2D0SA

Crystal structure of the cytochrome c552 from moderate thermophilic bacterium, hydrogenophilus thermoluteolus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
DEALAKAKGCMACHAIDKKLVGPSYKDVAKKYTEADVPKLVEKVKKGGAGVWGPVPMPPHPQVAEADIEKIVRWVLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cytochrome c
publication title Structure of Cytochrome c552 from a Moderate Thermophilic Bacterium, Hydrogenophilus thermoluteolus: Comparative Study on the Thermostability of Cytochrome c
pubmed doi rcsb
source organism Hydrogenophilus thermoluteolus
molecule tags Electron transport
total genus 20
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2d0sA00
4EICA 5AURA 1CIGA 4O1WA 4DY9A 1CYJA 4XYDB 3KZIV 1BE3D 2CE0A 1C2RA 1CHIA 3CXHD 4FAVA 1EZVD 3L71D 1IRWA 1QL3A 3OA8A 1YEBA 3WFEC 2MHMA 5DJQB 1VYDA 1OAEA 1LMSA 4K3IA 1WVEC 2GIWA 4L3GA 1CSXA 3OCDA 1K3GA 1H33A 3WFDC 1CCRA 1YEAA 1H32A 2GB8B 4EIEA 4U3FD 4WQEA 3DP5A 1DT1A 3H1HD 3L74D 1CO6A 3BCCD 1DW2A 1N9CA 2C9XB 4JCGA 1A2SA 1HRCA 1KB9D 2C1DB 1CNOA 1N15A 4N0KA 1E2RA 3ZOXA 4L1QA 4XXLA 1QL4A 2YK3A 3CX5W 2FYNB 4UB6V 4AALA 1H31A 4Y5RA 1KIBA 5DJQC 2AIUA 3WC8A 3L4MA 3ORVA 2QJPB 5CYTR 4AX3A 1HJ4A 3WFBC 2N18B 1SQVD 1YICA 2V08A 1CEDA 1ETPA 5CIDB 1KB0A 2BPBB 4AANA 1JDLA 1RAQA 1PPJD 3A0HV 3L72D 1FHBA 1CXAA 3L4OA 3OA8B 4WQAA 1CTJA 1SQPD 2CA4B 3H1LD 1K3HA 3OCDB 1FI7A 1H33B 1B7VA 1IZL0 2I8FA 1I8PA 1NTKD 4PWAA 1H32B 1M70A 4Q5PA 2D0WA 1C6SA 1KV9A 1L9BC 2OZ1A 2YIUB 3L75D 2PCBB 5DF5A 4FA9A 1KX7A 3MK7C 3H1KD 2VHDA 4H0JA 1AYGA 1N50A 4RSZA 3WUIA 1C52A 5C9MA 1J3SA 3CP5A 1CRCA 1NNOA 3VNWA 1BL9A 4AAOA 1I8OA 2QJYB 1L0LD 1H1OA 1MZ4A 3RN1A 1GDVA 2BH4X 1AOFA 4FA4A 1W5CT 4MU8A 4NFGB 1DIIC 2IBZD 3O5CA 1LFMA 2BH5X 1FOCA 1I6EA 1RAPA 3CXHW 2ZZS1 3CU4A 4O1QA 1DW1A 3PXSA 2FYUD 2B10B 4H0KA 5TISV 1MG3D 1AKKA 1CCHA 4WQCA 1EB7A 1FCDC 3VYMA 2C2CA 2CE1A 1A8CA 1OCDA 2C8SA 3X39A 4PD4D 1CSUA 4WQ7A 4YE1A 2B0ZB 1L9JC 3O1YA 1NU1D 2PACA 1YFCA 5B6QA 1LC2A 1CYCA 1NMIA 1SQXD 1C6OA 2BCCD 1BGYD 2ZONG 1E8EA 1C7MA 3SLEA 1CORA 1GIWA 2C1UA 2YCCA 1FI9A 1SQBD 1WEJF 1HROA 2DGEA 1DIQC 3SJLA 1NTZD 4WQ8A 1A56A 2ZOOA 3DMIA 1C75A 3VRDA 1S5LV 2FRCA 3HQ8A 3ZIYA 4PW9B 1CHJA 5KLVD 5DFSA 1LS9A 4WQ9A 1S6VB 1RZ5A 3PXWA 4EIDA 5GTHV 1ZZHA 1W2LA 3WU2V 3TYIA 2LIRA 2N18C 3ZOYA 3C2CA 1H9XA 4PJ0V 4V2KA 3ZBMA 1YIQA 3H1JD 3HQ7A 2CXBA 5H2FV 1CC5A 3ZOOA 1CSVA 1KYOD 2N9IA 4IL6V 3CYTI 1IQCA 2GC7D 2L4DA 3NBSA 3A0BV 3M97X 2C1VA 3H1ID 2YQBA 3O0RC 2B11B 1H31B 2B12B 4D6TD 3RMZA 1HJ3A 1RZ6A 3DR0A 3L73D 1DW3A 5KKZB 2MTAC 4LJIA 3TGUD 1L0ND 2CA3B 1NIRA 5C0ZA 1DW0A 1SQQD 2A06D 1LC1A 1MG2D 2ZBOA 5CIHB 5E79V 3HQ9A 1CIEA 5IY51 2B4ZA 2N3BA 5CIEB 4FA5A 1DVHA 3PXTA 5KLIB 1CRIA 1HH7A 2GC4D 1CRJA 1YTCA 1KX2A 1PP9D 3SXTA 1BCCD 1GQ1A 1COTA 2DVHA 5KAIV 