2D0NA

Crystal structure of the c-terminal sh3 domain of the adaptor protein gads in complex with slp-76 motif peptide reveals a unique sh3-sh3 interaction
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
GSPWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GRB2-related adaptor protein 2
publication title Crystal structure of the C-terminal SH3 domain of the adaptor protein GADS in complex with SLP-76 motif peptide reveals a unique SH3-SH3 interaction
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 11
structure length 59
sequence length 59
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2d0nA00
3NMZC 3VS5A 2HSPA 2C0IA 2DX1A 2D8HA 2AKLA 5FWCA 1SEMA 1WX6A 2A28A 2B86A 4GBQA 1VYVA 3THKA 1GBQA 1AVZC 2KXCA 2ECZA 1SPKA 2YUNA 2OI3A 1ZUYA 1K4US 3TVTA 1UUEA 2RMOA 4OMPA 1UJ0A 2CT3A 1GCQA 5EC7A 2X3XD 1OOTA 2DMOA 1X2KA 1KSWA 1NM7A 4JPBW 4A63B 2JS0A 3H0FA 4WCIA 2RQWA 4ESRA 1AZEA 1W6XA 2DA9A 1HD3A 3O5ZA 2RQRA 3H0IA 5FWBA 1UJYA 1FMKA 2J6KA 2JMCA 4X1VA 2RPNA 1GFDA 2KROA 1ZBJA 4IIMA 2LZ6B 1OPKA 3NHNA 1HSQA 2LJ0A 2BZXA 3VS7A 1M30A 1PWTA 2BZYA 1B07A 2ROLA 1E6GA 2FEIA 2AZVA 2GNCA 2NWMA 2HEQA 2ESWA 2LCSA 2L2PA 2EBPA 1K9AA 3M0PA 1ZUKA 1ZX6A 1AWJA 2GTOA 4RTTA 4EIKA 2DRKA 2DVJA 1T3LA 3M0UA 4RTWA 2YT6A 2DLPA 1W70A 1UGVA 1OEBA 2J06A 4CC7A 1G2BA 2O31A 2IIMA 5I11A 3H0HA 2YDLA 4DEYA 2DL4A 2LX7A 3ULRB 1MV0B 1X6GA 2PTKA 3UA7A 2KT8A 2FRWA 2QDLA 2JM8A 1JXOA 1BK2A 1VYTA 1QLYA 2FPEA 1WDXA 2SEMA 4IIOA 2LNHB 2W0ZA 2RQUA 1MV3A 4OMMA 4RTXA 1A0NB 5IHNA 1AWXA 2NUZA 4LUEA 1RLPC 2FO0A 2EVRA 1BB9A 1YN8A 4RUGA 4F16A 2JS2A 2H8HA 2A08A 1QKWA 2YUOA 1W1FA 2DRMA 2A37A 3VRYA 4E6RA 1CKAA 4J9GA 1G83A 3REAB 1IO6A 4D8DA 1PKTA 3RBBB 4F17A 3REBB 1WXBA 2BTTA 3I9QA 4J9FA 2KRNA 3JV3A 2DILA 4Z8AA 3M0SA 1SHGA 2F2XA 2CH4W 1RLQC 2LJ3A 2XMFA 1NEGA 1K76A 2K79A 2DL5A 4OMQA 4JZ3A 2MOXA 2DL8A 2KNBB 2FRYA 1PRMC 4JJDA 1NLOC 4KRTA 1E6HA 5IXFA 1NG2A 1QWFA 2MCNA 2RNAA 2FG0A 3EG1A 1H8KA 1SSHA 1K0XA 3M0RA 2F2WA 2CUBA 3PVLA 2K9GA 1MUZA 1PRLC 2DBMA 5IH2A 1PKSA 2M0YA 3KFVA 1JO8A 2HBWA 1YWOA 2DM1A 2M51A 2JMAA 1M8MA 2YUPA 3I5RA 4J9BA 2DYBA 1GRIA 2O9VA 2RF0A 1JU5C 2JW4A 1U06A 1ABQA 4RTYA 1H92A 2C0TA 3EG0A 1TUCA 2RQTA 3UF4A 4OMOA 3IQLA 1TG0A 1UTIA 3U23A 3VS0A 1PHTA 2RQVA 1YCSB 2EW3A 4HXJA 3I35A 1ZSGA 5L23A 2J6OA 4HCKA 2OJ2A 1T0HA 1K1ZA 2ROTA 4AFSC 4AG2C 1QCFA 3CQTA 4Z89A 2EGCA 4ORZA 2A36A 1KIKA 1BU1A 2P4RA 4RTUA 2CSQA 5IXBA 1EFNA 1AOJA 4J9EA 1N5ZA 1T3SA 1E7OA 1NLPC 1AWWA 4JJBA 4Z88A 1NYFA 3VS1A 1AEYA 2KT1A 1ZLMA 1AD5A 3NGPA 2SRCA 2CREA 1RI9A 1UHFA 2L3QA 2CT4A 2FPFA 1NYGA 4HVUA 4Y92A 2EPDA 2KYBA 3UA6A 2PZ1A 1Z9ZA 3TSZA 5IHIA 4K11A 2JTEA 5ECAA 2EKHA 4F14A 1UHCA 1M3AA 5FW9A 2ED1A 4CC2A 3SEMA 2GTJA 2KXDA 2JT4A 2HDAA 1GCQC 2CDTA 1ZUUA 2LQWA 4CC3A 1QKXA 1GFCA 5I22A 2LQNA 4HVWA 2EYZA 4AFUC 4JJCA 2DBKA 2J7IA 1GL5A 4RTVA 4LN2A 1X69A 2G6FX 2V1QA 1Z9QA 4J9IA 3VS2A 1WIEA 2L3PA 3I5SA 3M0QA 4ZNXA 4R0KA 2LMJA 3NPFA 1FYNA 1YP5A 1SHFA 1WXUA 2E5KA 1Y0MA 1U3OA 1VA7A 2AZSA 2DL7A 2EYWA 1PNJA 2F2VA 3EHQA 3VS3A 2DF6A 1WFWA 2VKNA 3ZL7C 4QT7A 3VS6A 2K2MA 1BBZA 2AKKA 2O9SA 2BZ8A 1NEBA 1U5SA 1J3TA 1RUWA 1GBRA 2RN8A 1CKBA 2O2OA 2EGAA 4J9DA 5GJWB 3UATA 2CUDA 4HVVA 3TSWA 3H41A 1WXTA 1WYXA 2ABLA 2KE9A 3GBQA 3PVQA 4J9HA 1ARKA 3SHWA 1Y57A 1GCPA 1VYUA 2KBTA 3VRZA 1X6BA 3EHRA 3FJ5A 2AK5A 4LE9A 1X27A 2KGTA 2KRMA 2K7AA 4OMNA 1AWOA 1S1NA 3A98A 1X43A 1X2QA 3EG3A 1I07A 1I1JA 1M3CA 1WI7A 1JXMA 4FSSA 5GJVB 1T0JA 2L0AA 4GLMA 2V1RA 1M3BA 1H3HA 2LP5A 2EQIA 4OMLA 1UECA 2DJQA 1B3QA 1JQQA 2K6DA 4LNPA 4DEXA 2D1XA 2C0OA 1V1CA 2DE0X 4LUDA 2I0NA 2KYMA 1AZGB 1XOVA 2L3SA 1OPLA 3C0CA 1UE9A 1WLPB 1JEGA 1K0SA 2HCKA 2EYXA 2J6FA 2CSIA 1I0CA 2EGEA 1LCKA 3QWYA 2K3BA 2OAWA 1SRMA 2MIOA 2EYYA 2FPDA 2VWFA 2YUQA 1HJDA 1OV3A 1SRLA 2X3WD 2JM9A 2W10A 3QWXX 3LH5A 2D0NA 4AFQC 4JZ4A 4AG1C 2YSQA 3PE0A 1KJWA 2DL3A 2GGRA 2JXBA 3M0TA 2O88A 4CC4B 1YWPA 2ENMA 1WA7A 5HCKA 2GQIA 2PNIA 3RNJA 1UFFA 1QWEA 2DNUA 2KEAA 1UG1A 3EGUA 2J05A 2KRSA 3VS4A 3EG2A 5IHKA 2KR3A 2VVKA 1M27C 4RTZA 3R6NA 1TUDA 2LJ1A 4AFZC 1YNZA 4J9CA 2CH4A 1UDLA 4M4ZA 1CSKA 1ABOA 1KFZA 2D8JA 4D8KA 2GBQA 2ED0A
chains in the Genus database with same CATH superfamily
2X9HA 1Q86U 3RERA 2RHIA 1NZ9A 3VS5A 4OB0B 2C0IA 1PG5B 4M75D 2D8HA 1SEMA 2E3IA 2B86A 4Z02A 1N8RC 4R55A 1GBQA 3CCMQ 1AVZC 4FU6A 2ECZA 1SPKA 2YUNA 1G3YA 2D0QB 3S3NA 1K4US 2JN0A 4LDXA 1VQLT 4EMGA 1Q81C 5EC7A 1OOTA 1KC8C 3CCLQ 2JS0A 2CKKA 3CCQT 1AZEA 5LJ5d 2LT1A 4B6MA 2DA9A 2COZA 1M90U 4ELZC 1FMKA 4X1VA 2RPNA 2KQWA 4IIMA 3NHNA 1HSQA 2BZXA 4EMKB 4J8OA 2BZYA 1RAFB 2NWMA 3DB3A 4XK8E 4EMHA 1VUBA 1OU9A 2HEQA 5CKEA 4M77B 2EBPA 3PFSA 2RA2A 2C06A 1QVPA 2PU9B 2WSFE 1UGVA 5GANj 3CCEA 1OEBA 4XTXA 2J06A 3NTIA 4BY6B 4II1A 3QYHB 3LYIA 2YDLA 3M55A 4DEYA 4DOVA 4E7HA 1QP2A 2DL4A 3QYGB 5LJ5e 3ULRB 5D6XA 3JCMJ 5GMKi 2PTKA 1RAGB 4C92D 2KT8A 4KULA 4PJLA 1RI0A 1VQOT 2RHUA 3LGFA 1SF9A 5GAMg 1QQJA 3UDCA 2JUFA 1VYTA 3VUBA 1QLYA 1WDXA 4DQ2A 1VQ6Q 4E7LA 1MV3A 2CP5A 1VQ8T 5LL6S 2E6ZA 4JRIA 3EGDB 2OAUA 4FT2A 2XDDA 3EH2A 4XU1A 2E64A 1KG1A 2LCCA 3QPHA 1YN8A 1RAHB 4ZTJA 4RUGA 4RKUE 2VUBA 2XK0A 1W2BA 1QKWA 1KD1R 2YUOA 1VQMA 5HKCA 2A37A 1Q81U 3REAB 3OS0A 1IO6A 1KC8U 3RBBB 3A8HB 5D6YA 1D3BB 4E47A 4F17A 1WXBA 4XTWA 4QVZA 1WPYA 2DXUA 2PUOB 4Z8AA 3M0SA 3G4SA 4EMKA 1VQKT 5LJ3f 2F2XA 2EQUA 4M7DA 3L42A 3M59A 4M78B 4OMQA 3J81E 1QW1A 2MOXA 4JRQA 2PUKB 1PRMC 3MP8A 5CR2A 5GAOp 2MCNA 2KMTA 2FG0A 1NJIU 4XTVA 2KI7A 1K9MC 3OA6A 1K0XA 2L3RA 1PRLC 2DBMA 3SB2A 1VQPT 1PKSA 2M0YA 3OYLA 2VASA 1JO8A 4MDWA 2HBWA 1YWOA 4OGEA 2QA4A 2DM1A 1VQNQ 1LPLA 2JMAA 2FB7A 3JCMe 2O9VA 1SG5A 5HK3A 1U06A 1VQ9Q 1G3WA 4RTYA 3L2RA 2C0TA 1TUCA 3UF4A 3IQLA 1TG0A 1UTIA 1YCSB 2QQAA 4HXJA 1ZSGA 2JVVA 5L23A 4Y91A 1P92A 1DJ7B 1WHGA 2ROTA 4JRPA 3PIOA 4Z89A 2RI5A 3JCMc 2P4RA 2CSQA 1EFNA 4TVRA 1AWWA 1O75A 4JJNK 1VQ7T 1D3BA 5GMKh 2I2LA 1PCXA 3QUIA 4F7UA 2JTMA 2RHZA 1RI9A 1VQLQ 2L3QA 3WVEB 1NYGA 4C0DB 4FL6A 1YJNA 1K8AR 4Y92A 1TSFA 2QEXQ 4M78A 3CMAT 2HBPA 4OF1A 5IHIA 3HSBA 3CPWP 3H8ZA 5CKDA 5M9OA 2BE9B 2ED1A 2M9UA 1VQ5T 1BI2A 2GTJA 2KXDA 2ZPIB 2EWNA 1KK7A 2A0FB 3CC7A 3KUFA 1YIJQ 4WTOB 4CC3A 1QKXA 4OB2B 4JUVA 2ATCB 3QDRB 2LQNA 