V9S A;  1QVG M;  4JKH A;  4BE2 A;  1TKT A;  1IJJ A;  1RDD A;  5AN4 A;  4KH5 A;  5C24 A;  4BR9 A;  1RTD A;  4A2A A;  1KD1 O;  1KCF A;  2P9U A;  4CIF A;  4DV3 K;  3M8R A;  1TV6 A;  2NOE A;  2MJ7 A;  2VG6 A;  3OTO K;  1VSH A;  2O8C B;  4JEP A;  4BDY A;  1RBR A;  4KHU A;  1N32 K;  1RBT A;  3C6A A;  2HHT A;  3SBT A;  3SQ2 A;  1NVP A;  3NMU A;  3K5L A;  3CIP A;  1IV0 A;  3AV9 A;  3CCU N;  3VA3 A;  2V92 A;  1N39 A;  4WFA L;  3SK3 A;  2OYQ A;  4CED A;  1UAX A;  3CER A;  1LCU A;  1CXU A;  3O1W A;  1NOY A;  2QW9 A;  4RW4 A;  3R9P A;  2RE2 A;  4DCH A;  3HPO A;  5AQR A;  2D1K A;  1VRU A;  3LAK A;  4DU1 A;  4QS7 A;  4N76 A;  2Z1G A;  4E7L A;  3DJC A;  2DKD A;  3O9T A;  1GLB G;  2HVI A;  3OSE A;  4YDU A;  5HRN A;  3C7N B;  4MDB A;  4LF4 K;  1L3U A;  3WXK A;  5HRS A;  1Q9U A;  4RW7 A;  1Y64 A;  4IFV A;  3D2F B;  3VES A;  3VEV A;  4WZS D;  3PX6 A;  2YHB A;  5F0X A;  3HST B;  1HNV A;  3MX5 A;  4KHN A;  3THX B;  2FLO A;  4DR2 K;  2IV8 A;  1Q18 A;  4B9Q A;  5AQH A;  2H4L X;  4GV6 A;  1WQA A;  4GKJ K;  3V1O A;  3CG7 A;  1WB9 A;  3ZT3 A;  3F5T A;  4Z94 A;  2VQF K;  1C0T A;  4KI6 A;  1FJG K;  3IFR A;  1VQ5 N;  4X64 K;  3H1Q A;  2JPI A;  1UWB A;  1IKV A;  4YOX A;  4FJ8 A;  3CMA N;  4FWP A;  2YCH A;  4IWV A;  1L3S A;  3H46 O;  3QEV A;  2OZM A;  3AVN A;  1TAU A;  3PUF A;  3L3V A;  3PLA A;  3DXK A;  4CJE A;  4DF4 A;  3L4Q A;  3NVK A;  1JCF A;  3KLG A;  1K6Y A;  1S6Q A;  5M1K A;  2YHX A;  2OA8 A;  1K8K B;  3FLC O;  4CF1 A;  3FFI A;  1LAV A;  1OH8 A;  3RMB A;  4CEC A;  4CGG A;  5GIO A;  1NK6 A;  3MCP A;  3VEN A;  1XMO K;  3C0B A;  4AHS A;  2QXF A;  2VGN A;  4BR7 A;  3CHW A;  2WBN A;  4CZI A;  2GEM A;  1IG9 A;  3AVB A;  3HOT A;  1QHA A;  5AZI A;  1WSI A;  3K59 A;  2XY8 A;  1CDW A;  1WSJ A;  1BI4 B;  5ELZ A;  3ENC A;  3PO5 A;  4BR5 A;  1NU0 A;  2F7L A;  1RT7 A;  5LJV A;  2KFN A;  2HBK A;  2P9K B;  5BPN A;  1EXQ A;  3CPE A;  4YOY A;  1HYS A;  2BGG A;  1U2V A;  2KW4 A;  4O8U A;  3VGL A;  4Z4I A;  4RWT A;  3WNH A;  3EYZ A;  1C0F A;  4B9U A;  2UUC K;  3BF3 A;  3WEE A;  4WX8 A;  5J2Q A;  3MXM A;  1NGJ A;  1JXB A;  4K41 A;  5KPR A;  3ZET B;  2NRT A;  1QE1 A;  3TAQ A;  1QN5 A;  4YFU A;  3L2W A;  4FK0 A;  3TR8 A;  4BGB A;  3ZSR A;  2IVN A;  3BEX A;  5JVG L;  1HUX A;  4KHY A;  1TBA B;  2KQ2 A;  4N5S A;  2FSK A;  1REV A;  1QTS A;  4B3O A;  4DHY A;  3TSQ A;  4DMN A;  3I0S A;  4JV5 K;  3G71 N;  4WCE L;  4C8K A;  4MO4 A;  3ZSV A;  3OW2 M;  4EAH D;  4CJQ A;  3L3U A;  3F9K A;  3QBW A;  1KSP A;  1GLL O;  3RSE A;  5M1F A;  2WON A;  2NRX A;  1XNR K;  3HL8 