2D0WA

Crystal structure of cytochrome cl from hyphomicrobium denitrificans
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
168
structure length
168
Chain Sequence
AQEVFRNTVTGEALDVEGQAPKEGRDTPAVKQFMQTGVDPYVEVAGCLPKGEEIYLESCSGCHGHIGEGKVGPGLNDSYWTYPKNTTDKGLFETIFGGANGMMGPHGQDLELDNMLKLIAWIRHIQKDDVADADWLSDEQKKNFKPFDIKAWEATGKAAAEKAQCKIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cytochrome cL
publication title Crystal structures of cytochrome c(L) and methanol dehydrogenase from Hyphomicrobium denitrificans: structural and mechanistic insights into interactions between the two proteins
pubmed doi rcsb
molecule tags Electron transport
total genus 52
structure length 168
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13442 Cytochrome_CBB3 Cytochrome C oxidase, cbb3-type, subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2d0wA00
4YE1A 1J3SA 1KYOD 2GIWA 3ZIYA 1C2RA 1DW0A 5KLIB 1DIIC 1YCCA 3O5CA 3OA8B 1A56A 2ZXYA 4NFGB 4FAVA 3H1JD 4L3GA 2L4DA 3ZOXA 1H33B 2A06D 2ZONG 2OZ1B 3JBTB 1HJ3A 3MK7C 5CIHB 1HZVA 2B4ZA 1NTMD 1MZ4A 3ZOOA 2V07A 5DJQB 1A8CA 1I8PA 1CRIA 2XTSB 2JQRA 1SQBD 1LC2A 2C2CA 2ORLA 4K3IA 4EICA 3ZOWA 4FANA 4KMGA 2PCBB 1H9XA 1IRWA 3KZIV 1YEBA 3M97X 2C1DA 4WQDA 1M6ZA 1IQCA 1F1FA 1LC1A 4J20A 1CYCA 3PXSA 1SQPD 3H1ID 4U3FD 1FOCA 1IRVA 1LFMA 3WFDC 1CTYA 1RZ5A 1CC5A 4LJIA 5B66V 1AYGA 1FI3A 1YNRA 1F1CA 5AURA 3WFBC 1QKSA 2BH5X 3OCDA 2HV4A 4WQ8A 4XXLA 2FWLA 3L70D 4V2KA 1L9BC 4AX3A 1CHHA 1CYJA 1CHIA 3HQ6A 2C1DB 1MG3D 1N50A 2QJYB 1I5TA 5TISV 1GIWA 1I6EA 3L72D 1YEAA 2C1VA 4H0JA 3NWVA 1CIHA 4FA1A 1HROA 1AKKA 1YFCA 1H32A 1YIQA 1RZ6A 2GC4D 1ZRTD 1H33A 2GB8B 2CE1A 3HQ7A 1C75A 4PD4D 4RSZA 2OZ1A 1N9CA 4EIFA 3L74D 4WQAA 3RMZA 2N9JA 2JTIB 3PH2B 4PJ0V 1HZUA 2C9XB 3L75D 3ORVA 2CA4B 3MK7B 2D0SA 3VRDA 1L0LD 2AI5A 4P4QB 351CA 3L73D 1FHBA 2CA3B 5CYTR 4N0KA 2BGVX 1CCHA 1QL4A 2C1UA 2N18C 1NMIA 1H32B 1DW2A 2ZOOA 3WFEC 1ZZHA 3SVWA 1LS9A 4WQEA 1CIEA 2I8FA 3L4MA 4WQ9A 2B12B 1BL9A 1GDVA 1IO3A 1K3GA 2ZZS1 1CCRA 1YICA 1KX2A 1C2NA 3TYIA 5E79V 1C6OA 3CP5A 1WVEC 3O20A 1W5CT 2DVHA 1NNOA 1CSWA 2QJKB 1NMLA 4UB8V 1DT1A 3TGUD 3DMIA 4Y5RA 5DF5A 1CTJA 4JCGA 1HH7A 1FI7A 2MTAC 5KKZB 4QAOA 3BCCD 3C2CA 3CXHW 3RLMA 2BPBB 1FJ0A 1CRCA 4GEDB 2LITA 1I54A 1C6SA 5CIFB 4Q5PA 1E2RA 2DGEA 1M60A 4XYDB 5H2FV 1DIQC 1SQQD 2PCCB 1RAPA 3CU4A 1LMSA 1CHJA 5C9MA 1HCMA 2MHMA 3WFCC 1I8OA 2BLFB 4DY9A 1H1OA 1H9YA 1M70A 1E29A 2VHDA 4H0KA 5KAFV 1JDLA 5B6QA 1R0QA 1PP9D 1CSXA 1S6VB 3CYTI 1DVHA 1CRJA 1KYOW 1H31B 2FRCA 3X39A 1HJ4A 4AAMA 3DR0A 1GJQA 4IL6V 5CIDB 1CIFA 1CORA 4O1QA 4FB1A 5DFSA 3A9FA 2QJPB 155CA 2AXTV 1NIRA 2FYUD 1HRCA 1C52A 1IZL0 3L4OA 1P84D 2N18B 3H1HD 4O1WA 1FI9A 1I55A 3SLEA 1AOQA 1W2LA 4PWAA 1GQ1A 1KIBA 1YTCA 2B0ZB 1QYZA 1CRYA 4L1QA 2LIRA 1CRHA 2GC7D 