4FCYA 3CBPA 4QVCA 4J6WA 2V1QA 5KYXB 1G8XA 2HL5C 2L3PA 2K3XA 5LJ5h 5CVIA 4ZNXA 2LMJA 4IUPA 3DLMA 2QXFA 4PL6A 2E5KA 1KQ1A 3OYAA 3HRTA 1PNJA 1WFWA 5LJ3d 3VS6A 1PD0A 2K2MA 2O9SA 2BZ8A 1U5SA 1Q82R 1GBRA 4XU2A 2OTLQ 1M9SA 2O2OA 4KH1B 1D0XA 3UATA 4RG8A 2CP6A 3UWNA 3T9NA 5GAOn 1WYXA 4BB7A 2KE9A 3PVQA 4BUGA 2KBTA 3OYKA 2IG0A 3EHRA 3QJYA 4FW1A 2LT4A 3V7CA 4LE9A 2BUDA 2RK1A 1X27A 3SFMA 3PNWC 4OMNA 1AWOA 3A98A 4O6JA 1X43A 2V8JA 1X2QA 3EG3A 3VKIA 1I07A 1JXMA 4C8QE 2VYTA 3MO8A 2HL3A 2L0AA 3CCUA 2V1RA 1YITA 1M3BA 2PVOB 3OS2A 1JQQA 3S6WA 2K6DA 4LNPA 5GANe 3I56Q 2V26A 3PGGA 4A4HA 4Y28E 2X4WA 4NS5A 5GAN4 2HNIA 2XDPA 4IUTA 5KYXA 1XOVA 1K8AC 1D1CA 3C0CA 2DXCA 3CCJT 2R57A 4N4HA 1IGUA 1C0MA 1YJWT 4PK4A 3VUZA 1K0SA 1LCKA 1ZSZC 2EQMA 1SRMA 3DLLA 2MIOA 3LWIA 2MI6A 1B34A 3MJXA 3LGLA 3OYJA 4CI0C 1I8FA 5D7UA 2YRVA 4M77G 1HJDA 3EGXB 2HSEB 2X4YA 5CK9A 2MAMA 3QWXX 3LH5A 2JJ9A 4DBHA 3GLXA 2DXBA 4DBRA 2E5QA 2DKGA 2GQVA 3HL8A 1EZZB 3CD6Q 5I2MA 1YWPA 1OX8A 1OZ2A 2GQIA 3FDRA 5HCKA 1VQ4A 2QK0A 1R0BG 2R58A 2LX9A 4ELYC 3VS4A 2RK2A 2VVKA 1M27C 2LJ1A 3CPWS 4M7AB 3JB9J 8AT1B 3CBMA 2JOYA 1CSKA 1ABOA 2D8JA 1YJ9A 4D8KA 2GBQA 2ED0A 4BE0A 3VJPA 2HSPA 1OYXA 2L89A 5FU7B 4LD6A 4FYXB 4PJOC 2AKLA 5FWCA 3CCVQ 2R5MA 4M75B 2EAYA 1ZA2B 1M2OA 3G7ZA 3TVTA 4KUIA 4C8QD 2MYSA 3I55A 1H3ZA 1U8RA 1GCQA 4BDZA 5LJ5f 2DMOA 1X2KA 4C0ZA 1NM7A 4JPBW 1YI2Q 4A63B 1ZA1B 3H0FA 5GAOr 5GAMj 2RQWA 5DLOA 2E10A 3EGXA 1HD3A 1S72T 3O5ZA 2P0PA 1K73R 5CKBA 2DZ9A 4L6V5 1D1BA 4DOWA 5C0MA 4DBQA 4FIBA 3BW1A 3X24B 3NTKA 2L8DA 2YRDA 1IRXA 2CZ0B 3QIIA 3CCMA 3VYGA 2Z0WA 4KGZB 2GNCA 3SWNC 3S3OA 4XU0A 1ZUKA 3GF5A 2QGFB 1KQ2A 2ZPBB 2DRKA 3VV0A 7AT1B 5AYFA 1T3LA 3M0UA 2YT6A 3EFSA 2CS7A 3CCLA 3RKYA 2O31A 2IIMA 4XTZA 4A53A 4CRIA 3TU4K 2LX7A 2XDBA 3MHXA 4NL2A 4ZGJB 2DYIA 2FRWA 3CMEQ 4RMOA 3CC2Q 1JXOA 1NE8A 1QMCA 4C92B 5LJ3h 4M75A 2MK5A 2FPEA 2DTIA 3OYYA 1AT1B 2W0ZA 2RQUA 5GAN3 4OMMA 3JCMQ 3OYHA 1AWXA 1OQKA 2NUZA 2DAQA 3M4YA 4LUEA 2WSEE 3HP9A 4PLLA 1BB9A 2K4YA 4Q5WA 1JBMA 3JCMf 2CZ6B 4M77F 3OY9A 2NLUA 4L5GA 2DRMA 3CCET 1Q7YU 4E6RA 1G83A 4QQDA 3REBB 2E70A 3X26B 2KRNA 3JV3A 2DILA 3G6EQ 2CH4W 3ZEHA 1K76A 3CC4Q 2K79A 1VQ6A 2FRYA 3PMTA 4PJOG 3GPLA 4KRTA 4E7SA 2QTVA 2RNAA 3EG1A 1LNXA 1V29B 3FC3A 3M0RA 2F2WA 2RHYA 3PVLA 2K9GA 4C5EA 5IH2A 1PSFA 1Y7XA 5GAN7 5CKFA 4NL3A 3M54A 3CPWA 2M51A 1K73C 2LNVA 2YUPA 1VQMT 4J9BA 4BI4A 6AT1B 1D1AA 5LJ5g 1RACB 1ABQA 4C92A 3OMGA 4C5GA 1FWZA 3EFOB 1H92A 1QP3A 3OYEA 3G4ST 3RDVA 2MPXC 4B9WA 1WHKA 2DFUA 2EW3A 3OYIA 4M7DB 1LVKA 2HZYA 4HCKA 2OJ2A 1K1ZA 3D7SB 4AG2C 3CQTA 2ZPHB 3SDZA 1BU1A 1PD1A 2IPOB 5IXBA 3QKJA 3LH0A 1N5ZA 1T3SA 4LDVA 2AT1B 4A4KA 1NYFA 3X20B 3QHSA 4LDUA 2VC8A 2QA4T 5FU6C 2CREA 5CKHA 4DA4A 3FIFA 1C6VX 1UHFA 3KBGA 2FL7A 2FPFA 1VQ9A 4M77E 4JS5A 4E7JA 4UC4A 1TU0B 4V2SA 1TOVA 3TSZA 4K11A 3OS1A 3EAEA 1WGSA 1XJWB 5ECAA 2EKHA 2GFAA 4F14A 2YWWA 1M2VA 4CC2A 1N8RU 3MEVA 2JT4A 1N6AA 1ZUUA 5A0LA 1UEBA 5CCAA 2RI2A 2AHJB 1BIAA 4X34A 4AFUC 2V8KA 1N27A 3JCMd 2J7IA 1GL5A 4LN2A 1X69A 3EFOA 3JAME 5L8RE 3LWHA 4F7UB 4QQGA 1Y96B 2QEXA 3FB9A 4KGXB 4B9XA 3CCSQ 2M1HA 5GAOl 3OYMA 1YJNT 3A8MB 3NPFA 1YP5A 3CBOA 2MWOA 5GANf 5KYNA 3JCMb 2EYQA 1VA7A 1SSFA 2EJFA 2GF7A 3EHQA 3VS3A 2VKNA 3ZL7C 4QT7A 3QXEB 1BBZA 1WHLA 1NEBA 1CKBA 5GAMe 1YHQT 4J9DA 1M8VA 1YIJA 4HVVA 3CC7T 3JSCA 2DK3A 4DBFA 4N4GA 2ZZDA 5DLQE 1Y07A 1GCPA 4M7AG 1VYUA 3VRZA 1D0YA 3FJ5A 5GMKm 3BDUA 2AK5A 1LJOA 4PJOF 2KRMA 1IB8A 3JCMV 1GXIE 2K5FA 1NPRA 4BACA 1M3CA 2ZAEA 3A5ZB 2H3EB 4OMLA 2DJQA 4DEXA 2CGHA 2OTLA 2KVQG 3GOXA 2K3YA 2E12A 4M77D 2L3SA 4C0FA 2BKDN 3FRNA 1Y96A 4KT0E 1MNEA 1UE9A 5GAN5 2O4XA 3M4GA 2HCKA 3V8JA 4EMKC 2K3BA 4MZPA 3CCQQ 2P0QA 4M77C 2FPDA 4LXCA 2ZPEB 3PMIA 2F5TX 2YUQA 3CCUT 1YITT 1KD1C 1YHQA 3RKXA 1TS9A 3I56A 2JM9A 4BY6C 3G4SQ 4AFQC 3QJ6A 1K9MU 1FX7A 4JZ4A 3QZ9B 2YSQA 3PE0A 4D6WA 1KJWA 2GGRA 3CEYA 3GP8A 3PIPA 1Q95G 2EFIA 2ENMA 2QAZA 3OSSC 2PNIA 3RNJA 1UFFA 2DNUA 5A2QE 4LDYA 3HPWA 1UG1A 3EGUA 2KRSA 4ZN3A 4ANJA 5IHKA 2QTXA 4KGVB 3R6NA 1TUDA 4OB1B 2DD5A 4PJOE 1B34B 3LW5E 4M4ZA 1TTHB 5LJ3g 1VQOQ 1KFZA 5GANd 1TWBA 1QVGS 2DETA 5IAYA 2DX1A 3A8OB 3G71T 4GBQA 1VQ8Q 4MZTA 2JNGA 2KXCA 4RG2A 3CD6A 4P5NA 2OI3A 2YLCA 4FW2A 1BCOA 4IKFA 1RADB 1X6OA 1M1KR 3ASKA 4LDWA 1UUEA 1VQ4T 4OMPA 1UJ0A 2CT3A 3P8DA 4M78C 4J83A 4C8QB 1KSWA 3OB9A 4WCIA 4ZGEB 1IREB 1FXXA 2MWPA 3H0IA 3DKMA 5FWBA 2OTJA 1OU8A 2EQJA 2J6KA 2JMCA 1VQKQ 1GFDA 4M7AF 1YJ9T 4PFZA 2KROA 2LZ6B 4HT8A 3CCRA 1VIEA 3CCVA 5KE2A 1Q7YR 3VS7A 1KD1U 3ER0A 5GMKj 2DO3A 1B07A 2ROLA 1E6GA 2FEIA 2AZVA 2Y90A 1QVFP 2ESWA 2COYA 1Q86R 1W4SA 3M0PA 1AWJA 2GTOA 4RTTA 5FROA 3P8HA 5GAN6 1VQPQ 1M5Q1 3JCMh 1HXDA 3GNFB 3I55T 2DLPA 4JS4A 3ZFJA 4LD9K 1YI2A 2DTHA 2DEUA 4CC7A 1G2BA 4BI8B 2DIGA 2ZGWA 2MF2A 1WHHA 4M7DG 1U1SA 1WJQA 1MV0B 4E7ZA 5DM7R 4OP0A 2JZ2A 2E41A 1PM3A 2HKNA 2ZCFB 1I81A 2XKOC 1FMVA 1KHCA 2HD0A 4RCBA 3G71A 3A8LB 3BY7A 3EH1A 2LNHB 1A0NB 1OULA 4QKUA 1I4K1 3CCMT 5GAOm 1X01A 4C0DC 1M90R 3UT1A 1MMGA 1BI3A 2AIRB 3QG1A 4YTLA 4C8QA 4N0AC 4F16A 2H8HA 4PJOD 3QDFA 1ZHIA 3CCLT 1VQ7Q 2DEQA 3L2QA 1Q82C 1CKAA 4J9GA 2EKOA 4D8DA 3JB9G 4HCCA 1R0CB 2CYZB 3CMEA 1LOJA 1OX9A 1V76A 3I9QA 4J9FA 1Y71A 3CMAQ 2DXTA 2DJZA 4ATOA 3CPFA 2DL8A 4PJMA 1I5LA 4C92F 4JJDA 1YITQ 1VQ5Q 1NG2A 4M7AE 5KCOA 1H8KA 1SSHA 1BI1A 2CUBA 3E1SA 4F7UG 2WACA 3RKWA 2L5QA 1K8AU 3V7SA 3RESA 4JLIA 4QVDA 3TCJA 4M78G 3MEUA 1M8MA 3I5RA 3M56A 3L2UA 2X51A 2RF0A 1HK9A 1RAAB 2JW4A 2KSSA 2KK4A 4NOYA 3Q1JA 3EFRA 3EG0A 3G6EA 1MMDA 4XTYA 5FRNA 4MZMA 5I2SA 2YLBA 5GAN8 3CC4A 2LDMA 3OBYA 1Q81R 1VOMA 4FM4B 3I35A 1VQ6T 4ME7A 1KC8R 1WZOA 1T0HA 4AFSC 1QCFA 2EGCA 3M53A 3O8VA 1ZQ1A 4GLKA 8ATCB 3E9FA 1NLPC 4Z88A 5KCHA 3VS1A 1AEYA 1NJIR 1ZLMA 2XI9A 1AD5A 1EX4A 2SRCA 3NTHA 1D0ZA 2CT4A 2COWA 1MGQA 1Q82U 2XU8A 4BE1A 3M58A 3UA6A 5GANh 1Z9ZA 4X9DA 1UGSB 4HA8A 2JTEA 5GAMf 1RL2A 9ATCB 1I5OB 1UHCA 3A1PA 3OYCA 1M4ZA 4PKCC 1QVFS 4M7DF 1GCQC 2CDTA 4PJNA 4PJJA 3C94A 2V8IA 3FEOA 2LQWA 1WQWA 2P4TA 4PFOA 2D6FA 4HVWA 2EYZA 1VQNT 3CCJQ 4RTVA 2VGMA 2G3RA 2G6FX 2E65A 4XU3A 2VGNA 1YJWQ 4J6XA 1VIFA 3OYFA 2OX7A 4IURA 4OMFB 1VQ9T 4J9IA 4KH0B 3VS2A 4BD3A 1IZ6A 4R0KA 4GY5A 3V8KA 4M7AD 3WXMB 1WXUA 1Y0MA 1U3OA 2HKQB 