2ORLA 4KMGA 2N3YA 1HJ5A 1FI3A 1CIHA 1ZRTD 1I5TA 2PCCB 2OZ1B 3NBTA 3L70D 2AI5A 4FB1A 5B5EV 3HQ6A 3PH2B 1IO3A 1U74B 1N90A 1GU2A 1CTYA 1DVVA 351CA 1C6RA 3CX5D 3O20A 5EXQA 4UB8V 451CA 1CSWA 2HV4A 5GTIV 5CICB 4GYDA 1R0QA 2JQRA 1CIFA 4QAOA 3RN0A 4P4QB 1GKSA 155CA 3NWVA 3ZCFA 2EXVA 3CWBD 4J20A 4EIFA 1CYIA 1QKSA 1AOQA 4L3HA 1CRGA 4FANA 2QJKB 3ZOWA 4GEDB 3RLMA 1P84D 1I55A 2LITA 1CRYA 2ZXYA 2V07A 3MK7B 5CIGB 3A9FA 1KYOW 1QN2A 1IRVA 1F1FA 2BCNB 5CIFB 1I54A 1E29A 3WFCC 1NTMD 1U75B 1HCMA 1FJ0A 2BGVX 1M60A 2FWLA 3JBTB 2AXTV 4WQDA 5CIBB 2BLFB 1M6ZA 1CXCA 2XTSB 5B66V 2C1DA 1CTZA 1GJQA 1F1CA 2N9JA 1YCCA 1NMLA 5KAFV 3SWSA 1YNRA 4FA1A 3SVWA 4WQBA 2JTIB 1I6DA 1HZUA 1HZVA 4AAMA 1C2NA 2D0SA 1CRHA 1CHHA 1H9YA 1QYZA
chains in the Genus database with same CATH superfamily
4EICA 5AURA 1CIGA 4O1WA 4DY9A 1CYJA 4XYDB 3KZIV 1BE3D 2CE0A 1C2RA 1CHIA 3CXHD 4FAVA 1EZVD 3L71D 1IRWA 1QL3A 3OA8A 1YEBA 3WFEC 2MHMA 5DJQB 1VYDA 1OAEA 1LMSA 4K3IA 1WVEC 2GIWA 4L3GA 1CSXA 3OCDA 1K3GA 1H33A 3WFDC 1CCRA 1YEAA 1H32A 2GB8B 4EIEA 4U3FD 4WQEA 3DP5A 1DT1A 3H1HD 3L74D 1CO6A 3BCCD 1DW2A 1N9CA 2C9XB 4JCGA 1A2SA 1HRCA 1KB9D 2C1DB 1CNOA 1N15A 4N0KA 1E2RA 3ZOXA 4L1QA 4XXLA 1QL4A 2YK3A 3CX5W 2FYNB 4UB6V 4AALA 1H31A 4Y5RA 1KIBA 5DJQC 2AIUA 3WC8A 3L4MA 3ORVA 2QJPB 5CYTR 4AX3A 1HJ4A 3WFBC 2N18B 1SQVD 1YICA 2V08A 1CEDA 1ETPA 5CIDB 1KB0A 2BPBB 4AANA 1JDLA 1RAQA 1PPJD 3A0HV 3L72D 1FHBA 1CXAA 3L4OA 3OA8B 4WQAA 1CTJA 1SQPD 2CA4B 3H1LD 1K3HA 3OCDB 1FI7A 1H33B 1B7VA 1IZL0 2I8FA 1I8PA 1NTKD 4PWAA 1H32B 1M70A 4Q5PA 2D0WA 1C6SA 1KV9A 1L9BC 2OZ1A 2YIUB 3L75D 2PCBB 5DF5A 4FA9A 1KX7A 3MK7C 3H1KD 2VHDA 4H0JA 1AYGA 1N50A 4RSZA 3WUIA 1C52A 5C9MA 1J3SA 3CP5A 1CRCA 1NNOA 3VNWA 1BL9A 4AAOA 1I8OA 2QJYB 1L0LD 1H1OA 1MZ4A 3RN1A 1GDVA 2BH4X 1AOFA 4FA4A 1W5CT 4MU8A 4NFGB 1DIIC 2IBZD 3O5CA 1LFMA 2BH5X 1FOCA 1I6EA 1RAPA 3CXHW 2ZZS1 3CU4A 4O1QA 1DW1A 3PXSA 2FYUD 2B10B 4H0KA 5TISV 1MG3D 1AKKA 1CCHA 4WQCA 1EB7A 1FCDC 3VYMA 2C2CA 2CE1A 1A8CA 1OCDA 2C8SA 3X39A 4PD4D 1CSUA 4WQ7A 4YE1A 2B0ZB 1L9JC 3O1YA 1NU1D 2PACA 1YFCA 5B6QA 1LC2A 1CYCA 1NMIA 1SQXD 1C6OA 2BCCD 1BGYD 2ZONG 1E8EA 1C7MA 3SLEA 1CORA 1GIWA 2C1UA 2YCCA 1FI9A 1SQBD 1WEJF 1HROA 2DGEA 1DIQC 3SJLA 1NTZD 4WQ8A 1A56A 2ZOOA 3DMIA 1C75A 3VRDA 1S5LV 2FRCA 3HQ8A 3ZIYA 4PW9B 1CHJA 5KLVD 5DFSA 1LS9A 4WQ9A 1S6VB 1RZ5A 3PXWA 4EIDA 5GTHV 1ZZHA 1W2LA 3WU2V 3TYIA 2LIRA 2N18C 3ZOYA 3C2CA 1H9XA 4PJ0V 4V2KA 3ZBMA 1YIQA 3H1JD 3HQ7A 2CXBA 5H2FV 1CC5A 3ZOOA 1CSVA 1KYOD 2N9IA 4IL6V 3CYTI 1IQCA 2GC7D 2L4DA 3NBSA 3A0BV 3M97X 2C1VA 3H1ID 2YQBA 3O0RC 2B11B 1H31B 2B12B 4D6TD 3RMZA 1HJ3A 1RZ6A 3DR0A 3L73D 1DW3A 5KKZB 2MTAC 4LJIA 3TGUD 1L0ND 2CA3B 1NIRA 5C0ZA 1DW0A 1SQQD 2A06D 1LC1A 1MG2D 2ZBOA 5CIHB 5E79V 3HQ9A 1CIEA 5IY51 2B4ZA 2N3BA 5CIEB 