1CXAA 4FA5A 2N9IA 1U74B 1PPJD 1MG2D 3ZBMA 1VYDA 5B5EV 1CSUA 1EZVD 1C7MA 5EXQA 3WC8A 1FCDC 2B11B 1KV9A 2YIUB 5CIGB 1EB7A 5CICB 2N3BA 1KX7A 2AIUA 4L3HA 3VNWA 1BE3D 1CYIA 2PACA 2B10B 1AOFA 3HQ9A 2IBZD 3NBSA 5IY51 4AALA 2EXVA 3O1YA 2BH4X 1OCDA 4EIEA 1DW1A 3VYMA 3CWBD 3SWSA 451CA 3H1LD 1H31A 1ETPA 1E8EA 4GYDA 2CXBA 2BCNB 3CX5W 1OAEA 1DVVA 3ZOYA 4MU8A 2CE0A 1CTZA 3O0RC 5DJQC 4AANA 3SJLA 1L9JC 1CNOA 1QL3A 1GKSA 1NTZD 3WUIA 1N15A 3WU2V 2ZBOA 5KLVD 3PXTA 4PW9B 5CIBB 4WQBA 5GTHV 1I6DA 1CO6A 1BCCD 1L0ND 1HJ5A 3ZCFA 1C6RA 3RN0A 1SQXD 2YQBA 4WQ7A 4D6TD 3NBTA 1COTA 2FYNB 2N3YA 1S5LV 1A2SA 1B7VA 1NTKD 2YK3A 5CIEB 1KB9D 1QN2A 1CRGA 2YCCA 1CIGA 1CEDA 5C0ZA 1U75B 3A0HV 1SQVD 3L71D 1DW3A 4EIDA 4UB6V 2C8SA 3CXHD 2V08A 3DP5A 3HQ8A 3PXWA 4WQCA 3CX5D 3OA8A 3H1KD 4AAOA 1CXCA 3SXTA 1WEJF 3A0BV 1GU2A 1K3HA 1RAQA 1KB0A 2D0WA 1CSVA 2BCCD 3OCDB 1NU1D 4FA4A 1BGYD 1N90A 4FA9A 5GTIV 3RN1A 5KAIV
chains in the Genus database with same CATH superfamily
4YE1A 1J3SA 1KYOD 2GIWA 3ZIYA 1C2RA 1DW0A 5KLIB 1DIIC 1YCCA 3O5CA 3OA8B 1A56A 2ZXYA 4NFGB 4FAVA 3H1JD 4L3GA 2L4DA 3ZOXA 1H33B 2A06D 2ZONG 2OZ1B 3JBTB 1HJ3A 3MK7C 5CIHB 1HZVA 2B4ZA 1NTMD 1MZ4A 3ZOOA 2V07A 5DJQB 1A8CA 1I8PA 1CRIA 2XTSB 2JQRA 1SQBD 1LC2A 2C2CA 2ORLA 4K3IA 4EICA 3ZOWA 4FANA 4KMGA 2PCBB 1H9XA 1IRWA 3KZIV 1YEBA 3M97X 2C1DA 4WQDA 1M6ZA 1IQCA 1F1FA 1LC1A 4J20A 1CYCA 3PXSA 1SQPD 3H1ID 4U3FD 1FOCA 1IRVA 1LFMA 3WFDC 1CTYA 1RZ5A 1CC5A 4LJIA 5B66V 1AYGA 1FI3A 1YNRA 1F1CA 5AURA 3WFBC 1QKSA 2BH5X 3OCDA 2HV4A 4WQ8A 4XXLA 2FWLA 3L70D 4V2KA 1L9BC 4AX3A 1CHHA 1CYJA 1CHIA 3HQ6A 2C1DB 1MG3D 1N50A 2QJYB 1I5TA 5TISV 1GIWA 1I6EA 3L72D 1YEAA 2C1VA 4H0JA 3NWVA 1CIHA 4FA1A 1HROA 1AKKA 1YFCA 1H32A 1YIQA 1RZ6A 2GC4D 1ZRTD 1H33A 2GB8B 2CE1A 3HQ7A 1C75A 4PD4D 4RSZA 2OZ1A 1N9CA 4EIFA 3L74D 4WQAA 3RMZA 2N9JA 2JTIB 3PH2B 4PJ0V 1HZUA 2C9XB 3L75D 3ORVA 2CA4B 3MK7B 2D0SA 3VRDA 1L0LD 2AI5A 4P4QB 351CA 3L73D 1FHBA 2CA3B 5CYTR 4N0KA 2BGVX 1CCHA 1QL4A 2C1UA 2N18C 1NMIA 1H32B 1DW2A 2ZOOA 3WFEC 1ZZHA 3SVWA 1LS9A 4WQEA 1CIEA 2I8FA 3L4MA 4WQ9A 2B12B 1BL9A 1GDVA 1IO3A 1K3GA 2ZZS1 1CCRA 1YICA 1KX2A 1C2NA 3TYIA 5E79V 1C6OA 3CP5A 1WVEC 3O20A 1W5CT 2DVHA 1NNOA 1CSWA 2QJKB 1NMLA 4UB8V 1DT1A 3TGUD 3DMIA 4Y5RA 5DF5A 1CTJA 4JCGA 1HH7A 1FI7A 2MTAC 5KKZB 4QAOA 3BCCD 3C2CA 3CXHW 3RLMA 2BPBB 1FJ0A 1CRCA 4GEDB 2LITA 1I54A 1C6SA 5CIFB 4Q5PA 1E2RA 2DGEA 1M60A 4XYDB 5H2FV 1DIQC 1SQQD 2PCCB 1RAPA 3CU4A 1LMSA 1CHJA 5C9MA 1HCMA 2MHMA 3WFCC 1I8OA 2BLFB 4DY9A 1H1OA 1H9YA 1M70A 1E29A 2VHDA 4H0KA 5KAFV 1JDLA 5B6QA 1R0QA 1PP9D 1CSXA 1S6VB 3CYTI 3D0WA 1DVHA 1CRJA 1KYOW 1H31B 2FRCA 3X39A 1HJ4A 4AAMA 3DR0A 1GJQA 4IL6V 5CIDB 1CIFA 1CORA 4O1QA 4FB1A 5DFSA 3A9FA 2QJPB 155CA 2AXTV 1NIRA 2FYUD 1HRCA 1C52A 1IZL0 3L4OA 1P84D 2N18B 3H1HD 4O1WA 1FI9A 1I55A 3SLEA 