A;  3G10 A;  4BRA A;  5CYM A;  5LJW A;  4LSL A;  3AVF A;  4J8F A;  1MWM A;  4IFY A;  1Q8I A;  1NGH A;  3THV A;  4NLC A;  4NCB A;  1TYQ A;  4XEI A;  5AQN A;  4IOX A;  1HYV A;  3MX2 A;  3OVN A;  4DQS A;  1QQM A;  1J5E K;  1HYZ A;  4F2R A;  2NOI A;  2F9T A;  3LAN A;  2R5X A;  1VSM A;  1BWF O;  2QWP A;  4O8K A;  1MA9 B;  1SQK A;  2QWR A;  4FWS A;  1QN3 A;  5KQD A;  2P9I A;  3OYG A;  3WQT A;  4RCH A;  4B1W B;  2NOH A;  4FZZ A;  4ROE B;  3CFR A;  3HO1 A;  3CF5 L;  4CZH A;  3SNN A;  3V81 A;  3RRH A;  2Z1H A;  5GAD P;  3CC4 N;  4CES A;  4CJS A;  1GLF O;  1ASW A;  4DB3 A;  4FWM A;  4BRG A;  2X78 A;  2W41 A;  3QEI A;  4WQ4 A;  1S72 N;  4ISG A;  3JS6 A;  5B8H A;  3QER A;  3OGD A;  3V9W A;  4I2Q A;  3CCR N;  3ZX0 A;  1UA0 A;  2BUP A;  4EAK A;  2A6A A;  2HHX A;  2YNH A;  3VQP A;  4KTQ A;  4FK2 A;  4AHC A;  3PSI A;  4DU3 A;  5BPM A;  4ID5 A;  3KLF A;  5F2R A;  4BRH A;  2JHJ A;  1XNQ K;  2ITG A;  2GWK A;  2NOF A;  3O3G A;  4Z0U A;  3EZ5 A;  3JAM O;  1W2B M;  3TAM A;  4B1Y B;  1WSF A;  4MQ3 A;  3LM2 A;  4CGD A;  1M1K O;  4B3M K;  3QIC A;  3NF8 A;  1IO2 A;  3O4Q A;  5TKW A;  4KB1 A;  1S3X A;  3VQA A;  1NGD A;  1LXT A;  4CZE A;  4DV1 K;  1JLQ A;  4G9Z A;  1JLC A;  4CJR A;  3G25 A;  1QSS A;  3PSF A;  1BDG A;  4CHQ A;  1SL1 A;  3PIO L;  4Q0B A;  3OHR A;  3TSU A;  3KD1 E;  1QNC A;  4IOC L;  2P51 A;  3OYJ A;  4CIG A;  2NUB A;  4IOA L;  2Q1N A;  1QN7 A;  1WSE A;  1VTL E;  3SLC A;  5AQZ A;  4FJL A;  4CBW A;  2A40 A;  3M1F A;  1EKE A;  3NDK A;  1NWK A;  1NJX A;  4H5W A;  3U4L A;  1VAZ A;  3ATV A;  4JKC A;  4JS4 A;  3ZT4 A;  4OO1 J;  1KVC A;  3SQ0 A;  1A5V A;  3EE8 A;  4HTU A;  2QI2 A;  4OPH A;  1Z25 A;  1YJ9 N;  3HOS A;  3OYA A;  1RT3 A;  1KAZ A;  1S1W A;  1PCJ X;  2Z1I A;  1XMQ K;  1NJI O;  5AQI A;  4JI2 K;  1P5G X;  3T1Y K;  1VQP N;  4NO7 A;  2F8T A;  4OGE A;  2HF3 A;  1NK7 A;  1IKW A;  3ZSZ A;  1YIT N;  3NA5 A;  4KV8 A;  5EXW A;  2YHA A;  3O1B A;  1U48 A;  1L3V A;  1RT6 A;  1XC3 A;  4L3Q A;  3WT0 A;  2HHV A;  4CGI A;  2YNI A;  1X9M A;  2QRD A;  3DOK A;  3M8P A;  3EIK A;  5KGW A;  1E42 A;  1TK5 A;  1U2V B;  2ASO A;  4DUY K;  3E9L A;  4U67 L;  1DKG D;  3OBY A;  5KRS A;  3DMJ A;  2CGK A;  3KRM A;  5J1E A;  1Q9Y A;  4AQY K;  3MEC A;  4CHP A;  2OPP A;  5BMP A;  3P4I A;  1TKZ A;  3U9D A;  1OVY A;  2QEX N;  1P5D X;  1KQS M;  3I3W A;  3AVM A;  3D45 A;  1O13 A;  1HJR A;  3NF7 A;  1WNS A;  4CJU A;  5AQK A;  1D3U A;  2PFU A;  1BCO A;  5IYD P;  4CZM A;  3UKR B;  1Q81 O;  4DR7 K;  4CJF A;  4C23 A;  3I56 N;  4BRN A;  1ATR A;  4C8M A;  1VHX