2D0NA

Crystal structure of the c-terminal sh3 domain of the adaptor protein gads in complex with slp-76 motif peptide reveals a unique sh3-sh3 interaction
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
GSPWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GRB2-related adaptor protein 2
publication title Crystal structure of the C-terminal SH3 domain of the adaptor protein GADS in complex with SLP-76 motif peptide reveals a unique SH3-SH3 interaction
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 11
structure length 59
sequence length 59
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2d0nA00
2DL7A 2F2VA 1YWOA 2O31A 4M4ZA 1YCSB 2KYMA 1QLYA 1RLQC 4RTUA 2CH4W 1U5SA 2EPDA 2P4RA 1W70A 1GFDA 5IHKA 1TUCA 4JJDA 1N5ZA 2JS2A 2QDLA 2EYWA 1X2QA 1CKBA 3M0RA 1H92A 2HSPA 4KRTA 4CC7A 2D8HA 2LZ6B 1TG0A 4ZNXA 2FO0A 2LQWA 2JM8A 4Y92A 2DRMA 4AFUC 2K7AA 4LE9A 2J06A 1JU5C 2RQRA 4J9FA 3NPFA 1SPKA 1S1NA 1M30A 5FWBA 2EVRA 4J9EA 3UA6A 2RNAA 3KFVA 2RQUA 1PHTA 1LCKA 1SRMA 2B86A 1PKTA 3EG0A 4ORZA 2RMOA 2K3BA 1UHCA 2AZVA 1KSWA 2JTEA 2DL4A 2AKKA 1T3SA 1E6HA 1WXBA 2V1QA 1WLPB 1SHFA 2EYYA 1Z9ZA 4JPBW 2CT4A 2RF0A 2F2WA 2ENMA 1RUWA 1YN8A 2BTTA 2CH4A 2LMJA 2J6OA 2M0YA 2RPNA 4FSSA 4JJCA 2KRNA 1NYFA 1M3BA 1MV0B 1UFFA 1FMKA 1GCPA 2EYZA 1GCQA 5ECAA 2D1XA 3VRZA 3QWXX 2ECZA 1TUDA 1K1ZA 2ED0A 4HVWA 2DX1A 3I9QA 2BZ8A 4J9CA 4CC2A 5L23A 2KNBB 2YUPA 2DMOA 2EW3A 1T3LA 1J3TA 2CREA 1OPLA 2ED1A 2O9VA 2L3QA 2H8HA 2ROLA 1VYVA 1M3CA 3CQTA 1ZX6A 3IQLA 4GBQA 1WYXA 2KRSA 3EG2A 3O5ZA 2A08A 1VA7A 1AWOA 1GBQA 2RQWA 4AFSC 1WI7A 3U23A 3TSWA 1ZUYA 2L3SA 2KGTA 1PNJA 4RTYA 4RTXA 4F14A 3M0QA 1B07A 1AWXA 2M51A 4LN2A 2F2XA 3H0FA 5FWCA 3GBQA 1KJWA 4JZ4A 1BU1A 1GCQC 3UA7A 1H3HA 1Y57A 2IIMA 3PVLA 2FEIA 2VKNA 2PZ1A 1T0JA 2RQTA 2MCNA 1AD5A 2LP5A 5EC7A 2DVJA 4J9HA 1MUZA 3RNJA 1ZUKA 2DL5A 2JMAA 1KIKA 4EIKA 4OMPA 2AK5A 5I22A 1OOTA 1ABOA 2LCSA 5GJVB 1NLOC 1MV3A 4AG2C 1AWJA 1OV3A 1WA7A 2HEQA 2L2PA 2EKHA 2DYBA 2KROA 1AZEA 1FYNA 2KT8A 2HBWA 2VWFA 4Z89A 2ABLA 3VS3A 1RI9A 1NLPC 4Z8AA 3THKA 2I0NA 2FPDA 2KYBA 4J9GA 1K4US 1UHFA 4RTZA 4GLMA 1T0HA 1HJDA 3RBBB 1JXOA 5IH2A 2OAWA 4AFQC 1I1JA 2J05A 3H0IA 1X27A 2LJ1A 3ULRB 1ZBJA 1ARKA 1UTIA 1WX6A 4R0KA 2BZXA 3UATA 2FRWA 2FG0A 3EHQA 3QWYA 2GBQA 2PTKA 1NYGA 4OMLA 5IHIA 2DL8A 2D8JA 1V1CA 1JO8A 3SEMA 3VRYA 1YWPA 2YUNA 1U3OA 1UDLA 2DLPA 1GRIA 1H8KA 4X1VA 1SRLA 3SHWA 1GFCA 1E7OA 4RTVA 1U06A 1QWFA 4RTTA 1X43A 2EGEA 3R6NA 2MIOA 3I5SA 3REBB 1AEYA 1SEMA 1GL5A 1UJ0A 2MOXA 4RTWA 2J6KA 2GTOA 3EGUA 4HVUA 1UE9A 4LUEA 1GBRA 1WFWA 2RQVA 2OI3A 4LUDA 2HCKA 2RN8A 1M27C 2KBTA 2VVKA 1OEBA 4OMNA 3EG3A 2DRKA 2AZSA 3VS2A 2K79A 1QKWA 1G83A 3JV3A 1K0SA 1CKAA 1I0CA 4IIOA 2A37A 3VS0A 2C0TA 2DNUA 2JS0A 3H41A 1NG2A 2C0IA 2OJ2A 1NEBA 4QT7A 1X69A 2A36A 3M0PA 4HVVA 4CC3A 2LX7A 1Y0MA 4DEYA 2HDAA 1VYTA 1SHGA 1W1FA 1X6GA 2DJQA 5IXFA 4CC4B 1JQQA 2W0ZA 2DA9A 3M0TA 2JMCA 4F16A 3LH5A 2X3WD 1K9AA 2YUQA 3EHRA 1CSKA 3VS1A 3EG1A 2CUDA 3M0SA 1AOJA 2DM1A 2EBPA 2SRCA 2YSQA 2LQNA 4LNPA 2E5KA 3TVTA 1NM7A 3A98A 4JZ3A 1AVZC 4WCIA 1WXUA 4K11A 1QKXA 2K2MA 4RUGA 2DILA 2DE0X 1E6GA 2FPEA 2GQIA 4AFZC 1BB9A 1AWWA 2LJ3A 1W6XA 2KRMA 2SEMA 4J9IA 3I5RA 3PVQA 2KEAA 1QWEA 2KT1A 2DBKA 1X6BA 4DEXA 2EYXA 2YT6A 2CUBA 2O9SA 3NHNA 1UG1A 1NEGA 3UF4A 2LNHB 4ESRA 2LJ0A 1YP5A 1UGVA 3VS5A 2DF6A 3NMZC 4IIMA 1ABQA 3TSZA 1Z9QA 1BBZA 1B3QA 2JXBA 2YDLA 5HCKA 1X2KA 3I35A 2JW4A 2GNCA 1HSQA 2BZYA 3M0UA 1PRLC 2GTJA 3H0HA 4OMOA 3C0CA 4J9DA 2EGCA 1UECA 2L3PA 2JT4A 1WDXA 1M8MA 1SSHA 2CSIA 1OPKA 2G6FX 2DBMA 2J6FA 2KE9A 1XOVA 2FRYA 2KXCA 4HCKA 5FW9A 2CT3A 2KXDA 2ROTA 1ZSGA 2PNIA 1UJYA 4JJBA 4A63B 1AZGB 2KR3A 4HXJA 1QCFA 1A0NB 1PWTA 2YUOA 1YNZA 2W10A 3REAB 3FJ5A 3PE0A 3VS6A 2NWMA 5GJWB 1ZUUA 1KFZA 1K0XA 2XMFA 4AG1C 2CSQA 2C0OA 1RLPC 1ZLMA 3VS7A 1WXTA 2A28A 2D0NA 2DL3A 4E6RA 1VYUA 2NUZA 1WIEA 2EQIA 2J7IA 2EGAA 1K76A 2CDTA 1UUEA 2K6DA 2AKLA 4J9BA 1HD3A 1PKSA 5IHNA 1IO6A 2ESWA 1PRMC 2O88A 2K9GA 3ZL7C 4Z88A 2O2OA 1G2BA 2JM9A 5IXBA 2GGRA 3VS4A 1JXMA 2X3XD 4OMMA 1M3AA 2V1RA 4D8KA 3NGPA 1JEGA 2L0AA 5I11A 1EFNA 4F17A 1BK2A 4D8DA 2FPFA 1I07A 4OMQA
chains in the Genus database with same CATH superfamily
1TWBA 2CH4W 4DA4A 5IHKA 4JJDA 4KGZB 1S72T 2JS2A 1X2QA 3CD6Q 4XU1A 1K9MR 3KUFA 3EFRA 1H92A 4RG8A 4E7JA 4KRTA 2COWA 3OYMA 2LRQA 4PJOA 4M75A 2FO0A 5GAOm 5GAOr 4AFUC 3HKSA 2R5AA 5GAN6 4LE9A 2J06A 1G3TA 1YHQT 2LCCA 4J7IA 1I8FA 3E9GA 3P8HA 4LD6A 2E64A 2LTOA 1M30A 2EVRA 4M78E 2F5TX 2EFIA 1BCOA 2B86A 1HK9A 3EG0A 4B9WA 3CD6T 1M8VA 3M4GA 2EKOA 2RMOA 4Q5WA 2AZVA 2LNVA 1KSWA 2DL4A 2AKKA 4OMFB 3QJYA 3NTHA 4JPBW 2E3HA 3DB3A 1U8RA 3G71A 2HL3A 2E6NA 2E5QA 2DIQA 2RF0A 4C8QA 4PLLA 2ENMA 1YN8A 2BTTA 2M0YA 1BIBA 1M2VB 2J6OA 2KRNA 1N6AA 1ZSZA 2I2LA 4QW2A 5I21A 1D1AA 2WSEE 4XTZA 3CC4A 1GCQA 4KH1B 3MP8A 4M75D 3PFSA 1Y96B 1QVGS 4E7HA 2PUOB 4KULA 1TUDA 3QYGB 2ED0A 1YIJA 4E7KA 2HQEA 3META 1RAGB 3SD4A 3M58A 5KYWB 1T3LA 1K73U 5HY6A 4C0DB 2CS7A 2X35A 3MEVA 5GAOq 2H8HA 1VQMA 1M3CA 2DTOA 3AHUA 1ZX6A 4GBQA 5GAOl 1WYXA 3CC2T 4M78B 2X9HA 3S6WA 1GBQA 2RQWA 4PJMA 3OMCA 1PD1A 1WI7A 3ZEHA 2HAXA 3U23A 4D6WA 2A0FB 3M0QA 3RERA 1QP3A 1MMAA 2M51A 3OYHA 1KD1U 2GFAA 3CMET 1VQKQ 4M7AE 2ZPEB 3I56A 1Y57A 4A4FA 2ZZDA 3PVLA 2FEIA 4C92E 1TTHB 3G7ZA 3HSBA 1X01A 2MAMA 1T0JA 2X4YA 3M56A 3RKYA 3VJPA 1VQ6T 1ZBXA 1MUZA 3RNJA 3JCMV 1KIKA 5GMKi 4OMPA 3E2UA 3WXMB 2IVWA 1G3WA 3LLRA 3A8OB 1OOTA 2LCSA 2QDYB 4M7DE 1WA7A 3RMQA 2HBWA 2RHUA 5GANe 2OAUA 1B34A 3M9QA 3OYBA 5CVIA 5DLQE 5KYNA 5AYFA 1HYOA 4M77E 1UHFA 4LD9K 2DETA 5HKCA 2QGGA 3H6ZA 2R5MA 2X4JA 4BD3A 4AFQC 3J80E 2QEXA 4PJLA 2RK1A 3RESA 1I1JA 3H0IA 3OYCA 3PMIA 4OB0B 4M7AB 2M02A 2EJFA 3WVDB 1WGSA 1WHMA 4BDYA 3RKXA 1BI1A 4C92B 3LWHA 3RDVA 2MWPA 3HFNA 5GANf 3ER0A 5IHIA 1V1CA 1KD1C 3X20B 2RB6A 2MWOA 3V7RA 1V76A 2DJZA 2RI3A 5LJ5f 3EG9B 4X1VA 3JB9D 3JCMc 4RTVA 2JNGA 1D0XA 2H3JA 1QWFA 1K9MU 1O9SA 4BDZA 4RTTA 4M7DB 3L1AA 3BE3A 5A0DA 2A3LA 3LWIA 1D0ZA 1SF9A 1UJ0A 4RTWA 2D9TA 2GTOA 4HVUA 1FXXA 3OBWA 1YJNT 2OI3A 2RN8A 2VVKA 2MMPA 4VUBA 4M77B 2DRKA 2AZSA 3FIFA 1JBMA 2ZPBB 3OYJA 1QKWA 4ZN3A 3CBOA 4C0DC 3JV3A 1VQ8A 1K0SA 1CKAA 3OY9A 1VQPQ 2FVUA 2L3RA 1NEBA 