1AOQA 1W2LA 4PWAA 1GQ1A 1KIBA 1YTCA 2B0ZB 1QYZA 1CRYA 4L1QA 2LIRA 1CRHA 2GC7D 1CXAA 4FA5A 2N9IA 1U74B 1PPJD 1MG2D 3ZBMA 1VYDA 5B5EV 1CSUA 1EZVD 1C7MA 5EXQA 3WC8A 1FCDC 2B11B 1KV9A 2YIUB 5CIGB 1EB7A 5CICB 2N3BA 1KX7A 2AIUA 4L3HA 3VNWA 1BE3D 1CYIA 2PACA 2B10B 1AOFA 3HQ9A 2IBZD 3NBSA 5IY51 4AALA 2EXVA 3O1YA 2BH4X 1OCDA 4EIEA 1DW1A 3VYMA 3CWBD 3SWSA 451CA 3H1LD 1H31A 1ETPA 1E8EA 4GYDA 2CXBA 2BCNB 3CX5W 1OAEA 1DVVA 3ZOYA 4MU8A 2CE0A 1CTZA 3O0RC 5DJQC 4AANA 3SJLA 1L9JC 1CNOA 1QL3A 1GKSA 1NTZD 3WUIA 1N15A 3WU2V 2ZBOA 5KLVD 3PXTA 4PW9B 5CIBB 4WQBA 5GTHV 1I6DA 1CO6A 1BCCD 1L0ND 1HJ5A 3ZCFA 1C6RA 3RN0A 1SQXD 2YQBA 4WQ7A 4D6TD 3NBTA 1COTA 2FYNB 2N3YA 1S5LV 1A2SA 1B7VA 1NTKD 2YK3A 5CIEB 1KB9D 1QN2A 1CRGA 2YCCA 1CIGA 1CEDA 5C0ZA 1U75B 3A0HV 1SQVD 3L71D 1DW3A 4EIDA 4UB6V 2C8SA 3CXHD 2V08A 3DP5A 3HQ8A 3PXWA 4WQCA 3CX5D 3OA8A 3H1KD 4AAOA 1CXCA 3SXTA 1WEJF 3A0BV 1GU2A 1K3HA 1RAQA 1KB0A 2D0WA 1CSVA 2BCCD 3OCDB 1NU1D 4FA4A 1BGYD 1N90A 4FA9A 5GTIV 3RN1A 5KAIV
chains in the Genus database with same CATH topology
4YE1A 1J3SA 1KYOD 2GIWA 3ZIYA 1C2RA 1DW0A 5KLIB 1DIIC 1YCCA 3O5CA 3OA8B 1A56A 2ZXYA 4NFGB 4FAVA 3H1JD 4L3GA 2L4DA 3ZOXA 1H33B 2A06D 2ZONG 2OZ1B 3JBTB 1HJ3A 3MK7C 5CIHB 1HZVA 2B4ZA 1NTMD 1MZ4A 3ZOOA 2V07A 5DJQB 1A8CA 1I8PA 1CRIA 2XTSB 2JQRA 1SQBD 1LC2A 2C2CA 2ORLA 4K3IA 4EICA 3ZOWA 4FANA 4KMGA 2PCBB 1H9XA 1IRWA 3KZIV 1YEBA 3M97X 2C1DA 4WQDA 1M6ZA 1IQCA 1F1FA 1LC1A 4J20A 1CYCA 3PXSA 1SQPD 3H1ID 4U3FD 1FOCA 1IRVA 1LFMA 3WFDC 1CTYA 1RZ5A 1CC5A 4LJIA 5B66V 1AYGA 1FI3A 1YNRA 1F1CA 5AURA 3WFBC 1QKSA 2BH5X 3OCDA 2HV4A 4WQ8A 4XXLA 2FWLA 3L70D 4V2KA 1L9BC 4AX3A 1CHHA 1CYJA 1CHIA 3HQ6A 2C1DB 1MG3D 1N50A 2QJYB 1I5TA 5TISV 1GIWA 1I6EA 3L72D 1YEAA 2C1VA 4H0JA 3NWVA 1CIHA 4FA1A 1HROA 1AKKA 1YFCA 1H32A 1YIQA 1RZ6A 2GC4D 1ZRTD 1H33A 2GB8B 2CE1A 3HQ7A 1C75A 4PD4D 4RSZA 2OZ1A 1N9CA 4EIFA 3L74D 4WQAA 3RMZA 2N9JA 2JTIB 3PH2B 4PJ0V 1HZUA 2C9XB 3L75D 3ORVA 2CA4B 3MK7B 2D0SA 3VRDA 1L0LD 2AI5A 4P4QB 351CA 3L73D 1FHBA 2CA3B 5CYTR 4N0KA 2BGVX 1CCHA 1QL4A 2C1UA 2N18C 1NMIA 1H32B 1DW2A 2ZOOA 3WFEC 1ZZHA 3SVWA 1LS9A 4WQEA 1CIEA 2I8FA 3L4MA 4WQ9A 2B12B 1BL9A 1GDVA 1IO3A 1K3GA 2ZZS1 1CCRA 1YICA 1KX2A 1C2NA 3TYIA 5E79V 1C6OA 3CP5A 1WVEC 3O20A 1W5CT 2DVHA 1NNOA 1CSWA 2QJKB 1NMLA 4UB8V 1DT1A 3TGUD 3DMIA 4Y5RA 5DF5A 1CTJA 4JCGA 1HH7A 1FI7A 2MTAC 5KKZB 4QAOA 3BCCD 3C2CA 3CXHW 3RLMA 2BPBB 1FJ0A 1CRCA 4GEDB 2LITA 1I54A 1C6SA 5CIFB 4Q5PA 1E2RA 2DGEA 1M60A 4XYDB 5H2FV 1DIQC 1SQQD 2PCCB 1RAPA 3CU4A 1LMSA 1CHJA 5C9MA 1HCMA 2MHMA 3WFCC 1I8OA 2BLFB 4DY9A 1H1OA 1H9YA 1M70A 1E29A 2VHDA 4H0KA 5KAFV 1JDLA 5B6QA 1R0QA 1PP9D 1CSXA 1S6VB 3CYTI 1DVHA 1CRJA 1KYOW 1H31B 2FRCA 3X39A 1HJ4A 4AAMA 3DR0A 1GJQA 4IL6V 5CIDB 1CIFA 1CORA 4O1QA 4FB1A 5DFSA 3A9FA 2QJPB 155CA 2AXTV 1NIRA 