2D0AA

Crystal structure of bst-rnase hiii
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
308
Chain Sequence
SNYVIQADQQLLDALRAHYEGALSDRLPAGALFAVKRPDVVITAYRSGKVLFQGKAAEQEAAKWISGASASNETADHQPSALAAHQLGSLSAIGSDEVGTGDYFGPIVVAAAYVDRPHIAKIAALGVKDSKQLNDEAIKRIAPAIMETVPHAVTVLDNPQYNRWQRSGMPQTKMKALLHNRTLVKLVDAIAPAEPEAIIIDEFLKRDSYFRYLSDEDRIIRERVHCLPKAESVHVSVAAASIIARYVFLEEMEQLSRAVGLLLPKGAGAIVDEAAARIIRARGEEMLETCAKLHFANTKKALAIAKRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and structure-based mutational analyses of RNase HIII from Bacillus stearothermophilus: a new type 2 RNase H with TBP-like substrate-binding domain at the N terminus
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords ribonuclease HIII
total genus 100
structure length 308
sequence length 308
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
A PF11858 DUF3378 Domain of unknown function (DUF3378)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2d0aA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2d0aA02
2B4JA 4OKKA 1BCMA 3RMAA 1TK5A 1ZBIA 4E1MA 4ICLA 4WZSD 1IO2A 1KVCA 4M3UA 1LWCA 1BGXT 4BACA 1I39A 3O3FA 3V9UA 1SL2A 4DFMA 1NK8A 3NF8A 5E41A 4KI6A 1C0TA 1QE1A 1UWBA 3OYHA 4DLGA 3SV4A 3WNEA 4BDYA 3OJSA 4PWDA 2HHQA 1TKTA 1TKDA 3VA0A 1RBUA 3NBPA 4NCBA 1TVRA 3KLGA 2VG5A 3QEPA 2KZZA 4AHVA 3QEVA 2BANA 3L3UA 3RR8A 3QETA 4YFUA 3HVRA 4DFJA 2P1JA 4CFCA 2OYQA 3I0SA 5HROA 1QN6A 4Z4GA 3SQ1A 4M3TA 4MFBA 5SWMA 1G15A 4DF8A 4E1NA 1QHTA 3NCIA 4DQIA 4H8KA 3U3YA 1RILA 4CJWA 5I3UA 1TAQA 3CFRA 4DS5A 1VSFA 3SPZA 1DTQA 4CIEA 2QK9A 3SJJA 1BCOA 1CZ9A 3L2WA 2FC0A 4CHPA 4PQUA 1YTAA 4KTZA 4DTOA 3CM5A 3OYGA 1T7PA 3EIKA 1AISA 1YTUA 2Z8UA 3ISNC 2R7YA 4FLVA 4B9LA 1WSEA 1W9HA 1JLGA 4HHTA 3T19A 2G8VA 1EKEA 1CZBA 2YHBA 4CEBA 1HNVA 4CECA 3M8SA 2IS3A 1N5YA 2HHWA 4KV8A 4N47A 1W80A 1IH7A 1ZBHA 3DRRA 1NJYA 1LV5A 5KI6A 4BE1A 3K5MA 4FXDA 1ZBFA 4LH5A 1S9GA 1QNAA 1TBPA 1B9DA 3AVKA 3QO9A 4HUFA 4E3SA 2XY7A 2G8IA 2KTQA 3DI6A 3ZSWA 4DLEA 1U49A 3OYDA 4FJ8A 3KK2A 3SUPA 1JLAA 4DTRA 2G8WA 1D3UA 4CF1A 4FCYA 4Y1DA 1QN8A 3OYEA 1R4XA 5I42A 5HP1A 3QERA 4I9QA 4OGEA 3NHGA 3DLRA 3NH2A 1HRHA 4CEZA 1RTHA 1VOKA 4E7JA 4B3OA 2YV0X 3ZSRA 2ETJA 4C8MA 5C24A 3V81A 4KTWA 4B9UA 4FJMA 5CZ2A 2D0AA 3SUNA 3A2FA 1X9MA 4CEOA 3NF7A 3TAEA 2DFHA 3TI0A 4ELTA 1WSGA 3K2PA 2QKBA 4KB1A 2YNHA 3SNNA 4PY5A 1QN4A 4CF9A 2F8SA 4GW6A 3ZT1A 4FJ7A 5FROA 4N76A 4FYDA 3AO4A 2VG6A 1D9DA 1XC9A 3CFPA 2HHXA 4KB0A 1VRUA 4M41A 2P51A 4ZHRA 4M3ZA 1BQMA 2E6MA 1SL0A 3VQ5A 2YKNA 4FZXC 3I0RA 3IS9A 3SPYA 1LAWA 2B5JA 4CJLA 5J2QA 2E6LA 3KKSA 4M45A 4CF0A 3AVGA 4OJRA 1E42A 1UA1A 4B9TA 2FBYA 1S1TA 4NYFA 4IFVA 3V4IA 3LZJA 1XI1A 1B92A 4LD0A 3M8RA 1KY6A 4IFYA 3TAFA 2PYJA 3AVNA 3KKRA 3H1ZA 1WSIA 4AHUA 3V9ZA 3IAYA 3SV3A 2FBVA 3LP2A 1Q9XA 4JS5A 2IGIA 1QS4A 5IYBP 3OS1A 4DTJA 4DSEA 1S9EA 4Y1CA 3C94A 4I2QA 4KHUA 4FW2A 4O55A 4CGIA 2HW3A 5EU7A 3ZSVA 4JRQA 1JLEA 1QTPA 4FJ5A 1WN7A 4AILC 1YTBA 2WONA 3DLEA 1KYDA 1QTSA 3MEEA 2AJQA 4W5RA 3V9WA 4JS4A 1BQNA 4AHTA 3RRGA 1VTOA 3F73A 4EZ9A 4RW7A 3U3GA 1RDBA 1VSMA 3O3HA 3OYBA 1KLNA 2F96A 3IRXA 4CFAA 4FLZA 3PX4A 4FJLA 1SKRA 3VQCA 3VQDA 3OS0A 1RTDA 4DQQA 3SQ4A 4OKJA 3OVNA 3HK2A 3L3VA 2IOCA 4I9LA 1VSJA 4DU1A 2ZD1A 3ZCMA 4ZTJA 5HRRA 4CJRA 2VJ0A 1JFIC 1XHZA 1IG9A 1GOBA 1WLJA 1PCZA 1REVA 1S6QA 5CYQA 4DQSA 3P5JA 2X6SA 3HS9A 2RF2A 1X9SA 1NK0A 4RW9A 4F3TA 1TL3A 1NK7A 4DSLA 1WAJA 4DTMA 2Z1HA 4RG8A 3TARA 4PA1A 2W42A 4JLHA 3L2QA 3TAQA 5J2PA 3QEXA 2VWJA 4N56A 4OPJA 1RTJA 3AVBA 3CQ8A 1HYSA 3QIOA 1TBAB 1C1AA 1IKXA 4E19A 3QLHA 4G1QA 3P83D 3OYFA 1QSYA 2YKMA 4KHNA 1QTMA 2KW4A 1SV5A 1C1CA 1JLCA 3DLKA 3DM2A 4LH4A 3OYMA 5CY4A 3T3FA 3MXMA 4RODB 1VRTA 4UQGA 1NK4A 4IBNA 3B6OA 4CJFA 5SZTA 3O3GA 3LANA 4ID1A 1Z25A 4NYNA 1NH2A 2OPQA 3SZ2A 1PZDA 4WE1A 1L5UA 3LP3A 1L3TA 4K8XA 2GV9A 4N5SA 1BIUA 3OCIA 1S5JA 3LZIA 4LSNA 5HRSA 3M8QA 3MEDA 3IG1A 1T03A 3PX0A 1NK6A 3RWUA 4KI4A 4CIGA 1RDDA 3HP6A 4O0IA 1CDWA 1HNIA 4OKEA 3K5OA 4HTUA 1QN3A 3VN5A 4KHQA 4L8RB 4DU4A 3LALA 3K5LA 3K59A 3DRSA 2HNZA 3SUQA 3OYLA 3ZSYA 4DSFA 4BWMA 4M3XA 2OZMA 4DSKA 4CIFA 1JLQA 1NOZA 1UAXA 4FVMA 4B8CA 2A1RA 4CGGA 3HS8A 2G30A 3HL8A 3V9SA 4E7IA 1ASUA 5IYDP 4H4OA 1FXXA 2XY6A 3HSTB 4KHWA 3P1GA 3KK3A 4AHCA 1LW2A 1IKWA 1C0MA 1VSHA 1YT3A 4CGDA 3D0PA 4FM0A 3NDKA 3FFIA 1MU2A 2F8TA 4ELVA 3KTQA 2EHGA 3AVCA 2G8KA 1QSSA 2GUIA 3AO1A 3O4NA 3AVIA 4LSLA 1NOYA 5HBMA 3MECA 4CHYA 3QESA 4FW1A 4B9MA 4CK2A 2OPPA 1K6YA 4AHRA 3OYJA 4EP4A 1QNCA 3SCXA 1S1XA 2XRIA 3KD5E 2PY5A 3HT3A 1BHLA 3BGRA 1SL1A 5FRNA 3TAMA 4C8OA 1EP4A 4CJ3A 4F2RA 1TGOA 4BDZA 3HPHA 3CFOA 3RMDA 4B9NA 1HQUA 4OVLA 1RDCA 3V9XA 3AVFA 2ZQBA 2X6NA 4CHNA 1RT1A 1U48A 2OA8A 1DLOA 1ITGA 4J2AA 1L3VA 3K57A 1A5WA 4CHQA 3OS2A 3SUOA 1RCHA 1SKWA 2G8FA 4K8ZA 2KZMA 2KFZA 3HO1A 4C8LA 1RTIA 2IAJA 2JLEA 3KJVA 4DG1A 3C6TA 1VOLB 1KYUA 3VA3A 5CZ1A 1TKZA 3EYZA 4IKFA 4Q0BA 1EXQA 3RMBA 3NF9A 4E7KA 1KVAA 4DTNA 1RT2A 1EETA 4FLXA 1GOCA 3HXMA 3ZT2A 4O4GA 4LY7A 1UA0A 1IKVA 1VTLE 4DTSA 3DLBA 1FKOA 2MJ7A 1TKXA 1Q8IA 3C6UA 4E7HA 3OJUA 1W0HA 3ZSZA 3KLFA 3NGIA 1RM1A 3KK1A 1QSLA 4CJVA 4H4MA 4DTUA 4GVMA 1TK8A 4B0AA 2Q3SA 4RW6A 4Z4CA 3LPUA 2YHAA 1QN7A 1SKSA 1TGHA 1QQCA 5DK5A 3ULDA 4HVJA 2HVIA 4DU3A 4F3OA 4KO0A 1WAFA 4W5OA 3AVHA 3K5NA 1IKYA 2DFEA 2Z1JA 4AH9A 3CM6A 1J53A 3NGZA 4F2SA 4I7FA 4FZZA 1Z26A 3QNNA 3VQ7A 1NVPA 2OPSA 4O44A 3OYCA 3OYKA 1RBVA 4FJ9A 3KLEA 4M3WA 3DRPA 1QNEA 3NFAA 5JS2A 4HCBA 1VSDA 4DFKA 3HJFA 4CESA 3OC3C 2E4LA 3F9KA 3O4QA 1HJRA 3JYTA 1S6PA 2I5JA 2Z1GA 4IG3A 4TSXA 3ZSOA 4B8AB 1HQEA 4CEEA 3VQ9A 4CK1A 4DTXA 1TAUA 1X9WA 1NJWA 4EZ6A 1J9AA 4J2DA 1A5XA 3S9HA 1N6QA 2PZSA 2O4IA 1JXBA 4KREA 3PV8A 1VSKA 3DYAA 3WNFA 1CLQA 1HYZA 3OY9A 3EY1A 5DMRA 4CJKA 3SQ0A 3AO2A 3AA5X 4CJEA 2G8UA 4B9VA 2D0CA 3V1QA 1KY7A 4FZYA 4B9SA 4PUOA 2YNFA 4M42A 2KFNA 4AHSA 2OZSA 4KRFA 1D8YA 4Z4EA 4DF4A 1KFDA 3QIPA 5HLFA 3VQAA 4DQRA 3ZT4A 4J2BA 3K58A 1JLBA 3HM9A 3RTVA 4Z4HA 5J2MA 3ZSXA 4FJJA 1KLMA 3MEGA 3ITHA 4W5TA 1C1BA 3NH1A 3VQQA 3C95A 3TABA 1KSPA 1T05A 3PY8A 1XWLA 1VSLA 5KRTA 3L2RA 3LWMA 2XY5A 1U47A 3ASMA 1S1VA 2EX3A 4KHYA 1X1PA 3OYNA 4Z4IA 1FKPA 3VQ8A 2IDOA 2WOMA 4ID5A 3CG7A 2FBXA 4E89A 3LAMA 1NKCA 5D3GA 1NGMA 4ROEB 2X78A 3DMJA 1YVUA 3QINA 4CF8A 3SQ2A 1J5OA 2XO7A 4E0DA 3TR8A 1KRPA 2GBZA 2FBTA 3NAEA 2X74A 1BL3A 3H08A 4CEQA 1VSEA 3LDSA 3LWLA 1BI4A 5KGXA 3S3NA 1RBTA 4FM1A 3AVAA 2HMIA 2DTUA 3LP1A 4FJHA 3D45A 2RN2A 3V1OA 3MAQA 3CYMA 1KCFA 1KFSA 4OGCA 4FLWA 4HUGA 3MXIA 2NUBA 1RT7A 4DQPA 3AA2A 4FJKA 4W5QA 1QNBA 3S3OA 1WSFA 3S3MA 2VG7A 1I3AA 4FJXA 2IV9A 4KKOA 5K14A 4R5PA 2XHBA 2Y1IA 1BIZA 1ZBUA 2HHTA 3RR7A 3I8DA 1RT6A 1CXUA 5KTQA 3PX6A 4FK4A 3HPGA 1JL2A 2YNIA 3SYZA 1NKEA 1Q9YA 2G8HA 1YTFA 1HPZA 1B9FA 1L3UA 3KD1E 1WSHA 3VQPA 2KQ2A 4IG0A 4DWIA 5FDLA 2QKKA 2HHUA 3LAKA 4CE9A 2BE2A 4O5BA 5CYMA 3OYAA 4FJGA 4KHSA 3QEIA 2BGGA 2B6AA 3G0ZA 4C8KA 3JSMA 3TWHA 4ELUA 2Z1IA 3E01A 4BWJA 4EP5A 3TANA 4BE0A 1NJZA 3LPTA 4ZTFA 1T8EA 4RW8A 5KGWA 5HRPA 2P5OA 1RT4A 2DY4A 1KTQA 4W5NA 4KFBA 4CJ5A 4DTPA 3KLIA 1GOAA 1F21A 2ATQA 3PUFA 2VWKA 3ZSQA 2Y1JA 3KLHA 1J54A 1HYVA 1R0AA 3TAGA 4CJTA 3AO3A 4OLAA 1RDAA 4FJIA 2HB5A 1RT5A 3KIOA 4IDKA 3UIQA 2OPRA 3NE6A 1BI4B 1Y97A 4I2PA 3AO5A 4CHZA 4CJQA 3RMCA 4QCLA 2PYLA 5JS1A 2BDPA 3BDPA 3DLGA 4CGFA 4HCCA 4DSJA 4CJUA 1TV6A 4QOZB 4B08A 5T7BA 5J2NA 4F4KA 1TL1A 4FLYA 1L3SA 4FJNA 4QAGA 4Q5VA 3ZT3A 3SI6A 4NCGA 4JRPA 4XIUA 3WNGA 4C8NA 4CEFA 4CFDA 3L2VA 4NCAA 1JKHA 1KYFA 1NJXA 1VK0A 1WSJA 3NGYA 2HHSA 3VQEA 2D5RA 1SUQA 1ZYQA 4Z0UA 4FLUA 3QEWA 3AA3A 4CJPA 1JXEA 4BDPA 4DSIA 4GMJB 2IC3A 2HVHA 1QN9A 3HYFA 4CERA 3AVJA 3TAPA 4OPKA 1C0UA 1RBSA 3HPOA 2D0BA 5C42A 1U45A 1S1UA 3M8PA 5HRNA 3AVMA 4CHOA 4E7LA 4CEDA 4DFPA 1DTTA 1CXQA 5FRMA 1U4BA 2HNDA 3PO4A 2RKIA 2YNGA 3VQ4A 1D9FA 2A1SA 1RT3A 1EX4A 1VSIA 1JLFA 2ZE2A 1RBRA 1RNHA 3AV9A 2QXFA 3V1RA 3VQBA 3L8BA 3DLHA 4O0JA 4BE2A 4RW4A 4CGHA 1ZBLA 1NK5A 4CF2A 2DFFA 4CJSA 1C9BB 3DOKA 4ROCB 3THVA 1LW0A 1LWFA 3DOLA 3G10A 2ITGA 4KPYA 3LP0A 4CEAA 3L2UA 4HUEA 1NK9A 3HP9A 4N41A 5IYCP 1ASVA 3PO5A 3WNHA 1UOCA 3EZ5A 1XHXA 3T1AA 4DMNA 3OYIA 3B6PA 5J1EA 3VQ6A 1LAVA 4KAZA 4J2EA 4CCHA 1BISA 4FK2A 2P5GA 1S1WA 2JGUA 4CFBA 1KVBA 4OLBA 4MQ3A 1O1WA 4F8RA 1QN5A 1D5AA 3ALYA 2RPIA 1MP9A 4FM2A 4M3RA 2XY8A 3RRHA 3NF6A 1U04A 5C25A 3HVTA 2HNYA 4CK3A 1NKBA 4M3YA 3AVLA 4Z4FA 4FK0A 1TK0A 2O4GA 3ZT0A 2IV8A 1C6VA 4CGJA 2HHVA 3AA4A 3U6FA 4DS4A 1LWEA 4CJ4A 3QNOA 4KTQA 1WNSA 1A5VA 3V6DA 2LSNA 3MXJA 1FK9A 1ASWA 3NH0A 1B9KA 4YNQA 1JL1A 4FLTA 1HMVA 5KRSA
chains in the Genus database with same CATH superfamily