A;  5KI6 A;  1EUV A;  3N4Q A;  4CEE A;  4B9L A;  5FDL A;  3PX4 A;  2G8F A;  1YVN A;  4O0I A;  2YJE A;  1NK5 A;  2GWJ A;  1T44 A;  5BRH A;  4H0V B;  5AQO A;  1N6Q A;  2HL9 A;  1WAF A;  4MO5 A;  3TAR A;  1JFI C;  1P90 A;  1MP9 A;  4CW7 B;  5HL7 L;  3J8A A;  4K8X A;  2CGJ A;  5CR4 A;  1IBK K;  2AJQ A;  1NBW A;  4FWQ A;  5K14 A;  4KHS A;  2B4J A;  4B08 A;  1QS4 A;  4LF7 K;  3D4V A;  5FLX O;  2QWO A;  4RW6 A;  4BWJ A;  5F1X A;  4BR0 A;  4BC5 A;  1JXE A;  3IH7 A;  2P9I B;  1WBB A;  2BAN A;  1Q82 O;  1T7P A;  1QQO A;  1Z26 A;  5CZ2 A;  4DR6 K;  1AIS A;  3KKS A;  4CEO A;  3DOL A;  3DRR A;  3DRS A;  4DTO A;  4DFJ A;  4BC2 A;  3SPZ A;  4FJ7 A;  1TGO A;  3SUO A;  3D2F A;  2V51 B;  4IL8 A;  3ULX A;  1QN9 A;  3VTH A;  1VSD A;  3O80 A;  1LWF A;  2ASM A;  2F9W A;  3ULD A;  4DTJ A;  1BUP A;  4BJU A;  3AA2 A;  4BRL A;  4CCH A;  3HS8 A;  1RIL A;  3RR8 A;  4JKA A;  3L4I A;  5J2P A;  5T7B A;  2QWN A;  4AHU A;  3OH6 A;  1LAW A;  2NWV A;  2VQE K;  3CYM A;  4E7K A;  4BC3 A;  4JI6 K;  2HMI A;  1A5W A;  4JI3 K;  4DUL A;  3S9H A;  1NJZ A;  1K8A O;  1K8K A;  3LP2 A;  3ASM A;  1D9D A;  3VF2 A;  4CGH A;  2YX6 A;  1VQ7 N;  4XH4 A;  1NKE A;  3CD6 N;  1DT9 A;  1FKP A;  3AVL A;  4CFC A;  5EVZ A;  1Q7Y O;  4H5R A;  4FLZ A;  4JK9 A;  1QN4 A;  3HVT A;  1JLF A;  2ZGY A;  4D7Q A;  3MN6 A;  4LFB K;  2E2P A;  1BU6 O;  3EY1 A;  4K43 A;  1PZD A;  4F2S A;  2P9P B;  3NF9 A;  4JD2 A;  2E4L A;  1NK9 A;  3IS9 A;  4IJA A;  1LWY A;  4Z4H A;  3HBT A;  3QB0 A;  1NK4 A;  1BI4 A;  4FJI A;  4FJG A;  1ITG A;  2P9K A;  3KK1 A;  3HM8 A;  4N41 A;  2XHI A;  4JN4 A;  5FPN A;  4HCC A;  1U45 A;  4H0P A;  3T1H K;  5AJ3 K;  2I5W A;  4DSF A;  3K58 A;  5CYQ A;  3ZLJ A;  1BQM A;  1QNA A;  5KTQ A;  5AQT A;  5BR8 K;  3IAY A;  1VQ6 N;  1QSL A;  3ZET A;  3ULE B;  1KAX A;  4H0T B;  3U3G A;  4BE0 A;  4LF9 K;  4MLH A;  1U4B A;  4YOR A;  4BQL A;  4IO9 L;  1CXQ A;  5AFU A;  3O4N A;  3O9S A;  1EBM A;  2RKI A;  3OYL A;  2DFE A;  2E2O A;  4O5B A;  4ROD B;  3DLK A;  1M90 O;  1B92 A;  2Q97 A;  4FJ9 A;  2KHO A;  3VEY A;  2LSN A;  5FPD A;  1YJN N;  3L2U A;  4CEA A;  1LWW A;  4JI1 K;  4CZJ A;  3L2R A;  3BZK A;  2XY7 A;  3KKR A;  1BHL A;  4DV0 K;  2YKM A;  4L8R B;  1YTB A;  2H5A X;  3HRG A;  1LWC A;  1ZBI A;  1YAG A;  2E5L K;  3B6O A;  3C95 A;  3CQ8 A;  4E7I A;  1TAQ A;  1TKX A;  2UUA K;  3D6R A;  2CGL A;  4JLH A;  5GAE P;  4KFB A;  3CME N;  2NOZ A;  2NOL A;  1HMV A;  3WNG A;  3D7E O;  3ID6 A;  4CK2 A;  1U47 A;  5F9C A;  3CI5 A;  5AR0 A;  2PAV A;  4M3U A;  1JLE A;  2VJ0 A;  4A59 A;  4M3X A;  