4F04B 1I5OB 4M78C 1X69A 2A36A 3M0PA 3Q1JA 2M1HA 4M75E 1KC8R 1VYTA 2G3RA 1SHGA 4C0GA 3LYIA 1OI1A 3BY7A 1CSKA 5C0MA 4J5YA 1UEBA 2DM1A 5LJ3g 2SRCA 4LNPA 2DXCA 3FDRA 5KH6A 2K2MA 5D6WA 1N27A 4RUGA 4OP0A 4DOVA 5GMKe 5GMKm 3CC7A 4AFZC 2GQIA 3CCUT 2PVGB 4PJJA 2DYIA 3S3OA 2SEMA 2EJGA 1VUBA 4XTUA 3HP9A 1VQ9Q 4C5EA 1PM3A 5J3BA 4A4KA 5KYYB 1K9MC 4XTWA 1KQ1A 1VQNT 2LQKA 4J83A 1VQ6A 1M4ZA 2O9SA 3NHNA 2QGFB 1IB8A 3FRNA 4E47A 2LJ0A 3SB2A 1YP5A 2DF6A 3NMZC 1ACMB 4BE0A 2YXYA 1B3QA 2DZ9A 4M75B 3I35A 2VXEA 1JJ2S 1VQ7A 2GNCA 3M0UA 3CCVA 3CCRA 4JRQA 3C0CA 4JRIA 4X34A 1VQ9T 2EGCA 2RHIA 1UECA 2L3PA 2JT4A 2QQ9A 3LX7A 2XKOC 2G6FX 3OQ5A 2V8KA 4M7AC 3JCMd 5I2SA 2KXCA 4X9CA 1ZSGA 4C92C 5GAN7 2BE7D 2M16A 4JJBA 4HXJA 1QCFA 5KYUA 4QQGA 1KQ2A 2P0KA 2KK4A 2EJ9A 5GJWB 5GMKl 3LGFA 3DKMA 5FRNA 1EX4A 4AG1C 2E10A 2RHXA 4OB2B 2LT1A 1UGSB 4EMKA 1WNLA 2CP7A 2CSQA 4M7DC 5GANg 2O01E 2Y90A 1ZSZB 1YBYA 2DXBA 3KBGA 3VS7A 5DM7R 3LW5E 3L2QA 4QQDA 1BKBA 1LJOA 1OX8A 3ZFJA 5LJ5g 2H3EB 3RUXA 2DIGA 4BE2A 4BI3A 1UUEA 4F7UE 4Z02A 3OBYA 4M77C 3P8DA 3G71Q 4J9BA 4BACA 1IO6A 1RAHB 1Q7YR 5IXBA 3N5BB 3VS4A 5C6SA 2V1RA 1H3ZA 2EIFA 1KQSS 1W2BS 1YJNA 3CC4Q 3ME9A 2DL7A 2O31A 1KHIA 1YCSB 4RTUA 5A0LA 1MMGA 2P4RA 1YIJQ 4EMGA 1GFDA 1TUCA 3OYIA 3UDCA 3CCQQ 3G71T 1I4K1 2D0QB 3M0RA 2PUKB 3CBPA 4IUPA 4KUDK 1WZOA 4CC7A 1M1FA 3OB9A 1VQMQ 4ZNXA 1TU0B 2OTJA 4Y92A 2DRMA 2RHYA 2RK2A 1M9SA 1JU5C 1V29B 4JLIA 2XD0A 2NLUA 4DBRA 3NPFA 4PFOA 5GANj 3J7AF 1YI2T 1WJQA 1EZZB 1SRMA 2MYSA 1PKTA 5LJ5j 1WPYA 3JB9G 4F7UB 4XQ3A 2CZ1B 3I56Q 4IKFA 1T3SA 1E6HA 4NL2A 3OYKA 1KC8U 1WLPB 3CCUA 3NFCA 1B34B 2WSCE 9ATCB 2F2WA 3QO3A 1RUWA 2CH4A 2L8DA 2O4XA 1NYFA 1M3BA 4M75C 4AT1B 3L2WA 1FMKA 2HKQB 2EYZA 4M78F 4Y28E 3QWXX 4RKUE 2EYQA 4MZTA 5CKEA 2ECZA 2JJ9A 1WHLA 1K1ZA 5CKBA 2MF2A 3J81E 4P5NA 3I9QA 2BZ8A 4CC2A 3TU4K 2KNBB 3RIRA 2DMOA 3MEWA 1Q86R 2LVMA 2CREA 4ZGDB 2O9VA 4XTYA 2ROLA 2ZPHB 3CQTA 1WJRA 3PT9A 2X4XA 3EG2A 4V2SA 3M4YA 1KK7A 4AFSC 3OYYA 1B7TA 4A54A 2L3SA 2KGTA 2CP0A 3EGDA 4RTXA 4F14A 3CPWA 2DXUA 4FL6A 1MMDA 1ZSZC 2GQVA 3KXTA 4IUQA 1QVFA 5KYXA 4JZ4A 1GCQC 3BFMA 1Q82R 4A4EA 3JB9H 1NE8A 3OSVA 2RH2A 2VKNA 3CPWP 3JCMf 1IXDA 2PZ1A 3VYGA 5CKFA 1AD5A 1D3BA 2QEXT 4ELZC 2LP5A 3CCET 2DVJA 1PCXA 1ZQ1A 1QVFP 2DL5A 2JMAA 4N0AC 4EIKA 1KC8C 2HNIA 3VUZA 2M0OA 4L6V5 1RL2A 1NPRA 2RJEA 2HEQA 1OU8A 1XTDA 2VUBA 3MJXA 4PK4A 2YRDA 5GMKj 3X28B 2VWFA 4M7AF 4OGEA 4E7IA 3VS3A 1NLPC 4FYXB 1TH7A 3PIPA 2KYBA 4J9GA 1VQ8Q 2Y4XA 4C92F 4MMKA 3X24B 4DQ2A 1K4US 4GLMA 2CP5A 2R58A 1YCYA 1JXOA 1LPLA 4C0FA 2EWNA 2L89A 2GFUA 1Q7YU 2YWWA 1MNEA 4M7DF 4R0KA 2FRWA 1I81A 4J6YA 1OZ2A 3EHQA 3OMGA 5LJ3e 2R57A 1IHVA 4GLKA 3CC2Q 1VQLA 2PTKA 1VQ8T 3E19A 4ZGEB 3HFOA 4PJOD 4XU0A 2A7YA 2NUPA 2YUNA 3VU3C 1U3OA 2KI7A 1UDLA 2DLPA 1GRIA 2RHZA 3CC7Q 4M77F 3SHWA 2D6FA 4ZTJA 1YI2A 4XU2A 5D6YA 1X43A 3CMEQ 2EGEA 3R6NA 1NZ9A 1AEYA 3MP1A 2HD0A 4M78G 4B9XA 2MOXA 3A1PA 3EGUA 4LUEA 3OYNA 2E4HA 2KBTA 1QCNA 2JN0A 5LJ3f 1VQ6Q 1JB0E 4OMNA 3JCMJ 2BKDN 2VGMA 3VS2A 3OS5A 3CC7T 3A8HB 2KMTA 4C8QD 4HCZA 2RI2A 3A8MB 1O75A 5KYUB 3H41A 3QJ6A 1VQ7Q 1EIFA 2QXFA 4BE1A 3CCVQ 3V7SA 4HVVA 2B8AA 4RG2A 1VIFA 2CP6A 4L59A 1TXQA 2E3IA 3JCMP 4EMKB 5HK3A 1W1FA 3CXCA 2HBPA 2GCXA 4CC4B 1WHGA 2W0ZA 2JMCA 3LH5A 1QP2A 5GAMe 1RAAB 3VS1A 3FC3A 1MHNA 1Q7YC 2EBPA 3A98A 4HCCA 4JZ3A 1VQ7T 1WXUA 1VQ5A 3CXCP 2F69A 3CCVT 5HK0A 3CCRT 2E70A 1YITT 1BIAA 1AWWA 3QG1A 2Z0WA 3F70A 2LJ3A 1Q86U 3OS1A 3EGXB 2VC8A 1VQ4A 1LNXA 3OYAA 4FT2A 2Y4YA 5LJ5e 4M75F 2KEAA 4XTXA 1QWEA 3TCJA 2FZCB 3JCMg 2V8IA 3QZ9B 2DBKA 2EQKA 3JSCA 2P4TA 2P0PA 1OYXA 2YT6A 1YJ9T 5GAMf 4M7AG 3CCEA 1NJIR 2HZYA 2CP2A 1X75C 4ESRA 2XK0A 4C92G 1R77A 5IT9E 1UGVA 4BY6B 4ATOA 3OW2A 2MI6A 4E7ZA 2EQJA 3TSZA 1Z9QA 1BBZA 2YDLA 5HCKA 1X2KA 2FZGB 2JZ2A 1Q82U 3NTKA 2DK3A 4QKUA 1YJNQ 3QKJA 4J9DA 5CIUA 2DEQA 3JCMX 5CO7A 4MDWA 1I5LA 3P8BB 3OW2P 3H9NA 1SSHA 3FLGA 4OB1B 3CCST 4M7DG 2J6FA 5LJ3h 1XOVA 4HCKA 1FMVA 5FW9A 1QVPA 2ROTA 2HKNA 2F5KA 5J26A 3LGLA 2XDPA 1OQKA 4PFZA 1F1BB 2K4YA 2KR3A 3FJPA 3C12A 1A0NB 2OTJQ 3R6OA 1YNZA 3FJ5A 4M77G 3V8LA 3PE0A 1VOMA 1KFZA 1K0XA 2PVOB 2XMFA 2JTMA 3L2ZA 2DEUA 4XK8E 2AT1B 2CYZB 2O4XB 1PD0A 2P84A 2C0OA 5GAN4 1ZLMA 1FX7A 3CBMA 1WXTA 2D0NA 4EPCA 4E6RA 1Q86C 1M1KR 2J7IA 4FYVB 1AT1B 3A5ZB 3CCUQ 2CDTA 2OTJT 2BUDA 1TSFA 1SG5A 4PJOE 2AKLA 3X25B 1PRMC 2O88A 2K9GA 3EH2A 2O2OA 3CCJT 5CKHA 1HXDA 4IURA 3NGPA 1JEGA 2L0AA 1JRIA 1EFNA 5L8RE 2CGHA 1VQNQ 1OULA 4D8DA 2FPFA 2DD5A 2FL7A 4OMQA 2DZCA 1MNDA 1YWOA 2F2VA 4KT0E 4RMOA 2KYMA 1QLYA 1RLQC 1U1TA 1U5SA 2EPDA 4FW1A 1C0MA 1Q82C 5GAMh 3DLMA 2C06A 2EYWA 2QQSA 5DY9A 5DLOA 4KH0B 5KYXB 1IRXA 1PSFA 3I55T 4F7UF 2LZ6B 4ANJA 4C8QE 2YHTA 2ZPFB 2XDBA 3FEOA 3JB9F 5GANh 1D3BB 2VV5A 4J9FA 1SPKA 1S1NA 2K57A 4J6XA 5FWBA 1RABB 3PNWC 3KFVA 5LJ5h 1D0YA 4M75G 1PHTA 5CAIA 3SFMA 4E2FB 3GPLA 4ORZA 2K3BA 4PJOB 2JTEA 3PGGA 2L5QA 1YITA 2V1QA 1Z9ZA 2LDMA 1TUGB 4EDUA 1OX9A 3CCLT 4BY6C 2HQHA 4FSSA 4JS5A 2RPNA 5LJ3j 1MV0B 4GY5A 1LOJA 5GAMg 2RA2A 4LDUA 1GCPA 1YJ9A 1XJWB 3NTIA 4M78A 3L42A 1QCOA 2DTIA 4HVWA 2DX1A 2KY9A 2YLBA 5L23A 1LVKA 3UWNA 4C8QB 2EW3A 4FU6A 3HRTA 3WVEB 1J3TA 4JUVA 1OPLA 2QAZA 4A53A 1M5Q1 1RACB 2E65A 2YRCA 5CQYA 5IN1A 2DKGA 1G3SA 1VYVA 3E1SA 1C1AA 2KRSA 4C0ZA 3M5AA 3O5ZA 2A08A 4NL3A 3QUIA 5FU6B 1NJIU 3OA6A 4AMCA 3QXEB 3CCSA 3SWNA 3OYLA 3H8ZA 1NBEB 3D7SB 1PNJA 4RTYA 3QIIA 3JCMb 1B07A 1AWXA 4PNOA 3GLXA 2F2XA 3E9FA 3CCMT 4O5VA 1BU1A 1VQLQ 2K5IA 1H3HA 2JOYA 2RI5A 4DOWA 2MCNA 2QG9B 1UGQB 4J9HA 1YI2Q 1C6VX 2M9UA 1GXIE 2X51A 2GF7A 5GAMj 5I22A 4WF2A 3M57A 2WACA 1ABOA 3TQ7P 1IZ6A 3OYDA 2L2PA 5GMKh 2DAQA 1VQLT 2EKHA 2DYBA 1WHJA 1AZEA 3MKDA 2KT8A 2E6ZA 1SSFA 3CCJA 2ABLA 4QQ6A 2PU9B 4M7AA 2ZCFB 4B6MA 1K73R 2I0NA 4F7UG 3JCMQ 2FPDA 2QK0A 4C92A 2ATCB 3VKIA 1T0HA 1HJDA 3RBBB 2XU8A 2OAWA 3HTRA 1P92A 2VYTA 2LCLA 4A4HA 2QA4A 2LJ1A 3ULRB 1ZBJA 1NJIC 1UTIA 1WX6A 3I55A 3HRSA 2BZXA 1AHJB 3UATA 2FG0A 1VQPA 1N8RR 4PJOC 1NYGA 4OMLA 3VYHB 3INZA 5EG2A 1RI0A 3SEMA 3VRYA 1WQ7A 1YWPA 5CK9A 1VQ5Q 4E7SA 2DPPB 2FHDA 2YLCA 1H8KA 1SRLA 3JAME 5FROA 3PTAA 1E7OA 4M77A 1IREB 1MMNA 3X26B 1VQ4Q 1UGRB 4IUUA 3REBB 1WHHA 4WTOB 3JCMe 1VQOT 1GBRA 3UPUA 2ZGWA 1WFWA 3OYFA 2HCKA 2QEXQ 