2B4JA 4WCEL 1ZBIA 1W7AA 3OA9A 4ICLA 4IOCL 4WZSD 2QTDA 4M3UA 4B1XB 1SL2A 4DFMA 2DKAA 5BRHA 1C0TA 1UWBA 1D4XA 1C4GA 3LDPA 3OJSA 3CCVN 4B1VA 5FLXO 3NBPA 2ZGYA 3DXMA 3QEPA 5JN5A 1NMDA 2CGJA 2O8BB 3C65A 5AZIB 2JHNA 3HVRA 2NRTA 4EJYA 4DF8A 5F9CA 4L3QA 4E1NA 4DV3K 5I9EB 3F2KA 1DTQA 3SBGA 4CIEA 4GV9A 3A5OC 3SJJA 2QK9A 1WOQA 4ILGB 1NMNA 4KTZA 3BKQX 3ISNC 4B9LA 5BMNA 1WSEA 1NGDA 4WQ4A 4HHTA 3T19A 2G8VA 1N5YA 2IS3A 2Y8QA 4KV8A 1IH7A 1ZBHA 3DRRA 1NJYA 5FPEA 2Z0FA 3ULEB 1B9DA 4M63C 4WFNL 3SUPA 4DTRA 2YCHA 1QHAA 1D3UA 2UXBK 4CF1A 1QN8A 3OYEA 5HP1A 3NHGA 3OLPA 3DLRA 1HRHA 2ZWHA 5CZ2A 2D0AA 4LF8K 4CBWA 4CEOA 3TAEA 3K2PA 5BRDA 1W2BM 2YNHA 4CF9A 2F8SA 2IVOA 4GW6A 3ZT1A 3PSIA 1KXPA 1XC9A 3CFPA 1JCEA 2O3OA 4M41A 3LDQA 2YKNA 4JD2A 4FZXC 3I0RA 4EHTA 1LAWA 2B5JA 4OJRA 4NYFA 1EBMA 4IFVA 3LZJA 2IVNA 3TAFA 1KY6A 4B3MK 3DLLL 3H1ZA 4AHUA 2ZJQL 3SV3A 1HJOA 1S9EA 4ILHA 4Y1CA 4QS7A 5BR9A 1IJJA 1PCJX 3ZSVA 2KHOA 1QTPA 2P9SA 3MEEA 4JS4A 4AHTA 4ISEA 3F73A 1O13A 4RW7A 3IRXA 3PX4A 3OS0A 3SQ4A 1T6AA 3RVCA 4IJNA 4CJRA 2VJ0A 1JFIC 4DQSA 5AQUA 3HS9A 5AFUH 2RF2A 3B8AX 4DB3A 1ATRA 1QQOA 5CR4A 1WAJA 2Z1HA 2NOEA 3O9RA 5AQRA 1NGBA 3WQTA 4JLHA 3CCJN 1JCGA 1YQMA 1RFQA 5E84A 4OPJA 1HYSA 1TBAB 3OYFA 4G1QA 4FWMA 3S41A 3OYMA 1JLCA 3DM2A 4LH4A 3SAFA 1VRTA 3SMSA 4ID1A 4K8XA 1PZDA 4H03B 1L3TA 4YOUA 1EWQA 1QZ5A 3CCMN 4DV6K 2CGKA 4KI4A 4DV0K 3O9SA 3K59A 2PWWA 3VOVA 1N33K 3HOTA 2NRRA 3WEEB 2E2OA 4DSFA 4BWMA 4M3XA 2QWNA 4IDHA 1TYQA 4B8CA 2A1RA 3HS8A 2G30A 3MN7A 1FXXA 3HSTB 4U7BA 4AHCA 1LW2A 1C0MA 1C0GA 3O08A 3NDKA 5AJ3K 2F8TA 3FZLA 3D2EB 4LFBK 1QSSA 3O4NA 4KBOA 2HKPA 4LSLA 3U9ZA 5HBMA 3MECA 2YH5A 4CHYA 3UE5A 2OPPA 1K6YA 3OYJA 3KD5E 1IG8A 1SL1A 1BHLA 3HM8A 4CJ3A 4BDZA 3CFOA 1RDCA 2ZQBA 2OA8A 4M7YA 3WXIA 1ITGA 2ZGZA 1A5WA 3OS2A 1XNRK 3CWTA 1Q18A 4Y0WA 5GIPA 1KC8O 4BRPA 3SNSA 3I56N 2E2PA 3WEEA 3RMBA 4A2AA 1RT2A 2Y8LA 5DM6L 4O4GA 3O9TA 1IKVA 4DR1K 4DTSA 1FKOA 1Q8IA 2YX6A 4IJAA 4OPHA 3KK1A 4BJUA 4DTUA 1TK8A 4Z4CA 2E1ZA 3LPUA 2YHAA 3ULDA 3KTUA 1WUAA 5BREA 4DCHA 4W5OA 3DWLA 4BR5A 1Z26A 2OPSA 4QG5A 1RBVA 4CVNE 4FWOA 3DRPA 3ULXA 5JS2A 2BUPA 3OW2M 1YJWN 4H0XB 4JKEA 1HJRA 3QMLA 1HQEA 2NVMA 1NGIA 3HOSA 1NJWA 4JI7K 4CZKA 2PZSA 3M6GA 4FOEA 5AQTA 1CLQA 3F10A 4FZYA 4JEPA 4AHSA 4KRFA 1PCMX 1KFDA 5HLFA 2NOFA 2P9IA 3ZT4A 3K58A 1JLBA 4Z4HA 4FJJA 2XHIA 3C04A 3ITHA 4K41A 1Z05A 3NH1A 3TABA 3C95A 1XMQK 4J2AA 3PY8A 1XWLA 1VSLA 3L2RA 4A62A 5C15A 4BR9A 2GELA 2EX3A 4YHHK 1X1PA 2WOMA 4ID5A 2FBXA 5JLFA 2OCEA 2NOHA 1XNQK 4GVEA 2NWVA 1YVUA 3QINA 4CF8A 2ZF5O 3NAEA 1VSEA 3LWLA 5KGXA 2A40A 1RBTA 3AVAA 5JMVA 2HMIA 2DTUA 1NM1A 4FJHA 3D45A 1KFSA 3ZX2A 3CYMA 1KCFA 3MAQA 4OGCA 1VQ5N 1TUYA 2NUBA 3AA2A 1K9MO 3TE5A 4MLEA 4KKOA 4DR7K 3RR7A 1RT6A 1CXUA 3UKUB 1C47A 4Q11A 3I0XA 3QBXA 1JL2A 4JKHA 3SYZA 1Q9YA 2G8HA 1YTFA 4AM7A 1OVQA 1WSHA 1E3MA 4JI4K 4DWIA 3LAKA 4FVUA 2HOEA 3G6EN 4O5BA 4D7RA 3QEIA 4C8KA 2HBMA 1ZBSA 2E1YA 4X65K 4ELUA 3MX5A 5FPNA 3UW2A 4RW8A 5KGWA 3O1WA 3I3WA 4KFBA 1BO5O 2WTUA 4A57A 2OTJN 1F21A 2VWKA 4YOWA 2KKZA 4E1JA 1I94K 3VESA 4CJTA 2P9PA 5LY3A 1RDAA 3CIPA 5JS1A 2QREA 3RMCA 4QCLA 2BDPA 3DLGA 4CGFA 4Z94A 4JI0K 4DSJA 1HR0K 2E8AA 5EXWA 2UXDK 4Q5VA 5HOOA 1MPGA 3N89A 3OSMA 3FZKA 4NCGA 5BN8A 4JRPA 3CWSA 3SI6A 3THYB 4CEFA 4NCAA 1CZAN 1NJXA 4DR3K 2EWSA 3CF5L 1BU6O 5M1FA 4DSIA 1QN9A 3AVJA 1C0UA 3HPOA 5C42A 1S1UA 3IKMA 5JVGL 3WXMB 2JHJA 1DTTA 4HJHA 5FRMA 2FSNA 4LC9B 3A5LC 4JKDA 2A1SA 3P38A 2ZE2A 1RBRA 3WXLA 1XSZA 4BRMA 3ZEUB 2O8FB 3EEQA 5M1OA 2QXFA 3V1RA 3L8BA 3DLHA 4O0JA 4RW4A 4CGHA 4NXMK 5H1SQ 1LW0A 3ZETB 5BN9A 2D4WA 3L2UA 4HUEA 5IYCP 1ASVA 1M90O 3WNHA 1IV0A 1UOCA 2WFBA 1XHXA 3B6PA 1LAVA 1BISA 1YAGA 3ZX0A 4F8RA 1QN5A 1D5AA 2RPIA 1KAZA 5AZJA 2QWRA 1N36K 2O4GA 1ESVA 3QFPA 3RSEA 2A42A 4H5WA 1WNSA 1A5VA 4I6MA 3MXJA 4EJZA 1B9KA 4FO0A 3V9WA 4YNQA 4BE0A 3CMAN 3THXA 4OKKA 2FGTA 4JD2B 1K8KA 1I39A 3O3FA 3V9UA 4KI6A 2NRWA 2QWLA 4JHDA 3SV4A 4H5NA 2P9KB 3VGLA 3OSTA 1NNEA 1TKTA 5ADXH 1RBUA 1EUVA 3DAWA 1SAZA 3QETA 4DFJA 2VGNA 1BUPA 4CFCA 3I0SA 5HROA 1QN6A 3F5TA 4MO5A 2HBJA 3SQ1A 4M3TA 1G15A 1QHTA 3U3YA 4DS5A 4BC4A 1BDGA 1VSFA 1BCOA 3L2WA 4CZMA 2HMPA 4CHPA 2A5XA 4DTOA 3CM5A 3OYGA 1HLUA 3C0BA 1T3VA 2R7YA 4FLVA 3DJCA 2YHYA 4LF4K 1CZBA 4CECA 3J7AP 3CCSN 3FFKB 1LCUA 3TSPA 4BE1A 4LH5A 1OVYA 3QO9A 3AVKA 2XY7A 3KRMA 4IFEA 3MK6A 4DLEA 3SLCA 3OYDA 4Y1DA 2V9JA 2P9SB 3QERA 4I9QA 5HSHA 3NH2A 4CEZA 4RWTA 1VOKA 3EL2A 4E7JA 4B3OA 2YV0X 4OPAA 3ZSRA 2ETJA 4C8MA 2GUPA 5AQHA 3O80A 5AQSA 4ELTA 4KB1A 3SNNA 4O8KA 3CJ7A 5FROA 3J81O 1N8RO 1JDYA 4IL8A 2H4LX 4GKJK 1VRUA 4ZHRA 4LFAK 1LWYA 1GLDG 4MDBA 5B8HA 1Y64A 3IS9A 1KFQA 3KKSA 4M45A 4CF0A 1DT9A 5EX5A 3CVSA 1DIZA 1S1TA 3V4IA 3WXJA 1XI1A 4IFYA 5LMUK 1WSIA 3VERA 2FBVA 3LP2A 1VKLA 3J8AA 4JS5A 1QS4A 4DSEA 5FPMA 4CGIA 2A6AA 4JI6K 2WC9A 3DLEA 1NGJA 1QTSA 4EZ9A 1KLNA 4FJ8A 4CFAA 5BPNA 3H45C 3T7ZA 1VQNN 3HK2A 1YVNA 3LL3A 2IOCA 1K8KB 2QRDA 1VSJA 4DU1A 3A8YA 1XHZA 1WLJA 4CZHA 1PCZA 2E88A 5CYQA 3CCUN 1X9SA 2F9WA 4BQLA 1VQ4N 3GG4A 4LF7K 2ASOA 4DV5K 1ATSA 2GWJA 4JI3K 4DTMA 3AGKA 3H3NO 4PA1A 2O8CB 2YHXA 2VWJA 4KHPK 1RTJA 3AVBA 3CQ8A 3M3ZA 1IKXA 3QLHA 5TKWA 1QSYA 2YKMA 4KHNA 2RHKA 3MXMA 1VQ6N 1NK4A 4RODB 2YJFA 3O3GA 5SZTA 3LANA 4YOVA 2HVIA 1HKCA 2GWKA 4A5BA 1S5JA 4YDUA 5C2DA 3UKRA 3TDHA 3CWAA 1NK6A 1HNZK 1YXQA 3HP6A 4CZLA 1HNIA 4OKEA 3K5OA 4CD3A 3K5LA 3OBWA 3TSUA 3DRSA 3H1QA 2HNZA 3SUQA 3OYLA 3C7NA 3ZYYX 2OZMA 2W6LA 1NOZA 2O8CA 4FVMA 4WQ5C 4CZEA 3HL8A 4H4OA 1WJWA 5IYDP 1ASUA 4KHWA 2XY6A 3P1GA 4BRGA 3KK3A 4BRNA 4CGDA 2KLAA 1VAZA 3O9QA 3KTQA 3PMGA 3EN9A 3AVIA 3RSEB 1FJGK 3NVKA 4ISFA 4CBUA 3FE1A 4CK2A 3W3DA 4AHRA 4EP4A 1QZ6A 3SCXA 1S1XA 5JMVD 2PY5A 5FRNA 3BGRA 4X64K 1VQPN 4C8OA 2NZTA 1EP4A 4F2RA 3TTCA 3HPHA 3R1XA 4B9NA 1HQUA 3AVFA 2X6NA 2Q0UA 1M5Q1 3K57A 4CHQA 4DHYA 2G8FA 4PKIA 4DKWA 1ZXOA 1BOTO 2V7YA 2IAJA 3IDHA 3MN6A 4B1ZA 3KJVA 4BRKA 2NLXA 3C6TA 3CCQN 3O8MA 4BR0A 2NOIA 4FLXA 1GOCA 3H46O 1EO1A 4B3TK 1UA0A 3DLBA 4CI6A 1TKXA 3ZSZA 3KLFA 5IT9O 3NGIA 1RM1A 3TPQA 1YJNN 1QSLA 2D1KA 4GVMA 2Q3SA 4RW6A 3P39A 1SKSA 1TGHA 1QQCA 1G99A 4DQ8A 5EPCA 2O8DB 5AQJA 1WAFA 4C7PA 1IKYA 2Z1JA 3BY5A 4AH9A 3CM6A 1YQRA 1J53A 3QNNA 3OYKA 3OYCA 2F9TA 1QNEA 4HCBA 1VSDA 4BC5A 2UUAK 3OC3C 3F9KA 3JYTA 2VGMA 4IG3A 2GX9A 1WBDA 4CEEA 5M1NA 4CK1A 1J9AA 2JWKA 2F7TA 3WT0A 4KREA 4IEIA 1VSKA 3DYAA 4I6MB 3AA5X 4CZFA 4PUOA 3KWGA 4M42A 1NGHA 2FSKA 4DF4A 1NGCA 3VQAA 4J2BA 3F0ZA 1BA0A 3HM9A 4BRHA 2J4RA 3THWB 3ZSXA 4W5TA 3VQQA 1KSPA 4BRIA 5EOYA 4BREA 4H0TB 1T05A 1MA9B 3M1FA 5DM7L 3OYNA 4Z4IA 1FKPA 4KH5A 4IEEA 3BF3A 4E89A 1OH5A 4A59A 3L4IA 3DMJA 3G4SN 2XO7A 3ID8A 4WXAA 3JAMO 4V19S 1KRPA 1J3MA 3BP8A 4GKKK 5M1QA 3V1OA 3MXIA 4AM6A 3CW7A 1FW6A 3LM2A 4JV5K 1QNBA 4FJXA 2VG7A 1I3AA 1LOTB 5KTQA 3PX6A 4FK4A 2QWOA 4DR2K 1NKEA 4PKGA 1HPZA 1L3UA 3VQPA 4IO8A 2QKKA 4CE9A 4DV4K 1LWWA 2BE2A 3PSFA 4BRCA 2BGGA 3G0ZA 2QW9A 3ZX3A 4BWJA 4FPAA 1S22A 4IZ9A 1T8EA 2P5OA 4W5NA 1KTQA 4CJ5A 4M7XA 4DTPA 2ATQA 3PUFA 3VTHA 2Y1JA 2FUVA 1GLCG 3ZSQA 2E5LK 3KLHA 3TAGA 3VEXA 3ZETA 1OKJA 4FJIA 4IDKA 3UIQA 3NE6A 4I2PA 3AO5A 4CJQA 3OH6A 3UB5A 3MX2A 4CJUA 3KWIA 3D2FB 4LF6K 1K8AO 2UU9K 3ZT3A 2NOZA 2P9NB 1ILYA 4C8NA 4CFDA 1BA1A 3NGYA 3E1YA 3VQEA 1SUQA 4NLBA 2E20A 1ZYQA 5JLHA 3QEWA 3AA3A 1K73O 3HYFA 2VYPA 3VENA 4LF9K 5AQMA 2D0BA 2H5AX 1U45A 3M8PA 5HRNA 1IBMK 3J7ZO 2P9KA 1YJ9N 4FWRA 1U4BA 3O6WA 3MCPA 1JLFA 2HF4A 1RNHA 3VQBA 1NK5A 4CF2A 4CJSA 5GINA 5BR8K 3O4WA 3DOLA 3G10A 3GBTA 4KPYA 3LP0A 3SJHA 4DR5K 4FL9A 3W0LA 1M1KO 3O9UA 3C7NB 3AARA 5J1EA 1XUPO 2A41A 2QWMA 4QS9A 3OHRA 4CCHA 5AQFA 1KVBA 4OLBA 3E66A 1MP9A 3PLAA 5C25A 5CE3A 1HKGA 2P9NA 3I55N 3UKUA 3ZT0A 2IV8A 1C6VA 2ZJPL 3U6FA 3QNOA 2UUCK 1J5EK 1JL1A 1DGKN 3RMAA 2HL9A 4H0YB 4E1MA 2FKFA 1KVCA 1T44A 2PBDA 1LWCA 3NA5A 4BACA 2NLVA 3ATUA 3NF8A 1NK8A 5E41A 5KPTA 1QE1A 3OYHA 4DLGA 2O8EA 2HHQA 3VA0A 1TVRA 5AQKA 4FSVA 1IBLK 4WFAL 2KZZA 4AHVA 3THXB 3RR8A 3VGMA 2P1JA 4XEIA 1YHQN 2OYQA 3SBTA 1E4FT 3U8XA 4MFBA 4OX9K 3JS6A 1H1VA 4H8KA 4DQIA 1RILA 4CJWA 1Q86O 2IIRA 1TAQA 3CFRA 1V4TA 2Q1NA 3I8BA 5C0YA 1HNXK 3GDQA 4PQUA 3EIKA 1YTUA 2Z8UA 1W9HA 2WUSA 2HHWA 1HNVA 3D7EO 4JK8A 1YQKA 1ATNA 1KAXA 1W80A 4N47A 5LJWA 2O8EB 4KH4A 5AQPA 3K5MA 1ZBFA 4FXDA 1S9GA 4CZJA 4HUFA 4E3SA 2G8IA 3DI6A 1YF5L 2IVPA 1JLAA 3KK2A 4BR4A 3VEVA 4FCYA 1DKGD 1DEJA 3VEOA 2GTDA 4H5RA 4OGEA 1T6CA 5AN4A 4O8UA 3VPZA 3V81A 3GE1A 5C24A 4KTWA 4B9UA 3A2FA 2OTLN 4DR6K 3TI0A 2QKBA 2NNWA 1WSGA 2E2QA 5C2FA 4FJ7A 3J80O 1P5DX 4N76A 3AO4A 1D9DA 2NRVA 2I7NA 2Q2RA 2P51A 3KZBA 2E6MA 3VQ5A 3SPYA 1YITN 2E6LA 1LXTA 1E42A 1UA1A 4B9TA 3L0QA 2FBYA 3VEWA 4BRDA 5JVHL 2AA4A 4XH1A 3LDLA 1B92A 3RPJA 4LD0A 3M8RA 1YI2N 3AVNA 3IAYA 4FOIA 2QLVA 3I33A 4EAIA 3OS1A 5IYBP 4DTJA 3FR0A 3C94A 4I2QA 3BUZB 3CPWM 3CCLN 4FW2A 4O55A 3R6MA 5EU7A 1JLEA 1NG9A 2O8DA 1WN7A 1K2YX 2WONA 2O8BA 1KYDA 1YQLA 3FGUA 3HI0A 1BG3A 4FWNA 4U67L 4G9ZA 1QQMA 1U2VB 2DY4A 1RDBA 1VSMA 3EAYA 2NRXA 3CJ9A 2F96A 3O3HA 1SKRA 3C6HA 3VQCA 2YJEA 1RTDA 4DQQA 4OKJA 3OVNA 3U4LA 3D7QA 1QVGM 3ENBA 4I9LA 3ZCMA 4ZTJA 4H0VB 5HRRA 3CETA 1IG9A 4BVOA 4HTLA 1GOBA 4IO9L 1REVA 3THWA 3P5JA 2X6SA 3FZFA 1NK0A 1QVFM 4F3TA 1N39A 1NK7A 4DSLA 2MZ8A 4JHDB 4RG8A 3TARA 2W42A 3L2QA 5J2PA 1C0FA 1N3AA 4EAJA 3Q7BA 3VF6A 1C1AA 4E19A 2W41A 5TKYA 4UQGA 3A5NC 4IBNA 3B6OA 4H0PA 4NYNA 1L5UA 4WE1A 4NXNK 4FWLA 4N5SA 1BIUA 4LSNA 5HRSA 3M8QA 3MEDA 3IG1A 1T03A 3PX0A 3RWUA 4CIGA 4AF1A 1RDDA 4KHQA 1QN3A 1W97L 4L8RB 4DU4A 3LALA 5AQIA 3DXMB 4NO7A 4K25A 3KK7A 4H5VA 4MO4A 3CCRN 4BROA 1IBKK 3T1YK 3L4QA 3SK3A 4CGGA 1GLJO 4H5TA 4E7IA 2RE2A 4JI8K 1EWRA 1IKWA 3D0PA 1YT3A 4FM0A 1WBBA 3FFIA 1MU2A 2HBLA 4ELVA 1PVSA 2F7LA 2NRHA 3AVCA 4B1UB 3AO1A 5BPLA 3F9MA 1KAYA 4EAHD 3K9JA 4FW1A 4B9MA 1NGAA 1QNCA 1HNWK 1YUWA 2XRIA 3D6RA 1TGOA 3RMDA 5C10A 4CHNA 1RT1A 1E4GT 1DLOA 1L3VA 1SKWA 4K8ZA 2KFZA 3ZEUA 2KZMA 3QB0A 2HZMA 4C8LA 2JLEA 1N34K 2FKMX 3SAHA 4FWSA 4YOTA 5M1KA 3OGDA 1WB9A 2HF3A 3VA3A 1NLVA 1TKZA 1Z6RA 5CZ1A 4LFCK 4IWVA 3CWUA 1KVAA 4DTNA 3HXMA 4UY8O 4LY7A 4EIAA 1U6ZA 3WUHA 1VTLE 4WX8A 3MMVA 5GIOA 3JXUA 3C6UA 2V8QA 4E7HA 3OJUA 1W0HA 4B0AA 4JK9A 4OO1J 1QN7A 1N3CA 5DK5A 4YY3K 3AVHA 3ID6A 3EE9A 3NGZA 4F2SA 1NVPA 3UKRB 1XMOK 3D4VA 3A0IX 3NFAA 4DFKA 3R8EA 2E4LA 3NVMA 1S6PA 2I5JA 2HL8A 4TSXA 4B8AB 5AQVA 3HZ6A 4DV2K 1VQON 3VQ9A 3IMXA 1X9WA 1Q7YO 4EZ6A 3T69A 3S9HA 4BRLA 2O4IA 4WQ5A 5KPZA 4JKGB 3PV8A 3WNFA 2PFUA 1TUUA 3OY9A 3EY1A 5DMRA 5BRFA 4CJKA 3AO2A 3SQ0A 3IUCA 2G8UA 3V1QA 2KFNA 4B9SA 3QIPA 4DQRA 1XC3A 3RTVA 5J2MA 1WQAA 2LAEA 1KLMA 3MEGA 1C1BA 5AQGA 4BG8A 4N41A 5KRTA 4RTFD 4KHYA 1NWKA 3VQ8A 2IDOA 3M5RA 3LAMA 1NKCA 4ROEB 2P9IB 4D7QA 3SQ2A 3O5BA 2PAVA 3DXKA 4RCHA 4WQ4C 2NOLA 2FBTA 1BL3A 4CEQA 3G71N 1N32K 4FM1A 3LP1A 3OH9A 4K42A 1RT7A 4A2BA 4DQPA 2ITMA 4W5QA 3S3OA 4YDUC 4B9QA 2IV9A 2XHBA 2Y1IA 3I8DA 4F9OA 3N4PA 2YNIA 4A5AA 2UYTA 3IFRA 4IG0A 5FDLA 2HHUA 2DPNA 4EAKA 5CYMA 3OYAA 4FJGA 4KHSA 3MN5A 2B6AA 3JSMA 2Z1IA 3E01A 1NJZA 3LPTA 1RT4A 4JK7A 1HX1A 1QQNA 3K9KA 1Q9UA 2QWPA 3D2EA 1GOAA 1J54A 3I0WA 3AO3A 4JKFA 5F2RA 1NGGA 1RT5A 2HB5A 2OPRA 1Y97A 4JYAK 2F4VK 5AR0A 4HCCA 4BY9C 1TV6A 1TUOA 2QWQA 