4FA5A 1DVHA 3PXTA 5KLIB 1CRIA 1HH7A 2GC4D 1CRJA 3D0WA 1YTCA 1KX2A 1PP9D 3SXTA 1BCCD 1GQ1A 1COTA 2DVHA 5KAIV 2ORLA 4KMGA 2N3YA 1HJ5A 1FI3A 1CIHA 1ZRTD 1I5TA 2PCCB 2OZ1B 3NBTA 3L70D 2AI5A 4FB1A 5B5EV 3HQ6A 3PH2B 1IO3A 1U74B 1N90A 1GU2A 1CTYA 1DVVA 351CA 1C6RA 3CX5D 3O20A 5EXQA 4UB8V 451CA 1CSWA 2HV4A 5GTIV 5CICB 4GYDA 1R0QA 2JQRA 1CIFA 4QAOA 3RN0A 4P4QB 1GKSA 155CA 3NWVA 3ZCFA 2EXVA 3CWBD 4J20A 4EIFA 1CYIA 1QKSA 1AOQA 4L3HA 1CRGA 4FANA 2QJKB 3ZOWA 4GEDB 3RLMA 1P84D 1I55A 2LITA 1CRYA 2ZXYA 2V07A 3MK7B 5CIGB 3A9FA 1KYOW 1QN2A 1IRVA 1F1FA 2BCNB 5CIFB 1I54A 1E29A 3WFCC 1NTMD 1U75B 1HCMA 1FJ0A 2BGVX 1M60A 2FWLA 3JBTB 2AXTV 4WQDA 5CIBB 2BLFB 1M6ZA 1CXCA 2XTSB 5B66V 2C1DA 1CTZA 1GJQA 1F1CA 2N9JA 1YCCA 1NMLA 5KAFV 3SWSA 1YNRA 4FA1A 3SVWA 4WQBA 2JTIB 1I6DA 1HZUA 1HZVA 4AAMA 1C2NA 2D0SA 1CRHA 1CHHA 1H9YA 1QYZA
chains in the Genus database with same CATH topology
4EICA 5AURA 1CIGA 4O1WA 4DY9A 1CYJA 4XYDB 3KZIV 1BE3D 2CE0A 1C2RA 1CHIA 3CXHD 4FAVA 1EZVD 3L71D 1IRWA 1QL3A 3OA8A 1YEBA 3WFEC 2MHMA 5DJQB 1VYDA 1OAEA 1LMSA 4K3IA 1WVEC 2GIWA 4L3GA 1CSXA 3OCDA 1K3GA 1H33A 3WFDC 1CCRA 1YEAA 1H32A 2GB8B 4EIEA 4U3FD 4WQEA 3DP5A 1DT1A 3H1HD 3L74D 1CO6A 3BCCD 1DW2A 1N9CA 2C9XB 4JCGA 1A2SA 1HRCA 1KB9D 2C1DB 1CNOA 1N15A 4N0KA 1E2RA 3ZOXA 4L1QA 4XXLA 1QL4A 2YK3A 3CX5W 2FYNB 4UB6V 4AALA 1H31A 4Y5RA 1KIBA 5DJQC 2AIUA 3WC8A 3L4MA 3ORVA 2QJPB 5CYTR 4AX3A 1HJ4A 3WFBC 2N18B 1SQVD 1YICA 2V08A 1CEDA 1ETPA 5CIDB 1KB0A 2BPBB 4AANA 1JDLA 1RAQA 1PPJD 3A0HV 3L72D 1FHBA 1CXAA 3L4OA 3OA8B 4WQAA 1CTJA 1SQPD 2CA4B 3H1LD 1K3HA 3OCDB 1FI7A 1H33B 1B7VA 1IZL0 2I8FA 1I8PA 1NTKD 4PWAA 1H32B 1M70A 4Q5PA 2D0WA 1C6SA 1KV9A 1L9BC 2OZ1A 2YIUB 3L75D 2PCBB 5DF5A 4FA9A 1KX7A 3MK7C 3H1KD 2VHDA 4H0JA 1AYGA 1N50A 4RSZA 3WUIA 1C52A 5C9MA 1J3SA 3CP5A 1CRCA 1NNOA 3VNWA 1BL9A 4AAOA 1I8OA 2QJYB 1L0LD 1H1OA 1MZ4A 3RN1A 1GDVA 2BH4X 1AOFA 4FA4A 1W5CT 4MU8A 4NFGB 1DIIC 2IBZD 3O5CA 1LFMA 2BH5X 1FOCA 1I6EA 1RAPA 3CXHW 2ZZS1 3CU4A 4O1QA 1DW1A 3PXSA 2FYUD 2B10B 4H0KA 5TISV 1MG3D 1AKKA 1CCHA 4WQCA 1EB7A 1FCDC 3VYMA 2C2CA 2CE1A 1A8CA 1OCDA 2C8SA 3X39A 4PD4D 1CSUA 4WQ7A 4YE1A 2B0ZB 1L9JC 3O1YA 1NU1D 2PACA 1YFCA 5B6QA 1LC2A 1CYCA 1NMIA 1SQXD 1C6OA 2BCCD 1BGYD 2ZONG 1E8EA 1C7MA 3SLEA 1CORA 1GIWA 2C1UA 2YCCA 1FI9A 1SQBD 1WEJF 1HROA 2DGEA 1DIQC 3SJLA 1NTZD 4WQ8A 1A56A 2ZOOA 3DMIA 1C75A 3VRDA 1S5LV 2FRCA 3HQ8A 3ZIYA 4PW9B 1CHJA 5KLVD 5DFSA 1LS9A 4WQ9A 1S6VB 1RZ5A 3PXWA 4EIDA 5GTHV 1ZZHA 1W2LA 3WU2V 3TYIA 2LIRA 2N18C 3ZOYA 3C2CA 1H9XA 4PJ0V 4V2KA 3ZBMA 1YIQA 3H1JD 3HQ7A 2CXBA 5H2FV 1CC5A 3ZOOA 1CSVA 1KYOD 2N9IA 4IL6V 3CYTI 1IQCA 2GC7D 2L4DA 3NBSA 3A0BV 3M97X 2C1VA 3H1ID 2YQBA 3O0RC 2B11B 1H31B 2B12B 4D6TD 3RMZA 1HJ3A 1RZ6A 3DR0A 3L73D 1DW3A 5KKZB 2MTAC 4LJIA 3TGUD 1L0ND 