2D0AA

Crystal structure of bst-rnase hiii
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
308
Chain Sequence
SNYVIQADQQLLDALRAHYEGALSDRLPAGALFAVKRPDVVITAYRSGKVLFQGKAAEQEAAKWISGASASNETADHQPSALAAHQLGSLSAIGSDEVGTGDYFGPIVVAAAYVDRPHIAKIAALGVKDSKQLNDEAIKRIAPAIMETVPHAVTVLDNPQYNRWQRSGMPQTKMKALLHNRTLVKLVDAIAPAEPEAIIIDEFLKRDSYFRYLSDEDRIIRERVHCLPKAESVHVSVAAASIIARYVFLEEMEQLSRAVGLLLPKGAGAIVDEAAARIIRARGEEMLETCAKLHFANTKKALAIAKRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and structure-based mutational analyses of RNase HIII from Bacillus stearothermophilus: a new type 2 RNase H with TBP-like substrate-binding domain at the N terminus
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords ribonuclease HIII
total genus 100
structure length 308
sequence length 308
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
A PF11858 DUF3378 Domain of unknown function (DUF3378)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2d0aA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2d0aA02
3KD5E 2HHSA 1JLGA 2P51A 3AO1A 3AVGA 4M41A 3OYJA 1WSFA 3LALA 2VG6A 4GVMA 5IYDP 3HS9A 2BE2A 1S1XA 3TI0A 1JLQA 3KLGA 1Y97A 3SV4A 3ZT0A 2Z8UA 3ULDA 3C6TA 4CJ4A 4E7HA 3HS8A 2ZQBA 1XHZA 3AA5X 4LSNA 3ZSZA 3RMBA 4JS5A 1HRHA 1BGXT 4ROCB 1CXUA 2B4JA 3HL8A 1SL2A 4M3RA 2XHBA 4CFAA 3THVA 1TGOA 4C8NA 4AHTA 4O0JA 2OZSA 4YNQA 2F8TA 5JS2A 4FJ5A 5IYCP 1WSIA 3CM5A 3L3UA 2HB5A 1QNCA 3V9ZA 5KGWA 3U6FA 4E19A 1NOYA 4FW2A 4CE9A 4QOZB 1X1PA 3QEPA 1S5JA 3LWLA 3OS0A 1U45A 1NKCA 1HYZA 4FJ9A 4NCAA 3SCXA 4M42A 4CF9A 5KGXA 4CGHA 2Z1GA 3OYAA 3SZ2A 4KV8A 4FJKA 5JS1A 1JXEA 1A5WA 1WSEA 4CEBA 4I2PA 2WOMA 4CHPA 1PZDA 4DU4A 2Y1JA 4C8LA 4DSLA 4F4KA 1VOKA 1NVPA 1U04A 4FJ7A 3AVKA 1GOBA 1TK8A 2KFNA 4DSEA 2DTUA 1ZBIA 4ZHRA 1VRUA 4BE1A 3DLKA 5IYBP 4OGEA 4CEAA 4HUEA 1IKXA 4KHNA 4FJ8A 2I5JA 3LP3A 5E41A 3HVRA 4I2QA 3VQ9A 3SYZA 4DF8A 5I3UA 1RT6A 3IS9A 1G15A 4NCGA 3QNOA 3S3OA 1VSLA 3BGRA 1RBTA 1U49A 5CZ1A 2OPQA 4DSIA 1B9KA 1NKEA 1J53A 3C94A 4DU3A 1UA1A 4M3TA 3RTVA 4B08A 2KZMA 4RG8A 1TAQA 4DQQA 4Z4IA 4FZXC 2IAJA 1I3AA 2QXFA 4KTWA 1EETA 2X6SA 4HCCA 1UWBA 3HP6A 3AA3A 3SQ4A 1RDAA 3VQ7A 4CGIA 2HHWA 5CZ2A 1KLNA 2Q3SA 3AVCA 4CF1A 2VWKA 3AO3A 4J2DA 1VSEA 1EP4A 2IC3A 1DTQA 1YT3A 3PUFA 1RT7A 2YHBA 3AVFA 2RN2A 2DY4A 1XHXA 5I42A 1NJYA 2IGIA 3CFPA 4FLZA 4FJIA 3SUOA 4M3WA 2E4LA 4CGGA 1UA0A 2D0BA 3TAEA 3MEGA 3K2PA 3PX4A 2HHXA 4CHQA 4DSFA 3DLHA 4HCBA 4FCYA 1XWLA 1HPZA 3QETA 4CJEA 1XC9A 2O4IA 2HHVA 4W5QA 3C6UA 4M3ZA 2WONA 3VQ4A 4AHVA 4IFYA 1TKZA 1T03A 4Q0BA 2AJQA 5T7BA 1VSKA 3D0PA 1L3SA 2NUBA 3G0ZA 3OS2A 1QSLA 2HW3A 1RBSA 1CZ9A 3KIOA 4H8KA 3WNFA 4I7FA 1WAJA 3NFAA 4CJTA 3KKSA 3QIPA 3LWMA 3SPYA 3PO4A 3OYHA 4N47A 3DRRA 3O3GA 3EY1A 1YTUA 3V1QA 5C24A 2G8IA 4DQSA 1TBAB 4L8RB 2YNHA 1SL0A 4QAGA 1Z26A 4KHWA 1E42A 1KCFA 1RDBA 2ATQA 1B9FA 4KAZA 2R7YA 4OLBA 4QCLA 4KHSA 4DTRA 1ZBFA 3CFOA 4CJ3A 4FZYA 4KHUA 3OYMA 3MAQA 2VJ0A 3K5MA 5J2NA 3AV9A 5J2QA 1RT2A 1F21A 1FK9A 1VSDA 3UIQA 4KRFA 3VQ8A 3OYCA 4CGFA 3KD1E 4CJWA 4RW6A 5FRMA 1N5YA 4O0IA 4E89A 3K59A 3AO5A 4WZSD 3AVLA 3T3FA 1JXBA 1NKBA 1WLJA 1D9FA 4FJHA 1QN4A 4DU1A 1BCOA 3V1OA 4CF8A 4OLAA 3DOLA 3FFIA 1HNVA 1BQMA 5EU7A 1Q9XA 3VQAA 3HO1A 1REVA 2FBYA 3TWHA 3QEVA 1KVAA 1TKTA 4ID5A 4E7LA 3TAFA 4M45A 4CERA 4E0DA 4NCBA 2Z1IA 3DLRA 3NH0A 5HRPA 1ZBLA 4J2BA 3F73A 4FLYA 4BWJA 4FM1A 1GOCA 3KK2A 4FXDA 3RR8A 4IG3A 1VSJA 4PQUA 4O44A 4FJNA 2D5RA 2YKNA 2HHTA 2IV8A 3IG1A 3NGYA 4AILC 1MU2A 3PX6A 1S1UA 2B5JA 1S9EA 3OYLA 4BDYA 2RF2A 5KRSA 1TKDA 3U3YA 2XY8A 3S3NA 4C8OA 3VN5A 3ISNC 3NF8A 4OKJA 4Z0UA 1QN9A 3OVNA 4ZTFA 3SPZA 2ETJA 1SKWA 4C8KA 1BL3A 4FLVA 3SUNA 4JS4A 2PY5A 1WNSA 4LH4A 3KJVA 3OY9A 4E1MA 1TK0A 3EZ5A 1NK0A 2D0AA 3LDSA 4RW8A 3WNHA 4DTMA 2VG5A 4HUFA 1JL1A 2A1RA 1WSHA 3ZSWA 1QSYA 2X78A 2HHUA 3AVBA 4OKKA 3EIKA 4KI6A 3CQ8A 4IBNA 1WSGA 3S9HA 1A5VA 3KLIA 4FJGA 4MQ3A 3K5LA 3KK3A 2G8KA 5KTQA 1VTLE 1JLAA 3L3VA 1X9MA 1CDWA 1W9HA 1QTMA 2G8UA 1TBPA 1VRTA 2X6NA 3U3GA 3M8RA 3S3MA 4E7JA 1QN6A 1UOCA 4FLUA 3P83D 4CIEA 4FVMA 4E7KA 1KRPA 4KB0A 3HK2A 1TL3A 1N6QA 1U48A 1TAUA 1KVBA 4PA1A 1YTAA 1NJZA 4NYFA 4E1NA 4CJPA 1SKRA 1HMVA 3PY8A 4B9SA 4KB1A 3OYEA 1DTTA 4C8MA 4W5NA 4BACA 1D9DA 4DTXA 4FW1A 2G30A 1ASUA 3AVMA 3T19A 3OYGA 4DFPA 3TANA 1B92A 2P1JA 4TSXA 4DFMA 4PUOA 2G8HA 3LP2A 4KHYA 4KREA 1VTOA 5FROA 4DF4A 3LPTA 1HNIA 4HTUA 1YTBA 2YKMA 4FLWA 4KTQA 4N41A 3AVIA 5D3GA 1C0MA 4YFUA 4CJSA 3SNNA 1J5OA 3LZJA 4AHUA 2QK9A 1ZBHA 4FK0A 2XY5A 4IFVA 2IOCA 4EP4A 3KKRA 3AA2A 4IG0A 4B9LA 2BDPA 5KRTA 3O3FA 2Z1HA 4Z4HA 4B9UA 1RBVA 1S6QA 1S9GA 3HP9A 3NAEA 5DK5A 3ZT2A 1LV5A 2QKKA 2VWJA 1RTJA 4CJUA 2KW4A 2HVIA 1QQCA 1SL1A 4Z4EA 1VSIA 4FK2A 1VSFA 2GUIA 3O4NA 4LH5A 5FDLA 4B8CA 4DQRA 1QE1A 1S1TA 1JLCA 3WNEA 3HJFA 1U4BA 1NJXA 3CFRA 2RPIA 3CG7A 1JL2A 3LP0A 1ITGA 1RT5A 4LSLA 4AHSA 4AHCA 2G8FA 1HYSA 4RW9A 3V1RA 3VQBA 5HROA 4B0AA 3LP1A 3V9UA 1KY6A 3OYDA 4CHYA 3O3HA 5HBMA 4F2SA 2JLEA 3DRSA 3RMDA 4KHQA 1NK7A 3QLHA 1IKYA 1D3UA 3K58A 4RW4A 3HXMA 4CF2A 1GOAA 1K6YA 1KTQA 3IAYA 3RMAA 4CFBA 1HJRA 1CZBA 5J1EA 3SQ0A 3LAMA 2P5GA 1BI4A 4ELUA 1TV6A 4RW7A 3T1AA 3DM2A 4IKFA 1BQNA 3ZT3A 3AVHA 1X9WA 2OA8A 3NDKA 2OPSA 3MEEA 3OYNA 1RBRA 2FBTA 3RRHA 1NK4A 3M8PA 3B6OA 3DI6A 1YTFA 2PZSA 2OPPA 3E01A 2Z1JA 2HNZA 3AO4A 3NGIA 3L2UA 3OC3C 1RDDA 1LWFA 4B9TA 1DLOA 3HVTA 3RR7A 5HRNA 4DLEA 4FJLA 3DLEA 4HVJA 4FM0A 1L3VA 4W5RA 3TR8A 2QKBA 3OYBA 4B9MA 4OKEA 1KFDA 3ZSQA 4CIGA 3OYIA 1VOLB 3KLFA 1WAFA 2KQ2A 4CGDA 3H1ZA 1QTPA 3VQEA 1ASVA 4CECA 4FYDA 3JYTA 1S6PA 3VQDA 3OCIA 1D5AA 2ZD1A 3I8DA 1QNBA 2LSNA 2YV0X 1VSHA 3OYKA 1W0HA 1S1WA 4LY7A 3L2QA 3SQ2A 3MEDA 1JLFA 3AO2A 4O55A 4W5TA 2P5OA 2F96A 4DQPA 3C95A 4JRPA 1LW2A 3V4IA 2BANA 4E7IA 1XI1A 1RTHA 4KTZA 5CYQA 4CHOA 4CGJA 2O4GA 1C0TA 3LZIA 1KSPA 4NYNA 1RNHA 1TK5A 2FC0A 4CEFA 3TARA 3V81A 1IH7A 1NK5A 1IO2A 4M3XA 4CCHA 1ZBUA 1WSJA 2E6LA 1RTDA 3B6PA 4F3OA 1QHTA 1RTIA 4N56A 1QN5A 3L2VA 1KYDA 3D45A 2G8WA 4FZZA 2D0CA 1HQUA 1KYFA 1C1AA 2W42A 3V9SA 3SUQA 5C25A 4FK4A 3DYAA 4CK2A 4FM2A 1C1BA 2GBZA 2GV9A 4ID1A 4Q5VA 1NK6A 1QSSA 2HVHA 1NGMA 4ELVA 2BGGA 4FJMA 1Q9YA 3AVJA 1BIZA 1SUQA 3VA3A 1IG9A 4J2EA 3HPOA 3V9WA 2Y1IA 1IKVA 3ZCMA 4I9QA 4OVLA 4KKOA 3SI6A 3TAPA 4CEZA 1D8YA 1I39A 4ROEB 5HLFA 4DLGA 4AHRA 5HRRA 4AH9A 3OS1A 4PWDA 4HHTA 3K57A 1R4XA 4DTNA 3K5NA 2YNIA 4LD0A 2DFEA 3A2FA 4Y1DA 3TAMA 3SUPA 1QN8A 1NOZA 2A1SA 3NBPA 4K8XA 4PY5A 4HUGA 4DTPA 3ZT1A 1SKSA 3NF9A 3ZSXA 3QINA 4Y1CA 3VA0A 3KTQA 4DFJA 1C1CA 4CIFA 4H4MA 1TGHA 1ASWA 2EHGA 4Z4GA 3HPHA 2KZZA 1HQEA 1T8EA 4BDPA 1RM1A 1L3TA 2F8SA 1WN7A 3DRPA 4O5BA 4DWIA 3SQ1A 4CESA 1NK9A 1A5XA 3RWUA 3SV3A 4MFBA 1QS4A 3OJSA 5K14A 3ZSVA 4CJFA 4R5PA 2OYQA 1RCHA 4CK3A 3TAQA 3CM6A 4GW6A 3P1GA 4K8ZA 2YNFA 1EXQA 4ICLA 4O4GA 4F3TA 3I0RA 1UAXA 2VG7A 5HRSA 5SWMA 5CY4A 4XIUA 1NH2A 2HMIA 4EP5A 1L3UA 3NF6A 1B9DA 3DOKA 3DLBA 3I0SA 4IDKA 1QN3A 4CJ5A 3MXJA 5FRNA 1J9AA 2YHAA 2HHQA 1Z25A 4B9VA 4CJRA 5J2MA 2IS3A 3NH2A 3DMJA 3AVNA 3G10A 4G1QA 4UQGA 3QNNA 1FKPA 3RRGA 2FBXA 3IRXA 5KI6A 4F8RA 1CLQA 3LAKA 4DFKA 2X74A 3QIOA 3KK1A 3MXIA 1QNAA 1T7PA 2XRIA 4KPYA 1NK8A 3VQQA 1W80A 1U47A 3DLGA 4M3UA 4N76A 1JLEA 1RILA 3M8SA 1QN7A 4CFCA 3OYFA 1EX4A 4F2RA 3QEIA 4CFDA 4DS5A 4DMNA 2DFFA 5DMRA 4Z4CA 4E3SA 3QESA 3RMCA 5HP1A 3H08A 4CJKA 1BCMA 3NH1A 1L5UA 3WNGA 3JSMA 4B9NA 4GMJB 2PYJA 4B3OA 3V6DA 3L8BA 2RKIA 4JLHA 3HYFA 4CJLA 1BIUA 4DSJA 2ZE2A 5J2PA 2HNDA 3ALYA 1MP9A 2E6MA 1LAVA 3AA4A 3HT3A 1YVUA 3LANA 2OPRA 3V9XA 1KYUA 3ITHA 4EZ6A 2MJ7A 2HNYA 1TL1A 3HPGA 2JGUA 1AISA 1C0UA 3HSTB 3BDPA 1IKWA 4BE2A 4CEEA 2IDOA 3LPUA 1LAWA 4B8AB 3NF7A 2XY7A 3M8QA 1FXXA 1VSMA 4N5SA 4ELTA 1RT4A 4CK1A 1PCZA 2OZMA 3AVAA 2IV9A 4OPJA 3CYMA 1QNEA 1S1VA 1T05A 1KFSA 2G8VA 1LWEA 4CEOA 1JKHA 3ZT4A 3KLEA 4CJVA 4CEQA 4DS4A 2XY6A 4ZTJA 1BHLA 1TVRA 4FJXA 3EYZA 4DSKA 2DFHA 1J54A 4EZ9A 4I9LA 4J2AA 1C6VA 3QEWA 3NGZA 3F9KA 3HM9A 3SJJA 2XO7A 1X9SA 4BWMA 3QERA 2FBVA 3NE6A 3KLHA 1EKEA 4BDZA 2KFZA 4KO0A 3O4QA 4W5OA 4H4OA 3L2WA 2ITGA 3MECA 1LW0A 1SV5A 3VQ5A 2B6AA 3VQPA 1RBUA 5CYMA 1Q8IA 3ZSRA 3OJUA 4DTJA 1KVCA 4BE0A 4OPKA 1QTSA 3MXMA 1R0AA 4Z4FA 3NHGA 3ASMA 4KFBA 3L2RA 4DTSA 1RT3A 1TKXA 3ZSOA 4DTOA 3PV8A 1RDCA 4CEDA 4FJJA 4DG1A 3TABA 1JFIC 3PO5A 1NJWA 4FLTA 3QO9A 3P5JA 4WE1A 3QEXA 5C42A 4M3YA 2KTQA 4JRQA 3NCIA 4OGCA 4CJQA 1VK0A 1RT1A 3VQ6A 3K5OA 4CF0A 4CHNA 4KI4A 3TAGA 1BI4B 1CXQA 1O1WA 1FKOA 4OJRA 1BISA 2YNGA 1HYVA 4FLXA 1ZYQA 2PYLA 4DTUA 3ZSYA 3PX0A 1KY7A 1KLMA 2EX3A 4CHZA 5SZTA 1C9BB 1LWCA 4DQIA 4RODB 3VQCA 1JLBA
chains in the Genus database with same CATH superfamily