1HUXA 5T7BA 5F1XA 3BF1A 4F4KA 1TL1A 4FJNA 2OOYA 3WNGA 4IOAL 3L2VA 3HSCA 2CGLA 1JKHA 1VK0A 4CFFA 2QI2A 4NLCA 2D5RA 4FLUA 4HWIA 2IC3A 4CERA 3BZCA 4OPKA 2OOXA 1VHXA 2QEXN 3CJ1A 3G25A 3AVMA 1VQ9N 4C1NI 4CEDA 2Q36A 1CXQA 4WFBL 2VQEK 2YNGA 2P9UB 2YA3A 1D9FA 3D2FA 1EX4A 1RDUA 3EKSA 1J6ZA 1X9JA 4BE2A 1ZBLA 2I7PA 2DFFA 3DOKA 3AY9A 1Q81O 1LWFA 3E9PA 2ITGA 1P90A 4CEAA 4BGBA 1NK9A 3PO5A 4B1WB 3HTVA 1V4SA 3J7YP 4BRQA 3EZ5A 3T1AA 3VQ6A 4LF5K 4J2EA 1MDUB 3MCAB 2WBNA 3N4QA 2P9LA 5LMNK 4MQ3A 5GAGP 5EY4A 1NGFA 2HSTA 4M3RA 3AAQA 3RRHA 4JNEA 1U04A 4CK3A 2HNYA 1NKBA 4FK0A 1T6DA 3TTDA 4WYBA 4PHTX 4X66K 4CGJA 4BGAA 2W40A 4DS4A 4I8OA 1LWEA 4MDAA 4CJ4A 4KTQA 3V6DA 1FK9A 1ASWA 2E2NA 1HMVA 3C6AA 1M3QA 3OBYA 1BCMA 1TK5A 1IO2A 4EHUA 3FLCO 1BGXT 5JICA 4PWDA 1NBWA 3WNEA 4BDYA 2D0OA 4CD1A 5CHIA 1TKDA 4NCBA 4R79A 4YOXA 5AZJB 3CC2N 3KLGA 2VG5A 1GLAG 3QEVA 2BANA 3L3UA 4YFUA 4BQZA 2QM1A 4Z4GA 2P9LB 5SWMA 3NCIA 3VEYA 5I3UA 4BC2A 3P31A 2YI1A 3SPZA 2QR1A 5AQZA 1CZ9A 2FC0A 3MDQA 1GLLO 1YTAA 1T7PA 1AISA 5F0XA 4DUYK 1VQ7N 1JLGA 3RSMA 4K43A 1EKEA 2YHBA 4CEBA 3M8SA 2ASPA 1VQLN 2YHWA 3DPTA 3ULEA 5KQ8A 3Q7CA 1LV5A 4J8FA 5KI6A 2W6KA 1HKBA 4BRFA 1QNAA 1TBPA 1RGIA 4MRQA 1U2VA 5AQXA 3VMFB 2KTQA 3ZSWA 4H0OA 1U49A 2G8WA 3MN9A 3CPEA 2DKDA 1R4XA 1HU0A 5I42A 5MLCQ 1K35A 4NB4A 1RTHA 3VGKA 5KL0A 4FJMA 3EKUA 3SUNA 1X9MA 3CQXA 3NF7A 2DFHA 3IH7A 3CXCM 3EO3A 4PY5A 1QN4A 5GAEP 4FYDA 2VG6A 4GV3A 2HHXA 4KB0A 5AZIA 2NOBA 3ENCA 1MWMA 4M3ZA 1BQMA 1SL0A 3CJCA 4CJLA 5J2QA 3AVGA 1SQKA 2O8FA 3EZWA 5GADP 1P8ZA 2FXUA 2PYJA 3KKRA 2JPIA 3V9ZA 3SAGA 1Q9XA 2IGIA 4BRAA 4KHUA 2HW3A 4JRQA 1V5SA 1EQYA 4FJ5A 4AILC 1YTBA 2AJQA 2H3GX 5EVZA 3TSQA 4W5RA 1BQNA 3RRGA 1VTOA 3U3GA 1M3HA 2NRZA 3CJBA 3OYBA 4FJLA 1S3XA 5BPMA 4FLZA 3PIPL 3VQDA 3L3VA 2ZD1A 1S72N 4JN4A 1S6QA 3BEXA 4RW9A 2V52B 1TL3A 2V7ZA 4EAGA 3DXKB 3QICA 4C23A 5AQLA 2DKCA 3TAQA 3LDOA 3QEXA 4N56A 5AQYA 4MLHA 3QIOA 4ILJA 3P83D 3FZHA 1QTMA 2KW4A 1SV5A 1C1CA 3DLKA 3T3FA 1KD1O 5CY4A 2A3ZA 3FZMA 2VQFK 2JOIA 4IOXA 4CJFA 1GLFO 3ZLJA 1Z25A 2OPQA 3SZ2A 3EE8A 3LP3A 2GV9A 2OANA 3OCIA 3LZIA 5GAHP 3CVTA 2FSJA 1CDWA 2BH1A 4O0IA 4HTUA 3VN5A 4GY2B 4EALA 3SMPA 4TPSA 1UT7A 4BR2A 3ZSYA 3QBWA 1JJ2M 4DSKA 4CIFA 3P4IA 1JLQA 3WXKA 1UAXA 1VQKN 1UL7A 3AGRA 3V9SA 3HRGA 5FPDA 1ZC6A 3ENOC 2CH5A 2HZSA 1VSHA 1YIJN 3VETA 3AAPA 3CC4N 5AQWA 3T4NA 2EHGA 2G8KA 2GUIA 3HBTA 1NOYA 3OTOK 3BZKA 3QESA 4B3RK 3HT3A 3TAMA 3ENHA 1MWKA 4OVLA 3V9XA 3CD6N 3NMUA 1U48A 4DR4K 4JI2K 3SUOA 1NGEA 4O5FA 1RCHA 3E9OA 4JKGA 4WF9L 4PL8A 1P5GX 4QS8A 4CW7B 3HO1A 1RTIA 3CMEN 4IXCA 4DG1A 4GNIA 1KO9A 1VOLB 1KYUA 5AQOA 5KQDA 3LDNA 3EYZA 4IKFA 4Q0BA 1EXQA 3NF9A 4E7KA 2HBKA 2VCPA 3PDKA 1EETA 1BWFO 3CQYA 5M1PA 3ZT2A 4CJ7A 3O1BA 2QRCA 4FWKA 1UT4A 5BMPA 3CJAA 2MJ7A 1TYQB 3VTIA 3LM9A 2UXCK 2D0PA 4CJVA 4H4MA 4AQYK 4JKAA 4JI5K 4HVJA 4DU3A 4F3OA 4KO0A 3K5NA 2DFEA 4FZZA 2FF3B 3VEZA 1SS6A 4I7FA 3DPUA 3VQ7A 4FJ9A 4O44A 3MWPA 4M3WA 3KLEA 2Q31A 3HJFA 3MWTA 1JCFA 4BVPA 4CESA 3O4QA 4XH4A 2Z1GA 4DUZK 2VWBA 3ZSOA 4PL7A 2EHBD 4DTXA 1TAUA 4J2DA 1A5XA 1N6QA 2UUBK 4XH5A 1JXBA 3TU5A 2R5XA 1HYZA 3H1VX 4B9VA 4CJEA 2D0CA 1KY7A 4EFHA 2YNFA 3KVGA 2OZSA 1D8YA 4Z4EA 3CCEN 1GLBG 5ELZA 5C12A 4CZGA 1GLEG 1LWVA 5KPRA 5LJVA 4ISGA 2ZJRL 5AFUA 3KHYA 3LWMA 3E9LA 1U47A 2XY5A 3ASMA 1S1VA 2FLOA 4FWPA 3CHWA 3CG7A 5D3GA 1NGMA 2X78A 1X3NA 3R3LA 1J5OA 4K0KK 4E0DA 3TR8A 2GBZA 2X74A 3H3OB 3H08A 4PKHA 3LDSA 2I5WA 1BI4A 3ENOA 3S3NA 1VQMN 3A5MC 2RN2A 4GV6A 4FLWA 4HUGA 2Q0RA 4FJKA 1NJIO 1WSFA 3S3MA 2P9UA 3T1HK 4CBXA 5K14A 2HHTA 5AQQA 4R5PA 4BC3A 1BIZA 1ZBUA 2FF6A 4FPBA 2GEMA 1KQSM 5IWAK 3HPGA 3L6QA 1B9FA 3KD1E 2KQ2A 4JKCA 1X3MA 3TWHA 3QFUA 4EP5A 3TANA 3THYA 1XQSC 4ZTFA 5HRPA 3K0SA 3KLIA 2BTFA 1VQ8N 3H6EA 1HYVA 1R0AA 4OLAA 1R59O 3KIOA 1BI4B 5A2QO 4CHZA 2PYLA 3U9DA 1Q82O 3BDPA 4YORA 4X62K 3PIOL 5E26A 4BG9A 3GL1A 4QOZB 4B08A 5J2NA 1L3SA 4FLYA 2Q97A 4QAGA 2ZFDB 2AP1A 4A61A 4XIUA 4KH6A 1KYFA 1WSJA 2HHSA 3CI5A 4Z0UA 1FN7A 4CJPA 1JXEA 4BDPA 4GMJB 2HVHA 3TAPA 1RBSA 3TTFA 3VF4A 4CHOA 2ZM6K 4E7LA 4DFPA 2HHHK 2HNDA 3PO4A 2RKIA 2QA4N 3VQ4A 1RT3A 1VSIA 3OSEA 4DV7K 5LL6Z 3AV9A 2QXLA 4B3SK 1C9BB 3QDKA 4ROCB 3THVA 2P9PB 4C1NK 4CZIA 4JAXA 3CERA 1NU0A 3HP9A 2ASMA 1RDWX 2V92A 3CC7N 2JWLA 4DMNA 3OYIA 4KAZA 3VF2A 2V51B 4JKBA 4BR7A 4FK2A 2P5GA 1S1WA 2JGUA 4CFBA 1OH6A 4FWQA 1O1WA 3ATVA 3R9PA 5AQNA 1OH8A 3ALYA 4FM2A 2XY8A 3NF6A 4YOYA 1HPMA 3HVTA 4M3YA 4Z4FA 3AVLA 4DV1K 1KFIA 1OH7A 4B1YB 2CH6A 3WQUA 1TK0A 1SZ2A 3GOIA 5HL7L 3AA4A 2HHVA 2LSNA 4DULA 4JI1K 3NH0A 1NH2A 5ADXA 4FLTA 5KRSA
chains in the Genus database with same CATH topology
2B4JA 1M3QA 4OKKA 1BCMA 3RMAA 1TK5A 2FGTA 1ZBIA 4E1MA 4ICLA 4WZSD 1IO2A 1KVCA 4M3UA 1LWCA 1BGXT 4BACA 1I39A 3O3FA 3V9UA 1SL2A 4DFMA 1NK8A 3NF8A 5E41A 4KI6A 1C0TA 1QE1A 1UWBA 3OYHA 4DLGA 3SV4A 3WNEA 4BDYA 3OJSA 4PWDA 3OSTA 2HHQA 1TKTA 1TKDA 3VA0A 1RBUA 3NBPA 4NCBA 1TVRA 3KLGA 2VG5A 3QEPA 2KZZA 4AHVA 3QEVA 2BANA 3L3UA 3RR8A 3QETA 4YFUA 3HVRA 4DFJA 2P1JA 4CFCA 2OYQA 3I0SA 5HROA 1QN6A 4Z4GA 3SQ1A 4M3TA 4EJYA 4MFBA 1G15A 5SWMA 4E1NA 1QHTA 3NCIA 4DF8A 4DQIA 4H8KA 3U3YA 1RILA 4CJWA 5I3UA 1TAQA 3CFRA 4DS5A 1VSFA 3SPZA 1DTQA 4CIEA 2QK9A 3SJJA 1BCOA 1CZ9A 3L2WA 2FC0A 4CHPA 4PQUA 1YTAA 4KTZA 4DTOA 3CM5A 3OYGA 1T7PA 3EIKA 1AISA 1YTUA 2Z8UA 3ISNC 2R7YA 4FLVA 4B9LA 1WSEA 1W9HA 1JLGA 4HHTA 3T19A 2G8VA 1EKEA 1CZBA 2YHBA 4CEBA 1HNVA 4CECA 3M8SA 2IS3A 1N5YA 2HHWA 4KV8A 1YQKA 4N47A 1W80A 3DPTA 1IH7A 1ZBHA 3DRRA 1NJYA 1LV5A 5KI6A 4BE1A 3K5MA 4FXDA 1ZBFA 4LH5A 1S9GA 1QNAA 1TBPA 1B9DA 3AVKA 3QO9A 4HUFA 4E3SA 2XY7A 3KRMA 2G8IA 3DI6A 3ZSWA 4DLEA 1U49A 3OYDA 1KLNA 3KK2A 3SUPA 1JLAA 4DTRA 4FJ8A 4FK4A 2G8WA 1D3UA 4CF1A 4FCYA 4Y1DA 1QN8A 3OYEA 1R4XA 1HU0A 5I42A 5HP1A 3QERA 4I9QA 4OGEA 3NHGA 3DLRA 3NH2A 1HRHA 4CEZA 1RTHA 1VOKA 4E7JA 5AN4A 4B3OA 2YV0X 3ZSRA 2ETJA 4C8MA 5C24A 3V81A 4KTWA 4B9UA 4FJMA 5CZ2A 2D0AA 3SUNA 3A2FA 1X9MA 4CEOA 3NF7A 3TAEA 2DFHA 3TI0A 4ELTA 3IH7A 1WSGA 3K2PA 4KB1A 2YNHA 3SNNA 4PY5A 1QN4A 4CF9A 2F8SA 4GW6A 3ZT1A 4FJ7A 5FROA 4N76A 4FYDA 3AO4A 2VG6A 1D9DA 1XC9A 3CFPA 2HHXA 4KB0A 1VRUA 2O3OA 2P51A 2NOBA 4M41A 1LWYA 4ZHRA 4M3ZA 1BQMA 2E6MA 1SL0A 3VQ5A 2YKNA 4FZXC 3I0RA 3IS9A 3SPYA 1LAWA 2B5JA 4CJLA 5J2QA 2E6LA 3KKSA 4M45A 4CF0A 3AVGA 4OJRA 1E42A 1UA1A 4B9TA 2FBYA 1S1TA 4NYFA 1EBMA 4IFVA 3V4IA 3LZJA 1XI1A 1B92A 3RPJA 4LD0A 1KY6A 4IFYA 3M8RA 3TAFA 2PYJA 3AVNA 3KKRA 3H1ZA 1WSIA 4AHUA 3V9ZA 3IAYA 3SV3A 2FBVA 3LP2A 1Q9XA 4JS5A 2IGIA 1QS4A 5IYBP 3OS1A 4DTJA 4DSEA 1S9EA 4Y1CA 3C94A 4I2QA 4KHUA 4FW2A 4O55A 4CGIA 2HW3A 5EU7A 3ZSVA 4JRQA 1JLEA 1QTPA 4FJ5A 1WN7A 4AILC 1YTBA 2WONA 3DLEA 1KYDA 1QTSA 3MEEA 2AJQA 4W5RA 1YQLA 3V9WA 4JS4A 1BQNA 4AHTA 3RRGA 1VTOA 3F73A 4EZ9A 4RW7A 1M3HA 1RDBA 1VSMA 3U3GA 3O3HA 3OYBA 2F96A 3IRXA 4CFAA 4FLZA 3PX4A 4FJLA 1SKRA 3VQCA 3VQDA 3OS0A 1RTDA 4DQQA 3SQ4A 4OKJA 3OVNA 3HK2A 3L3VA 2IOCA 4I9LA 1VSJA 4DU1A 2ZD1A 3ZCMA 4ZTJA 5HRRA 4CJRA 2VJ0A 1JFIC 1XHZA 1IG9A 1GOBA 1WLJA 1PCZA 1REVA 1S6QA 5CYQA 4DQSA 3P5JA 2X6SA 3HS9A 2RF2A 1X9SA 1NK0A 4RW9A 4F3TA 1TL3A 1N39A 1NK7A 4DSLA 2MZ8A 1WAJA 4DTMA 2Z1HA 2NOEA 4RG8A 3TARA 4PA1A 2W42A 4JLHA 3L2QA 3TAQA 5J2PA 1N3AA 3QEXA 2VWJA 1YQMA 4N56A 4OPJA 1RTJA 3AVBA 3CQ8A 1HYSA 3QIOA 1TBAB 1C1AA 1IKXA 4E19A 3QLHA 4G1QA 3P83D 3OYFA 1QSYA 2YKMA 4KHNA 1QTMA 2KW4A 1SV5A 1C1CA 1JLCA 3DLKA 3DM2A 4LH4A 3OYMA 5CY4A 3T3FA 3MXMA 4RODB 1VRTA 4UQGA 2JOIA 1NK4A 4IBNA 3B6OA 4CJFA 5SZTA 3O3GA 3LANA 4ID1A 1Z25A 4NYNA 1NH2A 2OPQA 3SZ2A 1PZDA 4WE1A 1L5UA 3LP3A 1L3TA 4K8XA 2GV9A 4N5SA 1BIUA 3OCIA 1S5JA 3LZIA 4LSNA 5HRSA 3M8QA 3MEDA 3IG1A 1T03A 3PX0A 1NK6A 3RWUA 4KI4A 4CIGA 1RDDA 3HP6A 4O0IA 1CDWA 1HNIA 4OKEA 3K5OA 4HTUA 1QN3A 3VN5A 4KHQA 4L8RB 4DU4A 3LALA 3K5LA 3K59A 3DRSA 4TPSA 1UT7A 2HNZA 3SUQA 3OYLA 3ZSYA 4DSFA 4BWMA 4M3XA 2OZMA 4DSKA 4CIFA 1JLQA 1NOZA 1UAXA 4FVMA 2QKBA 4B8CA 2A1RA 4CGGA 3HS8A 2G30A 3HL8A 3V9SA 4E7IA 1ASUA 5IYDP 4H4OA 1FXXA 2XY6A 3HSTB 4KHWA 3P1GA 3KK3A 4AHCA 1LW2A 2HZSA 1IKWA 1C0MA 1VSHA 1YT3A 4CGDA 3D0PA 3NDKA 4FM0A 3FFIA 1MU2A 2F8TA 4ELVA 3KTQA 2EHGA 3AVCA 2G8KA 1QSSA 2GUIA 3AO1A 3O4NA 3AVIA 4LSLA 1NOYA 5HBMA 3MECA 2YH5A 4CHYA 3QESA 4FW1A 4B9MA 4CK2A 2OPPA 1K6YA 4AHRA 3OYJA 4EP4A 1QNCA 3SCXA 1S1XA 2XRIA 3KD5E 2PY5A 3HT3A 1BHLA 3BGRA 1SL1A 5FRNA 3TAMA 4C8OA 1EP4A 4CJ3A 4F2RA 1TGOA 4BDZA 3HPHA 3CFOA 3RMDA 4B9NA 1HQUA 4OVLA 1RDCA 3V9XA 3AVFA 2KTQA 2ZQBA 2X6NA 4CHNA 1RT1A 1U48A 2OA8A 1DLOA 1ITGA 4J2AA 1L3VA 3K57A 1A5WA 4CHQA 3OS2A 3SUOA 1RCHA 1SKWA 2G8FA 4K8ZA 2KZMA 2KFZA 3HO1A 2HZMA 4C8LA 1RTIA 2IAJA 2JLEA 3KJVA 4DG1A 1KO9A 1VOLB 1KYUA 3C6TA 3VA3A 5CZ1A 1TKZA 3SNSA 3EYZA 4IKFA 4Q0BA 1EXQA 3RMBA 3NF9A 4E7KA 1KVAA 4DTNA 2NOIA 1RT2A 1EETA 4FLXA 1GOCA 3HXMA 3ZT2A 4O4GA 4LY7A 1UA0A 1IKVA 1VTLE 4DTSA 1UT4A 3DLBA 1FKOA 2MJ7A 1TKXA 1Q8IA 3C6UA 4E7HA 3OJUA 1W0HA 3ZSZA 3KLFA 3NGIA 1RM1A 3KK1A 1QSLA 4CJVA 4H4MA 4DTUA 4GVMA 1TK8A 4B0AA 2Q3SA 4RW6A 4Z4CA 3LPUA 2YHAA 1QN7A 1N3CA 1SKSA 1TGHA 1QQCA 5DK5A 3ULDA 4HVJA 2HVIA 3KTUA 4DU3A 4F3OA 4KO0A 1WAFA 4W5OA 3AVHA 3K5NA 1IKYA 2DFEA 2Z1JA 4AH9A 3CM6A 1YQRA 1J53A 3NGZA 4I7FA 4F2SA 1Z26A 3QNNA 3DPUA 3VQ7A 1NVPA 2OPSA 4O44A 3OYCA 3OYKA 1RBVA 4FJ9A 3KLEA 4M3WA 3DRPA 3ULXA 1QNEA 3NFAA 5JS2A 1VSDA 4DFKA 4HCBA 3HJFA 4CESA 3OC3C 2E4LA 3F9KA 3O4QA 1HJRA 3JYTA 1S6PA 2I5JA 2Z1GA 4FZZA 4IG3A 4TSXA 3ZSOA 4B8AB 1HQEA 4CEEA 3VQ9A 4CK1A 4DTXA 1TAUA 1X9WA 1NJWA 4EZ6A 1J9AA 4J2DA 1A5XA 3S9HA 1N6QA 2PZSA 2O4IA 1JXBA 4KREA 3PV8A 1VSKA 3DYAA 3WNFA 1CLQA 1HYZA 3OY9A 3EY1A 3F10A 5DMRA 4CJKA 3AO2A 3AA5X 4CJEA 3SQ0A 2G8UA 2D0CA 4B9VA 3V1QA 1KY7A 4FZYA 4B9SA 4PUOA 2YNFA 4M42A 2KFNA 4AHSA 2OZSA 4KRFA 1D8YA 4Z4EA 4DF4A 1KFDA 3QIPA 5HLFA 3VQAA 2NOFA 4DQRA 3ZT4A 4J2BA 3F0ZA 3K58A 1JLBA 3HM9A 3RTVA 4Z4HA 5J2MA 1LWVA 2LAEA 3ZSXA 4FJJA 2XHIA 1KLMA 3MEGA 3ITHA 4W5TA 1C1BA 3NH1A 3VQQA 