2CA3B 1NIRA 5C0ZA 1DW0A 1SQQD 2A06D 1LC1A 1MG2D 2ZBOA 5CIHB 5E79V 3HQ9A 1CIEA 5IY51 2B4ZA 2N3BA 5CIEB 4FA5A 1DVHA 3PXTA 5KLIB 1CRIA 1HH7A 2GC4D 1CRJA 1YTCA 1KX2A 1PP9D 3SXTA 1BCCD 1GQ1A 1COTA 2DVHA 5KAIV 2ORLA 4KMGA 2N3YA 1HJ5A 1FI3A 1CIHA 1ZRTD 1I5TA 2PCCB 2OZ1B 3NBTA 3L70D 2AI5A 4FB1A 5B5EV 3HQ6A 3PH2B 1IO3A 1U74B 1N90A 1GU2A 1CTYA 1DVVA 351CA 1C6RA 3CX5D 3O20A 5EXQA 4UB8V 451CA 1CSWA 2HV4A 5GTIV 5CICB 4GYDA 1R0QA 2JQRA 1CIFA 4QAOA 3RN0A 4P4QB 1GKSA 155CA 3NWVA 3ZCFA 2EXVA 3CWBD 4J20A 4EIFA 1CYIA 1QKSA 1AOQA 4L3HA 1CRGA 4FANA 2QJKB 3ZOWA 4GEDB 3RLMA 1P84D 1I55A 2LITA 1CRYA 2ZXYA 2V07A 3MK7B 5CIGB 3A9FA 1KYOW 1QN2A 1IRVA 1F1FA 2BCNB 5CIFB 1I54A 1E29A 3WFCC 1NTMD 1U75B 1HCMA 1FJ0A 2BGVX 1M60A 2FWLA 3JBTB 2AXTV 4WQDA 5CIBB 2BLFB 1M6ZA 1CXCA 2XTSB 5B66V 2C1DA 1CTZA 1GJQA 1F1CA 2N9JA 1YCCA 1NMLA 5KAFV 3SWSA 1YNRA 4FA1A 3SVWA 4WQBA 2JTIB 1I6DA 1HZUA 1HZVA 4AAMA 1C2NA 2D0SA 1CRHA 1CHHA 1H9YA 1QYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EIC A;  5AUR A;  1CIG A;  4O1W A;  4DY9 A;  1CYJ A;  4XYD B;  3KZI V;  1BE3 D;  2CE0 A;  1C2R A;  1CHI A;  3CXH D;  4FAV A;  1EZV D;  3L71 D;  1IRW A;  1QL3 A;  3OA8 A;  1YEB A;  3WFE C;  2MHM A;  5DJQ B;  1VYD A;  1OAE A;  1LMS A;  4K3I A;  1WVE C;  2GIW A;  4L3G A;  1CSX A;  3OCD A;  1K3G A;  1H33 A;  3WFD C;  1CCR A;  1YEA A;  1H32 A;  2GB8 B;  4EIE A;  4U3F D;  4WQE A;  3DP5 A;  1DT1 A;  3H1H D;  3L74 D;  1CO6 A;  3BCC D;  1DW2 A;  1N9C A;  2C9X B;  4JCG A;  1A2S A;  1HRC A;  1KB9 D;  2C1D B;  1CNO A;  1N15 A;  4N0K A;  1E2R A;  3ZOX A;  4L1Q A;  4XXL A;  1QL4 A;  2YK3 A;  3CX5 W;  2FYN B;  4UB6 V;  4AAL A;  1H31 A;  4Y5R A;  1KIB A;  5DJQ C;  2AIU A;  3WC8 A;  3L4M A;  3ORV A;  2QJP B;  5CYT R;  4AX3 A;  1HJ4 A;  3WFB C;  2N18 B;  1SQV D;  1YIC A;  2V08 A;  1CED A;  1ETP A;  5CID B;  1KB0 A;  2BPB B;  4AAN A;  1JDL A;  1RAQ A;  1PPJ D;  3A0H V;  3L72 D;  1FHB A;  1CXA A;  3L4O A;  3OA8 B;  4WQA A;  1CTJ A;  1SQP D;  2CA4 B;  3H1L D;  1K3H A;  3OCD B;  1FI7 A;  1H33 B;  1B7V A;  1IZL 0;  2I8F A;  1I8P A;  1NTK D;  4PWA A;  1H32 B;  1M70 A;  4Q5P A;  2D0W A;  1C6S A;  1KV9 A;  1L9B C;  2OZ1 A;  2YIU B;  3L75 D;  2PCB B;  5DF5 A;  4FA9 A;  1KX7 A;  3MK7 C;  3H1K D;  2VHD A;  4H0J A;  1AYG A;  1N50 A;  4RSZ A;  3WUI A;  1C52 A;  5C9M A;  1J3S A;  3CP5 A;  1CRC A;  1NNO A;  3VNW A;  1BL9 A;  4AAO A;  1I8O A;  2QJY B;  1L0L D;  1H1O A;  1MZ4 A;  3RN1 A;  1GDV A;  2BH4 X;  1AOF A;  4FA4 A;  1W5C T;  4MU8 A;  4NFG B;  1DII C;  2IBZ D;  3O5C A;  1LFM A;  2BH5 X;  1FOC A;  1I6E A;  1RAP A;  3CXH W;  2ZZS 1;  3CU4 A;  4O1Q A;  1DW1 A;  3PXS A;  2FYU D;  2B10 B;  4H0K A;  5TIS V;  1MG3 D;  1AKK A;  1CCH A;  4WQC A;  1EB7 A;  1FCD C;  3VYM A;  2C2C A;  2CE1 