2FYUD 1HRCA 1C52A 1IZL0 3L4OA 1P84D 2N18B 3H1HD 4O1WA 1FI9A 1I55A 3SLEA 1AOQA 1W2LA 4PWAA 1GQ1A 1KIBA 1YTCA 2B0ZB 1QYZA 1CRYA 4L1QA 2LIRA 1CRHA 2GC7D 1CXAA 4FA5A 2N9IA 1U74B 1PPJD 1MG2D 3ZBMA 1VYDA 5B5EV 1CSUA 1EZVD 1C7MA 5EXQA 3WC8A 1FCDC 2B11B 1KV9A 2YIUB 5CIGB 1EB7A 5CICB 2N3BA 1KX7A 2AIUA 4L3HA 3VNWA 1BE3D 1CYIA 2PACA 2B10B 1AOFA 3HQ9A 2IBZD 3NBSA 5IY51 4AALA 2EXVA 3O1YA 2BH4X 1OCDA 4EIEA 1DW1A 3VYMA 3CWBD 3SWSA 451CA 3H1LD 1H31A 1ETPA 1E8EA 4GYDA 2CXBA 2BCNB 3CX5W 1OAEA 1DVVA 3ZOYA 4MU8A 2CE0A 1CTZA 3O0RC 5DJQC 4AANA 3SJLA 1L9JC 1CNOA 1QL3A 1GKSA 1NTZD 3WUIA 1N15A 3WU2V 2ZBOA 5KLVD 3PXTA 4PW9B 5CIBB 4WQBA 5GTHV 1I6DA 1CO6A 1BCCD 1L0ND 1HJ5A 3ZCFA 1C6RA 3RN0A 1SQXD 2YQBA 4WQ7A 4D6TD 3NBTA 1COTA 2FYNB 2N3YA 1S5LV 1A2SA 1B7VA 1NTKD 2YK3A 5CIEB 1KB9D 1QN2A 1CRGA 2YCCA 1CIGA 1CEDA 5C0ZA 1U75B 3A0HV 1SQVD 3L71D 1DW3A 4EIDA 4UB6V 2C8SA 3CXHD 2V08A 3DP5A 3HQ8A 3PXWA 4WQCA 3CX5D 3OA8A 3H1KD 4AAOA 1CXCA 3SXTA 1WEJF 3A0BV 1GU2A 1K3HA 1RAQA 1KB0A 2D0WA 1CSVA 2BCCD 3OCDB 1NU1D 4FA4A 1BGYD 1N90A 4FA9A 5GTIV 3RN1A 5KAIV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YE1 A;  1J3S A;  1KYO D;  2GIW A;  3ZIY A;  1C2R A;  1DW0 A;  5KLI B;  1DII C;  1YCC A;  3O5C A;  3OA8 B;  1A56 A;  2ZXY A;  4NFG B;  4FAV A;  3H1J D;  4L3G A;  2L4D A;  3ZOX A;  1H33 B;  2A06 D;  2ZON G;  2OZ1 B;  3JBT B;  1HJ3 A;  3MK7 C;  5CIH B;  1HZV A;  2B4Z A;  1NTM D;  1MZ4 A;  3ZOO A;  2V07 A;  5DJQ B;  1A8C A;  1I8P A;  1CRI A;  2XTS B;  2JQR A;  1SQB D;  1LC2 A;  2C2C A;  2ORL A;  4K3I A;  4EIC A;  3ZOW A;  4FAN A;  4KMG A;  2PCB B;  1H9X A;  1IRW A;  3KZI V;  1YEB A;  3M97 X;  2C1D A;  4WQD A;  1M6Z A;  1IQC A;  1F1F A;  1LC1 A;  4J20 A;  1CYC A;  3PXS A;  1SQP D;  3H1I D;  4U3F D;  1FOC A;  1IRV A;  1LFM A;  3WFD C;  1CTY A;  1RZ5 A;  1CC5 A;  4LJI A;  5B66 V;  1AYG A;  1FI3 A;  1YNR A;  1F1C A;  5AUR A;  3WFB C;  1QKS A;  2BH5 X;  3OCD A;  2HV4 A;  4WQ8 A;  4XXL A;  2FWL A;  3L70 D;  4V2K A;  1L9B C;  4AX3 A;  1CHH A;  1CYJ A;  1CHI A;  3HQ6 A;  2C1D B;  1MG3 D;  1N50 A;  2QJY B;  1I5T A;  5TIS V;  1GIW A;  1I6E A;  3L72 D;  1YEA A;  2C1V A;  4H0J A;  3NWV A;  1CIH A;  4FA1 A;  1HRO A;  1AKK A;  1YFC A;  1H32 A;  1YIQ A;  1RZ6 A;  2GC4 D;  1ZRT D;  1H33 A;  2GB8 B;  2CE1 A;  3HQ7 A;  1C75 A;  4PD4 D;  4RSZ A;  2OZ1 A;  1N9C A;  4EIF A;  3L74 D;  4WQA A;  3RMZ A;  2N9J A;  2JTI B;  3PH2 B;  4PJ0 V;  1HZU A;  2C9X B;  3L75 D;  3ORV A;  2CA4 B;  3MK7 B;  2D0S A;  3VRD A;  1L0L D;  2AI5 A;  4P4Q B;  351C A;  3L73 D;  1FHB A;  2CA3 B;  5CYT R;  4N0K A;  2BGV X;  1CCH A;  1QL4 A;  2C1U A;  2N18 C;  1NMI A;  1H32 B;  1DW2 A;  2ZOO A;  3WFE C;  1ZZH A;  3SVW A;  1LS9 A;  4WQE A;  1CIE A;  2I8F A;  3L4M A;  4WQ9 A;  2B12 B;  1BL9 A;  1GDV A;  1IO3 