2D0AA

Crystal structure of bst-rnase hiii
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
308
Chain Sequence
SNYVIQADQQLLDALRAHYEGALSDRLPAGALFAVKRPDVVITAYRSGKVLFQGKAAEQEAAKWISGASASNETADHQPSALAAHQLGSLSAIGSDEVGTGDYFGPIVVAAAYVDRPHIAKIAALGVKDSKQLNDEAIKRIAPAIMETVPHAVTVLDNPQYNRWQRSGMPQTKMKALLHNRTLVKLVDAIAPAEPEAIIIDEFLKRDSYFRYLSDEDRIIRERVHCLPKAESVHVSVAAASIIARYVFLEEMEQLSRAVGLLLPKGAGAIVDEAAARIIRARGEEMLETCAKLHFANTKKALAIAKRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribonuclease HIII
publication title Crystal structure and structure-based mutational analyses of RNase HIII from Bacillus stearothermophilus: a new type 2 RNase H with TBP-like substrate-binding domain at the N terminus
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 100
structure length 308
sequence length 308
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
A PF11858 DUF3378 Domain of unknown function (DUF3378)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2d0aA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2d0aA02
3LALA 3C94A 1JFIC 4PA1A 1D8YA 2X78A 2YNHA 1XHZA 1X1PA 3D0PA 3ZCMA 2Z1GA 4E1NA 3V9WA 3VN5A 4ROCB 5HLFA 4DTSA 4B9TA 4TSXA 4C8LA 1R4XA 1I3AA 1UA0A 2HHWA 1KFSA 2ETJA 3TAPA 2G30A 1TAUA 1RBSA 3DLEA 3LWLA 1R0AA 3PUFA 1QN9A 3KLEA 4DTOA 3HYFA 1RTHA 3OS2A 4N5SA 4KB1A 4E3SA 1BQMA 3KK2A 1IKXA 1EX4A 2RN2A 4M45A 5HRSA 1ZBFA 3O3HA 1EXQA 3V9UA 4NCAA 1RT2A 4OLAA 4I7FA 4JRQA 1CLQA 3L2QA 2ZE2A 3OYJA 4CF2A 2GUIA 4YFUA 1AISA 4I9QA 2F8TA 3AO1A 4RW6A 4DMNA 4H4MA 1NK0A 5HRRA 5JS1A 4OPKA 4KRFA 4KHSA 4B9SA 4DQIA 1WAFA 2ATQA 2RKIA 4OGCA 3C6UA 5HRNA 1W9HA 4B9VA 2P1JA 3DRPA 1JXEA 2G8KA 2GV9A 2E4LA 4DFJA 4CJUA 3QNNA 2XRIA 4PUOA 3BDPA 2DY4A 1Q8IA 1N6QA 4FK2A 2Z8UA 1KTQA 1WSIA 4AHUA 1S1WA 3LP0A 1SL0A 2OPSA 3P83D 4FW1A 1I39A 1RBUA 3AVGA 3DRRA 4LY7A 3JYTA 4RG8A 1BCOA 4FM1A 1QTSA 3SI6A 1SL1A 1IKYA 5CY4A 3AO2A 2G8FA 1HJRA 4O4GA 4PWDA 3OCIA 3AA2A 3OY9A 1D9DA 1WAJA 4Y1DA 2PYJA 2YNGA 2DFHA 2B5JA 4RW4A 4DFMA 1NKEA 3CFRA 4E7LA 3RR8A 3PV8A 1FK9A 5C24A 4J2BA 1RNHA 2OPQA 4DTPA 2D0AA 1L3TA 4FYDA 1ASWA 1KLMA 4CGFA 3OJUA 3LP1A 4DTJA 3B6OA 1U47A 3NCIA 2Z1HA 3OYBA 1A5VA 1U48A 2IC3A 3T19A 1C1BA 3E01A 2G8HA 1VRUA 1LWCA 3SYZA 3JSMA 2JLEA 4FLWA 2DFFA 1S1UA 3OYGA 4FLUA 3L2WA 4UQGA 1VSEA 4FJKA 2XY7A 3ZSVA 4Y1CA 4J2EA 1A5XA 3EIKA 4K8ZA 1X9MA 3PO4A 4IFVA 3M8SA 3AVNA 3I0RA 4ICLA 4IDKA 3NH2A 1JXBA 4DTUA 1BIZA 3TR8A 1IKWA 3T1AA 3LPTA 2VG5A 3ZSXA 2YNFA 4Z4HA 4LSLA 2HMIA 1B9FA 2D0CA 1TL3A 3HSTB 2Z1IA 3M8QA 5KTQA 3KLHA 1T8EA 4FVMA 1NKBA 4DG1A 4AILC 4FLVA 5E41A 5KI6A 4CJRA 2LSNA 4LD0A 4DTRA 4BDYA 3RWUA 5IYBP 3H1ZA 4IKFA 3SJJA 1U4BA 3RR7A 3VQ7A 2VG6A 3QETA 2HHTA 4HUGA 1T7PA 4WE1A 3KLFA 4O44A 3NGIA 3OYLA 4CGHA 1ZBLA 1YTFA 1C1AA 1JLFA 1VSLA 4E19A 1QNCA 3OS0A 4KTZA 4FM0A 1TK8A 4B08A 4QOZB 3NBPA 4AHCA 1WSFA 1CZBA 4DQPA 3PY8A 3ZSZA 3SUOA 4DTNA 3OYNA 3AV9A 1YTUA 1W0HA 2HVHA 1ZYQA 3OYHA 5FDLA 3L8BA 3AVLA 5T7BA 4ZHRA 3AVKA 4JS4A 4BACA 1Q9YA 1UWBA 4KHUA 1SUQA 4M3TA 3AVHA 4RW9A 4CESA 3SUPA 3THVA 4EP4A 3SQ0A 3IRXA 3WNHA 4ID1A 2ZQBA 5SZTA 4B9NA 5CYMA 2YV0X 3LZJA 3ZSRA 3OYEA 2YHBA 2IGIA 4KTWA 3MEDA 3OYMA 2B4JA 1HMVA 3VQ8A 4AHTA 4CJWA 4CFBA 1QSYA 3LAKA 1SKRA 1YVUA 3AVJA 4DF8A 1X9SA 3TWHA 4ZTFA 4FJ8A 4ID5A 3AVIA 2OZMA 2ITGA 1VSJA 3F9KA 4B8AB 1JLGA 3K5MA 2QKBA 1SKSA 3NF7A 2BGGA 3VQ5A 1S6PA 4FJXA 1RT3A 3C95A 4ELTA 3U3YA 1S1VA 1DLOA 4LH5A 3O3GA 4Z4GA 3DYAA 1TKXA 3ISNC 2HHVA 3OYFA 2XY8A 1TBAB 2D5RA 4KFBA 1NGMA 4AHSA 3QERA 4DWIA 2KTQA 1CZ9A 4I2PA 5IYDP 1YTAA 3NDKA 3AO3A 4ROEB 4E7HA 2X6SA 1SL2A 2G8WA 4M3RA 4JRPA 1C6VA 4CFDA 1BHLA 2F8SA 3HT3A 1UA1A 4YNQA 2OPRA 4FJGA 3K58A 3K5OA 5J2QA 3PO5A 4CK3A 2VJ0A 1GOCA 2Q3SA 3NE6A 3NH1A 4JS5A 3HK2A 1JL2A 1C0MA 4HUFA 1TV6A 4OJRA 4QCLA 3SZ2A 4DTXA 1CXUA 1QTPA 3SV3A 1D5AA 3AVMA 2PY5A 2X6NA 3MXJA 3NF6A 4CF8A 2P5GA 4M3XA 4DTMA 3QNOA 1NOYA 3WNEA 4FCYA 1BQNA 5HP1A 2BDPA 2YKNA 1RTJA 4W5QA 2KZMA 3MXIA 4CFCA 4HCCA 3MEEA 3KD1E 1UAXA 2FBTA 3V4IA 3K2PA 2HNYA 4DS5A 3B6PA 1Q9XA 4OVLA 3M8PA 4CGIA 1RDAA 3MEGA 3TAEA 4F3TA 3RMCA 1VTLE 4N41A 2FC0A 1VOLB 2RPIA 3CFOA 1IKVA 4O55A 1U04A 1XC9A 2B6AA 2HHSA 1KLNA 2IOCA 4CIFA 5KRTA 4M3YA 1NOZA 2D0BA 1F21A 4E89A 4CJVA 4F8RA 1RM1A 2HVIA 1U49A 1RT7A 1TGOA 4KKOA 2DTUA 1RBVA 3QESA 4CHQA 4KI4A 3NGZA 2AJQA 3DI6A 4OKEA 1TKTA 4FJNA 1PZDA 1KYUA 3VQAA 3TAMA 2VWKA 1KVBA 3V9ZA 4CIGA 4B9LA 4J2DA 1ASUA 1UOCA 2VG7A 3ASMA 2HB5A 3MXMA 3PX0A 3DOLA 1EETA 2A1SA 3ZT2A 4NYNA 3WNFA 3F73A 4M3ZA 3K5LA 1Z25A 1EKEA 3U6FA 2IV9A 1BI4A 5K14A 2Y1IA 1RTDA 2DFEA 4AH9A 1HNVA 1RBRA 3AA4A 4NCGA 5C25A 3RMBA 1S1TA 1QQCA 3EZ5A 3OVNA 4W5RA 1N5YA 5KRSA 1KRPA 3TANA 4Z0UA 3NF9A 2KFZA 4CJPA 1IH7A 1XI1A 4F4KA 4EP5A 3OYKA 1C0UA 1SV5A 1WLJA 3DLHA 4FLZA 3I8DA 2HW3A 1JLAA 4M3WA 1J5OA 3HJFA 3G10A 2PYLA 3DM2A 4FZZA 3V1OA 3K57A 3QEPA 2G8UA 1VSIA 4FJ9A 4FJJA 4KTQA 1CXQA 4CEFA 3ZT0A 4HVJA 3QEWA 1RT1A 3DLBA 1RDDA 3LWMA 3SV4A 1WN7A 1GOAA 3ZSWA 3OYDA 4B9UA 1KYDA 4H8KA 3KD5E 4F2RA 4OPJA 3VQQA 2JGUA 5J2PA 4DU1A 4F2SA 3HPHA 3AVCA 3KTQA 4W5OA 3KK3A 3V9XA 2XHBA 3P1GA 4NYFA 3KLIA 1VRTA 1HYVA 1Y97A 3HS9A 4CERA 4CEQA 4C8OA 5HRPA 1KVCA 4Z4IA 3KIOA 1WSJA 1PCZA 1QN4A 4N56A 4GMJB 3OJSA 4M41A 1IG9A 4KV8A 4DSFA 3CM5A 1BGXT 3O3FA 1XWLA 4KO0A 1BISA 1TKZA 1KCFA 3HL8A 3OS1A 4E0DA 4Q0BA 4WZSD 2WONA 4CJEA 4FLXA 1JL1A 1BI4B 5HBMA 4CJ3A 4CJKA 4BE0A 4FM2A 2FBXA 3D45A 4CJSA 4CECA 3RTVA 3PX4A 4BE2A 4KHWA 4OKJA 3LDSA 4OLBA 4DQRA 4DSJA 3S3MA 2QKKA 3L2VA 1D9FA 5IYCP 4I2QA 3OYIA 1CDWA 3RMAA 2BE2A 3EYZA 3SQ2A 3KKRA 4MQ3A 2IS3A 4DLGA 2FBYA 4CF1A 4Q5VA 2KQ2A 3QLHA 1QN5A 3AA3A 4FLTA 3K59A 1HQUA 2FBVA 4JLHA 4QAGA 3ULDA 1IO2A 2NUBA 5I3UA 4Z4CA 4KI6A 4KREA 4DQSA 3LP3A 1RT6A 1TL1A 4KPYA 1LW0A 2O4GA 4NCBA 4FK4A 3L2RA 3AO5A 1FXXA 4N76A 3RRHA 5FRNA 3HP9A 1E42A 3AVAA 1B9KA 4CHNA 3KK1A 1T03A 4EZ6A 4FZYA 1QS4A 3LP2A 4B8CA 4DSLA 1ASVA 2KZZA 1HNIA 3OC3C 4KB0A 4CF0A 4W5NA 2HNZA 5KGXA 3S3OA 1YT3A 1DTTA 1Z26A 1RCHA 2KW4A 3VQBA 4FJ5A 3AA5X 4M42A 1NK4A 3CYMA 3HP6A 4CHZA 3S9HA 1QNEA 1LW2A 1VOKA 3RMDA 5CZ2A 1FKPA 3NGYA 2IAJA 1WNSA 1NK9A 3ZSYA 3IAYA 3RRGA 2IDOA 2VWJA 4FK0A 3HVRA 2O4IA 4I9LA 4HUEA 1S5JA 2YHAA 1QSSA 4CJ4A 3VQ4A 1FKOA 3ZSQA 1KY7A 4R5PA 4FZXC 3NH0A 4HTUA 3WNGA 4ELUA 2Y1JA 5HROA 4MFBA 4DU3A 1LAVA 3V1RA 3I0SA 4OKKA 1LWFA 2KFNA 4FW2A 4E7JA 4DFPA 4CCHA 1C1CA 2OA8A 4IFYA 3M8RA 1ZBHA 1ZBUA 3KLGA 4CGDA 1MP9A 1J53A 3DLRA 4LSNA 4CK1A 4BE1A 2RF2A 3SUQA 1U45A 5EU7A 1C0TA 1LAWA 4CGJA 4DU4A 3L3UA 3TARA 1RT5A 1L3SA 4CFAA 3QEXA 2HHQA 4CEBA 4ELVA 1JLQA 1TK5A 1RILA 2XO7A 1WSHA 4FJLA 5CZ1A 3A2FA 3HVTA 3CFPA 1EP4A 1NK7A 1NKCA 3SPYA 2QK9A 3G0ZA 3QEVA 5J2MA 4Z4FA 2HHUA 3V9SA 4F3OA 2YNIA 3NAEA 4KHNA 4B3OA 2OZSA 1VSKA 1QNBA 3VA0A 4AHVA 5J1EA 1VK0A 1MU2A 2E6LA 4PY5A 3VQDA 1D3UA 4FJIA 3K5NA 3AO4A 4E1MA 2R7YA 1QE1A 4L8RB 4RODB 1VSFA 5C42A 1TBPA 1WSEA 1C9BB 2ZD1A 4GVMA 4O0IA 3ZT4A 1JLEA 3MECA 1HYSA 2IV8A 2W42A 1RBTA 4E7IA 3ITHA 4CEAA 1QSLA 3V6DA 1L3VA 3HPOA 3SNNA 1LWEA 4CEDA 3DOKA 1VSDA 3T3FA 4BDPA 1RTIA 1XHXA 5D3GA 4PQUA 2YKMA 1RDBA 1LV5A 3C6TA 2G8VA 3QINA 2PZSA 2XY6A 1NK6A 5DMRA 4FJ7A 4CJ5A 2G8IA 3NF8A 3O4QA 5DK5A 3VQ6A 4CK2A 4RW8A 5KGWA 3TAQA 1T05A 2OPPA 1TKDA 1RT4A 1GOBA 3O4NA 4CHPA 3PX6A 4H4OA 1B92A 3V81A 3SQ1A 4FXDA 1S6QA 3QIOA 3TABA 5FRMA 2P5OA 3TI0A 1HYZA 1RDCA 1W80A 1NJZA 4FJHA 1VSMA 3DRSA 3QO9A 4LH4A 3ZSOA 4IBNA 4XIUA 3UIQA 1JKHA 1NVPA 4FLYA 3VQCA 3HM9A 4HCBA 1KVAA 3P5JA 3VA3A 3NFAA 1J54A 4CEOA 3SPZA 1REVA 4E7KA 4ZTJA 4C8KA 1L3UA 3IS9A 3VQEA 4CJFA 3DMJA 3OYCA 4G1QA 2E6MA 3MAQA 5SWMA 3TAFA 3QIPA 4CHOA 2P51A 4CHYA 1NK8A 5JS2A 4HHTA 3NHGA 4C8NA 1QTMA 3LAMA 4B0AA 4KHYA 3HO1A 4K8XA 3BGRA 3IG1A 1BCMA 3AVFA 5I42A 4DLEA 1SKWA 1HQEA 1B9DA 3VQ9A 3V1QA 4CJTA 3HS8A 3S3NA 4FJMA 4M3UA 4O0JA 3KKSA 3QEIA 1KFDA 4KAZA 3LZIA 3AVBA 1ITGA 2I5JA 4IG3A 5J2NA 1NJYA 1QN7A 1BIUA 2HNDA 4CF9A 4DF4A 3SCXA 1KSPA 1J9AA 4DS4A 4CEZA 4OGEA 1QN3A 2XY5A 3HXMA 3HPGA 3SQ4A 1NH2A 2EHGA 3L3VA 4CEEA 3ALYA 4DQQA 3CM6A 4CGGA 1HRHA 1A5WA 1HPZA 2BANA 3L2UA 4J2AA 3DLKA 1KYFA 1WSGA 4IG0A 3U3GA 1K6YA 3SUNA 3ZT1A 4CJLA 1X9WA 1L5UA 1BL3A 1NK5A 3VQPA 4N47A 1JLBA 3CG7A 1S9GA 4CIEA 1DTQA 4C8MA 2A1RA 1NJXA 1G15A 1S1XA 3FFIA 5FROA 3OYAA 1QNAA 3CQ8A 2OYQA 2QXFA 1JLCA 4DSKA 1TK0A 4CJQA 1NJWA 1ZBIA 2WOMA 4AHRA 1QHTA 1QN6A 2GBZA 3EY1A 4DSEA 4B9MA 4EZ9A 1VTOA 3LANA 1KY6A 1O1WA 1TVRA 2X74A 1S9EA 4DSIA 1QN8A 2F96A 4BDZA 3H08A 4Z4EA 4O5BA 1TAQA 3ZT3A 4CE9A 2MJ7A 4DFKA 5CYQA 4RW7A 3KJVA 1VSHA 2HHXA 2Z1JA 3DLGA 3TAGA 1TGHA 1YTBA 4GW6A 4BWJA 4BWMA 4KHQA 2EX3A 3LPUA 4W5TA
chains in the Genus database with same CATH superfamily