2AZSA 2BE7D 2F2VA 2DF6A 3EG9A 4E7IA 4C5IA 3JB9H 1RUWA 5J3BA 2RN8A 1OI1A 1M2VB 3ME9A 2XG8D 5GJWB 3JB9F 1HYOA 2F1LA 4EDUA 2DIQA 3H41A 1WXTA 2F5KA 4M7AC 2X35A 2VXEA 2ABLA 4J9HA 3MKDA 4JRKA 1IGQA 2RJCA 5FU7C 1UGPB 1RAIB 1B7TA 3CCSA 2K7AA 4X9CA 2KY9A 2LTOA 5GMKe 2D9TA 2QEXT 3AT1B 1K9MR 2A7YA 4M75C 1WI7A 3HRSA 4F7UF 2BIVA 5GJVB 2YRCA 1T0JA 4RCCA 1H3HA 2LP5A 4J7IA 3OS5A 4M78F 2EQKA 2D1XA 1UB4A 2C0OA 1V1CA 4LUDA 4C8QG 1NJIC 1YIJT 2I0NA 1AZGB 2RD1A 1IHVA 1VQNA 4AMCA 4HT9A 3BE3A 2FZKB 3JCMP 4M7DE 1OPLA 3OQ5A 2F69A 1XTDA 2EYXA 5LJ3j 2CSIA 3QWYA 5KYYA 2EYYA 4MMKA 3PTAA 3VYHB 2NUTB 1S72Q 3C4SA 3NFCA 1F1BB 2QG9B 2RB6A 1QVGP 1KHIA 1MMNA 1OV3A 2NYSA 2WSCE 5GAMd 1SRLA 2X3WD 2OTLT 2QQRA 2W10A 1R8OB 4L59A 2D0NA 3QZ5B 4AG1C 2RM4A 2DD4A 2XICA 1ZBXA 2JXBA 1PSEA 3M0TA 3JCMg 2CZ7B 3L2ZA 2VXFA 5CAIA 1VQLA 1WA7A 4C92C 5A0GA 3J7AF 2FZGB 2KEAA 2E6NA 3JB9I 1JJ2P 1K73U 4AT1B 2H3JA 2J05A 2CP3A 4A54A 3TEEA 2O4XB 2RHXA 4J5YA 2JTFA 2RJFA 5KE3A 3EG2A 4FSXA 3CCQA 4RTZA 2X4JA 4AFZC 5D6WA 1YNZA 1XQHA 1QVFA 2ZPFB 1UDLA 2FYKA 2EJGA 5DY9A 2QASA 1MHNA 2KNBB 4F7UE 3NMZC 1WJRA 3I56T 1G3TA 1WX6A 2A28A 2DTOA 1VYVA 3THKA 1RAEB 1BKBA 4M78E 4PLIA 4M77A 2M16A 3A8GB 2DERA 1ZUYA 5IT9E 4J7FA 2M02A 2QQSA 2RMOA 2YHTA 4HCBA 3E19A 4PNOA 2XHCA 2X3XD 1WQ7A 2NUTA 3CCEQ 3CXCP 2PQWA 4MDXA 4ESRA 4M75G 1W6XA 3WVDB 2O01E 2YXYA 1VQOA 2RQRA 1KQSP 1UJYA 3JCMX 3MEAA 1ZBJA 4QQ6A 5FRMA 1OPKA 3QO3A 4M7DD 2LJ0A 4IUUA 1PC0A 1VQ8A 3EGDA 5C6SA 5IN1A 1M30A 5GAOq 3HRUA 1PWTA 1ZSZB 3FJPA 1WHMA 3CD6T 2K5IA 2LCSA 2L2PA 1K9AA 1FMWA 1ZX6A 5GAN2 1G5VA 5AT1B 4EIKA 2RO0A 3OW2P 2DVJA 4RTWA 3RUXA 1X75C 1W70A 4M7DC 1YBYA 1U1TA 2KDSA 1VQMQ 2P84A 2LCLA 5I11A 3H0HA 3X28B 1MNDA 4C0GA 2GCXA 4C8QF 1JB0E 1X6GA 2R5AA 3UA7A 5FLXE 2QDLA 3MP6A 2JM8A 2Y4XA 3ZBDA 1VQKA 2LQKA 2OTJT 1BK2A 4O5VA 2SEMA 4IIOA 3URGA 3CCRT 3JB9D 3CCVT 3R6OA 5IHNA 3HFOA 3OYDA 3OMCA 2P0KA 2X4XA 1RLPC 2FO0A 2EVRA 5HY6A 2CP7A 1VQPA 5KYWB 4C92G 4R56A 2JS2A 2A08A 4FYVB 1QCNA 1W1FA 3JRZA 1YI2T 3H6ZA 2QA4Q 3VRYA 4PJOB 3OYGA 1PKTA 3C12A 3J80E 1YFNA 2GFUA 1WJSA 3UPUA 3RMQA 2BTTA 5GANg 4M78D 1SHGA 1RLQC 2LJ3A 2XMFA 1NEGA 1ZSZA 4OVAA 2M0OA 2DL5A 4JZ3A 1WHJA 1NLOC 1E6HA 5IXFA 3M5AA 1QWFA 4A4EA 4BDYA 4JDSA 2CZ1B 1MUZA 2B8AA 3OYBA 1JJ2S 2IVWA 4KUDK 2VV5A 3KFVA 2HMAA 1VQ7A 4JLGA 1R77A 2DYBA 2ZPGB 1GRIA 1JU5C 3QBYA 1NBEB 3FLGA 3SWNB 1OZ3A 3CMET 1YJNQ 4N0AA 3CC2T 2RQTA 3CMAA 5J26A 4OMOA 3GIBA 1BIBA 3U23A 3VS0A 1PHTA 5KYUB 2RQVA 4E7KA 1W2BP 4ZN1A 5GAMh 3MP1A 2NUPB 4OB3B 4VUBA 4N4IA 2J6OA 3MEWA 1VQ5A 5LJ3e 3OBWA 1RABB 2QI2A 5KYWA 3C95A 1TXQA 2LC4A 4ORZA 2A36A 1BI0A 2E4HA 4M75F 1YHQQ 1KIKA 4KBMB 4RTUA 3H9NA 5CQYA 3CC7Q 1AOJA 4J9EA 1C1AA 4PJOA 1E7OA 2E1HA 4JJBA 3KXTA 3CXCS 4MMLA 5CO7A 3QSUA 4C5HA 2KT1A 1BCMA 5J39A 4QW2A 3NGPA 2LRQA 3HTRA 1XNIA 2EIFA 4HVUA 1KQSS 3BFMA 2FHDA 2EPDA 4A4GA 3G6ET 2KYBA 2PZ1A 1O9SA 3GNGA 3CC4T 1EIFA 1TUGB 3TQ7P 2QDYB 2HQEA 2XD0A 2CP2A 1M3AA 1UGRB 2A3LA 5FW9A 3VU3C 1BYMA 1MMAA 3SEMA 3L2WA 4BI3A 2HDAA 2HQHA 5LJ5j 5A0DA 3OW2S 3MPUB 1WNLA 2K57A 2QQ9A 1GFCA 5I22A 1JRIA 4JJCA 2LQ8A 2DBKA 4IUVA 2KAFA 3SWNA 3E9GA 2EJ9A 4OGCA 1Z9QA 3CC2A 3M9QA 1WIEA 2E3HA 4XAXB 5KYUA 3I5SA 3M0QA 1FYNA 2NUPA 1SHFA 4F04B 1M1KC 3LLRA 5I21A 1N9SA 1M1GA 4HKEA 2DL7A 2EYWA 3CCUQ 5CIUA 2DVEA 3PT9A 2PVGB 5EG2A 2AKKA 3RR6A 2HAXA 1J3TA 2CP0A 2OTJQ 3JCMW 4FYYB 2EGAA 3M57A 4FYWB 2CUDA 3TSWA 4E2FB 3CCRQ 4ZGDB 3GBQA 1IXDA 1ARKA 3SHWA 1Y57A 4M75E 3V7RA 3CCJA 3RMSA 1X6BA 1QVGA 2RH2A 1N8RR 1YJWA 4PFPA 5CQXA 2PVDB 2KGTA 1Q7YC 1M1FA 2K2VA 1S1NA 1D09B 4XTUA 3INZA 4WF2A 1I1JA 2K5LA 3HKSA 4FSSA 2QGGA 1Q86C 1H641 4GLMA 2DZCA 3V8LA 1G3SA 2EQIA 1UECA 3BDLA 3E2UA 1B3QA 1JJ2A 3EG9B 3G1JA 3OSVA 4C8QC 5FU6B 3P8BB 3G71Q 2DE0X 5KH6A 5GMKl 3HFNA 2KYMA 2FZCB 1UGQB 2QQBA 3F70A 1IHWA 1WLPB 1VQ4Q 3META 1JEGA 4IUQA 3TREA 1QCOA 2RI3A 3DB4A 1NPPA 1TH7A 2J6FA 4BE2A 1I0CA 2EGEA 3CCST 2Y4YA 2FVUA 2OAWA 1M90C 4M7AA 1YCYA 1W2BS 2VWFA 2HQXA 2DPPB 2RJDA 1YJ9Q 1M1KU 1N9RA 4HCZA 4ZTFA 4C92E 3L2VA 3CXCA 4EPCA 2XIDA 2QYZA 3RIRA 3L1AA 2DL3A 3S3MA 2O88A 4CC4B 1KQSA 1AHJB 3N5BB 1QWEA 3I55Q 3SD4A 2RJEA 2LVMA 3X25B 4FT4A 4A4FA 3OYNA 1ACMB 4J6YA 2KR3A 1SKUB 5HK0A 3HHTB 1S72A 4XQ3A 5KYYB 4J9CA 2CH4A 2MMPA 3AHUA 2VB6A 3MCAB 4RTXA 3OW2A 3LX7A
chains in the Genus database with same CATH topology
3NMZC 3VS5A 2HSPA 2C0IA 2DX1A 2D8HA 2AKLA 5FWCA 1SEMA 1WX6A 2A28A 2B86A 4GBQA 1VYVA 3THKA 1GBQA 1AVZC 2KXCA 2ECZA 1SPKA 2YUNA 2OI3A 1ZUYA 1K4US 3TVTA 1UUEA 2RMOA 4OMPA 1UJ0A 2CT3A 1GCQA 5EC7A 2X3XD 1OOTA 2DMOA 1X2KA 1KSWA 1NM7A 4JPBW 4A63B 2JS0A 3H0FA 4WCIA 2RQWA 4ESRA 1AZEA 1W6XA 2DA9A 1HD3A 3O5ZA 2RQRA 3H0IA 5FWBA 1UJYA 1FMKA 2J6KA 2JMCA 4X1VA 2RPNA 1GFDA 2KROA 1ZBJA 4IIMA 2LZ6B 1OPKA 3NHNA 1HSQA 2LJ0A 2BZXA 3VS7A 1M30A 1PWTA 2BZYA 1B07A 2ROLA 1E6GA 2FEIA 2AZVA 2GNCA 2NWMA 2HEQA 2ESWA 2LCSA 2L2PA 2EBPA 1K9AA 3M0PA 1ZUKA 1ZX6A 1AWJA 2GTOA 4RTTA 4EIKA 2DRKA 2DVJA 1T3LA 3M0UA 4RTWA 2YT6A 2DLPA 1W70A 1UGVA 1OEBA 2J06A 4CC7A 1G2BA 2O31A 2IIMA 5I11A 3H0HA 2YDLA 4DEYA 2DL4A 2LX7A 3ULRB 1MV0B 1X6GA 2PTKA 3UA7A 2KT8A 2FRWA 2QDLA 2JM8A 1JXOA 1BK2A 1VYTA 1QLYA 2FPEA 1WDXA 2SEMA 4IIOA 2LNHB 2W0ZA 2RQUA 1MV3A 4OMMA 4RTXA 1A0NB 5IHNA 1AWXA 2NUZA 4LUEA 1RLPC 2FO0A 2EVRA 1BB9A 1YN8A 4RUGA 4F16A 2JS2A 2H8HA 2A08A 1QKWA 2YUOA 1W1FA 2DRMA 2A37A 3VRYA 4E6RA 1CKAA 4J9GA 1G83A 3REAB 1IO6A 4D8DA 1PKTA 3RBBB 4F17A 3REBB 1WXBA 2BTTA 3I9QA 4J9FA 2KRNA 3JV3A 2DILA 4Z8AA 3M0SA 1SHGA 2F2XA 2CH4W 1RLQC 2LJ3A 2XMFA 1NEGA 1K76A 2K79A 2DL5A 4OMQA 4JZ3A 2MOXA 2DL8A 2KNBB 2FRYA 1PRMC 4JJDA 1NLOC 4KRTA 1E6HA 5IXFA 1NG2A 1QWFA 2MCNA 2RNAA 2FG0A 3EG1A 1H8KA 1SSHA 1K0XA 3M0RA 2F2WA 2CUBA 3PVLA 2K9GA 1MUZA 1PRLC 2DBMA 5IH2A 1PKSA 2M0YA 3KFVA 1JO8A 2HBWA 1YWOA 2DM1A 2M51A 2JMAA 1M8MA 2YUPA 3I5RA 4J9BA 2DYBA 1GRIA 2O9VA 2RF0A 1JU5C 2JW4A 1U06A 1ABQA 4RTYA 1H92A 2C0TA 3EG0A 1TUCA 2RQTA 3UF4A 4OMOA 3IQLA 1TG0A 1UTIA 3U23A 3VS0A 1PHTA 2RQVA 1YCSB 2EW3A 4HXJA 3I35A 1ZSGA 5L23A 2J6OA 4HCKA 2OJ2A 1T0HA 1K1ZA 2ROTA 4AFSC 4AG2C 1QCFA 3CQTA 4Z89A 2EGCA 4ORZA 2A36A 1KIKA 1BU1A 2P4RA 4RTUA 2CSQA 5IXBA 1EFNA 1AOJA 4J9EA 1N5ZA 1T3SA 1E7OA 1NLPC 1AWWA 4JJBA 4Z88A 1NYFA 3VS1A 1AEYA 2KT1A 