3C95A 3TABA 1KSPA 1T05A 3PY8A 1XWLA 1VSLA 5KRTA 3L2RA 3LWMA 2XY5A 1U47A 3ASMA 1S1VA 2EX3A 4KHYA 1X1PA 3OYNA 4Z4IA 1FKPA 3VQ8A 2IDOA 2WOMA 4ID5A 3CG7A 2FBXA 4E89A 3LAMA 1NKCA 5D3GA 1NGMA 4ROEB 2NOHA 2X78A 3DMJA 1YVUA 3QINA 4CF8A 3SQ2A 1J5OA 2XO7A 4E0DA 3TR8A 1KRPA 2GBZA 2NOLA 2FBTA 3NAEA 2X74A 1BL3A 3H08A 4CEQA 1VSEA 3LDSA 3LWLA 2I5WA 1BI4A 5KGXA 1RBTA 4FM1A 3AVAA 3S3NA 2HMIA 2DTUA 3LP1A 4FJHA 3D45A 2RN2A 3V1OA 3MAQA 3CYMA 1KCFA 1KFSA 4OGCA 4FLWA 4HUGA 3MXIA 2NUBA 1RT7A 4DQPA 3AA2A 4FJKA 4W5QA 1QNBA 3S3OA 1WSFA 3S3MA 2VG7A 1I3AA 4FJXA 2IV9A 4KKOA 5K14A 4R5PA 2XHBA 2Y1IA 1BIZA 1ZBUA 2HHTA 3RR7A 3I8DA 1RT6A 1CXUA 5KTQA 4Q11A 3I0XA 3PX6A 3HPGA 1JL2A 2YNIA 3SYZA 1NKEA 1Q9YA 2G8HA 1YTFA 1HPZA 1B9FA 1L3UA 3KD1E 1WSHA 3VQPA 2KQ2A 4IG0A 4DWIA 5FDLA 2QKKA 2HHUA 3LAKA 4CE9A 1LWWA 2BE2A 4O5BA 5CYMA 3OYAA 4FJGA 4KHSA 3QEIA 2BGGA 2B6AA 3G0ZA 4C8KA 3JSMA 3TWHA 4ELUA 2Z1IA 3E01A 4BWJA 4EP5A 3TANA 4BE0A 1NJZA 3LPTA 4ZTFA 1T8EA 4RW8A 5KGWA 5HRPA 2P5OA 1RT4A 2DY4A 1KTQA 4W5NA 4KFBA 4CJ5A 4DTPA 3KLIA 1GOAA 1F21A 2ATQA 3PUFA 2VWKA 3ZSQA 2Y1JA 3KLHA 1J54A 1HYVA 3I0WA 3TAGA 4CJTA 3AO3A 1R0AA 4OLAA 1RDAA 4FJIA 2HB5A 1RT5A 3KIOA 4IDKA 3UIQA 2OPRA 3NE6A 1BI4B 1Y97A 4I2PA 3AO5A 4CHZA 4CJQA 3RMCA 4QCLA 2PYLA 5JS1A 2BDPA 3BDPA 3DLGA 4CGFA 4HCCA 4DSJA 4CJUA 1TV6A 4QOZB 4B08A 5T7BA 5J2NA 4F4KA 1TL1A 4FLYA 1L3SA 4FJNA 4QAGA 4Q5VA 3N89A 3ZT3A 3OSMA 3SI6A 4NCGA 2NOZA 4JRPA 4XIUA 3WNGA 4C8NA 4CEFA 4CFDA 3L2VA 4NCAA 1JKHA 1KYFA 1NJXA 1VK0A 1WSJA 3NGYA 2HHSA 3VQEA 2D5RA 1SUQA 1ZYQA 4Z0UA 4FLUA 3QEWA 1FN7A 3AA3A 4CJPA 1JXEA 4BDPA 4DSIA 4GMJB 2IC3A 2HVHA 1QN9A 3HYFA 4CERA 3AVJA 3TAPA 4OPKA 1C0UA 1RBSA 3HPOA 2D0BA 5C42A 1U45A 1S1UA 3M8PA 5HRNA 3AVMA 4CHOA 4E7LA 4CEDA 4DFPA 1DTTA 1CXQA 5FRMA 1U4BA 2HNDA 3PO4A 2RKIA 2YNGA 3VQ4A 1D9FA 2A1SA 1RT3A 1EX4A 1VSIA 1JLFA 2ZE2A 1RBRA 1RNHA 3AV9A 2QXFA 3V1RA 3VQBA 3L8BA 3DLHA 4O0JA 4BE2A 4RW4A 4CGHA 1ZBLA 1NK5A 4CF2A 2DFFA 4CJSA 1C9BB 3DOKA 4ROCB 3THVA 1LW0A 1LWFA 3DOLA 3G10A 2ITGA 4KPYA 3LP0A 4CEAA 3L2UA 4HUEA 1NK9A 3HP9A 4N41A 5IYCP 1ASVA 3PO5A 3WNHA 1UOCA 3EZ5A 1XHXA 3T1AA 4DMNA 3OYIA 3B6PA 5J1EA 3VQ6A 1LAVA 4KAZA 4J2EA 4CCHA 1BISA 4FK2A 2P5GA 1S1WA 2JGUA 4CFBA 1KVBA 4OLBA 4MQ3A 1O1WA 4F8RA 1QN5A 1D5AA 3ALYA 2RPIA 1MP9A 4FM2A 4M3RA 2XY8A 3RRHA 3NF6A 1U04A 5C25A 3HVTA 2HNYA 4CK3A 1NKBA 4M3YA 3AVLA 4Z4FA 4FK0A 1TK0A 2O4GA 3ZT0A 2IV8A 1C6VA 4CGJA 2HHVA 3AA4A 3U6FA 4DS4A 4I8OA 1LWEA 4CJ4A 3QNOA 4KTQA 1WNSA 1A5VA 3V6DA 2LSNA 4DULA 4EJZA 1FK9A 1ASWA 3MXJA 1B9KA 3NH0A 4YNQA 1JL1A 4FLTA 1HMVA 5KRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B4J A;  4OKK A;  1BCM A;  3RMA A;  1TK5 A;  1ZBI A;  4E1M A;  4ICL A;  4WZS D;  1IO2 A;  1KVC A;  4M3U A;  1LWC A;  1BGX T;  4BAC A;  1I39 A;  3O3F A;  3V9U A;  1SL2 A;  4DFM A;  1NK8 A;  3NF8 A;  5E41 A;  4KI6 A;  1C0T A;  1QE1 A;  1UWB A;  3OYH A;  4DLG A;  3SV4 A;  3WNE A;  4BDY A;  3OJS A;  4PWD A;  2HHQ A;  1TKT A;  1TKD A;  3VA0 A;  1RBU A;  3NBP A;  4NCB A;  1TVR A;  3KLG A;  2VG5 A;  3QEP A;  2KZZ A;  4AHV A;  3QEV A;  2BAN A;  3L3U A;  3RR8 A;  3QET A;  4YFU A;  3HVR A;  4DFJ A;  2P1J A;  4CFC A;  2OYQ A;  3I0S A;  5HRO A;  1QN6 A;  4Z4G A;  3SQ1 A;  4M3T A;  4MFB A;  5SWM A;  1G15 A;  4DF8 A;  4E1N A;  1QHT A;  3NCI A;  4DQI A;  4H8K A;  3U3Y A;  1RIL A;  4CJW A;  5I3U A;  1TAQ A;  3CFR A;  4DS5 A;  1VSF A;  3SPZ A;  1DTQ A;  4CIE A;  2QK9 A;  3SJJ A;  1BCO A;  1CZ9 A;  3L2W A;  2FC0 A;  4CHP A;  4PQU A;  1YTA A;  4KTZ A;  4DTO A;  3CM5 A;  3OYG A;  1T7P A;  3EIK A;  1AIS A;  1YTU A;  2Z8U A;  3ISN C;  2R7Y A;  4FLV A;  4B9L A;  1WSE A;  1W9H A;  1JLG A;  4HHT A;  3T19 A;  2G8V A;  1EKE A;  1CZB A;  2YHB A;  4CEB A;  1HNV A;  4CEC A;  3M8S A;  2IS3 A;  1N5Y A;  2HHW A;  4KV8 A;  4N47 A;  1W80 A;  1IH7 A;  1ZBH A;  3DRR A;  1NJY A;  1LV5 A;  5KI6 A;  4BE1 A;  3K5M A;  4FXD A;  1ZBF A;  4LH5 A;  1S9G A;  1QNA A;  1TBP A;  1B9D A;  3AVK A;  3QO9 A;  4HUF A;  4E3S A;  2XY7 A;  2G8I A;  2KTQ A;  3DI6 A;  3ZSW A;  4DLE A;  1U49 A;  3OYD A;  4FJ8 A;  3KK2 A;  3SUP A;  1JLA A;  4DTR A;  2G8W A;  1D3U A;  4CF1 A;  4FCY A;  4Y1D A;  1QN8 A;  3OYE A;  1R4X A;  5I42 A;  5HP1 A;  3QER A;  4I9Q A;  4OGE A;  3NHG A;  3DLR A;  3NH2 A;  1HRH A;  4CEZ A;  1RTH A;  1VOK A;  4E7J A;  4B3O A;  2YV0 X;  3ZSR A;  2ETJ A;  4C8M A;  5C24 A;  3V81 A;  4KTW A;  4B9U A;  4FJM A;  5CZ2 A;  2D0A A;  3SUN A;  3A2F A;  1X9M A;  4CEO A;  3NF7 A;  3TAE A;  2DFH A;  3TI0 A;  4ELT A;  1WSG A;  3K2P A;  2QKB A;  4KB1 A;  2YNH A;  3SNN A;  4PY5 A;  1QN4 A;  4CF9 A;  2F8S A;  4GW6 A;  3ZT1 A;  4FJ7 A;  5FRO A;  4N76 A;  4FYD A;  3AO4 A;  2VG6 A;  1D9D A;  1XC9 A;  3CFP A;  2HHX A;  4KB0 A;  1VRU A;  4M41 A;  2P51 A;  4ZHR A;  4M3Z A;  1BQM A;  2E6M A;  1SL0 A;  3VQ5 A;  2YKN A;  4FZX C;  3I0R A;  3IS9 A;  3SPY A;  1LAW A;  2B5J A;  4CJL A;  5J2Q A;  2E6L A;  3KKS A;  4M45 A;  4CF0 A;  3AVG A;  4OJR A;  1E42 A;  1UA1 A;  4B9T A;  2FBY A;  1S1T A;  4NYF A;  4IFV A;  3V4I A;  3LZJ A;  1XI1 A;  1B92 A;  4LD0 A;  3M8R A;  1KY6 A;  4IFY A;  3TAF A;  2PYJ A;  3AVN A;  3KKR A;  3H1Z A;  1WSI A;  4AHU A;  3V9Z A;  3IAY A;  3SV3 A;  2FBV A;  3LP2 A;  1Q9X A;  4JS5 A;  2IGI A;  1QS4 A;  5IYB P;  3OS1 A;  4DTJ A;  4DSE A;  1S9E A;  4Y1C A;  3C94 A;  4I2Q A;  4KHU A;  4FW2 A;  4O55 A;  4CGI A;  2HW3 A;  5EU7 A;  3ZSV A;  4JRQ A;  1JLE A;  1QTP A;  4FJ5 A;  1WN7 A;  4AIL C;  1YTB A;  2WON A;  3DLE A;  1KYD A;  1QTS A;  3MEE A;  2AJQ A;  4W5R A;  3V9W A;  4JS4 A;  1BQN A;  4AHT A;  3RRG A;  1VTO A;  3F73 A;  4EZ9 A;  4RW7 A;  3U3G A;  1RDB A;  1VSM A;  3O3H A;  3OYB A;  1KLN A;  2F96 A;  3IRX A;  4CFA A;  4FLZ A;  3PX4 A;  4FJL A;  1SKR A;  3VQC A;  3VQD A;  3OS0 A;  1RTD A;  4DQQ A;  3SQ4 A;  4OKJ A;  3OVN A;  3HK2 A;  3L3V A;  2IOC A;  4I9L A;  1VSJ A;  4DU1 A;  2ZD1 A;  3ZCM A;  4ZTJ A;  5HRR A;  4CJR A;  2VJ0 A;  1JFI C;  1XHZ A;  1IG9 A;  1GOB A;  1WLJ A;  1PCZ A;  1REV A;  1S6Q A;  5CYQ A;  4DQS A;  3P5J A;  2X6S A;  3HS9 A;  2RF2 A;  1X9S A;  1NK0 A;  4RW9 A;  4F3T A;  1TL3 A;  1NK7 A;  4DSL A;  1WAJ A;  4DTM A;  2Z1H A;  4RG8 A;  3TAR A;  4PA1 A;  2W42 A;  4JLH A;  3L2Q A;  3TAQ A;  5J2P A;  3QEX A;  2VWJ A;  4N56 A;  4OPJ A;  1RTJ A;  3AVB A;  3CQ8 A;  1HYS A;  3QIO A;  1TBA B;  1C1A A;  1IKX A;  4E19 A;  3QLH A;  4G1Q A;  3P83 D;  3OYF A;  1QSY A;  2YKM A;  4KHN A;  1QTM A;  2KW4 A;  1SV5 A;  1C1C A;  1JLC A;  3DLK A;  3DM2 A;  4LH4 A;  3OYM A;  5CY4 A;  3T3F A;  3MXM A;  4ROD B;  1VRT A;  4UQG A;  1NK4 A;  4IBN A;  3B6O A;  4CJF A;  5SZT A;  3O3G A;  3LAN A;  4ID1 A;  1Z25 A;  4NYN A;  1NH2 A;  2OPQ A;  3SZ2 A;  1PZD A;  4WE1 A;  1L5U A;  3LP3 A;  1L3T A;  4K8X A;  2GV9 A;  4N5S A;  1BIU A;  3OCI A;  1S5J A;  3LZI A;  4LSN A;  5HRS A;  3M8Q A;  3MED A;  3IG1 A;  1T03 A;  3PX0 A;  1NK6 A;  3RWU A;  4KI4 A;  4CIG A;  1RDD A;  3HP6 A;  4O0I A;  1CDW A;  1HNI A;  4OKE A;  3K5O A;  4HTU A;  1QN3 A;  3VN5 A;  4KHQ A;  4L8R B;  4DU4 A;  3LAL A;  3K5L A;  3K59 A;  3DRS A;  2HNZ A;  3SUQ A;  3OYL A;  3ZSY A;  4DSF A;  4BWM A;  4M3X A;  2OZM A;  4DSK A;  4CIF A;  1JLQ A;  1NOZ A;  1UAX A;  4FVM A;  4B8C A;  2A1R A;  4CGG A;  3HS8 A;  2G30 A;  3HL8 A;  3V9S A;  4E7I A;  1ASU A;  5IYD P;  4H4O A;  1FXX A;  2XY6 A;  3HST B;  4KHW A;  3P1G A;  3KK3 A;  4AHC A;  1LW2 A;  1IKW A;  1C0M A;  1VSH A;  1YT3 A;  4CGD A;  3D0P A;  4FM0 A;  3NDK A;  3FFI A;  1MU2 A;  2F8T A;  4ELV A;  3KTQ A;  2EHG A;  3AVC A;  2G8K A;  1QSS A;  2GUI A;  3AO1 A;  3O4N A;  3AVI A;  4LSL A;  1NOY A;  5HBM A;  3MEC A;  4CHY A;  3QES A;  4FW1 A;  4B9M A;  4CK2 A;  2OPP A;  1K6Y A;  4AHR A;  3OYJ A;  4EP4 A;  1QNC A;  3SCX A;  1S1X A;  2XRI A;  3KD5 E;  2PY5 A;  3HT3 A;  1BHL A;  3BGR A;  1SL1 A;  5FRN A;  3TAM A;  4C8O A;  1EP4 A;  4CJ3 A;  4F2R A;  1TGO A;  4BDZ A;  3HPH A;  3CFO A;  3RMD A;  4B9N A;  1HQU A;  4OVL A;  1RDC A;  3V9X A;  3AVF A;  2ZQB A;  2X6N A;  4CHN A;  1RT1 A;  1U48 A;  2OA8 A;  1DLO A;  1ITG A;  4J2A A;  1L3V A;  3K57 A;  1A5W A;  4CHQ A;  3OS2 A;  3SUO A;  1RCH A;  1SKW A;  2G8F A;  4K8Z A;  2KZM A;  2KFZ A;  3HO1 A;  4C8L A;  1RTI A;  2IAJ A;  2JLE A;  3KJV A;  4DG1 A;  3C6T A;  1VOL B;  1KYU A;  3VA3 A;  5CZ1 A;  1TKZ A;  3EYZ A;  4IKF A;  4Q0B A;  1EXQ A;  3RMB A;  3NF9 A;  4E7K A;  1KVA A;  4DTN A;  1RT2 A;  1EET A;  4FLX A;  1GOC A;  3HXM A;  3ZT2 A;  4O4G A;  4LY7 A;  1UA0 A;  1IKV A;  1VTL E;  4DTS A;  3DLB A;  1FKO A;  2MJ7 A;  1TKX A;  1Q8I A;  3C6U A;  4E7H A;  3OJU A;  1W0H A;  3ZSZ A;  3KLF A;  3NGI A;  1RM1 A;  3KK1 A;  1QSL A;  4CJV A;  4H4M A;  4DTU A;  4GVM A;  1TK8 A;  4B0A A;  2Q3S A;  4RW6 A;  4Z4C A;  3LPU A;  2YHA A;  1QN7 A;  1SKS A;  1TGH A;  1QQC A;  5DK5 A;  3ULD A;  4HVJ A;  2HVI A;  4DU3 A;  4F3O A;  4KO0 A;  1WAF A;  4W5O A;  3AVH A;  3K5N A;  1IKY A;  2DFE A;  2Z1J A;  4AH9 A;  3CM6 A;  1J53 A;  3NGZ A;  4F2S A;  4I7F A;  4FZZ A;  1Z26 A;  3QNN A;  3VQ7 A;  1NVP A;  2OPS A;  4O44 A;  3OYC A;  3OYK A;  1RBV A;  4FJ9 A;  3KLE A;  4M3W A;  3DRP A;  1QNE A;  3NFA A;  5JS2 A;  4HCB A;  1VSD A;  4DFK A;  3HJF A;  4CES A;  3OC3 C;  2E4L A;  3F9K A;  3O4Q A;  1HJR A;  3JYT A;  1S6P A;  2I5J A;  2Z1G A;  4IG3 A;  4TSX A;  3ZSO A;  4B8A B;  1HQE A;  4CEE A;  3VQ9 A;  4CK1 A;  4DTX A;  1TAU A;  1X9W A;  1NJW A;  4EZ6 A;  1J9A A;  4J2D A;  1A5X A;  3S9H A;  1N6Q A;  2PZS A;  2O4I A;  1JXB A;  4KRE A;  3PV8 A;  1VSK A;  3DYA A;  3WNF A;  1CLQ A;  1HYZ A;  3OY9 A;  3EY1 A;  5DMR A;  4CJK A;  3SQ0 A;  3AO2 A;  3AA5 X;  4CJE A;  2G8U A;  4B9V A;  2D0C A;  3V1Q A;  1KY7 A;  4FZY A;  4B9S A;  4PUO A;  2YNF A;  4M42 A;  2KFN A;  4AHS A;  2OZS A;  4KRF A;  1D8Y A;  4Z4E A;  4DF4 A;  1KFD A;  3QIP A;  5HLF A;  3VQA A;  4DQR A;  3ZT4 A;  4J2B A;  3K58 A;  1JLB A;  3HM9 A;  3RTV A;  4Z4H A;  5J2M A;  3ZSX A;  4FJJ A;  1KLM A;  3MEG A;  3ITH A;  4W5T A;  1C1B A;  3NH1 A;  3VQQ A;  3C95 A;  3TAB A;  1KSP A;  1T05 A;  3PY8 A;  1XWL A;  1VSL A;  5KRT A;  3L2R A;  3LWM A;  2XY5 A;  1U47 A;  3ASM A;  1S1V A;  2EX3 A;  4KHY A;  1X1P A;  3OYN A;  4Z4I A;  1FKP A;  3VQ8 A;  2IDO A;  2WOM A;  4ID5 A;  3CG7 A;  2FBX A;  4E89 A;  3LAM A;  1NKC A;  5D3G A;  1NGM A;  4ROE B;  2X78 A;  3DMJ A;  1YVU A;  3QIN A;  4CF8 A;  3SQ2 A;  1J5O A;  2XO7 A;  4E0D A;  3TR8 A;  1KRP A;  2GBZ A;  2FBT A;  3NAE A;  2X74 A;  1BL3 A;  3H08 A;  4CEQ A;  1VSE A;  3LDS A;  3LWL A;  1BI4 A;  5KGX A;  3S3N A;  1RBT A;  4FM1 A;  3AVA A;  2HMI A;  2DTU A;  3LP1 A;  4FJH A;  3D45 A;  2RN2 A;  3V1O A;  3MAQ A;  3CYM A;  1KCF A;  1KFS A;  4OGC A;  4FLW A;  4HUG A;  3MXI A;  2NUB A;  1RT7 A;  4DQP A;  3AA2 A;  4FJK A;  4W5Q A;  1QNB A;  3S3O A;  1WSF A;  3S3M A;  2VG7 A;  1I3A A;  4FJX A;  2IV9 A;  4KKO A;  5K14 A;  4R5P A;  2XHB A;  2Y1I A;  1BIZ A;  1ZBU A;  2HHT A;  3RR7 A;  3I8D A;  1RT6 A;  1CXU A;  5KTQ A;  3PX6 A;  4FK4 A;  3HPG A;  1JL2 A;  2YNI A;  3SYZ A;  1NKE A;  1Q9Y A;  2G8H A;  1YTF A;  1HPZ A;  1B9F A;  1L3U A;  3KD1 E;  1WSH A;  3VQP A;  2KQ2 A;  4IG0 A;  4DWI A;  5FDL A;  2QKK A;  2HHU A;  3LAK A;  4CE9 A;  2BE2 A;  4O5B A;  5CYM A;  3OYA A;  4FJG A;  4KHS A;  3QEI A;  2BGG A;  2B6A A;  3G0Z A;  4C8K A;  3JSM A;  3TWH A;  4ELU A;  2Z1I A;  3E01 A;  4BWJ A;  4EP5 A;  3TAN A;  4BE0 A;  1NJZ A;  3LPT A;  4ZTF A;  1T8E A;  4RW8 A;  5KGW A;  5HRP A;  2P5O A;  1RT4 A;  2DY4 A;  1KTQ A;  4W5N A;  4KFB A;  4CJ5 A;  4DTP A;  3KLI A;  1GOA A;  1F21 A;  2ATQ A;  3PUF A;  2VWK A;  3ZSQ A;  2Y1J A;  3KLH A;  1J54 A;  1HYV A;  1R0A A;  3TAG A;  4CJT A;  3AO3 A;  4OLA A;  1RDA A;  4FJI A;  2HB5 A;  1RT5 A;  3KIO A;  4IDK A;  3UIQ A;  2OPR A;  3NE6 A;  1BI4 B;  1Y97 A;  4I2P A;  3AO5 A;  4CHZ A;  4CJQ A;  3RMC A;  4QCL A;  2PYL A;  5JS1 A;  2BDP A;  3BDP A;  3DLG A;  4CGF A;  4HCC A;  4DSJ A;  4CJU A;  1TV6 A;  4QOZ B;  4B08 A;  5T7B A;  5J2N A;  4F4K A;  1TL1 A;  4FLY A;  1L3S A;  4FJN A;  4QAG A;  4Q5V A;  3ZT3 A;  3SI6 A;  4NCG A;  4JRP A;  4XIU A;  3WNG A;  4C8N A;  4CEF A;  4CFD A;  3L2V A;  4NCA A;  1JKH A;  1KYF A;  1NJX A;  1VK0 A;  1WSJ A;  3NGY A;  2HHS A;  3VQE A;  2D5R A;  1SUQ A;  1ZYQ A;  4Z0U A;  4FLU A;  3QEW A;  3AA3 A;  4CJP A;  1JXE A;  4BDP A;  4DSI A;  4GMJ B;  2IC3 A;  2HVH A;  1QN9 A;  3HYF A;  4CER A;  3AVJ A;  3TAP A;  4OPK A;  1C0U A;  1RBS A;  3HPO A;  2D0B A;  5C42 A;  1U45 A;  1S1U A;  3M8P A;  5HRN A;  3AVM A;  4CHO A;  4E7L A;  4CED A;  4DFP A;  1DTT A;  1CXQ A;  5FRM A;  1U4B A;  2HND A;  3PO4 A;  2RKI A;  2YNG A;  3VQ4 A;  1D9F A;  2A1S A;  1RT3 A;  1EX4 A;  1VSI A;  1JLF A;  2ZE2 A;  1RBR A;  1RNH A;  3AV9 A;  2QXF A;  3V1R A;  3VQB A;  3L8B A;  3DLH A;  4O0J A;  4BE2 A;  4RW4 A;  4CGH A;  1ZBL A;  1NK5 A;  4CF2 A;  2DFF A;  4CJS A;  1C9B B;  3DOK A;  4ROC B;  3THV A;  1LW0 A;  1LWF A;  3DOL A;  3G10 A;  2ITG A;  4KPY A;  3LP0 A;  4CEA A;  3L2U A;  4HUE A;  1NK9 A;  3HP9 A;  4N41 A;  5IYC P;  1ASV A;  3PO5 A;  3WNH A;  1UOC A;  3EZ5 A;  1XHX A;  3T1A A;  4DMN A;  3OYI A;  3B6P A;  5J1E A;  3VQ6 A;  1LAV A;  4KAZ A;  4J2E A;  4CCH A;  1BIS A;  4FK2 A;  2P5G A;  1S1W A;  2JGU A;  4CFB A;  1KVB A;  4OLB A;  4MQ3 A;  1O1W A;  4F8R A;  1QN5 A;  1D5A A;  3ALY A;  2RPI A;  1MP9 A;  4FM2 A;  4M3R A;  2XY8 A;  3RRH A;  3NF6 A;  1U04 A;  5C25 A;  3HVT A;  2HNY A;  4CK3 A;  1NKB A;  4M3Y A;  3AVL A;  4Z4F A;  4FK0 A;  1TK0 A;  2O4G A;  3ZT0 A;  2IV8 A;  1C6V A;  4CGJ A;  2HHV A;  3AA4 A;  3U6F A;  4DS4 A;  1LWE A;  4CJ4 A;  3QNO A;  4KTQ A;  1WNS A;  1A5V A;  3V6D A;  2LSN A;  3MXJ A;  1FK9 A;  1ASW A;  3NH0 A;  1B9K A;  4YNQ A;  1JL1 A;  4FLT A;  1HMV A;  5KRS A; 
#chains in the Genus database with same CATH topology
 2B4J A;  4WCE L;  1ZBI A;  1W7A A;  3OA9 A;  4ICL A;  4IOC L;  4WZS D;  2QTD A;  4M3U A;  4B1X B;  1SL2 A;  4DFM A;  2DKA A;  5BRH A;  1C0T A;  1UWB A;  1D4X A;  1C4G A;  3LDP A;  3OJS A;  3CCV N;  4B1V A;  5FLX O;  3NBP A;  2ZGY A;  3DXM A;  3QEP A;  5JN5 A;  1NMD A;  2CGJ A;  2O8B B;  3C65 A;  5AZI B;  2JHN A;  3HVR A;  2NRT A;  4EJY A;  4DF8 A;  5F9C A;  4L3Q A;  4E1N A;  4DV3 K;  5I9E B;  3F2K A;  1DTQ A;  3SBG A;  4CIE A;  4GV9 A;  3A5O C;  3SJJ A;  2QK9 A;  1WOQ A;  4ILG B;  1NMN A;  4KTZ A;  3BKQ X;  3ISN C;  4B9L A;  5BMN A;  1WSE A;  1NGD A;  4WQ4 A;  4HHT A;  3T19 A;  2G8V A;  1N5Y A;  2IS3 A;  2Y8Q A;  4KV8 A;  1IH7 A;  1ZBH A;  3DRR A;  1NJY A;  5FPE A;  2Z0F A;  3ULE B;  1B9D A;  4M63 C;  4WFN L;  3SUP A;  4DTR A;  2YCH A;  1QHA A;  1D3U A;  2UXB K;  4CF1 A;  1QN8 A;  3OYE A;  5HP1 A;  3NHG A;  3OLP A;  3DLR A;  1HRH A;  2ZWH A;  5CZ2 A;  2D0A A;  4LF8 K;  4CBW A;  4CEO A;  3TAE A;  3K2P A;  5BRD A;  1W2B M;  2YNH A;  4CF9 A;  2F8S A;  2IVO A;  4GW6 A;  3ZT1 A;  3PSI A;  1KXP A;  1XC9 A;  3CFP A;  1JCE A;  2O3O A;  4M41 A;  3LDQ A;  2YKN A;  4JD2 A;  4FZX C;  3I0R A;  4EHT A;  1LAW A;  2B5J A;  4OJR A;  4NYF A;  1EBM A;  4IFV A;  3LZJ A;  2IVN A;  3TAF A;  1KY6 A;  4B3M K;  3DLL L;  3H1Z A;  4AHU A;  2ZJQ L;  3SV3 A;  1HJO A;  1S9E A;  4ILH A;  4Y1C A;  4QS7 A;  5BR9 A;  1IJJ A;  1PCJ X;  3ZSV A;  2KHO A;  1QTP A;  2P9S A;  3MEE A;  4JS4 A;  4AHT A;  4ISE A;  3F73 A;  1O13 A;  4RW7 A;  3IRX A;  3PX4 A;  3OS0 A;  3SQ4 A;  1T6A A;  3RVC A;  4IJN A;  4CJR A;  2VJ0 A;  1JFI C;  4DQS A;  5AQU A;  3HS9 A;  5AFU H;  2RF2 A;  3B8A X;  4DB3 A;  1ATR A;  1QQO A;  5CR4 A;  1WAJ A;  2Z1H A;  2NOE A;  3O9R A;  5AQR A;  1NGB A;  3WQT A;  4JLH A;  3CCJ N;  1JCG A;  1YQM A;  1RFQ A;  5E84 A;  4OPJ A;  1HYS A;  1TBA B;  3OYF A;  4G1Q A;  4FWM A;  3S41 A;  3OYM A;  1JLC A;  3DM2 A;  4LH4 A;  3SAF A;  1VRT A;  3SMS A;  4ID1 A;  4K8X A;  1PZD A;  4H03 B;  1L3T A;  4YOU A;  1EWQ A;  1QZ5 A;  3CCM N;  4DV6 K;  2CGK A;  4KI4 A;  4DV0 K;  3O9S A;  3K59 A;  2PWW A;  3VOV A;  1N33 K;  3HOT A;  2NRR A;  3WEE B;  2E2O A;  4DSF A;  4BWM A;  4M3X A;  2QWN A;  4IDH A;  1TYQ A;  4B8C A;  2A1R A;  3HS8 A;  2G30 A;  3MN7 A;  1FXX A;  3HST B;  4U7B A;  4AHC A;  1LW2 A;  1C0M A;  1C0G A;  3O08 A;  3NDK A;  5AJ3 K;  2F8T A;  3FZL A;  3D2E B;  4LFB K;  1QSS A;  3O4N A;  4KBO A;  2HKP A;  4LSL A;  3U9Z A;  5HBM A;  3MEC A;  2YH5 A;  4CHY A;  3UE5 A;  2OPP A;  1K6Y A;  3OYJ A;  3KD5 E;  1IG8 A;  1SL1 A;  1BHL A;  3HM8 A;  4CJ3 A;  4BDZ A;  3CFO A;  1RDC A;  2ZQB A;  2OA8 A;  4M7Y A;  3WXI A;  1ITG A;  2ZGZ A;  1A5W A;  3OS2 A;  1XNR K;  3CWT A;  1Q18 A;  4Y0W A;  5GIP A;  1KC8 O;  4BRP A;  3SNS A;  3I56 N;  2E2P A;  3WEE A;  3RMB A;  4A2A A;  1RT2 A;  2Y8L A;  5DM6 L;  4O4G A;  3O9T A;  1IKV A;  4DR1 K;  4DTS A;  1FKO A;  1Q8I A;  2YX6 A;  4IJA A;  4OPH A;  3KK1 A;  4BJU A;  4DTU A;  1TK8 A;  4Z4C A;  2E1Z A;  3LPU A;  2YHA A;  3ULD A;  3KTU A;  1WUA A;  5BRE A;  4DCH A;  4W5O A;  3DWL A;  4BR5 A;  1Z26 A;  2OPS A;  4QG5 A;  1RBV A;  4CVN E;  4FWO A;  3DRP A;  3ULX A;  5JS2 A;  2BUP A;  3OW2 M;  1YJW N;  4H0X B;  4JKE A;  1HJR A;  3QML A;  1HQE A;  2NVM A;  1NGI A;  3HOS A;  1NJW A;  4JI7 K;  4CZK A;  2PZS A;  3M6G A;  4FOE A;  5AQT A;  1CLQ A;  3F10 A;  4FZY A;  4JEP A;  4AHS A;  4KRF A;  1PCM X;  1KFD A;  5HLF A;  2NOF A;  2P9I A;  3ZT4 A;  3K58 A;  1JLB A;  4Z4H A;  4FJJ A;  2XHI A;  3C04 A;  3ITH A;  4K41 A;  1Z05 A;  3NH1 A;  3TAB A;  3C95 A;  1XMQ K;  4J2A A;  3PY8 A;  1XWL A;  1VSL A;  3L2R A;  4A62 A;  5C15 A;  4BR9 A;  2GEL A;  2EX3 A;  4YHH K;  1X1P A;  2WOM A;  4ID5 A;  2FBX A;  5JLF A;  2OCE A;  2NOH A;  1XNQ K;  4GVE A;  2NWV A;  1YVU A;  3QIN A;  4CF8 A;  2ZF5 O;  3NAE A;  1VSE A;  3LWL A;  5KGX A;  2A40 A;  1RBT A;  3AVA A;  5JMV A;  2HMI A;  2DTU A;  1NM1 A;  4FJH A;  3D45 A;  1KFS A;  3ZX2 A;  3CYM A;  1KCF A;  3MAQ A;  4OGC A;  1VQ5 N;  1TUY A;  2NUB A;  3AA2 A;  1K9M O;  3TE5 A;  4MLE A;  4KKO A;  4DR7 K;  3RR7 A;  1RT6 A;  1CXU A;  3UKU B;  1C47 A;  4Q11 A;  3I0X A;  3QBX A;  1JL2 A;  4JKH A;  3SYZ A;  1Q9Y A;  2G8H A;  1YTF A;  4AM7 A;  1OVQ A;  1WSH A;  1E3M A;  4JI4 K;  4DWI A;  3LAK A;  4FVU A;  2HOE A;  3G6E N;  4O5B A;  4D7R A;  3QEI A;  4C8K A;  2HBM A;  1ZBS A;  2E1Y A;  4X65 K;  4ELU A;  3MX5 A;  5FPN A;  3UW2 A;  4RW8 A;  5KGW A;  3O1W A;  3I3W A;  4KFB A;  1BO5 O;  2WTU A;  4A57 A;  2OTJ N;  1F21 A;  2VWK A;  4YOW A;  2KKZ A;  4E1J A;  1I94 K;  3VES A;  4CJT A;  2P9P A;  5LY3 A;  1RDA A;  3CIP A;  5JS1 A;  2QRE A;  3RMC A;  4QCL A;  2BDP A;  3DLG A;  4CGF A;  4Z94 A;  4JI0 K;  4DSJ A;  1HR0 K;  2E8A A;  5EXW A;  2UXD K;  4Q5V A;  5HOO A;  1MPG A;  3N89 A;  3OSM A;  3FZK A;  4NCG A;  5BN8 A;  4JRP A;  3CWS A;  3SI6 A;  3THY B;  4CEF A;  4NCA A;  1CZA N;  1NJX A;  4DR3 K;  2EWS A;  3CF5 L;  1BU6 O;  5M1F A;  4DSI A;  1QN9 A;  3AVJ A;  1C0U A;  3HPO A;  5C42 A;  1S1U A;  3IKM A;  5JVG L;  3WXM B;  2JHJ A;  1DTT A;  4HJH A;  5FRM A;  2FSN A;  4LC9 B;  3A5L C;  4JKD A;  2A1S A;  3P38 A;  2ZE2 A;  1RBR A;  3WXL A;  1XSZ A;  4BRM A;  3ZEU B;  2O8F B;  3EEQ A;  5M1O A;  2QXF A;  3V1R A;  3L8B A;  3DLH A;  4O0J A;  4RW4 A;  4CGH A;  4NXM K;  5H1S Q;  1LW0 A;  3ZET B;  5BN9 A;  2D4W A;  3L2U A;  4HUE A;  5IYC P;  1ASV A;  1M90 O;  3WNH A;  1IV0 A;  1UOC A;  2WFB A;  1XHX A;  3B6P A;  1LAV A;  1BIS A;  1YAG A;  3ZX0 A;  4F8R A;  1QN5 A;  1D5A A;  2RPI A;  1KAZ A;  5AZJ A;  2QWR A;  1N36 K;  2O4G A;  1ESV A;  3QFP A;  3RSE A;  2A42 A;  4H5W A;  1WNS A;  1A5V A;  4I6M A;  3MXJ A;  4EJZ A;  1B9K A;  4FO0 A;  3V9W A;  4YNQ A;  4BE0 A;  3CMA N;  3THX A;  4OKK A;  2FGT A;  4JD2 B;  1K8K