A;  1A8C A;  1OCD A;  2C8S A;  3X39 A;  4PD4 D;  1CSU A;  4WQ7 A;  4YE1 A;  2B0Z B;  1L9J C;  3O1Y A;  1NU1 D;  2PAC A;  1YFC A;  5B6Q A;  1LC2 A;  1CYC A;  1NMI A;  1SQX D;  1C6O A;  2BCC D;  1BGY D;  2ZON G;  1E8E A;  1C7M A;  3SLE A;  1COR A;  1GIW A;  2C1U A;  2YCC A;  1FI9 A;  1SQB D;  1WEJ F;  1HRO A;  2DGE A;  1DIQ C;  3SJL A;  1NTZ D;  4WQ8 A;  1A56 A;  2ZOO A;  3DMI A;  1C75 A;  3VRD A;  1S5L V;  2FRC A;  3HQ8 A;  3ZIY A;  4PW9 B;  1CHJ A;  5KLV D;  5DFS A;  1LS9 A;  4WQ9 A;  1S6V B;  1RZ5 A;  3PXW A;  4EID A;  5GTH V;  1ZZH A;  1W2L A;  3WU2 V;  3TYI A;  2LIR A;  2N18 C;  3ZOY A;  3C2C A;  1H9X A;  4PJ0 V;  4V2K A;  3ZBM A;  1YIQ A;  3H1J D;  3HQ7 A;  2CXB A;  5H2F V;  1CC5 A;  3ZOO A;  1CSV A;  1KYO D;  2N9I A;  4IL6 V;  3CYT I;  1IQC A;  2GC7 D;  2L4D A;  3NBS A;  3A0B V;  3M97 X;  2C1V A;  3H1I D;  2YQB A;  3O0R C;  2B11 B;  1H31 B;  2B12 B;  4D6T D;  3RMZ A;  1HJ3 A;  1RZ6 A;  3DR0 A;  3L73 D;  1DW3 A;  5KKZ B;  2MTA C;  4LJI A;  3TGU D;  1L0N D;  2CA3 B;  1NIR A;  5C0Z A;  1DW0 A;  1SQQ D;  2A06 D;  1LC1 A;  1MG2 D;  2ZBO A;  5CIH B;  5E79 V;  3HQ9 A;  1CIE A;  5IY5 1;  2B4Z A;  2N3B A;  5CIE B;  4FA5 A;  1DVH A;  3PXT A;  5KLI B;  1CRI A;  1HH7 A;  2GC4 D;  1CRJ A;  1YTC A;  1KX2 A;  1PP9 D;  3SXT A;  1BCC D;  1GQ1 A;  1COT A;  2DVH A;  5KAI V;  2ORL A;  4KMG A;  2N3Y A;  1HJ5 A;  1FI3 A;  1CIH A;  1ZRT D;  1I5T A;  2PCC B;  2OZ1 B;  3NBT A;  3L70 D;  2AI5 A;  4FB1 A;  5B5E V;  3HQ6 A;  3PH2 B;  1IO3 A;  1U74 B;  1N90 A;  1GU2 A;  1CTY A;  1DVV A;  351C A;  1C6R A;  3CX5 D;  3O20 A;  5EXQ A;  4UB8 V;  451C A;  1CSW A;  2HV4 A;  5GTI V;  5CIC B;  4GYD A;  1R0Q A;  2JQR A;  1CIF A;  4QAO A;  3RN0 A;  4P4Q B;  1GKS A;  155C A;  3NWV A;  3ZCF A;  2EXV A;  3CWB D;  4J20 A;  4EIF A;  1CYI A;  1QKS A;  1AOQ A;  4L3H A;  1CRG A;  4FAN A;  2QJK B;  3ZOW A;  4GED B;  3RLM A;  1P84 D;  1I55 A;  2LIT A;  1CRY A;  2ZXY A;  2V07 A;  3MK7 B;  5CIG B;  3A9F A;  1KYO W;  1QN2 A;  1IRV A;  1F1F A;  2BCN B;  5CIF B;  1I54 A;  1E29 A;  3WFC C;  1NTM D;  1U75 B;  1HCM A;  1FJ0 A;  2BGV X;  1M60 A;  2FWL A;  3JBT B;  2AXT V;  4WQD A;  5CIB B;  2BLF B;  1M6Z A;  1CXC A;  2XTS B;  5B66 V;  2C1D A;  1CTZ A;  1GJQ A;  1F1C A;  2N9J A;  1YCC A;  1NML A;  5KAF V;  3SWS A;  1YNR A;  4FA1 A;  3SVW A;  4WQB A;  2JTI B;  1I6D A;  1HZU A;  1HZV A;  4AAM A;  1C2N A;  2D0S A;  1CRH A;  1CHH A;  1H9Y A;  1QYZ A; 
#chains in the Genus database with same CATH topology