1ZLMA 1AD5A 3NGPA 2SRCA 2CREA 1RI9A 1UHFA 2L3QA 2CT4A 2FPFA 1NYGA 4HVUA 4Y92A 2EPDA 2KYBA 3UA6A 2PZ1A 1Z9ZA 3TSZA 5IHIA 4K11A 2JTEA 5ECAA 2EKHA 4F14A 1UHCA 1M3AA 5FW9A 2ED1A 4CC2A 3SEMA 2GTJA 2KXDA 2JT4A 2HDAA 1GCQC 2CDTA 1ZUUA 2LQWA 4CC3A 1QKXA 1GFCA 5I22A 2LQNA 4HVWA 2EYZA 4AFUC 4JJCA 2DBKA 2J7IA 1GL5A 4RTVA 4LN2A 1X69A 2G6FX 2V1QA 1Z9QA 4J9IA 3VS2A 1WIEA 2L3PA 3I5SA 3M0QA 4ZNXA 4R0KA 2LMJA 3NPFA 1FYNA 1YP5A 1SHFA 1WXUA 2E5KA 1Y0MA 1U3OA 1VA7A 2AZSA 2DL7A 2EYWA 1PNJA 2F2VA 3EHQA 3VS3A 2DF6A 1WFWA 2VKNA 3ZL7C 4QT7A 3VS6A 2K2MA 1BBZA 2AKKA 2O9SA 2BZ8A 1NEBA 1U5SA 1J3TA 1RUWA 1GBRA 2RN8A 1CKBA 2O2OA 2EGAA 4J9DA 5GJWB 3UATA 2CUDA 4HVVA 3TSWA 3H41A 1WXTA 1WYXA 2ABLA 2KE9A 3GBQA 3PVQA 4J9HA 1ARKA 3SHWA 1Y57A 1GCPA 1VYUA 2KBTA 3VRZA 1X6BA 3EHRA 3FJ5A 2AK5A 4LE9A 1X27A 2KGTA 2KRMA 2K7AA 4OMNA 1AWOA 1S1NA 3A98A 1X43A 1X2QA 3EG3A 1I07A 1I1JA 1M3CA 1WI7A 1JXMA 4FSSA 5GJVB 1T0JA 2L0AA 4GLMA 2V1RA 1M3BA 1H3HA 2LP5A 2EQIA 4OMLA 1UECA 2DJQA 1B3QA 1JQQA 2K6DA 4LNPA 4DEXA 2D1XA 2C0OA 1V1CA 2DE0X 4LUDA 2I0NA 2KYMA 1AZGB 1XOVA 2L3SA 1OPLA 3C0CA 1UE9A 1WLPB 1JEGA 1K0SA 2HCKA 2EYXA 2J6FA 2CSIA 1I0CA 2EGEA 1LCKA 3QWYA 2K3BA 2OAWA 1SRMA 2MIOA 2EYYA 2FPDA 2VWFA 2YUQA 1HJDA 1OV3A 1SRLA 2X3WD 2JM9A 2W10A 3QWXX 3LH5A 2D0NA 4AFQC 4JZ4A 4AG1C 2YSQA 3PE0A 1KJWA 2DL3A 2GGRA 2JXBA 3M0TA 2O88A 4CC4B 1YWPA 2ENMA 1WA7A 5HCKA 2GQIA 2PNIA 3RNJA 1UFFA 1QWEA 2DNUA 2KEAA 1UG1A 3EGUA 2J05A 2KRSA 3VS4A 3EG2A 5IHKA 2KR3A 2VVKA 1M27C 4RTZA 3R6NA 1TUDA 2LJ1A 4AFZC 1YNZA 4J9CA 2CH4A 1UDLA 4M4ZA 1CSKA 1ABOA 1KFZA 2D8JA 4D8KA 2GBQA 2ED0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NMZ C;  3VS5 A;  2HSP A;  2C0I A;  2DX1 A;  2D8H A;  2AKL A;  5FWC A;  1SEM A;  1WX6 A;  2A28 A;  2B86 A;  4GBQ A;  1VYV A;  3THK A;  1GBQ A;  1AVZ C;  2KXC A;  2ECZ A;  1SPK A;  2YUN A;  2OI3 A;  1ZUY A;  1K4U S;  3TVT A;  1UUE A;  2RMO A;  4OMP A;  1UJ0 A;  2CT3 A;  1GCQ A;  5EC7 A;  2X3X D;  1OOT A;  2DMO A;  1X2K A;  1KSW A;  1NM7 A;  4JPB W;  4A63 B;  2JS0 A;  3H0F A;  4WCI A;  2RQW A;  4ESR A;  1AZE A;  1W6X A;  2DA9 A;  1HD3 A;  3O5Z A;  2RQR A;  3H0I A;  5FWB A;  1UJY A;  1FMK A;  2J6K A;  2JMC A;  4X1V A;  2RPN A;  1GFD A;  2KRO A;  1ZBJ A;  4IIM A;  2LZ6 B;  1OPK A;  3NHN A;  1HSQ A;  2LJ0 A;  2BZX A;  3VS7 A;  1M30 A;  1PWT A;  2BZY A;  1B07 A;  2ROL A;  1E6G A;  2FEI A;  2AZV A;  2GNC A;  2NWM A;  2HEQ A;  2ESW A;  2LCS A;  2L2P A;  2EBP A;  1K9A A;  3M0P A;  1ZUK A;  1ZX6 A;  1AWJ A;  2GTO A;  4RTT A;  4EIK A;  2DRK A;  2DVJ A;  1T3L A;  3M0U A;  4RTW A;  2YT6 A;  2DLP A;  1W70 A;  1UGV A;  1OEB A;  2J06 A;  4CC7 A;  1G2B A;  2O31 A;  2IIM A;  5I11 A;  3H0H A;  2YDL A;  4DEY A;  2DL4 A;  2LX7 A;  3ULR B;  1MV0 B;  1X6G A;  2PTK A;  3UA7 A;  2KT8 A;  2FRW A;  2QDL A;  2JM8 A;  1JXO A;  1BK2 A;  1VYT A;  1QLY A;  2FPE A;  1WDX A;  2SEM A;  4IIO A;  2LNH B;  2W0Z A;  2RQU A;  1MV3 A;  4OMM A;  4RTX A;  1A0N B;  5IHN A;  1AWX A;  2NUZ A;  4LUE A;  1RLP C;  2FO0 A;  2EVR A;  1BB9 A;  1YN8 A;  4RUG A;  4F16 A;  2JS2 A;  2H8H A;  2A08 A;  1QKW A;  2YUO A;  1W1F A;  2DRM A;  2A37 A;  3VRY A;  4E6R A;  1CKA A;  4J9G A;  1G83 A;  3REA B;  1IO6 A;  4D8D A;  1PKT A;  3RBB B;  4F17 A;  3REB B;  1WXB A;  2BTT A;  3I9Q A;  4J9F A;  2KRN A;  3JV3 A;  2DIL A;  4Z8A A;  3M0S A;  1SHG A;  2F2X A;  2CH4 W;  1RLQ C;  2LJ3 A;  2XMF A;  1NEG A;  1K76 A;  2K79 A;  2DL5 A;  4OMQ A;  4JZ3 A;  2MOX A;  2DL8 A;  2KNB B;  2FRY A;  1PRM C;  4JJD A;  1NLO C;  4KRT A;  1E6H A;  5IXF A;  1NG2 A;  1QWF A;  2MCN A;  2RNA A;  2FG0 A;  3EG1 A;  1H8K A;  1SSH A;  1K0X A;  3M0R A;  2F2W A;  2CUB A;  3PVL A;  2K9G A;  1MUZ A;  1PRL C;  2DBM A;  5IH2 A;  1PKS A;  2M0Y A;  3KFV A;  1JO8 A;  2HBW A;  1YWO A;  2DM1 A;  2M51 A;  2JMA A;  1M8M A;  2YUP A;  3I5R A;  4J9B A;  2DYB A;  1GRI A;  2O9V A;  2RF0 A;  1JU5 C;  2JW4 A;  1U06 A;  1ABQ A;  4RTY A;  1H92 A;  2C0T A;  3EG0 A;  1TUC A;  2RQT A;  3UF4 A;  4OMO A;  3IQL A;  1TG0 A;  1UTI A;  3U23 A;  3VS0 A;  1PHT A;  2RQV A;  1YCS B;  2EW3 A;  4HXJ A;  3I35 A;  1ZSG A;  5L23 A;  2J6O A;  4HCK A;  2OJ2 A;  1T0H A;  1K1Z A;  2ROT A;  4AFS C;  4AG2 C;  1QCF A;  3CQT A;  4Z89 A;  2EGC A;  4ORZ A;  2A36 A;  1KIK A;  1BU1 A;  2P4R A;  4RTU A;  2CSQ A;  5IXB A;  1EFN A;  1AOJ A;  4J9E A;  1N5Z A;  1T3S A;  1E7O A;  1NLP C;  1AWW A;  4JJB A;  4Z88 A;  1NYF A;  3VS1 A;  1AEY A;  2KT1 A;  1ZLM A;  1AD5 A;  3NGP A;  2SRC A;  2CRE A;  1RI9 A;  1UHF A;  2L3Q A;  2CT4 A;  2FPF A;  1NYG A;  4HVU A;  4Y92 A;  2EPD A;  2KYB A;  3UA6 A;  2PZ1 A;  1Z9Z A;  3TSZ A;  5IHI A;  4K11 A;  2JTE A;  5ECA A;  2EKH A;  4F14 A;  1UHC A;  1M3A A;  5FW9 A;  2ED1 A;  4CC2 A;  3SEM A;  2GTJ A;  2KXD A;  2JT4 A;  2HDA A;  1GCQ C;  2CDT A;  1ZUU A;  2LQW A;  4CC3 A;  1QKX A;  1GFC A;  5I22 A;  2LQN A;  4HVW A;  2EYZ A;  4AFU C;  4JJC A;  2DBK A;  2J7I A;  1GL5 A;  4RTV A;  4LN2 A;  1X69 A;  2G6F X;  2V1Q A;  1Z9Q A;  4J9I A;  3VS2 A;  1WIE A;  2L3P A;  3I5S A;  3M0Q A;  4ZNX A;  4R0K A;  2LMJ A;  3NPF A;  1FYN A;  1YP5 A;  1SHF A;  1WXU A;  2E5K A;  1Y0M A;  1U3O A;  1VA7 A;  2AZS A;  2DL7 A;  2EYW A;  1PNJ A;  2F2V A;  3EHQ A;  3VS3 A;  2DF6 A;  1WFW A;  2VKN A;  3ZL7 C;  4QT7 A;  3VS6 A;  2K2M A;  1BBZ A;  2AKK A;  2O9S A;  2BZ8 A;  1NEB A;  1U5S A;  1J3T A;  1RUW A;  1GBR A;  2RN8 A;  1CKB A;  2O2O A;  2EGA A;  4J9D A;  5GJW B;  3UAT A;  2CUD A;  4HVV A;  3TSW A;  3H41 A;  1WXT A;  1WYX A;  2ABL A;  2KE9 A;  3GBQ A;  3PVQ A;  4J9H A;  1ARK A;  3SHW A;  1Y57 A;  1GCP A;  1VYU A;  2KBT A;  3VRZ A;  1X6B A;  3EHR A;  3FJ5 A;  2AK5 A;  4LE9 A;  1X27 A;  2KGT A;  2KRM A;  2K7A A;  4OMN A;  1AWO A;  1S1N A;  3A98 A;  1X43 A;  1X2Q A;  3EG3 A;  1I07 A;  1I1J A;  1M3C A;  1WI7 A;  1JXM A;  4FSS A;  5GJV B;  1T0J A;  2L0A A;  4GLM A;  2V1R A;  1M3B A;  1H3H A;  2LP5 A;  2EQI A;  4OML A;  1UEC A;  2DJQ A;  1B3Q A;  1JQQ A;  2K6D A;  4LNP A;  4DEX A;  2D1X A;  2C0O A;  1V1C A;  2DE0 X;  4LUD A;  2I0N A;  2KYM A;  1AZG B;  1XOV A;  2L3S A;  1OPL A;  3C0C A;  1UE9 A;  1WLP B;  1JEG A;  1K0S A;  2HCK A;  2EYX A;  2J6F A;  2CSI A;  1I0C A;  2EGE A;  1LCK A;  3QWY A;  2K3B A;  2OAW A;  1SRM A;  2MIO A;  2EYY A;  2FPD A;  2VWF A;  2YUQ A;  1HJD A;  1OV3 A;  1SRL A;  2X3W D;  2JM9 A;  2W10 A;  3QWX X;  3LH5 A;  2D0N A;  4AFQ C;  4JZ4 A;  4AG1 C;  2YSQ A;  3PE0 A;  1KJW A;  2DL3 A;  2GGR A;  2JXB A;  3M0T A;  2O88 A;  4CC4 B;  1YWP A;  2ENM A;  1WA7 A;  5HCK A;  2GQI A;  2PNI A;  3RNJ A;  1UFF A;  1QWE A;  2DNU A;  2KEA A;  1UG1 A;  3EGU A;  2J05 A;  2KRS A;  3VS4 A;  3EG2 A;  5IHK A;  2KR3 A;  2VVK A;  1M27 C;  4RTZ A;  3R6N A;  1TUD A;  2LJ1 A;  4AFZ C;  1YNZ A;  4J9C A;  2CH4 A;  1UDL A;  4M4Z A;  1CSK A;  1ABO A;  1KFZ A;  2D8J A;  4D8K A;  2GBQ A;  2ED0 A; 