1M27C 3CCEQ 1OEBA 3CCLA 3EG3A 1VQ5T 3EFSA 1K8AR 2EQUA 5KE2A 4C8QC 5KE3A 1G83A 2E1HA 3HHTB 1I0CA 4FCYA 4IIOA 4CI0C 3VS0A 2KDSA 4ZTFA 1VQ4T 2DNUA 2JS0A 3L2VA 1QVGA 2K5FA 1NG2A 2OJ2A 2OTLT 4QT7A 1ZA2B 5FU6C 2LX7A 2RO0A 3A8LB 2QASA 1Y0MA 4DEYA 4JJNK 3TREA 3OYEA 4BB7A 2KAFA 1X6GA 2QTVA 5IXFA 3G6EA 2LQ8A 4F16A 1JQQA 3M0TA 4R55A 2X3WD 2YUQA 3CMAA 4XU3A 3EG1A 1R0CB 2CUDA 3M0SA 4A4GA 2ZPIB 4PKCC 2LQNA 3TVTA 2E5KA 1KHCA 4PLIA 3EAEA 4K11A 1QKXA 5GANd 5FU7B 2FPEA 2WSFE 1BB9A 2CP3A 4OB3B 3G4ST 5LJ5d 1G8XA 5CQXA 1M1GA 2RJFA 3V8JA 3CCMA 3M59A 4J9IA 3AT1B 2DTHA 3PVQA 1RAEB 2KT1A 2DO3A 4DEXA 2EYXA 2BIVA 4FSXA 4HT8A 1UG1A 1NEGA 3UF4A 1Q95G 4IIMA 4ME7A 2JXBA 4UC4A 1RAIB 3GF5A 3G1JA 2JW4A 2BZYA 1PRLC 4OMOA 1OZ3A 2KQWA 4MDXA 1QQJA 2RJCA 2JVVA 2AIRB 1R8OB 1OPKA 4OVAA 3ZBDA 2KXDA 3VV0A 3CPWS 3CPFA 4HA8A 4FYYB 2PNIA 5GAOp 1AZGB 5GAN2 1BCMA 2XI9A 6AT1B 2YRVA 1PWTA 2OX7A 1QVFS 2W10A 3REAB 5M9OA 3PIOA 2NWMA 1ZUUA 1M90R 1N9RA 3CCQA 3JCMh 4LDVA 2FYKA 4MZMA 4N0AA 4EMHA 2A28A 2XG8D 2DL3A 3JB9I 4HCBA 2JTFA 4YTLA 1VYUA 1WIEA 2EQIA 5GAN5 2HQXA 3CCRQ 2NUTA 1YITQ 3QBYA 2EGAA 1YJWA 2K6DA 5KCOA 2RJDA 2BE9B 1Q81R 1Y71A 3ZL7C 1R0BG 1VQOA 2JM9A 3MO8A 1JXMA 2X3XD 4OMMA 1N8RU 3GP8A 3JRZA 1PC0A 1MGQA 4QVZA 3MEAA 1WQWA 1IGUA 4OGCA 2E41A 1YJ9Q 5CR2A 1FWZA 4PJNA 3CEYA 3SWNB 4M4ZA 5J39A 1W70A 4JDSA 1RADB 2AHJB 2QTXA 1WJSA 1N5ZA 2XICA 2QDLA 4BUGA 1CKBA 2HSPA 2VGNA 2OTLA 1G3YA 2D8HA 2DD4A 4Y91A 1TG0A 4PJOF 4F7UA 2XIDA 3JB9J 1VQKT 2LQWA 2X4WA 2JM8A 1VIEA 2K7AA 1BI3A 2RQRA 5FU7C 3CCSQ 1K8AU 5FLXE 4J9EA 3UA6A 8AT1B 2RNAA 2RQUA 4XTVA 3GIBA 1LCKA 3O8VA 2CZ0B 2IPOB 1ZHIA 1UHCA 1K73C 3QSUA 2QQAA 2COYA 2LX9A 1WXBA 3V8KA 3JCMW 3S3NA 3URGA 1SHFA 2EYYA 1S72A 3EH1A 3G4SA 2CT4A 3BW1A 4C8QF 5FRMA 2LMJA 2MPXC 1N9SA 4JJCA 1D1BA 1X6OA 4JRPA 5A2QE 1UFFA 1M2OA 3EFOA 5ECAA 2D1XA 1YHQA 1N8RC 2DXTA 3VRZA 4PL6A 4C5HA 1KG1A 4J9CA 2HSEB 3CCJQ 1FMWA 2YUPA 3CD6A 3CXCS 1JJ2A 3QYHB 2ED1A 5GAOn 2L3QA 1Y07A 2MK5A 3IQLA 4DBQA 4QVDA 2F1LA 1VA7A 4HT9A 1AWOA 4FYWB 4NS5A 3TSWA 4JLGA 5AT1B 1ZUYA 2QA4Q 1JJ2P 2DFUA 1OU9A 1XNIA 4LN2A 1W4SA 3OS2A 3H0FA 3I55Q 1K8AC 2E12A 5FWCA 3GBQA 4BI4A 1KJWA 4J8OA 3C95A 3UA7A 2IIMA 3MPUB 2QQRA 1DJ7B 2RQTA 4KGVB 4E7LA 3EGDB 4EMKC 5EC7A 4BI8B 3TEEA 1ZUKA 2P0QA 4FW2A 2QA4T 2IG0A 3OYGA 2AK5A 2RD1A 2DERA 3CC2A 3OW2S 2HMAA 5GJVB 1NLOC 1VQPT 1MV3A 4AG2C 1AWJA 1OV3A 4CRIA 1UGPB 3BDUA 3C94A 3SWNC 1WHKA 3RR6A 1M90U 5CCAA 4LDXA 2KROA 2KSSA 1FYNA 3CCLQ 3QDFA 1ZA1B 2VASA 4Z89A 1RI9A 3CMEA 4Z8AA 3THKA 3FB9A 2COZA 4PJOG 1KQSA 1W2BA 2XHCA 3QDRB 1SKUB 1M2VA 4RTZA 3RKWA 5IH2A 4KUIA 2K2VA 3MP6A 2J05A 1Y96A 1Q81U 4II1A 1X27A 1Y7XA 3SDZA 3UT1A 1KQSP 2EAYA 1W2BP 3M54A 3VUBA 3G6EQ 1ARKA 4RCBA 5D6XA 5KYWA 3QWYA 3CMAQ 5IAYA 2GBQA 1VQKA 3M53A 2DL8A 2D8JA 1JO8A 3M55A 2HL5C 4C8QG 2QQBA 4JS4A 1IHWA 1GFCA 4FM4B 4FIBA 1BI0A 1U06A 3CCMQ 3QHSA 4JRKA 1IGQA 2MIOA 3I5SA 1SEMA 1GL5A 3G6ET 4ZGJB 2FB7A 4KBMB 2J6KA 3CMAT 1UE9A 3V7CA 3BDLA 2NUPB 2RQVA 4LUDA 2K3YA 1U1SA 4R56A 3OSSC 8ATCB 4C5IA 4J6WA 1D09B 2K79A 3GNFB 3MEUA 1M90C 2LC4A 3GOXA 3PMTA 1QW1A 1TOVA 2RM4A 2A37A 2C0TA 2C0IA 2V8JA 3GNGA 1UB4A 2CZ7B 3OS0A 3MCAB 4CC3A 4M78D 1G5VA 3DLLA 2HDAA 4L5GA 4DBHA 4LDYA 2FZKB 2DJQA 4KGXB 4XAXB 2DA9A 3LH0A 1Q81C 1K9AA 3EGXA 3EHRA 2CZ6B 1NPPA 1AOJA 4TVRA 2NUTB 2YSQA 1NM7A 5LL6S 1AVZC 4LDWA 4WCIA 3C4SA 3HRUA 4FT4A 1QMCA 2DILA 2DE0X 1E6GA 4N4HA 4ZN1A 1D1CA 2PVDB 1W6XA 4X9DA 2KRMA 2KVQG 3RMSA 4LXCA 5GAN3 1PSEA 4QVCA 3I5RA 2QYZA 1M1KU 2VB6A 5I2MA 2DVEA 5A0GA 1X6BA 2CUBA 3CC4T 1YJWQ 2K3XA 2VXFA 3EG9A 2LNHB 1YIJT 5LJ3d 1TS9A 3VS5A 1VQOQ 3ASKA 3CCQT 1ABQA 1KD1R 2V26A 3T9NA 4M7DA 2NYSA 5CKDA 1BYMA 4RCCA 4O6JA 1HSQA 2ZAEA 4MZPA 2GTJA 3H0HA 1VQMT 3L2UA 3L2RA 1BI2A 3QZ5B 2QI2A 4J7FA 1WDXA 2LT4A 4IUVA 1M8MA 2CSIA 2K5LA 1YJWT 2JUFA 2DBMA 4N4IA 2KE9A 2FRYA 3QPHA 4C5GA 3HPWA 2CT3A 3DB4A 4M7AD 4NOYA 5GAN8 4DBFA 2XDDA 3HL8A 2OTLQ 2ZPGB 1VQNA 1UJYA 4A63B 4C92D 2YUOA 3I56T 3VS6A 5D7UA 4MMLA 2CKKA 4IUTA 2PQWA 1RLPC 3A8GB 4M7DD 1XQHA 1VQ9A 3EFOB 2NUZA 4ELYC 4HKEA 7AT1B 4PFPA 3S3MA 1K76A 1H641 1PG5B 1S72Q 1M1KC 5KCHA 3G4SQ 5GAMd 1HD3A 1PKSA 5IHNA 4N4GA 4M77D 2ESWA 4OF1A 1YFNA 4Z88A 1G2BA 1QVGP 2GGRA 1M3AA 4D8KA 2EQMA 5I11A 3MHXA 1RAFB 4F17A 1BK2A 5KYYA 1YHQQ 1I07A
chains in the Genus database with same CATH topology
2DL7A 2F2VA 1YWOA 2O31A 4M4ZA 1YCSB 2KYMA 1QLYA 1RLQC 4RTUA 2CH4W 1U5SA 2EPDA 2P4RA 1W70A 1GFDA 5IHKA 1TUCA 4JJDA 1N5ZA 2JS2A 2QDLA 2EYWA 1X2QA 1CKBA 3M0RA 1H92A 2HSPA 4KRTA 4CC7A 2D8HA 2LZ6B 1TG0A 4ZNXA 2FO0A 2LQWA 2JM8A 4Y92A 2DRMA 4AFUC 2K7AA 4LE9A 2J06A 1JU5C 2RQRA 4J9FA 3NPFA 1SPKA 1S1NA 1M30A 5FWBA 2EVRA 4J9EA 3UA6A 2RNAA 3KFVA 2RQUA 1PHTA 1LCKA 1SRMA 2B86A 1PKTA 3EG0A 4ORZA 2RMOA 2K3BA 1UHCA 2AZVA 1KSWA 2JTEA 2DL4A 2AKKA 1T3SA 1E6HA 1WXBA 2V1QA 1WLPB 1SHFA 2EYYA 1Z9ZA 4JPBW 2CT4A 2RF0A 2F2WA 2ENMA 1RUWA 1YN8A 2BTTA 2CH4A 2LMJA 2J6OA 2M0YA 2RPNA 4FSSA 4JJCA 2KRNA 1NYFA 1M3BA 1MV0B 1UFFA 1FMKA 1GCPA 2EYZA 1GCQA 5ECAA 2D1XA 3VRZA 3QWXX 2ECZA 1TUDA 1K1ZA 2ED0A 4HVWA 2DX1A 3I9QA 2BZ8A 4J9CA 4CC2A 5L23A 2KNBB 2YUPA 2DMOA 2EW3A 1T3LA 1J3TA 2CREA 1OPLA 2ED1A 2O9VA 2L3QA 2H8HA 2ROLA 1VYVA 1M3CA 3CQTA 1ZX6A 3IQLA 4GBQA 1WYXA 2KRSA 3EG2A 3O5ZA 2A08A 1VA7A 1AWOA 1GBQA 2RQWA 4AFSC 1WI7A 3U23A 3TSWA 1ZUYA 2L3SA 2KGTA 1PNJA 4RTYA 4RTXA 4F14A 3M0QA 1B07A 1AWXA 2M51A 4LN2A 2F2XA 3H0FA 5FWCA 3GBQA 1KJWA 4JZ4A 1BU1A 1GCQC 3UA7A 1H3HA 1Y57A 2IIMA 3PVLA 2FEIA 2VKNA 2PZ1A 1T0JA 2RQTA 2MCNA 1AD5A 2LP5A 5EC7A 2DVJA 4J9HA 1MUZA 3RNJA 1ZUKA 2DL5A 2JMAA 1KIKA 4EIKA 4OMPA 2AK5A 5I22A 1OOTA 1ABOA 2LCSA 5GJVB 1NLOC 1MV3A 4AG2C 1AWJA 1OV3A 1WA7A 2HEQA 2L2PA 2EKHA 2DYBA 2KROA 1AZEA 1FYNA 2KT8A 2HBWA 2VWFA 4Z89A 2ABLA 3VS3A 1RI9A 1NLPC 4Z8AA 3THKA 2I0NA 2FPDA 2KYBA 4J9GA 1K4US 1UHFA 4RTZA 4GLMA 1T0HA 1HJDA 3RBBB 1JXOA 5IH2A 2OAWA 4AFQC 1I1JA 2J05A 3H0IA 1X27A 2LJ1A 3ULRB 1ZBJA 1ARKA 1UTIA 1WX6A 4R0KA 2BZXA 3UATA 2FRWA 2FG0A 3EHQA 3QWYA 2GBQA 2PTKA 1NYGA 4OMLA 5IHIA 2DL8A 2D8JA 1V1CA 1JO8A 3SEMA 3VRYA 1YWPA 2YUNA 1U3OA 1UDLA 2DLPA 1GRIA 1H8KA 4X1VA 1SRLA 3SHWA 1GFCA 1E7OA 4RTVA 1U06A 1QWFA 4RTTA 1X43A 2EGEA 3R6NA 2MIOA 3I5SA 3REBB 1AEYA 1SEMA 1GL5A 1UJ0A 2MOXA 