A;  1K3G A;  2ZZS 1;  1CCR A;  1YIC A;  1KX2 A;  1C2N A;  3TYI A;  5E79 V;  1C6O A;  3CP5 A;  1WVE C;  3O20 A;  1W5C T;  2DVH A;  1NNO A;  1CSW A;  2QJK B;  1NML A;  4UB8 V;  1DT1 A;  3TGU D;  3DMI A;  4Y5R A;  5DF5 A;  1CTJ A;  4JCG A;  1HH7 A;  1FI7 A;  2MTA C;  5KKZ B;  4QAO A;  3BCC D;  3C2C A;  3CXH W;  3RLM A;  2BPB B;  1FJ0 A;  1CRC A;  4GED B;  2LIT A;  1I54 A;  1C6S A;  5CIF B;  4Q5P A;  1E2R A;  2DGE A;  1M60 A;  4XYD B;  5H2F V;  1DIQ C;  1SQQ D;  2PCC B;  1RAP A;  3CU4 A;  1LMS A;  1CHJ A;  5C9M A;  1HCM A;  2MHM A;  3WFC C;  1I8O A;  2BLF B;  4DY9 A;  1H1O A;  1H9Y A;  1M70 A;  1E29 A;  2VHD A;  4H0K A;  5KAF V;  1JDL A;  5B6Q A;  1R0Q A;  1PP9 D;  1CSX A;  1S6V B;  3CYT I;  1DVH A;  1CRJ A;  1KYO W;  1H31 B;  2FRC A;  3X39 A;  1HJ4 A;  4AAM A;  3DR0 A;  1GJQ A;  4IL6 V;  5CID B;  1CIF A;  1COR A;  4O1Q A;  4FB1 A;  5DFS A;  3A9F A;  2QJP B;  155C A;  2AXT V;  1NIR A;  2FYU D;  1HRC A;  1C52 A;  1IZL 0;  3L4O A;  1P84 D;  2N18 B;  3H1H D;  4O1W A;  1FI9 A;  1I55 A;  3SLE A;  1AOQ A;  1W2L A;  4PWA A;  1GQ1 A;  1KIB A;  1YTC A;  2B0Z B;  1QYZ A;  1CRY A;  4L1Q A;  2LIR A;  1CRH A;  2GC7 D;  1CXA A;  4FA5 A;  2N9I A;  1U74 B;  1PPJ D;  1MG2 D;  3ZBM A;  1VYD A;  5B5E V;  1CSU A;  1EZV D;  1C7M A;  5EXQ A;  3WC8 A;  1FCD C;  2B11 B;  1KV9 A;  2YIU B;  5CIG B;  1EB7 A;  5CIC B;  2N3B A;  1KX7 A;  2AIU A;  4L3H A;  3VNW A;  1BE3 D;  1CYI A;  2PAC A;  2B10 B;  1AOF A;  3HQ9 A;  2IBZ D;  3NBS A;  5IY5 1;  4AAL A;  2EXV A;  3O1Y A;  2BH4 X;  1OCD A;  4EIE A;  1DW1 A;  3VYM A;  3CWB D;  3SWS A;  451C A;  3H1L D;  1H31 A;  1ETP A;  1E8E A;  4GYD A;  2CXB A;  2BCN B;  3CX5 W;  1OAE A;  1DVV A;  3ZOY A;  4MU8 A;  2CE0 A;  1CTZ A;  3O0R C;  5DJQ C;  4AAN A;  3SJL A;  1L9J C;  1CNO A;  1QL3 A;  1GKS A;  1NTZ D;  3WUI A;  1N15 A;  3WU2 V;  2ZBO A;  5KLV D;  3PXT A;  4PW9 B;  5CIB B;  4WQB A;  5GTH V;  1I6D A;  1CO6 A;  1BCC D;  1L0N D;  1HJ5 A;  3ZCF A;  1C6R A;  3RN0 A;  1SQX D;  2YQB A;  4WQ7 A;  4D6T D;  3NBT A;  1COT A;  2FYN B;  2N3Y A;  1S5L V;  1A2S A;  1B7V A;  1NTK D;  2YK3 A;  5CIE B;  1KB9 D;  1QN2 A;  1CRG A;  2YCC A;  1CIG A;  1CED A;  5C0Z A;  1U75 B;  3A0H V;  1SQV D;  3L71 D;  1DW3 A;  4EID A;  4UB6 V;  2C8S A;  3CXH D;  2V08 A;  3DP5 A;  3HQ8 A;  3PXW A;  4WQC A;  3CX5 D;  3OA8 A;  3H1K D;  4AAO A;  1CXC A;  3SXT A;  1WEJ F;  3A0B V;  1GU2 A;  1K3H A;  1RAQ A;  1KB0 A;  2D0W A;  1CSV A;  2BCC D;  3OCD B;  1NU1 D;  4FA4 A;  1BGY D;  1N90 A;  4FA9 A;  5GTI V;  3RN1 A;  5KAI V; 
#chains in the Genus database with same CATH topology