#chains in the Genus database with same CATH topology
 2X9H A;  1Q86 U;  3RER A;  2RHI A;  1NZ9 A;  3VS5 A;  4OB0 B;  2C0I A;  1PG5 B;  4M75 D;  2D8H A;  1SEM A;  2E3I A;  2B86 A;  4Z02 A;  1N8R C;  4R55 A;  1GBQ A;  3CCM Q;  1AVZ C;  4FU6 A;  2ECZ A;  1SPK A;  2YUN A;  1G3Y A;  2D0Q B;  3S3N A;  1K4U S;  2JN0 A;  4LDX A;  1VQL T;  4EMG A;  1Q81 C;  5EC7 A;  1OOT A;  1KC8 C;  3CCL Q;  2JS0 A;  2CKK A;  3CCQ T;  1AZE A;  5LJ5 d;  2LT1 A;  4B6M A;  2DA9 A;  2COZ A;  1M90 U;  4ELZ C;  1FMK A;  4X1V A;  2RPN A;  2KQW A;  4IIM A;  3NHN A;  1HSQ A;  2BZX A;  4EMK B;  4J8O A;  2BZY A;  1RAF B;  2NWM A;  3DB3 A;  4XK8 E;  4EMH A;  1VUB A;  1OU9 A;  2HEQ A;  5CKE A;  4M77 B;  2EBP A;  3PFS A;  2RA2 A;  2C06 A;  1QVP A;  2PU9 B;  2WSF E;  1UGV A;  5GAN j;  3CCE A;  1OEB A;  4XTX A;  2J06 A;  3NTI A;  4BY6 B;  4II1 A;  3QYH B;  3LYI A;  2YDL A;  3M55 A;  4DEY A;  4DOV A;  4E7H A;  1QP2 A;  2DL4 A;  3QYG B;  5LJ5 e;  3ULR B;  5D6X A;  3JCM J;  5GMK i;  2PTK A;  1RAG B;  4C92 D;  2KT8 A;  4KUL A;  4PJL A;  1RI0 A;  1VQO T;  2RHU A;  3LGF A;  1SF9 A;  5GAM g;  1QQJ A;  3UDC A;  2JUF A;  1VYT A;  3VUB A;  1QLY A;  1WDX A;  4DQ2 A;  1VQ6 Q;  4E7L A;  1MV3 A;  2CP5 A;  1VQ8 T;  5LL6 S;  2E6Z A;  4JRI A;  3EGD B;  2OAU A;  4FT2 A;  2XDD A;  3EH2 A;  4XU1 A;  2E64 A;  1KG1 A;  2LCC A;  3QPH A;  1YN8 A;  1RAH B;  4ZTJ A;  4RUG A;  4RKU E;  2VUB A;  2XK0 A;  1W2B A;  1QKW A;  1KD1 R;  2YUO A;  1VQM A;  5HKC A;  2A37 A;  1Q81 U;  3REA B;  3OS0 A;  1IO6 A;  1KC8 U;  3RBB B;  3A8H B;  5D6Y A;  1D3B B;  4E47 A;  4F17 A;  1WXB A;  4XTW A;  4QVZ A;  1WPY A;  2DXU A;  2PUO B;  4Z8A A;  3M0S A;  3G4S A;  4EMK A;  1VQK T;  5LJ3 f;  2F2X A;  2EQU A;  4M7D A;  3L42 A;  3M59 A;  4M78 B;  4OMQ A;  3J81 E;  1QW1 A;  2MOX A;  4JRQ A;  2PUK B;  1PRM C;  3MP8 A;  5CR2 A;  5GAO p;  2MCN A;  2KMT A;  2FG0 A;  1NJI U;  4XTV A;  2KI7 A;  1K9M C;  3OA6 A;  1K0X A;  2L3R A;  1PRL C;  2DBM A;  3SB2 A;  1VQP T;  1PKS A;  2M0Y A;  3OYL A;  2VAS A;  1JO8 A;  4MDW A;  2HBW A;  1YWO A;  4OGE A;  2QA4 A;  2DM1 A;  1VQN Q;  1LPL A;  2JMA A;  2FB7 A;  3JCM e;  2O9V A;  1SG5 A;  5HK3 A;  1U06 A;  1VQ9 Q;  1G3W A;  4RTY A;  3L2R A;  2C0T A;  1TUC A;  3UF4 A;  3IQL A;  1TG0 A;  1UTI A;  1YCS B;  2QQA A;  4HXJ A;  1ZSG A;  2JVV A;  5L23 A;  4Y91 A;  1P92 A;  1DJ7 B;  1WHG A;  2ROT A;  4JRP A;  3PIO A;  4Z89 A;  2RI5 A;  3JCM c;  2P4R A;  2CSQ A;  1EFN A;  4TVR A;  1AWW A;  1O75 A;  4JJN K;  1VQ7 T;  1D3B A;  5GMK h;  2I2L A;  1PCX A;  3QUI A;  4F7U A;  2JTM A;  2RHZ A;  1RI9 A;  1VQL Q;  2L3Q A;  3WVE B;  1NYG A;  4C0D B;  4FL6 A;  1YJN A;  1K8A R;  4Y92 A;  1TSF A;  2QEX Q;  4M78 A;  3CMA T;  2HBP A;  4OF1 A;  5IHI A;  3HSB A;  3CPW P;  3H8Z A;  5CKD A;  5M9O A;  2BE9 B;  2ED1 A;  2M9U A;  1VQ5 T;  1BI2 A;  2GTJ A;  2KXD A;  2ZPI B;  2EWN A;  1KK7 A;  2A0F B;  3CC7 A;  3KUF A;  1YIJ Q;  4WTO B;  4CC3 A;  1QKX A;  4OB2 B;  4JUV A;  2ATC B;  3QDR B;  2LQN A;  4FCY A;  3CBP A;  4QVC A;  4J6W A;  2V1Q A;  5KYX B;  1G8X A;  2HL5 C;  2L3P A;  2K3X A;  5LJ5 h;  5CVI A;  4ZNX A;  2LMJ A;  4IUP A;  3DLM A;  2QXF A;  4PL6 A;  2E5K A;  1KQ1 A;  3OYA A;  3HRT A;  1PNJ A;  1WFW A;  5LJ3 d;  3VS6 A;  1PD0 A;  2K2M A;  2O9S A;  2BZ8 A;  1U5S A;  1Q82 R;  1GBR A;  4XU2 A;  2OTL Q;  1M9S A;  2O2O A;  4KH1 B;  1D0X A;  3UAT A;  4RG8 A;  2CP6 A;  3UWN A;  3T9N A;  5GAO n;  1WYX A;  4BB7 A;  2KE9 A;  3PVQ A;  4BUG A;  2KBT A;  3OYK A;  2IG0 A;  3EHR A;  3QJY A;  4FW1 A;  2LT4 A;  3V7C A;  4LE9 A;  2BUD A;  2RK1 A;  1X27 A;  3SFM A;  3PNW C;  4OMN A;  1AWO A;  3A98 A;  4O6J A;  1X43 A;  2V8J A;  1X2Q A;  3EG3 A;  3VKI A;  1I07 A;  1JXM A;  4C8Q E;  2VYT A;  3MO8 A;  2HL3 A;  2L0A A;  3CCU A;  2V1R A;  1YIT A;  1M3B A;  2PVO B;  3OS2 A;  1JQQ A;  3S6W A;  2K6D A;  4LNP A;  5GAN e;  3I56 Q;  2V26 A;  3PGG A;  4A4H A;  4Y28 E;  2X4W A;  4NS5 A;  5GAN 4;  2HNI A;  2XDP A;  4IUT A;  5KYX A;  1XOV A;  1K8A C;  1D1C A;  3C0C A;  2DXC A;  3CCJ T;  2R57 A;  4N4H A;  1IGU A;  1C0M A;  1YJW T;  4PK4 A;  3VUZ A;  1K0S A;  1LCK A;  1ZSZ C;  2EQM A;  1SRM A;  3DLL A;  2MIO A;  3LWI A;  2MI6 A;  1B34 A;  3MJX A;  3LGL A;  3OYJ A;  4CI0 C;  1I8F A;  5D7U A;  2YRV A;  4M77 G;  1HJD A;  3EGX B;  2HSE B;  2X4Y A;  5CK9 A;  2MAM A;  3QWX X;  3LH5 A;  2JJ9 A;  4DBH A;  3GLX A;  2DXB A;  4DBR A;  2E5Q A;  2DKG A;  2GQV A;  3HL8 A;  1EZZ B;  3CD6 Q;  5I2M A;  1YWP A;  1OX8 A;  1OZ2 A;  2GQI A;  3FDR A;  5HCK A;  1VQ4 A;  2QK0 A;  1R0B G;  2R58 A;  2LX9 A;  4ELY C;  3VS4 A;  2RK2 A;  2VVK A;  1M27 C;  2LJ1 A;  3CPW S;  4M7A B;  3JB9 J;  8AT1 B;  3CBM A;  2JOY A;  1CSK A;  1ABO A;  2D8J A;  1YJ9 A;  4D8K A;  2GBQ A;  2ED0 A;  4BE0 A;  3VJP A;  2HSP A;  1OYX A;  2L89 A;  5FU7 B;  4LD6 A;  4FYX B;  4PJO C;  2AKL A;  5FWC A;  3CCV Q;  2R5M A;  4M75 B;  2EAY A;  1ZA2 B;  1M2O A;  3G7Z A;  3TVT A;  4KUI A;  4C8Q D;  2MYS A;  3I55 A;  1H3Z A;  1U8R A;  1GCQ A;  4BDZ A;  5LJ5 f;  2DMO A;  1X2K A;  4C0Z A;  1NM7 A;  4JPB W;  1YI2 Q;  4A63 B;  1ZA1 B;  3H0F A;  5GAO r;  5GAM j;  2RQW A;  5DLO A;  2E10 A;  3EGX A;  1HD3 A;  1S72 T;  3O5Z A;  2P0P A;  1K73 R;  5CKB A;  2DZ9 A;  4L6V 5;  1D1B A;  4DOW A;  5C0M A;  4DBQ A;  4FIB A;  3BW1 A;  3X24 B;  3NTK A;  2L8D A;  2YRD A;  1IRX A;  2CZ0 B;  3QII A;  3CCM A;  3VYG A;  2Z0W A;  4KGZ B;  2GNC A;  3SWN C;  3S3O A;  4XU0 A;  1ZUK