4RTWA 2J6KA 2GTOA 3EGUA 4HVUA 1UE9A 4LUEA 1GBRA 1WFWA 2RQVA 2OI3A 4LUDA 2HCKA 2RN8A 1M27C 2KBTA 2VVKA 1OEBA 4OMNA 3EG3A 2DRKA 2AZSA 3VS2A 2K79A 1QKWA 1G83A 3JV3A 1K0SA 1CKAA 1I0CA 4IIOA 2A37A 3VS0A 2C0TA 2DNUA 2JS0A 3H41A 1NG2A 2C0IA 2OJ2A 1NEBA 4QT7A 1X69A 2A36A 3M0PA 4HVVA 4CC3A 2LX7A 1Y0MA 4DEYA 2HDAA 1VYTA 1SHGA 1W1FA 1X6GA 2DJQA 5IXFA 4CC4B 1JQQA 2W0ZA 2DA9A 3M0TA 2JMCA 4F16A 3LH5A 2X3WD 1K9AA 2YUQA 3EHRA 1CSKA 3VS1A 3EG1A 2CUDA 3M0SA 1AOJA 2DM1A 2EBPA 2SRCA 2YSQA 2LQNA 4LNPA 2E5KA 3TVTA 1NM7A 3A98A 4JZ3A 1AVZC 4WCIA 1WXUA 4K11A 1QKXA 2K2MA 4RUGA 2DILA 2DE0X 1E6GA 2FPEA 2GQIA 4AFZC 1BB9A 1AWWA 2LJ3A 1W6XA 2KRMA 2SEMA 4J9IA 3I5RA 3PVQA 2KEAA 1QWEA 2KT1A 2DBKA 1X6BA 4DEXA 2EYXA 2YT6A 2CUBA 2O9SA 3NHNA 1UG1A 1NEGA 3UF4A 2LNHB 4ESRA 2LJ0A 1YP5A 1UGVA 3VS5A 2DF6A 3NMZC 4IIMA 1ABQA 3TSZA 1Z9QA 1BBZA 1B3QA 2JXBA 2YDLA 5HCKA 1X2KA 3I35A 2JW4A 2GNCA 1HSQA 2BZYA 3M0UA 1PRLC 2GTJA 3H0HA 4OMOA 3C0CA 4J9DA 2EGCA 1UECA 2L3PA 2JT4A 1WDXA 1M8MA 1SSHA 2CSIA 1OPKA 2G6FX 2DBMA 2J6FA 2KE9A 1XOVA 2FRYA 2KXCA 4HCKA 5FW9A 2CT3A 2KXDA 2ROTA 1ZSGA 2PNIA 1UJYA 4JJBA 4A63B 1AZGB 2KR3A 4HXJA 1QCFA 1A0NB 1PWTA 2YUOA 1YNZA 2W10A 3REAB 3FJ5A 3PE0A 3VS6A 2NWMA 5GJWB 1ZUUA 1KFZA 1K0XA 2XMFA 4AG1C 2CSQA 2C0OA 1RLPC 1ZLMA 3VS7A 1WXTA 2A28A 2D0NA 2DL3A 4E6RA 1VYUA 2NUZA 1WIEA 2EQIA 2J7IA 2EGAA 1K76A 2CDTA 1UUEA 2K6DA 2AKLA 4J9BA 1HD3A 1PKSA 5IHNA 1IO6A 2ESWA 1PRMC 2O88A 2K9GA 3ZL7C 4Z88A 2O2OA 1G2BA 2JM9A 5IXBA 2GGRA 3VS4A 1JXMA 2X3XD 4OMMA 1M3AA 2V1RA 4D8KA 3NGPA 1JEGA 2L0AA 5I11A 1EFNA 4F17A 1BK2A 4D8DA 2FPFA 1I07A 4OMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DL7 A;  2F2V A;  1YWO A;  2O31 A;  4M4Z A;  1YCS B;  2KYM A;  1QLY A;  1RLQ C;  4RTU A;  2CH4 W;  1U5S A;  2EPD A;  2P4R A;  1W70 A;  1GFD A;  5IHK A;  1TUC A;  4JJD A;  1N5Z A;  2JS2 A;  2QDL A;  2EYW A;  1X2Q A;  1CKB A;  3M0R A;  1H92 A;  2HSP A;  4KRT A;  4CC7 A;  2D8H A;  2LZ6 B;  1TG0 A;  4ZNX A;  2FO0 A;  2LQW A;  2JM8 A;  4Y92 A;  2DRM A;  4AFU C;  2K7A A;  4LE9 A;  2J06 A;  1JU5 C;  2RQR A;  4J9F A;  3NPF A;  1SPK A;  1S1N A;  1M30 A;  5FWB A;  2EVR A;  4J9E A;  3UA6 A;  2RNA A;  3KFV A;  2RQU A;  1PHT A;  1LCK A;  1SRM A;  2B86 A;  1PKT A;  3EG0 A;  4ORZ A;  2RMO A;  2K3B A;  1UHC A;  2AZV A;  1KSW A;  2JTE A;  2DL4 A;  2AKK A;  1T3S A;  1E6H A;  1WXB A;  2V1Q A;  1WLP B;  1SHF A;  2EYY A;  1Z9Z A;  4JPB W;  2CT4 A;  2RF0 A;  2F2W A;  2ENM A;  1RUW A;  1YN8 A;  2BTT A;  2CH4 A;  2LMJ A;  2J6O A;  2M0Y A;  2RPN A;  4FSS A;  4JJC A;  2KRN A;  1NYF A;  1M3B A;  1MV0 B;  1UFF A;  1FMK A;  1GCP A;  2EYZ A;  1GCQ A;  5ECA A;  2D1X A;  3VRZ A;  3QWX X;  2ECZ A;  1TUD A;  1K1Z A;  2ED0 A;  4HVW A;  2DX1 A;  3I9Q A;  2BZ8 A;  4J9C A;  4CC2 A;  5L23 A;  2KNB B;  2YUP A;  2DMO A;  2EW3 A;  1T3L A;  1J3T A;  2CRE A;  1OPL A;  2ED1 A;  2O9V A;  2L3Q A;  2H8H A;  2ROL A;  1VYV A;  1M3C A;  3CQT A;  1ZX6 A;  3IQL A;  4GBQ A;  1WYX A;  2KRS A;  3EG2 A;  3O5Z A;  2A08 A;  1VA7 A;  1AWO A;  1GBQ A;  2RQW A;  4AFS C;  1WI7 A;  3U23 A;  3TSW A;  1ZUY A;  2L3S A;  2KGT A;  1PNJ A;  4RTY A;  4RTX A;  4F14 A;  3M0Q A;  1B07 A;  1AWX A;  2M51 A;  4LN2 A;  2F2X A;  3H0F A;  5FWC A;  3GBQ A;  1KJW A;  4JZ4 A;  1BU1 A;  1GCQ C;  3UA7 A;  1H3H A;  1Y57 A;  2IIM A;  3PVL A;  2FEI A;  2VKN A;  2PZ1 A;  1T0J A;  2RQT A;  2MCN A;  1AD5 A;  2LP5 A;  5EC7 A;  2DVJ A;  4J9H A;  1MUZ A;  3RNJ A;  1ZUK A;  2DL5 A;  2JMA A;  1KIK A;  4EIK A;  4OMP A;  2AK5 A;  5I22 A;  1OOT A;  1ABO A;  2LCS A;  5GJV B;  1NLO C;  1MV3 A;  4AG2 C;  1AWJ A;  1OV3 A;  1WA7 A;  2HEQ A;  2L2P A;  2EKH A;  2DYB A;  2KRO A;  1AZE A;  1FYN A;  2KT8 A;  2HBW A;  2VWF A;  4Z89 A;  2ABL A;  3VS3 A;  1RI9 A;  1NLP C;  4Z8A A;  3THK A;  2I0N A;  2FPD A;  2KYB A;  4J9G A;  1K4U S;  1UHF A;  4RTZ A;  4GLM A;  1T0H A;  1HJD A;  3RBB B;  1JXO A;  5IH2 A;  2OAW A;  4AFQ C;  1I1J A;  2J05 A;  3H0I A;  1X27 A;  2LJ1 A;  3ULR B;  1ZBJ A;  1ARK A;  1UTI A;  1WX6 A;  4R0K A;  2BZX A;  3UAT A;  2FRW A;  2FG0 A;  3EHQ A;  3QWY A;  2GBQ A;  2PTK A;  1NYG A;  4OML A;  5IHI A;  2DL8 A;  2D8J A;  1V1C A;  1JO8 A;  3SEM A;  3VRY A;  1YWP A;  2YUN A;  1U3O A;  1UDL A;  2DLP A;  1GRI A;  1H8K A;  4X1V A;  1SRL A;  3SHW A;  1GFC A;  1E7O A;  4RTV A;  1U06 A;  1QWF A;  4RTT A;  1X43 A;  2EGE A;  3R6N A;  2MIO A;  3I5S A;  3REB B;  1AEY A;  1SEM A;  1GL5 A;  1UJ0 A;  2MOX A;  4RTW A;  2J6K A;  2GTO A;  3EGU A;  4HVU A;  1UE9 A;  4LUE A;  1GBR A;  1WFW A;  2RQV A;  2OI3 A;  4LUD A;  2HCK A;  2RN8 A;  1M27 C;  2KBT A;  2VVK A;  1OEB A;  4OMN A;  3EG3 A;  2DRK A;  2AZS A;  3VS2 A;  2K79 A;  1QKW A;  1G83 A;  3JV3 A;  1K0S A;  1CKA A;  1I0C A;  4IIO A;  2A37 A;  3VS0 A;  2C0T A;  2DNU A;  2JS0 A;  3H41 A;  1NG2 A;  2C0I A;  2OJ2 A;  1NEB A;  4QT7 A;  1X69 A;  2A36 A;  3M0P A;  4HVV A;  4CC3 A;  2LX7 A;  1Y0M A;  4DEY A;  2HDA A;  1VYT A;  1SHG A;  1W1F A;  1X6G A;  2DJQ A;  5IXF A;  4CC4 B;  1JQQ A;  2W0Z A;  2DA9 A;  3M0T A;  2JMC A;  4F16 A;  3LH5 A;  2X3W D;  1K9A A;  2YUQ A;  3EHR A;  1CSK A;  3VS1 A;  3EG1 A;  2CUD A;  3M0S A;  1AOJ A;  2DM1 A;  2EBP A;  2SRC A;  2YSQ A;  2LQN A;  4LNP A;  2E5K A;  3TVT A;  1NM7 A;  3A98 A;  4JZ3 A;  1AVZ C;  4WCI A;  1WXU A;  4K11 A;  1QKX A;  2K2M A;  4RUG A;  2DIL A;  2DE0 X;  1E6G A;  2FPE A;  2GQI A;  4AFZ C;  1BB9 A;  1AWW A;  2LJ3 A;  1W6X A;  2KRM A;  2SEM A;  4J9I A;  3I5R A;  3PVQ A;  2KEA A;  1QWE A;  2KT1 A;  2DBK A;  1X6B A;  4DEX A;  2EYX A;  2YT6 A;  2CUB A;  2O9S A;  3NHN A;  1UG1 A;  1NEG A;  3UF4 A;  2LNH B;  4ESR A;  2LJ0 A;  1YP5 A;  1UGV A;  3VS5 A;  2DF6 A;  3NMZ C;  4IIM A;  1ABQ A;  3TSZ A;  1Z9Q A;  1BBZ A;  1B3Q A;  2JXB A;  2YDL A;  5HCK A;  1X2K A;  3I35 A;  2JW4 A;  2GNC A;  1HSQ A;  2BZY A;  3M0U A;  1PRL C;  2GTJ A;  3H0H A;  4OMO A;  3C0C A;  4J9D A;  2EGC A;  1UEC A;  2L3P A;  2JT4 A;  1WDX A;  1M8M A;  1SSH A;  2CSI A;  1OPK A;  2G6F X;  2DBM A;  2J6F A;  2KE9 A;  1XOV A;  2FRY A;  2KXC A;  4HCK A;  5FW9 A;  2CT3 A;  2KXD A;  2ROT A;  1ZSG A;  2PNI A;  1UJY A;  4JJB A;  4A63 B;  1AZG B;  2KR3 A;  4HXJ A;  1QCF A;  1A0N B;  1PWT A;  2YUO A;  1YNZ A;  2W10 A;  3REA B;  3FJ5 A;  3PE0 A;  3VS6 A;  2NWM A;  5GJW B;  1ZUU A;  1KFZ A;  1K0X A;  2XMF A;  4AG1 C;  2CSQ A;  2C0O A;  1RLP C;  1ZLM A;  3VS7 A;  1WXT A;  2A28 A;  2D0N A;  2DL3 A;  4E6R A;  1VYU A;  2NUZ A;  1WIE A;  2EQI A;  2J7I A;  2EGA A;  1K76 A;  2CDT A;  1UUE A;  2K6D A;  2AKL A;  4J9B A;  1HD3 A;  1PKS A;  5IHN A;  1IO6 A;  2ESW A;  1PRM C;  2O88 A;  2K9G A;  3ZL7 C;  4Z88 A;  2O2O A;  1G2B A;  2JM9 A;  5IXB A;  2GGR A;  3VS4 A;  1JXM A;  2X3X D;  4OMM A;  1M3A A;  2V1R A;  4D8K A;  3NGP A;  1JEG A;  2L0A A;  5I11 A;  1EFN A;  4F17 A;  1BK2 A;  4D8D A;  2FPF A;  1I07 A;  4OMQ A; 