3LALA 4PA1A 1D8YA 2CGJA 2GTDA 4ROCB 3M3ZA 2Y8QA 2IVNA 1U2VA 1UA0A 3TAPA 2FXUA 1TAUA 3DLEA 4R79A 3LWLA 4QS8A 3SAHA 5CE3A 4N5SA 1WB9A 3CCRN 1SS6A 3KK2A 2IIRA 1DKGD 2RN2A 3O3HA 4NCAA 4FWOA 4GKKK 4JRQA 3L2QA 4I9QA 1DT9A 2F8TA 3AO1A 4RW6A 1XC3A 4H4MA 1NK0A 4WQ5C 4JNEA 5HRNA 5JVHL 1PVSA 1NGDA 3BZCA 2GV9A 4CJUA 5C12A 3QNNA 1T3VA 3ZYYX 5HOOA 1MPGA 1KAZA 3VEVA 1WSIA 5E84A 1LCUA 3SMPA 1S1WA 4FW1A 2UUAK 1QHAA 4FM1A 1SL1A 4JI0K 5JLHA 4MO4A 1HJRA 3BF3A 4NXNK 3I3WA 4O4GA 1QZ5A 3OY9A 4V19S 4Y1DA 2NRHA 4NLCA 3CFRA 3CERA 4J2BA 3CCLN 1U47A 3NCIA 5ADXH 2G8HA 3VF4A 1LWCA 4H0YB 4NO7A 3SYZA 3C65A 2GEMA 1S1UA 3A0IX 3L2WA 1VSEA 2XY7A 1D4XA 2E2PA 3PO4A 4AQYK 3M8SA 5MLCQ 1VQLN 4ICLA 4TPSA 3ZSXA 3CJ7A 1GLAG 3ID6A 4FVMA 3SBTA 4DG1A 4AILC 3LM9A 1BOTO 4LD0A 4CJRA 4DQ8A 1SQKA 1U4BA 3VQ7A 3QETA 1K8KA 2HHTA 4HUGA 4O44A 3NGIA 1YTFA 2E8AA 1XUPO 1VSLA 4F8RA 2IVOA 1P5DX 1N39A 3MCPA 3ZSZA 1W0HA 3OYHA 5FDLA 3L8BA 3AVLA 3R3LA 5BN8A 4DUYK 3O9QA 1SUQA 1HNZK 4CESA 3SQ0A 2Q2RA 2ZM6K 3LZJA 3MEDA 3O9SA 4CFBA 1LWYA 3LAKA 5BR9A 4I6MA 1P8ZA 3QICA 1X9SA 1M3HA 2ASPA 4CFFA 2FKFA 4ID5A 3J7AP 2E2OA 2XHIA 3K5MA 1RDWX 1S72N 1SKSA 3VQ5A 3O3GA 5EPCA 2HHHK 3VTHA 4BRMA 4EAIA 2XY8A 3OYFA 2WTUA 1NGMA 3QERA 3O6WA 1JCFA 3VMFB 4BR4A 5BRDA 3WXJA 3OH9A 3THXA 4JK7A 1QQOA 1SL2A 4ROEB 4YOTA 4M3RA 1FW6A 4DR4K 1ZC6A 1HLUA 2GUPA 4FVUA 4BRFA 1BHLA 1GLLO 3CI5A 4CFDA 1UA1A 3WEEB 3CETA 3DPTA 2QTDA 4CK3A 2VJ0A 3NE6A 3HK2A 1JL2A 4QCLA 3HOTA 4FWSA 3FZHA 2KKZA 4WQ4C 3QNOA 3WNEA 4IO8A 2YKNA 4D7QA 4W5QA 2KZMA 3MXIA 4XEIA 4FWRA 1UAXA 3K2PA 2QLVA 4QS7A 3CVSA 3DXKA 1XMQK 3CFOA 1IKVA 1U04A 3T4NA 1Y64A 2H5AX 2KLAA 5KRTA 4M3YA 3ZX0A 4CJVA 1W2BM 2HVIA 1U49A 1RT7A 2DTUA 5GADP 3QESA 2CH6A 3NGZA 2QRCA 4FJNA 1PZDA 3TAMA 2VWKA 3V9ZA 4B9LA 4CIGA 1ASUA 1Q81O 3MWTA 3MXMA 1EETA 2A1SA 4CZMA 4DUZK 4EAHD 5FPMA 3H45C 5AN4A 1EKEA 3EO3A 5K14A 4AH9A 1RBRA 3SPZA 4NCGA 4B3SK 1QQCA 4W5RA 4H0XB 1N5YA 1HU0A 4Z0UA 3NF9A 1IH7A 1XI1A 4EP5A 1C0UA 1X3MA 3GG4A 2E2QA 3F0ZA 3IUCA 3QEPA 3TTFA 2ITMA 4BRNA 1VSIA 3A8YA 4KTQA 3VTIA 1WN7A 4FJ5A 4H8KA 3OSMA 3IMXA 1HNWK 1HJOA 3KRMA 3UW2A 2NOEA 3AVCA 3HPHA 3KTQA 4W5OA 3KK3A 2YI1A 4X64K 4NYFA 1GLJO 1NMDA 1PCMX 3U8XA 5AQTA 4GMJB 1IG9A 4KV8A 3FZLA 3BUZB 2E88A 2P9PA 3O3FA 1BISA 1TKZA 4BQZA 1KCFA 3QB0A 4B1VA 3CW7A 3OS1A 1N34K 4CVNE 3HM8A 3LDPA 3MDQA 1NGEA 4BE0A 3MCAB 5E26A 4CJSA 4CECA 4L3QA 3TPQA 5F0XA 2PFUA 3OYIA 3QMLA 3RMAA 3SQ2A 3KKRA 4DLGA 2FBYA 4F3TA 1QN5A 3AA3A 4DB3A 1HQUA 4JLHA 1IO2A 4PKHA 4KREA 1N3AA 1TL1A 3HP9A 4CHNA 5LMUK 1B9KA 3KK1A 1ASVA 1HNIA 1IG8A 4IDHA 3QFPA 1OH6A 1KXPA 2HNZA 3VQBA 1Z26A 3OH6A 2KW4A 2O8EB 1NK4A 3CYMA 3HP6A 4FJ7A 1VOKA 3N4PA 4ILHA 1TYQA 5F9CA 2NOBA 2IDOA 1JCEA 4I9LA 3VQ4A 1FKOA 3GOIA 1KY7A 3WQTA 3I55N 3WNGA 2ZFDB 4ELUA 5HROA 4JHDA 4MFBA 2FKMX 3B8AX 5BRHA 1BG3A 3VEXA 4DFPA 4EFHA 3KLGA 3J7YP 3C6HA 4BE1A 3SUQA 1U45A 2UUBK 1C0TA 1TUOA 4JKFA 3VEZA 1L3SA 3FGUA 3E9PA 2HHQA 4CEBA 3F10A 4DV3K 2XO7A 3KZBA 4IXCA 3CFPA 1EP4A 4LF4K 2GWKA 3G0ZA 1GLEG 2A6AA 2HHUA 4F3OA 2OZSA 2JWKA 3HBTA 2ZJQL 3L4IA 2E6LA 5LJVA 1D3UA 4FJIA 1YF5L 3AO4A 4E1MA 1QE1A 4H5TA 4RODB 3C6AA 1TBPA 2VGMA 5F1XA 3ZT4A 1JLEA 2HL9A 2IV8A 5BPNA 5I9EB 2W42A 2HKPA 4E7IA 2P9UB 5H1SQ 1LWEA 4CEDA 1BDGA 4BDPA 1Q7YO 1XHXA 3SAFA 5M1QA 2FLOA 1LV5A 4YDUC 1WUAA 2G8IA 1BUPA 3HI0A 1T05A 3VQ6A 2OANA 2DKDA 4CHPA 4H4OA 1B92A 1S6QA 5FRMA 3ZX3A 3TI0A 1HYZA 1RDCA 2AA4A 1U6ZA 3AAPA 3ZSOA 1DEJA 1JKHA 1N33K 2O8FA 3P5JA 2BGGA 3NFAA 4NLBA 2KHOA 2DKAA 5JICA 4CJFA 3FE1A 4K0KK 2WC9A 4G1QA 3OYCA 3MAQA 3OTOK 3UKUB 2P9LA 2W6LA 1C47A 1QTMA 1ZBSA 5AZJA 4A5BA 4KHYA 3BGRA 3D7QA 3CMEN 3AVFA 2D4WA 5I42A 1HQEA 3VQ9A 4CJTA 3HS8A 4M3UA 2W41A 1KFDA 2I5JA 2QW9A 2ASMA 1NJYA 3FZMA 4IZ9A 4DWIA 2HNDA 4MLHA 4JYAK 1QQNA 4KHPK 3CM6A 1A5WA 1HPZA 3AGKA 3L2UA 1KYFA 3U3GA 3SUNA 3CG7A 4C8MA 1R59O 2NNWA 1OH7A 4HJHA 4M7XA 4CJQA 4AHRA 1QHTA 4JI1K 3EY1A 4DCHA 3HRGA 4DSEA 4BGBA 3LANA 4EJYA 1TVRA 2X74A 1Z6RA 1S9EA 4DSIA 4FJMA 4Z4EA 1TAQA 4JKBA 4JKGA 4DFKA 4BC4A 5CYQA 3KJVA 1VSHA 4LF8K 1YJ9N 4CZLA 5C15A 1EO1A 2H3GX 2X78A 2E1YA 5CHIA 1X1PA 3CPWM 3D0PA 1NNEA 2H4LX 4CBUA 2QWNA 3R6MA 4C8LA 4EAJA 4B9TA 1R4XA 3MN7A 4AF1A 2HHWA 1T44A 5DM6L 2ETJA 1WBDA 3HYFA 1RTHA 4K43A 1HPMA 4LFBK 4OLAA 4M45A 3V9UA 4EIAA 2GUIA 1Q9UA 4DMNA 2HZMA 5HRRA 3TSQA 2ATQA 4IL8A 1YI2N 4OGCA 4B9VA 2P1JA 3IDHA 1X9JA 2E4LA 4FOIA 3BDPA 1P90A 3NVKA 3LL3A 4FK2A 1QVGM 4AHUA 5HL7L 3LP0A 3DRRA 4LY7A 3SI6A 1BCOA 1NWKA 2HBJA 3CIPA 1YQKA 1V4TA 1D9DA 2YCHA 2PYJA 2YNGA 2P9IB 5KQDA 2HSTA 4RW4A 4DFMA 1NKEA 3RR8A 4E7LA 2OTJN 3DXMB 5FLXO 3ENHA 3M5RA 1HR0K 3LP1A 2Z1HA 4HTLA 4KH6A 2IC3A 3T19A 1C1BA 2JLEA 4CBWA 1YVNA 1YJWN 1IBKK 3D2EB 3ZX2A 3I0RA 3NH2A 1BIZA 1OKJA 4PL8A 3T1AA 2VG5A 2WBNA 3VENA 3HSCA 1B9FA 2D0CA 3HSTB 2HMIA 2V51B 2Z1IA 5M1FA 1T8EA 3SJHA 5E41A 2WFBA 2LSNA 4MRQA 4BDYA 3H1ZA 1Z05A 3SJJA 2JPIA 3RR7A 2RHKA 5A2QO 1T7PA 1YQRA 2JWLA 4JK8A 2A42A 3OS0A 1W7AA 2E2NA 3L0QA 1QNCA 4FM0A 4KTZA 4B08A 4AHCA 4DV5K 1WSFA 3I8BA 4PKGA 1VQON 3PY8A 3WEEA 3SUOA 4G9ZA 3AV9A 2HVHA 1NBWA 2NOHA 1EWRA 4BACA 1UWBA 3SUPA 4IFEA 3IRXA 4NB4A 4ID1A 4QG5A 3EN9A 5SZTA 4B9NA 3ZSRA 2IGIA 4B3TK 4KTWA 2JOIA 3CD6N 1YVUA 3AVJA 4UY8O 3CJ9A 2QR1A 3TWHA 3J8AA 3A5LC 4AM7A 5GAHP 3AVIA 3F9KA 1VSJA 1JLGA 4B1UB 3JAMO 1OH5A 2QKBA 1S1VA 4BR7A 2HMPA 1O13A 3E66A 4KH4A 1TKXA 2HHVA 1TBAB 4FWKA 4KFBA 4DR7K 2AP1A 4I2PA 5IYDP 4HWIA 4E7HA 3ENOA 2G8WA 5AQLA 2PAVA 5AQPA 1BU6O 5JMVA 3CMAN 1C4GA 2Q1NA 5AQGA 3CF5L 2OPRA 3J80O 3K5OA 2GWJA 5J2QA 4CBXA 3NH1A 4JS5A 2NOIA 5AJ3K 1TV6A 5TKYA 3H1QA 5AQJA 1CXUA 3CWTA 2PY5A 3AVMA 2X6NA 3NF6A 4BRHA 2VQEK 4M3XA 1WOQA 4DTMA 2I7NA 1EBMA 5HP1A 4WXAA 2BDPA 1KC8O 4JI3K 1RTJA 3D4VA 2FBTA 3V4IA 4JN4A 2CH5A 3B6PA 4CGIA 1RDAA 3TAEA 2E1ZA 1VTLE 4N41A 2RPIA 2O8BA 3G71N 1VKLA 1KLNA 1MDUB 1JCGA 4E89A 3I0XA 2NRXA 5DM7L 3CPEA 1KAYA 4KKOA 3EKSA 3I56N 4KI4A 4LC9B 2AJQA 4OKEA 1TKTA 4J2DA 1VAZA 4A59A 2F9WA 5AFUA 1UOCA 4CW7B 1ESVA 3ZT2A 1K9MO 3U6FA 1FJGK 4AM6A 4O8UA 4BC3A 1HNVA 4NXMK 3RMBA 1S1TA 4DHYA 5KRSA 2KFZA 4CJPA 2P9NB 4DV1K 3E1YA 3OYKA 4GV9A 3VGKA 4IWVA 4FLZA 1JLAA 4A61A 4M3WA 3G10A 3DM2A 3THYB 4FJ9A 1CXQA 1ATNA 3ZT0A 4HVJA 3DLBA 3LWMA 1LWWA 2A3ZA 3AARA 4B9UA 4F2RA 1KYDA 3KD5E 5J2PA 2XHBA 3P1GA 4GNIA 5JN5A 1VRTA 3THWB 1Y97A 4D7RA 5HRPA 1KVCA 4Y0WA 5AZIB 4YY3K 2O8EA 4EAGA 1QN4A 4N56A 4J8FA 4M41A 1WJWA 4DSFA 1BGXT 3TSPA 3N4QA 4H5WA 4Q0BA 4FLXA 2EHBD 1JL1A 4CJ3A 4CJKA 2FBXA 4DQRA 3R1XA 5IYCP 1CDWA 5M1NA 3FFKB 1K73O 4MQ3A 1ILYA 1E4GT 1KD1O 4Q5VA 2UXBK 4FLTA 3LDLA 3K59A 2FBVA 2YHYA 3ULDA 1NGAA 4KI6A 2NUBA 3UKRB 2FF6A 4WCEL 4BJUA 1RT6A 1LW0A 4NCBA 4FK4A 4C1NI 4FWPA 4N76A 3ZEUA 3RRHA 2W40A 3NVMA 1MWMA 3BP8A 4FZYA 1QS4A 3LP2A 3A5MC 4FWNA 4CF0A 4EHTA 3HOSA 4OPAA 4W5NA 4M42A 4A57A 2FGTA 2FSJA 4LF7K 3S9HA 1QNEA 1LW2A 4FWQA 1FKPA 3NGYA 5CZ2A 4IOCL 3VGMA 4FK0A 2O4IA 4HUEA 1S5JA 3KWGA 1QSSA 3IFRA 4CJ4A 3SLCA 3ZSQA 2QEXN 4HTUA 4DU3A 3VETA 1LAVA 3I0SA 4OKKA 1LWFA 2KFNA 4FW2A 4LF6K 4EALA 4IFYA 1ZBHA 3DLRA 1ATSA 1H1VA 4CK1A 3CCSN 3QBXA 4ILGB 5EU7A 4CGJA 5LY3A 3L3UA 5LMNK 1RT5A 1K8AO 3QEXA 3M6GA 4FJLA 5CZ1A 3HVTA 4X62K 1NK7A 3SPYA 3D2FA 4KBOA 4CD3A 4PHTX 5J2MA 4Z4FA 2YNIA 4KHNA 4B3OA 4FL9A 1QNBA 1HNXK 2NRRA 3K5NA 2QRDA 2UU9K 4L8RB 5AQRA 4GVEA 1C9BB 4BRGA 2R5XA 4A2AA 1V5SA 2NOFA 4ISEA 4CEAA 1QSLA 3SNNA 4BRAA 3T3FA 5D3GA 4DV6K 1U2VB 4PQUA 1RDBA 4E1JA 3QINA 4CK2A 1TKDA 2J4RA 2D1KA 1RT4A 2OCEA 4FPBA 3O4NA 4CZGA 1MWKA 2ZGZA 4FXDA 3QIOA 3KWIA 4H5VA 2P5OA 3MK6A 3F5TA 5AR0A 1VSMA 2YA3A 3DRSA 3QO9A 4IBNA 2Y8LA 5AQVA 4FLYA 3HM9A 1KVAA 4CEOA 4E7KA 3BKQX 2O3OA 3CCMN 2V92A 5GAEP 3QIPA 2P51A 3Q7BA 4CHYA 4HHTA 2QWLA 2YJEA 4CZFA 3CVTA 1LWVA 2QM1A 4K8XA 3HO1A 3IG1A 1BCMA 4DSLA 4H0OA 1SKWA 5BN9A 4QS9A 4JKCA 4O0JA 4KAZA 2Z0FA 2Q36A 3SCXA 4OGEA 1QN3A 4YOVA 3HXMA 2XY5A 1N36K 4CEEA 3L3VA 4DQQA 2BANA 1JJ2M 5BRFA 3R9PA 1WSGA 3FLCO 2F7TA 4CJLA 4LFCK 1BL3A 1NK5A 3VQPA 1RDUA 2IVPA 2D0OA 1DTQA 5AQKA 4X66K 3CQ8A 2OYQA 4DSKA 1EWQA 5JS1A 1O1WA 2YX6A 3E9OA 4BDZA 3H08A 4H0PA 3ZT3A 3FZKA 2RE2A 2HHXA 3DLGA 3MX2A 1KFQA 1NGJA 4GW6A 4BWMA 1OVYA 3C94A 1JFIC 5C0YA 1IV0A 2YNHA 3L6QA 4BRQA 1XHZA 3ZCMA 3O1WA 2Z1GA 4E1NA 5AQYA 5AQQA 5HLFA 4DTSA 4TSXA 1I3AA 4XH4A 3KTUA 2G30A 2P9IA 3SAGA 3PUFA 5FPDA 3OS2A 3DXMA 3CXCM 4BRDA 1GLBG 1IKXA 1EX4A 3A5NC 4YHHK 1EXQA 4ILJA 1RT2A 5FPNA 4I7FA 1CLQA 2ZE2A 2NWVA 4YFUA 1AISA 4YOUA 4WQ4A 1NG9A 4KHSA 4DQIA 4JK9A 3I33A 4JKEA 3CC2N 1TUYA 1JXEA 2G8KA 3ULEB 4CZKA 2XRIA 3GL1A 1M90O 2DY4A 1N6QA 2O8CA 5GIPA 1I39A 1RBUA 1ATRA 3AVGA 5B8HA 4JKDA 1QTSA 4JD2A 3TTCA 3S41A 4PWDA 3OCIA 3BY5A 2DFHA 2B5JA 3THXB 3PV8A 1V4SA 5C24A 3VEOA 1RNHA 4DTPA 1L3TA 1ASWA 1KLMA 4CGFA 3OJUA 4DTJA 3TE5A 3B6OA 2DKCA 2P9KA 5KPTA 1XMOK 3H3OB 3E01A 1VRUA 4YORA 3JSMA 4FLWA 4FLUA 4UQGA 4FJKA 3J7ZO 1XSZA 4Y1CA 3EIKA 3BEXA 4K8ZA 4IFVA 4DR1K 4IDKA 3OW2M 1JXBA 3O4WA 1IKWA 3TR8A 4FWLA 4H5RA 2YNFA 2QA4N 4Z4HA 5KTQA 3F2KA 3KLHA 4BC2A 3RVCA 1NKBA 4FLVA 1Q82O 2DPNA 3RWUA 2HF3A 4DTRA 4JI7K 4BR9A 4BRPA 3CCEN 5AQHA 4WE1A 3KLFA 3CJCA 3OYLA 4CGHA 4OPHA 1ZBLA 1C1AA 3EEQA 3NBPA 4MDAA 4DQPA 1FN7A 1N32K 4DTNA 3OYNA 1YTUA 4BRLA 1ZYQA 4DR5K 4JS4A 1YITN 5AQZA 1Q9YA 4KHUA 1J6ZA 4M3TA 2WUSA 4WF9L 4EP4A 2O8DB 3WNHA 2ZQBA 2QWPA 3JS6A 3LM2A 4F9OA 1VQ6N 3OYMA 2NRWA 3VQ8A 4AHTA 4CJWA 1QSYA 5JMVD 4O5FA 4DR2K 3WXIA 4DF8A 3D6RA 4JAXA 4ZTFA 2BUPA 5BREA 4B8AB 4BGAA 3NF7A 4RTFD 1S6PA 4FJXA 4ELTA 3U3YA 4LH5A 4Z4GA 3DYAA 4LF5K 2D5RA 3OLPA 1QQMA 2KTQA 2VCPA 3QFUA 1YTAA 1NU0A 3T69A 4EJZA 3ENOC 3C0BA 2F8SA 3HT3A 2NZTA 4YNQA 3K58A 3PO5A 1GOCA 4ISGA 2Q3SA 4HUFA 5TKWA 4DTXA 4LF9K 3SV3A 4M63C 1LXTA 3MN9A 3HZ6A 3SMSA 4DULA 5HSHA 4FCYA 4B3RK 4MLEA 3LDOA 3K0SA 3DPUA 4HCCA 4WFAL 1KAXA 3F9MA 2HNYA 4DS5A 4OVLA 3M8PA 1S22A 2I5WA 5AQNA 3MEGA 3NA5A 1YAGA 1XC9A 2LAEA 2B6AA 2CGKA 3KHYA 1NGHA 2IOCA 4XH1A 4CIFA 1F21A 1RM1A 4JKHA 4IJNA 1RBVA 3CQYA 5AZIA 3DI6A 2D0PA 2HOEA 1KYUA 3P39A 3VQAA 3WXMB 4JEPA 3ASMA 3FZFA 3PX0A 4A5AA 3DOLA 3PIPL 4NYNA 3EAYA 5BMNA 1TYQB 3F73A 4M3ZA 3MN5A 3ULXA 5FPEA 2IV9A 4X65K 2Y1IA 3OVNA 3C7NB 3AAQA 1KRPA 3ZLJA 3TANA 3A5OC 1NGBA 4JHDB 1ZXOA 4B9QA 1J5EK 4F4KA 3GDQA 1SV5A 1WLJA 5EXWA 3DLHA 3I8DA 4BRCA 1J5OA 3MX5A 3HJFA 2PYLA 1NGGA 4CZIA 3K57A 3UKRA 3PIOL 1UT4A 2GX9A 4FJJA 4CEFA 3QEWA 3SV4A 3ZSWA 3V9XA 4YOWA 3ENCA 2HBKA 1HYVA 4CEQA 3IKMA 3R8EA 4Z4IA 1PCZA 3GE1A 4GKJK 2A40A 3OA9A 1YQMA 2Q97A 2A5XA 2VWBA 3CM5A 4KO0A 5ADXA 5AQMA 4WZSD 2WONA 4CJEA 3ZETB 2NRVA 1BI4B 5HBMA 3N89A 3D45A 3PX4A 3LDSA 4DSJA 3S3MA 2QKKA 2NLVA 4JI6K 2BE2A 3EYZA 2OOXA 2IS3A 1JDYA 1NGIA 2P9SB 4CF1A 2KQ2A 1VQPN 2NRTA 3OSEA 4Z4CA 5AQOA 2UYTA 4KPYA 3Q7CA 2NVMA 2O4GA 3L2RA 2O8FB 3AO5A 3W0LA 1FXXA 2NOZA 4PL7A 5EOYA 1OH8A 1J3MA 1E42A 4KH5A 5FRNA 1VQNN 2W6KA 4B8CA 3EL2A 1QZ6A 1C0GA 4DV4K 4B1YB 5KGXA 1YT3A 2P9LB 3KK7A 1IJJA 3ZSYA 3IAYA 1VQ5N 4RCHA 5C10A 4JKAA 3HVRA 2VWJA 2YHAA 3CC7N 2UXCK 4FZXC 1VQ7N 3PDKA 2Y1JA 4Q11A 3V1RA 1KFIA 3VF6A 2OA8A 4EAKA 1ZBUA 1J53A 2RF2A 1YJNN 3CCQN 4FOEA 4DU4A 3TARA 4CFAA 1TK5A 3RSEB 3A2FA 4LFAK 1VQ8N 3QDKA 3QEVA 3CWUA 1M3QA 1NGCA 3V9SA 3NAEA 1VSKA 3VA0A 1VK0A 1MU2A 1DIZA 4JKGB 3PLAA 2R7YA 