 4EIC A;  5AUR A;  1CIG A;  4O1W A;  4DY9 A;  1CYJ A;  4XYD B;  3KZI V;  1BE3 D;  2CE0 A;  1C2R A;  1CHI A;  3CXH D;  4FAV A;  1EZV D;  3L71 D;  1IRW A;  1QL3 A;  3OA8 A;  1YEB A;  3WFE C;  2MHM A;  5DJQ B;  1VYD A;  1OAE A;  1LMS A;  4K3I A;  1WVE C;  2GIW A;  4L3G A;  1CSX A;  3OCD A;  1K3G A;  1H33 A;  3WFD C;  1CCR A;  1YEA A;  1H32 A;  2GB8 B;  4EIE A;  4U3F D;  4WQE A;  3DP5 A;  1DT1 A;  3H1H D;  3L74 D;  1CO6 A;  3BCC D;  1DW2 A;  1N9C A;  2C9X B;  4JCG A;  1A2S A;  1HRC A;  1KB9 D;  2C1D B;  1CNO A;  1N15 A;  4N0K A;  1E2R A;  3ZOX A;  4L1Q A;  4XXL A;  1QL4 A;  2YK3 A;  3CX5 W;  2FYN B;  4UB6 V;  4AAL A;  1H31 A;  4Y5R A;  1KIB A;  5DJQ C;  2AIU A;  3WC8 A;  3L4M A;  3ORV A;  2QJP B;  5CYT R;  4AX3 A;  1HJ4 A;  3WFB C;  2N18 B;  1SQV D;  1YIC A;  2V08 A;  1CED A;  1ETP A;  5CID B;  1KB0 A;  2BPB B;  4AAN A;  1JDL A;  1RAQ A;  1PPJ D;  3A0H V;  3L72 D;  1FHB A;  1CXA A;  3L4O A;  3OA8 B;  4WQA A;  1CTJ A;  1SQP D;  2CA4 B;  3H1L D;  1K3H A;  3OCD B;  1FI7 A;  1H33 B;  1B7V A;  1IZL 0;  2I8F A;  1I8P A;  1NTK D;  4PWA A;  1H32 B;  1M70 A;  4Q5P A;  2D0W A;  1C6S A;  1KV9 A;  1L9B C;  2OZ1 A;  2YIU B;  3L75 D;  2PCB B;  5DF5 A;  4FA9 A;  1KX7 A;  3MK7 C;  3H1K D;  2VHD A;  4H0J A;  1AYG A;  1N50 A;  4RSZ A;  3WUI A;  1C52 A;  5C9M A;  1J3S A;  3CP5 A;  1CRC A;  1NNO A;  3VNW A;  1BL9 A;  4AAO A;  1I8O A;  2QJY B;  1L0L D;  1H1O A;  1MZ4 A;  3RN1 A;  1GDV A;  2BH4 X;  1AOF A;  4FA4 A;  1W5C T;  4MU8 A;  4NFG B;  1DII C;  2IBZ D;  3O5C A;  1LFM A;  2BH5 X;  1FOC A;  1I6E A;  1RAP A;  3CXH W;  2ZZS 1;  3CU4 A;  4O1Q A;  1DW1 A;  3PXS A;  2FYU D;  2B10 B;  4H0K A;  5TIS V;  1MG3 D;  1AKK A;  1CCH A;  4WQC A;  1EB7 A;  1FCD C;  3VYM A;  2C2C A;  2CE1 A;  1A8C A;  1OCD A;  2C8S A;  3X39 A;  4PD4 D;  1CSU A;  4WQ7 A;  4YE1 A;  2B0Z B;  1L9J C;  3O1Y A;  1NU1 D;  2PAC A;  1YFC A;  5B6Q A;  1LC2 A;  1CYC A;  1NMI A;  1SQX D;  1C6O A;  2BCC D;  1BGY D;  2ZON G;  1E8E A;  1C7M A;  3SLE A;  1COR A;  1GIW A;  2C1U A;  2YCC A;  1FI9 A;  1SQB D;  1WEJ F;  1HRO A;  2DGE A;  1DIQ C;  3SJL A;  1NTZ D;  4WQ8 A;  1A56 A;  2ZOO A;  3DMI A;  1C75 A;  3VRD A;  1S5L V;  2FRC A;  3HQ8 A;  3ZIY A;  4PW9 B;  1CHJ A;  5KLV D;  5DFS A;  1LS9 A;  4WQ9 A;  1S6V B;  1RZ5 A;  3PXW A;  4EID A;  5GTH V;  1ZZH A;  1W2L A;  3WU2 V;  3TYI A;  2LIR A;  2N18 C;  3ZOY A;  3C2C A;  1H9X A;  4PJ0 V;  4V2K A;  3ZBM A;  1YIQ A;  3H1J D;  3HQ7 A;  2CXB A;  5H2F V;  1CC5 A;  3ZOO A;  1CSV A;  1KYO D;  2N9I A;  4IL6 V;  3CYT I;  1IQC A;  2GC7 D;  2L4D A;  3NBS A;  3A0B V;  3M97 X;  2C1V A;  3H1I D;  2YQB A;  3O0R C;  2B11 B;  1H31 B;  2B12 B;  4D6T D;  3RMZ A;  1HJ3 A;  1RZ6 A;  3DR0 A;  3L73 D;  1DW3 A;  5KKZ B;  2MTA C;  4LJI A;  3TGU D;  1L0N D;  2CA3 B;  1NIR A;  5C0Z A;  1DW0 A;  1SQQ D;  2A06 D;  1LC1 A;  1MG2 D;  2ZBO A;  5CIH B;  5E79 V;  3HQ9 A;  1CIE A;  5IY5 1;  2B4Z A;  2N3B A;  5CIE B;  4FA5 A;  1DVH A;  3PXT A;  5KLI B;  1CRI A;  1HH7 A;  2GC4 D;  1CRJ A;  3D0W A;  1YTC A;  1KX2 A;  1PP9 D;  3SXT A;  1BCC D;  1GQ1 A;  1COT A;  2DVH A;  5KAI V;  2ORL A;  4KMG A;  2N3Y A;  1HJ5 A;  1FI3 A;  1CIH A;  1ZRT D;  1I5T A;  2PCC B;  2OZ1 B;  3NBT A;  3L70 D;  2AI5 A;  4FB1 A;  5B5E V;  3HQ6 A;  3PH2 B;  1IO3 A;  1U74 B;  1N90 A;  1GU2 A;  1CTY A;  1DVV A;  351C A;  1C6R A;  3CX5 D;  3O20 A;  5EXQ A;  4UB8 V;  451C A;  1CSW A;  2HV4 A;  5GTI V;  5CIC B;  4GYD A;  1R0Q A;  2JQR A;  1CIF A;  4QAO A;  3RN0 A;  4P4Q B;  1GKS A;  155C A;  3NWV A;  3ZCF A;  2EXV A;  3CWB D;  4J20 A;  4EIF A;  1CYI A;  1QKS A;  1AOQ A;  4L3H A;  1CRG A;  4FAN A;  2QJK B;  3ZOW A;  4GED B;  3RLM A;  1P84 D;  1I55 A;  2LIT A;  1CRY A;  2ZXY A;  2V07 A;  3MK7 B;  5CIG B;  3A9F A;  1KYO W;  1QN2 A;  1IRV A;  1F1F A;  2BCN B;  5CIF B;  1I54 A;  1E29 A;  3WFC C;  1NTM D;  1U75 B;  1HCM A;  1FJ0 A;  2BGV X;  1M60 A;  2FWL A;  3JBT B;  2AXT V;  4WQD A;  5CIB B;  2BLF B;  1M6Z A;  1CXC A;  2XTS B;  5B66 V;  2C1D A;  1CTZ A;  1GJQ A;  1F1C A;  2N9J A;  1YCC A;  1NML A;  5KAF V;  3SWS A;  1YNR A;  4FA1 A;  3SVW A;  4WQB A;  2JTI B;  1I6D A;  1HZU A;  1HZV A;  4AAM A;  1C2N A;  2D0S A;  1CRH A;  1CHH A;  1H9Y A;  1QYZ A; 
#chains in the Genus database with same CATH homology
 4EIC A;  5AUR A;  1CIG A;  4O1W A;  4DY9 A;  1CYJ A;  4XYD B;  3KZI V;  1BE3 D;  2CE0 A;  1C2R A;  1CHI A;  3CXH D;  4FAV A;  1EZV D;  3L71 D;  1IRW A;  1QL3 A;  3OA8 A;  1YEB A;  3WFE C;  2MHM A;  5DJQ B;  1VYD A;  1OAE A;  1LMS A;  4K3I A;  1WVE C;  2GIW A;  4L3G A;  1CSX A;  3OCD A;  1K3G A;  1H33 A;  3WFD C;  1CCR A;  1YEA A;  1H32 A;  2GB8 B;  4EIE A;  4U3F D;  4WQE A;  3DP5 A;  1DT1 A;  3H1H D;  3L74 D;  1CO6 A;  3BCC D;  1DW2 A;  1N9C A;  2C9X B;  4JCG A;  1A2S A;  1HRC A;  1KB9 D;  2C1D B;  1CNO A;  1N15 A;  4N0K A;  1E2R A;  3ZOX A;  4L1Q A;  4XXL A;  1QL4 A;  2YK3 A;  3CX5 W;  2FYN B;  4UB6 V;  4AAL A;  1H31 A;  4Y5R A;  1KIB A;  5DJQ C;  2AIU A;  3WC8 A;  3L4M A;  3ORV A;  2QJP B;  5CYT R;  4AX3 A;  1HJ4 A;  3WFB C;  2N18 B;  1SQV D;  1YIC A;  2V08 A;  1CED A;  1ETP A;  5CID B;  1KB0 A;  2BPB B;  4AAN A;  1JDL A;  1RAQ A;  1PPJ D;  3A0H V;  3L72 D;  1FHB A;  1CXA A;  3L4O A;  3OA8 B;  4WQA A;  1CTJ A;  1SQP D;  2CA4 B;  3H1L D;  1K3H A;  3OCD B;  1FI7 A;  1H33 B;  1B7V A;  1IZL 0;  2I8F A;  1I8P A;  1NTK D;  4PWA A;  1H32 B;  1M70 A;  4Q5P A;  2D0W A;  1C6S A;  1KV9 A;  1L9B C;  2OZ1 A;  2YIU B;  3L75 D;  2PCB B;  5DF5 A;  4FA9 A;  1KX7 A;  3MK7 C;  3H1K D;  2VHD A;  4H0J A;  1AYG A;  1N50 A;  4RSZ A;  3WUI A;  1C52 A;  5C9M A;  1J3S A;  3CP5 A;  1CRC A;  1NNO A;  3VNW A;  1BL9 A;  4AAO A;  1I8O A;  2QJY B;  1L0L D;  1H1O A;  1MZ4 A;  3RN1 A;  1GDV A;  2BH4 X;  1AOF A;  4FA4 A;  1W5C T;  4MU8 A;  