#chains in the Genus database with same CATH topology
 1TWB A;  2CH4 W;  4DA4 A;  5IHK A;  4JJD A;  4KGZ B;  1S72 T;  2JS2 A;  1X2Q A;  3CD6 Q;  4XU1 A;  1K9M R;  3KUF A;  3EFR A;  1H92 A;  4RG8 A;  4E7J A;  4KRT A;  2COW A;  3OYM A;  2LRQ A;  4PJO A;  4M75 A;  2FO0 A;  5GAO m;  5GAO r;  4AFU C;  3HKS A;  2R5A A;  5GAN 6;  4LE9 A;  2J06 A;  1G3T A;  1YHQ T;  2LCC A;  4J7I A;  1I8F A;  3E9G A;  3P8H A;  4LD6 A;  2E64 A;  2LTO A;  1M30 A;  2EVR A;  4M78 E;  2F5T X;  2EFI A;  1BCO A;  2B86 A;  1HK9 A;  3EG0 A;  4B9W A;  3CD6 T;  1M8V A;  3M4G A;  2EKO A;  2RMO A;  4Q5W A;  2AZV A;  2LNV A;  1KSW A;  2DL4 A;  2AKK A;  4OMF B;  3QJY A;  3NTH A;  4JPB W;  2E3H A;  3DB3 A;  1U8R A;  3G71 A;  2HL3 A;  2E6N A;  2E5Q A;  2DIQ A;  2RF0 A;  4C8Q A;  4PLL A;  2ENM A;  1YN8 A;  2BTT A;  2M0Y A;  1BIB A;  1M2V B;  2J6O A;  2KRN A;  1N6A A;  1ZSZ A;  2I2L A;  4QW2 A;  5I21 A;  1D1A A;  2WSE E;  4XTZ A;  3CC4 A;  1GCQ A;  4KH1 B;  3MP8 A;  4M75 D;  3PFS A;  1Y96 B;  1QVG S;  4E7H A;  2PUO B;  4KUL A;  1TUD A;  3QYG B;  2ED0 A;  1YIJ A;  4E7K A;  2HQE A;  3MET A;  1RAG B;  3SD4 A;  3M58 A;  5KYW B;  1T3L A;  1K73 U;  5HY6 A;  4C0D B;  2CS7 A;  2X35 A;  3MEV A;  5GAO q;  2H8H A;  1VQM A;  1M3C A;  2DTO A;  3AHU A;  1ZX6 A;  4GBQ A;  5GAO l;  1WYX A;  3CC2 T;  4M78 B;  2X9H A;  3S6W A;  1GBQ A;  2RQW A;  4PJM A;  3OMC A;  1PD1 A;  1WI7 A;  3ZEH A;  2HAX A;  3U23 A;  4D6W A;  2A0F B;  3M0Q A;  3RER A;  1QP3 A;  1MMA A;  2M51 A;  3OYH A;  1KD1 U;  2GFA A;  3CME T;  1VQK Q;  4M7A E;  2ZPE B;  3I56 A;  1Y57 A;  4A4F A;  2ZZD A;  3PVL A;  2FEI A;  4C92 E;  1TTH B;  3G7Z A;  3HSB A;  1X01 A;  2MAM A;  1T0J A;  2X4Y A;  3M56 A;  3RKY A;  3VJP A;  1VQ6 T;  1ZBX A;  1MUZ A;  3RNJ A;  3JCM V;  1KIK A;  5GMK i;  4OMP A;  3E2U A;  3WXM B;  2IVW A;  1G3W A;  3LLR A;  3A8O B;  1OOT A;  2LCS A;  2QDY B;  4M7D E;  1WA7 A;  3RMQ A;  2HBW A;  2RHU A;  5GAN e;  2OAU A;  1B34 A;  3M9Q A;  3OYB A;  5CVI A;  5DLQ E;  5KYN A;  5AYF A;  1HYO A;  4M77 E;  1UHF A;  4LD9 K;  2DET A;  5HKC A;  2QGG A;  3H6Z A;  2R5M A;  2X4J A;  4BD3 A;  4AFQ C;  3J80 E;  2QEX A;  4PJL A;  2RK1 A;  3RES A;  1I1J A;  3H0I A;  3OYC A;  3PMI A;  4OB0 B;  4M7A B;  2M02 A;  2EJF A;  3WVD B;  1WGS A;  1WHM A;  4BDY A;  3RKX A;  1BI1 A;  4C92 B;  3LWH A;  3RDV A;  2MWP A;  3HFN A;  5GAN f;  3ER0 A;  5IHI A;  1V1C A;  1KD1 C;  3X20 B;  2RB6 A;  2MWO A;  3V7R A;  1V76 A;  2DJZ A;  2RI3 A;  5LJ5 f;  3EG9 B;  4X1V A;  3JB9 D;  3JCM c;  4RTV A;  2JNG A;  1D0X A;  2H3J A;  1QWF A;  1K9M U;  1O9S A;  4BDZ A;  4RTT A;  4M7D B;  3L1A A;  3BE3 A;  5A0D A;  2A3L A;  3LWI A;  1D0Z A;  1SF9 A;  1UJ0 A;  4RTW A;  2D9T A;  2GTO A;  4HVU A;  1FXX A;  3OBW A;  1YJN T;  2OI3 A;  2RN8 A;  2VVK A;  2MMP A;  4VUB A;  4M77 B;  2DRK A;  2AZS A;  3FIF A;  1JBM A;  2ZPB B;  3OYJ A;  1QKW A;  4ZN3 A;  3CBO A;  4C0D C;  3JV3 A;  1VQ8 A;  1K0S A;  1CKA A;  3OY9 A;  1VQP Q;  2FVU A;  2L3R A;  1NEB A;  4F04 B;  1I5O B;  4M78 C;  1X69 A;  2A36 A;  3M0P A;  3Q1J A;  2M1H A;  4M75 E;  1KC8 R;  1VYT A;  2G3R A;  1SHG A;  4C0G A;  3LYI A;  1OI1 A;  3BY7 A;  1CSK A;  5C0M A;  4J5Y A;  1UEB A;  2DM1 A;  5LJ3 g;  2SRC A;  4LNP A;  2DXC A;  3FDR A;  5KH6 A;  2K2M A;  5D6W A;  1N27 A;  4RUG A;  4OP0 A;  4DOV A;  5GMK e;  5GMK m;  3CC7 A;  4AFZ C;  2GQI A;  3CCU T;  2PVG B;  4PJJ A;  2DYI A;  3S3O A;  2SEM A;  2EJG A;  1VUB A;  4XTU A;  3HP9 A;  1VQ9 Q;  4C5E A;  1PM3 A;  5J3B A;  4A4K A;  5KYY B;  1K9M C;  4XTW A;  1KQ1 A;  1VQN T;  2LQK A;  4J83 A;  1VQ6 A;  1M4Z A;  2O9S A;  3NHN A;  2QGF B;  1IB8 A;  3FRN A;  4E47 A;  2LJ0 A;  3SB2 A;  1YP5 A;  2DF6 A;  3NMZ C;  1ACM B;  4BE0 A;  2YXY A;  1B3Q A;  2DZ9 A;  4M75 B;  3I35 A;  2VXE A;  1JJ2 S;  1VQ7 A;  2GNC A;  3M0U A;  3CCV A;  3CCR A;  4JRQ A;  3C0C A;  4JRI A;  4X34 A;  1VQ9 T;  2EGC A;  2RHI A;  1UEC A;  2L3P A;  2JT4 A;  2QQ9 A;  3LX7 A;  2XKO C;  2G6F X;  3OQ5 A;  2V8K A;  4M7A C;  3JCM d;  5I2S A;  2KXC A;  4X9C A;  1ZSG A;  4C92 C;  5GAN 7;  2BE7 D;  2M16 A;  4JJB A;  4HXJ A;  1QCF A;  5KYU A;  4QQG A;  1KQ2 A;  2P0K A;  2KK4 A;  2EJ9 A;  5GJW B;  5GMK l;  3LGF A;  3DKM A;  5FRN A;  1EX4 A;  4AG1 C;  2E10 A;  2RHX A;  4OB2 B;  2LT1 A;  1UGS B;  4EMK A;  1WNL A;  2CP7 A;  2CSQ A;  4M7D C;  5GAN g;  2O01 E;  2Y90 A;  1ZSZ B;  1YBY A;  2DXB A;  3KBG A;  3VS7 A;  5DM7 R;  3LW5 E;  3L2Q A;  4QQD A;  1BKB A;  1LJO A;  1OX8 A;  3ZFJ A;  5LJ5 g;  2H3E B;  3RUX A;  2DIG A;  4BE2 A;  4BI3 A;  1UUE A;  4F7U E;  4Z02 A;  3OBY A;  4M77 C;  3P8D A;  3G71 Q;  4J9B A;  4BAC A;  1IO6 A;  1RAH B;  1Q7Y R;  5IXB A;  3N5B B;  3VS4 A;  5C6S A;  2V1R A;  1H3Z A;  2EIF A;  1KQS S;  1W2B S;  1YJN A;  3CC4 Q;  3ME9 A;  2DL7 A;  2O31 A;  1KHI A;  1YCS B;  4RTU A;  5A0L A;  1MMG A;  2P4R A;  1YIJ Q;  4EMG A;  1GFD A;  1TUC A;  3OYI A;  3UDC A;  3CCQ Q;  3G71 T;  1I4K 1;  2D0Q B;  3M0R A;  2PUK B;  3CBP A;  4IUP A;  4KUD K;  1WZO A;  4CC7 A;  1M1F A;  3OB9 A;  1VQM Q;  4ZNX A;  1TU0 B;  2OTJ A;  4Y92 A;  2DRM A;  2RHY A;  2RK2 A;  1M9S A;  1JU5 C;  1V29 B;  4JLI A;  2XD0 A;  2NLU A;  4DBR A;  3NPF A;  4PFO A;  5GAN j;  3J7A F;  1YI2 T;  1WJQ A;  1EZZ B;  1SRM A;  2MYS A;  1PKT A;  5LJ5 j;  1WPY A;  3JB9 G;  4F7U B;  4XQ3 A;  2CZ1 B;  3I56 Q;  4IKF A;  1T3S A;  1E6H A;  4NL2 A;  3OYK A;  1KC8 U;  1WLP B;  3CCU A;  3NFC A;  1B34 B;  2WSC E;  9ATC