4KH6A 2YHXA 1JLGA 3AO1A 3AVGA 3VTIA 3OYJA 1WSFA 1VQLN 5IYDP 1S1XA 4DULA 1Y97A 3R6MA 3C6TA 1HRHA 1C4GA 4M3RA 2XHBA 4CFAA 3BEXA 2ZJPL 4O0JA 3I0WA 4LF6K 1NJIO 1TUOA 1WSIA 4BRNA 4JD2B 2HB5A 2Y8QA 5KGWA 3QEPA 2F4VK 1HYZA 3WT0A 3VPZA 2A3ZA 4CGHA 3GG4A 5BR8K 1DGKN 3SZ2A 3A8YA 4IO8A 4KV8A 1JXEA 4A59A 4FJKA 5JS1A 4YOWA 3THWA 1T6DA 1PZDA 2Y1JA 1NVPA 1U04A 3VENA 5M1OA 4DSEA 2DTUA 4MDBA 4CEAA 3VETA 4DF8A 4I8OA 1RT6A 3H45C 1YVNA 1RBTA 2E20A 2OPQA 4DSIA 5BREA 3C94A 4DU3A 2KZMA 4B08A 5FPEA 1OH6A 1UWBA 1W2BM 1XMQK 4CGIA 1FN7A 3AVCA 3VF6A 1EP4A 1YT3A 3PUFA 3AVFA 4C1NI 5A2QO 1NJYA 4A5AA 4BQZA 4JI5K 1UA0A 2D0BA 3TAEA 2HBKA 3GL1A 3K2PA 5AQMA 3ID8A 2HHXA 3O8MA 1I94K 4FCYA 4L3QA 1TYQB 2P9LB 1NGEA 4AHVA 1TKZA 4Q0BA 3BF3A 5F1XA 2HW3A 4IEEA 4H8KA 3WNFA 3SPYA 1YTUA 1T6CA 4MLHA 1HNWK 2G8IA 1TBAB 4K42A 1YJNN 1Z26A 1E42A 2UU9K 1YQMA 3NVMA 1BA0A 4A57A 4AQYK 4WFBL 4DTRA 4FZYA 3L6QA 2VJ0A 5J2QA 1RT2A 1F21A 4DR6K 1MWKA 4JI7K 3M5RA 4CJWA 3A5LC 4O0IA 3O80A 2IVPA 1XNRK 1WLJA 1YUWA 4DU1A 3LDNA 3V1OA 4MLEA 4CF8A 3FFIA 2VGNA 1Q9XA 3QFUA 2A41A 3SLCA 4MRQA 4ID5A 4E7LA 3DLRA 3NH0A 4J2BA 2UUCK 3OHRA 1P5DX 1GOCA 4DR1K 1U2VA 2HL9A 1S22A 1VSJA 2HHTA 3IG1A 1BO5O 2HF3A 3PX6A 1S9EA 3EL2A 4BDYA 2RF2A 2QRCA 3W0LA 3H6EA 4IWVA 3QB0A 3OVNA 4ZTFA 3SPZA 1SKWA 4NXNK 3SUNA 2PY5A 1WNSA 3LDPA 4LH4A 3OY9A 3MDQA 1JDYA 2D0AA 2A1RA 2VG5A 3ZSWA 5AQLA 4OKKA 3EIKA 1WSGA 1A5VA 3O9SA 4FJGA 3K5LA 4RTFD 2G8UA 2NRZA 3BZKA 4FLUA 1GLLO 5JVHL 5E26A 3M1FA 4BREA 3WXKA 1KVBA 1TAUA 3C0BA 5BR9A 4JKGA 4E1NA 5AQUA 4EIAA 4B9SA 3OYEA 4C8MA 4DTXA 1ASUA 1B92A 4PUOA 3AGKA 4KTQA 2UUAK 5D3GA 2FGTA 2ZF5O 3HZ6A 2QK9A 2XY5A 4H0TB 4IFVA 3AA2A 4B9LA 4MO5A 3THYA 2Z1HA 3R8EA 4B9UA 1RBVA 3PIPL 3SJHA 3J81O 2QKKA 4CJUA 4BR9A 5C10A 1QQOA 4FK2A 3O4NA 4DQRA 4B8CA 3C7NB 2W40A 1JL2A 4LSLA 3N4PA 1HYSA 2D0OA 2OTJN 3O3HA 2O8EA 5LJVA 4X62K 1NK7A 2NRHA 3DJCA 3QLHA 4IZ9A 1N3CA 4JI4K 4RW4A 1KTQA 3O4WA 3SQ0A 3T1AA 5AQSA 5AZJB 2HKPA 2OPSA 3MEEA 4J8FA 1RBRA 2FBTA 4LFCK 3B6OA 3DI6A 1YTFA 1NGCA 3E01A 3HVTA 4FJLA 5CR4A 2GEMA 1P90A 3TR8A 1W97L 4B9MA 2QEXN 2JWLA 5LMNK 4OKEA 1VOLB 4CGDA 3H1ZA 1P8ZA 2CGKA 3OCIA 2ZD1A 2E2NA 3VEYA 1QNBA 2YV0X 4C23A 1HJOA 2AA4A 3OYKA 2GELA 3AO2A 4O55A 5AQZA 5TKWA 3VMFB 3UB5A 4E7IA 1QVGM 1C0TA 3HM8A 4DR2K 1KSPA 4D7RA 4JHDA 3E9PA 4M3XA 4CCHA 1ZBUA 1WSJA 2E6LA 1RTDA 2NLVA 1J6ZA 3L2VA 3CMAN 3D2EA 1GLBG 2D0CA 1HQUA 1C1AA 3V9SA 4FK4A 4B1WB 3CMEN 4ELVA 1Q9YA 3CCRN 3K9KA 4J2EA 1SQKA 2P9NB 3HPOA 3CVSA 1IKVA 4I9QA 4DB3A 4DLGA 5HRRA 4BRMA 4HHTA 1HU0A 4DTNA 1RDUA 4LD0A 1YIJN 4K8XA 4DTPA 3ZT1A 3KTQA 4LF8K 1NWKA 3DLLL 2OTLN 4CIFA 4CJ7A 4FO0A 3HPHA 4H03B 5AZJA 3SAHA 3A5MC 4CZLA 2F8SA 3Q7CA 3SQ1A 3CPEA 1GLJO 1NK9A 1A5XA 2NWVA 4MFBA 3SV3A 3VEVA 1SZ2A 4CJFA 2RHKA 4R5PA 4A2BA 4FWOA 5FPDA 3UKUB 3CM6A 4GW6A 3P1GA 5IT9O 3ATVA 4PKGA 4F3TA 2Z0FA 3CPWM 3I0RA 3OBYA 3OGDA 3HRGA 3CETA 3AGRA 4EP5A 5AQRA 5FRNA 2E8AA 2QWMA 5J2MA 3SAFA 3DMJA 3IMXA 2QA4N 4F8RA 2X74A 1Q86O 2OANA 3I56N 4KPYA 1W80A 3R3LA 1U47A 1JLEA 1RILA 1QN7A 1VQON 5IWAK 2I5WA 3WXIA 3QESA 1YJWN 5ADXA 3NH1A 3CCVN 3SNSA 3B8AX 3TE5A 3L8BA 4BGBA 4DSJA 5J2PA 3TSQA 1VQNN 3FZMA 2E6MA 1LAVA 1YVUA 4DR5K 4BC4A 1KD1O 2JGUA 2QLVA 3EKSA 1IKWA 2IDOA 3LPUA 2FKMX 3M8QA 4OPJA 4FPBA 1T05A 1IBMK 5BMNA 2VWBA 5JMVD 4JK7A 2XY6A 3I8BA 3F0ZA 4FJXA 4DSKA 4EZ9A 3NGZA 5M1KA 3SJJA 2XO7A 1EQYA 1S72N 1K8KA 2NOEA 2KFZA 4KO0A 1YJ9N 4IOXA 1R0AA 2QXLA 1KVCA 3G4SN 4BE0A 3DXKA 1JCFA 4DTSA 3PV8A 1RT3A 1TKXA 4TPSA 1RDCA 4CEDA 4FJJA 4DG1A 1NJWA 1ZBSA 4M3YA 4JRQA 4CJQA 1RT1A 3K5OA 4CF0A 3OH9A 4CHNA 3TAGA 1BI4B 1O1WA 1FKOA 4JKBA 2YNGA 5C15A 4FLXA 3SMSA 2YHWA 1BWFO 2NRXA 3ZSYA 1HR0K 5SZTA 1C9BB 4B1ZA 4RODB 4IO9L 2P51A 1FJGK 3LALA 1XNQK 3TI0A 2BE2A 1JLQA 4PKIA 4RWTA 3KLGA 3ULDA 2Q0UA 1XHZA 2ZQBA 4NB4A 3ZSZA 4BRKA 4K0KK 4JS5A 4ROCB 3T4NA 4OO1J 1CXUA 1SL2A 3KWIA 4C8NA 2I7PA 2O8BB 3L3UA 4YY3K 2YHYA 1P5GX 4BRDA 4QOZB 4M42A 3O9UA 3SCXA 2NLXA 3MN6A 5KGXA 4GY2B 2Z1GA 2CH5A 4EHUA 3NVKA 2WOMA 3P39A 1VOKA 3JXUA 5GIOA 5GAGP 4U7BA 3AVKA 3EN9A 2KFNA 5LL6Z 3RPJA 3J7ZO 1OKJA 5IYBP 4OGEA 1EBMA 5AFUH 2HHQA 2I5JA 3HVRA 4OPAA 2MZ8A 5CE3A 2O8DA 3ENOA 2HBJA 1S3XA 4FWMA 3S3OA 3LDLA 1U49A 3H46O 3EEQA 4M3TA 4KHPK 1TAQA 2QXFA 4KTWA 1EETA 2X6SA 4HCCA 3SQ4A 1NMNA 3AA3A 4MO4A 1OH5A 2Q3SA 4CF1A 3AO3A 1YAGA 3VEWA 3ENOC 5I42A 4CD3A 1W7AA 3QETA 4CJEA 1CZAN 3VQ4A 2QWQA 4IFYA 1ESVA 2NUBA 3OS2A 1CZ9A 1N5YA 1WAJA 3NFAA 3QIPA 3T69A 4WQ4C 3OYHA 5C24A 4DQSA 1SL0A 1HNXK 4QAGA 5AQYA 3CC4N 1RDBA 1B9FA 4B3SK 3D4VA 2W41A 4QCLA 4DHYA 4KHSA 4AF1A 1ZBFA 3CFOA 4CJ3A 2YJFA 1DT9A 4CZEA 3OYMA 3MAQA 4KHUA 3CJ7A 1DKGD 4FWNA 5J2NA 5EOYA 1FK9A 4KRFA 3VQ8A 3F9MA 4CGFA 3UKRA 3OBWA 3VEZA 1NMDA 1G99A 1WQAA 4WZSD 2E1YA 3CF5L 3T3FA 4WYBA 3VGKA 1D9FA 4JI1K 1BCOA 3ID6A 4M7YA 4OLAA 3DOLA 1BQMA 4B1YB 3VQAA 5KQDA 1NGGA 3ULEA 2OOYA 2GWJA 1KVAA 5KPRA 4B1XB 1HX1A 1X3NA 4IOAL 2LAEA 5HRPA 1ZBLA 3F73A 3OW2M 4BWJA 3CWSA 3KK2A 3CIPA 4O44A 4FJNA 2D5RA 3UKUA 2HZMA 3NGYA 1MU2A 1OVYA 2B5JA 4BR0A 3OYLA 4LF5K 4UY8O 4IJAA 2XY8A 5DM7L 5GAEP 3C6AA 3IUCA 4IEIA 2ETJA 2ITMA 4DV0K 1BL3A 2A6AA 4Q11A 3T1YK 1GLEG 1VAZA 3WXMB 5TKYA 1TK0A 2O8FA 3EZ5A 1NK0A 3OTOK 3LDSA 2VGMA 4RW8A 4HUFA 1JL1A 4JKEA 3O1WA 3S9HA 3KLIA 4MQ3A 2G8KA 3KK3A 4DV5K 3L3VA 1CDWA 1W9HA 1C47A 4DR3K 1QTMA 1TBPA 2X6NA 3U3GA 3M8RA 3S3MA 3P83D 4CIEA 3HI0A 4FVMA 3CQYA 2J4RA 1NJZA 4NYFA 4CJPA 5C2DA 3C04A 1HMVA 5M1NA 5KL0A 3AVMA 3OYGA 2BTFA 5AQOA 3NA5A 4KHYA 1VTOA 4OPHA 5AQXA 4FLWA 3AVIA 1NGHA 2WBNA 2Q97A 2ZFDB 3I0XA 5KRTA 2ZJQL 4BRGA 3F5TA 3ZEUB 3HP9A 3NAEA 4OX9K 3ZT2A 1E3MA 1LV5A 2VWJA 1Z6RA 4BR4A 3J7YP 1VQPN 3ZX3A 2HBMA 2FF6A 1JLCA 3WNEA 3HJFA 1U4BA 1NJXA 4JYAK 2RPIA 2JOIA 3CG7A 4LFBK 4AHCA 2G8FA 4BRQA 4B0AA 1KY6A 4F2SA 2JLEA 1N8RO 3NMUA 5AZIB 1IKYA 4WQ5C 4CF2A 4FSVA 1Q81O 4FL9A 1HJRA 5J1EA 2P5GA 3LAMA 1BI4A 4RW7A 4FOEA 4BGAA 1Q9UA 3DM2A 2O8EB 4IKFA 3OLPA 4CZMA 4WFNL 3CCUN 2OPPA 2ZWHA 2KLAA 3AO4A 1RDDA 4BVPA 3PLAA 4W5RA 2FXUA 3OYIA 3FGUA 2NZTA 4HJHA 3VQEA 1T44A 4NXMK 4CECA 3JYTA 1NG9A 2D1KA 1KFIA 1OVQA 5JVGL 5EPCA 1JLFA 2P5OA 5FPMA 2F96A 3C95A 4JRPA 4X66K 1RTHA 4KTZA 2GUPA 4CGJA 1K35A 2O4GA 4NYNA 1TK5A 3RSMA 3CJ9A 4CEFA 3CWUA 2NRRA 4A61A 3H1QA 4F3OA 4FWRA 2W42A 5E84A 3SUQA 4FVUA 4CK2A 1C1BA 1QQNA 2P9SA 2HVHA 2BGGA 2QWLA 4HTLA 3TTDA 4OVLA 3SI6A 4YOXA 4EAHD 1NM1A 1BU6O 5HLFA 4PWDA 4C1NK 2HL8A 3OS1A 3K5NA 1KAZA 2YNIA 2DFEA 2A1SA 4BG9A 1DIZA 1C1CA 4H4MA 2QWRA 1TGHA 2EHGA 4EAGA 3D6RA 4Z4GA 1T8EA 2VYPA 2E1ZA 4CD1A 4BDPA 3UW2A 1L3TA 5M1QA 1WN7A 3N4QA 1N33K 1NLVA 3RWUA 3OJSA 1K2YX 4K8ZA 2YNFA 1IG8A 3A5OC 1U2VB 1LWVA 3O1BA 2V92A 2PBDA 1NH2A 4JEPA 1VQ9N 1B9DA 4CJ5A 1J9AA 1YF5L 3CHWA 1ILYA 4G1QA 3AVNA 3ZLJA 3ZX2A 4MDAA 2FBXA 5KI6A 3MXIA 5AQGA 3QIOA 2Q36A 2XRIA 5CHIA 3U8XA 1NK8A 3U4LA 5GAHP 3DLGA 4M3UA 1XSZA 2NVMA 2NOBA 3QEIA 4DV7K 1YI2N 5AFUA 2BUPA 4Z4CA 4E3SA 3L0QA 1NGJA 2W6LA 1J3MA 1BCMA 5GIPA 1L5UA 3JSMA 4GMJB 2PYJA 1QVFM 2RKIA 4CJLA 1BIUA 2Q0RA 4H0YB 2HNDA 2P9NA 4YOTA 1MPGA 3HT3A 4GKKK 1NGIA 3V9XA 1KYUA 2MJ7A 3GOIA 1TL1A 2QW9A 4BE2A 3O9RA 5ELZA 1LAWA 2XY7A 5M1FA 1M1KO 1FXXA 1NGFA 4N5SA 4ELTA 1PCZA 3VEOA 3CCMN 3CYMA 1KFSA 3KLEA 3ZT4A 3RVCA 4CEQA 1Z05A 4WXAA 4DS4A 3DPTA 4JKCA 2FSJA 4ZTJA 2E2OA 1BHLA 4ILHA 4DV6K 2DFHA 1J54A 3C6HA 2WUSA 1UT4A 2F7TA 3QEWA 2JHJA 3VGMA 2FBVA 1MWMA 3NE6A 3KLHA 1EKEA 4DUZK 4W5OA 4H4OA 2B6AA 1RBUA 4FWSA 4B1UB 3ZSRA 3MXMA 1QTSA 2ZJRL 1CLQA 2D0PA 3DPUA 3ENCA 3QEXA 5C42A 2KTQA 3CJAA 3NCIA 1H1VA 1VK0A 3OSTA 3SBGA 5BPNA 1QHAA 1WBDA 4B3TK 2VQFK 5B8HA 4OJRA 5DM6L 3BY5A 4BROA 3CJCA 3U9DA 1JCGA 1JCEA 4DTUA 2PYLA 3J7AP 3PX0A 1KLMA 2RE2A 4JI6K 2IIRA 3VQCA 4FOIA 3OH6A 3KD5E 4JI8K 2HHSA 4M41A 4GVMA 4BR5A 3SV4A 2Z8UA 4XEIA 4I6MA 2NOHA 3C7NA 4CJ4A 3HS8A 1M90O 3RMBA 3O08A 1NNEA 1VQMN 2B4JA 3MX5A 2GTDA 4CI6A 4AHTA 2E5LK 2OZSA 4YNQA 5BPMA 4FJ5A 3CM5A 4E1JA 4H5TA 3U6FA 1NOYA 4FW2A 3CC7N 2O8CA 4CE9A 1X1PA 1S5JA 3LWLA 1U45A 4FJ9A 4NCAA 1LCUA 2NRVA 4Z94A 1WSEA 2QWPA 4CHPA 4F4KA 3CCLN 1YQKA 3R9PA 2NOZA 3A0IX 4ISEA 2HHHK 1ZBIA 4ZHRA 1VRUA 2FF3B 1SS6A 5BN9A 4BRHA 4FJ8A 3LP3A 1KAYA 3SYZA 4I2QA 2W6KA 3IS9A 1VSLA 4FWPA 3CCSN 4YOVA 1KQSM 1J53A 1QZ5A 3RTVA 4DQQA 4Z4IA 1NGAA 5AQNA 3VQ7A 5CZ2A 1OH7A 1KLNA 2VWKA 4J2DA 2IC3A 1TUYA 1RT7A 2YHBA 4KH5A 1N34K 2DY4A 4LF7K 2IGIA 4M3WA 4FJIA 3SUOA 3D2EB 3MEGA 3SAGA 3CWAA 1YITN 4CHQA 4DSFA 3DLHA 4HCBA 2YCHA 1XC9A 4JI3K 3C6UA 3IKMA 1T03A 1VSKA 3OA9A 1RBSA 3KIOA 5BRHA 4IFEA 4I7FA 4CJTA 3PO4A 3VESA 3EY1A 3DRRA 4FWLA 3V1QA 4L8RB 2YNHA 3ZETB 4KHWA 1KCFA 2ATQA 4KAZA 1Y64A 4YHHK 4GVEA 4OLBA 2EWSA 3FZKA 2V51B 1K9MO 2JWKA 4BG8A 3HBTA 3K5MA 3AV9A 3HOTA 4B3MK 1VSDA 3UIQA 3ENHA 3OYCA 2VQEK 2D4WA 4EAJA 4B9QA 3L4IA 3MX2A 3DXMB 4E89A 3K59A 3AO5A 3MCAB 3E9LA 4NLCA 1PVSA 1REVA 3TWHA 5AQVA 3QEVA 3AAPA 3TAFA 4FPAA 4CERA 2IVNA 4NCBA 3PMGA 3IDHA 3BP8A 4CVNE 2DKAA 4JAXA 4FM1A 4G9ZA 4FXDA 4IG3A 4DKWA 4PQUA 4CBWA 4EAKA 3EZWA 2IV8A 1BDGA 2E2PA 3HTVA 2GWKA 1Q18A 1V4TA 3S3NA 4QG5A 3VN5A 4QS7A 4CZIA 1HUXA 4OKJA 4Z0UA 1IJJA 1QN9A 5FPNA 4C8KA 2DKCA 4FLVA 3JS6A 2FKFA 1YQLA 4DTMA 3WNHA 5F2RA 1WSHA 3G6EN 3AVBA 5C12A 5GADP 2V7YA 3T1HK 3CERA 3LM9A 3P4IA 1JLAA 4YDUA 2UUBK 3C65A 3QBXA 1RGIA 4E7KA 2HZSA 5FLXO 3HK2A 1ATRA 2V9JA 3CWTA 1TL3A 1N6QA 4LC9B 5GINA 1SKRA 3PY8A 5F9CA 1GLDG 1DTTA 3TSPA 4W5NA 3WQUA 4BACA 1D9DA 2PFUA 2G30A 3GDQA 1NU0A 2G8HA 3LP2A 4KREA 3ATUA 2P9KB 1HNIA 3LPTA 4DUYK 4HTUA 3VF2A 1YTBA 2YKMA 3WUHA 4N41A 4YFUA 5KPTA 2BH1A 2H4LX 5AN4A 4FWKA 4EP4A 2WTUA 2JHNA 3KKRA 3BF1A 5JLHA 3EE8A 4O5FA 4JI2K 4Z4HA 3I33A 2GX9A 1S6QA 2P9IB 1S9GA 1WJWA 1RTJA 2HVIA 3TPQA 1QQCA 1SL1A 4Z4EA 4LH5A 2GUIA 1QE1A 1S1TA 2A42A 1C0GA 1M3QA 3LP0A 1ITGA 4AHSA 1RDWX 3V1RA 3VQBA 5HROA 3LP1A 1UL7A 3OYDA 4CHYA 1GLAG 5HBMA 4KHQA 2A5XA 3K58A 1D3UA 3FLCO 4X64K 3HXMA 1GOAA 1K6YA 2ASMA 2V7ZA 2AP1A 1OH8A 1VQ4N 2QWNA 1TV6A 1BQNA 1IBKK 2NRTA 4IOCL 3ZT3A 3AVHA 1ATNA 3NDKA 3OYNA 3RRHA 1WUAA 5KPZA 3THXA 1NK4A 3O9QA 2Z1JA 3NGIA 4EJYA 3L2UA 3OC3C 1LWFA 1DLOA 3RR7A 4FM0A 2QKBA 2NOLA 4DQ8A 4WX8A 1KFDA 2KQ2A 4B3RK 1QTPA 4FYDA 1ASVA 1S6PA 1D5AA 1TUUA 2HBLA 3I8DA 3ZETA 4FWQA 4LY7A 3L2QA 4K41A 4W5TA 1XI1A 3V4IA 4H0XB 4YOYA 5CYQA 4CHOA 1X3MA 4WF9L 3LZIA 1RNHA 3TARA 1DEJA 3V81A 1IO2A 1TYQA 2P9LA 2VCPA 1V5SA 4EFHA 4BC3A 1QHTA 1RTIA 4N56A 1QN5A 5AQFA 2G8WA 2QR1A 5C25A 3DYAA 1NK6A 4ID1A 3MN5A 1KC8O 4BR7A 3OSMA 1QQMA 1BIZA 3AVJA 1GLFO 1IG9A 2Y1IA 3MN9A 1YHQN 4KKOA 1D8YA 4CEZA 1EO1A 1I39A 4ROEB 3D2FA 3TU5A 3A2FA 3SUPA 3OSEA 3Q7BA 4HUGA 2V8QA 1SKSA 2O8FB 2F7LA 4Y1CA 4JI0K 1VQ7N 2KZZA 1HQEA 1RM1A 1QZ6A 3KVGA 4CFFA 3DRPA 5M1PA 5BRDA 3SBTA 4PKHA 5K14A 3ZSVA 5JMVA 2ZM6K 2OYQA 3EAYA 4IL8A 4O4GA 1UAXA 2VG7A 5SWMA 4JD2A 4XIUA 4RCHA 3ZYYX 2HMIA 1L3UA 3NF6A 3S41A 3DLBA 3I0SA 1QN3A 4EHTA 3D7QA 2P9IA 4BRAA 1Z25A 4B9VA 1MA9B 3NH2A 3G10A 5JICA 4UQGA 1FKPA 3KK1A 1HNZK 1QNAA 4EJZA 4N76A 4AM7A 3ULXA 3OYFA 4H5NA 2P9KA 2A40A 3E9OA 4CFDA 5AQHA 3UKRB 4DMNA 4DS5A 5DMRA 3RMCA 5HP1A 2OOXA 1X9JA 3WNGA 4ISFA 4B9NA 4B3OA 2KHOA 3V6DA 4JLHA 3HYFA 1GLCG 2ZE2A 3K0SA 2QTDA 3ALYA 2KKZA 4JKGB 3AA4A 3LANA 4CBXA 3ITHA 4EZ6A 1AISA 3BDPA 3MWTA 2QREA 4CZGA 1WOQA 2OZMA 3AVAA 