A;  1I39 A;  3O3F A;  3V9U A;  4KI6 A;  2NRW A;  2QWL A;  4JHD A;  3SV4 A;  4H5N A;  2P9K B;  3VGL A;  3OST A;  1NNE A;  1TKT A;  5ADX H;  1RBU A;  1EUV A;  3DAW A;  1SAZ A;  3QET A;  4DFJ A;  2VGN A;  1BUP A;  4CFC A;  3I0S A;  5HRO A;  1QN6 A;  3F5T A;  4MO5 A;  2HBJ A;  3SQ1 A;  4M3T A;  1G15 A;  1QHT A;  3U3Y A;  4DS5 A;  4BC4 A;  1BDG A;  1VSF A;  1BCO A;  3L2W A;  4CZM A;  2HMP A;  4CHP A;  2A5X A;  4DTO A;  3CM5 A;  3OYG A;  1HLU A;  3C0B A;  1T3V A;  2R7Y A;  4FLV A;  3DJC A;  2YHY A;  4LF4 K;  1CZB A;  4CEC A;  3J7A P;  3CCS N;  3FFK B;  1LCU A;  3TSP A;  4BE1 A;  4LH5 A;  1OVY A;  3QO9 A;  3AVK A;  2XY7 A;  3KRM A;  4IFE A;  3MK6 A;  4DLE A;  3SLC A;  3OYD A;  4Y1D A;  2V9J A;  2P9S B;  3QER A;  4I9Q A;  5HSH A;  3NH2 A;  4CEZ A;  4RWT A;  1VOK A;  3EL2 A;  4E7J A;  4B3O A;  2YV0 X;  4OPA A;  3ZSR A;  2ETJ A;  4C8M A;  2GUP A;  5AQH A;  3O80 A;  5AQS A;  4ELT A;  4KB1 A;  3SNN A;  4O8K A;  3CJ7 A;  5FRO A;  3J81 O;  1N8R O;  1JDY A;  4IL8 A;  2H4L X;  4GKJ K;  1VRU A;  4ZHR A;  4LFA K;  1LWY A;  1GLD G;  4MDB A;  5B8H A;  1Y64 A;  3IS9 A;  1KFQ A;  3KKS A;  4M45 A;  4CF0 A;  1DT9 A;  5EX5 A;  3CVS A;  1DIZ A;  1S1T A;  3V4I A;  3WXJ A;  1XI1 A;  4IFY A;  5LMU K;  1WSI A;  3VER A;  2FBV A;  3LP2 A;  1VKL A;  3J8A A;  4JS5 A;  1QS4 A;  4DSE A;  5FPM A;  4CGI A;  2A6A A;  4JI6 K;  2WC9 A;  3DLE A;  1NGJ A;  1QTS A;  4EZ9 A;  1KLN A;  4FJ8 A;  4CFA A;  5BPN A;  3H45 C;  3T7Z A;  1VQN N;  3HK2 A;  1YVN A;  3LL3 A;  2IOC A;  1K8K B;  2QRD A;  1VSJ A;  4DU1 A;  3A8Y A;  1XHZ A;  1WLJ A;  4CZH A;  1PCZ A;  2E88 A;  5CYQ A;  3CCU N;  1X9S A;  2F9W A;  4BQL A;  1VQ4 N;  3GG4 A;  4LF7 K;  2ASO A;  4DV5 K;  1ATS A;  2GWJ A;  4JI3 K;  4DTM A;  3AGK A;  3H3N O;  4PA1 A;  2O8C B;  2YHX A;  2VWJ A;  4KHP K;  1RTJ A;  3AVB A;  3CQ8 A;  3M3Z A;  1IKX A;  3QLH A;  5TKW A;  1QSY A;  2YKM A;  4KHN A;  2RHK A;  3MXM A;  1VQ6 N;  1NK4 A;  4ROD B;  2YJF A;  3O3G A;  5SZT A;  3LAN A;  4YOV A;  2HVI A;  1HKC A;  2GWK A;  4A5B A;  1S5J A;  4YDU A;  5C2D A;  3UKR A;  3TDH A;  3CWA A;  1NK6 A;  1HNZ K;  1YXQ A;  3HP6 A;  4CZL A;  1HNI A;  4OKE A;  3K5O A;  4CD3 A;  3K5L A;  3OBW A;  3TSU A;  3DRS A;  3H1Q A;  2HNZ A;  3SUQ A;  3OYL A;  3C7N A;  3ZYY X;  2OZM A;  2W6L A;  1NOZ A;  2O8C A;  4FVM A;  4WQ5 C;  4CZE A;  3HL8 A;  4H4O A;  1WJW A;  5IYD P;  1ASU A;  4KHW A;  2XY6 A;  3P1G A;  4BRG A;  3KK3 A;  4BRN A;  4CGD A;  2KLA A;  1VAZ A;  3O9Q A;  3KTQ A;  3PMG A;  3EN9 A;  3AVI A;  3RSE B;  1FJG K;  3NVK A;  4ISF A;  4CBU A;  3FE1 A;  4CK2 A;  3W3D A;  4AHR A;  4EP4 A;  1QZ6 A;  3SCX A;  1S1X A;  5JMV D;  2PY5 A;  5FRN A;  3BGR A;  4X64 K;  1VQP N;  4C8O A;  2NZT A;  1EP4 A;  4F2R A;  3TTC A;  3HPH A;  3R1X A;  4B9N A;  1HQU A;  3AVF A;  2X6N A;  2Q0U A;  1M5Q 1;  3K57 A;  4CHQ A;  4DHY A;  2G8F A;  4PKI A;  4DKW A;  1ZXO A;  1BOT O;  2V7Y A;  2IAJ A;  3IDH A;  3MN6 A;  4B1Z A;  3KJV A;  4BRK A;  2NLX A;  3C6T A;  3CCQ N;  3O8M A;  4BR0 A;  2NOI A;  4FLX A;  1GOC A;  3H46 O;  1EO1 A;  4B3T K;  1UA0 A;  3DLB A;  4CI6 A;  1TKX A;  3ZSZ A;  3KLF A;  5IT9 O;  3NGI A;  1RM1 A;  3TPQ A;  1YJN N;  1QSL A;  2D1K A;  4GVM A;  2Q3S A;  4RW6 A;  3P39 A;  1SKS A;  1TGH A;  1QQC A;  1G99 A;  4DQ8 A;  5EPC A;  2O8D B;  5AQJ A;  1WAF A;  4C7P A;  1IKY A;  2Z1J A;  3BY5 A;  4AH9 A;  3CM6 A;  1YQR A;  1J53 A;  3QNN A;  3OYK A;  3OYC A;  2F9T A;  1QNE A;  4HCB A;  1VSD A;  4BC5 A;  2UUA K;  3OC3 C;  3F9K A;  3JYT A;  2VGM A;  4IG3 A;  2GX9 A;  1WBD A;  4CEE A;  5M1N A;  4CK1 A;  1J9A A;  2JWK A;  2F7T A;  3WT0 A;  4KRE A;  4IEI A;  1VSK A;  3DYA A;  4I6M B;  3AA5 X;  4CZF A;  4PUO A;  3KWG A;  4M42 A;  1NGH A;  2FSK A;  4DF4 A;  1NGC A;  3VQA A;  4J2B A;  3F0Z A;  1BA0 A;  3HM9 A;  4BRH A;  2J4R A;  3THW B;  3ZSX A;  4W5T A;  3VQQ A;  1KSP A;  4BRI A;  5EOY A;  4BRE A;  4H0T B;  1T05 A;  1MA9 B;  3M1F A;  5DM7 L;  3OYN A;  4Z4I A;  1FKP A;  4KH5 A;  4IEE A;  3BF3 A;  4E89 A;  1OH5 A;  4A59 A;  3L4I A;  3DMJ A;  3G4S N;  2XO7 A;  3ID8 A;  4WXA A;  3JAM O;  4V19 S;  1KRP A;  1J3M A;  3BP8 A;  4GKK K;  5M1Q A;  3V1O A;  3MXI A;  4AM6 A;  3CW7 A;  1FW6 A;  3LM2 A;  4JV5 K;  1QNB A;  4FJX A;  2VG7 A;  1I3A A;  1LOT B;  5KTQ A;  3PX6 A;  4FK4 A;  2QWO A;  4DR2 K;  1NKE A;  4PKG A;  1HPZ A;  1L3U A;  3VQP A;  4IO8 A;  2QKK A;  4CE9 A;  4DV4 K;  1LWW A;  2BE2 A;  3PSF A;  4BRC A;  2BGG A;  3G0Z A;  2QW9 A;  3ZX3 A;  4BWJ A;  4FPA A;  1S22 A;  4IZ9 A;  1T8E A;  2P5O A;  4W5N A;  1KTQ A;  4CJ5 A;  4M7X A;  4DTP A;  2ATQ A;  3PUF A;  3VTH A;  2Y1J A;  2FUV A;  1GLC G;  3ZSQ A;  2E5L K;  3KLH A;  3TAG A;  3VEX A;  3ZET A;  1OKJ A;  4FJI A;  4IDK A;  3UIQ A;  3NE6 A;  4I2P A;  3AO5 A;  4CJQ A;  3OH6 A;  3UB5 A;  3MX2 A;  4CJU A;  3KWI A;  3D2F B;  4LF6 K;  1K8A O;  2UU9 K;  3ZT3 A;  2NOZ A;  2P9N B;  1ILY A;  4C8N A;  4CFD A;  1BA1 A;  3NGY A;  3E1Y A;  3VQE A;  1SUQ A;  4NLB A;  2E20 A;  1ZYQ A;  5JLH A;  3QEW A;  3AA3 A;  1K73 O;  3HYF A;  2VYP A;  3VEN A;  4LF9 K;  5AQM A;  2D0B A;  2H5A X;  1U45 A;  3M8P A;  5HRN A;  1IBM K;  3J7Z O;  2P9K A;  1YJ9 N;  4FWR A;  1U4B A;  3O6W A;  3MCP A;  1JLF A;  2HF4 A;  1RNH A;  3VQB A;  1NK5 A;  4CF2 A;  4CJS A;  5GIN A;  5BR8 K;  3O4W A;  3DOL A;  3G10 A;  3GBT A;  4KPY A;  3LP0 A;  3SJH A;  4DR5 K;  4FL9 A;  3W0L A;  1M1K O;  3O9U A;  3C7N B;  3AAR A;  5J1E A;  1XUP O;  2A41 A;  2QWM A;  4QS9 A;  3OHR A;  4CCH A;  5AQF A;  1KVB A;  4OLB A;  3E66 A;  1MP9 A;  3PLA A;  5C25 A;  5CE3 A;  1HKG A;  2P9N A;  3I55 N;  3UKU A;  3ZT0 A;  2IV8 A;  1C6V A;  2ZJP L;  3U6F A;  3QNO A;  2UUC K;  1J5E K;  1JL1 A;  1DGK N;  3RMA A;  2HL9 A;  4H0Y B;  4E1M A;  2FKF A;  1KVC A;  1T44 A;  2PBD A;  1LWC A;  3NA5 A;  4BAC A;  2NLV A;  3ATU A;  3NF8 A;  1NK8 A;  5E41 A;  5KPT A;  1QE1 A;  3OYH A;  4DLG A;  2O8E A;  2HHQ A;  3VA0 A;  1TVR A;  5AQK A;  4FSV A;  1IBL K;  4WFA L;  2KZZ A;  4AHV A;  3THX B;  3RR8 A;  3VGM A;  2P1J A;  4XEI A;  1YHQ N;  2OYQ A;  3SBT A;  1E4F T;  3U8X A;  4MFB A;  4OX9 K;  3JS6 A;  1H1V A;  4H8K A;  4DQI A;  1RIL A;  4CJW A;  1Q86 O;  2IIR A;  1TAQ A;  3CFR A;  1V4T A;  2Q1N A;  3I8B A;  5C0Y A;  1HNX K;  3GDQ A;  4PQU A;  3EIK A;  1YTU A;  2Z8U A;  1W9H A;  2WUS A;  2HHW A;  1HNV A;  3D7E O;  4JK8 A;  1YQK A;  1ATN A;  1KAX A;  1W80 A;  4N47 A;  5LJW A;  2O8E B;  4KH4 A;  5AQP A;  3K5M A;  1ZBF A;  4FXD A;  1S9G A;  4CZJ A;  4HUF A;  4E3S A;  2G8I A;  3DI6 A;  1YF5 L;  2IVP A;  1JLA A;  3KK2 A;  4BR4 A;  3VEV A;  4FCY A;  1DKG D;  1DEJ A;  3VEO A;  2GTD A;  4H5R A;  4OGE A;  1T6C A;  5AN4 A;  4O8U A;  3VPZ A;  3V81 A;  3GE1 A;  5C24 A;  4KTW A;  4B9U A;  3A2F A;  2OTL N;  4DR6 K;  3TI0 A;  2QKB A;  2NNW A;  1WSG A;  2E2Q A;  5C2F A;  4FJ7 A;  3J80 O;  1P5D X;  4N76 A;  3AO4 A;  1D9D A;  2NRV A;  2I7N A;  2Q2R A;  2P51 A;  3KZB A;  2E6M A;  3VQ5 A;  3SPY A;  1YIT N;  2E6L A;  1LXT A;  1E42 A;  1UA1 A;  4B9T A;  3L0Q A;  2FBY A;  3VEW A;  4BRD A;  5JVH L;  2AA4 A;  4XH1 A;  3LDL A;  1B92 A;  3RPJ A;  4LD0 A;  3M8R A;  1YI2 N;  3AVN A;  3IAY A;  4FOI A;  2QLV A;  3I33 A;  4EAI A;  3OS1 A;  5IYB P;  4DTJ A;  3FR0 A;  3C94 A;  4I2Q A;  3BUZ B;  3CPW M;  3CCL N;  4FW2 A;  4O55 A;  3R6M A;  5EU7 A;  1JLE A;  1NG9 A;  2O8D A;  1WN7 A;  1K2Y X;  2WON A;  2O8B A;  1KYD A;  1YQL A;  3FGU A;  3HI0 A;  1BG3 A;  4FWN A;  4U67 L;  4G9Z A;  1QQM A;  1U2V B;  2DY4 A;  1RDB A;  1VSM A;  3EAY A;  2NRX A;  3CJ9 A;  2F96 A;  3O3H A;  1SKR A;  3C6H A;  3VQC A;  2YJE A;  1RTD A;  4DQQ A;  4OKJ A;  3OVN A;  3U4L A;  3D7Q A;  1QVG M;  3ENB A;  4I9L A;  3ZCM A;  4ZTJ A;  4H0V B;  5HRR A;  3CET A;  1IG9 A;  4BVO A;  4HTL A;  1GOB A;  4IO9 L;  1REV A;  3THW A;  3P5J A;  2X6S A;  3FZF A;  1NK0 A;  1QVF M;  4F3T A;  1N39 A;  1NK7 A;  4DSL A;  2MZ8 A;  4JHD B;  4RG8 A;  3TAR A;  2W42 A;  3L2Q A;  5J2P A;  1C0F A;  1N3A A;  4EAJ A;  3Q7B A;  3VF6 A;  1C1A A;  4E19 A;  2W41 A;  5TKY A;  4UQG A;  3A5N C;  4IBN A;  3B6O A;  4H0P A;  4NYN A;  1L5U A;  4WE1 A;  4NXN K;  4FWL A;  4N5S A;  1BIU A;  4LSN A;  5HRS A;  3M8Q A;  3MED A;  3IG1 A;  1T03 A;  3PX0 A;  3RWU A;  4CIG A;  4AF1 A;  1RDD A;  4KHQ A;  1QN3 A;  1W97 L;  4L8R B;  4DU4 A;  3LAL A;  5AQI A;  3DXM B;  4NO7 A;  4K25 A;  3KK7 A;  4H5V A;  4MO4 A;  3CCR N;  4BRO A;  1IBK K;  3T1Y K;  3L4Q A;  3SK3 A;  4CGG A;  1GLJ O;  4H5T A;  4E7I A;  2RE2 A;  4JI8 K;  1EWR A;  1IKW A;  3D0P A;  1YT3 A;  4FM0 A;  1WBB A;  3FFI A;  1MU2 A;  2HBL A;  4ELV A;  1PVS A;  2F7L A;  2NRH A;  3AVC A;  4B1U B;  3AO1 A;  5BPL A;  3F9M A;  1KAY A;  4EAH D;  3K9J A;  4FW1 A;  4B9M A;  1NGA A;  1QNC A;  1HNW K;  1YUW A;  2XRI A;  3D6R A;  1TGO A;  3RMD A;  5C10 A;  4CHN A;  1RT1 A;  1E4G T;  1DLO A;  1L3V A;  1SKW A;  4K8Z A;  2KFZ A;  3ZEU A;  2KZM A;  3QB0 A;  2HZM A;  4C8L A;  2JLE A;  1N34 K;  2FKM X;  3SAH A;  4FWS A;  4YOT A;  5M1K A;  3OGD A;  1WB9 A;  2HF3 A;  3VA3 A;  1NLV A;  1TKZ A;  1Z6R A;  5CZ1 A;  4LFC K;  4IWV A;  3CWU A;  1KVA A;  4DTN A;  3HXM A;  4UY8 O;  4LY7 A;  4EIA A;  1U6Z A;  3WUH A;  1VTL E;  4WX8 A;  3MMV A;  5GIO A;  3JXU A;  3C6U A;  2V8Q A;  4E7H A;  3OJU A;  1W0H A;  4B0A A;  4JK9 A;  4OO1 J;  1QN7 A;  1N3C A;  5DK5 A;  4YY3 K;  3AVH A;  3ID6 A;  3EE9 A;  3NGZ A;  4F2S A;  1NVP A;  3UKR B;  1XMO K;  3D4V A;  3A0I X;  3NFA A;  4DFK A;  3R8E A;  2E4L A;  3NVM A;  1S6P A;  2I5J A;  2HL8 A;  4TSX A;  4B8A B;  5AQV A;  3HZ6 A;  4DV2 K;  1VQO N;  3VQ9 A;  3IMX A;  1X9W A;  1Q7Y O;  4EZ6 A;  3T69 A;  3S9H A;  4BRL A;  2O4I A;  4WQ5 A;  5KPZ A;  4JKG B;  3PV8 A;  3WNF A;  2PFU A;  1TUU A;  3OY9 A;  3EY1 A;  5DMR A;  5BRF A;  4CJK A;  3AO2 A;  3SQ0 A;  3IUC A;  