1EP4 A;  5AQP A;  2OPQ A;  1HNZ K;  5DM6 L;  4Q5V A;  5AQM A;  4OPA A;  2D5R A;  3HP9 A;  4QAG A;  1J6Z A;  3OSM A;  1EQY A;  4FW1 A;  5AQW A;  2X74 A;  4JHD A;  3ZX3 A;  3Q7B A;  4HUG A;  5C25 A;  1S22 A;  2OPR A;  1CZB A;  4NCA A;  3HPH A;  2W6L A;  3WXJ A;  1BCM A;  4J2E A;  3WNE A;  4JI7 K;  3OYC A;  2FKF A;  1ZBF A;  1FXX A;  2F7T A;  4CHY A;  4M41 A;  1JCG A;  4ZTJ A;  4CFA A;  4DTU A;  1T05 A;  3KVG A;  5EY4 A;  1I3A A;  4CEB A;  2DKC A;  4EP4 A;  2F96 A;  4IFE A;  3WQU A;  1U49 A;  1KLM A;  3EL2 A;  2FBT A;  1Z05 A;  4J2B A;  3CPW M;  3TAP A;  1TUU A;  4FM0 A;  2O8F A;  4QG5 A;  3TTF A;  1GLJ O;  2YH5 A;  3C6T A;  3QEW A;  4JAX A;  4ISF A;  2O8E B;  4BR4 A;  5C42 A;  4GV9 A;  3CJB A;  3SQ4 A;  4JI8 K;  4FO0 A;  1N36 K;  1C1A A;  2PZS A;  4DV7 K;  1YF5 L;  2YJF A;  5KGX A;  4PQU A;  1K9M O;  4EIA A;  4DS5 A;  3VQQ A;  1XSZ A;  4EP5 A;  3HK2 A;  3J7Y P;  4ZTF A;  4KBO A;  4ROC B;  1MWK A;  1SL2 A;  2QRC A;  3MED A;  3O9U A;  3QO9 A;  4CF8 A;  4EAG A;  1HJO A;  1EWR A;  3OYF A;  4FM1 A;  1C0U A;  1SAZ A;  1WOQ A;  4O44 A;  2RF2 A;  2VWJ A;  5BRD A;  4FJX A;  4F3O A;  4HUE A;  4DQQ A;  5JVH L;  2JOI A;  1M5Q 1; 
#chains in the Genus database with same CATH homology
 3LAM A;  3AVH A;  1RBU A;  4CJL A;  2HHW A;  3ZSQ A;  3SCX A;  4W5Q A;  2ITG A;  3SNS A;  2Y1J A;  2NOF A;  3ZT0 A;  3O3G A;  4DF8 A;  3AVA A;  4DS4 A;  4Z0U A;  3EZ5 A;  4PWD A;  3OCI A;  4I9L A;  4IG3 A;  3TAM A;  3SPY A;  4B9M A;  3RPJ A;  1KFD A;  1WSF A;  2FBV A;  4MQ3 A;  3OC3 C;  4AHR A;  1TL1 A;  3AO2 A;  4CGD A;  3NH2 A;  3QET A;  4EJZ A;  3NF8 A;  3DYA A;  1IO2 A;  3O4Q A;  3HXM A;  2A1R A;  3VQ4 A;  3ZCM A;  1N3A A;  2RN2 A;  4KB1 A;  1LW0 A;  4CFD A;  1HU0 A;  3LP0 A;  4FJ7 A;  3VQA A;  4Z4G A;  3M8Q A;  1ZBL A;  4W5N A;  1JLQ A;  4E0D A;  1JLC A;  4CJR A;  4RG8 A;  1QSS A;  2GBZ A;  3K5M A;  2QKB A;  4LY7 A;  4CHQ A;  5IYB P;  3O3H A;  3LZI A;  1SL1 A;  4Q0B A;  3TAB A;  4IBN A;  4N47 A;  3I8D A;  4CHO A;  3KD1 E;  1ZBH A;  1QNC A;  3MXI A;  2P51 A;  3U6F A;  4FJH A;  3OYJ A;  4CIG A;  4JS5 A;  4F3T A;  1YQL A;  2NUB A;  4DQI A;  1HNI A;  3WNF A;  1XI1 A;  3AVI A;  5CZ1 A;  1WN7 A;  2XHB A;  4KHQ A;  1VSF A;  3B6P A;  3SUN A;  1QN7 A;  1WSE A;  1VTL E;  3NE6 A;  4OLA A;  3RMC A;  3AA5 X;  3VQ8 A;  3S3O A;  4FJL A;  2HNY A;  3G0Z A;  1RTI A;  4CFB A;  4CEZ A;  1EKE A;  3OS1 A;  3CM6 A;  2Z1J A;  3NDK A;  2ZE2 A;  4O0J A;  4OPK A;  3M8S A;  1NJX A;  2IV9 A;  4Q11 A;  3OYK A;  3T3F A;  3AVJ A;  2G8V A;  4OKK A;  1JLB A;  3K2P A;  