B;  2F2W A;  3QO3 A;  1RUW A;  2CH4 A;  2L8D A;  2O4X A;  1NYF A;  1M3B A;  4M75 C;  4AT1 B;  3L2W A;  1FMK A;  2HKQ B;  2EYZ A;  4M78 F;  4Y28 E;  3QWX X;  4RKU E;  2EYQ A;  4MZT A;  5CKE A;  2ECZ A;  2JJ9 A;  1WHL A;  1K1Z A;  5CKB A;  2MF2 A;  3J81 E;  4P5N A;  3I9Q A;  2BZ8 A;  4CC2 A;  3TU4 K;  2KNB B;  3RIR A;  2DMO A;  3MEW A;  1Q86 R;  2LVM A;  2CRE A;  4ZGD B;  2O9V A;  4XTY A;  2ROL A;  2ZPH B;  3CQT A;  1WJR A;  3PT9 A;  2X4X A;  3EG2 A;  4V2S A;  3M4Y A;  1KK7 A;  4AFS C;  3OYY A;  1B7T A;  4A54 A;  2L3S A;  2KGT A;  2CP0 A;  3EGD A;  4RTX A;  4F14 A;  3CPW A;  2DXU A;  4FL6 A;  1MMD A;  1ZSZ C;  2GQV A;  3KXT A;  4IUQ A;  1QVF A;  5KYX A;  4JZ4 A;  1GCQ C;  3BFM A;  1Q82 R;  4A4E A;  3JB9 H;  1NE8 A;  3OSV A;  2RH2 A;  2VKN A;  3CPW P;  3JCM f;  1IXD A;  2PZ1 A;  3VYG A;  5CKF A;  1AD5 A;  1D3B A;  2QEX T;  4ELZ C;  2LP5 A;  3CCE T;  2DVJ A;  1PCX A;  1ZQ1 A;  1QVF P;  2DL5 A;  2JMA A;  4N0A C;  4EIK A;  1KC8 C;  2HNI A;  3VUZ A;  2M0O A;  4L6V 5;  1RL2 A;  1NPR A;  2RJE A;  2HEQ A;  1OU8 A;  1XTD A;  2VUB A;  3MJX A;  4PK4 A;  2YRD A;  5GMK j;  3X28 B;  2VWF A;  4M7A F;  4OGE A;  4E7I A;  3VS3 A;  1NLP C;  4FYX B;  1TH7 A;  3PIP A;  2KYB A;  4J9G A;  1VQ8 Q;  2Y4X A;  4C92 F;  4MMK A;  3X24 B;  4DQ2 A;  1K4U S;  4GLM A;  2CP5 A;  2R58 A;  1YCY A;  1JXO A;  1LPL A;  4C0F A;  2EWN A;  2L89 A;  2GFU A;  1Q7Y U;  2YWW A;  1MNE A;  4M7D F;  4R0K A;  2FRW A;  1I81 A;  4J6Y A;  1OZ2 A;  3EHQ A;  3OMG A;  5LJ3 e;  2R57 A;  1IHV A;  4GLK A;  3CC2 Q;  1VQL A;  2PTK A;  1VQ8 T;  3E19 A;  4ZGE B;  3HFO A;  4PJO D;  4XU0 A;  2A7Y A;  2NUP A;  2YUN A;  3VU3 C;  1U3O A;  2KI7 A;  1UDL A;  2DLP A;  1GRI A;  2RHZ A;  3CC7 Q;  4M77 F;  3SHW A;  2D6F A;  4ZTJ A;  1YI2 A;  4XU2 A;  5D6Y A;  1X43 A;  3CME Q;  2EGE A;  3R6N A;  1NZ9 A;  1AEY A;  3MP1 A;  2HD0 A;  4M78 G;  4B9X A;  2MOX A;  3A1P A;  3EGU A;  4LUE A;  3OYN A;  2E4H A;  2KBT A;  1QCN A;  2JN0 A;  5LJ3 f;  1VQ6 Q;  1JB0 E;  4OMN A;  3JCM J;  2BKD N;  2VGM A;  3VS2 A;  3OS5 A;  3CC7 T;  3A8H B;  2KMT A;  4C8Q D;  4HCZ A;  2RI2 A;  3A8M B;  1O75 A;  5KYU B;  3H41 A;  3QJ6 A;  1VQ7 Q;  1EIF A;  2QXF A;  4BE1 A;  3CCV Q;  3V7S A;  4HVV A;  2B8A A;  4RG2 A;  1VIF A;  2CP6 A;  4L59 A;  1TXQ A;  2E3I A;  3JCM P;  4EMK B;  5HK3 A;  1W1F A;  3CXC A;  2HBP A;  2GCX A;  4CC4 B;  1WHG A;  2W0Z A;  2JMC A;  3LH5 A;  1QP2 A;  5GAM e;  1RAA B;  3VS1 A;  3FC3 A;  1MHN A;  1Q7Y C;  2EBP A;  3A98 A;  4HCC A;  4JZ3 A;  1VQ7 T;  1WXU A;  1VQ5 A;  3CXC P;  2F69 A;  3CCV T;  5HK0 A;  3CCR T;  2E70 A;  1YIT T;  1BIA A;  1AWW A;  3QG1 A;  2Z0W A;  3F70 A;  2LJ3 A;  1Q86 U;  3OS1 A;  3EGX B;  2VC8 A;  1VQ4 A;  1LNX A;  3OYA A;  4FT2 A;  2Y4Y A;  5LJ5 e;  4M75 F;  2KEA A;  4XTX A;  1QWE A;  3TCJ A;  2FZC B;  3JCM g;  2V8I A;  3QZ9 B;  2DBK A;  2EQK A;  3JSC A;  2P4T A;  2P0P A;  1OYX A;  2YT6 A;  1YJ9 T;  5GAM f;  4M7A G;  3CCE A;  1NJI R;  2HZY A;  2CP2 A;  1X75 C;  4ESR A;  2XK0 A;  4C92 G;  1R77 A;  5IT9 E;  1UGV A;  4BY6 B;  4ATO A;  3OW2 A;  2MI6 A;  4E7Z A;  2EQJ A;  3TSZ A;  1Z9Q A;  1BBZ A;  2YDL A;  5HCK A;  1X2K A;  2FZG B;  2JZ2 A;  1Q82 U;  3NTK A;  2DK3 A;  4QKU A;  1YJN Q;  3QKJ A;  4J9D A;  5CIU A;  2DEQ A;  3JCM X;  5CO7 A;  4MDW A;  1I5L A;  3P8B B;  3OW2 P;  3H9N A;  1SSH A;  3FLG A;  4OB1 B;  3CCS T;  4M7D G;  2J6F A;  5LJ3 h;  1XOV A;  4HCK A;  1FMV A;  5FW9 A;  1QVP A;  2ROT A;  2HKN A;  2F5K A;  5J26 A;  3LGL A;  2XDP A;  1OQK A;  4PFZ A;  1F1B B;  2K4Y A;  2KR3 A;  3FJP A;  3C12 A;  1A0N B;  2OTJ Q;  3R6O A;  1YNZ A;  3FJ5 A;  4M77 G;  3V8L A;  3PE0 A;  1VOM A;  1KFZ A;  1K0X A;  2PVO B;  2XMF A;  2JTM A;  3L2Z A;  2DEU A;  4XK8 E;  2AT1 B;  2CYZ B;  2O4X B;  1PD0 A;  2P84 A;  2C0O A;  5GAN 4;  1ZLM A;  1FX7 A;  3CBM A;  1WXT A;  2D0N A;  4EPC A;  4E6R A;  1Q86 C;  1M1K R;  2J7I A;  4FYV B;  1AT1 B;  3A5Z B;  3CCU Q;  2CDT A;  2OTJ T;  2BUD A;  1TSF A;  1SG5 A;  4PJO E;  2AKL A;  3X25 B;  1PRM C;  2O88 A;  2K9G A;  3EH2 A;  2O2O A;  3CCJ T;  5CKH A;  1HXD A;  4IUR A;  3NGP A;  1JEG A;  2L0A A;  1JRI A;  1EFN A;  5L8R E;  2CGH A;  1VQN Q;  1OUL A;  4D8D A;  2FPF A;  2DD5 A;  2FL7 A;  4OMQ A;  2DZC A;  1MND A;  1YWO A;  2F2V A;  4KT0 E;  4RMO A;  2KYM A;  1QLY A;  1RLQ C;  1U1T A;  1U5S A;  2EPD A;  4FW1 A;  1C0M A;  1Q82 C;  5GAM h;  3DLM A;  2C06 A;  2EYW A;  2QQS A;  5DY9 A;  5DLO A;  4KH0 B;  5KYX B;  1IRX A;  1PSF A;  3I55 T;  4F7U F;  2LZ6 B;  4ANJ A;  4C8Q E;  2YHT A;  2ZPF B;  2XDB A;  3FEO A;  3JB9 F;  5GAN h;  1D3B B;  2VV5 A;  4J9F A;  1SPK A;  1S1N A;  2K57 A;  4J6X A;  5FWB A;  1RAB B;  3PNW C;  3KFV A;  5LJ5 h;  1D0Y A;  4M75 G;  1PHT A;  5CAI A;  3SFM A;  4E2F B;  3GPL A;  4ORZ A;  2K3B A;  4PJO B;  2JTE A;  3PGG A;  2L5Q A;  1YIT A;  2V1Q A;  1Z9Z A;  2LDM A;  1TUG B;  4EDU A;  1OX9 A;  3CCL T;  4BY6 C;  2HQH A;  4FSS A;  4JS5 A;  2RPN A;  5LJ3 j;  1MV0 B;  4GY5 A;  1LOJ A;  5GAM g;  2RA2 A;  4LDU A;  1GCP A;  1YJ9 A;  1XJW B;  3NTI A;  4M78 A;  3L42 A;  1QCO A;  2DTI A;  4HVW A;  2DX1 A;  2KY9 A;  2YLB A;  5L23 A;  1LVK A;  3UWN A;  4C8Q B;  2EW3 A;  4FU6 A;  3HRT A;  3WVE B;  1J3T A;  4JUV A;  1OPL A;  2QAZ A;  4A53 A;  1M5Q 1;  1RAC B;  2E65 A;  2YRC A;  5CQY A;  5IN1 A;  2DKG A;  1G3S A;  1VYV A;  3E1S A;  1C1A A;  2KRS A;  4C0Z A;  3M5A A;  3O5Z A;  2A08 A;  4NL3 A;  3QUI A;  5FU6 B;  1NJI U;  3OA6 A;  4AMC A;  3QXE B;  3CCS A;  3SWN A;  3OYL A;  3H8Z A;  1NBE B;  3D7S B;  1PNJ A;  4RTY A;  3QII A;  3JCM b;  1B07 A;  1AWX A;  4PNO A;  3GLX A;  2F2X A;  3E9F A;  3CCM T;  4O5V A;  1BU1 A;  1VQL Q;  2K5I A;  1H3H A;  2JOY A;  2RI5 A;  4DOW A;  2MCN A;  2QG9 B;  1UGQ B;  4J9H A;  1YI2 Q;  1C6V X;  2M9U A;  1GXI E;  2X51 A;  2GF7 A;  5GAM j;  5I22 A;  4WF2 A;  3M57 A;  2WAC A;  1ABO A;  3TQ7 P;  1IZ6 A;  3OYD A;  2L2P A;  5GMK h;  2DAQ A;  1VQL T;  2EKH A;  2DYB A;  1WHJ A;  1AZE A;  3MKD A;  2KT8 A;  2E6Z A;  1SSF A;  3CCJ A;  2ABL A;  4QQ6 A;  2PU9 B;  4M7A A;  2ZCF B;  4B6M A;  1K73 R;  2I0N A;  4F7U G;  3JCM Q;  2FPD A;  2QK0 A;  4C92 A;  2ATC B;  3VKI