2G8U A;  3V1Q A;  2KFN A;  4B9S A;  3QIP A;  4DQR A;  1XC3 A;  3RTV A;  5J2M A;  1WQA A;  2LAE A;  1KLM A;  3MEG A;  1C1B A;  5AQG A;  4BG8 A;  4N41 A;  5KRT A;  4RTF D;  4KHY A;  1NWK A;  3VQ8 A;  2IDO A;  3M5R A;  3LAM A;  1NKC A;  4ROE B;  2P9I B;  4D7Q A;  3SQ2 A;  3O5B A;  2PAV A;  3DXK A;  4RCH A;  4WQ4 C;  2NOL A;  2FBT A;  1BL3 A;  4CEQ A;  3G71 N;  1N32 K;  4FM1 A;  3LP1 A;  3OH9 A;  4K42 A;  1RT7 A;  4A2B A;  4DQP A;  2ITM A;  4W5Q A;  3S3O A;  4YDU C;  4B9Q A;  2IV9 A;  2XHB A;  2Y1I A;  3I8D A;  4F9O A;  3N4P A;  2YNI A;  4A5A A;  2UYT A;  3IFR A;  4IG0 A;  5FDL A;  2HHU A;  2DPN A;  4EAK A;  5CYM A;  3OYA A;  4FJG A;  4KHS A;  3MN5 A;  2B6A A;  3JSM A;  2Z1I A;  3E01 A;  1NJZ A;  3LPT A;  1RT4 A;  4JK7 A;  1HX1 A;  1QQN A;  3K9K A;  1Q9U A;  2QWP A;  3D2E A;  1GOA A;  1J54 A;  3I0W A;  3AO3 A;  4JKF A;  5F2R A;  1NGG A;  1RT5 A;  2HB5 A;  2OPR A;  1Y97 A;  4JYA K;  2F4V K;  5AR0 A;  4HCC A;  4BY9 C;  1TV6 A;  1TUO A;  2QWQ A;  1HUX A;  5T7B A;  5F1X A;  3BF1 A;  4F4K A;  1TL1 A;  4FJN A;  2OOY A;  3WNG A;  4IOA L;  3L2V A;  3HSC A;  2CGL A;  1JKH A;  1VK0 A;  4CFF A;  2QI2 A;  4NLC A;  2D5R A;  4FLU A;  4HWI A;  2IC3 A;  4CER A;  3BZC A;  4OPK A;  2OOX A;  1VHX A;  2QEX N;  3CJ1 A;  3G25 A;  3AVM A;  1VQ9 N;  4C1N I;  4CED A;  2Q36 A;  1CXQ A;  4WFB L;  2VQE K;  2YNG A;  2P9U B;  2YA3 A;  1D9F A;  3D2F A;  1EX4 A;  1RDU A;  3EKS A;  1J6Z A;  1X9J A;  4BE2 A;  1ZBL A;  2I7P A;  2DFF A;  3DOK A;  3AY9 A;  1Q81 O;  1LWF A;  3E9P A;  2ITG A;  1P90 A;  4CEA A;  4BGB A;  1NK9 A;  3PO5 A;  4B1W B;  3HTV A;  1V4S A;  3J7Y P;  4BRQ A;  3EZ5 A;  3T1A A;  3VQ6 A;  4LF5 K;  4J2E A;  1MDU B;  3MCA B;  2WBN A;  3N4Q A;  2P9L A;  5LMN K;  4MQ3 A;  5GAG P;  5EY4 A;  1NGF A;  2HST A;  4M3R A;  3AAQ A;  3RRH A;  4JNE A;  1U04 A;  4CK3 A;  2HNY A;  1NKB A;  4FK0 A;  1T6D A;  3TTD A;  4WYB A;  4PHT X;  4X66 K;  4CGJ A;  4BGA A;  2W40 A;  4DS4 A;  4I8O A;  1LWE A;  4MDA A;  4CJ4 A;  4KTQ A;  3V6D A;  1FK9 A;  1ASW A;  2E2N A;  1HMV A;  3C6A A;  1M3Q A;  3OBY A;  1BCM A;  1TK5 A;  1IO2 A;  4EHU A;  3FLC O;  1BGX T;  5JIC A;  4PWD A;  1NBW A;  3WNE A;  4BDY A;  2D0O A;  4CD1 A;  5CHI A;  1TKD A;  4NCB A;  4R79 A;  4YOX A;  5AZJ B;  3CC2 N;  3KLG A;  2VG5 A;  1GLA G;  3QEV A;  2BAN A;  3L3U A;  4YFU A;  4BQZ A;  2QM1 A;  4Z4G A;  2P9L B;  5SWM A;  3NCI A;  3VEY A;  5I3U A;  4BC2 A;  3P31 A;  2YI1 A;  3SPZ A;  2QR1 A;  5AQZ A;  1CZ9 A;  2FC0 A;  3MDQ A;  1GLL O;  1YTA A;  1T7P A;  1AIS A;  5F0X A;  4DUY K;  1VQ7 N;  1JLG A;  3RSM A;  4K43 A;  1EKE A;  2YHB A;  4CEB A;  3M8S A;  2ASP A;  1VQL N;  2YHW A;  3DPT A;  3ULE A;  5KQ8 A;  3Q7C A;  1LV5 A;  4J8F A;  5KI6 A;  2W6K A;  1HKB A;  4BRF A;  1QNA A;  1TBP A;  1RGI A;  4MRQ A;  1U2V A;  5AQX A;  3VMF B;  2KTQ A;  3ZSW A;  4H0O A;  1U49 A;  2G8W A;  3MN9 A;  3CPE A;  2DKD A;  1R4X A;  1HU0 A;  5I42 A;  5MLC Q;  1K35 A;  4NB4 A;  1RTH A;  3VGK A;  5KL0 A;  4FJM A;  3EKU A;  3SUN A;  1X9M A;  3CQX A;  3NF7 A;  2DFH A;  3IH7 A;  3CXC M;  3EO3 A;  4PY5 A;  1QN4 A;  5GAE P;  4FYD A;  2VG6 A;  4GV3 A;  2HHX A;  4KB0 A;  5AZI A;  2NOB A;  3ENC A;  1MWM A;  4M3Z A;  1BQM A;  1SL0 A;  3CJC A;  4CJL A;  5J2Q A;  3AVG A;  1SQK A;  2O8F A;  3EZW A;  5GAD P;  1P8Z A;  2FXU A;  2PYJ A;  3KKR A;  2JPI A;  3V9Z A;  3SAG A;  1Q9X A;  2IGI A;  4BRA A;  4KHU A;  2HW3 A;  4JRQ A;  1V5S A;  1EQY A;  4FJ5 A;  4AIL C;  1YTB A;  2AJQ A;  2H3G X;  5EVZ A;  3TSQ A;  4W5R A;  1BQN A;  3RRG A;  1VTO A;  3U3G A;  1M3H A;  2NRZ A;  3CJB A;  3OYB A;  4FJL A;  1S3X A;  5BPM A;  4FLZ A;  3PIP L;  3VQD A;  3L3V A;  2ZD1 A;  1S72 N;  4JN4 A;  1S6Q A;  3BEX A;  4RW9 A;  2V52 B;  1TL3 A;  2V7Z A;  4EAG A;  3DXK B;  3QIC A;  4C23 A;  5AQL A;  2DKC A;  3TAQ A;  3LDO A;  3QEX A;  4N56 A;  5AQY A;  4MLH A;  3QIO A;  4ILJ A;  3P83 D;  3FZH A;  1QTM A;  2KW4 A;  1SV5 A;  1C1C A;  3DLK A;  3T3F A;  1KD1 O;  5CY4 A;  2A3Z A;  3FZM A;  2VQF K;  2JOI A;  4IOX A;  4CJF A;  1GLF O;  3ZLJ A;  1Z25 A;  2OPQ A;  3SZ2 A;  3EE8 A;  3LP3 A;  2GV9 A;  2OAN A;  3OCI A;  3LZI A;  5GAH P;  3CVT A;  2FSJ A;  1CDW A;  2BH1 A;  4O0I A;  4HTU A;  3VN5 A;  4GY2 B;  4EAL A;  3SMP A;  4TPS A;  1UT7 A;  4BR2 A;  3ZSY A;  3QBW A;  1JJ2 M;  4DSK A;  4CIF A;  3P4I A;  1JLQ A;  3WXK A;  1UAX A;  1VQK N;  1UL7 A;  3AGR A;  3V9S A;  3HRG A;  5FPD A;  1ZC6 A;  3ENO C;  2CH5 A;  2HZS A;  1VSH A;  1YIJ N;  3VET A;  3AAP A;  3CC4 N;  5AQW A;  3T4N A;  2EHG A;  2G8K A;  2GUI A;  3HBT A;  1NOY A;  3OTO K;  3BZK A;  3QES A;  4B3R K;  3HT3 A;  3TAM A;  3ENH A;  1MWK A;  4OVL A;  3V9X A;  3CD6 N;  3NMU A;  1U48 A;  4DR4 K;  4JI2 K;  3SUO A;  1NGE A;  4O5F A;  1RCH A;  3E9O A;  4JKG A;  4WF9 L;  4PL8 A;  1P5G X;  4QS8 A;  4CW7 B;  3HO1 A;  1RTI A;  3CME N;  4IXC A;  4DG1 A;  4GNI A;  1KO9 A;  1VOL B;  1KYU A;  5AQO A;  5KQD A;  3LDN A;  3EYZ A;  4IKF A;  4Q0B A;  1EXQ A;  3NF9 A;  4E7K A;  2HBK A;  2VCP A;  3PDK A;  1EET A;  1BWF O;  3CQY A;  5M1P A;  3ZT2 A;  4CJ7 A;  3O1B A;  2QRC A;  4FWK A;  1UT4 A;  5BMP A;  3CJA A;  2MJ7 A;  1TYQ B;  3VTI A;  3LM9 A;  2UXC K;  2D0P A;  4CJV A;  4H4M A;  4AQY K;  4JKA A;  4JI5 K;  4HVJ A;  4DU3 A;  4F3O A;  4KO0 A;  3K5N A;  2DFE A;  4FZZ A;  2FF3 B;  3VEZ A;  1SS6 A;  4I7F A;  3DPU A;  3VQ7 A;  4FJ9 A;  4O44 A;  3MWP A;  4M3W A;  3KLE A;  2Q31 A;  3HJF A;  3MWT A;  1JCF A;  4BVP A;  4CES A;  3O4Q A;  4XH4 A;  2Z1G A;  4DUZ K;  2VWB A;  3ZSO A;  4PL7 A;  2EHB D;  4DTX A;  1TAU A;  4J2D A;  1A5X A;  1N6Q A;  2UUB K;  4XH5 A;  1JXB A;  3TU5 A;  2R5X A;  1HYZ A;  3H1V X;  4B9V A;  4CJE A;  2D0C A;  1KY7 A;  4EFH A;  2YNF A;  3KVG A;  2OZS A;  1D8Y A;  4Z4E A;  3CCE N;  1GLB G;  5ELZ A;  5C12 A;  4CZG A;  1GLE G;  1LWV A;  5KPR A;  5LJV A;  4ISG A;  2ZJR L;  5AFU A;  3KHY A;  3LWM A;  3E9L A;  1U47 A;  2XY5 A;  3ASM A;  1S1V A;  2FLO A;  4FWP A;  3CHW A;  3CG7 A;  5D3G A;  1NGM A;  2X78 A;  1X3N A;  3R3L A;  1J5O A;  4K0K K;  4E0D A;  3TR8 A;  2GBZ A;  2X74 A;  3H3O B;  3H08 A;  4PKH A;  3LDS A;  2I5W A;  1BI4 A;  3ENO A;  3S3N A;  1VQM N;  3A5M C;  2RN2 A;  4GV6 A;  4FLW A;  4HUG A;  2Q0R A;  4FJK A;  1NJI O;  1WSF A;  3S3M A;  2P9U A;  3T1H K;  4CBX A;  5K14 A;  2HHT A;  5AQQ A;  4R5P A;  4BC3 A;  1BIZ A;  1ZBU A;  2FF6 A;  4FPB A;  2GEM A;  1KQS M;  5IWA K;  3HPG A;  3L6Q A;  1B9F A;  3KD1 E;  2KQ2 A;  4JKC A;  1X3M A;  3TWH A;  3QFU A;  4EP5 A;  3TAN A;  3THY A;  1XQS C;  4ZTF A;  5HRP A;  3K0S A;  3KLI A;  2BTF A;  1VQ8 N;  3H6E A;  1HYV A;  1R0A A;  4OLA A;  1R59 O;  3KIO A;  1BI4 B;  5A2Q O;  4CHZ A;  2PYL A;  3U9D A;  1Q82 O;  3BDP A;  4YOR A;  4X62 K;  3PIO L;  5E26 A;  4BG9 A;  3GL1 A;  4QOZ B;  4B08 A;  5J2N A;  1L3S A;  4FLY A;  2Q97 A;  4QAG A;  2ZFD B;  2AP1 A;  4A61 A;  4XIU A;  4KH6 A;  1KYF A;  1WSJ A;  2HHS A;  3CI5 A;  4Z0U A;  1FN7 A;  4CJP A;  1JXE A;  4BDP A;  4GMJ B;  2HVH A;  3TAP A;  1RBS A;  3TTF A;  3VF4 A;  4CHO A;  2ZM6 K;  4E7L A;  4DFP A;  2HHH K;  2HND A;  3PO4 A;  2RKI A;  2QA4 N;  3VQ4 A;  1RT3 A;  1VSI A;  3OSE A;  4DV7 K;  5LL6 Z;  3AV9 A;  2QXL A;  4B3S K;  1C9B B;  3QDK A;  4ROC B;  3THV A;  2P9P B;  4C1N K;  4CZI A;  4JAX A;  3CER A;  1NU0 A;  3HP9 A;  2ASM A;  1RDW X;  2V92 A;  3CC7 N;  2JWL A;  4DMN A;  3OYI A;  4KAZ A;  3VF2 A;  2V51 B;  4JKB A;  4BR7 A;  4FK2 A;  2P5G A;  1S1W A;  2JGU A;  4CFB A;  1OH6 A;  4FWQ A;  1O1W A;  3ATV A;  3R9P A;  5AQN A;  1OH8 A;  3ALY A;  4FM2 A;  2XY8 A;  3NF6 A;  4YOY A;  1HPM A;  3HVT A;  4M3Y A;  4Z4F A;  3AVL A;  4DV1 K;  1KFI A;  1OH7 A;  4B1Y B;  2CH6 A;  3WQU A;  1TK0 A;  1SZ2 A;  3GOI A;  5HL7 L;  3AA4 A;  2HHV A;  2LSN A;  4DUL A;  4JI1 K;  3NH0 A;  1NH2 A;  5ADX A;  4FLT A;  5KRS A; 
#chains in the Genus database with same CATH homology
 2B4J A;  1M3Q A;  4OKK A;  1BCM A;  3RMA A;  1TK5 A;  2FGT A;  1ZBI A;  4E1M A;  4ICL A;  4WZS D;  1IO2 A;  1KVC A;  4M3U A;  1LWC A;  1BGX T;  4BAC A;  1I39 A;  3O3F A;  3V9U A;  1SL2 A;  4DFM A;  1NK8 A;  3NF8 A;  5E41 A;  4KI6 A;  1C0T A;  1QE1 A;  1UWB A;  3OYH A;  4DLG A;  3SV4 A;  3WNE A;  4BDY A;  3OJS A;  4PWD A;  3OST A;  2HHQ A;  1TKT A;  1TKD A;  3VA0 A;  1RBU A;  3NBP A;  4NCB A;  1TVR A;  3KLG A;  2VG5 A;  3QEP A;  2KZZ A;  4AHV A;  3QEV A;  2BAN A;  3L3U A;  3RR8 A;  3QET A;  4YFU A;  3HVR A;  4DFJ A;  2P1J A;  4CFC A;  2OYQ A;  3I0S A;  5HRO A;  1QN6 A;  4Z4G A;  3SQ1 A;  4M3T A;  4EJY A;  4MFB A;  1G15 A;  5SWM A;  4E1N A;  1QHT A;  3NCI A;  4DF8 A;  4DQI A;  4H8K A;  3U3Y A;  1RIL A;  4CJW A;  5I3U A;  1TAQ A;  3CFR A;  4DS5 A;  1VSF A;  3SPZ A;  1DTQ A;  4CIE A;  2QK9 A;  3SJJ A;  1BCO A;  1CZ9 A;  3L2W A;  2FC0 A;  4CHP A;  4PQU A;  1YTA A;  4KTZ A;  4DTO A;  3CM5 A;  3OYG A;  1T7P A;  3EIK A;  1AIS A;  1YTU A;  2Z8U A;  3ISN C;  2R7Y A;  4FLV A;  4B9L A;  1WSE A;  1W9H A;  1JLG A;  4HHT A;  3T19 A;  2G8V A;  1EKE A;  1CZB A;  2YHB A;  4CEB A;  1HNV A;  4CEC A;  3M8S A;  2IS3 A;  1N5Y A;  2HHW A;  4KV8 A;  1YQK A;  4N47 A;  1W80 A;  3DPT A;  1IH7 A;  1ZBH A;  3DRR A;  1NJY A;  1LV5 A;  5KI6 A;  4BE1 A;  3K5M A;  4FXD A;  1ZBF A;  4LH5 A;  1S9G A;  1QNA A;  1TBP A;  1B9D A;  3AVK A;  3QO9 A;  4HUF A;  4E3S A;  2XY7 A;  3KRM A;  2G8I A;  3DI6 A;  3ZSW A;  4DLE A;  1U49 A;  3OYD A;  1KLN A;  3KK2 A;  3SUP A;  1JLA A;  4DTR A;  4FJ8 A;  4FK4 A;  2G8W A;  1D3U A;  4CF1 A;  4FCY A;  4Y1D A;  1QN8 A;  3OYE A;  1R4X A;  1HU0 A;  5I42 A;  5HP1 A;  3QER A;  4I9Q A;  4OGE A;  3NHG A;  3DLR A;  3NH2 A;  1HRH A;  4CEZ A;  1RTH A;  1VOK A;  4E7J A;  5AN4 A;  4B3O A;  2YV0 X;  3ZSR A;  2ETJ A;  4C8M A;  5C24 A;  3V81 A;  4KTW A;  4B9U A;  4FJM A;  5CZ2 A;  2D0A A;  3SUN A;  