 4YE1 A;  1J3S A;  1KYO D;  2GIW A;  3ZIY A;  1C2R A;  1DW0 A;  5KLI B;  1DII C;  1YCC A;  3O5C A;  3OA8 B;  1A56 A;  2ZXY A;  4NFG B;  4FAV A;  3H1J D;  4L3G A;  2L4D A;  3ZOX A;  1H33 B;  2A06 D;  2ZON G;  2OZ1 B;  3JBT B;  1HJ3 A;  3MK7 C;  5CIH B;  1HZV A;  2B4Z A;  1NTM D;  1MZ4 A;  3ZOO A;  2V07 A;  5DJQ B;  1A8C A;  1I8P A;  1CRI A;  2XTS B;  2JQR A;  1SQB D;  1LC2 A;  2C2C A;  2ORL A;  4K3I A;  4EIC A;  3ZOW A;  4FAN A;  4KMG A;  2PCB B;  1H9X A;  1IRW A;  3KZI V;  1YEB A;  3M97 X;  2C1D A;  4WQD A;  1M6Z A;  1IQC A;  1F1F A;  1LC1 A;  4J20 A;  1CYC A;  3PXS A;  1SQP D;  3H1I D;  4U3F D;  1FOC A;  1IRV A;  1LFM A;  3WFD C;  1CTY A;  1RZ5 A;  1CC5 A;  4LJI A;  5B66 V;  1AYG A;  1FI3 A;  1YNR A;  1F1C A;  5AUR A;  3WFB C;  1QKS A;  2BH5 X;  3OCD A;  2HV4 A;  4WQ8 A;  4XXL A;  2FWL A;  3L70 D;  4V2K A;  1L9B C;  4AX3 A;  1CHH A;  1CYJ A;  1CHI A;  3HQ6 A;  2C1D B;  1MG3 D;  1N50 A;  2QJY B;  1I5T A;  5TIS V;  1GIW A;  1I6E A;  3L72 D;  1YEA A;  2C1V A;  4H0J A;  3NWV A;  1CIH A;  4FA1 A;  1HRO A;  1AKK A;  1YFC A;  1H32 A;  1YIQ A;  1RZ6 A;  2GC4 D;  1ZRT D;  1H33 A;  2GB8 B;  2CE1 A;  3HQ7 A;  1C75 A;  4PD4 D;  4RSZ A;  2OZ1 A;  1N9C A;  4EIF A;  3L74 D;  4WQA A;  3RMZ A;  2N9J A;  2JTI B;  3PH2 B;  4PJ0 V;  1HZU A;  2C9X B;  3L75 D;  3ORV A;  2CA4 B;  3MK7 B;  2D0S A;  3VRD A;  1L0L D;  2AI5 A;  4P4Q B;  351C A;  3L73 D;  1FHB A;  2CA3 B;  5CYT R;  4N0K A;  2BGV X;  1CCH A;  1QL4 A;  2C1U A;  2N18 C;  1NMI A;  1H32 B;  1DW2 A;  2ZOO A;  3WFE C;  1ZZH A;  3SVW A;  1LS9 A;  4WQE A;  1CIE A;  2I8F A;  3L4M A;  4WQ9 A;  2B12 B;  1BL9 A;  1GDV A;  1IO3 A;  1K3G A;  2ZZS 1;  1CCR A;  1YIC A;  1KX2 A;  1C2N A;  3TYI A;  5E79 V;  1C6O A;  3CP5 A;  1WVE C;  3O20 A;  1W5C T;  2DVH A;  1NNO A;  1CSW A;  2QJK B;  1NML A;  4UB8 V;  1DT1 A;  3TGU D;  3DMI A;  4Y5R A;  5DF5 A;  1CTJ A;  4JCG A;  1HH7 A;  1FI7 A;  2MTA C;  5KKZ B;  4QAO A;  3BCC D;  3C2C A;  3CXH W;  3RLM A;  2BPB B;  1FJ0 A;  1CRC A;  4GED B;  2LIT A;  1I54 A;  1C6S A;  5CIF B;  4Q5P A;  1E2R A;  2DGE A;  1M60 A;  4XYD B;  5H2F V;  1DIQ C;  1SQQ D;  2PCC B;  1RAP A;  3CU4 A;  1LMS A;  1CHJ A;  5C9M A;  1HCM A;  2MHM A;  3WFC C;  1I8O A;  2BLF B;  4DY9 A;  1H1O A;  1H9Y A;  1M70 A;  1E29 A;  2VHD A;  4H0K A;  5KAF V;  1JDL A;  5B6Q A;  1R0Q A;  1PP9 D;  1CSX A;  1S6V B;  3CYT I;  3D0W A;  1DVH A;  1CRJ A;  1KYO W;  1H31 B;  2FRC A;  3X39 A;  1HJ4 A;  4AAM A;  3DR0 A;  1GJQ A;  4IL6 V;  5CID B;  1CIF A;  1COR A;  4O1Q A;  4FB1 A;  5DFS A;  3A9F A;  2QJP B;  155C A;  2AXT V;  1NIR A;  2FYU D;  1HRC A;  1C52 A;  1IZL 0;  3L4O A;  1P84 D;  2N18 B;  3H1H D;  4O1W A;  1FI9 A;  1I55 A;  3SLE A;  1AOQ A;  1W2L A;  4PWA A;  1GQ1 A;  1KIB A;  1YTC A;  2B0Z B;  1QYZ A;  1CRY A;  4L1Q A;  2LIR A;  1CRH A;  2GC7 D;  1CXA A;  4FA5 A;  2N9I A;  1U74 B;  1PPJ D;  1MG2 D;  3ZBM A;  1VYD A;  5B5E V;  1CSU A;  1EZV D;  1C7M A;  5EXQ A;  