A;  1T0H A;  1HJD A;  3RBB B;  2XU8 A;  2OAW A;  3HTR A;  1P92 A;  2VYT A;  2LCL A;  4A4H A;  2QA4 A;  2LJ1 A;  3ULR B;  1ZBJ A;  1NJI C;  1UTI A;  1WX6 A;  3I55 A;  3HRS A;  2BZX A;  1AHJ B;  3UAT A;  2FG0 A;  1VQP A;  1N8R R;  4PJO C;  1NYG A;  4OML A;  3VYH B;  3INZ A;  5EG2 A;  1RI0 A;  3SEM A;  3VRY A;  1WQ7 A;  1YWP A;  5CK9 A;  1VQ5 Q;  4E7S A;  2DPP B;  2FHD A;  2YLC A;  1H8K A;  1SRL A;  3JAM E;  5FRO A;  3PTA A;  1E7O A;  4M77 A;  1IRE B;  1MMN A;  3X26 B;  1VQ4 Q;  1UGR B;  4IUU A;  3REB B;  1WHH A;  4WTO B;  3JCM e;  1VQO T;  1GBR A;  3UPU A;  2ZGW A;  1WFW A;  3OYF A;  2HCK A;  2QEX Q;  1M27 C;  3CCE Q;  1OEB A;  3CCL A;  3EG3 A;  1VQ5 T;  3EFS A;  1K8A R;  2EQU A;  5KE2 A;  4C8Q C;  5KE3 A;  1G83 A;  2E1H A;  3HHT B;  1I0C A;  4FCY A;  4IIO A;  4CI0 C;  3VS0 A;  2KDS A;  4ZTF A;  1VQ4 T;  2DNU A;  2JS0 A;  3L2V A;  1QVG A;  2K5F A;  1NG2 A;  2OJ2 A;  2OTL T;  4QT7 A;  1ZA2 B;  5FU6 C;  2LX7 A;  2RO0 A;  3A8L B;  2QAS A;  1Y0M A;  4DEY A;  4JJN K;  3TRE A;  3OYE A;  4BB7 A;  2KAF A;  1X6G A;  2QTV A;  5IXF A;  3G6E A;  2LQ8 A;  4F16 A;  1JQQ A;  3M0T A;  4R55 A;  2X3W D;  2YUQ A;  3CMA A;  4XU3 A;  3EG1 A;  1R0C B;  2CUD A;  3M0S A;  4A4G A;  2ZPI B;  4PKC C;  2LQN A;  3TVT A;  2E5K A;  1KHC A;  4PLI A;  3EAE A;  4K11 A;  1QKX A;  5GAN d;  5FU7 B;  2FPE A;  2WSF E;  1BB9 A;  2CP3 A;  4OB3 B;  3G4S T;  5LJ5 d;  1G8X A;  5CQX A;  1M1G A;  2RJF A;  3V8J A;  3CCM A;  3M59 A;  4J9I A;  3AT1 B;  2DTH A;  3PVQ A;  1RAE B;  2KT1 A;  2DO3 A;  4DEX A;  2EYX A;  2BIV A;  4FSX A;  4HT8 A;  1UG1 A;  1NEG A;  3UF4 A;  1Q95 G;  4IIM A;  4ME7 A;  2JXB A;  4UC4 A;  1RAI B;  3GF5 A;  3G1J A;  2JW4 A;  2BZY A;  1PRL C;  4OMO A;  1OZ3 A;  2KQW A;  4MDX A;  1QQJ A;  2RJC A;  2JVV A;  2AIR B;  1R8O B;  1OPK A;  4OVA A;  3ZBD A;  2KXD A;  3VV0 A;  3CPW S;  3CPF A;  4HA8 A;  4FYY B;  2PNI A;  5GAO p;  1AZG B;  5GAN 2;  1BCM A;  2XI9 A;  6AT1 B;  2YRV A;  1PWT A;  2OX7 A;  1QVF S;  2W10 A;  3REA B;  5M9O A;  3PIO A;  2NWM A;  1ZUU A;  1M90 R;  1N9R A;  3CCQ A;  3JCM h;  4LDV A;  2FYK A;  4MZM A;  4N0A A;  4EMH A;  2A28 A;  2XG8 D;  2DL3 A;  3JB9 I;  4HCB A;  2JTF A;  4YTL A;  1VYU A;  1WIE A;  2EQI A;  5GAN 5;  2HQX A;  3CCR Q;  2NUT A;  1YIT Q;  3QBY A;  2EGA A;  1YJW A;  2K6D A;  5KCO A;  2RJD A;  2BE9 B;  1Q81 R;  1Y71 A;  3ZL7 C;  1R0B G;  1VQO A;  2JM9 A;  3MO8 A;  1JXM A;  2X3X D;  4OMM A;  1N8R U;  3GP8 A;  3JRZ A;  1PC0 A;  1MGQ A;  4QVZ A;  3MEA A;  1WQW A;  1IGU A;  4OGC A;  2E41 A;  1YJ9 Q;  5CR2 A;  1FWZ A;  4PJN A;  3CEY A;  3SWN B;  4M4Z A;  5J39 A;  1W70 A;  4JDS A;  1RAD B;  2AHJ B;  2QTX A;  1WJS A;  1N5Z A;  2XIC A;  2QDL A;  4BUG A;  1CKB A;  2HSP A;  2VGN A;  2OTL A;  1G3Y A;  2D8H A;  2DD4 A;  4Y91 A;  1TG0 A;  4PJO F;  4F7U A;  2XID A;  3JB9 J;  1VQK T;  2LQW A;  2X4W A;  2JM8 A;  1VIE A;  2K7A A;  1BI3 A;  2RQR A;  5FU7 C;  3CCS Q;  1K8A U;  5FLX E;  4J9E A;  3UA6 A;  8AT1 B;  2RNA A;  2RQU A;  4XTV A;  3GIB A;  1LCK A;  3O8V A;  2CZ0 B;  2IPO B;  1ZHI A;  1UHC A;  1K73 C;  3QSU A;  2QQA A;  2COY A;  2LX9 A;  1WXB A;  3V8K A;  3JCM W;  3S3N A;  3URG A;  1SHF A;  2EYY A;  1S72 A;  3EH1 A;  3G4S A;  2CT4 A;  3BW1 A;  4C8Q F;  5FRM A;  2LMJ A;  2MPX C;  1N9S A;  4JJC A;  1D1B A;  1X6O A;  4JRP A;  5A2Q E;  1UFF A;  1M2O A;  3EFO A;  5ECA A;  2D1X A;  1YHQ A;  1N8R C;  2DXT A;  3VRZ A;  4PL6 A;  4C5H A;  1KG1 A;  4J9C A;  2HSE B;  3CCJ Q;  1FMW A;  2YUP A;  3CD6 A;  3CXC S;  1JJ2 A;  3QYH B;  2ED1 A;  5GAO n;  2L3Q A;  1Y07 A;  2MK5 A;  3IQL A;  4DBQ A;  4QVD A;  2F1L A;  1VA7 A;  4HT9 A;  1AWO A;  4FYW B;  4NS5 A;  3TSW A;  4JLG A;  5AT1 B;  1ZUY A;  2QA4 Q;  1JJ2 P;  2DFU A;  1OU9 A;  1XNI A;  4LN2 A;  1W4S A;  3OS2 A;  3H0F A;  3I55 Q;  1K8A C;  2E12 A;  5FWC A;  3GBQ A;  4BI4 A;  1KJW A;  4J8O A;  3C95 A;  3UA7 A;  2IIM A;  3MPU B;  2QQR A;  1DJ7 B;  2RQT A;  4KGV B;  4E7L A;  3EGD B;  4EMK C;  5EC7 A;  4BI8 B;  3TEE A;  1ZUK A;  2P0Q A;  4FW2 A;  2QA4 T;  2IG0 A;  3OYG A;  2AK5 A;  2RD1 A;  2DER A;  3CC2 A;  3OW2 S;  2HMA A;  5GJV B;  1NLO C;  1VQP T;  1MV3 A;  4AG2 C;  1AWJ A;  1OV3 A;  4CRI A;  1UGP B;  3BDU A;  3C94 A;  3SWN C;  1WHK A;  3RR6 A;  1M90 U;  5CCA A;  4LDX A;  2KRO A;  2KSS A;  1FYN A;  3CCL Q;  3QDF A;  1ZA1 B;  2VAS A;  4Z89 A;  1RI9 A;  3CME A;  4Z8A A;  3THK A;  3FB9 A;  2COZ A;  4PJO G;  1KQS A;  1W2B A;  2XHC A;  3QDR B;  1SKU B;  1M2V A;  4RTZ A;  3RKW A;  5IH2 A;  4KUI A;  2K2V A;  3MP6 A;  2J05 A;  1Y96 A;  1Q81 U;  4II1 A;  1X27 A;  1Y7X A;  3SDZ A;  3UT1 A;  1KQS P;  2EAY A;  1W2B P;  3M54 A;  3VUB A;  3G6E Q;  1ARK A;  4RCB A;  5D6X A;  5KYW A;  3QWY A;  3CMA Q;  5IAY A;  2GBQ A;  1VQK A;  3M53 A;  2DL8 A;  2D8J A;  1JO8 A;  3M55 A;  2HL5 C;  4C8Q G;  2QQB A;  4JS4 A;  1IHW A;  1GFC A;  4FM4 B;  4FIB A;  1BI0 A;  1U06 A;  3CCM Q;  3QHS A;  4JRK A;  1IGQ A;  2MIO A;  3I5S A;  1SEM A;  1GL5 A;  3G6E T;  4ZGJ B;  2FB7 A;  4KBM B;  2J6K A;  3CMA T;  1UE9 A;  3V7C A;  3BDL A;  2NUP B;  2RQV A;  4LUD A;  2K3Y A;  1U1S A;  4R56 A;  3OSS C;  8ATC B;  4C5I A;  4J6W A;  1D09 B;  2K79 A;  3GNF B;  3MEU A;  1M90 C;  2LC4 A;  3GOX A;  3PMT A;  1QW1 A;  1TOV A;  2RM4 A;  2A37 A;  2C0T A;  2C0I A;  2V8J A;  3GNG A;  1UB4 A;  2CZ7 B;  3OS0 A;  3MCA B;  4CC3 A;  4M78 D;  1G5V A;  3DLL A;  2HDA A;  4L5G A;  4DBH A;  4LDY A;  2FZK B;  2DJQ A;  4KGX B;  4XAX B;  2DA9 A;  3LH0 A;  1Q81 C;  1K9A A;  3EGX A;  3EHR A;  2CZ6 B;  1NPP A;  1AOJ A;  4TVR A;  2NUT B;  2YSQ A;  1NM7 A;  5LL6 S;  1AVZ C;  4LDW A;  4WCI A;  3C4S A;  3HRU A;  4FT4 A;  1QMC A;  2DIL A;  2DE0 X;  1E6G A;  4N4H A;  4ZN1 A;  1D1C A;  2PVD B;  1W6X A;  4X9D A;  2KRM A;  2KVQ G;  3RMS A;  4LXC A;  5GAN 3;  1PSE A;  4QVC A;  3I5R A;  2QYZ A;  1M1K U;  2VB6 A;  5I2M A;  2DVE A;  5A0G A;  1X6B A;  2CUB A;  3CC4 T;  1YJW Q;  2K3X A;  2VXF A;  3EG9 A;  2LNH B;  1YIJ T;  5LJ3 d;  1TS9 A;  3VS5 A;  1VQO Q;  3ASK A;  3CCQ T;  1ABQ A;  1KD1 R;  2V26 A;  3T9N A;  4M7D A;  2NYS A;  5CKD A;  1BYM A;  4RCC A;  4O6J A;  1HSQ A;  2ZAE A;  4MZP A;  2GTJ A;  3H0H A;  1VQM T;  3L2U A;  3L2R A;  1BI2 A;  3QZ5 B;  2QI2 A;  4J7F A;  1WDX A;  2LT4 A;  4IUV A;  1M8M A;  2CSI A;  2K5L A;  1YJW T;  2JUF A;  2DBM A;  4N4I A;  2KE9 A;  2FRY A;  3QPH A;  4C5G A;  3HPW A;  2CT3 A;  3DB4 A;  4M7A D;  4NOY A;  5GAN 8;  4DBF A;  2XDD A;  3HL8 A;  2OTL Q;  2ZPG B;  1VQN A;  1UJY A;  4A63 B;  4C92 D;  2YUO A;  3I56 T;  3VS6 A;  5D7U A;  4MML A;  2CKK A;  4IUT A;  2PQW A;  1RLP C;  3A8G B;  4M7D D;  1XQH A;  1VQ9 A;  3EFO B;  2NUZ A;  4ELY C;  4HKE A;  7AT1 B;  4PFP A;  3S3M A;  1K76 A;  1H64 1;  1PG5 B;  1S72 Q;  1M1K C;  5KCH A;  3G4S Q;  5GAM d;  1HD3 A;  1PKS A;  5IHN A;  4N4G A;  4M77 D;  2ESW A;  4OF1 A;  1YFN A;  4Z88 A;  1G2B A;  1QVG P;  2GGR A;  1M3A A;  4D8K A;  2EQM A;  5I11 A;  3MHX A;  1RAF B;  4F17 A;  1BK2 A;  5KYY A;  1YHQ Q;  1I07 A; 