1VSFA 2ZD1A 5AQWA 3MECA 1K2YX 1RBTA 4WX8A 1L3VA 4IJAA 3HPOA 2NRZA 3CJAA 2YJFA 2YKMA 3WUHA 4B1XB 1QVFM 2YHWA 2PZSA 5DMRA 1RFQA 3P38A 4DR6K 2OPPA 1GOBA 3G4SN 3O08A 3PX6A 3SQ1A 3SBGA 3V81A 3CJBA 1NLVA 2VYPA 1W80A 4CJ7A 4FJHA 1E4FT 4DV7K 2FSKA 4XIUA 1NVPA 3UB5A 3VEYA 4HCBA 3AGRA 1J54A 4C8KA 4B1WB 2OTLN 5AQXA 3CCUN 1L3UA 3O1BA 3VQEA 2BTFA 5SWMA 4CHOA 3NHGA 5EY4A 2YH5A 1SZ2A 3LAMA 4BR2A 1K35A 2GELA 1BO5O 1B9DA 1NMNA 3S3NA 3VPZA 3QEIA 3LZIA 3AVBA 5KPZA 5J2NA 4CF9A 1KSPA 4DF4A 1J9AA 4DS4A 3ATVA 1NH2A 3ALYA 4CGGA 1YHQN 3O9TA 1EUVA 3DLKA 4IG0A 1X9WA 3ZT1A 4K25A 2HL8A 4CIEA 3J81O 3C04A 2I7PA 1S1XA 3O9UA 5FROA 1JLCA 5AQUA 3ENBA 3K9JA 4B9MA 2GBZA 5EVZA 1KY6A 2Q0RA 3WXLA 1QN8A 3ULEA 1PCJX 3BF1A 4O5BA 3OBWA 4BREA 1XQSC 2MJ7A 1VQ9N 4GV6A 3TAGA 1TGHA 4BWJA 2UUCK 4KHQA 3LPUA 4W5TA 2P9UA 3V9WA 4H5NA 3VN5A 3U9DA 3GBTA 1KFSA 1RBSA 1R0AA 4DTOA 1QN9A 3KLEA 5AFUH 2V9JA 4KB1A 4E3SA 3SNSA 1BQMA 1IBLK 1C0FA 1S3XA 5GINA 3O80A 4JI8K 5HRSA 1ZBFA 3H6EA 2ASOA 1UT7A 3OYJA 4CF2A 5IT9O 4WQ5A 4PKIA 4OPKA 4KRFA 4B9SA 1WAFA 3TSUA 2RKIA 3C6UA 4YOYA 1W9HA 3CJ1A 3O5BA 4OO1J 3DRPA 2F4VK 3PSIA 4DFJA 3UKUA 3ID8A 4PUOA 3QBWA 1Q8IA 2Z8UA 1KTQA 3VESA 1SL0A 2OPSA 3P83D 3G25A 5BPMA 3JYTA 2Q31A 2UXDK 4RG8A 3T1YK 1IKYA 5CY4A 3AO2A 2G8FA 1N3CA 3CWSA 3DWLA 3AA2A 1WAJA 2ZGYA 1FK9A 1P5GX 3CC4N 2OPQA 2V8QA 2D0AA 4JV5K 3OYBA 1A5VA 1LOTB 1U48A 2DFFA 3OYGA 5LJWA 2O8DA 1YXQA 1T6CA 3ZSVA 4J2EA 1A5XA 1X9MA 4JI5K 4BG9A 5IWAK 3AVNA 2V7ZA 3CHWA 4DTUA 3LPTA 3CCVN 4LSLA 3DLLL 1TL3A 3JXUA 5M1KA 2QXLA 3M8QA 4FPAA 3NMUA 5M1OA 2BH1A 3CQXA 5KI6A 2JHNA 4IKFA 2FSNA 5IYBP 3VEWA 2VG6A 2O8BB 4DV0K 4H0TB 1JLFA 4E19A 4QOZB 1TK8A 2NOLA 1N8RO 1HX1A 4JI4K 4FO0A 4BRKA 4BR5A 1VQMN 1CZBA 3RPJA 2QWRA 3CCJN 4BR0A 5T7BA 4ZHRA 3AVKA 3W3DA 4CZHA 3AVHA 4RW9A 3THVA 1IBMK 4FSVA 5CYMA 2YV0X 3OYEA 2YHBA 3OHRA 1BA1A 5LL6Z 4C7PA 3U9ZA 4CI6A 1Q86O 2B4JA 4BROA 1HMVA 4OX9K 1SKRA 4FJ8A 3FR0A 3MMVA 4C23A 2OZMA 2ITGA 1NM1A 1RT3A 3C95A 3VF2A 2NLXA 4GY2B 1DLOA 4DKWA 1I94K 1K8KB 3ISNC 1E3MA 3MWPA 4AHSA 3O9RA 1CZ9A 3NDKA 3AO3A 2X6SA 1UL7A 4JRPA 1C6VA 3EZWA 4XH5A 3K9KA 2F9TA 1HKCA 4FJGA 1YUWA 1C0MA 4OJRA 3SZ2A 1QTPA 1D5AA 3PMGA 3D2EA 3MXJA 3C7NA 4CF8A 2P5GA 2A41A 1NOYA 5GAGP 1BQNA 4O8KA 4CFCA 2OOYA 2Q0UA 2PBDA 3MEEA 3KD1E 4I6MB 1Q9XA 3RMCA 2FC0A 1VOLB 1HUXA 3PSFA 4O55A 2HHSA 3H46O 2ZJPL 1NOZA 2D0BA 1M1KO 3ZEUB 1TGOA 1YIJN 4K42A 4CHQA 1T6AA 1KVBA 1T6DA 3LDQA 2VG7A 2HB5A 4A2BA 3WNFA 3AY9A 3ZETA 3K5LA 1Z25A 3H3NO 1RTDA 1BI4A 2DFEA 2E5LK 3AA4A 5C25A 3VGLA 3EZ5A 3P31A 5KPRA 3EE9A 1GLCG 4U7BA 2P9SA 2HW3A 2YHXA 4FZZA 5C2DA 4BVPA 4M7YA 3V1OA 2G8UA 3ATUA 1KQSM 1RT1A 3DXKB 1RDDA 4Z94A 1GOAA 3OYDA 4IOAL 4F2SA 5KQ8A 4OPJA 3VQQA 2JGUA 2QWOA 4DU1A 3D2FB 3KLIA 4BVOA 2QREA 4CERA 3HS9A 5BR8K 4C8OA 3KIOA 4BRIA 1WSJA 2ZJRL 3OJSA 3U4LA 1VQKN 3WXKA 4JI2K 3SK3A 1XWLA 3M1FA 3HL8A 3L4QA 4E0DA 1TUUA 3H1VX 4FM2A 1Q18A 3RTVA 4KHWA 4BE2A 3DAWA 2E20A 4OKJA 4OLBA 1NJIO 4WFBL 3TDHA 3L2VA 1D9FA 4I2QA 3G6EN 4MDBA 4RWTA 4B3MK 4IO9L 1VQ4N 3QLHA 4FYDA 5I3UA 4QAGA 5M1PA 4DQSA 3LP3A 3RSEA 3KVGA 4WFNL 4K41A 5BMPA 1T03A 3AVAA 4EZ6A 2KZZA 3EE8A 3OC3C 4KB0A 3DJCA 4FWMA 5AQIA 4C1NK 3S3OA 2PWWA 4ISFA 1DTTA 1RCHA 3AA5X 3CWAA 4CHZA 4CZJA 3RMDA 1KO9A 2IAJA 1WNSA 2P9PB 1NK9A 1XNQK 3RRGA 1OVQA 3VERA 2VQFK 5AQSA 3E9LA 4R5PA 3NH0A 5CR4A 3IH7A 3LDNA 2P9NA 3OSTA 3TTDA 4YOXA 1YQLA 4DV2K 3WT0A 4E7JA 4CCHA 1C1CA 3M8RA 2HF4A 1GLDG 4CGDA 1MP9A 4LSNA 3THYA 4WYBA 5C2FA 1LAWA 3I0WA 3T1HK 4ELVA 1G99A 3P4IA 3OBYA 1JLQA 1RILA 2CGLA 4A62A 1WSHA 1RGIA 1NKCA 5ELZA 2QK9A 2HZSA 5KL0A 3THWA 4H0VB 4AHVA 5J1EA 1NGFA 4PY5A 3VQDA 3UE5A 1MA9B 1GLFO 2V7YA 2ZF5O 5C42A 1WSEA 4GVMA 4O0IA 2ZWHA 1HYSA 4IOXA 3ITHA 5JLFA 3V6DA 2FUVA 3DOKA 1VSDA 3TU5A 4YDUA 3D7EO 1RTIA 2HBLA 3C6TA 2G8VA 2XY6A 1NK6A 1WQAA 4CJ5A 3NF8A 3O4QA 5DK5A 3TAQA 4RW8A 5KGWA 3O8MA 3EKUA 4EHUA 2FF3B 3TABA 4BC5A 1NJZA 3BZKA 4IEEA 3T7ZA 4LH4A 3UIQA 3RSMA 3VQCA 3VA3A 1REVA 4ZTJA 2F7LA 3WQUA 1WBBA 3IS9A 1HKGA 1HKBA 3DMJA 2E6MA 3TAFA 3MN6A 1NK8A 4GV3A 5EX5A 5JS2A 4C8NA 4U67L 4I8OA 4BQLA 4B0AA 2QWMA 3VOVA 2O8CB 4DLEA 5GIOA 3V1QA 3KKSA 2V52B 2HBMA 1M5Q1 4BY9C 1ITGA 4IG3A 4JD2B 2JHJA 1XNRK 1QN7A 1BIUA 2EWSA 5F2RA 4CEZA 3SQ4A 3HPGA 2EHGA 1W97L 1HRHA 1X3NA 4J2AA 1L5UA 2MZ8A 1K6YA 1BA0A 2QWQA 1CZAN 4N47A 1JLBA 1DGKN 1S9GA 5AQFA 5JVGL 2A1RA 2P9KB 1VHXA 1NJXA 1G15A 3FFIA 4CD1A 3OYAA 1QNAA 1SAZA 2QXFA 1EQYA 1TK0A 1NJWA 4BG8A 1ZBIA 2WOMA 1QN6A 4EZ9A 4B1ZA 1VTOA 2QI2A 4DR3K 2F96A 3OGDA 3HTVA 4CZEA 4CE9A 4H03B 1BWFO 4RW7A 4MO5A 2VGNA 2Z1JA 1YTBA 4IEIA 5AZJB 2EX3A 5BPLA
chains in the Genus database with same CATH topology
3LALA 3C94A 1JFIC 4PA1A 1D8YA 2X78A 2YNHA 1XHZA 1X1PA 3D0PA 3ZCMA 2Z1GA 4E1NA 3V9WA 3VN5A 4ROCB 5HLFA 4DTSA 4B9TA 4TSXA 4C8LA 1R4XA 1I3AA 1UA0A 3KTUA 2HHWA 1KFSA 2ETJA 3TAPA 2G30A 1TAUA 1RBSA 3DLEA 3LWLA 1R0AA 3PUFA 1QN9A 3KLEA 4DTOA 3HYFA 1RTHA 3OS2A 4N5SA 4KB1A 4E3SA 1L5UA 3SNSA 1BQMA 3KK2A 1IKXA 1EX4A 2RN2A 4M45A 5HRSA 1ZBFA 3O3HA 1EXQA 3V9UA 4NCAA 1RT2A 4OLAA 4I7FA 4JRQA 1UT7A 1CLQA 3L2QA 2ZE2A 3OYJA 4CF2A 2GUIA 4YFUA 1AISA 4I9QA 2F8TA 3AO1A 4RW6A 4DMNA 4H4MA 2HZMA 5HRRA 1NK0A 4OPKA 4KRFA 5JS1A 4KHSA 4B9SA 4DQIA 1WAFA 2ATQA 2RKIA 4OGCA 3C6UA 5HRNA 1W9HA 4B9VA 2P1JA 3DRPA 1JXEA 2G8KA 4F2SA 2GV9A 2E4LA 4DFJA 4CJUA 3QNNA 2XRIA 4PUOA 3BDPA 2DY4A 1Q8IA 1N6QA 4FK2A 2Z8UA 1KTQA 1WSIA 4AHUA 1S1WA 3LP0A 1SL0A 2OPSA 3P83D 4FW1A 1I39A 1RBUA 3AVGA 3DRRA 4LY7A 3JYTA 4RG8A 1BCOA 4FM1A 1QTSA 3SI6A 1SL1A 1IKYA 5CY4A 3AO2A 2G8FA 1N3CA 1HJRA 4O4GA 4PWDA 3OCIA 3AA2A 1YQKA 3OY9A 1D9DA 1WAJA 4Y1DA 2PYJA 2YNGA 2DFHA 2B5JA 4RW4A 4DFMA 1NKEA 3CFRA 4E7LA 3RR8A 3PV8A 1FK9A 5C24A 4J2BA 1RNHA 2OPQA 4DTPA 2D0AA 1L3TA 4FYDA 1ASWA 1KLMA 4CGFA 3OJUA 3LP1A 4DTJA 3B6OA 1U47A 3NCIA 2Z1HA 3OYBA 1A5VA 1U48A 2IC3A 3T19A 1C1BA 3E01A 2G8HA 1VRUA 1LWCA 3SYZA 3JSMA 2JLEA 4FLWA 2DFFA 1S1UA 3OYGA 4FLUA 3L2WA 4UQGA 1VSEA 4FJKA 2XY7A 3ZSVA 4Y1CA 4J2EA 1A5XA 3EIKA 4K8ZA 1X9MA 3PO4A 4IFVA 3M8SA 3AVNA 3I0RA 4ICLA 4IDKA 3NH2A 1JXBA 4DTUA 1BIZA 3TR8A 4TPSA 1IKWA 3T1AA 3LPTA 2VG5A 3ZSXA 2YNFA 4Z4HA 4LSLA 2HMIA 1B9FA 2D0CA 1TL3A 3HSTB 2Z1IA 3M8QA 5KTQA 3KLHA 1T8EA 4FVMA 1NKBA 4DG1A 4AILC 4FLVA 5E41A 5KI6A 4CJRA 2LSNA 4LD0A 4DTRA 4BDYA 3RWUA 5IYBP 3H1ZA 4IKFA 3SJJA 1U4BA 3RR7A 3VQ7A 2VG6A 3QETA 2HHTA 4HUGA 1T7PA 4WE1A 1YQRA 3KLFA 4O44A 3NGIA 3OYLA 4CGHA 1ZBLA 1YTFA 1C1AA 1JLFA 1VSLA 4E19A 1QNCA 2NOLA 4KTZA 3OS0A 4FM0A 4B08A 1TK8A 3NBPA 4QOZB 4AHCA 1WSFA 1N39A 1CZBA 4DQPA 1FN7A 3PY8A 3ZSZA 3SUOA 3RPJA 4DTNA 3OYNA 3AV9A 1YTUA 1W0HA 2HVHA 1ZYQA 3OYHA 5FDLA 3L8BA 3AVLA 2NOHA 4ZHRA 3AVKA 5T7BA 4JS4A 4BACA 1Q9YA 1UWBA 4KHUA 1SUQA 4M3TA 3AVHA 4RW9A 4CESA 3SUPA 3THVA 4EP4A 3SQ0A 3IRXA 3WNHA 4ID1A 2ZQBA 5SZTA 4B9NA 5CYMA 2YV0X 3LZJA 3ZSRA 3OYEA 2YHBA 2IGIA 4KTWA 3MEDA 2JOIA 3OYMA 2B4JA 1HMVA 3VQ8A 4AHTA 4CJWA 4CFBA 1QSYA 1LWYA 3LAKA 1SKRA 1YVUA 3AVJA 4DF8A 1X9SA 3TWHA 4ZTFA 4FJ8A 1M3HA 4ID5A 3AVIA 2OZMA 2ITGA 1VSJA 3F9KA 4B8AB 2XHIA 1JLGA 3K5MA 2QKBA 1SKSA 3NF7A 2BGGA 3VQ5A 1S6PA 4FJXA 1RT3A 3C95A 4ELTA 3U3YA 1S1VA 1DLOA 4LH5A 3O3GA 4Z4GA 3DYAA 1TKXA 3ISNC 2HHVA 3OYFA 2XY8A 1TBAB 2D5RA 4KFBA 1NGMA 4AHSA 3QERA 4DWIA 2KTQA 1CZ9A 4I2PA 5IYDP 1YTAA 3NDKA 3AO3A 4ROEB 4E7HA 4EJZA 2X6SA 1SL2A 2G8WA 4M3RA 4JRPA 1C6VA 4CFDA 1BHLA 2F8SA 3HT3A 1UA1A 4YNQA 3DPTA 2OPRA 4FJGA 3K58A 3K5OA 5J2QA 3PO5A 4CK3A 2VJ0A 1GOCA 2Q3SA 3NE6A 3NH1A 4JS5A 3HK2A 1JL2A 2NOIA 1C0MA 4HUFA 1TV6A 4OJRA 4QCLA 3SZ2A 4DTXA 1CXUA 1QTPA 3SV3A 1D5AA 3AVMA 2PY5A 2X6NA 3MXJA 3NF6A 4CF8A 2P5GA 4M3XA 4DTMA 3QNOA 1NOYA 3WNEA 1EBMA 4DULA 4FCYA 1BQNA 5HP1A 2BDPA 2YKNA 3DPUA 1RTJA 4W5QA 2KZMA 3MXIA 4CFCA 4HCCA 3MEEA 3KD1E 1UAXA 2FBTA 3V4IA 3K2PA 2HNYA 4DS5A 3B6PA 1Q9XA 4OVLA 3M8PA 4CGIA 2I5WA 1RDAA 3MEGA 3TAEA 4F3TA 3RMCA 1VTLE 4N41A 2FC0A 1VOLB 2RPIA 3CFOA 2LAEA 1IKVA 1U04A 4O55A 2B6AA 1XC9A 2HHSA 1KLNA 2IOCA 4CIFA 5KRTA 4M3YA 1NOZA 2D0BA 1F21A 4E89A 4CJVA 3I0XA 4F8RA 1RM1A 2HVIA 1U49A 1RT7A 1TGOA 4KKOA 2DTUA 1RBVA 3QESA 4CHQA 4KI4A 3NGZA 2AJQA 3DI6A 4OKEA 1TKTA 4FJNA 1PZDA 1KYUA 3VQAA 3TAMA 2VWKA 1KVBA 3V9ZA 4CIGA 4B9LA 4J2DA 1ASUA 1UOCA 2VG7A 3ASMA 2HB5A 3MXMA 3PX0A 3DOLA 1EETA 2A1SA 3ZT2A 4NYNA 3WNFA 3F73A 4M3ZA 3K5LA 5AN4A 3ULXA 1EKEA 2IV9A 1BI4A 1Z25A 5K14A 3U6FA 2DFEA 4AH9A 1HNVA 1RBRA 3AA4A 4NCGA 5C25A 3RMBA 1S1TA 1QQCA 3EZ5A 3OVNA 4W5RA 1N5YA 5KRSA 1KRPA 3TANA 1HU0A 4Z0UA 3NF9A 2KFZA 4CJPA 1IH7A 1XI1A 4F4KA 4EP5A 3OYKA 1C0UA 1SV5A 1WLJA 3DLHA 4FLZA 3I8DA 2HW3A 1JLAA 4M3WA 1J5OA 3HJFA 3G10A 3F0ZA 3DM2A 2PYLA 4FZZA 3V1OA 3K57A 3QEPA 2G8UA 1UT4A 2Y1IA 1VSIA 4FJ9A 4FJJA 4KTQA 1CXQA 4CEFA 3ZT0A 4HVJA 3QEWA 1RT1A 3DLBA 1RDDA 1LWWA 3LWMA 1WN7A 3SV4A 1GOAA 3ZSWA 3OYDA 4B9UA 1KYDA 3OSMA 4H8KA 3KD5E 4OPJA 3VQQA 3KRMA 2JGUA 4DU1A 5J2PA 2NOEA 3HPHA 3AVCA 3KTQA 4W5OA 3KK3A 3V9XA 2XHBA 3P1GA 4NYFA 3KLIA 1VRTA 1HYVA 1Y97A 3HS9A 4CERA 4CEQA 4C8OA 5HRPA 1KVCA 4Z4IA 3KIOA 1WSJA 1PCZA 1QN4A 4N56A 4GMJB 1YQMA 4M41A 3OJSA 1IG9A 4KV8A 4DSFA 3CM5A 1BGXT 3O3FA 1XWLA 4KO0A 1BISA 1TKZA 1KCFA 3HL8A 3OS1A 4E0DA 4Q0BA 4WZSD 2WONA 4CJEA 4FLXA 1JL1A 1BI4B 5HBMA 4CJ3A 4CJKA 4BE0A 4FM2A 2FBXA 3N89A 3D45A 4CECA 4CJSA 3RTVA 4BE2A 3PX4A 4OKJA 3LDSA 4KHWA 4OLBA 4DQRA 4DSJA 3S3MA 2QKKA 3L2VA 1D9FA 5IYCP 4I2QA 3OYIA 1CDWA 3RMAA 2BE2A 3EYZA 3SQ2A 3KKRA 4MQ3A 2IS3A 4DLGA 2FBYA 4CF1A 4Q5VA 2KQ2A 3QLHA 1QN5A 3AA3A 4FLTA 3K59A 1HQUA 2FBVA 4JLHA 4QAGA 3ULDA 1IO2A 2NUBA 5I3UA 4Z4CA 4KI6A 4KREA 4DQSA 1N3AA 3LP3A 1RT6A 1TL1A 4KPYA 1LW0A 2O4GA 4NCBA 4FK4A 3L2RA 1RTDA 3AO5A 1FXXA 2NOZA 4N76A 3RRHA 5FRNA 3HP9A 1E42A 3AVAA 1B9KA 4CHNA 3KK1A 1T03A 4EZ6A 4FZYA 1QS4A 3LP2A 4B8CA 4DSLA 1ASVA 2KZZA 1HNIA 3OC3C 4KB0A 4CF0A 4W5NA 2HNZA 5KGXA 3S3OA 1YT3A 1DTTA 1Z26A 1RCHA 2KW4A 3VQBA 4FJ5A 3AA5X 4M42A 1NK4A 3CYMA 2FGTA 3HP6A 4CHZA 3S9HA 1QNEA 1LW2A 1VOKA 3RMDA 