3WC8 A;  1FCD C;  2B11 B;  1KV9 A;  2YIU B;  5CIG B;  1EB7 A;  5CIC B;  2N3B A;  1KX7 A;  2AIU A;  4L3H A;  3VNW A;  1BE3 D;  1CYI A;  2PAC A;  2B10 B;  1AOF A;  3HQ9 A;  2IBZ D;  3NBS A;  5IY5 1;  4AAL A;  2EXV A;  3O1Y A;  2BH4 X;  1OCD A;  4EIE A;  1DW1 A;  3VYM A;  3CWB D;  3SWS A;  451C A;  3H1L D;  1H31 A;  1ETP A;  1E8E A;  4GYD A;  2CXB A;  2BCN B;  3CX5 W;  1OAE A;  1DVV A;  3ZOY A;  4MU8 A;  2CE0 A;  1CTZ A;  3O0R C;  5DJQ C;  4AAN A;  3SJL A;  1L9J C;  1CNO A;  1QL3 A;  1GKS A;  1NTZ D;  3WUI A;  1N15 A;  3WU2 V;  2ZBO A;  5KLV D;  3PXT A;  4PW9 B;  5CIB B;  4WQB A;  5GTH V;  1I6D A;  1CO6 A;  1BCC D;  1L0N D;  1HJ5 A;  3ZCF A;  1C6R A;  3RN0 A;  1SQX D;  2YQB A;  4WQ7 A;  4D6T D;  3NBT A;  1COT A;  2FYN B;  2N3Y A;  1S5L V;  1A2S A;  1B7V A;  1NTK D;  2YK3 A;  5CIE B;  1KB9 D;  1QN2 A;  1CRG A;  2YCC A;  1CIG A;  1CED A;  5C0Z A;  1U75 B;  3A0H V;  1SQV D;  3L71 D;  1DW3 A;  4EID A;  4UB6 V;  2C8S A;  3CXH D;  2V08 A;  3DP5 A;  3HQ8 A;  3PXW A;  4WQC A;  3CX5 D;  3OA8 A;  3H1K D;  4AAO A;  1CXC A;  3SXT A;  1WEJ F;  3A0B V;  1GU2 A;  1K3H A;  1RAQ A;  1KB0 A;  2D0W A;  1CSV A;  2BCC D;  3OCD B;  1NU1 D;  4FA4 A;  1BGY D;  1N90 A;  4FA9 A;  5GTI V;  3RN1 A;  5KAI V; 
#chains in the Genus database with same CATH homology
 4YE1 A;  1J3S A;  1KYO D;  2GIW A;  3ZIY A;  1C2R A;  1DW0 A;  5KLI B;  1DII C;  1YCC A;  3O5C A;  3OA8 B;  1A56 A;  2ZXY A;  4NFG B;  4FAV A;  3H1J D;  4L3G A;  2L4D A;  3ZOX A;  1H33 B;  2A06 D;  2ZON G;  2OZ1 B;  3JBT B;  1HJ3 A;  3MK7 C;  5CIH B;  1HZV A;  2B4Z A;  1NTM D;  1MZ4 A;  3ZOO A;  2V07 A;  5DJQ B;  1A8C A;  1I8P A;  1CRI A;  2XTS B;  2JQR A;  1SQB D;  1LC2 A;  2C2C A;  2ORL A;  4K3I A;  4EIC A;  3ZOW A;  4FAN A;  4KMG A;  2PCB B;  1H9X A;  1IRW A;  3KZI V;  1YEB A;  3M97 X;  2C1D A;  4WQD A;  1M6Z A;  1IQC A;  1F1F A;  1LC1 A;  4J20 A;  1CYC A;  3PXS A;  1SQP D;  3H1I D;  4U3F D;  1FOC A;  1IRV A;  1LFM A;  3WFD C;  1CTY A;  1RZ5 A;  1CC5 A;  4LJI A;  5B66 V;  1AYG A;  1FI3 A;  1YNR A;  1F1C A;  5AUR A;  3WFB C;  1QKS A;  2BH5 X;  3OCD A;  2HV4 A;  4WQ8 A;  4XXL A;  2FWL A;  3L70 D;  4V2K A;  1L9B C;  4AX3 A;  1CHH A;  1CYJ A;  1CHI A;  3HQ6 A;  2C1D B;  1MG3 D;  1N50 A;  2QJY B;  1I5T A;  5TIS V;  1GIW A;  1I6E A;  3L72 D;  1YEA A;  2C1V A;  4H0J A;  3NWV A;  1CIH A;  4FA1 A;  1HRO A;  1AKK A;  1YFC A;  1H32 A;  1YIQ A;  1RZ6 A;  2GC4 D;  1ZRT D;  1H33 A;  2GB8 B;  2CE1 A;  3HQ7 A;  1C75 A;  4PD4 D;  4RSZ A;  2OZ1 A;  1N9C A;  4EIF A;  3L74 D;  4WQA A;  3RMZ A;  2N9J A;  2JTI B;  3PH2 B;  4PJ0 V;  1HZU A;  2C9X B;  3L75 D;  3ORV A;  2CA4 B;  3MK7 B;  2D0S A;  3VRD A;  1L0L D;  2AI5 A;  4P4Q B;  351C A;  3L73 D;  1FHB A;  2CA3 B;  5CYT R;  4N0K A;  2BGV X;  1CCH A;  1QL4 