3A2F A;  1X9M A;  4CEO A;  3NF7 A;  3TAE A;  2DFH A;  3TI0 A;  4ELT A;  3IH7 A;  1WSG A;  3K2P A;  4KB1 A;  2YNH A;  3SNN A;  4PY5 A;  1QN4 A;  4CF9 A;  2F8S A;  4GW6 A;  3ZT1 A;  4FJ7 A;  5FRO A;  4N76 A;  4FYD A;  3AO4 A;  2VG6 A;  1D9D A;  1XC9 A;  3CFP A;  2HHX A;  4KB0 A;  1VRU A;  2O3O A;  2P51 A;  2NOB A;  4M41 A;  1LWY A;  4ZHR A;  4M3Z A;  1BQM A;  2E6M A;  1SL0 A;  3VQ5 A;  2YKN A;  4FZX C;  3I0R A;  3IS9 A;  3SPY A;  1LAW A;  2B5J A;  4CJL A;  5J2Q A;  2E6L A;  3KKS A;  4M45 A;  4CF0 A;  3AVG A;  4OJR A;  1E42 A;  1UA1 A;  4B9T A;  2FBY A;  1S1T A;  4NYF A;  1EBM A;  4IFV A;  3V4I A;  3LZJ A;  1XI1 A;  1B92 A;  3RPJ A;  4LD0 A;  1KY6 A;  4IFY A;  3M8R A;  3TAF A;  2PYJ A;  3AVN A;  3KKR A;  3H1Z A;  1WSI A;  4AHU A;  3V9Z A;  3IAY A;  3SV3 A;  2FBV A;  3LP2 A;  1Q9X A;  4JS5 A;  2IGI A;  1QS4 A;  5IYB P;  3OS1 A;  4DTJ A;  4DSE A;  1S9E A;  4Y1C A;  3C94 A;  4I2Q A;  4KHU A;  4FW2 A;  4O55 A;  4CGI A;  2HW3 A;  5EU7 A;  3ZSV A;  4JRQ A;  1JLE A;  1QTP A;  4FJ5 A;  1WN7 A;  4AIL C;  1YTB A;  2WON A;  3DLE A;  1KYD A;  1QTS A;  3MEE A;  2AJQ A;  4W5R A;  1YQL A;  3V9W A;  4JS4 A;  1BQN A;  4AHT A;  3RRG A;  1VTO A;  3F73 A;  4EZ9 A;  4RW7 A;  1M3H A;  1RDB A;  1VSM A;  3U3G A;  3O3H A;  3OYB A;  2F96 A;  3IRX A;  4CFA A;  4FLZ A;  3PX4 A;  4FJL A;  1SKR A;  3VQC A;  3VQD A;  3OS0 A;  1RTD A;  4DQQ A;  3SQ4 A;  4OKJ A;  3OVN A;  3HK2 A;  3L3V A;  2IOC A;  4I9L A;  1VSJ A;  4DU1 A;  2ZD1 A;  3ZCM A;  4ZTJ A;  5HRR A;  4CJR A;  2VJ0 A;  1JFI C;  1XHZ A;  1IG9 A;  1GOB A;  1WLJ A;  1PCZ A;  1REV A;  1S6Q A;  5CYQ A;  4DQS A;  3P5J A;  2X6S A;  3HS9 A;  2RF2 A;  1X9S A;  1NK0 A;  4RW9 A;  4F3T A;  1TL3 A;  1N39 A;  1NK7 A;  4DSL A;  2MZ8 A;  1WAJ A;  4DTM A;  2Z1H A;  2NOE A;  4RG8 A;  3TAR A;  4PA1 A;  2W42 A;  4JLH A;  3L2Q A;  3TAQ A;  5J2P A;  1N3A A;  3QEX A;  2VWJ A;  1YQM A;  4N56 A;  4OPJ A;  1RTJ A;  3AVB A;  3CQ8 A;  1HYS A;  3QIO A;  1TBA B;  1C1A A;  1IKX A;  4E19 A;  3QLH A;  4G1Q A;  3P83 D;  3OYF A;  1QSY A;  2YKM A;  4KHN A;  1QTM A;  2KW4 A;  1SV5 A;  1C1C A;  1JLC A;  3DLK A;  3DM2 A;  4LH4 A;  3OYM A;  5CY4 A;  3T3F A;  3MXM A;  4ROD B;  1VRT A;  4UQG A;  2JOI A;  1NK4 A;  4IBN A;  3B6O A;  4CJF A;  5SZT A;  3O3G A;  3LAN A;  4ID1 A;  1Z25 A;  4NYN A;  1NH2 A;  2OPQ A;  3SZ2 A;  1PZD A;  4WE1 A;  1L5U A;  3LP3 A;  1L3T A;  4K8X A;  2GV9 A;  4N5S A;  1BIU A;  3OCI A;  1S5J A;  3LZI A;  4LSN A;  5HRS A;  3M8Q A;  3MED A;  3IG1 A;  1T03 A;  3PX0 A;  1NK6 A;  3RWU A;  4KI4 A;  4CIG A;  1RDD A;  3HP6 A;  4O0I A;  1CDW A;  1HNI A;  4OKE A;  3K5O A;  4HTU A;  1QN3 A;  3VN5 A;  4KHQ A;  4L8R B;  4DU4 A;  3LAL A;  3K5L A;  3K59 A;  3DRS A;  4TPS A;  1UT7 A;  2HNZ A;  3SUQ A;  3OYL A;  3ZSY A;  4DSF A;  4BWM A;  4M3X A;  2OZM A;  4DSK A;  4CIF A;  1JLQ A;  1NOZ A;  1UAX A;  4FVM A;  2QKB A;  4B8C A;  2A1R A;  4CGG A;  3HS8 A;  2G30 A;  3HL8 A;  3V9S A;  4E7I A;  1ASU A;  5IYD P;  4H4O A;  1FXX A;  2XY6 A;  3HST B;  4KHW A;  3P1G A;  3KK3 A;  4AHC A;  1LW2 A;  2HZS A;  1IKW A;  1C0M A;  1VSH A;  1YT3 A;  4CGD A;  3D0P A;  3NDK A;  4FM0 A;  3FFI A;  1MU2 A;  2F8T A;  4ELV A;  3KTQ A;  2EHG A;  3AVC A;  2G8K A;  1QSS A;  2GUI A;  3AO1 A;  3O4N A;  3AVI A;  4LSL A;  1NOY A;  5HBM A;  3MEC A;  2YH5 A;  4CHY A;  3QES A;  4FW1 A;  4B9M A;  4CK2 A;  2OPP A;  1K6Y A;  4AHR A;  3OYJ A;  4EP4 A;  1QNC A;  3SCX A;  1S1X A;  2XRI A;  3KD5 E;  2PY5 A;  3HT3 A;  1BHL A;  3BGR A;  1SL1 A;  5FRN A;  3TAM A;  4C8O A;  1EP4 A;  4CJ3 A;  4F2R A;  1TGO A;  4BDZ A;  3HPH A;  3CFO A;  3RMD A;  4B9N A;  1HQU A;  4OVL A;  1RDC A;  3V9X A;  3AVF A;  2KTQ A;  2ZQB A;  2X6N A;  4CHN A;  1RT1 A;  1U48 A;  2OA8 A;  1DLO A;  1ITG A;  4J2A A;  1L3V A;  3K57 A;  1A5W A;  4CHQ A;  3OS2 A;  3SUO A;  1RCH A;  1SKW A;  2G8F A;  4K8Z A;  2KZM A;  2KFZ A;  3HO1 A;  2HZM A;  4C8L A;  1RTI A;  2IAJ A;  2JLE A;  3KJV A;  4DG1 A;  1KO9 A;  1VOL B;  1KYU A;  3C6T A;  3VA3 A;  5CZ1 A;  1TKZ A;  3SNS A;  3EYZ A;  4IKF A;  4Q0B A;  1EXQ A;  3RMB A;  3NF9 A;  4E7K A;  1KVA A;  4DTN A;  2NOI A;  1RT2 A;  1EET A;  4FLX A;  1GOC A;  3HXM A;  3ZT2 A;  4O4G A;  4LY7 A;  1UA0 A;  1IKV A;  1VTL E;  4DTS A;  1UT4 A;  3DLB A;  1FKO A;  2MJ7 A;  1TKX A;  1Q8I A;  3C6U A;  4E7H A;  3OJU A;  1W0H A;  3ZSZ A;  3KLF A;  3NGI A;  1RM1 A;  3KK1 A;  1QSL A;  4CJV A;  4H4M A;  4DTU A;  4GVM A;  1TK8 A;  4B0A A;  2Q3S A;  4RW6 A;  4Z4C A;  3LPU A;  2YHA A;  1QN7 A;  1N3C A;  1SKS A;  1TGH A;  1QQC A;  5DK5 A;  3ULD A;  4HVJ A;  2HVI A;  3KTU A;  4DU3 A;  4F3O A;  4KO0 A;  1WAF A;  4W5O A;  3AVH A;  3K5N A;  1IKY A;  2DFE A;  2Z1J A;  4AH9 A;  3CM6 A;  1YQR A;  1J53 A;  3NGZ A;  4I7F A;  4F2S A;  1Z26 A;  3QNN A;  3DPU A;  3VQ7 A;  1NVP A;  2OPS A;  4O44 A;  3OYC A;  3OYK A;  1RBV A;  4FJ9 A;  3KLE A;  4M3W A;  3DRP A;  3ULX A;  1QNE A;  3NFA A;  5JS2 A;  1VSD A;  4DFK A;  4HCB A;  3HJF A;  4CES A;  3OC3 C;  2E4L A;  3F9K A;  3O4Q A;  1HJR A;  3JYT A;  1S6P A;  2I5J A;  2Z1G A;  4FZZ A;  4IG3 A;  4TSX A;  3ZSO A;  4B8A B;  1HQE A;  4CEE A;  3VQ9 A;  4CK1 A;  4DTX A;  1TAU A;  1X9W A;  1NJW A;  4EZ6 A;  1J9A A;  4J2D A;  1A5X A;  3S9H A;  1N6Q A;  2PZS A;  2O4I A;  1JXB A;  4KRE A;  3PV8 A;  1VSK A;  3DYA A;  3WNF A;  1CLQ A;  1HYZ A;  3OY9 A;  3EY1 A;  3F10 A;  5DMR A;  4CJK A;  3AO2 A;  3AA5 X;  4CJE A;  3SQ0 A;  2G8U A;  2D0C A;  4B9V A;  3V1Q A;  1KY7 A;  4FZY A;  4B9S A;  4PUO A;  2YNF A;  4M42 A;  2KFN A;  4AHS A;  2OZS A;  4KRF A;  1D8Y A;  4Z4E A;  4DF4 A;  1KFD A;  3QIP A;  5HLF A;  3VQA A;  2NOF A;  4DQR A;  3ZT4 A;  4J2B A;  3F0Z A;  3K58 A;  1JLB A;  3HM9 A;  3RTV A;  4Z4H A;  5J2M A;  1LWV A;  2LAE A;  3ZSX A;  4FJJ A;  2XHI A;  1KLM A;  3MEG A;  3ITH A;  4W5T A;  1C1B A;  3NH1 A;  3VQQ A;  3C95 A;  3TAB A;  1KSP A;  1T05 A;  3PY8 A;  1XWL A;  1VSL A;  5KRT A;  3L2R A;  3LWM A;  2XY5 A;  1U47 A;  3ASM A;  1S1V A;  2EX3 A;  4KHY A;  1X1P A;  3OYN A;  4Z4I A;  1FKP A;  3VQ8 A;  2IDO A;  2WOM A;  4ID5 A;  3CG7 A;  2FBX A;  4E89 A;  3LAM A;  1NKC A;  5D3G A;  1NGM A;  4ROE B;  2NOH A;  2X78 A;  3DMJ A;  1YVU A;  3QIN A;  4CF8 A;  3SQ2 A;  1J5O A;  2XO7 A;  4E0D A;  3TR8 A;  1KRP A;  2GBZ A;  2NOL A;  2FBT A;  3NAE A;  2X74 A;  1BL3 A;  3H08 A;  4CEQ A;  1VSE A;  3LDS A;  3LWL A;  2I5W A;  1BI4 A;  5KGX A;  1RBT A;  4FM1 A;  3AVA A;  3S3N A;  2HMI A;  2DTU A;  3LP1 A;  4FJH A;  3D45 A;  2RN2 A;  3V1O A;  3MAQ A;  3CYM A;  1KCF A;  1KFS A;  4OGC A;  4FLW A;  4HUG A;  3MXI A;  2NUB A;  1RT7 A;  4DQP A;  3AA2 A;  4FJK A;  4W5Q A;  1QNB A;  3S3O A;  1WSF A;  3S3M A;  2VG7 A;  1I3A A;  4FJX A;  2IV9 A;  4KKO A;  5K14 A;  4R5P A;  2XHB A;  2Y1I A;  1BIZ A;  1ZBU A;  2HHT A;  3RR7 A;  3I8D A;  1RT6 A;  1CXU A;  5KTQ A;  4Q11 A;  3I0X A;  3PX6 A;  3HPG A;  1JL2 A;  2YNI A;  3SYZ A;  1NKE A;  1Q9Y A;  2G8H A;  1YTF A;  1HPZ A;  1B9F A;  1L3U A;  3KD1 E;  1WSH A;  3VQP A;  2KQ2 A;  4IG0 A;  4DWI A;  5FDL A;  2QKK A;  2HHU A;  3LAK A;  4CE9 A;  1LWW A;  2BE2 A;  4O5B A;  5CYM A;  3OYA A;  4FJG A;  4KHS A;  3QEI A;  2BGG A;  2B6A A;  3G0Z A;  4C8K A;  3JSM A;  3TWH A;  4ELU A;  2Z1I A;  3E01 A;  4BWJ A;  4EP5 A;  3TAN A;  4BE0 A;  1NJZ A;  3LPT A;  4ZTF A;  1T8E A;  4RW8 A;  5KGW A;  5HRP A;  2P5O A;  1RT4 A;  2DY4 A;  1KTQ A;  4W5N A;  4KFB A;  4CJ5 A;  4DTP A;  3KLI A;  1GOA A;  1F21 A;  2ATQ A;  3PUF A;  2VWK A;  3ZSQ A;  2Y1J A;  3KLH A;  1J54 A;  1HYV A;  3I0W A;  3TAG A;  4CJT A;  3AO3 A;  1R0A A;  4OLA A;  1RDA A;  4FJI A;  2HB5 A;  1RT5 A;  3KIO A;  4IDK A;  3UIQ A;  2OPR A;  3NE6 A;  1BI4 B;  1Y97 A;  4I2P A;  3AO5 A;  4CHZ A;  4CJQ A;  3RMC A;  4QCL A;  2PYL A;  5JS1 A;  2BDP A;  3BDP A;  3DLG A;  4CGF A;  4HCC A;  4DSJ A;  4CJU A;  1TV6 A;  4QOZ B;  4B08 A;  5T7B A;  5J2N A;  4F4K A;  1TL1 A;  4FLY A;  1L3S A;  4FJN A;  4QAG A;  4Q5V A;  3N89 A;  3ZT3 A;  3OSM A;  3SI6 A;  4NCG A;  2NOZ A;  4JRP A;  4XIU A;  3WNG A;  4C8N A;  4CEF A;  4CFD A;  3L2V A;  4NCA A;  1JKH A;  1KYF A;  1NJX A;  1VK0 A;  1WSJ A;  3NGY A;  2HHS A;  3VQE A;  2D5R A;  1SUQ A;  1ZYQ A;  4Z0U A;  4FLU A;  3QEW A;  1FN7 A;  3AA3 A;  4CJP A;  1JXE A;  4BDP A;  4DSI A;  4GMJ B;  2IC3 A;  2HVH A;  1QN9 A;  3HYF A;  4CER A;  3AVJ A;  3TAP A;  4OPK A;  1C0U A;  1RBS A;  3HPO A;  2D0B A;  5C42 A;  1U45 A;  1S1U A;  3M8P A;  5HRN A;  3AVM A;  4CHO A;  4E7L A;  4CED A;  4DFP A;  1DTT A;  1CXQ A;  5FRM A;  1U4B A;  2HND A;  3PO4 A;  2RKI A;  2YNG A;  3VQ4 A;  1D9F A;  2A1S A;  1RT3 A;  1EX4 A;  1VSI A;  1JLF A;  2ZE2 A;  1RBR A;  1RNH A;  3AV9 A;  2QXF A;  3V1R A;  3VQB A;  3L8B A;  3DLH A;  4O0J A;  4BE2 A;  4RW4 A;  4CGH A;  1ZBL A;  1NK5 A;  4CF2 A;  2DFF A;  4CJS A;  1C9B B;  3DOK A;  4ROC B;  3THV A;  1LW0 A;  1LWF A;  3DOL A;  3G10 A;  2ITG A;  4KPY A;  3LP0 A;  4CEA A;  3L2U A;  4HUE A;  1NK9 A;  3HP9 A;  4N41 A;  5IYC P;  1ASV A;  3PO5 A;  3WNH A;  1UOC A;  3EZ5 A;  1XHX A;  3T1A A;  4DMN A;  3OYI A;  3B6P A;  5J1E A;  3VQ6 A;  1LAV A;  4KAZ A;  4J2E A;  4CCH A;  1BIS A;  4FK2 A;  2P5G A;  1S1W A;  2JGU A;  4CFB A;  1KVB A;  4OLB A;  4MQ3 A;  1O1W A;  4F8R A;  1QN5 A;  1D5A A;  3ALY A;  2RPI A;  1MP9 A;  4FM2 A;  4M3R A;  2XY8 A;  3RRH A;  3NF6 A;  1U04 A;  5C25 A;  3HVT A;  2HNY A;  4CK3 A;  1NKB A;  4M3Y A;  3AVL A;  4Z4F A;  4FK0 A;  1TK0 A;  2O4G A;  3ZT0 A;  2IV8 A;  1C6V A;  4CGJ A;  2HHV A;  3AA4 A;  3U6F A;  4DS4 A;  4I8O A;  1LWE A;  4CJ4 A;  3QNO A;  4KTQ A;  1WNS A;  1A5V A;  3V6D A;  2LSN A;  4DUL A;  4EJZ A;  1FK9 A;  1ASW A;  3MXJ A;  1B9K A;  3NH0 A;  4YNQ A;  1JL1 A;  4FLT A;  1HMV A;  5KRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...