3I0R A;  1YQR A;  4GVM A;  1KVB A;  1NOZ A;  4TSX A;  3PV8 A;  1B9F A;  3ZT4 A;  4JS4 A;  5HBM A;  1QN8 A;  3DLR A;  3LWM A;  1KVC A;  2B5J A;  4FW2 A;  4CJT A;  1UOC A;  1YTA A;  1A5V A;  4KTZ A;  4Z4C A;  3HT3 A;  4HTU A;  4B8C A;  3SQ0 A;  2P5G A;  3KD5 E;  1VOK A;  1TBP A;  1Z25 A;  2DY4 A;  3AO4 A;  4O4G A;  5I42 A;  3DLH A;  3OYA A;  1RT3 A;  1VK0 A;  2O4G A;  1J53 A;  1S1W A;  1KYU A;  5J2M A;  3V1R A;  2XO7 A;  4OKJ A;  4AIL C;  2Z1I A;  3SYZ A;  1S1T A;  3DRP A;  2RPI A;  4NCG A;  3OYN A;  2QK9 A;  4ZHR A;  1R0A A;  1QTP A;  4I8O A;  2ZD1 A;  3KLI A;  4LSN A;  3RR7 A;  4KI4 A;  1FK9 A;  2F8T A;  4OGE A;  4RW9 A;  3RRG A;  1NK7 A;  4C8L A;  3JYT A;  2YNF A;  1IKW A;  3LP1 A;  3ZSZ A;  4IDK A;  3NBP A;  1C1B A;  1SKS A;  4DTM A;  3TI0 A;  2PYL A;  4FZY A;  3V9U A;  4HUF A;  1UT4 A;  3ALY A;  4KV8 A;  5JS2 A;  2XRI A;  2YHA A;  2XY5 A;  3S3M A;  2G8H A;  4BDP A;  4M3T A;  1JKH A;  1U48 A;  1RT6 A;  5HRO A;  1L3V A;  2BDP A;  4PUO A;  3QIN A;  3F0Z A;  4CE9 A;  2VG5 A;  4DTP A;  3K5N A;  2HHV A;  2EX3 A;  2YNI A;  3VQC A;  1QNE A;  4CGI A;  1X9M A;  3OYH A;  3PX0 A;  3DOK A;  3M8P A;  1KYD A;  3SJJ A;  3EIK A;  4DSJ A;  5KGW A;  1E42 A;  1VSI A;  4JRP A;  1VOL B;  2W42 A;  4HHT A;  5I3U A;  1TK5 A;  1TK8 A;  3E01 A;  3N89 A;  3C6U A;  3DI6 A;  4FLW A;  3TAF A;  2OPS A;  3VA0 A;  5KRS A;  2XY6 A;  3DMJ A;  1NKB A;  4CHN A;  3KRM A;  5J1E A;  1Q9Y A;  1RDC A;  2QKK A;  1TGH A;  4Z4F A;  3MEC A;  3ZSW A;  4CHP A;  1S1U A;  2OPP A;  1WLJ A;  4Y1D A;  1TKZ A;  4PY5 A;  4B9S A;  2FC0 A;  3AO5 A;  2DFH A;  4BDZ A;  1RCH A;  4HCB A;  4OPJ A;  3AVM A;  3D45 A;  1HJR A;  1HQE A;  1S1X A;  2PY5 A;  3NF7 A;  3LPU A;  1WNS A;  3HS9 A;  3P83 D;  4CJU A;  4FCY A;  1D3U A;  4OJR A;  1C0M A;  1NJY A;  4AHV A;  1RM1 A;  4CJ4 A;  4CJ5 A;  2FBY A;  1BCO A;  5IYD P;  5FRN A;  5DMR A;  4J2A A;  4CJF A;  1KFS A;  2F8S A;  1BIZ A;  1RDB A;  1YT3 A;  4FXD A;  2Z8U A;  4OLB A;  2GV9 A;  4DTX A;  3F73 A;  4FJK A;  2YNG A;  3V6D A;  4C8M A;  3AO3 A;  2G8U A;  1IKX A;  1J5O A;  1S6P A;  1LW2 A;  2FBX A;  4K8Z A;  3DLB A;  4AH9 A;  5KI6 A;  4CEE A;  4B9L A;  4PA1 A;  2ZQB A;  1EX4 A;  1X9W A;  4I2P A;  5FDL A;  2IGI A;  3PX4 A;  5E41 A;  2G8F A;  5EU7 A;  3I0W A;  1ASU A;  4O0I A;  4CF2 A;  3VN5 A;  1NK5 A;  4CIE A;  4C8N A;  3HP6 A;  4FLU A;  4E7H A;  4DTN A;  1KRP A;  3NH1 A;  3AO1 A;  1X9S A;  1BIU A;  3ISN C;  1HPZ A;  3QIO A;  4G1Q A;  1N6Q A;  2DTU A;  1WAF A;  4LH5 A;  2IDO A;  3VQ9 A;  4W5T A;  3TAR A;  1JFI C;  1A5X A;  1GOB