A;  3GF5 A;  2QGF B;  1KQ2 A;  2ZPB B;  2DRK A;  3VV0 A;  7AT1 B;  5AYF A;  1T3L A;  3M0U A;  2YT6 A;  3EFS A;  2CS7 A;  3CCL A;  3RKY A;  2O31 A;  2IIM A;  4XTZ A;  4A53 A;  4CRI A;  3TU4 K;  2LX7 A;  2XDB A;  3MHX A;  4NL2 A;  4ZGJ B;  2DYI A;  2FRW A;  3CME Q;  4RMO A;  3CC2 Q;  1JXO A;  1NE8 A;  1QMC A;  4C92 B;  5LJ3 h;  4M75 A;  2MK5 A;  2FPE A;  2DTI A;  3OYY A;  1AT1 B;  2W0Z A;  2RQU A;  5GAN 3;  4OMM A;  3JCM Q;  3OYH A;  1AWX A;  1OQK A;  2NUZ A;  2DAQ A;  3M4Y A;  4LUE A;  2WSE E;  3HP9 A;  4PLL A;  1BB9 A;  2K4Y A;  4Q5W A;  1JBM A;  3JCM f;  2CZ6 B;  4M77 F;  3OY9 A;  2NLU A;  4L5G A;  2DRM A;  3CCE T;  1Q7Y U;  4E6R A;  1G83 A;  4QQD A;  3REB B;  2E70 A;  3X26 B;  2KRN A;  3JV3 A;  2DIL A;  3G6E Q;  2CH4 W;  3ZEH A;  1K76 A;  3CC4 Q;  2K79 A;  1VQ6 A;  2FRY A;  3PMT A;  4PJO G;  3GPL A;  4KRT A;  4E7S A;  2QTV A;  2RNA A;  3EG1 A;  1LNX A;  1V29 B;  3FC3 A;  3M0R A;  2F2W A;  2RHY A;  3PVL A;  2K9G A;  4C5E A;  5IH2 A;  1PSF A;  1Y7X A;  5GAN 7;  5CKF A;  4NL3 A;  3M54 A;  3CPW A;  2M51 A;  1K73 C;  2LNV A;  2YUP A;  1VQM T;  4J9B A;  4BI4 A;  6AT1 B;  1D1A A;  5LJ5 g;  1RAC B;  1ABQ A;  4C92 A;  3OMG A;  4C5G A;  1FWZ A;  3EFO B;  1H92 A;  1QP3 A;  3OYE A;  3G4S T;  3RDV A;  2MPX C;  4B9W A;  1WHK A;  2DFU A;  2EW3 A;  3OYI A;  4M7D B;  1LVK A;  2HZY A;  4HCK A;  2OJ2 A;  1K1Z A;  3D7S B;  4AG2 C;  3CQT A;  2ZPH B;  3SDZ A;  1BU1 A;  1PD1 A;  2IPO B;  5IXB A;  3QKJ A;  3LH0 A;  1N5Z A;  1T3S A;  4LDV A;  2AT1 B;  4A4K A;  1NYF A;  3X20 B;  3QHS A;  4LDU A;  2VC8 A;  2QA4 T;  5FU6 C;  2CRE A;  5CKH A;  4DA4 A;  3FIF A;  1C6V X;  1UHF A;  3KBG A;  2FL7 A;  2FPF A;  1VQ9 A;  4M77 E;  4JS5 A;  4E7J A;  4UC4 A;  1TU0 B;  4V2S A;  1TOV A;  3TSZ A;  4K11 A;  3OS1 A;  3EAE A;  1WGS A;  1XJW B;  5ECA A;  2EKH A;  2GFA A;  4F14 A;  2YWW A;  1M2V A;  4CC2 A;  1N8R U;  3MEV A;  2JT4 A;  1N6A A;  1ZUU A;  5A0L A;  1UEB A;  5CCA A;  2RI2 A;  2AHJ B;  1BIA A;  4X34 A;  4AFU C;  2V8K A;  1N27 A;  3JCM d;  2J7I A;  1GL5 A;  4LN2 A;  1X69 A;  3EFO A;  3JAM E;  5L8R E;  3LWH A;  4F7U B;  4QQG A;  1Y96 B;  2QEX A;  3FB9 A;  4KGX B;  4B9X A;  3CCS Q;  2M1H A;  5GAO l;  3OYM A;  1YJN T;  3A8M B;  3NPF A;  1YP5 A;  3CBO A;  2MWO A;  5GAN f;  5KYN A;  3JCM b;  2EYQ A;  1VA7 A;  1SSF A;  2EJF A;  2GF7 A;  3EHQ A;  3VS3 A;  2VKN A;  3ZL7 C;  4QT7 A;  3QXE B;  1BBZ A;  1WHL A;  1NEB A;  1CKB A;  5GAM e;  1YHQ T;  4J9D A;  1M8V A;  1YIJ A;  4HVV A;  3CC7 T;  3JSC A;  2DK3 A;  4DBF A;  4N4G A;  2ZZD A;  5DLQ E;  1Y07 A;  1GCP A;  4M7A G;  1VYU A;  3VRZ A;  1D0Y A;  3FJ5 A;  5GMK m;  3BDU A;  2AK5 A;  1LJO A;  4PJO F;  2KRM A;  1IB8 A;  3JCM V;  1GXI E;  2K5F A;  1NPR A;  4BAC A;  1M3C A;  2ZAE A;  3A5Z B;  2H3E B;  4OML A;  2DJQ A;  4DEX A;  2CGH A;  2OTL A;  2KVQ G;  3GOX A;  2K3Y A;  2E12 A;  4M77 D;  2L3S A;  4C0F A;  2BKD N;  3FRN A;  1Y96 A;  4KT0 E;  1MNE A;  1UE9 A;  5GAN 5;  2O4X A;  3M4G A;  2HCK A;  3V8J A;  4EMK C;  2K3B A;  4MZP A;  3CCQ Q;  2P0Q A;  4M77 C;  2FPD A;  4LXC A;  2ZPE B;  3PMI A;  2F5T X;  2YUQ A;  3CCU T;  1YIT T;  1KD1 C;  1YHQ A;  3RKX A;  1TS9 A;  3I56 A;  2JM9 A;  4BY6 C;  3G4S Q;  4AFQ C;  3QJ6 A;  1K9M U;  1FX7 A;  4JZ4 A;  3QZ9 B;  2YSQ A;  3PE0 A;  4D6W A;  1KJW A;  2GGR A;  3CEY A;  3GP8 A;  3PIP A;  1Q95 G;  2EFI A;  2ENM A;  2QAZ A;  3OSS C;  2PNI A;  3RNJ A;  1UFF A;  2DNU A;  5A2Q E;  4LDY A;  3HPW A;  1UG1 A;  3EGU A;  2KRS A;  4ZN3 A;  4ANJ A;  5IHK A;  2QTX A;  4KGV B;  3R6N A;  1TUD A;  4OB1 B;  2DD5 A;  4PJO E;  1B34 B;  3LW5 E;  4M4Z A;  1TTH B;  5LJ3 g;  1VQO Q;  1KFZ A;  5GAN d;  1TWB A;  1QVG S;  2DET A;  5IAY A;  2DX1 A;  3A8O B;  3G71 T;  4GBQ A;  1VQ8 Q;  4MZT A;  2JNG A;  2KXC A;  4RG2 A;  3CD6 A;  4P5N A;  2OI3 A;  2YLC A;  4FW2 A;  1BCO A;  4IKF A;  1RAD B;  1X6O A;  1M1K R;  3ASK A;  4LDW A;  1UUE A;  1VQ4 T;  4OMP A;  1UJ0 A;  2CT3 A;  3P8D A;  4M78 C;  4J83 A;  4C8Q B;  1KSW A;  3OB9 A;  4WCI A;  4ZGE B;  1IRE B;  1FXX A;  2MWP A;  3H0I A;  3DKM A;  5FWB A;  2OTJ A;  1OU8 A;  2EQJ A;  2J6K A;  2JMC A;  1VQK Q;  1GFD A;  4M7A F;  1YJ9 T;  4PFZ A;  2KRO A;  2LZ6 B;  4HT8 A;  3CCR A;  1VIE A;  3CCV A;  5KE2 A;  1Q7Y R;  3VS7 A;  1KD1 U;  3ER0 A;  5GMK j;  2DO3 A;  1B07 A;  2ROL A;  1E6G A;  2FEI A;  2AZV A;  2Y90 A;  1QVF P;  2ESW A;  2COY A;  1Q86 R;  1W4S A;  3M0P A;  1AWJ A;  2GTO A;  4RTT A;  5FRO A;  3P8H A;  5GAN 6;  1VQP Q;  1M5Q 1;  3JCM h;  1HXD A;  3GNF B;  3I55 T;  2DLP A;  4JS4 A;  3ZFJ A;  4LD9 K;  1YI2 A;  2DTH A;  2DEU A;  4CC7 A;  1G2B A;  4BI8 B;  2DIG A;  2ZGW A;  2MF2 A;  1WHH A;  4M7D G;  1U1S A;  1WJQ A;  1MV0 B;  4E7Z A;  5DM7 R;  4OP0 A;  2JZ2 A;  2E41 A;  1PM3 A;  2HKN A;  2ZCF B;  1I81 A;  2XKO C;  1FMV A;  1KHC A;  2HD0 A;  4RCB A;  3G71 A;  3A8L B;  3BY7 A;  3EH1 A;  2LNH B;  1A0N B;  1OUL A;  4QKU A;  1I4K 1;  3CCM T;  5GAO m;  1X01 A;  4C0D C;  1M90 R;  3UT1 A;  1MMG A;  1BI3 A;  2AIR B;  3QG1 A;  4YTL A;  4C8Q A;  4N0A C;  4F16 A;  2H8H A;  4PJO D;  3QDF A;  1ZHI A;  3CCL T;  1VQ7 Q;  2DEQ A;  3L2Q A;  1Q82 C;  1CKA A;  4J9G A;  2EKO A;  4D8D A;  3JB9 G;  4HCC A;  1R0C B;  2CYZ B;  3CME A;  1LOJ A;  1OX9 A;  1V76 A;  3I9Q A;  4J9F A;  1Y71 A;  3CMA Q;  2DXT A;  2DJZ A;  4ATO A;  3CPF A;  2DL8 A;  4PJM A;  1I5L A;  4C92 F;  4JJD A;  1YIT Q;  1VQ5 Q;  1NG2 A;  4M7A E;  5KCO A;  1H8K A;  1SSH A;  1BI1 A;  2CUB A;  3E1S A;  4F7U G;  2WAC A;  3RKW A;  2L5Q A;  1K8A U;  3V7S A;  3RES A;  4JLI A;  4QVD A;  3TCJ A;  4M78 G;  3MEU A;  1M8M A;  3I5R A;  3M56 A;  3L2U A;  2X51 A;  2RF0 A;  1HK9 A;  1RAA B;  2JW4 A;  2KSS A;  2KK4 A;  4NOY A;  3Q1J A;  3EFR A;  3EG0 A;  3G6E A;  1MMD A;  4XTY A;  5FRN A;  4MZM A;  5I2S A;  2YLB A;  5GAN 8;  3CC4 A;  2LDM A;  3OBY A;  1Q81 R;  1VOM A;  4FM4 B;  3I35 A;  1VQ6 T;  4ME7 A;  1KC8 R;  1WZO A;  1T0H A;  4AFS C;  1QCF A;  2EGC A;  3M53 A;  3O8V A;  1ZQ1 A;  4GLK A;  8ATC B;  3E9F A;  1NLP C;  4Z88 A;  5KCH A;  3VS1 A;  1AEY A;  1NJI R;  1ZLM A;  2XI9 A;  1AD5 A;  1EX4 A;  2SRC A;  3NTH A;  1D0Z A;  2CT4 A;  2COW A;  1MGQ A;  1Q82 U;  2XU8 A;  4BE1 A;  3M58 A;  3UA6 A;  5GAN h;  1Z9Z A;  4X9D A;  1UGS B;  4HA8 A;  2JTE A;  5GAM f;  1RL2 A;  9ATC B;  1I5O B;  1UHC A;  3A1P A;  3OYC A;  1M4Z A;  4PKC C;  1QVF S;  4M7D F;  1GCQ C;  2CDT A;  4PJN A;  4PJJ A;  3C94 A;  2V8I A;  3FEO A;  2LQW A;  1WQW A;  2P4T A;  4PFO A;  2D6F A;  4HVW A;  2EYZ A;  1VQN T;  3CCJ Q;  4RTV A;  2VGM A;  2G3R A;  2G6F X;  2E65 A;  4XU3 A;  2VGN A;  1YJW Q;  4J6X A;  1VIF A;  3OYF A;  2OX7 A;  4IUR A;  4OMF B;  1VQ9 T;  4J9I A;  4KH0 B;  3VS2 A;  4BD3 A;  1IZ6 A;  4R0K A;  4GY5 A;  3V8K A;  4M7A D;  3WXM B;  1WXU A;  1Y0M A;  1U3O A;  2HKQ B;  2AZS A;  2BE7 D;  2F2V A;  2DF6 A;  3EG9 A;  4E7I A;  4C5I A;  3JB9 H;  1RUW A;  5J3B A;  2RN8 A;  1OI1 A;  1M2V B;  3ME9 A;  2XG8 D;  5GJW B;  3JB9 F;  1HYO A;  2F1L A;  4EDU A;  2DIQ A;  3H41 A;  1WXT A;  2F5K A;  4M7A C;  2X35 A;  2VXE A;  2ABL A;  4J9H A;  3MKD A;  4JRK A;  1IGQ A;  2RJC A;  5FU7 C;  1UGP B;  1RAI B;  1B7T A;  3CCS A;  2K7A A;  4X9C A;  2KY9 A;  2LTO A;  5GMK e;  2D9T A;  2QEX T;  3AT1 B;  1K9M R;  2A7Y A;  4M75 C;  1WI7 A;  3HRS A;  4F7U F;  2BIV A;  5GJV B;  2YRC A;  1T0J A;  4RCC A;  1H3H A;  2LP5 A;  4J7I A;  3OS5 A;  4M78 F;  2EQK A;  2D1X A;  1UB4 A;  2C0O A;  1V1C A;  4LUD A;  4C8Q G;  1NJI C;  1YIJ T;  2I0N A;  1AZG B;  2RD1 A;  1IHV A;  1VQN A;  4AMC A;  4HT9 A;  3BE3 A;  2FZK B;  3JCM P;  4M7D E;  1OPL A;  3OQ5 A;  2F69 A;  1XTD A;  2EYX A;  5LJ3 j;  2CSI A;  3QWY A;  5KYY A;  2EYY A;  4MMK A;  3PTA A;  3VYH B;  2NUT B;  1S72 Q;  3C4S A;  3NFC A;  1F1B B;  2QG9 B;  2RB6 A;  1QVG P;  1KHI A;  1MMN A;  1OV3 A;  2NYS A;  2WSC E;  5GAM d;  1SRL A;  2X3W D;  2OTL T;  2QQR A;  2W10 A;  1R8O B;  4L59 A;  2D0N A;  3QZ5 B;  4AG1 C;  2RM4 A;  2DD4 A;  2XIC A;  1ZBX A;  2JXB A;  1PSE A;  3M0T A;  3JCM g;  2CZ7 B;  3L2Z A;  2VXF A;  5CAI A;  1VQL A;  1WA7 A;  4C92 C;  5A0G A;  3J7A F;  2FZG B;  2KEA A;  2E6N A;  3JB9 I;  1JJ2 P;  1K73 U;  4AT1 B;  2H3J A;  2J05 A;  2CP3 A;  4A54 A;  3TEE A;  2O4X B;  2RHX A;  4J5Y A;  2JTF A;  2RJF A;  5KE3 A;  3EG2 A;  4FSX A;  3CCQ A;  4RTZ A;  2X4J A;  4AFZ C;  5D6W A;  1YNZ A;  1XQH A;  1QVF A;  2ZPF B;  1UDL A;  2FYK A;  2EJG A;  5DY9 A;  2QAS A;  1MHN A;  2KNB B;  4F7U E;  3NMZ C;  1WJR A;  3I56 T;  1G3T A;  1WX6 A;  2A28 A;  2DTO A;  1VYV A;  3THK A;  1RAE B;  1BKB A;  4M78 E;  4PLI A;  4M77 A;  2M16 A;  3A8G B;  2DER A;  1ZUY A;  5IT9 E;  4J7F A;  2M02 A;  2QQS A;  2RMO A;  2YHT A;  4HCB A;  3E19 A;  4PNO A;  2XHC A;  2X3X D;  1WQ7 A;  2NUT A;  3CCE Q;  3CXC P;  2PQW A;  4MDX A;  4ESR A;  4M75 G;  1W6X A;  3WVD B;  2O01 E;  2YXY A;  1VQO A;  2RQR A;  1KQS P;  1UJY A;  3JCM X;  3MEA A;  1ZBJ A;  4QQ6 A;  5FRM A;  1OPK A;  3QO3 A;  4M7D D;  2LJ0 A;  4IUU A;  1PC0 A;  1VQ8 A;  3EGD A;  5C6S A;  5IN1 A;  1M30 A;  5GAO q;  3HRU A;  1PWT A;  1ZSZ B;  3FJP A;  1WHM A;  3CD6 T;  2K5I A;  2LCS A;  2L2P A;  1K9A A;  1FMW A;  1ZX6 A;  5GAN 2;  1G5V A;  5AT1 B;  4EIK A;  2RO0 A;  3OW2 P;  2DVJ A;  4RTW A;  3RUX A;  1X75 C;  1W70 A;  4M7D C;  1YBY A;  1U1T A;  2KDS A;  1VQM Q;  2P84 A;  2LCL A;  5I11 A;  3H0H A;  3X28 B;  1MND A;  4C0G A;  2GCX A;  4C8Q F;  1JB0 E;  1X6G A;  2R5A A;  3UA7 A;  5FLX E;  2QDL A;  3MP6 A;  2JM8 A;  2Y4X A;  3ZBD A;  1VQK A;  2LQK A;  2OTJ T;  1BK2 A;  4O5V A;  2SEM A;  4IIO A;  3URG A;  3CCR T;  3JB9 D;  3CCV T;  3R6O A;  5IHN A;  3HFO A;  3OYD A;  3OMC A;  2P0K A;  2X4X A;  1RLP C;  2FO0 A;  2EVR A;  5HY6 A;  2CP7 A;  1VQP A;  5KYW B;  4C92 G;  4R56 A;  2JS2 A;  2A08 A;  4FYV B;  1QCN A;  1W1F A;  3JRZ A;  1YI2 T;  3H6Z A;  2QA4 Q;  3VRY A;  4PJO B;  3OYG A;  1PKT A;  3C12 A;  3J80 E;  1YFN A;  2GFU A;  1WJS A;  3UPU A;  3RMQ A;  2BTT A;  5GAN g;  4M78 D;  1SHG A;  1RLQ C;  2LJ3 A;  2XMF A;  1NEG A;  1ZSZ A;  4OVA A;  2M0O A;  2DL5 A;  4JZ3 A;  1WHJ A;  1NLO C;  1E6H A;  5IXF A;  3M5A A;  1QWF A;  4A4E A;  4BDY A;  4JDS A;  2CZ1 B;  1MUZ A;  2B8A A;  3OYB A;  1JJ2 S;  2IVW A;  4KUD K;  2VV5 A;  3KFV A;  2HMA A;  1VQ7 A;  4JLG A;  1R77 A;  2DYB A;  2ZPG B;  1GRI A;  1JU5 C;  3QBY A;  1NBE B;  3FLG A;  3SWN B;  1OZ3 A;  3CME T;  1YJN Q;  4N0A A;  3CC2 T;  2RQT A;  3CMA A;  5J26 A;  4OMO A;  3GIB A;  1BIB A;  3U23 A;  3VS0 A;  1PHT A;  5KYU B;  2RQV A;  4E7K A;  1W2B P;  4ZN1 A;  5GAM h;  3MP1 A;  2NUP B;  4OB3 B;  4VUB A;  4N4I A;  2J6O A;  3MEW A;  1VQ5 A;  5LJ3 e;  3OBW A;  1RAB B;  2QI2 A;  5KYW A;  3C95 A;  1TXQ A;  2LC4 A;  4ORZ A;  2A36 A;  1BI0 A;  2E4H A;  4M75 F;  1YHQ Q;  1KIK A;  4KBM B;  4RTU A;  3H9N A;  5CQY A;  3CC7 Q;  1AOJ A;  4J9E A;  1C1A A;  4PJO A;  1E7O A;  2E1H A;  4JJB A;  3KXT A;  3CXC S;  4MML A;  5CO7 A;  3QSU A;  4C5H A;  2KT1 A;  1BCM A;  5J39 A;  4QW2 A;  3NGP A;  2LRQ A;  3HTR A;  1XNI A;  2EIF A;  4HVU A;  1KQS S;  3BFM A;  2FHD A;  2EPD A;  4A4G A;  3G6E T;  2KYB A;  2PZ1 A;  1O9S A;  3GNG A;  3CC4 T;  1EIF A;  1TUG B;  3TQ7 P;  2QDY B;  2HQE A;  2XD0 A;  2CP2 A;  1M3A A;  1UGR B;  2A3L A;  5FW9 A;  3VU3 C;  1BYM A;  1MMA A;  3SEM A;  3L2W A;  4BI3 A;  2HDA A;  2HQH A;  5LJ5 j;  5A0D A;  3OW2 S;  3MPU B;  1WNL A;  2K57 A;  2QQ9 A;  1GFC A;  5I22 A;  1JRI A;  4JJC A;  2LQ8 A;  2DBK A;  4IUV A;  2KAF A;  3SWN A;  3E9G A;  2EJ9 A;  4OGC A;  1Z9Q A;  3CC2 A;  3M9Q A;  1WIE A;  2E3H A;  4XAX B;  5KYU A;  3I5S A;  3M0Q A;  1FYN A;  2NUP A;  1SHF A;  4F04 B;  1M1K C;  3LLR A;  5I21 A;  1N9S A;  1M1G A;  4HKE A;  2DL7 A;  2EYW A;  3CCU Q;  5CIU A;  2DVE A;  3PT9 A;  2PVG B;  5EG2 A;  2AKK A;  3RR6 A;  2HAX A;  1J3T A;  2CP0 A;  2OTJ Q;  3JCM W;  4FYY B;  2EGA A;  3M57 A;  4FYW B;  2CUD A;  3TSW A;  4E2F B;  3CCR Q;  4ZGD B;  3GBQ A;  1IXD A;  1ARK A;  3SHW A;  1Y57 A;  4M75 E;  3V7R A;  3CCJ A;  3RMS A;  1X6B A;  1QVG A;  2RH2 A;  1N8R R;  1YJW A;  4PFP A;  5CQX A;  2PVD B;  2KGT A;  1Q7Y C;  1M1F A;  2K2V A;  1S1N A;  1D09 B;  4XTU A;  3INZ A;  4WF2 A;  1I1J A;  2K5L A;  3HKS A;  4FSS A;  2QGG A;  1Q86 C;  1H64 1;  4GLM A;  2DZC A;  3V8L A;  1G3S A;  2EQI A;  1UEC A;  3BDL A;  3E2U A;  1B3Q A;  1JJ2 A;  3EG9 B;  3G1J A;  3OSV A;  4C8Q C;  5FU6 B;  3P8B B;  3G71 Q;  2DE0 X;  5KH6 A;  5GMK l;  3HFN A;  2KYM A;  2FZC B;  1UGQ B;  2QQB A;  3F70 A;  1IHW A;  1WLP B;  1VQ4 Q;  3MET A;  1JEG A;  4IUQ A;  3TRE A;  1QCO A;  2RI3 A;  3DB4 A;  1NPP A;  1TH7 A;  2J6F A;  4BE2 A;  1I0C A;  2EGE A;  3CCS T;  2Y4Y A;  2FVU A;  2OAW A;  1M90 C;  4M7A A;  1YCY A;  1W2B S;  2VWF A;  2HQX A;  2DPP B;  2RJD A;  1YJ9 Q;  1M1K U;  1N9R A;  4HCZ A;  4ZTF A;  4C92 E;  3L2V A;  3CXC A;  4EPC A;  2XID A;  2QYZ A;  3RIR A;  3L1A A;  2DL3 A;  3S3M A;  2O88 A;  4CC4 B;  1KQS A;  1AHJ B;  3N5B B;  1QWE A;  3I55 Q;  3SD4 A;  2RJE A;  2LVM A;  3X25 B;  4FT4 A;  4A4F A;  3OYN A;  1ACM B;  4J6Y A;  2KR3 A;  1SKU B;  5HK0 A;  3HHT B;  1S72 A;  4XQ3 A;  5KYY B;  4J9C A;  2CH4 A;  2MMP A;  3AHU A;  2VB6 A;  3MCA B;  4RTX A;  3OW2 A;  3LX7 A; 