1KO9A 1FKPA 3NGYA 2IAJA 1WNSA 5CZ2A 3ZSYA 1NK9A 3IAYA 3RRGA 2NOBA 2IDOA 2VWJA 3HVRA 4FK0A 2O4IA 4I9LA 4HUEA 1S5JA 2YHAA 1QSSA 4CJ4A 3VQ4A 1FKOA 3ZSQA 1KY7A 4R5PA 4FZXC 3NH0A 4HTUA 3WNGA 3IH7A 4ELUA 2Y1JA 5HROA 4Q11A 4MFBA 4DU3A 1LAVA 3OSTA 3V1RA 3I0SA 4OKKA 1LWFA 1YQLA 2KFNA 4FW2A 4E7JA 4DFPA 4CCHA 1C1CA 2OA8A 4IFYA 3M8RA 1ZBHA 1ZBUA 3KLGA 4CGDA 1MP9A 1J53A 3DLRA 4LSNA 4CK1A 4BE1A 2RF2A 3SUQA 1U45A 5EU7A 1C0TA 1LAWA 3I0WA 4CGJA 3L3UA 4DU4A 1RT5A 3TARA 4CFAA 3QEXA 1L3SA 4CEBA 4ELVA 2HHQA 1JLQA 3F10A 1TK5A 1RILA 2XO7A 1WSHA 4FJLA 5CZ1A 3A2FA 3HVTA 3CFPA 1EP4A 1NK7A 1NKCA 3SPYA 2QK9A 3G0ZA 3QEVA 5J2MA 1M3QA 4Z4FA 2HZSA 2HHUA 3V9SA 4F3OA 2YNIA 3NAEA 4KHNA 4B3OA 2OZSA 1VSKA 1QNBA 3VA0A 4AHVA 5J1EA 1VK0A 1MU2A 2E6LA 4PY5A 3VQDA 1D3UA 4FJIA 3K5NA 3AO4A 4E1MA 2R7YA 1QE1A 4L8RB 4RODB 1VSFA 5C42A 1TBPA 1WSEA 1C9BB 2ZD1A 4GVMA 4O0IA 3ZT4A 1JLEA 3MECA 1HYSA 2IV8A 2W42A 1RBTA 2NOFA 4E7IA 3ITHA 4CEAA 1QSLA 3V6DA 1L3VA 3HPOA 3SNNA 1LWEA 4CEDA 3DOKA 1VSDA 3T3FA 4BDPA 1RTIA 1XHXA 5D3GA 4PQUA 2YKMA 1RDBA 1LV5A 3C6TA 2G8VA 3QINA 2PZSA 2XY6A 1NK6A 5DMRA 4FJ7A 4CJ5A 2G8IA 3NF8A 3O4QA 5DK5A 3VQ6A 4CK2A 4RW8A 5KGWA 3TAQA 1T05A 2OPPA 1TKDA 1RT4A 1GOBA 3O4NA 4CHPA 3PX6A 4H4OA 1B92A 3V81A 3SQ1A 4FXDA 1S6QA 3QIOA 3TABA 5FRMA 2P5OA 3TI0A 1HYZA 1RDCA 1W80A 1NJZA 4FJHA 1VSMA 3DRSA 3QO9A 4LH4A 3ZSOA 4IBNA 4XIUA 3UIQA 1JKHA 1NVPA 4FLYA 3VQCA 3HM9A 4HCBA 1KVAA 3P5JA 3VA3A 3NFAA 1J54A 4CEOA 3SPZA 1REVA 4E7KA 4ZTJA 4C8KA 2O3OA 1L3UA 3IS9A 3VQEA 4CJFA 3DMJA 3OYCA 4G1QA 2E6MA 3MAQA 5SWMA 3TAFA 3QIPA 4CHOA 2P51A 4CHYA 1NK8A 5JS2A 4HHTA 3NHGA 4C8NA 2YH5A 1QTMA 4I8OA 3LAMA 4F2RA 4B0AA 1LWVA 4KHYA 3HO1A 4K8XA 3BGRA 3IG1A 1BCMA 3AVFA 5I42A 4DLEA 1SKWA 1HQEA 1B9DA 3VQ9A 3V1QA 4CJTA 3HS8A 3S3NA 4FJMA 4M3UA 4O0JA 3KKSA 3QEIA 1KFDA 4KAZA 3LZIA 3AVBA 1ITGA 2I5JA 4IG3A 5J2NA 1NJYA 1QN7A 1BIUA 2HNDA 4CF9A 4DF4A 3SCXA 1KSPA 1J9AA 4DS4A 4CEZA 4OGEA 1QN3A 2XY5A 3HXMA 3HPGA 3SQ4A 1NH2A 2EHGA 3L3VA 4CEEA 3ALYA 4DQQA 3CM6A 4CGGA 1HRHA 1A5WA 1HPZA 2BANA 3L2UA 4J2AA 3DLKA 1KYFA 1WSGA 2MZ8A 4IG0A 1K6YA 3U3GA 3ZT1A 4CJLA 3SUNA 1X9WA 1BL3A 1NK5A 3VQPA 4N47A 1JLBA 3CG7A 1S9GA 4CIEA 1DTQA 4C8MA 2A1RA 1NJXA 1G15A 1S1XA 3FFIA 5FROA 3OYAA 1QNAA 3CQ8A 2OYQA 2QXFA 1JLCA 4DSKA 1TK0A 4CJQA 1NJWA 1ZBIA 2WOMA 4AHRA 1QHTA 1QN6A 2GBZA 3EY1A 4DSEA 4B9MA 4EZ9A 1VTOA 4EJYA 1KY6A 1O1WA 1TVRA 2X74A 1S9EA 3LANA 1QN8A 2F96A 4BDZA 3H08A 4DSIA 4O5BA 1TAQA 4Z4EA 3ZT3A 4CE9A 2MJ7A 4DFKA 5CYQA 4RW7A 3KJVA 1VSHA 2HHXA 2Z1JA 3DLGA 3TAGA 1TGHA 1YTBA 4GW6A 4BWJA 4BWMA 4KHQA 2EX3A 3LPUA 4W5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LAL A;  3C94 A;  1JFI C;  4PA1 A;  1D8Y A;  2X78 A;  2YNH A;  1XHZ A;  1X1P A;  3D0P A;  3ZCM A;  2Z1G A;  4E1N A;  3V9W A;  3VN5 A;  4ROC B;  5HLF A;  4DTS A;  4B9T A;  4TSX A;  4C8L A;  1R4X A;  1I3A A;  1UA0 A;  2HHW A;  1KFS A;  2ETJ A;  3TAP A;  2G30 A;  1TAU A;  1RBS A;  3DLE A;  3LWL A;  1R0A A;  3PUF A;  1QN9 A;  3KLE A;  4DTO A;  3HYF A;  1RTH A;  3OS2 A;  4N5S A;  4KB1 A;  4E3S A;  1BQM A;  3KK2 A;  1IKX A;  1EX4 A;  2RN2 A;  4M45 A;  5HRS A;  1ZBF A;  3O3H A;  1EXQ A;  3V9U A;  4NCA A;  1RT2 A;  4OLA A;  4I7F A;  4JRQ A;  1CLQ A;  3L2Q A;  2ZE2 A;  3OYJ A;  4CF2 A;  2GUI A;  4YFU A;  1AIS A;  4I9Q A;  2F8T A;  3AO1 A;  4RW6 A;  4DMN A;  4H4M A;  1NK0 A;  5HRR A;  5JS1 A;  4OPK A;  4KRF A;  4KHS A;  4B9S A;  4DQI A;  1WAF A;  2ATQ A;  2RKI A;  4OGC A;  3C6U A;  5HRN A;  1W9H A;  4B9V A;  2P1J A;  3DRP A;  1JXE A;  2G8K A;  2GV9 A;  2E4L A;  4DFJ A;  4CJU A;  3QNN A;  2XRI A;  4PUO A;  3BDP A;  2DY4 A;  1Q8I A;  1N6Q A;  4FK2 A;  2Z8U A;  1KTQ A;  1WSI A;  4AHU A;  1S1W A;  3LP0 A;  1SL0 A;  2OPS A;  3P83 D;  4FW1 A;  1I39 A;  1RBU A;  3AVG A;  3DRR A;  4LY7 A;  3JYT A;  4RG8 A;  1BCO A;  4FM1 A;  1QTS A;  3SI6 A;  1SL1 A;  1IKY A;  5CY4 A;  3AO2 A;  2G8F A;  1HJR A;  4O4G A;  4PWD A;  3OCI A;  3AA2 A;  3OY9 A;  1D9D A;  1WAJ A;  4Y1D A;  2PYJ A;  2YNG A;  2DFH A;  2B5J A;  4RW4 A;  4DFM A;  1NKE A;  3CFR A;  4E7L A;  3RR8 A;  3PV8 A;  1FK9 A;  5C24 A;  4J2B A;  1RNH A;  2OPQ A;  4DTP A;  2D0A A;  1L3T A;  4FYD A;  1ASW A;  1KLM A;  4CGF A;  3OJU A;  3LP1 A;  4DTJ A;  3B6O A;  1U47 A;  3NCI A;  2Z1H A;  3OYB A;  1A5V A;  1U48 A;  2IC3 A;  3T19 A;  1C1B A;  3E01 A;  2G8H A;  1VRU A;  1LWC A;  3SYZ A;  3JSM A;  2JLE A;  4FLW A;  2DFF A;  1S1U A;  3OYG A;  4FLU A;  3L2W A;  4UQG A;  1VSE A;  4FJK A;  2XY7 A;  3ZSV A;  4Y1C A;  4J2E A;  1A5X A;  3EIK A;  4K8Z A;  1X9M A;  3PO4 A;  4IFV A;  3M8S A;  3AVN A;  3I0R A;  4ICL A;  4IDK A;  3NH2 A;  1JXB A;  4DTU A;  1BIZ A;  3TR8 A;  1IKW A;  3T1A A;  3LPT A;  2VG5 A;  3ZSX A;  2YNF A;  4Z4H A;  4LSL A;  2HMI A;  1B9F A;  2D0C A;  1TL3 A;  3HST B;  2Z1I A;  3M8Q A;  5KTQ A;  3KLH A;  1T8E A;  4FVM A;  1NKB A;  4DG1 A;  4AIL C;  4FLV A;  5E41 A;  5KI6 A;  4CJR A;  2LSN A;  4LD0 A;  4DTR A;  4BDY A;  3RWU A;  5IYB P;  3H1Z A;  4IKF A;  3SJJ A;  1U4B A;  3RR7 A;  3VQ7 A;  2VG6 A;  3QET A;  2HHT A;  4HUG A;  1T7P A;  4WE1 A;  3KLF A;  4O44 A;  3NGI A;  3OYL A;  4CGH A;  1ZBL A;  1YTF A;  1C1A A;  1JLF A;  1VSL A;  4E19 A;  1QNC A;  3OS0 A;  4KTZ A;  4FM0 A;  1TK8 A;  4B08 A;  4QOZ B;  3NBP A;  4AHC A;  1WSF A;  1CZB A;  4DQP A;  3PY8 A;  3ZSZ A;  3SUO A;  4DTN A;  3OYN A;  3AV9 A;  1YTU A;  1W0H A;  2HVH A;  1ZYQ A;  3OYH A;  5FDL A;  3L8B A;  3AVL A;  5T7B A;  4ZHR A;  3AVK A;  4JS4 A;  4BAC A;  1Q9Y A;  1UWB A;  4KHU A;  1SUQ A;  4M3T A;  3AVH A;  4RW9 A;  4CES A;  3SUP A;  3THV A;  4EP4 A;  3SQ0 A;  3IRX A;  3WNH A;  4ID1 A;  2ZQB A;  5SZT A;  4B9N A;  5CYM A;  2YV0 X;  3LZJ A;  3ZSR A;  3OYE A;  2YHB A;  2IGI A;  4KTW A;  3MED A;  3OYM A;  2B4J A;  1HMV A;  3VQ8 A;  4AHT A;  4CJW A;  4CFB A;  1QSY A;  3LAK A;  1SKR A;  1YVU A;  3AVJ A;  4DF8 A;  1X9S A;  3TWH A;  4ZTF A;  4FJ8 A;  4ID5 A;  3AVI A;  2OZM A;  2ITG A;  1VSJ A;  3F9K A;  4B8A B;  1JLG A;  3K5M A;  2QKB A;  1SKS A;  3NF7 A;  2BGG A;  3VQ5 A;  1S6P A;  4FJX A;  1RT3 A;  3C95 A;  4ELT A;  3U3Y A;  1S1V A;  1DLO A;  4LH5 A;  3O3G A;  4Z4G A;  3DYA A;  1TKX A;  3ISN C;  2HHV A;  3OYF A;  2XY8 A;  1TBA B;  2D5R A;  4KFB A;  1NGM A;  4AHS A;  3QER A;  4DWI A;  2KTQ A;  1CZ9 A;  4I2P A;  5IYD P;  1YTA A;  3NDK A;  3AO3 A;  4ROE B;  4E7H A;  2X6S A;  1SL2 A;  2G8W A;  4M3R A;  4JRP A;  1C6V A;  4CFD A;  1BHL A;  2F8S A;  3HT3 A;  1UA1 A;  4YNQ A;  2OPR A;  4FJG A;  3K58 A;  3K5O A;  5J2Q A;  3PO5 A;  4CK3 A;  2VJ0 A;  1GOC A;  2Q3S A;  3NE6 A;  3NH1 A;  4JS5 A;  3HK2 A;  1JL2 A;  1C0M A;  4HUF A;  1TV6 A;  4OJR A;  4QCL A;  3SZ2 A;  4DTX A;  1CXU A;  1QTP A;  3SV3 A;  1D5A A;  3AVM A;  2PY5 A;  2X6N A;  3MXJ A;  3NF6 A;  4CF8 A;  2P5G A;  4M3X A;  4DTM A;  3QNO A;  1NOY A;  3WNE A;  4FCY A;  1BQN A;  5HP1 A;  2BDP A;  2YKN A;  1RTJ A;  4W5Q A;  2KZM A;  3MXI A;  4CFC A;  4HCC A;  3MEE A;  3KD1 E;  1UAX A;  2FBT A;  3V4I A;  3K2P A;  2HNY A;  4DS5 A;  3B6P A;  1Q9X A;  4OVL A;  3M8P A;  4CGI A;  1RDA A;  3MEG A;  3TAE A;  4F3T A;  3RMC A;  1VTL E;  4N41 A;  2FC0 A;  1VOL B;  2RPI A;  3CFO A;  1IKV A;  4O55 A;  1U04 A;  1XC9 A;  2B6A A;  2HHS A;  1KLN A;  2IOC A;  4CIF A;  5KRT A;  4M3Y A;  1NOZ A;  2D0B A;  1F21 A;  4E89 A;  4CJV A;  4F8R A;  1RM1 A;  2HVI A;  1U49 A;  1RT7 A;  1TGO A;  4KKO A;  2DTU A;  1RBV A;  3QES A;  4CHQ A;  4KI4 A;  3NGZ A;  2AJQ A;  3DI6 A;  4OKE A;  1TKT A;  4FJN A;  1PZD A;  1KYU A;  3VQA A;  3TAM A;  2VWK A;  1KVB A;  3V9Z A;  4CIG A;  4B9L A;  4J2D A;  1ASU A;  1UOC A;  2VG7 A;  3ASM A;  2HB5 A;  3MXM A;  3PX0 A;  3DOL A;  1EET A;  2A1S A;  3ZT2 A;  4NYN A;  3WNF A;  3F73 A;  4M3Z A;  3K5L A;  1Z25 A;  1EKE A;  3U6F A;  2IV9 A;  1BI4 A;  5K14 A;  2Y1I A;  1RTD A;  2DFE A;  4AH9 A;  1HNV A;  1RBR A;  3AA4 A;  4NCG A;  5C25 A;  3RMB A;  1S1T A;  1QQC A;  3EZ5 A;  3OVN A;  4W5R A;  1N5Y A;  5KRS A;  1KRP A;  3TAN A;  4Z0U A;  3NF9 A;  2KFZ A;  4CJP A;  1IH7 A;  1XI1 A;  4F4K A;  4EP5 A;  3OYK A;  1C0U A;  1SV5 A;  1WLJ A;  3DLH A;  4FLZ A;  3I8D A;  2HW3 A;  1JLA A;  4M3W A;  1J5O A;  3HJF A;  3G10 A;  2PYL A;  3DM2 A;  4FZZ A;  3V1O A;  3K57 A;  3QEP A;  2G8U A;  1VSI A;  4FJ9 A;  4FJJ A;  4KTQ A;  1CXQ A;  4CEF A;  3ZT0 A;  4HVJ A;  3QEW A;  1RT1 A;  3DLB A;  1RDD A;  3LWM A;  3SV4 A;  1WN7 A;  1GOA A;  3ZSW A;  3OYD A;  4B9U A;  1KYD A;  4H8K A;  3KD5 E;  4F2R A;  4OPJ A;  3VQQ A;  2JGU A;  5J2P A;  4DU1 A;  4F2S A;  3HPH A;  3AVC A;  3KTQ A;  4W5O A;  3KK3 A;  3V9X A;  2XHB A;  3P1G A;  4NYF A;  3KLI A;  1VRT A;  1HYV A;  1Y97 A;  3HS9 A;  4CER A;  4CEQ A;  4C8O A;  5HRP A;  1KVC A;  4Z4I A;  3KIO A;  1WSJ A;  1PCZ A;  1QN4 A;  4N56 A;  4GMJ B;  3OJS A;  4M41 A;  1IG9 A;  4KV8 A;  4DSF A;  3CM5 A;  1BGX T;  3O3F A;  1XWL A;  4KO0 A;  1BIS A;  1TKZ A;  1KCF A;  3HL8 A;  3OS1 A;  4E0D A;  4Q0B A;  4WZS D;  2WON A;  4CJE A;  4FLX A;  1JL1 A;  1BI4 B;  5HBM A;  4CJ3 A;  4CJK A;  4BE0 A;  4FM2 A;  2FBX A;  3D45 A;  4CJS A;  4CEC A;  3RTV A;  3PX4 A;  4BE2 A;  4KHW A;  4OKJ A;  3LDS A;  4OLB A;  4DQR A;  4DSJ A;  3S3M A;  2QKK A;  3L2V A;  1D9F A;  5IYC P;  4I2Q A;  3OYI A;  1CDW A;  3RMA A;  2BE2 A;  3EYZ A;  3SQ2 A;  3KKR A;  4MQ3 A;  2IS3 A;  4DLG A;  2FBY A;  4CF1 A;  4Q5V A;  2KQ2 A;  3QLH A;  1QN5 A;  3AA3 A;  4FLT A;  3K59 A;  1HQU A;  2FBV A;  4JLH A;  4QAG A;  3ULD A;  1IO2 A;  2NUB A;  5I3U A;  4Z4C A;  4KI6 A;  4KRE A;  4DQS A;  3LP3 A;  1RT6 A;  1TL1 A;  4KPY A;  1LW0 A;  2O4G A;  4NCB A;  4FK4 A;  3L2R A;  3AO5 A;  1FXX A;  4N76 A;  3RRH A;  5FRN A;  3HP9 A;  1E42 A;  3AVA A;  1B9K A;  4CHN A;  3KK1 A;  1T03 A;  4EZ6 A;  4FZY A;  1QS4 A;  3LP2 A;  4B8C A;  4DSL A;  1ASV A;  2KZZ A;  1HNI A;  3OC3 