A;  3OYB A;  1KVA A;  3L2V A;  1WAJ A;  1YQK A;  1B9D A;  3QEX A;  2HHS A;  4EZ6 A;  1MP9 A;  2JLE A;  3VQD A;  1NH2 A;  3KTQ A;  4K8X A;  2KTQ A;  4DWI A;  4EJY A;  4H4O A;  2KFZ A;  1XHZ A;  2G8K A;  1EET A;  4KHS A;  5K14 A;  2AJQ A;  1W0H A;  1FN7 A;  2B4J A;  3V9X A;  1ZYQ A;  4B08 A;  1QS4 A;  2LAE A;  1BQN A;  3H08 A;  1VSJ A;  4ICL A;  3DLG A;  4CGJ A;  4BAC A;  4DQR A;  5D3G A;  4F8R A;  1Y97 A;  4DU4 A;  4R5P A;  4RW6 A;  4CF0 A;  2HZS A;  1VSK A;  4BWJ A;  3NFA A;  3S3N A;  2G8I A;  3AA4 A;  2BE2 A;  3OYM A;  4DFM A;  1MU2 A;  1U04 A;  2P1J A;  4CEQ A;  4IKF A;  4M42 A;  2EHG A;  4FVM A;  1JXE A;  3IH7 A;  4O55 A;  1DLO A;  3D0P A;  4E7J A;  1YVU A;  1TKD A;  2IAJ A;  2BAN A;  3NGZ A;  1T7P A;  1Z26 A;  3OYI A;  5CZ2 A;  1S9E A;  3TAG A;  2WOM A;  2HHQ A;  1D5A A;  3ITH A;  1AIS A;  3NH0 A;  3KKS A;  4CEO A;  1JLA A;  4FLX A;  3DOL A;  3DRR A;  3DRS A;  4CF9 A;  4DTO A;  4DFJ A;  3SV3 A;  3V9Z A;  2HB5 A;  3SPZ A;  1JL1 A;  1GOC A;  4CK3 A;  5FRO A;  1KTQ A;  1TGO A;  2IS3 A;  4DTS A;  3RTV A;  3SUO A;  2HW3 A;  1QN6 A;  4Y1C A;  4W5O A;  3V4I A;  4KO0 A;  4E1M A;  4DSI A;  1TL3 A;  1D9F A;  1BIS A;  3ULX A;  1QN9 A;  1IH7 A;  1C1C A;  1VSL A;  3QIP A;  3AVC A;  1VSD A;  3NGY A;  4E1N A;  3V9S A;  3DLE A;  1LWF A;  4BE2 A;  1TKT A;  5C24 A;  1RDD A;  5AN4 A;  1RTD A;  3K57 A;  3IG1 A;  4Z4E A;  2IOC A;  1XHX A;  5CY4 A;  4CEF A;  3ULD A;  2E6M A;  1CLQ A;  1N5Y A;  1KCF A;  4DTJ A;  4CIF A;  1YTU A;  3M8R A;  3QEP A;  3AA2 A;  1YQM A;  1TV6 A;  2NOE A;  2MJ7 A;  2VG6 A;  4CCH A;  3MEG A;  1LWE A;  5FRM A;  1VSH A;  3HS8 A;  1RIL A;  4E89 A;  3RR8 A;  3V1Q A;  1TAU A;  5J2P A;  4BDY A;  5T7B A;  1RBR A;  3OY9 A;  4JRQ A;  4KHU A;  1RBT A;  2HHT A;  3QES A;  4AHU A;  4I9Q A;  3LZJ A;  1LAW A;  1RNH A;  3SQ2 A;  1T8E A;  1NVP A;  1SV5 A;  4FJN A;  3CYM A;  3K5L A;  2D0B A;  4E7K A;  1KLN A;  4KTW A;  5HRP A;  2HMI A;  1L5U A;  1A5W A;  3AV9 A;  3SUQ A;  4DUL A;  3VA3 A;  1UT7 A;  1N39 A;  4LH4 A;  2R7Y A;  3S9H A;  1NJZ A;  1D8Y A;  3LPT A;  2KZZ A;  1WSH A;  3LP2 A;  4DSK A;  2OYQ A;  1KY6 A;  2HZM A;  3ASM A;  4CED A;  1NJW A;  1UAX A;  3U3Y A;  1D9D A;  4ELT A;  4CGH A;  2O3O A;  1CZ9 A;  1CXU A;  3NCI A;  1NKE A;  1NOY A;  4RW4 A;  1FKP A;  4CFC A;  2DFF A;  3AVL A;  1QHT A;  3CFO A;  4B9T A;  4KHW A;  3HPO A;  4FLZ A;  3HPG A;  1QN4 A;  4LD0 A;  3HVT A;  1JLF A;  1VRU A;  3LAK A;  4DU1 A;  4KRF A;  4N76 A;  1RBV A;  2Z1G A;  3C94 A;  1T03 A;  4E7L A;  1QTM A;  3EY1 A;  5JS1 A;  1ASV A;  1PZD A;  