3R1XA 4XH5A 2IV9A 1QNEA 1S1VA 4H5WA 2G8VA 4CEOA 1JKHA 4QS8A 1KO9A 3FZLA 4GV3A 4HWIA 4JKDA 4CBUA 1TVRA 2E2QA 4ILGB 2HOEA 1J5EK 2EHBD 4I9LA 4J2AA 4NLBA 3HM9A 1X9SA 3SMPA 4CZHA 3O4QA 4CZFA 2ITGA 4YORA 3VQPA 5CYMA 1Q8IA 4OPKA 3ASMA 4KFBA 3L2RA 3ZSOA 4DTOA 4WCEL 5BN8A 1JFIC 3TABA 3PO5A 4FLTA 3QO9A 3P5JA 4WE1A 1XQSC 4YDUC 3VQ6A 3A5NC 2CGJA 3PSFA 4BRFA 1BUPA 2FLOA 1CXQA 1PCMX 3LM2A 4BJUA 1HYVA 3GE1A 4GKJK 2FSKA 4KBOA 2EX3A 4CHZA 1LWCA 4DQIA 1NGDA 1JLBA 1T3VA 2VG6A 3HS9A 4D7QA 2UXCK 1HPMA 3ZT0A 3DXMA 5AQTA 4E7HA 3AA5X 4LSNA 3CVTA 1BGXT 2O8BA 1M5Q1 2P9PB 1XMOK 3ZEUA 3F10A 3HL8A 3RSEA 4A2AA 3BKQX 1TGOA 3EE9A 3H1VX 3THVA 1BG3A 2F8TA 5JS2A 5IYCP 1QNCA 3V9ZA 4E19A 3CW7A 1NKCA 3OS0A 4C7PA 3T7ZA 4PL7A 4CF9A 3KK7A 3OYAA 2ASOA 4WQ5A 1A5WA 4CEBA 4I2PA 4C8LA 4DU4A 4DSLA 2NNWA 3AAQA 5LJWA 3KTUA 1N39A 3IFRA 4FJ7A 1TK8A 1GOBA 2QI2A 3JAMO 4BE1A 2UYTA 3DLKA 4HUEA 1IKXA 4KHNA 5E41A 3WEEB 3VQ9A 4EALA 5I3UA 1PCJX 3KWGA 1UT7A 5MLCQ 2O3OA 1G15A 3QDKA 4NCGA 3QNOA 3BGRA 4JKFA 5CZ1A 3E1YA 4EAIA 1B9KA 4H5VA 4V19S 1NKEA 2Y8LA 3CI5A 1UA1A 4RG8A 1RFQA 4FZXC 2IAJA 1I3AA 4BVOA 4KH4A 1MDUB 3HP6A 4ILJA 5AR0A 1RDAA 3G71N 2HHWA 3EKUA 3G25A 1VSEA 1DTQA 4JKHA 1VQ5N 2RN2A 1NBWA 1XHXA 3CFPA 4FLZA 2E4LA 4CGGA 3TDHA 3PX4A 3H3OB 3QICA 5LMUK 1Q7YO 3CQXA 1XWLA 1HPZA 5LY3A 3W3DA 2O4IA 2HHVA 4W5QA 1IV0A 4M3ZA 2WONA 1XUPO 2CH6A 4BQLA 2AJQA 5T7BA 1L3SA 3D0PA 2NOIA 5BPLA 1QSLA 2IVOA 3G0ZA 3LWMA 4CW7B 4K43A 3KKSA 4JN4A 5ADXH 4N47A 5KQ8A 3O3GA 3UE5A 2HSTA 1WB9A 2O8CB 2Q1NA 2R7YA 1EWRA 5AJ3K 3LDOA 4M63C 5F0XA 4IDHA 3D7EO 3O9TA 3KD1E 4RW6A 5AQPA 5FRMA 4I6MB 3AVLA 4A5BA 1JXBA 2UXDK 5HL7L 1NKBA 3I55N 1D4XA 4PHTX 4FJHA 1QN4A 1ATSA 2H5AX 3TTFA 3KRMA 5EU7A 1HNVA 3HO1A 2FBYA 5AQKA 1TKTA 3TTCA 4IXCA 4M45A 4E0DA 3MCPA 2Z1IA 3MN7A 4FLYA 5C2FA 5AQIA 5EVZA 3RR8A 2YKNA 2QWOA 4AILC 3FFKB 1S1UA 1HKCA 1EWQA 1U6ZA 1KFQA 3CC2N 5KRSA 1E4FT 1TKDA 3U3YA 4C8OA 3H3NO 3ISNC 3NF8A 2YI1A 1N32K 3O6WA 5EY4A 4JS4A 4A62A 3KJVA 3CCQN 2ZGYA 3HOSA 4JK8A 1QSYA 3BUZB 2X78A 2HHUA 3KZBA 5AQWA 1Q82O 5HOOA 3CQ8A 4IBNA 4KI6A 4BRLA 2NOFA 4H0VB 4QS9A 5KTQA 1VTLE 1X9MA 3U9ZA 2HMPA 1VRTA 2HF4A 4E7JA 1QN6A 1UOCA 1KRPA 2R5XA 4KB0A 1U48A 4X65K 2O8DB 2H3GX 1YTAA 4PA1A 1N3AA 5BRFA 4GNIA 4R79A 4F9OA 3HSCA 2F9TA 4Y0WA 4KB1A 4JHDB 1C0FA 1XC3A 4DR7K 4FW1A 3T19A 3TANA 2UXBK 4DFPA 2P1JA 4TSXA 4DFMA 1K8AO 4DF4A 5FROA 3VTHA 4BRCA 1BOTO 1C0MA 1J5OA 4CJSA 3SNNA 3BZCA 4LFAK 3LZJA 4AHUA 1ZBHA 5BMPA 3AY9A 4FK0A 2IOCA 3VOVA 4IG0A 2BDPA 3CJBA 3O3FA 1EUVA 3O5BA 4PL8A 3RSEB 3WQTA 2V52B 2Q2RA 3P38A 5DK5A 2P9PA 3PIOL 4ISGA 1ZXOA 2KW4A 2YH5A 3GBTA 1VSIA 3CD6N 5FDLA 1VSFA 3MMVA 3CFRA 4JK9A 1RT5A 4BR2A 4RW9A 1K73O 3V9UA 3DRSA 3RMDA 4BRPA 3J80O 2ASPA 4DCHA 3IAYA 3ULEB 3RMAA 4CFBA 1CZBA 4ELUA 1NGBA 4AM6A 4XH4A 4CZJA 1X9WA 2OA8A 1LOTB 3QBWA 3M8PA 2PZSA 5EXWA 2HNZA 3VF4A 4NO7A 4B9TA 5HRNA 4DLEA 3DLEA 4HVJA 1L3VA 3OYBA 2PAVA 4CIGA 3ZSQA 1HKBA 3THYB 1K8KB 1WAFA 3KLFA 3VQDA 4CZKA 4GV9A 5HSHA 2YJEA 2P9SB 2LSNA 3VERA 1VSHA 4JKAA 1KAXA 1S1WA 1W0HA 3SQ2A 3MEDA 4JV5K 3QMLA 2YX6A 4DQPA 1LW2A 1V4SA 2BANA 2P9UB 4DR4K 2FC0A 1HLUA 1IH7A 1NK5A 1T6AA 1VKLA 1YQRA 3DAWA 3B6PA 2JPIA 2XHIA 2P9UA 5AQJA 3FZHA 3LDQA 4LF4K 1KYDA 3D45A 4FZZA 1KYFA 3FR0A 4FM2A 2GBZA 2GV9A 4Q5VA 2QRDA 1QSSA 3CJ1A 1NGMA 5H1SQ 4FJMA 1SUQA 3VA3A 2DKDA 3V9WA 3M6GA 3ZCMA 3TSUA 5C0YA 3TAPA 2WFBA 3I3WA 3K9JA 4AHRA 4AH9A 3ZX0A 3K57A 1R4XA 3MWPA 3TAMA 4Y1DA 4O8UA 3QFPA 1QN8A 1NOZA 3NBPA 5JLFA 4PY5A 1KXPA 2E88A 3P31A 1LWWA 3NF9A 3E66A 3ZSXA 3QINA 3VA0A 4DFJA 3CXCM 1ASWA 3WEEA 4DV4K 2PWWA 1FW6A 4DWIA 4O5BA 2QM1A 1JJ2M 4CESA 1IBLK 4H0OA 3WXLA 1QS4A 5AZIA 4DV2K 1RCHA 4CK3A 4BC2A 3TAQA 1LXTA 1EXQA 4ICLA 1N36K 3MK6A 5HRSA 1ZC6A 4GV6A 3AARA 3PDKA 4IJNA 5CY4A 4JNEA 3DOKA 4DV3K 4BRIA 4WQ4A 4IDKA 4XH1A 3PSIA 1VQ8N 3MXJA 5EX5A 2YHAA 4CJRA 2IS3A 1VHXA 3QNNA 3RRGA 3IRXA 3LAKA 4DFKA 2YA3A 1T7PA 1M3HA 3VQQA 1R59O 4BC5A 4O8KA 3M8SA 3VGLA 2F9WA 4CFCA 1EX4A 1E4GT 4F2RA 2WC9A 2DFFA 4YOUA 3H08A 4CJKA 1VQKN 2CGLA 1O13A 2I7NA 3D2FB 2NRWA 2FSNA 3WXJA 4WFAL 5AQQA 2Q31A 1MP9A 3LL3A 2OPRA 4LF9K 3N89A 4H0PA 3EO3A 1LWYA 3M3ZA 2HNYA 3HPGA 3HSTB 3VEXA 1C0UA 3F2KA 3DXKB 1HKGA 3SK3A 4CEEA 3DWLA 4B8AB 3NF7A 3CCEN 3FE1A 2DPNA 2FUVA 1VSMA 1RT4A 4CK1A 1WBBA 1YXQA 4U67L 1LWEA 3L4QA 3KHYA 4CJVA 3CCJN 3EYZA 3J8AA 1C6VA 5I9EB 3F9KA 4BWMA 3QERA 4M7XA 4K25A 4BDZA 4H5RA 2ZGZA 3L2WA 4BY9C 3MECA 1LW0A 1SV5A 3VQ5A 4Z4FA 4DTJA 3OJUA 1VQ6N 3FZFA 3NHGA 2OCEA 1BA1A 3IH7A 3THXB 4OGCA 4KI4A 4B1VA 4DV1K 1BISA 3THWB 1ZYQA 1SAZA 3ENBA 1KY7A 4E1MA 5JN5A
chains in the Genus database with same CATH topology
3KD5E 2HHSA 1JLGA 2P51A 3AO1A 3AVGA 4M41A 3OYJA 1WSFA 3LALA 2VG6A 4GVMA 5IYDP 3HS9A 2BE2A 1S1XA 3TI0A 1JLQA 4DULA 3KLGA 1Y97A 3SV4A 3ZT0A 2Z8UA 3ULDA 2NOHA 3C6TA 4CJ4A 4E7HA 3HS8A 2ZQBA 1XHZA 3AA5X 4LSNA 3ZSZA 3RMBA 4JS5A 1HRHA 1BGXT 4ROCB 1CXUA 2B4JA 3F10A 3HL8A 4M3RA 2XHBA 1SL2A 4CFAA 3THVA 1TGOA 4C8NA 4AHTA 4O0JA 2OZSA 4YNQA 3I0WA 2F8TA 5JS2A 4FJ5A 5IYCP 1WSIA 3CM5A 3L3UA 2HB5A 1QNCA 3V9ZA 5KGWA 3U6FA 4E19A 1NOYA 4FW2A 4CE9A 4QOZB 1X1PA 3QEPA 1S5JA 3LWLA 3OS0A 1U45A 1NKCA 1HYZA 4FJ9A 4NCAA 3SCXA 4M42A 4CF9A 5KGXA 4CGHA 2Z1GA 3OYAA 3SZ2A 4KV8A 4FJKA 5JS1A 1JXEA 1A5WA 1WSEA 4CEBA 4I2PA 2WOMA 4CHPA 1PZDA 4DU4A 2Y1JA 4C8LA 4DSLA 4F4KA 1YQKA 1VOKA 1NVPA 3KTUA 1N39A 2NOZA 1U04A 4FJ7A 3AVKA 1GOBA 1TK8A 2KFNA 4DSEA 2DTUA 1ZBIA 4ZHRA 3RPJA 1VRUA 4BE1A 3DLKA 5IYBP 4OGEA 1EBMA 4CEAA 1IKXA 4HUEA 4KHNA 2I5JA 3LP3A 5E41A 3HVRA 4I2QA 3VQ9A 3SYZA 2MZ8A 4DF8A 5I3UA 4I8OA 1UT7A 1RT6A 3IS9A 2O3OA 1G15A 4NCGA 3QNOA 3S3OA 1VSLA 3BGRA 1RBTA 1U49A 5CZ1A 2OPQA 4DSIA 1B9KA 1NKEA 1J53A 3C94A 4DU3A 1UA1A 4M3TA 3RTVA 4B08A 2KZMA 4RG8A 1TAQA 4DQQA 4Z4IA 4FZXC 2IAJA 1I3AA 2QXFA 4KTWA 1EETA 2X6SA 4HCCA 1UWBA 3HP6A 3AA3A 3SQ4A 1RDAA 3VQ7A 1FN7A 4CGIA 5CZ2A 1KLNA 2Q3SA 3AVCA 4CF1A 2VWKA 3AO3A 4J2DA 1VSEA 1EP4A 1YT3A 1DTQA 2IC3A 3PUFA 1RT7A 2YHBA 3AVFA 2RN2A 2DY4A 1XHXA 5I42A 1NJYA 2IGIA 3CFPA 4FLZA 4FJIA 3SUOA 4M3WA 2E4LA 4CGGA 1UA0A 2D0BA 3TAEA 3MEGA 3K2PA 3PX4A 2HHXA 4CHQA 4DSFA 3DLHA 4HCBA 4FCYA 1XWLA 1HPZA 3QETA 4CJEA 1XC9A 2O4IA 2HHVA 4W5QA 3C6UA 4M3ZA 2WONA 3VQ4A 4AHVA 4IFYA 1TKZA 1T03A 4Q0BA 2AJQA 5T7BA 1VSKA 3D0PA 2NOIA 1L3SA 2NUBA 3G0ZA 3OS2A 1QSLA 2HW3A 1RBSA 1CZ9A 3KIOA 4H8KA 3WNFA 4I7FA 1WAJA 3NFAA 4CJTA 3KKSA 3QIPA 3LWMA 3SPYA 3PO4A 3OYHA 4N47A 3DRRA 3O3GA 3EY1A 1YTUA 3V1QA 5C24A 2G8IA 4DQSA 1TBAB 4L8RB 2YNHA 1SL0A 4QAGA 1Z26A 4KHWA 2ATQA 1E42A 1KCFA 1RDBA 1YQMA 1B9FA 4KAZA 2R7YA 4OLBA 4QCLA 4KHSA 4DTRA 1ZBFA 3CFOA 4CJ3A 4FZYA 4KHUA 3OYMA 3MAQA 2VJ0A 3K5MA 5J2NA 3AV9A 5J2QA 1RT2A 1F21A 1FK9A 1VSDA 3UIQA 4KRFA 3VQ8A 3OYCA 4CGFA 3KD1E 4CJWA 4RW6A 5FRMA 1N5YA 4O0IA 4E89A 3K59A 3AO5A 4WZSD 3AVLA 3T3FA 1JXBA 1NKBA 1WLJA 1D9FA 4FJHA 1QN4A 4DU1A 1BCOA 3V1OA 4CF8A 3KRMA 4OLAA 3DOLA 3FFIA 1HNVA 1BQMA 5EU7A 1Q9XA 3VQAA 3HO1A 1REVA 2FBYA 3TWHA 3QEVA 1KVAA 1TKTA 4ID5A 4E7LA 3TAFA 4M45A 4CERA 4E0DA 4NCBA 2Z1IA 3DLRA 2LAEA 5HRPA 3NH0A 1ZBLA 4J2BA 3F73A 4FLYA 4BWJA 4FM1A 1GOCA 3KK2A 4FXDA 3RR8A 4IG3A 1VSJA 4PQUA 4O44A 4FJNA 2D5RA 2YKNA 2HHTA 2IV8A 2HZMA 3IG1A 3NGYA 4AILC 1MU2A 3PX6A 1S1UA 2B5JA 1S9EA 3OYLA 4BDYA 2RF2A 5KRSA 1TKDA 3U3YA 2XY8A 3S3NA 4C8OA 3VN5A 3ISNC 3NF8A 4OKJA 4Z0UA 1QN9A 3OVNA 4ZTFA 3SPZA 2ETJA 1SKWA 4C8KA 1BL3A 4Q11A 4FLVA 3SUNA 4JS4A 2PY5A 1WNSA 4LH4A 3KJVA 3OY9A 1YQLA 4E1MA 1TK0A 3EZ5A 1NK0A 2D0AA 3LDSA 4RW8A 3WNHA 4DTMA 2VG5A 4HUFA 1JL1A 2A1RA 1WSHA 3ZSWA 1QSYA 2X78A 2HHUA 3AVBA 4OKKA 3EIKA 4KI6A 3CQ8A 4IBNA 1WSGA 3S9HA 1A5VA 2NOFA 3KLIA 4FJGA 4MQ3A 3K5LA 3KK3A 2G8KA 5KTQA 1VTLE 1JLAA 3L3VA 1X9MA 1CDWA 1W9HA 1QTMA 2G8UA 1TBPA 1VRTA 2X6NA 3U3GA 3M8RA 3S3MA 4E7JA 1QN6A 1UOCA 4FLUA 2HZSA 3P83D 4FVMA 4CIEA 4E7KA 1KRPA 4KB0A 3HK2A 1TL3A 1N6QA 1U48A 1TAUA 1KVBA 4PA1A 1YTAA 1NJZA 4NYFA 1N3AA 4E1NA 4CJPA 1SKRA 1HMVA 3PY8A 4B9SA 4KB1A 3OYEA 1DTTA 4C8MA 4W5NA 4BACA 1D9DA 4DTXA 4FW1A 2G30A 1ASUA 3AVMA 3T19A 3OYGA 4DFPA 3TANA 1B92A 2P1JA 4TSXA 4DFMA 4PUOA 2G8HA 3LP2A 4KHYA 4KREA 1VTOA 5FROA 4DF4A 3LPTA 1HNIA 4HTUA 1YTBA 2YKMA 4FLWA 4KTQA 4N41A 2FGTA 3AVIA 1C0MA 5D3GA 4YFUA 4CJSA 3SNNA 1J5OA 3LZJA 4AHUA 2QK9A 1ZBHA 4FK0A 2XY5A 5AN4A 4IFVA 2IOCA 4EP4A 3KKRA 3AA2A 4IG0A 4B9LA 2BDPA 3I0XA 5KRTA 3O3FA 2Z1HA 4Z4HA 4B9UA 1RBVA 1S6QA 1S9GA 3HP9A 3NAEA 5DK5A 3ZT2A 1LV5A 2QKKA 2VWJA 1RTJA 4CJUA 2KW4A 2HVIA 1QQCA 2YH5A 1SL1A 4Z4EA 1VSIA 4FK2A 1VSFA 2GUIA 3O4NA 4LH5A 5FDLA 4B8CA 4DQRA 1QE1A 1S1TA 1JLCA 3WNEA 3HJFA 1U4BA 1NJXA 3CFRA 2RPIA 2JOIA 1M3QA 1JL2A 3CG7A 1ITGA 1RT5A 3LP0A 4LSLA 4AHSA 4AHCA 2G8FA 4RW9A 3V1RA 3VQBA 5HROA 4B0AA 1HYSA 3LP1A 3V9UA 1KY6A 3OYDA 4CHYA 3O3HA 5HBMA 4F2SA 2JLEA 3DRSA 3RMDA 4KHQA 1NK7A 3QLHA 1IKYA 1D3UA 1N3CA 3K58A 4RW4A 3HXMA 4CF2A 1GOAA 1K6YA 1KTQA 3IAYA 3RMAA 4CFBA 1HJRA 1CZBA 5J1EA 3SQ0A 3LAMA 2P5GA 1BI4A 4ELUA 1TV6A 4RW7A 3T1AA 3DM2A 4IKFA 1BQNA 3ZT3A 3AVHA 1X9WA 2OA8A 3NDKA 2OPSA 3MEEA 3OYNA 1RBRA 2FBTA 3RRHA 1NK4A 3M8PA 3B6OA 3DI6A 1YTFA 2PZSA 2OPPA 3E01A 2Z1JA 2HNZA 3AO4A 3NGIA 4EJYA 3L2UA 3OC3C 1RDDA 1LWFA 4B9TA 1DLOA 3HVTA 3RR7A 5HRNA 4DLEA 4FJLA 3DLEA 4HVJA 4FM0A 1L3VA 2NOLA 3TR8A 4W5RA 4FJ8A 3OYBA 4B9MA 2QKBA 4OKEA 1KFDA 3ZSQA 4CIGA 3OYIA 1VOLB 3KLFA 1WAFA 2KQ2A 4CGDA 3H1ZA 1QTPA 3VQEA 1ASVA 4CECA 4FYDA 3JYTA 1S6PA 3VQDA 3OCIA 1D5AA 2ZD1A 3I8DA 1QNBA 2LSNA 2YV0X 1VSHA 3OYKA 1W0HA 1S1WA 4LY7A 3L2QA 3SQ2A 3MEDA 1JLFA 3AO2A 4O55A 4W5TA 2P5OA 2F96A 4DQPA 3C95A 4JRPA 1LW2A 3V4IA 2BANA 4E7IA 1XI1A 1RTHA 4KTZA 5CYQA 4CHOA 4CGJA 2O4GA 1C0TA 3LZIA 1KSPA 4NYNA 1RNHA 1TK5A 2FC0A 4CEFA 3TARA 3V81A 1IH7A 1NK5A 1IO2A 4M3XA 4CCHA 1ZBUA 1WSJA 2E6LA 1RTDA 1YQRA 3B6PA 4F3OA 1QHTA 1RTIA 2XHIA 4N56A 1QN5A 3L2VA 1KYDA 3D45A 2G8WA 4FZZA 2D0CA 1HQUA 1KYFA 1C1AA 2W42A 3V9SA 3SUQA 5C25A 4FK4A 3DYAA 4CK2A 4FM2A 1C1BA 2GBZA 2GV9A 4ID1A 