4NFG B;  1DII C;  2IBZ D;  3O5C A;  1LFM A;  2BH5 X;  1FOC A;  1I6E A;  1RAP A;  3CXH W;  2ZZS 1;  3CU4 A;  4O1Q A;  1DW1 A;  3PXS A;  2FYU D;  2B10 B;  4H0K A;  5TIS V;  1MG3 D;  1AKK A;  1CCH A;  4WQC A;  1EB7 A;  1FCD C;  3VYM A;  2C2C A;  2CE1 A;  1A8C A;  1OCD A;  2C8S A;  3X39 A;  4PD4 D;  1CSU A;  4WQ7 A;  4YE1 A;  2B0Z B;  1L9J C;  3O1Y A;  1NU1 D;  2PAC A;  1YFC A;  5B6Q A;  1LC2 A;  1CYC A;  1NMI A;  1SQX D;  1C6O A;  2BCC D;  1BGY D;  2ZON G;  1E8E A;  1C7M A;  3SLE A;  1COR A;  1GIW A;  2C1U A;  2YCC A;  1FI9 A;  1SQB D;  1WEJ F;  1HRO A;  2DGE A;  1DIQ C;  3SJL A;  1NTZ D;  4WQ8 A;  1A56 A;  2ZOO A;  3DMI A;  1C75 A;  3VRD A;  1S5L V;  2FRC A;  3HQ8 A;  3ZIY A;  4PW9 B;  1CHJ A;  5KLV D;  5DFS A;  1LS9 A;  4WQ9 A;  1S6V B;  1RZ5 A;  3PXW A;  4EID A;  5GTH V;  1ZZH A;  1W2L A;  3WU2 V;  3TYI A;  2LIR A;  2N18 C;  3ZOY A;  3C2C A;  1H9X A;  4PJ0 V;  4V2K A;  3ZBM A;  1YIQ A;  3H1J D;  3HQ7 A;  2CXB A;  5H2F V;  1CC5 A;  3ZOO A;  1CSV A;  1KYO D;  2N9I A;  4IL6 V;  3CYT I;  1IQC A;  2GC7 D;  2L4D A;  3NBS A;  3A0B V;  3M97 X;  2C1V A;  3H1I D;  2YQB A;  3O0R C;  2B11 B;  1H31 B;  2B12 B;  4D6T D;  3RMZ A;  1HJ3 A;  1RZ6 A;  3DR0 A;  3L73 D;  1DW3 A;  5KKZ B;  2MTA C;  4LJI A;  3TGU D;  1L0N D;  2CA3 B;  1NIR A;  5C0Z A;  1DW0 A;  1SQQ D;  2A06 D;  1LC1 A;  1MG2 D;  2ZBO A;  5CIH B;  5E79 V;  3HQ9 A;  1CIE A;  5IY5 1;  2B4Z A;  2N3B A;  5CIE B;  4FA5 A;  1DVH A;  3PXT A;  5KLI B;  1CRI A;  1HH7 A;  2GC4 D;  1CRJ A;  1YTC A;  1KX2 A;  1PP9 D;  3SXT A;  1BCC D;  1GQ1 A;  1COT A;  2DVH A;  5KAI V;  2ORL A;  4KMG A;  2N3Y A;  1HJ5 A;  1FI3 A;  1CIH A;  1ZRT D;  1I5T A;  2PCC B;  2OZ1 B;  3NBT A;  3L70 D;  2AI5 A;  4FB1 A;  5B5E V;  3HQ6 A;  3PH2 B;  1IO3 A;  1U74 B;  1N90 A;  1GU2 A;  1CTY A;  1DVV A;  351C A;  1C6R A;  3CX5 D;  3O20 A;  5EXQ A;  4UB8 V;  451C A;  1CSW A;  2HV4 A;  5GTI V;  5CIC B;  4GYD A;  1R0Q A;  2JQR A;  1CIF A;  4QAO A;  3RN0 A;  4P4Q B;  1GKS A;  155C A;  3NWV A;  3ZCF A;  2EXV A;  3CWB D;  4J20 A;  4EIF A;  1CYI A;  1QKS A;  1AOQ A;  4L3H A;  1CRG A;  4FAN A;  2QJK B;  3ZOW A;  4GED B;  3RLM A;  1P84 D;  1I55 A;  2LIT A;  1CRY A;  2ZXY A;  2V07 A;  3MK7 B;  5CIG B;  3A9F A;  1KYO W;  1QN2 A;  1IRV A;  1F1F A;  2BCN B;  5CIF B;  1I54 A;  1E29 A;  3WFC C;  1NTM D;  1U75 B;  1HCM A;  1FJ0 A;  2BGV X;  1M60 A;  2FWL A;  3JBT B;  2AXT V;  4WQD A;  5CIB B;  2BLF B;  1M6Z A;  1CXC A;  2XTS B;  5B66 V;  2C1D A;  1CTZ A;  1GJQ A;  1F1C A;  2N9J A;  1YCC A;  1NML A;  5KAF V;  3SWS A;  1YNR A;  4FA1 A;  3SVW A;  4WQB A;  2JTI B;  1I6D A;  1HZU A;  1HZV A;  4AAM A;  1C2N A;  2D0S A;  1CRH A;  1CHH A;  1H9Y A;  1QYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...