4F2S A;  1W80 A;  2HVI A;  1N3C A;  4ID1 A;  5HRN A;  1S1V A;  4DTR A;  3NF9 A;  4ELV A;  4KRE A;  1L3U A;  2E4L A;  1NK9 A;  1SL0 A;  3IS9 A;  1Q9X A;  5HRS A;  4C8O A;  1LWY A;  3LAL A;  4RW7 A;  4Z4H A;  4IFV A;  1SKW A;  3PY8 A;  4GW6 A;  3AA3 A;  1BI4 A;  3HYF A;  3VQ5 A;  1NK4 A;  4FJG A;  4FJI A;  1ITG A;  2YKN A;  4WZS D;  3PX6 A;  2YHB A;  2Y1I A;  4M45 A;  4UQG A;  2G30 A;  5HP1 A;  3HST B;  4B0A A;  1GOA A;  3KK1 A;  1HNV A;  3BGR A;  4KHN A;  1YTF A;  3SQ1 A;  2E6L A;  3MAQ A;  2KZM A;  4N41 A;  2IV8 A;  2XHI A;  4BWM A;  4F4K A;  4KB0 A;  4NYF A;  4HCC A;  1RT5 A;  1XC9 A;  1S5J A;  1U45 A;  4M3Y A;  3V1O A;  3CG7 A;  3ZT3 A;  2HNZ A;  1RT1 A;  4M3W A;  2I5W A;  4DG1 A;  4DSF A;  3K58 A;  5CYQ A;  1C0T A;  1BQM A;  1O1W A;  3ZSY A;  4KI6 A;  1QNA A;  1HQU A;  1RTH A;  5KTQ A;  1UWB A;  5J2N A;  3TAE A;  3IAY A;  1IKV A;  3SV4 A;  1QSL A;  3KTU A;  4FJ8 A;  3LDS A;  3CFP A;  2OZM A;  1F21 A;  3U3G A;  4BE0 A;  3QLH A;  3QEV A;  1NKC A;  3AVN A;  1L3S A;  2HVH A;  1B9K A;  3L3V A;  3PUF A;  1U4B A;  2OZS A;  1SKR A;  3KJV A;  4HVJ A;  4CJE A;  1CXQ A;  4DF4 A;  1BGX T;  5IYC P;  1G15 A;  1TVR A;  1QNB A;  3O4N A;  1EBM A;  4FJJ A;  2RKI A;  3OYL A;  4CJ3 A;  2D0A A;  3KLG A;  3NHG A;  1K6Y A;  2DFE A;  2B6A A;  1S6Q A;  2OA8 A;  4CF1 A;  4O5B A;  3FFI A;  5SWM A;  1LAV A;  4ROD B;  1X1P A;  3RMB A;  3DLK A;  3KK3 A;  4TPS A;  1B92 A;  4FJ9 A;  4DSE A;  1PCZ A;  2ATQ A;  3RWU A;  4CEC A;  1KY7 A;  4CGG A;  2P5O A;  4FYD A;  4M3Z A;  3H1Z A;  2LSN A;  1NK6 A;  4FK4 A;  1R4X A;  1C6V A;  1RBS A;  3OS2 A;  3L2U A;  4CEA A;  1NK8 A;  1LWW A;  4AHS A;  5SZT A;  4RW8 A;  3L2R A;  4GMJ B;  2QXF A;  2XY7 A;  3KKR A;  1I39 A;  1BHL A;  3KIO A;  3T1A A;  1J9A A;  4DFK A;  2YKM A;  4L8R B;  4ELU A;  1YTB A;  4AHT A;  4WE1 A;  1HRH A;  1LWC A;  3IRX A;  4CJP A;  4FJ5 A;  1ZBI A;  1IG9 A;  3TWH A;  4QOZ B;  2A1S A;  3AVB A;  4OGC A;  3ZSO A;  3OJS A;  1WSI A;  1IKY A;  3B6O A;  2XY8 A;  3C95 A;  2IC3 A;  3NGI A;  5HRR A;  1CDW A;  1WSJ A;  3K59 A;  3CQ8 A;  1BI4 B;  1TAQ A;  4E7I A;  1TKX A;  3RMD A;  3PO5 A;  2G8W A;  1RT7 A;  4JLH A;  3VQ7 A;  4KFB A;  2KFN A;  2YV0 X;  3ZT1 A;  2NOZ A;  2NOL A;  1EXQ A;  1HMV A;  3WNG A;  1HYS A;  2BGG A;  2KW4 A;  3OYD A;  4Z4I A;  4CK2 A;  3WNH A;  3EYZ A;  2JGU A;  3TAN A;  2X6S A;  1FKO A;  2PYJ A;  1U47 A;  4OVL A;  4B9U A;  5DK5 A;  4CJV A;  4M3U A;  1JLE A;  2VWK A;  3A2F A;  4CGF A;  2VJ0 A;  3NAE A;  3L8B A;  5J2Q A;  3MXM A;  4M3X A;  1EP4 A;  1JXB A;  1RT4 A;  