4Q5VA 1NK6A 1QSSA 2HVHA 1NGMA 4ELVA 2BGGA 4FJMA 1Q9YA 3OSMA 3AVJA 1BIZA 1SUQA 3VA3A 1IG9A 4J2EA 3HPOA 3V9WA 2Y1IA 1IKVA 3ZCMA 4I9QA 4OVLA 4KKOA 3SI6A 3TAPA 4CEZA 1D8YA 1I39A 4ROEB 5HLFA 4DLGA 4AHRA 5HRRA 4AH9A 3OS1A 4PWDA 4HHTA 3K57A 1R4XA 1HU0A 4DTNA 3K5NA 2YNIA 4LD0A 2DFEA 3A2FA 4Y1DA 3TAMA 3SUPA 1QN8A 1NOZA 2A1SA 3NBPA 4K8XA 4PY5A 4HUGA 4DTPA 3ZT1A 1LWWA 1SKSA 3NF9A 3ZSXA 3QINA 4Y1CA 3VA0A 3KTQA 4DFJA 1C1CA 4CIFA 4H4MA 1TGHA 1ASWA 2EHGA 4Z4GA 3HPHA 2KZZA 1HQEA 1T8EA 4BDPA 1RM1A 1L3TA 2F8SA 1WN7A 3DRPA 4O5BA 4DWIA 3SQ1A 4CESA 1NK9A 1A5XA 3RWUA 3SV3A 4MFBA 1QS4A 3OJSA 5K14A 3ZSVA 4CJFA 4R5PA 2OYQA 1RCHA 4CK3A 3TAQA 3CM6A 4GW6A 3P1GA 4K8ZA 2YNFA 1EXQA 4ICLA 4O4GA 4F3TA 3I0RA 1UAXA 2VG7A 5HRSA 5SWMA 1LWVA 5CY4A 4XIUA 1NH2A 2HMIA 4EP5A 1L3UA 3NF6A 1B9DA 3DOKA 3DLBA 3I0SA 4IDKA 1QN3A 4CJ5A 3MXJA 5FRNA 1J9AA 2YHAA 2HHQA 1Z25A 4B9VA 4CJRA 5J2MA 2IS3A 3NH2A 3DMJA 3AVNA 3G10A 4G1QA 4UQGA 3QNNA 1FKPA 3RRGA 2HHWA 2FBXA 3IRXA 5KI6A 4F8RA 1CLQA 3LAKA 4DFKA 2X74A 3QIOA 3KK1A 3MXIA 1QNAA 1T7PA 2XRIA 1M3HA 4KPYA 1NK8A 3VQQA 1W80A 4EJZA 1U47A 3DLGA 4M3UA 4N76A 1JLEA 1RILA 3M8SA 3ULXA 1QN7A 4CFCA 3OYFA 2NOBA 1EX4A 4F2RA 3QEIA 2I5WA 4CFDA 4DS5A 4DMNA 2DFFA 5DMRA 4Z4CA 4E3SA 3QESA 3RMCA 5HP1A 3H08A 4CJKA 1BCMA 3NH1A 1L5UA 3WNGA 3JSMA 3SNSA 4B9NA 4GMJB 2PYJA 4B3OA 3V6DA 3L8BA 2RKIA 4JLHA 3HYFA 4CJLA 1BIUA 4DSJA 2ZE2A 5J2PA 2HNDA 3ALYA 1MP9A 2E6MA 1LAVA 3AA4A 3HT3A 1YVUA 3LANA 2OPRA 3V9XA 1KYUA 3N89A 1LWYA 3ITHA 2MJ7A 4EZ6A 2HNYA 1TL1A 3HPGA 2JGUA 1AISA 1C0UA 3HSTB 3BDPA 1IKWA 4BE2A 4CEEA 2IDOA 3LPUA 1LAWA 4B8AB 3NF7A 2XY7A 3M8QA 1FXXA 1VSMA 4N5SA 4ELTA 1RT4A 4CK1A 1PCZA 2OZMA 3AVAA 2IV9A 4OPJA 3CYMA 1QNEA 1S1VA 1T05A 1KFSA 2G8VA 1LWEA 4CEOA 1JKHA 3ZT4A 3KLEA 1KO9A 4CJVA 4CEQA 4DS4A 2XY6A 3DPTA 4ZTJA 3F0ZA 1BHLA 1TVRA 3EYZA 4FJXA 4DSKA 2DFHA 1J54A 4EZ9A 4I9LA 4J2AA 1C6VA 1UT4A 3QEWA 3NGZA 3F9KA 3HM9A 3SJJA 2XO7A 1X9SA 4BWMA 3QERA 2FBVA 3NE6A 2NOEA 3KLHA 1EKEA 4BDZA 2KFZA 4KO0A 3O4QA 4W5OA 4H4OA 3L2WA 2ITGA 3MECA 1LW0A 1SV5A 3VQ5A 2B6AA 3VQPA 1RBUA 5CYMA 1Q8IA 3ZSRA 3OJUA 4DTJA 1KVCA 4BE0A 4OPKA 1QTSA 3MXMA 1R0AA 4Z4FA 3NHGA 3ASMA 4KFBA 3L2RA 4DTSA 1RT3A 1TKXA 4TPSA 3ZSOA 4DTOA 1RDCA 4CEDA 3PV8A 4FJJA 4DG1A 3TABA 1JFIC 3PO5A 3DPUA 1NJWA 4FLTA 3QO9A 3P5JA 3IH7A 4WE1A 3QEXA 5C42A 4M3YA 2KTQA 4JRQA 3NCIA 4OGCA 4CJQA 1VK0A 3OSTA 1RT1A 3VQ6A 3K5OA 4CF0A 4CHNA 4KI4A 3TAGA 1BI4B 1CXQA 1O1WA 1FKOA 4OJRA 1BISA 2YNGA 1HYVA 4FLXA 1ZYQA 2PYLA 4DTUA 3ZSYA 3PX0A 1KY7A 1KLMA 2EX3A 4CHZA 5SZTA 1C9BB 1LWCA 4DQIA 4RODB 3VQCA 1JLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KD5 E;  2HHS A;  1JLG A;  2P51 A;  3AO1 A;  3AVG A;  4M41 A;  3OYJ A;  1WSF A;  3LAL A;  2VG6 A;  4GVM A;  5IYD P;  3HS9 A;  2BE2 A;  1S1X A;  3TI0 A;  1JLQ A;  3KLG A;  1Y97 A;  3SV4 A;  3ZT0 A;  2Z8U A;  3ULD A;  3C6T A;  4CJ4 A;  4E7H A;  3HS8 A;  2ZQB A;  1XHZ A;  3AA5 X;  4LSN A;  3ZSZ A;  3RMB A;  4JS5 A;  1HRH A;  1BGX T;  4ROC B;  1CXU A;  2B4J A;  3HL8 A;  1SL2 A;  4M3R A;  2XHB A;  4CFA A;  3THV A;  1TGO A;  4C8N A;  4AHT A;  4O0J A;  2OZS A;  4YNQ A;  2F8T A;  5JS2 A;  4FJ5 A;  5IYC P;  1WSI A;  3CM5 A;  3L3U A;  2HB5 A;  1QNC A;  3V9Z A;  5KGW A;  3U6F A;  4E19 A;  1NOY A;  4FW2 A;  4CE9 A;  4QOZ B;  1X1P A;  3QEP A;  1S5J A;  3LWL A;  3OS0 A;  1U45 A;  1NKC A;  1HYZ A;  4FJ9 A;  4NCA A;  3SCX A;  4M42 A;  4CF9 A;  5KGX A;  4CGH A;  2Z1G A;  3OYA A;  3SZ2 A;  4KV8 A;  4FJK A;  5JS1 A;  1JXE A;  1A5W A;  1WSE A;  4CEB A;  4I2P A;  2WOM A;  4CHP A;  1PZD A;  4DU4 A;  2Y1J A;  4C8L A;  4DSL A;  4F4K A;  1VOK A;  1NVP A;  1U04 A;  4FJ7 A;  3AVK A;  1GOB A;  1TK8 A;  2KFN A;  4DSE A;  2DTU A;  1ZBI A;  4ZHR A;  1VRU A;  4BE1 A;  3DLK A;  5IYB P;  4OGE A;  4CEA A;  4HUE A;  1IKX A;  4KHN A;  4FJ8 A;  2I5J A;  3LP3 A;  5E41 A;  3HVR A;  4I2Q A;  3VQ9 A;  3SYZ A;  4DF8 A;  5I3U A;  1RT6 A;  3IS9 A;  1G15 A;  4NCG A;  3QNO A;  3S3O A;  1VSL A;  3BGR A;  1RBT A;  1U49 A;  5CZ1 A;  2OPQ A;  4DSI A;  1B9K A;  1NKE A;  1J53 A;  3C94 A;  4DU3 A;  1UA1 A;  4M3T A;  3RTV A;  4B08 A;  2KZM A;  4RG8 A;  1TAQ A;  4DQQ A;  4Z4I A;  4FZX C;  2IAJ A;  1I3A A;  2QXF A;  4KTW A;  1EET A;  2X6S A;  4HCC A;  1UWB A;  3HP6 A;  3AA3 A;  3SQ4 A;  1RDA A;  3VQ7 A;  4CGI A;  2HHW A;  5CZ2 A;  1KLN A;  2Q3S A;  3AVC A;  4CF1 A;  2VWK A;  3AO3 A;  4J2D A;  1VSE A;  1EP4 A;  2IC3 A;  1DTQ A;  1YT3 A;  3PUF A;  1RT7 A;  2YHB A;  3AVF A;  2RN2 A;  2DY4 A;  1XHX A;  5I42 A;  1NJY A;  2IGI A;  3CFP A;  4FLZ A;  4FJI A;  3SUO A;  4M3W A;  2E4L A;  4CGG A;  1UA0 A;  2D0B A;  3TAE A;  3MEG A;  3K2P A;  3PX4 A;  2HHX A;  4CHQ A;  4DSF A;  3DLH A;  4HCB A;  4FCY A;  1XWL A;  1HPZ A;  3QET A;  4CJE A;  1XC9 A;  2O4I A;  2HHV A;  4W5Q A;  3C6U A;  4M3Z A;  2WON A;  3VQ4 A;  4AHV A;  4IFY A;  1TKZ A;  1T03 A;  4Q0B A;  2AJQ A;  5T7B A;  1VSK A;  3D0P A;  1L3S A;  2NUB A;  3G0Z A;  3OS2 A;  1QSL A;  2HW3 A;  1RBS A;  1CZ9 A;  3KIO A;  4H8K A;  3WNF A;  4I7F A;  1WAJ A;  3NFA A;  4CJT A;  3KKS A;  3QIP A;  3LWM A;  3SPY A;  3PO4 A;  3OYH A;  4N47 A;  3DRR A;  3O3G A;  3EY1 A;  1YTU A;  3V1Q A;  5C24 A;  2G8I A;  4DQS A;  1TBA B;  4L8R B;  2YNH A;  1SL0 A;  4QAG A;  1Z26 A;  4KHW A;  1E42 A;  1KCF A;  1RDB A;  2ATQ A;  1B9F A;  4KAZ A;  2R7Y A;  4OLB A;  4QCL A;  4KHS A;  4DTR A;  1ZBF A;  3CFO A;  4CJ3 A;  4FZY A;  4KHU A;  3OYM A;  3MAQ A;  2VJ0 A;  3K5M A;  5J2N A;  3AV9 A;  5J2Q A;  1RT2 A;  1F21 A;  1FK9 A;  1VSD A;  3UIQ A;  4KRF A;  3VQ8 A;  3OYC A;  4CGF A;  3KD1 E;  4CJW A;  4RW6 A;  5FRM A;  1N5Y A;  4O0I A;  4E89 A;  3K59 A;  3AO5 A;  4WZS D;  3AVL A;  3T3F A;  1JXB A;  1NKB A;  1WLJ A;  1D9F A;  4FJH A;  1QN4 A;  4DU1 A;  1BCO A;  3V1O A;  4CF8 A;  4OLA A;  3DOL A;  3FFI A;  1HNV A;  1BQM A;  5EU7 A;  1Q9X A;  3VQA A;  3HO1 A;  1REV A;  2FBY A;  3TWH A;  3QEV A;  1KVA A;  1TKT A;  4ID5 A;  4E7L A;  3TAF A;  4M45 A;  4CER A;  4E0D A;  4NCB A;  2Z1I A;  3DLR A;  3NH0 A;  5HRP A;  1ZBL A;  4J2B A;  3F73 A;  4FLY A;  4BWJ A;  4FM1 A;  1GOC A;  3KK2 A;  4FXD A;  3RR8 A;  4IG3 A;  1VSJ A;  4PQU A;  4O44 A;  4FJN A;  2D5R A;  2YKN A;  2HHT A;  2IV8 A;  3IG1 A;  3NGY A;  4AIL C;  1MU2 A;  3PX6 A;  1S1U A;  2B5J A;  1S9E A;  3OYL A;  4BDY A;  2RF2 A;  5KRS A;  1TKD A;  3U3Y A;  2XY8 A;  3S3N A;  4C8O A;  3VN5 A;  3ISN C;  3NF8 A;  4OKJ A;  4Z0U A;  1QN9 A;  3OVN A;  4ZTF A;  3SPZ A;  2ETJ A;  1SKW A;  4C8K A;  1BL3 A;  4FLV A;  3SUN A;  4JS4 A;  2PY5 A;  1WNS A;  4LH4 A;  3KJV A;  3OY9 A;  4E1M A;  1TK0 A;  3EZ5 A;  1NK0 A;  2D0A A;  3LDS A;  4RW8 A;  3WNH A;  4DTM A;  2VG5 A;  4HUF A;  1JL1 A;  2A1R A;  1WSH A;  3ZSW A;  1QSY A;  2X78 A;  2HHU A;  3AVB A;  4OKK A;  3EIK A;  4KI6 A;  3CQ8 A;  4IBN A;  1WSG A;  3S9H A;  1A5V A;  3KLI A;  4FJG A;  4MQ3 A;  3K5L A;  3KK3 A;  2G8K A;  5KTQ A;  1VTL E;  1JLA A;  3L3V A;  1X9M A;  1CDW A;  1W9H A;  1QTM A;  2G8U A;  1TBP A;  1VRT A;  2X6N A;  3U3G A;  3M8R A;  3S3M A;  4E7J A;  1QN6 A;  1UOC A;  4FLU A;  3P83 D;  4CIE A;  4FVM A;  4E7K A;  1KRP A;  4KB0 A;  3HK2 A;  1TL3 A;  1N6Q A;  1U48 A;  1TAU A;  1KVB A;  4PA1 A;  1YTA A;  1NJZ A;  4NYF A;  4E1N A;  4CJP A;  1SKR A;  1HMV A;  3PY8 A;  4B9S A;  4KB1 A;  3OYE A;  1DTT A;  4C8M A;  4W5N A;  4BAC A;  1D9D A;  4DTX A;  4FW1 A;  2G30 A;  1ASU A;  3AVM A;  3T19 A;  3OYG A;  4DFP A;  3TAN A;  1B92 A;  2P1J A;  4TSX A;  4DFM A;  4PUO A;  2G8H A;  3LP2 A;  4KHY A;  4KRE A;  1VTO A;  5FRO A;  4DF4 A;  3LPT A;  1HNI A;  4HTU A;  1YTB A;  2YKM A;  4FLW A;  4KTQ A;  4N41 A;  3AVI A;  5D3G A;  1C0M A;  4YFU A;  4CJS A;  3SNN A;  1J5O A;  3LZJ A;  4AHU A;  2QK9 A;  1ZBH A;  4FK0 A;  2XY5 A;  4IFV A;  2IOC A;  4EP4 A;  3KKR A;  3AA2 A;  4IG0 A;  4B9L A;  2BDP A;  5KRT A;  3O3F A;  2Z1H A;  4Z4H A;  4B9U A;  1RBV A;  1S6Q A;  1S9G A;  3HP9 A;  3NAE A;  5DK5 A;  3ZT2 A;  1LV5 A;  2QKK A;  2VWJ A;  1RTJ A;  4CJU A;  2KW4 A;  2HVI A;  1QQC A;  1SL1 A;  4Z4E A;  1VSI A;  4FK2 A;  1VSF A;  2GUI A;  3O4N A;  4LH5 A;  5FDL A;  4B8C A;  4DQR A;  1QE1 A;  1S1T A;  1JLC A;  3WNE A;  3HJF A;  1U4B A;  1NJX A;  3CFR A;  2RPI A;  3CG7 A;  1JL2 A;  3LP0 A;  1ITG A;  1RT5 A;  4LSL A;  4AHS A;  4AHC A;  2G8F A;  1HYS A;  4RW9 A;  3V1R A;  3VQB A;  5HRO A;  4B0A A;  3LP1 A;  3V9U A;  1KY6 A;  3OYD A;  4CHY A;  3O3H A;  5HBM A;  4F2S A;  2JLE A;  3DRS A;  3RMD A;  4KHQ A;  1NK7 A;  3QLH A;  1IKY A;  1D3U A;  3K58 A;  4RW4 A;  3HXM A;  4CF2 A;  1GOA A;  1K6Y A;  1KTQ A;  3IAY A;  3RMA A;  4CFB A;  1HJR A;  1CZB A;  5J1E A;  3SQ0 A;  3LAM A;  2P5G A;  1BI4 A;  4ELU A;  1TV6 A;  4RW7 A;  3T1A A;  3DM2 A;  4IKF A;  1BQN A;  3ZT3 A;  3AVH A;  1X9W A;  2OA8 A;  3NDK A;  2OPS A;  3MEE A;  3OYN A;  1RBR A;  2FBT A;  3RRH A;  1NK4 A;  3M8P A;  3B6O A;  3DI6 A;  1YTF A;  2PZS A;  2OPP A;  3E01 A;  2Z1J A;  2HNZ A;  3AO4 A;  3NGI A;  3L2U A;  3OC3 C;  1RDD A;  1LWF A;  4B9T A;  1DLO A;  3HVT A;  3RR7 A;  5HRN A;  4DLE A;  4FJL A;  3DLE A;  4HVJ A;  4FM0 A;  1L3V A;  4W5R A;  3TR8 A;  2QKB A;  3OYB A;  4B9M A;  4OKE A;  1KFD A;  3ZSQ A;  4CIG A;  3OYI A;  1VOL B;  3KLF A;  1WAF A;  2KQ2 A;  4CGD A;  3H1Z A;  1QTP A;  3VQE A;  1ASV A;  4CEC A;  4FYD A;  3JYT A;  1S6P A;  3VQD A;  3OCI A;  1D5A A;  2ZD1 A;  3I8D A;  1QNB A;  2LSN A;  2YV0 X;  1VSH A;  3OYK A;  1W0H A;  1S1W A;  4LY7 A;  3L2Q A;  3SQ2 A;  3MED A;  1JLF A;  3AO2 A;  4O55 A;  4W5T A;  2P5O A;  2F96 A;  4DQP A;  3C95 A;  4JRP A;  1LW2 A;  3V4I A;  2BAN A;  4E7I A;  1XI1 A;  1RTH A;  4KTZ A;  5CYQ A;  4CHO A;  4CGJ A;  2O4G A;  1C0T A;  3LZI A;  1KSP A;  4NYN A;  1RNH A;  1TK5 A;  2FC0 A;  4CEF A;  3TAR A;  3V81 A;  1IH7 A;  1NK5 A;  1IO2 A;  4M3X A;  4CCH A;  1ZBU A;  1WSJ A;  2E6L A;  1RTD A;  3B6P A;  4F3O A;  1QHT A;  1RTI A;  4N56 A;  1QN5 A;  3L2V A;  1KYD A;  3D45 A;  2G8W A;  4FZZ A;  2D0C A;  1HQU A;  1KYF A;  1C1A A;  2W42 A;  3V9S A;  3SUQ A;  5C25 A;  4FK4 A;  3DYA A;  4CK2 A;  4FM2 A;  1C1B A;  2GBZ A;  2GV9 A;  4ID1 A;  4Q5V A;  1NK6 A;  1QSS A;  2HVH A;  1NGM A;  4ELV A;  2BGG A;  4FJM A;  1Q9Y A;  3AVJ A;  1BIZ A;  1SUQ A;  3VA3 A;  1IG9 A;  4J2E A;  3HPO A;  3V9W A;  2Y1I A;  1IKV A;  3ZCM A;  4I9Q A;  4OVL A;  4KKO A;  3SI6 A;  3TAP A;  4CEZ A;  1D8Y A;  1I39 A;  4ROE B;  5HLF A;  4DLG A;  4AHR A;  5HRR A;  4AH9 A;  3OS1 A;  4PWD A;  4HHT A;  3K57 A;  1R4X A;  4DTN A;  3K5N A;  2YNI A;  4LD0 A;  2DFE A;  3A2F A;  4Y1D A;  3TAM A;  3SUP A;  1QN8 A;  1NOZ A;  2A1S A;  3NBP A;  4K8X A;  4PY5 A;  4HUG A;  4DTP A;  3ZT1 A;  1SKS A;  3NF9 A;  3ZSX A;  3QIN A;  4Y1C A;  3VA0 A;  3KTQ A;  4DFJ A;  1C1C A;  4CIF A;  4H4M A;  1TGH A;  1ASW A;  2EHG A;  4Z4G A;  3HPH A;  2KZZ A;  1HQE A;  1T8E A;  4BDP A;  1RM1 A;  1L3T A;  2F8S A;  1WN7 A;  3DRP A;  4O5B A;  4DWI A;  3SQ1 A;  4CES A;  1NK9 A;  1A5X A;  3RWU A;  3SV3 A;  4MFB A;  1QS4 A;  3OJS A;  5K14 A;  3ZSV A;  4CJF A;  4R5P A;  2OYQ A;  1RCH A;  4CK3 A;  3TAQ A;  3CM6 A;  4GW6 A;  3P1G A;  4K8Z A;  2YNF A;  1EXQ A;  4ICL A;  4O4G A;  4F3T A;  3I0R A;  1UAX A;  2VG7 A;  5HRS A;  5SWM A;  5CY4 A;  4XIU A;  1NH2 A;  2HMI A;  4EP5 A;  1L3U A;  3NF6 A;  1B9D A;  3DOK A;  3DLB A;  3I0S A;  4IDK A;  1QN3 A;  4CJ5 A;  3MXJ A;  5FRN A;  1J9A A;  2YHA A;  2HHQ A;  1Z25 A;  4B9V A;  4CJR A;  5J2M A;  2IS3 A;  3NH2 A;  3DMJ A;  3AVN A;  3G10 A;  4G1Q A;  4UQG A;  3QNN A;  1FKP A;  3RRG A;  2FBX A;  3IRX A;  5KI6 A;  4F8R A;  1CLQ A;  3LAK A;  4DFK A;  2X74 A;  3QIO A;  3KK1 A;  3MXI A;  1QNA A;  1T7P A;  2XRI A;  4KPY A;  1NK8 A;  3VQQ A;  1W80 A;  1U47 A;  3DLG A;  4M3U A;  4N76 A;  1JLE A;  1RIL A;  3M8S A;  1QN7 A;  4CFC A;  3OYF A;  1EX4 A;  4F2R A;  3QEI A;  4CFD A;  4DS5 A;  4DMN A;  2DFF A;  5DMR A;  4Z4C A;  4E3S A;  3QES A;  3RMC A;  5HP1 A;  3H08 A;  4CJK A;  1BCM A;  3NH1 A;  1L5U A;  3WNG A;  3JSM A;  4B9N A;  4GMJ B;  2PYJ A;  4B3O A;  3V6D A;  3L8B A;  2RKI A;  4JLH A;  3HYF A;  4CJL A;  1BIU A;  4DSJ A;  2ZE2 A;  5J2P A;  2HND A;  3ALY A;  1MP9 A;  2E6M A;  1LAV A;  3AA4 A;  3HT3 A;  1YVU A;  3LAN A;  2OPR A;  3V9X A;  1KYU A;  3ITH A;  4EZ6 A;  2MJ7 A;  2HNY A;  1TL1 A;  3HPG A;  2JGU A;  1AIS A;  1C0U A;  3HST B;  3BDP A;  1IKW A;  4BE2 A;  4CEE A;  2IDO A;  3LPU A;  1LAW A;  4B8A B;  3NF7 A;  2XY7 A;  3M8Q A;  1FXX A;  1VSM A;  4N5S A;  4ELT A;  1RT4 A;  4CK1 A;  1PCZ A;  2OZM A;  3AVA A;  2IV9 A;  4OPJ A;  3CYM A;  1QNE A;  1S1V A;  1T05 A;  1KFS A;  2G8V A;  1LWE A;  4CEO A;  1JKH A;  3ZT4 A;  3KLE A;  4CJV A;  4CEQ A;  4DS4 A;  2XY6 A;  4ZTJ A;  1BHL A;  1TVR A;  4FJX A;  3EYZ A;  4DSK A;  2DFH A;  1J54 A;  4EZ9 A;  4I9L A;  4J2A A;  1C6V A;  3QEW A;  3NGZ A;  3F9K A;  3HM9 A;  3SJJ A;  2XO7 A;  1X9S A;  4BWM A;  3QER A;  2FBV A;  3NE6 A;  3KLH A;  1EKE A;  4BDZ A;  2KFZ A;  4KO0 A;  3O4Q A;  4W5O A;  4H4O A;  3L2W A;  2ITG A;  3MEC A;  1LW0 A;  1SV5 A;  3VQ5 A;  2B6A A;  3VQP A;  1RBU A;  5CYM A;  1Q8I A;  3ZSR A;  3OJU A;  4DTJ A;  1KVC A;  4BE0 A;  4OPK A;  1QTS A;  3MXM A;  1R0A A;  4Z4F A;  3NHG A;  3ASM A;  4KFB A;  3L2R A;  4DTS A;  1RT3 A;  1TKX A;  3ZSO A;  4DTO A;  3PV8 A;  1RDC A;  4CED A;  4FJJ A;  4DG1 A;  3TAB A;  1JFI C;  3PO5 A;  1NJW A;  4FLT A;  3QO9 A;  3P5J A;  4WE1 A;  3QEX A;  5C42 A;  4M3Y A;  2KTQ A;  4JRQ A;  3NCI A;  4OGC A;  4CJQ A;  1VK0 A;  1RT1 A;  3VQ6 A;  3K5O A;  4CF0 A;  4CHN A;  4KI4 A;  3TAG A;  1BI4 B;  1CXQ A;  1O1W A;  1FKO A;  4OJR A;  1BIS A;  2YNG A;  1HYV A;  4FLX A;  1ZYQ A;  2PYL A;  4DTU A;  3ZSY A;  3PX0 A;  1KY7 A;  1KLM A;  2EX3 A;  4CHZ A;  5SZT A;  1C9B B;  1LWC A;  4DQI A;  4ROD B;  3VQC A;  1JLB A; 
#chains in the Genus database with same CATH topology
 4KH6 A;  2YHX A;  1JLG A;  3AO1 A;  3AVG A;  3VTI A;  3OYJ A;  1WSF A;  1VQL N;  5IYD P;  1S1X A;  4DUL A;  1Y97 A;  3R6M A;  3C6T A;  1HRH A;  1C4G A;  4M3R A;  2XHB A;  4CFA A;  3BEX A;  2ZJP L;  4O0J A;  3I0W A;  4LF6 K;  1NJI O;  1TUO A;  1WSI A;  4BRN A;  4JD2 B;  2HB5 A;  2Y8Q A;  5KGW A;  3QEP A;  2F4V K;  1HYZ A;  3WT0 A;  3VPZ A;  2A3Z A;  4CGH A;  3GG4 A;  5BR8 K;  1DGK N;  3SZ2 A;  3A8Y A;  4IO8 A;  4KV8 A;  1JXE A;  4A59 A;  4FJK A;  5JS1 A;  4YOW A;  3THW A;  1T6D A;  1PZD A;  2Y1J A;  1NVP A;  1U04 A;  3VEN A;  5M1O A;  4DSE A;  2DTU A;  4MDB A;  4CEA A;  3VET A;  4DF8 A;  4I8O A;  1RT6 A;  3H45 C;  1YVN A;  1RBT A;  2E20 A;  2OPQ A;  4DSI A;  5BRE A;  3C94 A;  4DU3 A;  2KZM A;  4B08 A;  5FPE A;  1OH6 A;  1UWB A;  1W2B M;  1XMQ K;  4CGI A;  1FN7 A;  3AVC A;  3VF6 A;  1EP4 A;  1YT3 A;  3PUF A;  3AVF A;  4C1N I;  5A2Q O;  1NJY A;  4A5A A;  4BQZ A;  4JI5 K;  1UA0 A;  2D0B A;  3TAE A;  2HBK A;  3GL1 A;  3K2P A;  5AQM A;  3ID8 A;  2HHX A;  3O8M A;  1I94 K;  4FCY A;  4L3Q A;  1TYQ B;  2P9L B;  1NGE A;  4AHV A;  1TKZ A;  4Q0B A;  3BF3 A;  5F1X A;  2HW3 A;  4IEE A;  4H8K A;  3WNF A;  3SPY A;  1YTU A;  1T6C A;  4MLH A;  1HNW K;  2G8I A;  1TBA B;  4K42 A;  1YJN N;  1Z26 A;  1E42 A;  2UU9 K;  1YQM A;  3NVM A;  1BA0 A;  4A57 A;  4AQY K;  4WFB L;  4DTR A;  4FZY A;  3L6Q A;  2VJ0 A;  5J2Q A;  1RT2 A;  1F21 A;  4DR6 K;  1MWK A;  4JI7 K;  3M5R A;  4CJW A;  3A5L C;  4O0I A;  3O80 A;  2IVP A;  1XNR K;  1WLJ A;  1YUW A;  4DU1 A;  3LDN A;  3V1O A;  4MLE A;  4CF8 A;  3FFI A;  2VGN A;  1Q9X A;  3QFU A;  2A41 A;  3SLC A;  4MRQ A;  4ID5 A;  4E7L A;  3DLR A;  3NH0 A;  4J2B A;  2UUC K;  3OHR A;  1P5D X;  1GOC A;  4DR1 K;  1U2V A;  2HL9 A;  1S22 A;  1VSJ A;  2HHT A;  3IG1 A;  1BO5 O;  2HF3 A;  3PX6 A;  1S9E A;  3EL2 A;  4BDY A;  2RF2 A;  2QRC A;  3W0L A;  3H6E A;  4IWV A;  3QB0 A;  3OVN A;  4ZTF A;  3SPZ A;  1SKW A;  4NXN K;  3SUN A;  2PY5 A;  1WNS A;  3LDP A;  4LH4 A;  3OY9 A;  3MDQ A;  1JDY A;  2D0A A;  2A1R A;  2VG5 A;  3ZSW A;  5AQL A;  4OKK A;  3EIK A;  1WSG A;  1A5V A;  3O9S A;  4FJG A;  3K5L A;  4RTF D;  2G8U A;  2NRZ A;  3BZK A;  4FLU A;  1GLL O;  5JVH L;  5E26 A;  3M1F A;  4BRE A;  3WXK A;  1KVB A;  1TAU A;  3C0B A;  5BR9 A;  4JKG A;  4E1N A;  5AQU A;  4EIA A;  4B9S A;  3OYE A;  4C8M A;  4DTX A;  1ASU A;  1B92 A;  4PUO A;  3AGK A;  4KTQ A;  2UUA K;  5D3G A;  2FGT A;  2ZF5 O;  3HZ6 A;  2QK9 A;  2XY5 A;  4H0T B;  4IFV A;  3AA2 A;  4B9L A;  4MO5 A;  3THY A;  2Z1H A;  3R8E A;  4B9U A;  1RBV A;  3PIP L;  3SJH A;  3J81 O;  2QKK A;  4CJU A;  4BR9 A;  5C10 A;  1QQO A;  4FK2 A;  3O4N A;  4DQR A;  4B8C A;  3C7N B;  2W40 A;  1JL2 A;  4LSL A;  3N4P A;  1HYS A;  2D0O A;  2OTJ N;  3O3H A;  2O8E A;  5LJV A;  4X62 K;  1NK7 A;  2NRH A;  3DJC A;  3QLH A;  4IZ9 A;  1N3C A;  4JI4 K;  4RW4 A;  1KTQ A;  3O4W A;  3SQ0 A;  3T1A A;  5AQS A;  5AZJ B;  2HKP A;  2OPS A;  3MEE A;  4J8F A;  1RBR A;  2FBT A;  4LFC K;  3B6O A;  3DI6 A;  1YTF A;  1NGC A;  3E01 A;  3HVT A;  4FJL A;  5CR4 A;  2GEM A;  1P90 A;  3TR8 A;  1W97 L;  4B9M A;  2QEX N;  2JWL A;  5LMN K;  4OKE A;  1VOL B;  4CGD A;  3H1Z A;  1P8Z A;  2CGK A;  3OCI A;  2ZD1 A;  2E2N A;  3VEY A;  1QNB A;  2YV0 X;  4C23 A;  1HJO A;  2AA4 A;  3OYK A;  2GEL A;  3AO2 A;  4O55 A;  5AQZ A;  5TKW A;  3VMF B;  3UB5 A;  4E7I A;  1QVG M;  1C0T A;  3HM8 A;  4DR2 K;  1KSP A;  4D7R A;  4JHD A;  3E9P A;  4M3X A;  4CCH A;  1ZBU A;  1WSJ A;  2E6L A;  1RTD A;  2NLV A;  1J6Z A;  3L2V A;  3CMA N;  3D2E A;  1GLB G;  2D0C A;  1HQU A;  1C1A A;  3V9S A;  4FK4 A;  4B1W B;  3CME N;  4ELV A;  1Q9Y A;  3CCR N;  3K9K A;  4J2E A;  1SQK A;  2P9N B;  3HPO A;  3CVS A;  1IKV A;  4I9Q A;  4DB3 A;  4DLG A;  5HRR A;  4BRM A;  4HHT A;  1HU0 A;  4DTN A;  1RDU A;  4LD0 A;  1YIJ N;  4K8X A;  4DTP A;  3ZT1 A;  3KTQ A;  4LF8 K;  1NWK A;  3DLL L;  2OTL N;  4CIF A;  4CJ7 A;  4FO0 A;  3HPH A;  4H03 B;  5AZJ A;  3SAH A;  3A5M C;  4CZL A;  2F8S A;  3Q7C A;  3SQ1 A;  3CPE A;  1GLJ O;  1NK9 A;  1A5X A;  2NWV A;  4MFB A;  3SV3 A;  3VEV A;  1SZ2 A;  4CJF A;  2RHK A;  4R5P A;  4A2B A;  4FWO A;  5FPD A;  3UKU B;  3CM6 A;  4GW6 A;  3P1G A;  5IT9 O;  3ATV A;  4PKG A;  4F3T A;  2Z0F A;  3CPW M;  3I0R A;  3OBY A;  3OGD A;  3HRG A;  3CET A;  3AGR A;  4EP5 A;  5AQR A;  5FRN A;  2E8A A;  2QWM A;  5J2M A;  3SAF A;  3DMJ A;  3IMX A;  2QA4 N;  4F8R A;  2X74 A;  1Q86 O;  2OAN A;  3I56 N;  4KPY A;  1W80 A;  3R3L A;  1U47 A;  1JLE A;  1RIL A;  1QN7 A;  1VQO N;  5IWA K;  2I5W A;  3WXI A;  3QES A;  1YJW N;  5ADX A;  3NH1 A;  3CCV N;  3SNS A;  3B8A X;  3TE5 A;  3L8B A;  4BGB A;  4DSJ A;  5J2P A;  3TSQ A;  1VQN N;  3FZM A;  2E6M A;  1LAV A;  1YVU A;  4DR5 K;  4BC4 A;  1KD1 O;  2JGU A;  2QLV A;  3EKS A;  1IKW A;  2IDO A;  3LPU A;  2FKM X;  3M8Q A;  4OPJ A;  4FPB A;  1T05 A;  1IBM K;  5BMN A;  2VWB A;  5JMV D;  4JK7 A;  2XY6 A;  3I8B A;  3F0Z A;  4FJX A;  4DSK A;  4EZ9 A;  3NGZ A;  5M1K A;  3SJJ A;  2XO7 A;  1EQY A;  1S72 N;  1K8K A;  2NOE A;  2KFZ A;  4KO0 A;  1YJ9 N;  4IOX A;  1R0A A;  2QXL A;  1KVC A;  3G4S N;  4BE0 A;  3DXK A;  1JCF A;  4DTS A;  3PV8 A;  1RT3 A;  1TKX A;  4TPS A;  1RDC A;  4CED A;  4FJJ A;  4DG1 A;  1NJW A;  1ZBS A;  4M3Y A;  4JRQ A;  4CJQ A;  1RT1 A;  3K5O A;  4CF0 A;  3OH9 A;  4CHN A;  3TAG A;  1BI4 B;  1O1W A;  1FKO A;  4JKB A;  2YNG A;  5C15 A;  4FLX A;  3SMS A;  2YHW A;  1BWF O;  2NRX A;  3ZSY A;  1HR0 K;  5SZT A;  1C9B B;  4B1Z A;  4ROD B;  4IO9 L;  2P51 A;  1FJG K;  3LAL A;  1XNQ K;  3TI0 A;  2BE2 A;  1JLQ A;  4PKI A;  4RWT A;  3KLG A;  3ULD A;  2Q0U A;  1XHZ A;  2ZQB A;  4NB4 A;  3ZSZ A;  4BRK A;  4K0K K;  4JS5 A;  4ROC B;  3T4N A;  4OO1 J;  1CXU A;  1SL2 A;  3KWI A;  4C8N A;  2I7P A;  2O8B B;  3L3U