C;  4KB0 A;  4CF0 A;  4W5N A;  2HNZ A;  5KGX A;  3S3O A;  1YT3 A;  1DTT A;  1Z26 A;  1RCH A;  2KW4 A;  3VQB A;  4FJ5 A;  3AA5 X;  4M42 A;  1NK4 A;  3CYM A;  3HP6 A;  4CHZ A;  3S9H A;  1QNE A;  1LW2 A;  1VOK A;  3RMD A;  5CZ2 A;  1FKP A;  3NGY A;  2IAJ A;  1WNS A;  1NK9 A;  3ZSY A;  3IAY A;  3RRG A;  2IDO A;  2VWJ A;  4FK0 A;  3HVR A;  2O4I A;  4I9L A;  4HUE A;  1S5J A;  2YHA A;  1QSS A;  4CJ4 A;  3VQ4 A;  1FKO A;  3ZSQ A;  1KY7 A;  4R5P A;  4FZX C;  3NH0 A;  4HTU A;  3WNG A;  4ELU A;  2Y1J A;  5HRO A;  4MFB A;  4DU3 A;  1LAV A;  3V1R A;  3I0S A;  4OKK A;  1LWF A;  2KFN A;  4FW2 A;  4E7J A;  4DFP A;  4CCH A;  1C1C A;  2OA8 A;  4IFY A;  3M8R A;  1ZBH A;  1ZBU A;  3KLG A;  4CGD A;  1MP9 A;  1J53 A;  3DLR A;  4LSN A;  4CK1 A;  4BE1 A;  2RF2 A;  3SUQ A;  1U45 A;  5EU7 A;  1C0T A;  1LAW A;  4CGJ A;  4DU4 A;  3L3U A;  3TAR A;  1RT5 A;  1L3S A;  4CFA A;  3QEX A;  2HHQ A;  4CEB A;  4ELV A;  1JLQ A;  1TK5 A;  1RIL A;  2XO7 A;  1WSH A;  4FJL A;  5CZ1 A;  3A2F A;  3HVT A;  3CFP A;  1EP4 A;  1NK7 A;  1NKC A;  3SPY A;  2QK9 A;  3G0Z A;  3QEV A;  5J2M A;  4Z4F A;  2HHU A;  3V9S A;  4F3O A;  2YNI A;  3NAE A;  4KHN A;  4B3O A;  2OZS A;  1VSK A;  1QNB A;  3VA0 A;  4AHV A;  5J1E A;  1VK0 A;  1MU2 A;  2E6L A;  4PY5 A;  3VQD A;  1D3U A;  4FJI A;  3K5N A;  3AO4 A;  4E1M A;  2R7Y A;  1QE1 A;  4L8R B;  4ROD B;  1VSF A;  5C42 A;  1TBP A;  1WSE A;  1C9B B;  2ZD1 A;  4GVM A;  4O0I A;  3ZT4 A;  1JLE A;  3MEC A;  1HYS A;  2IV8 A;  2W42 A;  1RBT A;  4E7I A;  3ITH A;  4CEA A;  1QSL A;  3V6D A;  1L3V A;  3HPO A;  3SNN A;  1LWE A;  4CED A;  3DOK A;  1VSD A;  3T3F A;  4BDP A;  1RTI A;  1XHX A;  5D3G A;  4PQU A;  2YKM A;  1RDB A;  1LV5 A;  3C6T A;  2G8V A;  3QIN A;  2PZS A;  2XY6 A;  1NK6 A;  5DMR A;  4FJ7 A;  4CJ5 A;  2G8I A;  3NF8 A;  3O4Q A;  5DK5 A;  3VQ6 A;  4CK2 A;  4RW8 A;  5KGW A;  3TAQ A;  1T05 A;  2OPP A;  1TKD A;  1RT4 A;  1GOB A;  3O4N A;  4CHP A;  3PX6 A;  4H4O A;  1B92 A;  3V81 A;  3SQ1 A;  4FXD A;  1S6Q A;  3QIO A;  3TAB A;  5FRM A;  2P5O A;  3TI0 A;  1HYZ A;  1RDC A;  1W80 A;  1NJZ A;  4FJH A;  1VSM A;  3DRS A;  3QO9 A;  4LH4 A;  3ZSO A;  4IBN A;  4XIU A;  3UIQ A;  1JKH A;  1NVP A;  4FLY A;  3VQC A;  3HM9 A;  4HCB A;  1KVA A;  3P5J A;  3VA3 A;  3NFA A;  1J54 A;  4CEO A;  3SPZ A;  1REV A;  4E7K A;  4ZTJ A;  4C8K A;  1L3U A;  3IS9 A;  3VQE A;  4CJF A;  3DMJ A;  3OYC A;  4G1Q A;  2E6M A;  3MAQ A;  5SWM A;  3TAF A;  3QIP A;  4CHO A;  2P51 A;  4CHY A;  1NK8 A;  5JS2 A;  4HHT A;  3NHG A;  4C8N A;  1QTM A;  3LAM A;  4B0A A;  4KHY A;  3HO1 A;  4K8X A;  3BGR A;  3IG1 A;  1BCM A;  3AVF A;  5I42 A;  4DLE A;  1SKW A;  1HQE A;  1B9D A;  3VQ9 A;  3V1Q A;  4CJT A;  3HS8 A;  3S3N A;  4FJM A;  4M3U A;  4O0J A;  3KKS A;  3QEI A;  1KFD A;  4KAZ A;  3LZI A;  3AVB A;  1ITG A;  2I5J A;  4IG3 A;  5J2N A;  1NJY A;  1QN7 A;  1BIU A;  2HND A;  4CF9 A;  4DF4 A;  3SCX A;  1KSP A;  1J9A A;  4DS4 A;  4CEZ A;  4OGE A;  1QN3 A;  2XY5 A;  3HXM A;  3HPG A;  3SQ4 A;  1NH2 A;  2EHG A;  3L3V A;  4CEE A;  3ALY A;  4DQQ A;  3CM6 A;  4CGG A;  1HRH A;  1A5W A;  1HPZ A;  2BAN A;  3L2U A;  4J2A A;  3DLK A;  1KYF A;  1WSG A;  4IG0 A;  3U3G A;  1K6Y A;  3SUN A;  3ZT1 A;  4CJL A;  1X9W A;  1L5U A;  1BL3 A;  1NK5 A;  3VQP A;  4N47 A;  1JLB A;  3CG7 A;  1S9G A;  4CIE A;  1DTQ A;  4C8M A;  2A1R A;  1NJX A;  1G15 A;  1S1X A;  3FFI A;  5FRO A;  3OYA A;  1QNA A;  3CQ8 A;  2OYQ A;  2QXF A;  1JLC A;  4DSK A;  1TK0 A;  4CJQ A;  1NJW A;  1ZBI A;  2WOM A;  4AHR A;  1QHT A;  1QN6 A;  2GBZ A;  3EY1 A;  4DSE A;  4B9M A;  4EZ9 A;  1VTO A;  3LAN A;  1KY6 A;  1O1W A;  1TVR A;  2X74 A;  1S9E A;  4DSI A;  1QN8 A;  2F96 A;  4BDZ A;  3H08 A;  4Z4E A;  4O5B A;  1TAQ A;  3ZT3 A;  4CE9 A;  2MJ7 A;  4DFK A;  5CYQ A;  4RW7 A;  3KJV A;  1VSH A;  2HHX A;  2Z1J A;  3DLG A;  3TAG A;  1TGH A;  1YTB A;  4GW6 A;  4BWJ A;  4BWM A;  4KHQ A;  2EX3 A;  3LPU A;  4W5T A; 
#chains in the Genus database with same CATH topology
 3LAL A;  4PA1 A;  1D8Y A;  2CGJ A;  2GTD A;  4ROC B;  3M3Z A;  2Y8Q A;  2IVN A;  1U2V A;  1UA0 A;  3TAP A;  2FXU A;  1TAU A;  3DLE A;  4R79 A;  3LWL A;  4QS8 A;  3SAH A;  5CE3 A;  4N5S A;  1WB9 A;  3CCR N;  1SS6 A;  3KK2 A;  2IIR A;  1DKG D;  2RN2 A;  3O3H A;  4NCA A;  4FWO A;  4GKK K;  4JRQ A;  3L2Q A;  4I9Q A;  1DT9 A;  2F8T A;  3AO1 A;  4RW6 A;  1XC3 A;  4H4M A;  1NK0 A;  4WQ5 C;  4JNE A;  5HRN A;  5JVH L;  1PVS A;  1NGD A;  3BZC A;  2GV9 A;  4CJU A;  5C12 A;  3QNN A;  1T3V A;  3ZYY X;  5HOO A;  1MPG A;  1KAZ A;  3VEV A;  1WSI A;  5E84 A;  1LCU A;  3SMP A;  1S1W A;  4FW1 A;  2UUA K;  1QHA A;  4FM1 A;  1SL1 A;  4JI0 K;  5JLH A;  4MO4 A;  1HJR A;  3BF3 A;  4NXN K;  3I3W A;  4O4G A;  1QZ5 A;  3OY9 A;  4V19 S;  4Y1D A;  2NRH A;  4NLC A;  3CFR A;  3CER A;  4J2B A;  3CCL N;  1U47 A;  3NCI A;  5ADX H;  2G8H A;  3VF4 A;  1LWC A;  4H0Y B;  4NO7 A;  3SYZ A;  3C65 A;  2GEM A;  1S1U A;  3A0I X;  3L2W A;  1VSE A;  2XY7 A;  1D4X A;  2E2P A;  3PO4 A;  4AQY K;  3M8S A;  5MLC Q;  1VQL N;  4ICL A;  4TPS A;  3ZSX A;  3CJ7 A;  1GLA G;  3ID6 A;  4FVM A;  3SBT A;  4DG1 A;  4AIL C;  3LM9 A;  1BOT O;  4LD0 A;  4CJR A;  4DQ8 A;  1SQK A;  1U4B A;  3VQ7 A;  3QET A;  1K8K A;  2HHT A;  4HUG A;  4O44 A;  3NGI A;  1YTF A;  2E8A A;  1XUP O;  1VSL A;  4F8R A;  2IVO A;  1P5D X;  1N39 A;  3MCP A;  3ZSZ A;  1W0H A;  3OYH A;  5FDL A;  3L8B A;  3AVL A;  3R3L A;  5BN8 A;  4DUY K;  3O9Q A;  1SUQ A;  1HNZ K;  4CES A;  3SQ0 A;  2Q2R A;  2ZM6 K;  3LZJ A;  3MED A;  3O9S A;  4CFB A;  1LWY A;  3LAK A;  5BR9 A;  4I6M A;  1P8Z A;  3QIC A;  1X9S A;  1M3H A;  2ASP A;  4CFF A;  2FKF A;  4ID5 A;  3J7A P;  2E2O A;  2XHI A;  3K5M A;  1RDW X;  1S72 N;  1SKS A;  3VQ5 A;  3O3G A;  5EPC A;  2HHH K;  3VTH A;  4BRM A;  4EAI A;  2XY8 A;  3OYF A;  2WTU A;  1NGM A;  3QER A;  3O6W A;  1JCF A;  3VMF B;  4BR4 A;  5BRD A;  3WXJ A;  3OH9 A;  3THX A;  4JK7 A;  1QQO A;  1SL2 A;  4ROE B;  4YOT A;  4M3R A;  1FW6 A;  4DR4 K;  1ZC6 A;  1HLU A;  2GUP A;  4FVU A;  4BRF A;  1BHL A;  1GLL O;  3CI5 A;  4CFD A;  1UA1 A;  3WEE B;  3CET A;  3DPT A;  2QTD A;  4CK3 A;  2VJ0 A;  3NE6 A;  3HK2 A;  1JL2 A;  4QCL A;  3HOT A;  4FWS A;  3FZH A;  2KKZ A;  4WQ4 C;  3QNO A;  3WNE A;  4IO8 A;  2YKN A;  4D7Q A;  4W5Q A;  2KZM A;  3MXI A;  4XEI A;  4FWR A;  1UAX A;  3K2P A;  2QLV A;  4QS7 A;  3CVS A;  3DXK A;  1XMQ K;  3CFO A;  1IKV A;  1U04 A;  3T4N A;  1Y64 A;  2H5A X;  2KLA A;  5KRT A;  4M3Y A;  3ZX0 A;  4CJV A;  1W2B M;  2HVI A;  1U49 A;  1RT7 A;  2DTU A;  5GAD P;  3QES A;  2CH6 A;  3NGZ A;  2QRC A;  4FJN A;  1PZD A;  3TAM A;  2VWK A;  3V9Z A;  4B9L A;  4CIG A;  1ASU A;  1Q81 O;  3MWT A;  3MXM A;  1EET A;  2A1S A;  4CZM A;  4DUZ K;  4EAH D;  5FPM A;  3H45 C;  5AN4 A;  1EKE A;  3EO3 A;  5K14 A;  4AH9 A;  1RBR A;  3SPZ A;  4NCG A;  4B3S K;  1QQC A;  4W5R A;  4H0X B;  1N5Y A;  1HU0 A;  4Z0U A;  3NF9 A;  1IH7 A;  1XI1 A;  4EP5 A;  1C0U A;  1X3M A;  3GG4 A;  2E2Q A;  3F0Z A;  3IUC A;  3QEP A;  3TTF A;  2ITM A;  4BRN A;  1VSI A;  3A8Y A;  4KTQ A;  3VTI A;  1WN7 A;  4FJ5 A;  4H8K A;  3OSM A;  3IMX A;  1HNW K;  1HJO A;  3KRM A;  3UW2 A;  2NOE A;  3AVC A;  3HPH A;  3KTQ A;  4W5O A;  3KK3 A;  2YI1 A;  4X64 K;  4NYF A;  1GLJ O;  1NMD A;  1PCM X;  3U8X A;  5AQT A;  4GMJ B;  1IG9 A;  4KV8 A;  3FZL A;  3BUZ B;  2E88 A;  2P9P A;  3O3F A;  1BIS A;  1TKZ A;  4BQZ A;  1KCF A;  3QB0 A;  4B1V A;  3CW7 A;  3OS1 A;  1N34 K;  4CVN E;  3HM8 A;  3LDP A;  3MDQ A;  1NGE A;  4BE0 A;  3MCA B;  5E26 A;  4CJS A;  4CEC A;  4L3Q A;  3TPQ A;  5F0X A;  2PFU A;  3OYI A;  3QML A;  3RMA A;  3SQ2 A;  3KKR A;  4DLG A;  2FBY A;  4F3T A;  1QN5 A;  3AA3 A;  4DB3 A;  1HQU A;  4JLH A;  1IO2 A;  4PKH A;  4KRE A;  1N3A A;  1TL1 A;  3HP9 A;  4CHN A;  5LMU K;  1B9K A;  3KK1 A;  1ASV A;  1HNI A;  1IG8 A;  4IDH A;  3QFP A;  1OH6 A;  1KXP A;  2HNZ A;  3VQB A;  1Z26 A;  3OH6 A;  2KW4 A;  2O8E B;  1NK4 A;  3CYM A;  3HP6 A;  4FJ7 A;  1VOK A;  3N4P A;  4ILH A;  1TYQ A;  5F9C A;  2NOB A;  2IDO A;  1JCE A;  4I9L A;  3VQ4 A;  1FKO A;  3GOI A;  1KY7 A;  3WQT A;  3I55 N;  3WNG A;  2ZFD B;  4ELU A;  5HRO A;  4JHD A;  4MFB A;  2FKM X;  3B8A X;  5BRH A;  1BG3 A;  3VEX A;  4DFP A;  4EFH A;  3KLG A;  3J7Y P;  3C6H A;  4BE1 A;  3SUQ A;  1U45 A;  2UUB K;  1C0T A;  1TUO A;  4JKF A;  3VEZ A;  1L3S A;  3FGU A;  3E9P A;  2HHQ A;  4CEB A;  3F10 A;  4DV3 K;  2XO7 A;  3KZB A;  4IXC A;  3CFP A;  1EP4 A;  4LF4 K;  2GWK A;  3G0Z A;  1GLE G;  2A6A A;  2HHU A;  4F3O A;  2OZS A;  2JWK A;  3HBT A;  2ZJQ L;  3L4I A;  2E6L A;  5LJV A;  1D3U A;  4FJI A;  1YF5 L;  3AO4 A;  4E1M A;  1QE1 A;  4H5T A;  4ROD B;  3C6A A;  1TBP A;  2VGM A;  5F1X A;  3ZT4 A;  1JLE A;  2HL9 A;  2IV8 A;  5BPN A;  5I9E B;  2W42 A;  2HKP A;  4E7I A;  2P9U B;  5H1S Q;  1LWE A;  4CED A;  1BDG A;  4BDP A;  1Q7Y O;  1XHX A;  3SAF A;  5M1Q A;  2FLO A;  1LV5 A;  4YDU C;  1WUA A;  2G8I A;  1BUP A;  3HI0 A;  1T05 A;  3VQ6 A;  2OAN A;  2DKD A;  4CHP A;  4H4O A;  1B92 A;  1S6Q A;  5FRM A;  3ZX3 A;  3TI0 A;  1HYZ A;  1RDC A;  2AA4 A;  1U6Z A;  3AAP A;  3ZSO A;  1DEJ A;  1JKH A;  1N33 K;  2O8F A;  3P5J A;  2BGG A;  3NFA A;  4NLB A;  2KHO A;  2DKA A;  5JIC A;  4CJF A;  3FE1 A;  4K0K K;  2WC9 A;  4G1Q A;  3OYC A;  3MAQ A;  3OTO K;  3UKU B;  2P9L A;  2W6L A;  1C47 A;  1QTM A;  1ZBS A;  5AZJ A;  4A5B A;  4KHY A;  3BGR A;  3D7Q A;  3CME N;  3AVF A;  2D4W A;  5I42 A;  1HQE A;  3VQ9 A;  4CJT A;  3HS8 A;  4M3U A;  2W41 A;  1KFD A;  2I5J A;  2QW9 A;  2ASM A;  1NJY A;  3FZM A;  4IZ9 A;  4DWI A;  2HND A;  4MLH A;  4JYA K;  1QQN A;  4KHP K;  3CM6 A;  1A5W A;  1HPZ A;  3AGK A;  3L2U A;  1KYF A;  3U3G A;  3SUN A;  3CG7 A;  4C8M A;  1R59 O;  2NNW A;  1OH7 A;  4HJH A;  4M7X A;  4CJQ A;  4AHR