3ZSX A;  3AVK A;  4FM2 A;  3SUP A;  3KLH A;  4EZ9 A;  1QE1 A;  2OPQ A;  3TAQ A;  1QN5 A;  4YFU A;  4N56 A;  3L2W A;  3TR8 A;  4FK0 A;  3K5O A;  3ZSR A;  4Q5V A;  2GUI A;  4E3S A;  1L3T A;  2D5R A;  3HP9 A;  4KKO A;  4KHY A;  3L2Q A;  3P1G A;  4QAG A;  1TBA B;  2KQ2 A;  4XIU A;  3OSM A;  1SUQ A;  4FW1 A;  3I0X A;  1REV A;  4M3R A;  4N5S A;  3SZ2 A;  2X74 A;  4NYN A;  4HUG A;  1NK0 A;  1QQC A;  1QTS A;  4B3O A;  3F10 A;  3LP3 A;  5C25 A;  2ETJ A;  1DTQ A;  2VG7 A;  4DMN A;  1J54 A;  3I0S A;  3DPU A;  3DM2 A;  4FLT A;  2OPR A;  1CZB A;  4C8K A;  4KPY A;  1RT2 A;  4NCA A;  3ZSV A;  1VTO A;  3HPH A;  4I7F A;  3MEE A;  3MXJ A;  4CJQ A;  3AVG A;  1BL3 A;  3L3U A;  4DSL A;  2HHU A;  1BCM A;  3F9K A;  4J2E A;  3WNE A;  1KSP A;  4OKE A;  3OYC A;  3UIQ A;  2WON A;  4B9V A;  4DQP A;  1M3H A;  1ZBF A;  3QNO A;  1VSE A;  1FXX A;  4CHY A;  3HL8 A;  3G10 A;  4M41 A;  4ZTJ A;  5CYM A;  4CFA A;  2HND A;  5KRT A;  4DTU A;  1T05 A;  3KLE A;  3PO4 A;  4LSL A;  3SI6 A;  4J2D A;  3AVF A;  4QCL A;  1RDA A;  1I3A A;  1JL2 A;  1S9G A;  4CEB A;  1Q8I A;  2F96 A;  4IFY A;  4EP4 A;  3VQ6 A;  1JLG A;  4CK1 A;  3NF6 A;  4W5R A;  3OJU A;  1KYF A;  1KLM A;  3THV A;  1U49 A;  1QSY A;  4NCB A;  1LV5 A;  3ZT2 A;  4FZX C;  2X6N A;  4YNQ A;  2FBT A;  1HYV A;  4J2B A;  3OVN A;  4DQS A;  4CER A;  2NOB A;  3TAP A;  4B9N A;  4FM0 A;  1HYZ A;  4DFP A;  4F2R A;  3QNN A;  4H4M A;  3O3F A;  2NOI A;  1WSG A;  2MZ8 A;  4DLG A;  3LAN A;  1VSM A;  2YH5 A;  1C9B B;  3C6T A;  4H8K A;  3T19 A;  3HM9 A;  3QEW A;  1NGM A;  1QN3 A;  3OYG A;  1ZBU A;  1UA1 A;  4DLE A;  2O4I A;  5C42 A;  3SQ4 A;  2NOH A;  4FZZ A;  4ROE B;  1C1A A;  3CFR A;  3HO1 A;  2PZS A;  1DTT A;  3OST A;  3OS0 A;  3SNN A;  3JSM A;  1VRT A;  5KGX A;  3V81 A;  3RRH A;  3RMA A;  4PQU A;  2Z1H A;  4CES A;  4CJS A;  4DS5 A;  1ASW A;  3OYE A;  3VQQ A;  2FGT A;  3KK2 A;  4CJK A;  3HVR A;  3DPT A;  3LWL A;  4KAZ A;  2X78 A;  3VQB A;  1LWV A;  4EP5 A;  3HK2 A;  1RTJ A;  3QEI A;  4E19 A;  4FLY A;  4ZTF A;  2Q3S A;  1TK0 A;  3P5J A;  3CM5 A;  4ROC B;  1W9H A;  4BE1 A;  1SL2 A;  4CJW A;  5HLF A;  4FJM A;  4B8A B;  3QER A;  3MED A;  1XWL A;  3QO9 A;  2D0C A;  4CF8 A;  3V9W A;  4I2Q A;  1KO9 A;  1UA0 A;  3OYF A;  4FM1 A;  1C0U A;  2HHX A;  2YNH A;  3VQP A;  4KTQ A;  4O44 A;  2RF2 A;  4FK2 A;  4AHC A;  2VWJ A;  4IG0 A;  3BDP A;  4FJX A;  3HJF A;  4MFB A;  4DU3 A;  4F3O A;  4CHZ A;  4HUE A;  4DQQ A;  4FLV A;  2I5J A;  4ID5 A;  3VQE A;  3KLF A;  2JOI A;  1M3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...