A;  4YY3 K;  2YHY A;  1P5G X;  4BRD A;  4QOZ B;  4M42 A;  3O9U A;  3SCX A;  2NLX A;  3MN6 A;  5KGX A;  4GY2 B;  2Z1G A;  2CH5 A;  4EHU A;  3NVK A;  2WOM A;  3P39 A;  1VOK A;  3JXU A;  5GIO A;  5GAG P;  4U7B A;  3AVK A;  3EN9 A;  2KFN A;  5LL6 Z;  3RPJ A;  3J7Z O;  1OKJ A;  5IYB P;  4OGE A;  1EBM A;  5AFU H;  2HHQ A;  2I5J A;  3HVR A;  4OPA A;  2MZ8 A;  5CE3 A;  2O8D A;  3ENO A;  2HBJ A;  1S3X A;  4FWM A;  3S3O A;  3LDL A;  1U49 A;  3H46 O;  3EEQ A;  4M3T A;  4KHP K;  1TAQ A;  2QXF A;  4KTW A;  1EET A;  2X6S A;  4HCC A;  3SQ4 A;  1NMN A;  3AA3 A;  4MO4 A;  1OH5 A;  2Q3S A;  4CF1 A;  3AO3 A;  1YAG A;  3VEW A;  3ENO C;  5I42 A;  4CD3 A;  1W7A A;  3QET A;  4CJE A;  1CZA N;  3VQ4 A;  2QWQ A;  4IFY A;  1ESV A;  2NUB A;  3OS2 A;  1CZ9 A;  1N5Y A;  1WAJ A;  3NFA A;  3QIP A;  3T69 A;  4WQ4 C;  3OYH A;  5C24 A;  4DQS A;  1SL0 A;  1HNX K;  4QAG A;  5AQY A;  3CC4 N;  1RDB A;  1B9F A;  4B3S K;  3D4V A;  2W41 A;  4QCL A;  4DHY A;  4KHS A;  4AF1 A;  1ZBF A;  3CFO A;  4CJ3 A;  2YJF A;  1DT9 A;  4CZE A;  3OYM A;  3MAQ A;  4KHU A;  3CJ7 A;  1DKG D;  4FWN A;  5J2N A;  5EOY A;  1FK9 A;  4KRF A;  3VQ8 A;  3F9M A;  4CGF A;  3UKR A;  3OBW A;  3VEZ A;  1NMD A;  1G99 A;  1WQA A;  4WZS D;  2E1Y A;  3CF5 L;  3T3F A;  4WYB A;  3VGK A;  1D9F A;  4JI1 K;  1BCO A;  3ID6 A;  4M7Y A;  4OLA A;  3DOL A;  1BQM A;  4B1Y B;  3VQA A;  5KQD A;  1NGG A;  3ULE A;  2OOY A;  2GWJ A;  1KVA A;  5KPR A;  4B1X B;  1HX1 A;  1X3N A;  4IOA L;  2LAE A;  5HRP A;  1ZBL A;  3F73 A;  3OW2 M;  4BWJ A;  3CWS A;  3KK2 A;  3CIP A;  4O44 A;  4FJN A;  2D5R A;  3UKU A;  2HZM A;  3NGY A;  1MU2 A;  1OVY A;  2B5J A;  4BR0 A;  3OYL A;  4LF5 K;  4UY8 O;  4IJA A;  2XY8 A;  5DM7 L;  5GAE P;  3C6A A;  3IUC A;  4IEI A;  2ETJ A;  2ITM A;  4DV0 K;  1BL3 A;  2A6A A;  4Q11 A;  3T1Y K;  1GLE G;  1VAZ A;  3WXM B;  5TKY A;  1TK0 A;  2O8F A;  3EZ5 A;  1NK0 A;  3OTO K;  3LDS A;  2VGM A;  4RW8 A;  4HUF A;  1JL1 A;  4JKE A;  3O1W A;  3S9H A;  3KLI A;  4MQ3 A;  2G8K A;  3KK3 A;  4DV5 K;  3L3V A;  1CDW A;  1W9H A;  1C47 A;  4DR3 K;  1QTM A;  1TBP A;  2X6N A;  3U3G A;  3M8R A;  3S3M A;  3P83 D;  4CIE A;  3HI0 A;  4FVM A;  3CQY A;  2J4R A;  1NJZ A;  4NYF A;  4CJP A;  5C2D A;  3C04 A;  1HMV A;  5M1N A;  5KL0 A;  3AVM A;  3OYG A;  2BTF A;  5AQO A;  3NA5 A;  4KHY A;  1VTO A;  4OPH A;  5AQX A;  4FLW A;  3AVI A;  1NGH A;  2WBN A;  2Q97 A;  2ZFD B;  3I0X A;  5KRT A;  2ZJQ L;  4BRG A;  3F5T A;  3ZEU B;  3HP9 A;  3NAE A;  4OX9 K;  3ZT2 A;  1E3M A;  1LV5 A;  2VWJ A;  1Z6R A;  4BR4 A;  3J7Y P;  1VQP N;  3ZX3 A;  2HBM A;  2FF6 A;  1JLC A;  3WNE A;  3HJF A;  1U4B A;  1NJX A;  4JYA K;  2RPI A;  2JOI A;  3CG7 A;  4LFB K;  4AHC A;  2G8F A;  4BRQ A;  4B0A A;  1KY6 A;  4F2S A;  2JLE A;  1N8R O;  3NMU A;  5AZI B;  1IKY A;  4WQ5 C;  4CF2 A;  4FSV A;  1Q81 O;  4FL9 A;  1HJR A;  5J1E A;  2P5G A;  3LAM A;  1BI4 A;  4RW7 A;  4FOE A;  4BGA A;  1Q9U A;  3DM2 A;  2O8E B;  4IKF A;  3OLP A;  4CZM A;  4WFN L;  3CCU N;  2OPP A;  2ZWH A;  2KLA A;  3AO4 A;  1RDD A;  4BVP A;  3PLA A;  4W5R A;  2FXU A;  3OYI A;  3FGU A;  2NZT A;  4HJH A;  3VQE A;  1T44 A;  4NXM K;  4CEC A;  3JYT A;  1NG9 A;  2D1K A;  1KFI A;  1OVQ A;  5JVG L;  5EPC A;  1JLF A;  2P5O A;  5FPM A;  2F96 A;  3C95 A;  4JRP A;  4X66 K;  1RTH A;  4KTZ A;  2GUP A;  4CGJ A;  1K35 A;  2O4G A;  4NYN A;  1TK5 A;  3RSM A;  3CJ9 A;  4CEF A;  3CWU A;  2NRR A;  4A61 A;  3H1Q A;  4F3O A;  4FWR A;  2W42 A;  5E84 A;  3SUQ A;  4FVU A;  4CK2 A;  1C1B A;  1QQN A;  2P9S A;  2HVH A;  2BGG A;  2QWL A;  4HTL A;  3TTD A;  4OVL A;  3SI6 A;  4YOX A;  4EAH D;  1NM1 A;  1BU6 O;  5HLF A;  4PWD A;  4C1N K;  2HL8 A;  3OS1 A;  3K5N A;  1KAZ A;  2YNI A;  2DFE A;  2A1S A;  4BG9 A;  1DIZ A;  1C1C A;  4H4M A;  2QWR A;  1TGH A;  2EHG A;  4EAG A;  3D6R A;  4Z4G A;  1T8E A;  2VYP A;  2E1Z A;  4CD1 A;  4BDP A;  3UW2 A;  1L3T A;  5M1Q A;  1WN7 A;  3N4Q A;  1N33 K;  1NLV A;  3RWU A;  3OJS A;  1K2Y X;  4K8Z A;  2YNF A;  1IG8 A;  3A5O C;  1U2V B;  1LWV A;  3O1B A;  2V92 A;  2PBD A;  1NH2 A;  4JEP A;  1VQ9 N;  1B9D A;  4CJ5 A;  1J9A A;  1YF5 L;  3CHW A;  1ILY A;  4G1Q A;  3AVN A;  3ZLJ A;  3ZX2 A;  4MDA A;  2FBX A;  5KI6 A;  3MXI A;  5AQG A;  3QIO A;  2Q36 A;  2XRI A;  5CHI A;  3U8X A;  1NK8 A;  3U4L A;  5GAH P;  3DLG A;  4M3U A;  1XSZ A;  2NVM A;  2NOB A;  3QEI A;  4DV7 K;  1YI2 N;  5AFU A;  2BUP A;  4Z4C A;  4E3S A;  3L0Q A;  1NGJ A;  2W6L A;  1J3M A;  1BCM A;  5GIP A;  1L5U A;  3JSM A;  4GMJ B;  2PYJ A;  1QVF M;  2RKI A;  4CJL A;  1BIU A;  2Q0R A;  4H0Y B;  2HND A;  2P9N A;  4YOT A;  1MPG A;  3HT3 A;  4GKK K;  1NGI A;  3V9X A;  1KYU A;  2MJ7 A;  3GOI A;  1TL1 A;  2QW9 A;  4BE2 A;  3O9R A;  5ELZ A;  1LAW A;  2XY7 A;  5M1F A;  1M1K O;  1FXX A;  1NGF A;  4N5S A;  4ELT A;  1PCZ A;  3VEO A;  3CCM N;  3CYM A;  1KFS A;  3KLE A;  3ZT4 A;  3RVC A;  4CEQ A;  1Z05 A;  4WXA A;  4DS4 A;  3DPT A;  4JKC A;  2FSJ A;  4ZTJ A;  2E2O A;  1BHL A;  4ILH A;  4DV6 K;  2DFH A;  1J54 A;  3C6H A;  2WUS A;  1UT4 A;  2F7T A;  3QEW A;  2JHJ A;  3VGM A;  2FBV A;  1MWM A;  3NE6 A;  3KLH A;  1EKE A;  4DUZ K;  4W5O A;  4H4O A;  2B6A A;  1RBU A;  4FWS A;  4B1U B;  3ZSR A;  3MXM A;  1QTS A;  2ZJR L;  1CLQ A;  2D0P A;  3DPU A;  3ENC A;  3QEX A;  5C42 A;  2KTQ A;  3CJA A;  3NCI A;  1H1V A;  1VK0 A;  3OST A;  3SBG A;  5BPN A;  1QHA A;  1WBD A;  4B3T K;  2VQF K;  5B8H A;  4OJR A;  5DM6 L;  3BY5 A;  4BRO A;  3CJC A;  3U9D A;  1JCG A;  1JCE A;  4DTU A;  2PYL A;  3J7A P;  3PX0 A;  1KLM A;  2RE2 A;  4JI6 K;  2IIR A;  3VQC A;  4FOI A;  3OH6 A;  3KD5 E;  4JI8 K;  2HHS A;  4M41 A;  4GVM A;  4BR5 A;  3SV4 A;  2Z8U A;  4XEI A;  4I6M A;  2NOH A;  3C7N A;  4CJ4 A;  3HS8 A;  1M90 O;  3RMB A;  3O08 A;  1NNE A;  1VQM N;  2B4J A;  3MX5 A;  2GTD A;  4CI6 A;  4AHT A;  2E5L K;  2OZS A;  4YNQ A;  5BPM A;  4FJ5 A;  3CM5 A;  4E1J A;  4H5T A;  3U6F A;  1NOY A;  4FW2 A;  3CC7 N;  2O8C A;  4CE9 A;  1X1P A;  1S5J A;  3LWL A;  1U45 A;  4FJ9 A;  4NCA A;  1LCU A;  2NRV A;  4Z94 A;  1WSE A;  2QWP A;  4CHP A;  4F4K A;  3CCL N;  1YQK A;  3R9P A;  2NOZ A;  3A0I X;  4ISE A;  2HHH K;  1ZBI A;  4ZHR A;  1VRU A;  2FF3 B;  1SS6 A;  5BN9 A;  4BRH A;  4FJ8 A;  3LP3 A;  1KAY A;  3SYZ A;  4I2Q A;  2W6K A;  3IS9 A;  1VSL A;  4FWP A;  3CCS N;  4YOV A;  1KQS M;  1J53 A;  1QZ5 A;  3RTV A;  4DQQ A;  4Z4I A;  1NGA A;  5AQN A;  3VQ7 A;  5CZ2 A;  1OH7 A;  1KLN A;  2VWK A;  4J2D A;  2IC3 A;  1TUY A;  1RT7 A;  2YHB A;  4KH5 A;  1N34 K;  2DY4 A;  4LF7 K;  2IGI A;  4M3W A;  4FJI A;  3SUO A;  3D2E B;  3MEG A;  3SAG A;  3CWA A;  1YIT N;  4CHQ A;  4DSF A;  3DLH A;  4HCB A;  2YCH A;  1XC9 A;  4JI3 K;  3C6U A;  3IKM A;  1T03 A;  1VSK A;  3OA9 A;  1RBS A;  3KIO A;  5BRH A;  4IFE A;  4I7F A;  4CJT A;  3PO4 A;  3VES A;  3EY1 A;  3DRR A;  4FWL A;  3V1Q A;  4L8R B;  2YNH A;  3ZET B;  4KHW A;  1KCF A;  2ATQ A;  4KAZ A;  1Y64 A;  4YHH K;  4GVE A;  4OLB A;  2EWS A;  3FZK A;  2V51 B;  1K9M O;  2JWK A;  4BG8 A;  3HBT A;  3K5M A;  3AV9 A;  3HOT A;  4B3M K;  1VSD A;  3UIQ A;  3ENH A;  3OYC A;  2VQE K;  2D4W A;  4EAJ A;  4B9Q A;  3L4I A;  3MX2 A;  3DXM B;  4E89 A;  3K59 A;  3AO5 A;  3MCA B;  3E9L A;  4NLC A;  1PVS A;  1REV A;  3TWH A;  5AQV A;  3QEV A;  3AAP A;  3TAF A;  4FPA A;  4CER A;  2IVN A;  4NCB A;  3PMG A;  3IDH A;  3BP8 A;  4CVN E;  2DKA A;  4JAX A;  4FM1 A;  4G9Z A;  4FXD A;  4IG3 A;  4DKW A;  4PQU A;  4CBW A;  4EAK A;  3EZW A;  2IV8 A;  1BDG A;  2E2P A;  3HTV A;  2GWK A;  1Q18 A;  1V4T A;  3S3N A;  4QG5 A;  3VN5 A;  4QS7 A;  4CZI A;  1HUX A;  4OKJ A;  4Z0U A;  1IJJ A;  1QN9 A;  5FPN A;  4C8K A;  2DKC A;  4FLV A;  3JS6 A;  2FKF A;  1YQL A;  4DTM A;  3WNH A;  5F2R A;  1WSH A;  3G6E N;  3AVB A;  5C12 A;  5GAD P;  2V7Y A;  3T1H K;  3CER A;  3LM9 A;  3P4I A;  1JLA A;  4YDU A;  2UUB K;  3C65 A;  3QBX A;  1RGI A;  4E7K A;  2HZS A;  5FLX O;  3HK2 A;  1ATR A;  2V9J A;  3CWT A;  1TL3 A;  1N6Q A;  4LC9 B;  5GIN A;  1SKR A;  3PY8 A;  5F9C A;  1GLD G;  1DTT A;  3TSP A;  4W5N A;  3WQU A;  4BAC A;  1D9D A;  2PFU A;  2G30 A;  3GDQ A;  1NU0 A;  2G8H A;  3LP2 A;  4KRE A;  3ATU A;  2P9K B;  1HNI A;  3LPT A;  4DUY K;  4HTU A;  3VF2 A;  1YTB A;  2YKM A;  3WUH A;  4N41 A;  4YFU A;  5KPT A;  2BH1 A;  2H4L X;  5AN4 A;  4FWK A;  4EP4 A;  2WTU A;  2JHN A;  3KKR A;  3BF1 A;  5JLH A;  3EE8 A;  4O5F A;  4JI2 K;  4Z4H A;  3I33 A;  2GX9 A;  1S6Q A;  2P9I B;  1S9G A;  1WJW A;  1RTJ A;  2HVI A;  3TPQ A;  1QQC A;  1SL1 A;  4Z4E A;  4LH5 A;  2GUI A;  1QE1 A;  1S1T A;  2A42 A;  1C0G A;  1M3Q A;  3LP0 A;  1ITG A;  4AHS A;  1RDW X;  3V1R A;  3VQB A;  5HRO A;  3LP1 A;  1UL7 A;  3OYD A;  4CHY A;  1GLA G;  5HBM A;  4KHQ A;  2A5X A;  3K58 A;  1D3U A;  3FLC O;  4X64 K;  3HXM A;  1GOA A;  1K6Y A;  2ASM A;  2V7Z A;  2AP1 A;  1OH8 A;  1VQ4 N;  2QWN A;  1TV6 A;  1BQN A;  1IBK K;  2NRT A;  4IOC L;  3ZT3 A;  3AVH A;  1ATN A;  3NDK A;  3OYN A;  3RRH A;  1WUA A;  5KPZ A;  3THX A;  1NK4 A;  3O9Q A;  2Z1J A;  3NGI A;  4EJY A;  3L2U A;  3OC3 C;  1LWF A;  1DLO A;  3RR7 A;  4FM0 A;  2QKB A;  2NOL A;  4DQ8 A;  4WX8 A;  1KFD A;  2KQ2 A;  4B3R K;  1QTP A;  4FYD A;  1ASV A;  1S6P A;  1D5A A;  1TUU A;  2HBL A;  3I8D A;  3ZET A;  4FWQ A;  4LY7 A;  3L2Q A;  4K41 A;  4W5T A;  1XI1 A;  3V4I A;  4H0X B;  4YOY A;  5CYQ A;  4CHO A;  1X3M A;  4WF9 L;  3LZI A;  1RNH A;  3TAR A;  1DEJ A;  3V81 A;  1IO2 A;  1TYQ A;  2P9L A;  2VCP A;  1V5S A;  4EFH A;  4BC3 A;  1QHT A;  1RTI A;  4N56 A;  1QN5 A;  5AQF A;  2G8W A;  2QR1 A;  5C25 A;  3DYA A;  1NK6 A;  4ID1 A;  3MN5 A;  1KC8 O;  4BR7 A;  3OSM A;  1QQM A;  1BIZ A;  3AVJ A;  1GLF O;  1IG9 A;  2Y1I A;  3MN9 A;  1YHQ N;  4KKO A;  1D8Y A;  4CEZ A;  1EO1 A;  1I39 A;  4ROE B;  3D2F A;  3TU5 A;  3A2F A;  