A;  1QHT A;  4JI1 K;  3EY1 A;  4DCH A;  3HRG A;  4DSE A;  4BGB A;  3LAN A;  4EJY A;  1TVR A;  2X74 A;  1Z6R A;  1S9E A;  4DSI A;  4FJM A;  4Z4E A;  1TAQ A;  4JKB A;  4JKG A;  4DFK A;  4BC4 A;  5CYQ A;  3KJV A;  1VSH A;  4LF8 K;  1YJ9 N;  4CZL A;  5C15 A;  1EO1 A;  2H3G X;  2X78 A;  2E1Y A;  5CHI A;  1X1P A;  3CPW M;  3D0P A;  1NNE A;  2H4L X;  4CBU A;  2QWN A;  3R6M A;  4C8L A;  4EAJ A;  4B9T A;  1R4X A;  3MN7 A;  4AF1 A;  2HHW A;  1T44 A;  5DM6 L;  2ETJ A;  1WBD A;  3HYF A;  1RTH A;  4K43 A;  1HPM A;  4LFB K;  4OLA A;  4M45 A;  3V9U A;  4EIA A;  2GUI A;  1Q9U A;  4DMN A;  2HZM A;  5HRR A;  3TSQ A;  2ATQ A;  4IL8 A;  1YI2 N;  4OGC A;  4B9V A;  2P1J A;  3IDH A;  1X9J A;  2E4L A;  4FOI A;  3BDP A;  1P90 A;  3NVK A;  3LL3 A;  4FK2 A;  1QVG M;  4AHU A;  5HL7 L;  3LP0 A;  3DRR A;  4LY7 A;  3SI6 A;  1BCO A;  1NWK A;  2HBJ A;  3CIP A;  1YQK A;  1V4T A;  1D9D A;  2YCH A;  2PYJ A;  2YNG A;  2P9I B;  5KQD A;  2HST A;  4RW4 A;  4DFM A;  1NKE A;  3RR8 A;  4E7L A;  2OTJ N;  3DXM B;  5FLX O;  3ENH A;  3M5R A;  1HR0 K;  3LP1 A;  2Z1H A;  4HTL A;  4KH6 A;  2IC3 A;  3T19 A;  1C1B A;  2JLE A;  4CBW A;  1YVN A;  1YJW N;  1IBK K;  3D2E B;  3ZX2 A;  3I0R A;  3NH2 A;  1BIZ A;  1OKJ A;  4PL8 A;  3T1A A;  2VG5 A;  2WBN A;  3VEN A;  3HSC A;  1B9F A;  2D0C A;  3HST B;  2HMI A;  2V51 B;  2Z1I A;  5M1F A;  1T8E A;  3SJH A;  5E41 A;  2WFB A;  2LSN A;  4MRQ A;  4BDY A;  3H1Z A;  1Z05 A;  3SJJ A;  2JPI A;  3RR7 A;  2RHK A;  5A2Q O;  1T7P A;  1YQR A;  2JWL A;  4JK8 A;  2A42 A;  3OS0 A;  1W7A A;  2E2N A;  3L0Q A;  1QNC A;  4FM0 A;  4KTZ A;  4B08 A;  4AHC A;  4DV5 K;  1WSF A;  3I8B A;  4PKG A;  1VQO N;  3PY8 A;  3WEE A;  3SUO A;  4G9Z A;  3AV9 A;  2HVH A;  1NBW A;  2NOH A;  1EWR A;  4BAC A;  1UWB A;  3SUP A;  4IFE A;  3IRX A;  4NB4 A;  4ID1 A;  4QG5 A;  3EN9 A;  5SZT A;  4B9N A;  3ZSR A;  2IGI A;  4B3T K;  4KTW A;  2JOI A;  3CD6 N;  1YVU A;  3AVJ A;  4UY8 O;  3CJ9 A;  2QR1 A;  3TWH A;  3J8A A;  3A5L C;  4AM7 A;  5GAH P;  3AVI A;  3F9K A;  1VSJ A;  1JLG A;  4B1U B;  3JAM O;  1OH5 A;  2QKB A;  1S1V A;  4BR7 A;  2HMP A;  1O13 A;  3E66 A;  4KH4 A;  1TKX A;  2HHV A;  1TBA B;  4FWK A;  4KFB A;  4DR7 K;  2AP1 A;  4I2P A;  5IYD P;  4HWI A;  4E7H A;  3ENO A;  2G8W A;  5AQL A;  2PAV A;  5AQP A;  1BU6 O;  5JMV A;  3CMA N;  1C4G A;  2Q1N A;  5AQG A;  3CF5 L;  2OPR A;  3J80 O;  3K5O A;  2GWJ A;  5J2Q A;  4CBX A;  3NH1 A;  4JS5 A;  2NOI A;  5AJ3 K;  1TV6 A;  5TKY A;  3H1Q A;  5AQJ A;  1CXU A;  3CWT A;  2PY5 A;  3AVM A;  2X6N A;  3NF6 A;  4BRH A;  2VQE K;  4M3X A;  1WOQ A;  4DTM A;  2I7N A;  1EBM A;  5HP1 A;  4WXA A;  2BDP A;  1KC8 O;  4JI3 K;  1RTJ A;  3D4V A;  2FBT A;  3V4I A;  4JN4 A;  2CH5 A;  3B6P A;  4CGI A;  1RDA A;  3TAE A;  2E1Z A;  1VTL E;  4N41 A;  2RPI A;  2O8B A;  3G71 N;  1VKL A;  1KLN A;  1MDU B;  1JCG A;  4E89 A;  3I0X A;  2NRX A;  5DM7 L;  3CPE A;  1KAY A;  4KKO A;  3EKS A;  3I56 N;  4KI4 A;  4LC9 B;  2AJQ A;  4OKE A;  1TKT A;  4J2D A;  1VAZ A;  4A59 A;  2F9W A;  5AFU A;  1UOC A;  4CW7 B;  1ESV A;  3ZT2 A;  1K9M O;  3U6F A;  1FJG K;  4AM6 A;  4O8U A;  4BC3 A;  1HNV A;  4NXM K;  3RMB A;  1S1T A;  4DHY A;  5KRS A;  2KFZ A;  4CJP A;  2P9N B;  4DV1 K;  3E1Y A;  3OYK A;  4GV9 A;  3VGK A;  4IWV A;  4FLZ A;  1JLA A;  4A61 A;  4M3W A;  3G10 A;  3DM2 A;  3THY B;  4FJ9 A;  1CXQ A;  1ATN A;  3ZT0 A;  4HVJ A;  3DLB A;  3LWM A;  1LWW A;  2A3Z A;  3AAR A;  4B9U A;  4F2R A;  1KYD A;  3KD5 E;  5J2P A;  2XHB A;  3P1G A;  4GNI A;  5JN5 A;  1VRT A;  3THW B;  1Y97 A;  4D7R A;  5HRP A;  1KVC A;  4Y0W A;  5AZI B;  4YY3 K;  2O8E A;  4EAG A;  1QN4 A;  4N56 A;  4J8F A;  4M41 A;  1WJW A;  4DSF A;  1BGX T;  3TSP A;  3N4Q A;  4H5W A;  4Q0B A;  4FLX A;  2EHB D;  1JL1 A;  4CJ3 A;  4CJK A;  2FBX A;  4DQR A;  3R1X A;  5IYC P;  1CDW A;  5M1N A;  3FFK B;  1K73 O;  4MQ3 A;  1ILY A;  1E4G T;  1KD1 O;  4Q5V A;  2UXB K;  4FLT A;  3LDL A;  3K59 A;  2FBV A;  2YHY A;  3ULD A;  1NGA A;  4KI6 A;  2NUB A;  3UKR B;  2FF6 A;  4WCE L;  4BJU A;  1RT6 A;  1LW0 A;  4NCB A;  4FK4 A;  4C1N I;  4FWP A;  4N76 A;  3ZEU A;  3RRH A;  2W40 A;  3NVM A;  1MWM A;  3BP8 A;  4FZY A;  1QS4 A;  3LP2 A;  3A5M C;  4FWN A;  4CF0 A;  4EHT A;  3HOS A;  4OPA A;  4W5N A;  4M42 A;  4A57 A;  2FGT A;  2FSJ A;  4LF7 K;  3S9H A;  1QNE A;  1LW2 A;  4FWQ A;  1FKP A;  3NGY A;  5CZ2 A;  4IOC L;  3VGM A;  4FK0 A;  2O4I A;  4HUE A;  1S5J A;  3KWG A;  1QSS A;  3IFR A;  4CJ4 A;  3SLC A;  3ZSQ A;  2QEX N;  4HTU A;  4DU3 A;  3VET A;  1LAV A;  3I0S A;  4OKK A;  1LWF A;  2KFN A;  4FW2 A;  4LF6 K;  4EAL A;  4IFY A;  1ZBH A;  3DLR A;  1ATS A;  1H1V A;  4CK1 A;  3CCS N;  3QBX A;  4ILG B;  5EU7 A;  4CGJ A;  5LY3 A;  3L3U A;  5LMN K;  1RT5 A;  1K8A O;  3QEX A;  3M6G A;  4FJL A;  5CZ1 A;  3HVT A;  4X62 K;  1NK7 A;  3SPY A;  3D2F A;  4KBO A;  4CD3 A;  4PHT X;  5J2M A;  4Z4F A;  2YNI A;  4KHN A;  4B3O A;  4FL9 A;  1QNB A;  1HNX K;  2NRR A;  3K5N A;  2QRD A;  2UU9 K;  4L8R B;  5AQR A;  4GVE A;  1C9B B;  4BRG A;  2R5X A;  4A2A A;  1V5S A;  2NOF A;  4ISE A;  4CEA A;  1QSL A;  3SNN A;  4BRA A;  3T3F A;  5D3G A;  4DV6 K;  1U2V B;  4PQU A;  1RDB A;  4E1J A;  3QIN A;  4CK2 A;  1TKD A;  2J4R A;  2D1K A;  1RT4 A;  2OCE A;  4FPB A;  3O4N A;  4CZG A;  1MWK A;  2ZGZ A;  4FXD A;  3QIO A;  3KWI A;  4H5V A;  2P5O A;  3MK6 A;  3F5T A;  5AR0 A;  1VSM A;  2YA3 A;  3DRS A;  3QO9 A;  4IBN A;  2Y8L A;  5AQV A;  4FLY A;  3HM9 A;  1KVA A;  4CEO A;  4E7K A;  3BKQ X;  2O3O A;  3CCM N;  2V92 A;  5GAE P;  3QIP A;  2P51 A;  3Q7B A;  4CHY A;  4HHT A;  2QWL A;  2YJE A;  4CZF A;  3CVT A;  1LWV A;  2QM1 A;  4K8X A;  3HO1 A;  3IG1 A;  1BCM A;  4DSL A;  4H0O A;  1SKW A;  5BN9 A;  4QS9 A;  4JKC A;  4O0J A;  4KAZ A;  2Z0F A;  2Q36 A;  3SCX A;  4OGE A;  1QN3 A;  4YOV A;  3HXM A;  2XY5 A;  1N36 K;  4CEE A;  3L3V A;  4DQQ A;  2BAN A;  1JJ2 M;  5BRF A;  3R9P A;  1WSG A;  3FLC O;  2F7T A;  4CJL A;  4LFC K;  1BL3 A;  1NK5 A;  3VQP A;  1RDU A;  2IVP A;  2D0O A;  1DTQ A;  5AQK A;  4X66 K;  3CQ8 A;  2OYQ A;  4DSK A;  1EWQ A;  5JS1 A;  1O1W A;  2YX6 A;  3E9O A;  4BDZ A;  3H08 A;  4H0P A;  3ZT3 A;  3FZK A;  2RE2 A;  2HHX A;  3DLG A;  3MX2 A;  1KFQ A;  1NGJ A;  4GW6 A;  4BWM A;  1OVY A;  3C94 A;  1JFI C;  5C0Y A;  1IV0 A;  2YNH A;  3L6Q A;  4BRQ A;  1XHZ A;  3ZCM A;  3O1W A;  2Z1G A;  4E1N A;  5AQY A;  5AQQ A;  5HLF A;  4DTS A;  4TSX A;  1I3A A;  4XH4 A;  3KTU A;  2G30 A;  2P9I A;  3SAG A;  3PUF A;  5FPD A;  3OS2 A;  3DXM A;  3CXC M;  4BRD A;  1GLB G;  1IKX A;  1EX4 A;  3A5N C;  4YHH K;  1EXQ A;  4ILJ A;  1RT2 A;  5FPN A;  4I7F A;  1CLQ A;  2ZE2 A;  2NWV A;  4YFU A;  1AIS A;  4YOU A;  4WQ4 A;  1NG9 A;  4KHS A;  4DQI A;  4JK9 A;  3I33 A;  4JKE A;  3CC2 N;  1TUY A;  1JXE A;  2G8K A;  3ULE B;  4CZK A;  2XRI A;  3GL1 A;  1M90 O;  2DY4 A;  1N6Q A;  2O8C A;  5GIP A;  1I39 A;  1RBU A;  1ATR A;  3AVG A;  5B8H A;  4JKD A;  1QTS A;  4JD2 A;  3TTC A;  3S41 A;  4PWD A;  3OCI A;  3BY5 A;  2DFH A;  2B5J A;  3THX B;  3PV8 A;  1V4S A;  5C24 A;  3VEO A;  1RNH A;  4DTP A;  1L3T A;  1ASW A;  1KLM A;  4CGF A;  3OJU A;  4DTJ A;  3TE5 A;  3B6O A;  2DKC A;  2P9K A;  5KPT A;  1XMO K;  3H3O B;  3E01 A;  1VRU A;  4YOR A;  3JSM A;  4FLW A;  4FLU A;  4UQG A;  4FJK A;  3J7Z O;  1XSZ A;  4Y1C A;  3EIK A;  3BEX A;  4K8Z A;  4IFV A;  4DR1 K;  4IDK A;  3OW2 M;  1JXB A;  3O4W A;  1IKW A;  3TR8 A;  4FWL A;  4H5R A;  2YNF A;  2QA4 N;  4Z4H A;  5KTQ A;  3F2K A;  3KLH A;  4BC2 A;  3RVC A;  1NKB A;  4FLV A;  1Q82 O;  2DPN A;  3RWU A;  2HF3 A;  4DTR A;  4JI7 K;  4BR9 A;  4BRP A;  3CCE N;  5AQH A;  4WE1 A;  3KLF A;  3CJC A;  3OYL A;  4CGH A;  4OPH A;  1ZBL A;  1C1A A;  3EEQ A;  3NBP A;  4MDA A;  4DQP A;  1FN7 A;  1N32 K;  4DTN A;  3OYN A;  1YTU A;  4BRL A;  1ZYQ A;  4DR5 K;  4JS4 A;  1YIT N;  5AQZ A;  1Q9Y A;  4KHU A;  1J6Z A;  4M3T A;  2WUS A;  4WF9 L;  4EP4 A;  2O8D B;  3WNH A;  2ZQB A;  2QWP A;  3JS6 A;  3LM2 A;  4F9O A;  1VQ6 N;  3OYM A;  2NRW A;  3VQ8 A;  4AHT A;  4CJW A;  1QSY A;  5JMV D;  4O5F A;  4DR2 K;  3WXI A;  4DF8 A;  3D6R A;  4JAX A;  4ZTF A;  2BUP A;  5BRE A;  4B8A B;  4BGA A;  3NF7 A;  4RTF D;  1S6P A;  4FJX A;  4ELT A;  3U3Y A;  4LH5 A;  4Z4G A;  3DYA A;  4LF5 K;  2D5R A;  3OLP A;  1QQM A;  2KTQ A;  2VCP A;  3QFU A;  1YTA A;  1NU0 A;  3T69 A;  4EJZ A;  3ENO C;  3C0B A;  2F8S A;  3HT3 A;  2NZT A;  4YNQ A;  3K58 A;  3PO5 A;  1GOC A;  4ISG A;  2Q3S A;  4HUF A;  5TKW A;  4DTX A;  4LF9 K;  3SV3 A;  4M63 C;  1LXT A;  3MN9 A;  3HZ6 A;  3SMS A;  4DUL A;  5HSH A;  4FCY A;  4B3R K;  4MLE A;  3LDO A;  3K0S A;  3DPU A;  4HCC A;  4WFA L;  1KAX A;  3F9M A;  2HNY A;  4DS5 A;  4OVL A;  3M8P A;  1S22 A;  2I5W A;  5AQN A;  3MEG A;  3NA5 A;  1YAG A;  1XC9 A;  2LAE A;  2B6A A;  2CGK A;  3KHY A;  1NGH A;  2IOC A;  4XH1 A;  4CIF A;  1F21 A;  1RM1 A;  4JKH A;  4IJN A;  1RBV A;  3CQY A;  5AZI A;  3DI6 A;  2D0P A;  2HOE A;  1KYU A;  3P39 A;  3VQA A;  3WXM B;  4JEP A;  3ASM A;  3FZF A;  3PX0 A;  4A5A A;  3DOL A;  3PIP L;  4NYN A;  3EAY A;  5BMN A;  1TYQ B;  3F73 A;  4M3Z A;  3MN5 A;  3ULX A;  5FPE A;  2IV9 A;  4X65 K;  2Y1I A;  3OVN A;  3C7N B;  3AAQ A;  1KRP A;  3ZLJ A;  3TAN A;  3A5O C;  1NGB A;  4JHD B;  1ZXO A;  4B9Q A;  1J5E K;  4F4K A;  3GDQ A;  1SV5 A;  1WLJ A;  5EXW A;  3DLH A;  3I8D A;  4BRC A;  1J5O A;  3MX5 A;  3HJF A;  2PYL A;  1NGG A;  4CZI A;  3K57 A;  3UKR A;  3PIO L;  1UT4 A;  2GX9 A;  4FJJ A;  4CEF A;  3QEW A;  3SV4 A;  3ZSW A;  3V9X A;  4YOW A;  3ENC A;  2HBK A;  1HYV A;  4CEQ A;  3IKM A;  3R8E A;  4Z4I A;  1PCZ A;  3GE1 A;  4GKJ K;  2A40 A;  3OA9 A;  1YQM A;  2Q97 A;  2A5X A;  2VWB A;  3CM5 A;  4KO0 A;  5ADX A;  5AQM A;  4WZS D;  2WON A;  4CJE A;  3ZET B;  2NRV A;  1BI4 B;  5HBM A;  3N89 