#chains in the Genus database with same CATH homology
 3NMZ C;  3VS5 A;  2HSP A;  2C0I A;  2DX1 A;  2D8H A;  2AKL A;  5FWC A;  1SEM A;  1WX6 A;  2A28 A;  2B86 A;  4GBQ A;  1VYV A;  3THK A;  1GBQ A;  1AVZ C;  2KXC A;  2ECZ A;  1SPK A;  2YUN A;  2OI3 A;  1ZUY A;  1K4U S;  3TVT A;  1UUE A;  2RMO A;  4OMP A;  1UJ0 A;  2CT3 A;  1GCQ A;  5EC7 A;  2X3X D;  1OOT A;  2DMO A;  1X2K A;  1KSW A;  1NM7 A;  4JPB W;  4A63 B;  2JS0 A;  3H0F A;  4WCI A;  2RQW A;  4ESR A;  1AZE A;  1W6X A;  2DA9 A;  1HD3 A;  3O5Z A;  2RQR A;  3H0I A;  5FWB A;  1UJY A;  1FMK A;  2J6K A;  2JMC A;  4X1V A;  2RPN A;  1GFD A;  2KRO A;  1ZBJ A;  4IIM A;  2LZ6 B;  1OPK A;  3NHN A;  1HSQ A;  2LJ0 A;  2BZX A;  3VS7 A;  1M30 A;  1PWT A;  2BZY A;  1B07 A;  2ROL A;  1E6G A;  2FEI A;  2AZV A;  2GNC A;  2NWM A;  2HEQ A;  2ESW A;  2LCS A;  2L2P A;  2EBP A;  1K9A A;  3M0P A;  1ZUK A;  1ZX6 A;  1AWJ A;  2GTO A;  4RTT A;  4EIK A;  2DRK A;  2DVJ A;  1T3L A;  3M0U A;  4RTW A;  2YT6 A;  2DLP A;  1W70 A;  1UGV A;  1OEB A;  2J06 A;  4CC7 A;  1G2B A;  2O31 A;  2IIM A;  5I11 A;  3H0H A;  2YDL A;  4DEY A;  2DL4 A;  2LX7 A;  3ULR B;  1MV0 B;  1X6G A;  2PTK A;  3UA7 A;  2KT8 A;  2FRW A;  2QDL A;  2JM8 A;  1JXO A;  1BK2 A;  1VYT A;  1QLY A;  2FPE A;  1WDX A;  2SEM A;  4IIO A;  2LNH B;  2W0Z A;  2RQU A;  1MV3 A;  4OMM A;  4RTX A;  1A0N B;  5IHN A;  1AWX A;  2NUZ A;  4LUE A;  1RLP C;  2FO0 A;  2EVR A;  1BB9 A;  1YN8 A;  4RUG A;  4F16 A;  2JS2 A;  2H8H A;  2A08 A;  1QKW A;  2YUO A;  1W1F A;  2DRM A;  2A37 A;  3VRY A;  4E6R A;  1CKA A;  4J9G A;  1G83 A;  3REA B;  1IO6 A;  4D8D A;  1PKT A;  3RBB B;  4F17 A;  3REB B;  1WXB A;  2BTT A;  3I9Q A;  4J9F A;  2KRN A;  3JV3 A;  2DIL A;  4Z8A A;  3M0S A;  1SHG A;  2F2X A;  2CH4 W;  1RLQ C;  2LJ3 A;  2XMF A;  1NEG A;  1K76 A;  2K79 A;  2DL5 A;  4OMQ A;  4JZ3 A;  2MOX A;  2DL8 A;  2KNB B;  2FRY A;  1PRM C;  4JJD A;  1NLO C;  4KRT A;  1E6H A;  5IXF A;  1NG2 A;  1QWF A;  2MCN A;  2RNA A;  2FG0 A;  3EG1 A;  1H8K A;  1SSH A;  1K0X A;  3M0R A;  2F2W A;  2CUB A;  3PVL A;  2K9G A;  1MUZ A;  1PRL C;  2DBM A;  5IH2 A;  1PKS A;  2M0Y A;  3KFV A;  1JO8 A;  2HBW A;  1YWO A;  2DM1 A;  2M51 A;  2JMA A;  1M8M A;  2YUP A;  3I5R A;  4J9B A;  2DYB A;  1GRI A;  2O9V A;  2RF0 A;  1JU5 C;  2JW4 A;  1U06 A;  1ABQ A;  4RTY A;  1H92 A;  2C0T A;  3EG0 A;  1TUC A;  2RQT A;  3UF4 A;  4OMO A;  3IQL A;  1TG0 A;  1UTI A;  3U23 A;  3VS0 A;  1PHT A;  2RQV A;  1YCS B;  2EW3 A;  4HXJ A;  3I35 A;  1ZSG A;  5L23 A;  2J6O A;  4HCK A;  2OJ2 A;  1T0H A;  1K1Z A;  2ROT A;  4AFS C;  4AG2 C;  1QCF A;  3CQT A;  4Z89 A;  2EGC A;  4ORZ A;  2A36 A;  1KIK A;  1BU1 A;  2P4R A;  4RTU A;  2CSQ A;  5IXB A;  1EFN A;  1AOJ A;  4J9E A;  1N5Z A;  1T3S A;  1E7O A;  1NLP C;  1AWW A;  4JJB A;  4Z88 A;  1NYF A;  3VS1 A;  1AEY A;  2KT1 A;  1ZLM A;  1AD5 A;  3NGP A;  2SRC A;  2CRE A;  1RI9 A;  1UHF A;  2L3Q A;  2CT4 A;  2FPF A;  1NYG A;  4HVU A;  4Y92 A;  2EPD A;  2KYB A;  3UA6 A;  2PZ1 A;  1Z9Z A;  3TSZ A;  5IHI A;  4K11 A;  2JTE A;  5ECA A;  2EKH A;  4F14 A;  1UHC A;  1M3A A;  5FW9 A;  2ED1 A;  4CC2 A;  3SEM A;  2GTJ A;  2KXD A;  2JT4 A;  2HDA A;  1GCQ C;  2CDT A;  1ZUU A;  2LQW A;  4CC3 A;  1QKX A;  1GFC A;  5I22 A;  2LQN A;  4HVW A;  2EYZ A;  4AFU C;  4JJC A;  2DBK A;  2J7I A;  1GL5 A;  4RTV A;  4LN2 A;  1X69 A;  2G6F X;  2V1Q A;  1Z9Q A;  4J9I A;  3VS2 A;  1WIE A;  2L3P A;  3I5S A;  3M0Q A;  4ZNX A;  4R0K A;  2LMJ A;  3NPF A;  1FYN A;  1YP5 A;  1SHF A;  1WXU A;  2E5K A;  1Y0M A;  1U3O A;  1VA7 A;  2AZS A;  2DL7 A;  2EYW A;  1PNJ A;  2F2V A;  3EHQ A;  3VS3 A;  2DF6 A;  1WFW A;  2VKN A;  3ZL7 C;  4QT7 A;  3VS6 A;  2K2M A;  1BBZ A;  2AKK A;  2O9S A;  2BZ8 A;  1NEB A;  1U5S A;  1J3T A;  1RUW A;  1GBR A;  2RN8 A;  1CKB A;  2O2O A;  2EGA A;  4J9D A;  5GJW B;  3UAT A;  2CUD A;  4HVV A;  3TSW A;  3H41 A;  1WXT A;  1WYX A;  2ABL A;  2KE9 A;  3GBQ A;  3PVQ A;  4J9H A;  1ARK A;  3SHW A;  1Y57 A;  1GCP A;  1VYU A;  2KBT A;  3VRZ A;  1X6B A;  3EHR A;  3FJ5 A;  2AK5 A;  4LE9 A;  1X27 A;  2KGT A;  2KRM A;  2K7A A;  4OMN A;  1AWO A;  1S1N A;  3A98 A;  1X43 A;  1X2Q A;  3EG3 A;  1I07 A;  1I1J A;  1M3C A;  1WI7 A;  1JXM A;  4FSS A;  5GJV B;  1T0J A;  2L0A A;  4GLM A;  2V1R A;  1M3B A;  1H3H A;  2LP5 A;  2EQI A;  4OML A;  1UEC A;  2DJQ A;  1B3Q A;  1JQQ A;  2K6D A;  4LNP A;  4DEX A;  2D1X A;  2C0O A;  1V1C A;  2DE0 X;  4LUD A;  2I0N A;  2KYM A;  1AZG B;  1XOV A;  2L3S A;  1OPL A;  3C0C A;  1UE9 A;  1WLP B;  1JEG A;  1K0S A;  2HCK A;  2EYX A;  2J6F A;  2CSI A;  1I0C A;  2EGE A;  1LCK A;  3QWY A;  2K3B A;  2OAW A;  1SRM A;  2MIO A;  2EYY A;  2FPD A;  2VWF A;  2YUQ A;  1HJD A;  1OV3 A;  1SRL A;  2X3W D;  2JM9 A;  2W10 A;  3QWX X;  3LH5 A;  2D0N A;  4AFQ C;  4JZ4 A;  4AG1 C;  2YSQ A;  3PE0 A;  1KJW A;  2DL3 A;  2GGR A;  2JXB A;  3M0T A;  2O88 A;  4CC4 B;  1YWP A;  2ENM A;  1WA7 A;  5HCK A;  2GQI A;  2PNI A;  3RNJ A;  1UFF A;  1QWE A;  2DNU A;  2KEA A;  1UG1 A;  3EGU A;  2J05 A;  2KRS A;  3VS4 A;  3EG2 A;  5IHK A;  2KR3 A;  2VVK A;  1M27 C;  4RTZ A;  3R6N A;  1TUD A;  2LJ1 A;  4AFZ C;  1YNZ A;  4J9C A;  2CH4 A;  1UDL A;  4M4Z A;  1CSK A;  1ABO A;  1KFZ A;  2D8J A;  4D8K A;  2GBQ A;  2ED0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...