3SUP A;  3OSE A;  3Q7B A;  4HUG A;  2V8Q A;  1SKS A;  2O8F B;  2F7L A;  4Y1C A;  4JI0 K;  1VQ7 N;  2KZZ A;  1HQE A;  1RM1 A;  1QZ6 A;  3KVG A;  4CFF A;  3DRP A;  5M1P A;  5BRD A;  3SBT A;  4PKH A;  5K14 A;  3ZSV A;  5JMV A;  2ZM6 K;  2OYQ A;  3EAY A;  4IL8 A;  4O4G A;  1UAX A;  2VG7 A;  5SWM A;  4JD2 A;  4XIU A;  4RCH A;  3ZYY X;  2HMI A;  1L3U A;  3NF6 A;  3S41 A;  3DLB A;  3I0S A;  1QN3 A;  4EHT A;  3D7Q A;  2P9I A;  4BRA A;  1Z25 A;  4B9V A;  1MA9 B;  3NH2 A;  3G10 A;  5JIC A;  4UQG A;  1FKP A;  3KK1 A;  1HNZ K;  1QNA A;  4EJZ A;  4N76 A;  4AM7 A;  3ULX A;  3OYF A;  4H5N A;  2P9K A;  2A40 A;  3E9O A;  4CFD A;  5AQH A;  3UKR B;  4DMN A;  4DS5 A;  5DMR A;  3RMC A;  5HP1 A;  2OOX A;  1X9J A;  3WNG A;  4ISF A;  4B9N A;  4B3O A;  2KHO A;  3V6D A;  4JLH A;  3HYF A;  1GLC G;  2ZE2 A;  3K0S A;  2QTD A;  3ALY A;  2KKZ A;  4JKG B;  3AA4 A;  3LAN A;  4CBX A;  3ITH A;  4EZ6 A;  1AIS A;  3BDP A;  3MWT A;  2QRE A;  4CZG A;  1WOQ A;  2OZM A;  3AVA A;  3R1X A;  4XH5 A;  2IV9 A;  1QNE A;  1S1V A;  4H5W A;  2G8V A;  4CEO A;  1JKH A;  4QS8 A;  1KO9 A;  3FZL A;  4GV3 A;  4HWI A;  4JKD A;  4CBU A;  1TVR A;  2E2Q A;  4ILG B;  2HOE A;  1J5E K;  2EHB D;  4I9L A;  4J2A A;  4NLB A;  3HM9 A;  1X9S A;  3SMP A;  4CZH A;  3O4Q A;  4CZF A;  2ITG A;  4YOR A;  3VQP A;  5CYM A;  1Q8I A;  4OPK A;  3ASM A;  4KFB A;  3L2R A;  3ZSO A;  4DTO A;  4WCE L;  5BN8 A;  1JFI C;  3TAB A;  3PO5 A;  4FLT A;  3QO9 A;  3P5J A;  4WE1 A;  1XQS C;  4YDU C;  3VQ6 A;  3A5N C;  2CGJ A;  3PSF A;  4BRF A;  1BUP A;  2FLO A;  1CXQ A;  1PCM X;  3LM2 A;  4BJU A;  1HYV A;  3GE1 A;  4GKJ K;  2FSK A;  4KBO A;  2EX3 A;  4CHZ A;  1LWC A;  4DQI A;  1NGD A;  1JLB A;  1T3V A;  2VG6 A;  3HS9 A;  4D7Q A;  2UXC K;  1HPM A;  3ZT0 A;  3DXM A;  5AQT A;  4E7H A;  3AA5 X;  4LSN A;  3CVT A;  1BGX T;  2O8B A;  1M5Q 1;  2P9P B;  1XMO K;  3ZEU A;  3F10 A;  3HL8 A;  3RSE A;  4A2A A;  3BKQ X;  1TGO A;  3EE9 A;  3H1V X;  3THV A;  1BG3 A;  2F8T A;  5JS2 A;  5IYC P;  1QNC A;  3V9Z A;  4E19 A;  3CW7 A;  1NKC A;  3OS0 A;  4C7P A;  3T7Z A;  4PL7 A;  4CF9 A;  3KK7 A;  3OYA A;  2ASO A;  4WQ5 A;  1A5W A;  4CEB A;  4I2P A;  4C8L A;  4DU4 A;  4DSL A;  2NNW A;  3AAQ A;  5LJW A;  3KTU A;  1N39 A;  3IFR A;  4FJ7 A;  1TK8 A;  1GOB A;  2QI2 A;  3JAM O;  4BE1 A;  2UYT A;  3DLK A;  4HUE A;  1IKX A;  4KHN A;  5E41 A;  3WEE B;  3VQ9 A;  4EAL A;  5I3U A;  1PCJ X;  3KWG A;  1UT7 A;  5MLC Q;  2O3O A;  1G15 A;  3QDK A;  4NCG A;  3QNO A;  3BGR A;  4JKF A;  5CZ1 A;  3E1Y A;  4EAI A;  1B9K A;  4H5V A;  4V19 S;  1NKE A;  2Y8L A;  3CI5 A;  1UA1 A;  4RG8 A;  1RFQ A;  4FZX C;  2IAJ A;  1I3A A;  4BVO A;  4KH4 A;  1MDU B;  3HP6 A;  4ILJ A;  5AR0 A;  1RDA A;  3G71 N;  2HHW A;  3EKU A;  3G25 A;  1VSE A;  1DTQ A;  4JKH A;  1VQ5 N;  2RN2 A;  1NBW A;  1XHX A;  3CFP A;  4FLZ A;  2E4L A;  4CGG A;  3TDH A;  3PX4 A;  3H3O B;  3QIC A;  5LMU K;  1Q7Y O;  3CQX A;  1XWL A;  1HPZ A;  5LY3 A;  3W3D A;  2O4I A;  2HHV A;  4W5Q A;  1IV0 A;  4M3Z A;  2WON A;  1XUP O;  2CH6 A;  4BQL A;  2AJQ A;  5T7B A;  1L3S A;  3D0P A;  2NOI A;  5BPL A;  1QSL A;  2IVO A;  3G0Z A;  3LWM A;  4CW7 B;  4K43 A;  3KKS A;  4JN4 A;  5ADX H;  4N47 A;  5KQ8 A;  3O3G A;  3UE5 A;  2HST A;  1WB9 A;  2O8C B;  2Q1N A;  2R7Y A;  1EWR A;  5AJ3 K;  3LDO A;  4M63 C;  5F0X A;  4IDH A;  3D7E O;  3O9T A;  3KD1 E;  4RW6 A;  5AQP A;  5FRM A;  4I6M B;  3AVL A;  4A5B A;  1JXB A;  2UXD K;  5HL7 L;  1NKB A;  3I55 N;  1D4X A;  4PHT X;  4FJH A;  1QN4 A;  1ATS A;  2H5A X;  3TTF A;  3KRM A;  5EU7 A;  1HNV A;  3HO1 A;  2FBY A;  5AQK A;  1TKT A;  3TTC A;  4IXC A;  4M45 A;  4E0D A;  3MCP A;  2Z1I A;  3MN7 A;  4FLY A;  5C2F A;  5AQI A;  5EVZ A;  3RR8 A;  2YKN A;  2QWO A;  4AIL C;  3FFK B;  1S1U A;  1HKC A;  1EWQ A;  1U6Z A;  1KFQ A;  3CC2 N;  5KRS A;  1E4F T;  1TKD A;  3U3Y A;  4C8O A;  3H3N O;  3ISN C;  3NF8 A;  2YI1 A;  1N32 K;  3O6W A;  5EY4 A;  4JS4 A;  4A62 A;  3KJV A;  3CCQ N;  2ZGY A;  3HOS A;  4JK8 A;  1QSY A;  3BUZ B;  2X78 A;  2HHU A;  3KZB A;  5AQW A;  1Q82 O;  5HOO A;  3CQ8 A;  4IBN A;  4KI6 A;  4BRL A;  2NOF A;  4H0V B;  4QS9 A;  5KTQ A;  1VTL E;  1X9M A;  3U9Z A;  2HMP A;  1VRT A;  2HF4 A;  4E7J A;  1QN6 A;  1UOC A;  1KRP A;  2R5X A;  4KB0 A;  1U48 A;  4X65 K;  2O8D B;  2H3G X;  1YTA A;  4PA1 A;  1N3A A;  5BRF A;  4GNI A;  4R79 A;  4F9O A;  3HSC A;  2F9T A;  4Y0W A;  4KB1 A;  4JHD B;  1C0F A;  1XC3 A;  4DR7 K;  4FW1 A;  3T19 A;  3TAN A;  2UXB K;  4DFP A;  2P1J A;  4TSX A;  4DFM A;  1K8A O;  4DF4 A;  5FRO A;  3VTH A;  4BRC A;  1BOT O;  1C0M A;  1J5O A;  4CJS A;  3SNN A;  3BZC A;  4LFA K;  3LZJ A;  4AHU A;  1ZBH A;  5BMP A;  3AY9 A;  4FK0 A;  2IOC A;  3VOV A;  4IG0 A;  2BDP A;  3CJB A;  3O3F A;  1EUV A;  3O5B A;  4PL8 A;  3RSE B;  3WQT A;  2V52 B;  2Q2R A;  3P38 A;  5DK5 A;  2P9P A;  3PIO L;  4ISG A;  1ZXO A;  2KW4 A;  2YH5 A;  3GBT A;  1VSI A;  3CD6 N;  5FDL A;  1VSF A;  3MMV A;  3CFR A;  4JK9 A;  1RT5 A;  4BR2 A;  4RW9 A;  1K73 O;  3V9U A;  3DRS A;  3RMD A;  4BRP A;  3J80 O;  2ASP A;  4DCH A;  3IAY A;  3ULE B;  3RMA A;  4CFB A;  1CZB A;  4ELU A;  1NGB A;  4AM6 A;  4XH4 A;  4CZJ A;  1X9W A;  2OA8 A;  1LOT B;  3QBW A;  3M8P A;  2PZS A;  5EXW A;  2HNZ A;  3VF4 A;  4NO7 A;  4B9T A;  5HRN A;  4DLE A;  3DLE A;  4HVJ A;  1L3V A;  3OYB A;  2PAV A;  4CIG A;  3ZSQ A;  1HKB A;  3THY B;  1K8K B;  1WAF A;  3KLF A;  3VQD A;  4CZK A;  4GV9 A;  5HSH A;  2YJE A;  2P9S B;  2LSN A;  3VER A;  1VSH A;  4JKA A;  1KAX A;  1S1W A;  1W0H A;  3SQ2 A;  3MED A;  4JV5 K;  3QML A;  2YX6 A;  4DQP A;  1LW2 A;  1V4S A;  2BAN A;  2P9U B;  4DR4 K;  2FC0 A;  1HLU A;  1IH7 A;  1NK5 A;  1T6A A;  1VKL A;  1YQR A;  3DAW A;  3B6P A;  2JPI A;  2XHI A;  2P9U A;  5AQJ A;  3FZH A;  3LDQ A;  4LF4 K;  1KYD A;  3D45 A;  4FZZ A;  1KYF A;  3FR0 A;  4FM2 A;  2GBZ A;  2GV9 A;  4Q5V A;  2QRD A;  1QSS A;  3CJ1 A;  1NGM A;  5H1S Q;  4FJM A;  1SUQ A;  3VA3 A;  2DKD A;  3V9W A;  3M6G A;  3ZCM A;  3TSU A;  5C0Y A;  3TAP A;  2WFB A;  3I3W A;  3K9J A;  4AHR A;  4AH9 A;  3ZX0 A;  3K57 A;  1R4X A;  3MWP A;  3TAM A;  4Y1D A;  4O8U A;  3QFP A;  1QN8 A;  1NOZ A;  3NBP A;  5JLF A;  4PY5 A;  1KXP A;  2E88 A;  3P31 A;  1LWW A;  3NF9 A;  3E66 A;  3ZSX A;  3QIN A;  3VA0 A;  4DFJ A;  3CXC M;  1ASW A;  3WEE A;  4DV4 K;  2PWW A;  1FW6 A;  4DWI A;  4O5B A;  2QM1 A;  1JJ2 M;  4CES A;  1IBL K;  4H0O A;  3WXL A;  1QS4 A;  5AZI A;  4DV2 K;  1RCH A;  4CK3 A;  4BC2 A;  3TAQ A;  1LXT A;  1EXQ A;  4ICL A;  1N36 K;  3MK6 A;  5HRS A;  1ZC6 A;  4GV6 A;  3AAR A;  3PDK A;  4IJN A;  5CY4 A;  4JNE A;  3DOK A;  4DV3 K;  4BRI A;  4WQ4 A;  4IDK A;  4XH1 A;  3PSI A;  1VQ8 N;  3MXJ A;  5EX5 A;  2YHA A;  4CJR A;  2IS3 A;  1VHX A;  3QNN A;  3RRG A;  3IRX A;  3LAK A;  4DFK A;  2YA3 A;  1T7P A;  1M3H A;  3VQQ A;  1R59 O;  4BC5 A;  4O8K A;  3M8S A;  3VGL A;  2F9W A;  4CFC A;  1EX4 A;  1E4G T;  4F2R A;  2WC9 A;  2DFF A;  4YOU A;  3H08 A;  4CJK A;  1VQK N;  2CGL A;  1O13 A;  2I7N A;  3D2F B;  2NRW A;  2FSN A;  3WXJ A;  4WFA L;  5AQQ A;  2Q31 A;  1MP9 A;  3LL3 A;  2OPR A;  4LF9 K;  3N89 A;  4H0P A;  3EO3 A;  1LWY A;  3M3Z A;  2HNY A;  3HPG A;  3HST B;  3VEX A;  1C0U A;  3F2K A;  3DXK B;  1HKG A;  3SK3 A;  4CEE A;  3DWL A;  4B8A B;  3NF7 A;  3CCE N;  3FE1 A;  2DPN A;  2FUV A;  1VSM A;  1RT4 A;  4CK1 A;  1WBB A;  1YXQ A;  4U67 L;  1LWE A;  3L4Q A;  3KHY A;  4CJV A;  3CCJ N;  3EYZ A;  3J8A A;  1C6V A;  5I9E B;  3F9K A;  4BWM A;  3QER A;  4M7X A;  4K25 A;  4BDZ A;  4H5R A;  2ZGZ A;  3L2W A;  4BY9 C;  3MEC A;  1LW0 A;  1SV5 A;  3VQ5 A;  4Z4F A;  4DTJ A;  3OJU A;  1VQ6 N;  3FZF A;  3NHG A;  2OCE A;  1BA1 A;  3IH7 A;  3THX B;  4OGC A;  4KI4 A;  4B1V A;  4DV1 K;  1BIS A;  3THW B;  1ZYQ A;  1SAZ A;  3ENB A;  1KY7 A;  4E1M A;  5JN5 A; 
#chains in the Genus database with same CATH homology
 3KD5 E;  2HHS A;  1JLG A;  2P51 A;  3AO1 A;  3AVG A;  4M41 A;  3OYJ A;  1WSF A;  3LAL A;  2VG6 A;  4GVM A;  5IYD P;  3HS9 A;  2BE2 A;  1S1X A;  3TI0 A;  1JLQ A;  4DUL A;  3KLG A;  1Y97 A;  3SV4 A;  3ZT0 A;  2Z8U A;  3ULD A;  2NOH A;  3C6T A;  4CJ4 A;  4E7H A;  3HS8 A;  2ZQB A;  1XHZ A;  3AA5 X;  4LSN A;  3ZSZ A;  3RMB A;  4JS5 A;  1HRH A;  1BGX T;  4ROC B;  1CXU A;  2B4J A;  3F10 A;  3HL8 A;  4M3R A;  2XHB A;  1SL2 A;  4CFA A;  3THV A;  1TGO A;  4C8N A;  4AHT A;  4O0J A;  2OZS A;  4YNQ A;  3I0W A;  2F8T A;  5JS2 A;  4FJ5 A;  5IYC P;  1WSI A;  3CM5 A;  3L3U A;  2HB5 A;  1QNC A;  3V9Z A;  5KGW A;  3U6F A;  4E19 A;  1NOY A;  4FW2 A;  4CE9 A;  4QOZ B;  1X1P A;  3QEP A;  1S5J A;  3LWL A;  3OS0 A;  1U45 A;  1NKC A;  1HYZ A;  4FJ9 A;  4NCA A;  3SCX A;  4M42 A;  4CF9 A;  5KGX A;  4CGH A;  2Z1G A;  3OYA A;  3SZ2 A;  4KV8 A;  4FJK A;  5JS1 A;  1JXE A;  1A5W A;  1WSE A;  4CEB A;  4I2P A;  2WOM A;  4CHP A;  1PZD A;  4DU4 A;  2Y1J A;  4C8L A;  4DSL A;  4F4K A;  1YQK A;  1VOK A;  1NVP A;  3KTU A;  1N39 A;  2NOZ A;  1U04 A;  4FJ7 A;  3AVK A;  1GOB A;  1TK8 A;  2KFN A;  4DSE A;  2DTU A;  1ZBI A;  4ZHR A;  3RPJ A;  1VRU A;  4BE1 A;  3DLK A;  5IYB P;  4OGE A;  1EBM A;  4CEA A;  1IKX A;  4HUE A;  4KHN A;  2I5J A;  3LP3 A;  5E41 A;  3HVR A;  4I2Q A;  3VQ9 A;  3SYZ A;  2MZ8 A;  4DF8 A;  5I3U A;  4I8O A;  1UT7 A;  1RT6 A;  3IS9 A;  2O3O A;  1G15 A;  4NCG A;  3QNO A;  3S3O A;  1VSL A;  3BGR A;  1RBT A;  1U49 A;  5CZ1 A;  2OPQ A;  4DSI A;  1B9K A;  1NKE A;  1J53 A;  3C94 A;  4DU3 A;  1UA1 A;  4M3T A;  3RTV A;  4B08 A;  2KZM A;  4RG8 A;  1TAQ A;  4DQQ A;  4Z4I A;  4FZX C;  2IAJ A;  1I3A A;  2QXF A;  4KTW A;  1EET A;  2X6S A;  4HCC A;  1UWB A;  3HP6 A;  3AA3 A;  3SQ4 A;  1RDA A;  3VQ7 A;  1FN7 A;  4CGI A;  5CZ2 A;  1KLN A;  2Q3S A;  3AVC A;  4CF1 A;  2VWK A;  3AO3 A;  4J2D A;  1VSE A;  1EP4 A;  1YT3 A;  