A;  3D45 A;  3PX4 A;  3LDS A;  4DSJ A;  3S3M A;  2QKK A;  2NLV A;  4JI6 K;  2BE2 A;  3EYZ A;  2OOX A;  2IS3 A;  1JDY A;  1NGI A;  2P9S B;  4CF1 A;  2KQ2 A;  1VQP N;  2NRT A;  3OSE A;  4Z4C A;  5AQO A;  2UYT A;  4KPY A;  3Q7C A;  2NVM A;  2O4G A;  3L2R A;  2O8F B;  3AO5 A;  3W0L A;  1FXX A;  2NOZ A;  4PL7 A;  5EOY A;  1OH8 A;  1J3M A;  1E42 A;  4KH5 A;  5FRN A;  1VQN N;  2W6K A;  4B8C A;  3EL2 A;  1QZ6 A;  1C0G A;  4DV4 K;  4B1Y B;  5KGX A;  1YT3 A;  2P9L B;  3KK7 A;  1IJJ A;  3ZSY A;  3IAY A;  1VQ5 N;  4RCH A;  5C10 A;  4JKA A;  3HVR A;  2VWJ A;  2YHA A;  3CC7 N;  2UXC K;  4FZX C;  1VQ7 N;  3PDK A;  2Y1J A;  4Q11 A;  3V1R A;  1KFI A;  3VF6 A;  2OA8 A;  4EAK A;  1ZBU A;  1J53 A;  2RF2 A;  1YJN N;  3CCQ N;  4FOE A;  4DU4 A;  3TAR A;  4CFA A;  1TK5 A;  3RSE B;  3A2F A;  4LFA K;  1VQ8 N;  3QDK A;  3QEV A;  3CWU A;  1M3Q A;  1NGC A;  3V9S A;  3NAE A;  1VSK A;  3VA0 A;  1VK0 A;  1MU2 A;  1DIZ A;  4JKG B;  3PLA A;  2R7Y A;  1VSF A;  2ZD1 A;  5AQW A;  3MEC A;  1K2Y X;  1RBT A;  4WX8 A;  1L3V A;  4IJA A;  3HPO A;  2NRZ A;  3CJA A;  2YJF A;  2YKM A;  3WUH A;  4B1X B;  1QVF M;  2YHW A;  2PZS A;  5DMR A;  1RFQ A;  3P38 A;  4DR6 K;  2OPP A;  1GOB A;  3G4S N;  3O08 A;  3PX6 A;  3SQ1 A;  3SBG A;  3V81 A;  3CJB A;  1NLV A;  2VYP A;  1W80 A;  4CJ7 A;  4FJH A;  1E4F T;  4DV7 K;  2FSK A;  4XIU A;  1NVP A;  3UB5 A;  3VEY A;  4HCB A;  3AGR A;  1J54 A;  4C8K A;  4B1W B;  2OTL N;  5AQX A;  3CCU N;  1L3U A;  3O1B A;  3VQE A;  2BTF A;  5SWM A;  4CHO A;  3NHG A;  5EY4 A;  2YH5 A;  1SZ2 A;  3LAM A;  4BR2 A;  1K35 A;  2GEL A;  1BO5 O;  1B9D A;  1NMN A;  3S3N A;  3VPZ A;  3QEI A;  3LZI A;  3AVB A;  5KPZ A;  5J2N A;  4CF9 A;  1KSP A;  4DF4 A;  1J9A A;  4DS4 A;  3ATV A;  1NH2 A;  3ALY A;  4CGG A;  1YHQ N;  3O9T A;  1EUV A;  3DLK A;  4IG0 A;  1X9W A;  3ZT1 A;  4K25 A;  2HL8 A;  4CIE A;  3J81 O;  3C04 A;  2I7P A;  1S1X A;  3O9U A;  5FRO A;  1JLC A;  5AQU A;  3ENB A;  3K9J A;  4B9M A;  2GBZ A;  5EVZ A;  1KY6 A;  2Q0R A;  3WXL A;  1QN8 A;  3ULE A;  1PCJ X;  3BF1 A;  4O5B A;  3OBW A;  4BRE A;  1XQS C;  2MJ7 A;  1VQ9 N;  4GV6 A;  3TAG A;  1TGH A;  4BWJ A;  2UUC K;  4KHQ A;  3LPU A;  4W5T A;  2P9U A;  3V9W A;  4H5N A;  3VN5 A;  3U9D A;  3GBT A;  1KFS A;  1RBS A;  1R0A A;  4DTO A;  1QN9 A;  3KLE A;  5AFU H;  2V9J A;  4KB1 A;  4E3S A;  3SNS A;  1BQM A;  1IBL K;  1C0F A;  1S3X A;  5GIN A;  3O80 A;  4JI8 K;  5HRS A;  1ZBF A;  3H6E A;  2ASO A;  1UT7 A;  3OYJ A;  4CF2 A;  5IT9 O;  4WQ5 A;  4PKI A;  4OPK A;  4KRF A;  4B9S A;  1WAF A;  3TSU A;  2RKI A;  3C6U A;  4YOY A;  1W9H A;  3CJ1 A;  3O5B A;  4OO1 J;  3DRP A;  2F4V K;  3PSI A;  4DFJ A;  3UKU A;  3ID8 A;  4PUO A;  3QBW A;  1Q8I A;  2Z8U A;  1KTQ A;  3VES A;  1SL0 A;  2OPS A;  3P83 D;  3G25 A;  5BPM A;  3JYT A;  2Q31 A;  2UXD K;  4RG8 A;  3T1Y K;  1IKY A;  5CY4 A;  3AO2 A;  2G8F A;  1N3C A;  3CWS A;  3DWL A;  3AA2 A;  1WAJ A;  2ZGY A;  1FK9 A;  1P5G X;  3CC4 N;  2OPQ A;  2V8Q A;  2D0A A;  4JV5 K;  3OYB A;  1A5V A;  1LOT B;  1U48 A;  2DFF A;  3OYG A;  5LJW A;  2O8D A;  1YXQ A;  1T6C A;  3ZSV A;  4J2E A;  1A5X A;  1X9M A;  4JI5 K;  4BG9 A;  5IWA K;  3AVN A;  2V7Z A;  3CHW A;  4DTU A;  3LPT A;  3CCV N;  4LSL A;  3DLL L;  1TL3 A;  3JXU A;  5M1K A;  2QXL A;  3M8Q A;  4FPA A;  3NMU A;  5M1O A;  2BH1 A;  3CQX A;  5KI6 A;  2JHN A;  4IKF A;  2FSN A;  5IYB P;  3VEW A;  2VG6 A;  2O8B B;  4DV0 K;  4H0T B;  1JLF A;  4E19 A;  4QOZ B;  1TK8 A;  2NOL A;  1N8R O;  1HX1 A;  4JI4 K;  4FO0 A;  4BRK A;  4BR5 A;  1VQM N;  1CZB A;  3RPJ A;  2QWR A;  3CCJ N;  4BR0 A;  5T7B A;  4ZHR A;  3AVK A;  3W3D A;  4CZH A;  3AVH A;  4RW9 A;  3THV A;  1IBM K;  4FSV A;  5CYM A;  2YV0 X;  3OYE A;  2YHB A;  3OHR A;  1BA1 A;  5LL6 Z;  4C7P A;  3U9Z A;  4CI6 A;  1Q86 O;  2B4J A;  4BRO A;  1HMV A;  4OX9 K;  1SKR A;  4FJ8 A;  3FR0 A;  3MMV A;  4C23 A;  2OZM A;  2ITG A;  1NM1 A;  1RT3 A;  3C95 A;  3VF2 A;  2NLX A;  4GY2 B;  1DLO A;  4DKW A;  1I94 K;  1K8K B;  3ISN C;  1E3M A;  3MWP A;  4AHS A;  3O9R A;  1CZ9 A;  3NDK A;  3AO3 A;  2X6S A;  1UL7 A;  4JRP A;  1C6V A;  3EZW A;  4XH5 A;  3K9K A;  2F9T A;  1HKC A;  4FJG A;  1YUW A;  1C0M A;  4OJR A;  3SZ2 A;  1QTP A;  1D5A A;  3PMG A;  3D2E A;  3MXJ A;  3C7N A;  4CF8 A;  2P5G A;  2A41 A;  1NOY A;  5GAG P;  1BQN A;  4O8K A;  4CFC A;  2OOY A;  2Q0U A;  2PBD A;  3MEE A;  3KD1 E;  4I6M B;  1Q9X A;  3RMC A;  2FC0 A;  1VOL B;  1HUX A;  3PSF A;  4O55 A;  2HHS A;  3H46 O;  2ZJP L;  1NOZ A;  2D0B A;  1M1K O;  3ZEU B;  1TGO A;  1YIJ N;  4K42 A;  4CHQ A;  1T6A A;  1KVB A;  1T6D A;  3LDQ A;  2VG7 A;  2HB5 A;  4A2B A;  3WNF A;  3AY9 A;  3ZET A;  3K5L A;  1Z25 A;  3H3N O;  1RTD A;  1BI4 A;  2DFE A;  2E5L K;  3AA4 A;  5C25 A;  3VGL A;  3EZ5 A;  3P31 A;  5KPR A;  3EE9 A;  1GLC G;  4U7B A;  2P9S A;  2HW3 A;  2YHX A;  4FZZ A;  5C2D A;  4BVP A;  4M7Y A;  3V1O A;  2G8U A;  3ATU A;  1KQS M;  1RT1 A;  3DXK B;  1RDD A;  4Z94 A;  1GOA A;  3OYD A;  4IOA L;  4F2S A;  5KQ8 A;  4OPJ A;  3VQQ A;  2JGU A;  2QWO A;  4DU1 A;  3D2F B;  3KLI A;  4BVO A;  2QRE A;  4CER A;  3HS9 A;  5BR8 K;  4C8O A;  3KIO A;  4BRI A;  1WSJ A;  2ZJR L;  3OJS A;  3U4L A;  1VQK N;  3WXK A;  4JI2 K;  3SK3 A;  1XWL A;  3M1F A;  3HL8 A;  3L4Q A;  4E0D A;  1TUU A;  3H1V X;  4FM2 A;  1Q18 A;  3RTV A;  4KHW A;  4BE2 A;  3DAW A;  2E20 A;  4OKJ A;  4OLB A;  1NJI O;  4WFB L;  3TDH A;  3L2V A;  1D9F A;  4I2Q A;  3G6E N;  4MDB A;  4RWT A;  4B3M K;  4IO9 L;  1VQ4 N;  3QLH A;  4FYD A;  5I3U A;  4QAG A;  5M1P A;  4DQS A;  3LP3 A;  3RSE A;  3KVG A;  4WFN L;  4K41 A;  5BMP A;  1T03 A;  3AVA A;  4EZ6 A;  2KZZ A;  3EE8 A;  3OC3 C;  4KB0 A;  3DJC A;  4FWM A;  5AQI A;  4C1N K;  3S3O A;  2PWW A;  4ISF A;  1DTT A;  1RCH A;  3AA5 X;  3CWA A;  4CHZ A;  4CZJ A;  3RMD A;  1KO9 A;  2IAJ A;  1WNS A;  2P9P B;  1NK9 A;  1XNQ K;  3RRG A;  1OVQ A;  3VER A;  2VQF K;  5AQS A;  3E9L A;  4R5P A;  3NH0 A;  5CR4 A;  3IH7 A;  3LDN A;  2P9N A;  3OST A;  3TTD A;  4YOX A;  1YQL A;  4DV2 K;  3WT0 A;  4E7J A;  4CCH A;  1C1C A;  3M8R A;  2HF4 A;  1GLD G;  4CGD A;  1MP9 A;  4LSN A;  3THY A;  4WYB A;  5C2F A;  1LAW A;  3I0W A;  3T1H K;  4ELV A;  1G99 A;  3P4I A;  3OBY A;  1JLQ A;  1RIL A;  2CGL A;  4A62 A;  1WSH A;  1RGI A;  1NKC A;  5ELZ A;  2QK9 A;  2HZS A;  5KL0 A;  3THW A;  4H0V B;  4AHV A;  5J1E A;  1NGF A;  4PY5 A;  3VQD A;  3UE5 A;  1MA9 B;  1GLF O;  2V7Y A;  2ZF5 O;  5C42 A;  1WSE A;  4GVM A;  4O0I A;  2ZWH A;  1HYS A;  4IOX A;  3ITH A;  5JLF A;  3V6D A;  2FUV A;  3DOK A;  1VSD A;  3TU5 A;  4YDU A;  3D7E O;  1RTI A;  2HBL A;  3C6T A;  2G8V A;  2XY6 A;  1NK6 A;  1WQA A;  4CJ5 A;  3NF8 A;  3O4Q A;  5DK5 A;  3TAQ A;  4RW8 A;  5KGW A;  3O8M A;  3EKU A;  4EHU A;  2FF3 B;  3TAB A;  4BC5 A;  1NJZ A;  3BZK A;  4IEE A;  3T7Z A;  4LH4 A;  3UIQ A;  3RSM A;  3VQC A;  3VA3 A;  1REV A;  4ZTJ A;  2F7L A;  3WQU A;  1WBB A;  3IS9 A;  1HKG A;  1HKB A;  3DMJ A;  2E6M A;  3TAF A;  3MN6 A;  1NK8 A;  4GV3 A;  5EX5 A;  5JS2 A;  4C8N A;  4U67 L;  4I8O A;  4BQL A;  4B0A A;  2QWM A;  3VOV A;  2O8C B;  4DLE A;  5GIO A;  3V1Q A;  3KKS A;  2V52 B;  2HBM A;  1M5Q 1;  4BY9 C;  1ITG A;  4IG3 A;  4JD2 B;  2JHJ A;  1XNR K;  1QN7 A;  1BIU A;  2EWS A;  5F2R A;  4CEZ A;  3SQ4 A;  3HPG A;  2EHG A;  1W97 L;  1HRH A;  1X3N A;  4J2A A;  1L5U A;  2MZ8 A;  1K6Y A;  1BA0 A;  2QWQ A;  1CZA N;  4N47 A;  1JLB A;  1DGK N;  1S9G A;  5AQF A;  5JVG L;  2A1R A;  2P9K B;  1VHX A;  1NJX A;  1G15 A;  3FFI A;  4CD1 A;  3OYA A;  1QNA A;  1SAZ A;  2QXF A;  1EQY A;  1TK0 A;  1NJW A;  4BG8 A;  1ZBI A;  2WOM A;  1QN6 A;  4EZ9 A;  4B1Z A;  1VTO A;  2QI2 A;  4DR3 K;  2F96 A;  3OGD A;  3HTV A;  4CZE A;  4CE9 A;  4H03 B;  1BWF O;  4RW7 A;  4MO5 A;  2VGN A;  2Z1J A;  1YTB A;  4IEI A;  5AZJ B;  2EX3 A;  5BPL A; 
#chains in the Genus database with same CATH homology
 3LAL A;  3C94 A;  1JFI C;  4PA1 A;  1D8Y A;  2X78 A;  2YNH A;  1XHZ A;  1X1P A;  3D0P A;  3ZCM A;  2Z1G A;  4E1N A;  3V9W A;  3VN5 A;  4ROC B;  5HLF A;  4DTS A;  4B9T A;  4TSX A;  4C8L A;  1R4X A;  1I3A A;  1UA0 A;  3KTU A;  2HHW A;  1KFS A;  2ETJ A;  3TAP A;  2G30 A;  1TAU A;  1RBS A;  3DLE A;  3LWL A;  1R0A A;  3PUF A;  1QN9 A;  3KLE A;  4DTO A;  3HYF A;  1RTH A;  3OS2 A;  4N5S A;  4KB1 A;  4E3S A;  1L5U A;  3SNS A;  1BQM A;  3KK2 A;  1IKX A;  1EX4 A;  2RN2 A;  4M45 A;  5HRS A;  1ZBF A;  3O3H A;  1EXQ A;  3V9U A;  4NCA A;  1RT2 A;  4OLA A;  4I7F A;  4JRQ A;  1UT7 A;  1CLQ A;  3L2Q A;  2ZE2 A;  3OYJ A;  4CF2 A;  2GUI A;  4YFU A;  1AIS A;  4I9Q A;  2F8T A;  3AO1 A;  4RW6 A;  4DMN A;  4H4M A;  2HZM A;  5HRR A;  1NK0 A;  4OPK A;  4KRF A;  5JS1 A;  4KHS A;  4B9S A;  4DQI A;  1WAF A;  2ATQ A;  2RKI A;  4OGC A;  3C6U A;  5HRN A;  1W9H A;  4B9V A;  2P1J A;  3DRP A;  1JXE A;  2G8K A;  4F2S A;  2GV9 A;  2E4L A;  4DFJ A;  4CJU A;  3QNN A;  2XRI A;  4PUO A;  3BDP A;  2DY4 A;  1Q8I A;  1N6Q A;  4FK2 A;  2Z8U A;  1KTQ A;  1WSI A;  4AHU A;  1S1W A;  3LP0 A;  1SL0 A;  2OPS A;  3P83 D;  4FW1 A;  1I39 A;  1RBU A;  3AVG A;  3DRR A;  4LY7 A;  3JYT A;  4RG8 A;  1BCO A;  4FM1 A;  1QTS A;  3SI6 A;  1SL1 A;  1IKY A;  5CY4 A;  3AO2 A;  2G8F A;  1N3C A;  1HJR A;  4O4G A;  4PWD A;  3OCI A;  3AA2 A;  1YQK A;  3OY9 A;  1D9D A;  1WAJ A;  4Y1D A;  2PYJ A;  2YNG A;  2DFH A;  2B5J A;  4RW4 A;  4DFM A;  1NKE A;  3CFR A;  4E7L A;  3RR8 A;  3PV8 A;  1FK9 A;  5C24 A;  4J2B A;  1RNH A;  2OPQ A;  4DTP A;  2D0A A;  1L3T A;  4FYD A;  1ASW A;  1KLM A;  4CGF A;  3OJU A;  3LP1 A;  4DTJ A;  3B6O A;  1U47 A;  3NCI A;  2Z1H A;  3OYB A;  1A5V A;  1U48 A;  2IC3 A;  3T19 A;  1C1B A;  3E01 A;  2G8H A;  1VRU A;  1LWC A;  3SYZ A;  3JSM A;  2JLE A;  4FLW A;  2DFF A;  1S1U A;  3OYG A;  4FLU A;  3L2W A;  4UQG A;  1VSE A;  4FJK