#chains in the Genus database with same CATH homology
 2DL7 A;  2F2V A;  1YWO A;  2O31 A;  4M4Z A;  1YCS B;  2KYM A;  1QLY A;  1RLQ C;  4RTU A;  2CH4 W;  1U5S A;  2EPD A;  2P4R A;  1W70 A;  1GFD A;  5IHK A;  1TUC A;  4JJD A;  1N5Z A;  2JS2 A;  2QDL A;  2EYW A;  1X2Q A;  1CKB A;  3M0R A;  1H92 A;  2HSP A;  4KRT A;  4CC7 A;  2D8H A;  2LZ6 B;  1TG0 A;  4ZNX A;  2FO0 A;  2LQW A;  2JM8 A;  4Y92 A;  2DRM A;  4AFU C;  2K7A A;  4LE9 A;  2J06 A;  1JU5 C;  2RQR A;  4J9F A;  3NPF A;  1SPK A;  1S1N A;  1M30 A;  5FWB A;  2EVR A;  4J9E A;  3UA6 A;  2RNA A;  3KFV A;  2RQU A;  1PHT A;  1LCK A;  1SRM A;  2B86 A;  1PKT A;  3EG0 A;  4ORZ A;  2RMO A;  2K3B A;  1UHC A;  2AZV A;  1KSW A;  2JTE A;  2DL4 A;  2AKK A;  1T3S A;  1E6H A;  1WXB A;  2V1Q A;  1WLP B;  1SHF A;  2EYY A;  1Z9Z A;  4JPB W;  2CT4 A;  2RF0 A;  2F2W A;  2ENM A;  1RUW A;  1YN8 A;  2BTT A;  2CH4 A;  2LMJ A;  2J6O A;  2M0Y A;  2RPN A;  4FSS A;  4JJC A;  2KRN A;  1NYF A;  1M3B A;  1MV0 B;  1UFF A;  1FMK A;  1GCP A;  2EYZ A;  1GCQ A;  5ECA A;  2D1X A;  3VRZ A;  3QWX X;  2ECZ A;  1TUD A;  1K1Z A;  2ED0 A;  4HVW A;  2DX1 A;  3I9Q A;  2BZ8 A;  4J9C A;  4CC2 A;  5L23 A;  2KNB B;  2YUP A;  2DMO A;  2EW3 A;  1T3L A;  1J3T A;  2CRE A;  1OPL A;  2ED1 A;  2O9V A;  2L3Q A;  2H8H A;  2ROL A;  1VYV A;  1M3C A;  3CQT A;  1ZX6 A;  3IQL A;  4GBQ A;  1WYX A;  2KRS A;  3EG2 A;  3O5Z A;  2A08 A;  1VA7 A;  1AWO A;  1GBQ A;  2RQW A;  4AFS C;  1WI7 A;  3U23 A;  3TSW A;  1ZUY A;  2L3S A;  2KGT A;  1PNJ A;  4RTY A;  4RTX A;  4F14 A;  3M0Q A;  1B07 A;  1AWX A;  2M51 A;  4LN2 A;  2F2X A;  3H0F A;  5FWC A;  3GBQ A;  1KJW A;  4JZ4 A;  1BU1 A;  1GCQ C;  3UA7 A;  1H3H A;  1Y57 A;  2IIM A;  3PVL A;  2FEI A;  2VKN A;  2PZ1 A;  1T0J A;  2RQT A;  2MCN A;  1AD5 A;  2LP5 A;  5EC7 A;  2DVJ A;  4J9H A;  1MUZ A;  3RNJ A;  1ZUK A;  2DL5 A;  2JMA A;  1KIK A;  4EIK A;  4OMP A;  2AK5 A;  5I22 A;  1OOT A;  1ABO A;  2LCS A;  5GJV B;  1NLO C;  1MV3 A;  4AG2 C;  1AWJ A;  1OV3 A;  1WA7 A;  2HEQ A;  2L2P A;  2EKH A;  2DYB A;  2KRO A;  1AZE A;  1FYN A;  2KT8 A;  2HBW A;  2VWF A;  4Z89 A;  2ABL A;  3VS3 A;  1RI9 A;  1NLP C;  4Z8A A;  3THK A;  2I0N A;  2FPD A;  2KYB A;  4J9G A;  1K4U S;  1UHF A;  4RTZ A;  4GLM A;  1T0H A;  1HJD A;  3RBB B;  1JXO A;  5IH2 A;  2OAW A;  4AFQ C;  1I1J A;  2J05 A;  3H0I A;  1X27 A;  2LJ1 A;  3ULR B;  1ZBJ A;  1ARK A;  1UTI A;  1WX6 A;  4R0K A;  2BZX A;  3UAT A;  2FRW A;  2FG0 A;  3EHQ A;  3QWY A;  2GBQ A;  2PTK A;  1NYG A;  4OML A;  5IHI A;  2DL8 A;  2D8J A;  1V1C A;  1JO8 A;  3SEM A;  3VRY A;  1YWP A;  2YUN A;  1U3O A;  1UDL A;  2DLP A;  1GRI A;  1H8K A;  4X1V A;  1SRL A;  3SHW A;  1GFC A;  1E7O A;  4RTV A;  1U06 A;  1QWF A;  4RTT A;  1X43 A;  2EGE A;  3R6N A;  2MIO A;  3I5S A;  3REB B;  1AEY A;  1SEM A;  1GL5 A;  1UJ0 A;  2MOX A;  4RTW A;  2J6K A;  2GTO A;  3EGU A;  4HVU A;  1UE9 A;  4LUE A;  1GBR A;  1WFW A;  2RQV A;  2OI3 A;  4LUD A;  2HCK A;  2RN8 A;  1M27 C;  2KBT A;  2VVK A;  1OEB A;  4OMN A;  3EG3 A;  2DRK A;  2AZS A;  3VS2 A;  2K79 A;  1QKW A;  1G83 A;  3JV3 A;  1K0S A;  1CKA A;  1I0C A;  4IIO A;  2A37 A;  3VS0 A;  2C0T A;  2DNU A;  2JS0 A;  3H41 A;  1NG2 A;  2C0I A;  2OJ2 A;  1NEB A;  4QT7 A;  1X69 A;  2A36 A;  3M0P A;  4HVV A;  4CC3 A;  2LX7 A;  1Y0M A;  4DEY A;  2HDA A;  1VYT A;  1SHG A;  1W1F A;  1X6G A;  2DJQ A;  5IXF A;  4CC4 B;  1JQQ A;  2W0Z A;  2DA9 A;  3M0T A;  2JMC A;  4F16 A;  3LH5 A;  2X3W D;  1K9A A;  2YUQ A;  3EHR A;  1CSK A;  3VS1 A;  3EG1 A;  2CUD A;  3M0S A;  1AOJ A;  2DM1 A;  2EBP A;  2SRC A;  2YSQ A;  2LQN A;  4LNP A;  2E5K A;  3TVT A;  1NM7 A;  3A98 A;  4JZ3 A;  1AVZ C;  4WCI A;  1WXU A;  4K11 A;  1QKX A;  2K2M A;  4RUG A;  2DIL A;  2DE0 X;  1E6G A;  2FPE A;  2GQI A;  4AFZ C;  1BB9 A;  1AWW A;  2LJ3 A;  1W6X A;  2KRM A;  2SEM A;  4J9I A;  3I5R A;  3PVQ A;  2KEA A;  1QWE A;  2KT1 A;  2DBK A;  1X6B A;  4DEX A;  2EYX A;  2YT6 A;  2CUB A;  2O9S A;  3NHN A;  1UG1 A;  1NEG A;  3UF4 A;  2LNH B;  4ESR A;  2LJ0 A;  1YP5 A;  1UGV A;  3VS5 A;  2DF6 A;  3NMZ C;  4IIM A;  1ABQ A;  3TSZ A;  1Z9Q A;  1BBZ A;  1B3Q A;  2JXB A;  2YDL A;  5HCK A;  1X2K A;  3I35 A;  2JW4 A;  2GNC A;  1HSQ A;  2BZY A;  3M0U A;  1PRL C;  2GTJ A;  3H0H A;  4OMO A;  3C0C A;  4J9D A;  2EGC A;  1UEC A;  2L3P A;  2JT4 A;  1WDX A;  1M8M A;  1SSH A;  2CSI A;  1OPK A;  2G6F X;  2DBM A;  2J6F A;  2KE9 A;  1XOV A;  2FRY A;  2KXC A;  4HCK A;  5FW9 A;  2CT3 A;  2KXD A;  2ROT A;  1ZSG A;  2PNI A;  1UJY A;  4JJB A;  4A63 B;  1AZG B;  2KR3 A;  4HXJ A;  1QCF A;  1A0N B;  1PWT A;  2YUO A;  1YNZ A;  2W10 A;  3REA B;  3FJ5 A;  3PE0 A;  3VS6 A;  2NWM A;  5GJW B;  1ZUU A;  1KFZ A;  1K0X A;  2XMF A;  4AG1 C;  2CSQ A;  2C0O A;  1RLP C;  1ZLM A;  3VS7 A;  1WXT A;  2A28 A;  2D0N A;  2DL3 A;  4E6R A;  1VYU A;  2NUZ A;  1WIE A;  2EQI A;  2J7I A;  2EGA A;  1K76 A;  2CDT A;  1UUE A;  2K6D A;  2AKL A;  4J9B A;  1HD3 A;  1PKS A;  5IHN A;  1IO6 A;  2ESW A;  1PRM C;  2O88 A;  2K9G A;  3ZL7 C;  4Z88 A;  2O2O A;  1G2B A;  2JM9 A;  5IXB A;  2GGR A;  3VS4 A;  1JXM A;  2X3X D;  4OMM A;  1M3A A;  2V1R A;  4D8K A;  3NGP A;  1JEG A;  2L0A A;  5I11 A;  1EFN A;  4F17 A;  1BK2 A;  4D8D A;  2FPF A;  1I07 A;  4OMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...