A;  2C1U A;  2N18 C;  1NMI A;  1H32 B;  1DW2 A;  2ZOO A;  3WFE C;  1ZZH A;  3SVW A;  1LS9 A;  4WQE A;  1CIE A;  2I8F A;  3L4M A;  4WQ9 A;  2B12 B;  1BL9 A;  1GDV A;  1IO3 A;  1K3G A;  2ZZS 1;  1CCR A;  1YIC A;  1KX2 A;  1C2N A;  3TYI A;  5E79 V;  1C6O A;  3CP5 A;  1WVE C;  3O20 A;  1W5C T;  2DVH A;  1NNO A;  1CSW A;  2QJK B;  1NML A;  4UB8 V;  1DT1 A;  3TGU D;  3DMI A;  4Y5R A;  5DF5 A;  1CTJ A;  4JCG A;  1HH7 A;  1FI7 A;  2MTA C;  5KKZ B;  4QAO A;  3BCC D;  3C2C A;  3CXH W;  3RLM A;  2BPB B;  1FJ0 A;  1CRC A;  4GED B;  2LIT A;  1I54 A;  1C6S A;  5CIF B;  4Q5P A;  1E2R A;  2DGE A;  1M60 A;  4XYD B;  5H2F V;  1DIQ C;  1SQQ D;  2PCC B;  1RAP A;  3CU4 A;  1LMS A;  1CHJ A;  5C9M A;  1HCM A;  2MHM A;  3WFC C;  1I8O A;  2BLF B;  4DY9 A;  1H1O A;  1H9Y A;  1M70 A;  1E29 A;  2VHD A;  4H0K A;  5KAF V;  1JDL A;  5B6Q A;  1R0Q A;  1PP9 D;  1CSX A;  1S6V B;  3CYT I;  1DVH A;  1CRJ A;  1KYO W;  1H31 B;  2FRC A;  3X39 A;  1HJ4 A;  4AAM A;  3DR0 A;  1GJQ A;  4IL6 V;  5CID B;  1CIF A;  1COR A;  4O1Q A;  4FB1 A;  5DFS A;  3A9F A;  2QJP B;  155C A;  2AXT V;  1NIR A;  2FYU D;  1HRC A;  1C52 A;  1IZL 0;  3L4O A;  1P84 D;  2N18 B;  3H1H D;  4O1W A;  1FI9 A;  1I55 A;  3SLE A;  1AOQ A;  1W2L A;  4PWA A;  1GQ1 A;  1KIB A;  1YTC A;  2B0Z B;  1QYZ A;  1CRY A;  4L1Q A;  2LIR A;  1CRH A;  2GC7 D;  1CXA A;  4FA5 A;  2N9I A;  1U74 B;  1PPJ D;  1MG2 D;  3ZBM A;  1VYD A;  5B5E V;  1CSU A;  1EZV D;  1C7M A;  5EXQ A;  3WC8 A;  1FCD C;  2B11 B;  1KV9 A;  2YIU B;  5CIG B;  1EB7 A;  5CIC B;  2N3B A;  1KX7 A;  2AIU A;  4L3H A;  3VNW A;  1BE3 D;  1CYI A;  2PAC A;  2B10 B;  1AOF A;  3HQ9 A;  2IBZ D;  3NBS A;  5IY5 1;  4AAL A;  2EXV A;  3O1Y A;  2BH4 X;  1OCD A;  4EIE A;  1DW1 A;  3VYM A;  3CWB D;  3SWS A;  451C A;  3H1L D;  1H31 A;  1ETP A;  1E8E A;  4GYD A;  2CXB A;  2BCN B;  3CX5 W;  1OAE A;  1DVV A;  3ZOY A;  4MU8 A;  2CE0 A;  1CTZ A;  3O0R C;  5DJQ C;  4AAN A;  3SJL A;  1L9J C;  1CNO A;  1QL3 A;  1GKS A;  1NTZ D;  3WUI A;  1N15 A;  3WU2 V;  2ZBO A;  5KLV D;  3PXT A;  4PW9 B;  5CIB B;  4WQB A;  5GTH V;  1I6D A;  1CO6 A;  1BCC D;  1L0N D;  1HJ5 A;  3ZCF A;  1C6R A;  3RN0 A;  1SQX D;  2YQB A;  4WQ7 A;  4D6T D;  3NBT A;  1COT A;  2FYN B;  2N3Y A;  1S5L V;  1A2S A;  1B7V A;  1NTK D;  2YK3 A;  5CIE B;  1KB9 D;  1QN2 A;  1CRG A;  2YCC A;  1CIG A;  1CED A;  5C0Z A;  1U75 B;  3A0H V;  1SQV D;  3L71 D;  1DW3 A;  4EID A;  4UB6 V;  2C8S A;  3CXH D;  2V08 A;  3DP5 A;  3HQ8 A;  3PXW A;  4WQC A;  3CX5 D;  3OA8 A;  3H1K D;  4AAO A;  1CXC A;  3SXT A;  1WEJ F;  3A0B V;  1GU2 A;  1K3H A;  1RAQ A;  1KB0 A;  2D0W A;  1CSV A;  2BCC D;  3OCD B;  1NU1 D;  4FA4 A;  1BGY D;  1N90 A;  4FA9 A;  5GTI V;  3RN1 A;  5KAI V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...