A;  2XY7 A;  3ZSV A;  4Y1C A;  4J2E A;  1A5X A;  3EIK A;  4K8Z A;  1X9M A;  3PO4 A;  4IFV A;  3M8S A;  3AVN A;  3I0R A;  4ICL A;  4IDK A;  3NH2 A;  1JXB A;  4DTU A;  1BIZ A;  3TR8 A;  4TPS A;  1IKW A;  3T1A A;  3LPT A;  2VG5 A;  3ZSX A;  2YNF A;  4Z4H A;  4LSL A;  2HMI A;  1B9F A;  2D0C A;  1TL3 A;  3HST B;  2Z1I A;  3M8Q A;  5KTQ A;  3KLH A;  1T8E A;  4FVM A;  1NKB A;  4DG1 A;  4AIL C;  4FLV A;  5E41 A;  5KI6 A;  4CJR A;  2LSN A;  4LD0 A;  4DTR A;  4BDY A;  3RWU A;  5IYB P;  3H1Z A;  4IKF A;  3SJJ A;  1U4B A;  3RR7 A;  3VQ7 A;  2VG6 A;  3QET A;  2HHT A;  4HUG A;  1T7P A;  4WE1 A;  1YQR A;  3KLF A;  4O44 A;  3NGI A;  3OYL A;  4CGH A;  1ZBL A;  1YTF A;  1C1A A;  1JLF A;  1VSL A;  4E19 A;  1QNC A;  2NOL A;  4KTZ A;  3OS0 A;  4FM0 A;  4B08 A;  1TK8 A;  3NBP A;  4QOZ B;  4AHC A;  1WSF A;  1N39 A;  1CZB A;  4DQP A;  1FN7 A;  3PY8 A;  3ZSZ A;  3SUO A;  3RPJ A;  4DTN A;  3OYN A;  3AV9 A;  1YTU A;  1W0H A;  2HVH A;  1ZYQ A;  3OYH A;  5FDL A;  3L8B A;  3AVL A;  2NOH A;  4ZHR A;  3AVK A;  5T7B A;  4JS4 A;  4BAC A;  1Q9Y A;  1UWB A;  4KHU A;  1SUQ A;  4M3T A;  3AVH A;  4RW9 A;  4CES A;  3SUP A;  3THV A;  4EP4 A;  3SQ0 A;  3IRX A;  3WNH A;  4ID1 A;  2ZQB A;  5SZT A;  4B9N A;  5CYM A;  2YV0 X;  3LZJ A;  3ZSR A;  3OYE A;  2YHB A;  2IGI A;  4KTW A;  3MED A;  2JOI A;  3OYM A;  2B4J A;  1HMV A;  3VQ8 A;  4AHT A;  4CJW A;  4CFB A;  1QSY A;  1LWY A;  3LAK A;  1SKR A;  1YVU A;  3AVJ A;  4DF8 A;  1X9S A;  3TWH A;  4ZTF A;  4FJ8 A;  1M3H A;  4ID5 A;  3AVI A;  2OZM A;  2ITG A;  1VSJ A;  3F9K A;  4B8A B;  2XHI A;  1JLG A;  3K5M A;  2QKB A;  1SKS A;  3NF7 A;  2BGG A;  3VQ5 A;  1S6P A;  4FJX A;  1RT3 A;  3C95 A;  4ELT A;  3U3Y A;  1S1V A;  1DLO A;  4LH5 A;  3O3G A;  4Z4G A;  3DYA A;  1TKX A;  3ISN C;  2HHV A;  3OYF A;  2XY8 A;  1TBA B;  2D5R A;  4KFB A;  1NGM A;  4AHS A;  3QER A;  4DWI A;  2KTQ A;  1CZ9 A;  4I2P A;  5IYD P;  1YTA A;  3NDK A;  3AO3 A;  4ROE B;  4E7H A;  4EJZ A;  2X6S A;  1SL2 A;  2G8W A;  4M3R A;  4JRP A;  1C6V A;  4CFD A;  1BHL A;  2F8S A;  3HT3 A;  1UA1 A;  4YNQ A;  3DPT A;  2OPR A;  4FJG A;  3K58 A;  3K5O A;  5J2Q A;  3PO5 A;  4CK3 A;  2VJ0 A;  1GOC A;  2Q3S A;  3NE6 A;  3NH1 A;  4JS5 A;  3HK2 A;  1JL2 A;  2NOI A;  1C0M A;  4HUF A;  1TV6 A;  4OJR A;  4QCL A;  3SZ2 A;  4DTX A;  1CXU A;  1QTP A;  3SV3 A;  1D5A A;  3AVM A;  2PY5 A;  2X6N A;  3MXJ A;  3NF6 A;  4CF8 A;  2P5G A;  4M3X A;  4DTM A;  3QNO A;  1NOY A;  3WNE A;  1EBM A;  4DUL A;  4FCY A;  1BQN A;  5HP1 A;  2BDP A;  2YKN A;  3DPU A;  1RTJ A;  4W5Q A;  2KZM A;  3MXI A;  4CFC A;  4HCC A;  3MEE A;  3KD1 E;  1UAX A;  2FBT A;  3V4I A;  3K2P A;  2HNY A;  4DS5 A;  3B6P A;  1Q9X A;  4OVL A;  3M8P A;  4CGI A;  2I5W A;  1RDA A;  3MEG A;  3TAE A;  4F3T A;  3RMC A;  1VTL E;  4N41 A;  2FC0 A;  1VOL B;  2RPI A;  3CFO A;  2LAE A;  1IKV A;  1U04 A;  4O55 A;  2B6A A;  1XC9 A;  2HHS A;  1KLN A;  2IOC A;  4CIF A;  5KRT A;  4M3Y A;  1NOZ A;  2D0B A;  1F21 A;  4E89 A;  4CJV A;  3I0X A;  4F8R A;  1RM1 A;  2HVI A;  1U49 A;  1RT7 A;  1TGO A;  4KKO A;  2DTU A;  1RBV A;  3QES A;  4CHQ A;  4KI4 A;  3NGZ A;  2AJQ A;  3DI6 A;  4OKE A;  1TKT A;  4FJN A;  1PZD A;  1KYU A;  3VQA A;  3TAM A;  2VWK A;  1KVB A;  3V9Z A;  4CIG A;  4B9L A;  4J2D A;  1ASU A;  1UOC A;  2VG7 A;  3ASM A;  2HB5 A;  3MXM A;  3PX0 A;  3DOL A;  1EET A;  2A1S A;  3ZT2 A;  4NYN A;  3WNF A;  3F73 A;  4M3Z A;  3K5L A;  5AN4 A;  3ULX A;  1EKE A;  2IV9 A;  1BI4 A;  1Z25 A;  5K14 A;  3U6F A;  2DFE A;  4AH9 A;  1HNV A;  1RBR A;  3AA4 A;  4NCG A;  5C25 A;  3RMB A;  1S1T A;  1QQC A;  3EZ5 A;  3OVN A;  4W5R A;  1N5Y A;  5KRS A;  1KRP A;  3TAN A;  1HU0 A;  4Z0U A;  3NF9 A;  2KFZ A;  4CJP A;  1IH7 A;  1XI1 A;  4F4K A;  4EP5 A;  3OYK A;  1C0U A;  1SV5 A;  1WLJ A;  3DLH A;  4FLZ A;  3I8D A;  2HW3 A;  1JLA A;  4M3W A;  1J5O A;  3HJF A;  3G10 A;  3F0Z A;  3DM2 A;  2PYL A;  4FZZ A;  3V1O A;  3K57 A;  3QEP A;  2G8U A;  1UT4 A;  2Y1I A;  1VSI A;  4FJ9 A;  4FJJ A;  4KTQ A;  1CXQ A;  4CEF A;  3ZT0 A;  4HVJ A;  3QEW A;  1RT1 A;  3DLB A;  1RDD A;  1LWW A;  3LWM A;  1WN7 A;  3SV4 A;  1GOA A;  3ZSW A;  3OYD A;  4B9U A;  1KYD A;  3OSM A;  4H8K A;  3KD5 E;  4OPJ A;  3VQQ A;  3KRM A;  2JGU A;  4DU1 A;  5J2P A;  2NOE A;  3HPH A;  3AVC A;  3KTQ A;  4W5O A;  3KK3 A;  3V9X A;  2XHB A;  3P1G A;  4NYF A;  3KLI A;  1VRT A;  1HYV A;  1Y97 A;  3HS9 A;  4CER A;  4CEQ A;  4C8O A;  5HRP A;  1KVC A;  4Z4I A;  3KIO A;  1WSJ A;  1PCZ A;  1QN4 A;  4N56 A;  4GMJ B;  1YQM A;  4M41 A;  3OJS A;  1IG9 A;  4KV8 A;  4DSF A;  3CM5 A;  1BGX T;  3O3F A;  1XWL A;  4KO0 A;  1BIS A;  1TKZ A;  1KCF A;  3HL8 A;  3OS1 A;  4E0D A;  4Q0B A;  4WZS D;  2WON A;  4CJE A;  4FLX A;  1JL1 A;  1BI4 B;  5HBM A;  4CJ3 A;  4CJK A;  4BE0 A;  4FM2 A;  2FBX A;  3N89 A;  3D45 A;  4CEC A;  4CJS A;  3RTV A;  4BE2 A;  3PX4 A;  4OKJ A;  3LDS A;  4KHW A;  4OLB A;  4DQR A;  4DSJ A;  3S3M A;  2QKK A;  3L2V A;  1D9F A;  5IYC P;  4I2Q A;  3OYI A;  1CDW A;  3RMA A;  2BE2 A;  3EYZ A;  3SQ2 A;  3KKR A;  4MQ3 A;  2IS3 A;  4DLG A;  2FBY A;  4CF1 A;  4Q5V A;  2KQ2 A;  3QLH A;  1QN5 A;  3AA3 A;  4FLT A;  3K59 A;  1HQU A;  2FBV A;  4JLH A;  4QAG A;  3ULD A;  1IO2 A;  2NUB A;  5I3U A;  4Z4C A;  4KI6 A;  4KRE A;  4DQS A;  1N3A A;  3LP3 A;  1RT6 A;  1TL1 A;  4KPY A;  1LW0 A;  2O4G A;  4NCB A;  4FK4 A;  3L2R A;  1RTD A;  3AO5 A;  1FXX A;  2NOZ A;  4N76 A;  3RRH A;  5FRN A;  3HP9 A;  1E42 A;  3AVA A;  1B9K A;  4CHN A;  3KK1 A;  1T03 A;  4EZ6 A;  4FZY A;  1QS4 A;  3LP2 A;  4B8C A;  4DSL A;  1ASV A;  2KZZ A;  1HNI A;  3OC3 C;  4KB0 A;  4CF0 A;  4W5N A;  2HNZ A;  5KGX A;  3S3O A;  1YT3 A;  1DTT A;  1Z26 A;  1RCH A;  2KW4 A;  3VQB A;  4FJ5 A;  3AA5 X;  4M42 A;  1NK4 A;  3CYM A;  2FGT A;  3HP6 A;  4CHZ A;  3S9H A;  1QNE A;  1LW2 A;  1VOK A;  3RMD A;  1KO9 A;  1FKP A;  3NGY A;  2IAJ A;  1WNS A;  5CZ2 A;  3ZSY A;  1NK9 A;  3IAY A;  3RRG A;  2NOB A;  2IDO A;  2VWJ A;  3HVR A;  4FK0 A;  2O4I A;  4I9L A;  4HUE A;  1S5J A;  2YHA A;  1QSS A;  4CJ4 A;  3VQ4 A;  1FKO A;  3ZSQ A;  1KY7 A;  4R5P A;  4FZX C;  3NH0 A;  4HTU A;  3WNG A;  3IH7 A;  4ELU A;  2Y1J A;  5HRO A;  4Q11 A;  4MFB A;  4DU3 A;  1LAV A;  3OST A;  3V1R A;  3I0S A;  4OKK A;  1LWF A;  1YQL A;  2KFN A;  4FW2 A;  4E7J A;  4DFP A;  4CCH A;  1C1C A;  2OA8 A;  4IFY A;  3M8R A;  1ZBH A;  1ZBU A;  3KLG A;  4CGD A;  1MP9 A;  1J53 A;  3DLR A;  4LSN A;  4CK1 A;  4BE1 A;  2RF2 A;  3SUQ A;  1U45 A;  5EU7 A;  1C0T A;  1LAW A;  3I0W A;  4CGJ A;  3L3U A;  4DU4 A;  1RT5 A;  3TAR A;  4CFA A;  3QEX A;  1L3S A;  4CEB A;  4ELV A;  2HHQ A;  1JLQ A;  3F10 A;  1TK5 A;  1RIL A;  2XO7 A;  1WSH A;  4FJL A;  5CZ1 A;  3A2F A;  3HVT A;  3CFP A;  1EP4 A;  1NK7 A;  1NKC A;  3SPY A;  2QK9 A;  3G0Z A;  3QEV A;  5J2M A;  1M3Q A;  4Z4F A;  2HZS A;  2HHU A;  3V9S A;  4F3O A;  2YNI A;  3NAE A;  4KHN A;  4B3O A;  2OZS A;  1VSK A;  1QNB A;  3VA0 A;  4AHV A;  5J1E A;  1VK0 A;  1MU2 A;  2E6L A;  4PY5 A;  3VQD A;  1D3U A;  4FJI A;  3K5N A;  3AO4 A;  4E1M A;  2R7Y A;  1QE1 A;  4L8R B;  4ROD B;  1VSF A;  5C42 A;  1TBP A;  1WSE A;  1C9B B;  2ZD1 A;  4GVM A;  4O0I A;  3ZT4 A;  1JLE A;  3MEC A;  1HYS A;  2IV8 A;  2W42 A;  1RBT A;  2NOF A;  4E7I A;  3ITH A;  4CEA A;  1QSL A;  3V6D A;  1L3V A;  3HPO A;  3SNN A;  1LWE A;  4CED A;  3DOK A;  1VSD A;  3T3F A;  4BDP A;  1RTI A;  1XHX A;  5D3G A;  4PQU A;  2YKM A;  1RDB A;  1LV5 A;  3C6T A;  2G8V A;  3QIN A;  2PZS A;  2XY6 A;  1NK6 A;  5DMR A;  4FJ7 A;  4CJ5 A;  2G8I A;  3NF8 A;  3O4Q A;  5DK5 A;  3VQ6 A;  4CK2 A;  4RW8 A;  5KGW A;  3TAQ A;  1T05 A;  2OPP A;  1TKD A;  1RT4 A;  1GOB A;  3O4N A;  4CHP A;  3PX6 A;  4H4O A;  1B92 A;  3V81 A;  3SQ1 A;  4FXD A;  1S6Q A;  3QIO A;  3TAB A;  5FRM A;  2P5O A;  3TI0 A;  1HYZ A;  1RDC A;  1W80 A;  1NJZ A;  4FJH A;  1VSM A;  3DRS A;  3QO9 A;  4LH4 A;  3ZSO A;  4IBN A;  4XIU A;  3UIQ A;  1JKH A;  1NVP A;  4FLY A;  3VQC A;  3HM9 A;  4HCB A;  1KVA A;  3P5J A;  3VA3 A;  3NFA A;  1J54 A;  4CEO A;  3SPZ A;  1REV A;  4E7K A;  4ZTJ A;  4C8K A;  2O3O A;  1L3U A;  3IS9 A;  3VQE A;  4CJF A;  3DMJ A;  3OYC A;  4G1Q A;  2E6M A;  3MAQ A;  5SWM A;  3TAF A;  3QIP A;  4CHO A;  2P51 A;  4CHY A;  1NK8 A;  5JS2 A;  4HHT A;  3NHG A;  4C8N A;  2YH5 A;  1QTM A;  4I8O A;  3LAM A;  4F2R A;  4B0A A;  1LWV A;  4KHY A;  3HO1 A;  4K8X A;  3BGR A;  3IG1 A;  1BCM A;  3AVF A;  5I42 A;  4DLE A;  1SKW A;  1HQE A;  1B9D A;  3VQ9 A;  3V1Q A;  4CJT A;  3HS8 A;  3S3N A;  4FJM A;  4M3U A;  4O0J A;  3KKS A;  3QEI A;  1KFD A;  4KAZ A;  3LZI A;  3AVB A;  1ITG A;  2I5J A;  4IG3 A;  5J2N A;  1NJY A;  1QN7 A;  1BIU A;  2HND A;  4CF9 A;  4DF4 A;  3SCX A;  1KSP A;  1J9A A;  4DS4 A;  4CEZ A;  4OGE A;  1QN3 A;  2XY5 A;  3HXM A;  3HPG A;  3SQ4 A;  1NH2 A;  2EHG A;  3L3V A;  4CEE A;  3ALY A;  4DQQ A;  3CM6 A;  4CGG A;  1HRH A;  1A5W A;  1HPZ A;  2BAN A;  3L2U A;  4J2A A;  3DLK A;  1KYF A;  1WSG A;  2MZ8 A;  4IG0 A;  1K6Y A;  3U3G A;  3ZT1 A;  4CJL A;  3SUN A;  1X9W A;  1BL3 A;  1NK5 A;  3VQP A;  4N47 A;  1JLB A;  3CG7 A;  1S9G A;  4CIE A;  1DTQ A;  4C8M A;  2A1R A;  1NJX A;  1G15 A;  1S1X A;  3FFI A;  5FRO A;  3OYA A;  1QNA A;  3CQ8 A;  2OYQ A;  2QXF A;  1JLC A;  4DSK A;  1TK0 A;  4CJQ A;  1NJW A;  1ZBI A;  2WOM A;  4AHR A;  1QHT A;  1QN6 A;  2GBZ A;  3EY1 A;  4DSE A;  4B9M A;  4EZ9 A;  1VTO A;  4EJY A;  1KY6 A;  1O1W A;  1TVR A;  2X74 A;  1S9E A;  3LAN A;  1QN8 A;  2F96 A;  4BDZ A;  3H08 A;  4DSI A;  4O5B A;  1TAQ A;  4Z4E A;  3ZT3 A;  4CE9 A;  2MJ7 A;  4DFK A;  5CYQ A;  4RW7 A;  3KJV A;  1VSH A;  2HHX A;  2Z1J A;  3DLG A;  3TAG A;  1TGH A;  1YTB A;  4GW6 A;  4BWJ A;  4BWM A;  4KHQ A;  2EX3 A;  3LPU A;  4W5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...