1DTQ A;  2IC3 A;  3PUF A;  1RT7 A;  2YHB A;  3AVF A;  2RN2 A;  2DY4 A;  1XHX A;  5I42 A;  1NJY A;  2IGI A;  3CFP A;  4FLZ A;  4FJI A;  3SUO A;  4M3W A;  2E4L A;  4CGG A;  1UA0 A;  2D0B A;  3TAE A;  3MEG A;  3K2P A;  3PX4 A;  2HHX A;  4CHQ A;  4DSF A;  3DLH A;  4HCB A;  4FCY A;  1XWL A;  1HPZ A;  3QET A;  4CJE A;  1XC9 A;  2O4I A;  2HHV A;  4W5Q A;  3C6U A;  4M3Z A;  2WON A;  3VQ4 A;  4AHV A;  4IFY A;  1TKZ A;  1T03 A;  4Q0B A;  2AJQ A;  5T7B A;  1VSK A;  3D0P A;  2NOI A;  1L3S A;  2NUB A;  3G0Z A;  3OS2 A;  1QSL A;  2HW3 A;  1RBS A;  1CZ9 A;  3KIO A;  4H8K A;  3WNF A;  4I7F A;  1WAJ A;  3NFA A;  4CJT A;  3KKS A;  3QIP A;  3LWM A;  3SPY A;  3PO4 A;  3OYH A;  4N47 A;  3DRR A;  3O3G A;  3EY1 A;  1YTU A;  3V1Q A;  5C24 A;  2G8I A;  4DQS A;  1TBA B;  4L8R B;  2YNH A;  1SL0 A;  4QAG A;  1Z26 A;  4KHW A;  2ATQ A;  1E42 A;  1KCF A;  1RDB A;  1YQM A;  1B9F A;  4KAZ A;  2R7Y A;  4OLB A;  4QCL A;  4KHS A;  4DTR A;  1ZBF A;  3CFO A;  4CJ3 A;  4FZY A;  4KHU A;  3OYM A;  3MAQ A;  2VJ0 A;  3K5M A;  5J2N A;  3AV9 A;  5J2Q A;  1RT2 A;  1F21 A;  1FK9 A;  1VSD A;  3UIQ A;  4KRF A;  3VQ8 A;  3OYC A;  4CGF A;  3KD1 E;  4CJW A;  4RW6 A;  5FRM A;  1N5Y A;  4O0I A;  4E89 A;  3K59 A;  3AO5 A;  4WZS D;  3AVL A;  3T3F A;  1JXB A;  1NKB A;  1WLJ A;  1D9F A;  4FJH A;  1QN4 A;  4DU1 A;  1BCO A;  3V1O A;  4CF8 A;  3KRM A;  4OLA A;  3DOL A;  3FFI A;  1HNV A;  1BQM A;  5EU7 A;  1Q9X A;  3VQA A;  3HO1 A;  1REV A;  2FBY A;  3TWH A;  3QEV A;  1KVA A;  1TKT A;  4ID5 A;  4E7L A;  3TAF A;  4M45 A;  4CER A;  4E0D A;  4NCB A;  2Z1I A;  3DLR A;  2LAE A;  5HRP A;  3NH0 A;  1ZBL A;  4J2B A;  3F73 A;  4FLY A;  4BWJ A;  4FM1 A;  1GOC A;  3KK2 A;  4FXD A;  3RR8 A;  4IG3 A;  1VSJ A;  4PQU A;  4O44 A;  4FJN A;  2D5R A;  2YKN A;  2HHT A;  2IV8 A;  2HZM A;  3IG1 A;  3NGY A;  4AIL C;  1MU2 A;  3PX6 A;  1S1U A;  2B5J A;  1S9E A;  3OYL A;  4BDY A;  2RF2 A;  5KRS A;  1TKD A;  3U3Y A;  2XY8 A;  3S3N A;  4C8O A;  3VN5 A;  3ISN C;  3NF8 A;  4OKJ A;  4Z0U A;  1QN9 A;  3OVN A;  4ZTF A;  3SPZ A;  2ETJ A;  1SKW A;  4C8K A;  1BL3 A;  4Q11 A;  4FLV A;  3SUN A;  4JS4 A;  2PY5 A;  1WNS A;  4LH4 A;  3KJV A;  3OY9 A;  1YQL A;  4E1M A;  1TK0 A;  3EZ5 A;  1NK0 A;  2D0A A;  3LDS A;  4RW8 A;  3WNH A;  4DTM A;  2VG5 A;  4HUF A;  1JL1 A;  2A1R A;  1WSH A;  3ZSW A;  1QSY A;  2X78 A;  2HHU A;  3AVB A;  4OKK A;  3EIK A;  4KI6 A;  3CQ8 A;  4IBN A;  1WSG A;  3S9H A;  1A5V A;  2NOF A;  3KLI A;  4FJG A;  4MQ3 A;  3K5L A;  3KK3 A;  2G8K A;  5KTQ A;  1VTL E;  1JLA A;  3L3V A;  1X9M A;  1CDW A;  1W9H A;  1QTM A;  2G8U A;  1TBP A;  1VRT A;  2X6N A;  3U3G A;  3M8R A;  3S3M A;  4E7J A;  1QN6 A;  1UOC A;  4FLU A;  2HZS A;  3P83 D;  4FVM A;  4CIE A;  4E7K A;  1KRP A;  4KB0 A;  3HK2 A;  1TL3 A;  1N6Q A;  1U48 A;  1TAU A;  1KVB A;  4PA1 A;  1YTA A;  1NJZ A;  4NYF A;  1N3A A;  4E1N A;  4CJP A;  1SKR A;  1HMV A;  3PY8 A;  4B9S A;  4KB1 A;  3OYE A;  1DTT A;  4C8M A;  4W5N A;  4BAC A;  1D9D A;  4DTX A;  4FW1 A;  2G30 A;  1ASU A;  3AVM A;  3T19 A;  3OYG A;  4DFP A;  3TAN A;  1B92 A;  2P1J A;  4TSX A;  4DFM A;  4PUO A;  2G8H A;  3LP2 A;  4KHY A;  4KRE A;  1VTO A;  5FRO A;  4DF4 A;  3LPT A;  1HNI A;  4HTU A;  1YTB A;  2YKM A;  4FLW A;  4KTQ A;  4N41 A;  2FGT A;  3AVI A;  1C0M A;  5D3G A;  4YFU A;  4CJS A;  3SNN A;  1J5O A;  3LZJ A;  4AHU A;  2QK9 A;  1ZBH A;  4FK0 A;  2XY5 A;  5AN4 A;  4IFV A;  2IOC A;  4EP4 A;  3KKR A;  3AA2 A;  4IG0 A;  4B9L A;  2BDP A;  3I0X A;  5KRT A;  3O3F A;  2Z1H A;  4Z4H A;  4B9U A;  1RBV A;  1S6Q A;  1S9G A;  3HP9 A;  3NAE A;  5DK5 A;  3ZT2 A;  1LV5 A;  2QKK A;  2VWJ A;  1RTJ A;  4CJU A;  2KW4 A;  2HVI A;  1QQC A;  2YH5 A;  1SL1 A;  4Z4E A;  1VSI A;  4FK2 A;  1VSF A;  2GUI A;  3O4N A;  4LH5 A;  5FDL A;  4B8C A;  4DQR A;  1QE1 A;  1S1T A;  1JLC A;  3WNE A;  3HJF A;  1U4B A;  1NJX A;  3CFR A;  2RPI A;  2JOI A;  1M3Q A;  1JL2 A;  3CG7 A;  1ITG A;  1RT5 A;  3LP0 A;  4LSL A;  4AHS A;  4AHC A;  2G8F A;  4RW9 A;  3V1R A;  3VQB A;  5HRO A;  4B0A A;  1HYS A;  3LP1 A;  3V9U A;  1KY6 A;  3OYD A;  4CHY A;  3O3H A;  5HBM A;  4F2S A;  2JLE A;  3DRS A;  3RMD A;  4KHQ A;  1NK7 A;  3QLH A;  1IKY A;  1D3U A;  1N3C A;  3K58 A;  4RW4 A;  3HXM A;  4CF2 A;  1GOA A;  1K6Y A;  1KTQ A;  3IAY A;  3RMA A;  4CFB A;  1HJR A;  1CZB A;  5J1E A;  3SQ0 A;  3LAM A;  2P5G A;  1BI4 A;  4ELU A;  1TV6 A;  4RW7 A;  3T1A A;  3DM2 A;  4IKF A;  1BQN A;  3ZT3 A;  3AVH A;  1X9W A;  2OA8 A;  3NDK A;  2OPS A;  3MEE A;  3OYN A;  1RBR A;  2FBT A;  3RRH A;  1NK4 A;  3M8P A;  3B6O A;  3DI6 A;  1YTF A;  2PZS A;  2OPP A;  3E01 A;  2Z1J A;  2HNZ A;  3AO4 A;  3NGI A;  4EJY A;  3L2U A;  3OC3 C;  1RDD A;  1LWF A;  4B9T A;  1DLO A;  3HVT A;  3RR7 A;  5HRN A;  4DLE A;  4FJL A;  3DLE A;  4HVJ A;  4FM0 A;  1L3V A;  2NOL A;  3TR8 A;  4W5R A;  4FJ8 A;  3OYB A;  4B9M A;  2QKB A;  4OKE A;  1KFD A;  3ZSQ A;  4CIG A;  3OYI A;  1VOL B;  3KLF A;  1WAF A;  2KQ2 A;  4CGD A;  3H1Z A;  1QTP A;  3VQE A;  1ASV A;  4CEC A;  4FYD A;  3JYT A;  1S6P A;  3VQD A;  3OCI A;  1D5A A;  2ZD1 A;  3I8D A;  1QNB A;  2LSN A;  2YV0 X;  1VSH A;  3OYK A;  1W0H A;  1S1W A;  4LY7 A;  3L2Q A;  3SQ2 A;  3MED A;  1JLF A;  3AO2 A;  4O55 A;  4W5T A;  2P5O A;  2F96 A;  4DQP A;  3C95 A;  4JRP A;  1LW2 A;  3V4I A;  2BAN A;  4E7I A;  1XI1 A;  1RTH A;  4KTZ A;  5CYQ A;  4CHO A;  4CGJ A;  2O4G A;  1C0T A;  3LZI A;  1KSP A;  4NYN A;  1RNH A;  1TK5 A;  2FC0 A;  4CEF A;  3TAR A;  3V81 A;  1IH7 A;  1NK5 A;  1IO2 A;  4M3X A;  4CCH A;  1ZBU A;  1WSJ A;  2E6L A;  1RTD A;  1YQR A;  3B6P A;  4F3O A;  1QHT A;  1RTI A;  2XHI A;  4N56 A;  1QN5 A;  3L2V A;  1KYD A;  3D45 A;  2G8W A;  4FZZ A;  2D0C A;  1HQU A;  1KYF A;  1C1A A;  2W42 A;  3V9S A;  3SUQ A;  5C25 A;  4FK4 A;  3DYA A;  4CK2 A;  4FM2 A;  1C1B A;  2GBZ A;  2GV9 A;  4ID1 A;  4Q5V A;  1NK6 A;  1QSS A;  2HVH A;  1NGM A;  4ELV A;  2BGG A;  4FJM A;  1Q9Y A;  3OSM A;  3AVJ A;  1BIZ A;  1SUQ A;  3VA3 A;  1IG9 A;  4J2E A;  3HPO A;  3V9W A;  2Y1I A;  1IKV A;  3ZCM A;  4I9Q A;  4OVL A;  4KKO A;  3SI6 A;  3TAP A;  4CEZ A;  1D8Y A;  1I39 A;  4ROE B;  5HLF A;  4DLG A;  4AHR A;  5HRR A;  4AH9 A;  3OS1 A;  4PWD A;  4HHT A;  3K57 A;  1R4X A;  1HU0 A;  4DTN A;  3K5N A;  2YNI A;  4LD0 A;  2DFE A;  3A2F A;  4Y1D A;  3TAM A;  3SUP A;  1QN8 A;  1NOZ A;  2A1S A;  3NBP A;  4K8X A;  4PY5 A;  4HUG A;  4DTP A;  3ZT1 A;  1LWW A;  1SKS A;  3NF9 A;  3ZSX A;  3QIN A;  4Y1C A;  3VA0 A;  3KTQ A;  4DFJ A;  1C1C A;  4CIF A;  4H4M A;  1TGH A;  1ASW A;  2EHG A;  4Z4G A;  3HPH A;  2KZZ A;  1HQE A;  1T8E A;  4BDP A;  1RM1 A;  1L3T A;  2F8S A;  1WN7 A;  3DRP A;  4O5B A;  4DWI A;  3SQ1 A;  4CES A;  1NK9 A;  1A5X A;  3RWU A;  3SV3 A;  4MFB A;  1QS4 A;  3OJS A;  5K14 A;  3ZSV A;  4CJF A;  4R5P A;  2OYQ A;  1RCH A;  4CK3 A;  3TAQ A;  3CM6 A;  4GW6 A;  3P1G A;  4K8Z A;  2YNF A;  1EXQ A;  4ICL A;  4O4G A;  4F3T A;  3I0R A;  1UAX A;  2VG7 A;  5HRS A;  5SWM A;  1LWV A;  5CY4 A;  4XIU A;  1NH2 A;  2HMI A;  4EP5 A;  1L3U A;  3NF6 A;  1B9D A;  3DOK A;  3DLB A;  3I0S A;  4IDK A;  1QN3 A;  4CJ5 A;  3MXJ A;  5FRN A;  1J9A A;  2YHA A;  2HHQ A;  1Z25 A;  4B9V A;  4CJR A;  5J2M A;  2IS3 A;  3NH2 A;  3DMJ A;  3AVN A;  3G10 A;  4G1Q A;  4UQG A;  3QNN A;  1FKP A;  3RRG A;  2HHW A;  2FBX A;  3IRX A;  5KI6 A;  4F8R A;  1CLQ A;  3LAK A;  4DFK A;  2X74 A;  3QIO A;  3KK1 A;  3MXI A;  1QNA A;  1T7P A;  2XRI A;  1M3H A;  4KPY A;  1NK8 A;  3VQQ A;  1W80 A;  4EJZ A;  1U47 A;  3DLG A;  4M3U A;  4N76 A;  1JLE A;  1RIL A;  3M8S A;  3ULX A;  1QN7 A;  4CFC A;  3OYF A;  2NOB A;  1EX4 A;  4F2R A;  3QEI A;  2I5W A;  4CFD A;  4DS5 A;  4DMN A;  2DFF A;  5DMR A;  4Z4C A;  4E3S A;  3QES A;  3RMC A;  5HP1 A;  3H08 A;  4CJK A;  1BCM A;  3NH1 A;  1L5U A;  3WNG A;  3JSM A;  3SNS A;  4B9N A;  4GMJ B;  2PYJ A;  4B3O A;  3V6D A;  3L8B A;  2RKI A;  4JLH A;  3HYF A;  4CJL A;  1BIU A;  4DSJ A;  2ZE2 A;  5J2P A;  2HND A;  3ALY A;  1MP9 A;  2E6M A;  1LAV A;  3AA4 A;  3HT3 A;  1YVU A;  3LAN A;  2OPR A;  3V9X A;  1KYU A;  3N89 A;  1LWY A;  3ITH A;  2MJ7 A;  4EZ6 A;  2HNY A;  1TL1 A;  3HPG A;  2JGU A;  1AIS A;  1C0U A;  3HST B;  3BDP A;  1IKW A;  4BE2 A;  4CEE A;  2IDO A;  3LPU A;  1LAW A;  4B8A B;  3NF7 A;  2XY7 A;  3M8Q A;  1FXX A;  1VSM A;  4N5S A;  4ELT A;  1RT4 A;  4CK1 A;  1PCZ A;  2OZM A;  3AVA A;  2IV9 A;  4OPJ A;  3CYM A;  1QNE A;  1S1V A;  1T05 A;  1KFS A;  2G8V A;  1LWE A;  4CEO A;  1JKH A;  3ZT4 A;  3KLE A;  1KO9 A;  4CJV A;  4CEQ A;  4DS4 A;  2XY6 A;  3DPT A;  4ZTJ A;  3F0Z A;  1BHL A;  1TVR A;  3EYZ A;  4FJX A;  4DSK A;  2DFH A;  1J54 A;  4EZ9 A;  4I9L A;  4J2A A;  1C6V A;  1UT4 A;  3QEW A;  3NGZ A;  3F9K A;  3HM9 A;  3SJJ A;  2XO7 A;  1X9S A;  4BWM A;  3QER A;  2FBV A;  3NE6 A;  2NOE A;  3KLH A;  1EKE A;  4BDZ A;  2KFZ A;  4KO0 A;  3O4Q A;  4W5O A;  4H4O A;  3L2W A;  2ITG A;  3MEC A;  1LW0 A;  1SV5 A;  3VQ5 A;  2B6A A;  3VQP A;  1RBU A;  5CYM A;  1Q8I A;  3ZSR A;  3OJU A;  4DTJ A;  1KVC A;  4BE0 A;  4OPK A;  1QTS A;  3MXM A;  1R0A A;  4Z4F A;  3NHG A;  3ASM A;  4KFB A;  3L2R A;  4DTS A;  1RT3 A;  1TKX A;  4TPS A;  3ZSO A;  4DTO A;  1RDC A;  4CED A;  3PV8 A;  4FJJ A;  4DG1 A;  3TAB A;  1JFI C;  3PO5 A;  3DPU A;  1NJW A;  4FLT A;  3QO9 A;  3P5J A;  3IH7 A;  4WE1 A;  3QEX A;  5C42 A;  4M3Y A;  2KTQ A;  4JRQ A;  3NCI A;  4OGC A;  4CJQ A;  1VK0 A;  3OST A;  1RT1 A;  3VQ6 A;  3K5O A;  4CF0 A;  4CHN A;  4KI4 A;  3TAG A;  1BI4 B;  1CXQ A;  1O1W A;  1FKO A;  4OJR A;  1BIS A;  2YNG A;  1HYV A;  4FLX A;  1ZYQ A;  2PYL A;  4DTU A;  3ZSY A;  3PX0 A;  1KY7 A;  1KLM A;  2EX3 A;  4CHZ A;  5SZT A;  1C9B B;  1LWC A;  4DQI A;  4ROD B;  3VQC A;  1JLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...