2D10A

Crystal structure of the radixin ferm domain complexed with the nherf-1 c-terminal tail peptide
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
295
structure length
295
Chain Sequence
KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for NHERF recognition by ERM proteins
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Radixin
total genus 79
structure length 295
sequence length 295
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2d10A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d10A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2d10A01
4OVVA 3AULA 4JGHB 4IM3A 4GZUA 5DCNA 3C0RB 2IY1B 3DQVA 1BT0A 2LULA 4ZRJA 4Z2MB 3ZTDA 4HJKA 2J0MA 5J18A 5FI1A 4NQKE 1OGWA 1MK9B 4CHJA 3L08A 3ODOA 3LJ3A 2MBQA 1UELA 2XK5A 3WAMA 3ZLZA 4II2B 3FEHA 4FA6A 2DYMA 2YSZA 2N4FA 1MIXA 4DHZE 4A6FA 2FUHB 2Z59B 1UEFA 2ZCCA 2M0XA 2YT0A 2LASA 2LBBA 3ULCA 2JZZA 2ZVNA 4G3XB 4WJPA 2LVPA 4WWNA 2LGXA 1JRUA 2N9XA 3SHQA 4J6IA 3PEGA 1WGDA 1YQBA 4FHKA 3VTUA 1U29A 3APDA 1DYNA 5IA7A 2KFJA 1RRPB 4I6LB 2UWQA 4MEMA 5CTRC 1KM7A 2ASQA 1WZ0A 2IBIB 3HM6X 1NI2A 4OVUA 3VVWB 1I35A 4K2OA 3M3JA 2YS3A 3U8ZA 4A5KA 4CHMA 1LQBA 3ZNHB 4BVUC 4ICUA 1X86A 1V86A 4FADA 4FULA 2BYFA 3FM8C 2LXCA 4ANVA 2ZJDA 1I7AA 1P3RA 2VRRB 3H6NA 4KIKA 2JT4B 1PFJA 4NAWA 4RM9A 4HB4B 2L76A 4HCPB 5AZHA 3L17A 4WSFA 5DH9B 1SIFA 2KJRA 3CSFA 3PT2B 4W9GA 3VAWA 3WANA 3N7CA 2MW5A 2DHKA 2LOXA 2H7DA 1UBQA 4WAAA 1WY8A 1WXMA 3P2BA 2RGFA 5DI9B 2GBKA 3IBEA 3ZNID 4BKSA 3DXCA 3SYXA 2L2IA 2DA0A 1FAOA 2R09A 3EC8A 2P0HA 4HPLB 2WX1A 1V5OA 2H7EA 3SV1A 5EFXA 2IZVB 2KZRA 2DKQA 1WMHA 5CX3A 3TBLD 5FI0A 2RGNB 4XX5A 2CAYA 1H10A 1LM8B 2KQSA 3EHVA 2CU1A 4RM8A 2DKPA 1WM3A 1IRSA 2RSGA 4GMXB 3H1UA 1E8YA 1PMSA 5E6PA 2RNRB 2CY4A 1WJUA 1XT9B 4LJOB 1KI1B 3PRPB 4IM0A 1T0YA 3SD5A 1X1FA 2X18A 1PLSA 2DAJA 1WXVA 4K7UA 1TXDA 2LD9A 2LGDA 2ZPNA 4A20A 3D8FA 3SNHA 4TKNA 3A8PA 2UZRA 5JHHA 1EUVB 3JW0X 1QC6A 1WGRA 3QC8B 4GU2A 4K7WA 4CYEA 2BF8B 2LYDA 1ZC4B 4WQOB 5IJMA 2K6QA 2IO3B 2MCNB 3W1SC 2MBBB 2O6VD 2N9PC 4WJOA 2NMBA 4F7GA 1WI1A 3CF6E 2FCSA 1DDMA 3QWMA 3SO6A 2Z0OA 1Q1OA 3PZDA 3DBSA 4MH0E 4II3B 2N1VA 4KIKB 2DZJA 1FGYA 1WH3A 1WG7A 4GB9A 1ZVRA 3KVFB 3RULA 3ZRCA 2XBBC 1X1GA 1V6EA 2JP2A 1SHCA 1UNQA 2OQBA 1QZEA 4MDKE 3KUDB 4Y94A 1S3SG 5J3QA 1LXDA 3PTFC 2O6VB 4GIVA 5L81A 2ZCBA 4ICVA 3SDLC 3TL5A 4K81A 4M0WB 4YONA 2QHOA 4MK0A 1Z2MA 1MAIA 1U5DA 3VOQA 2COCA 1X05A 1FHWA 1I42A 2D9WA 1BWNA 5CLQB 3ZNGC 1WJ1A 1W1GA 3GYOA 2KJ6A 4KHOA 1AQCA 2BKFA 2JPHA 2LUEA 2WWZA 4W9LA 4XC2A 1Y5OA 1C3TA 2C60A 3KUZA 4MGIE 1WYWB 3A9KA 2KTRB 3KH0A 4K17A 3QJZA 1WJ4A 1J8CA 3QWZB 2MRPA 3DOWA 3ZVRA 2JY6A 4HHVA 2BYEA 3TW1A 3PHWB 4FJYA 4I6NB 5HKHA 4AWJA 2D2QA 1W1DA 2Z0QA 3KYDD 4NQLB 3V6EB 2WH5A 4MGKE 5G2NA 4A3OA 4W9HA 2KCJA 4ANXA 1V89A 2CHWA 3RT3B 3NOBA 4PNKA 4JLCA 3M62B 1H8CA 1NU2A 4HVBA 3DXDA 4PS3A 2RD0A 3WA0A 5LXIB 4DXAB 3HK0A 1UPQA 2WDTB 5BO4B 5C16A 1V9JA 3VTVA 1XCGA 2W2XC 2VKIA 2LVQA 2NVUI 3PHXB 4BKGA 4M8NA 1UBIA 2KN5A 2MBEA 2ZNVC 4DHJB 2G45B 2YS5A 5J3YA 1OMWA 1WE6A 2J59M 5DPSA 3WIMA 3APFA 3H7PB 5JZEB 3U30A 2D9XA 4HATB 2ZVOA 4BKTA 1EF5A 4HAVB 1WFYA 4ANWA 2DX1A 3KYCD 1WF9A 2FCMA 2QKMA 3OJ3A 3NZSA 4WJNA 5DIFB 1FB8A 1M94A 3U7DA 4YL8A 3PRMB 3KSYA 4EMOA 2RQ1A 1LW3A 2L1CA 2V3SA 1MKEA 5C79A 3B0AA 4KZ0A 3UIPB 3VHTC 4CO7A 2KJHB 5D2MB 4AUQC 1AWEA 5JHAA 1M7RA 4P7IA 2D9ZA 1P1AA 4BKSD 4EFOA 2AWTA 4A6HA 4BOZB 2HE7A 2BWES 1IPGA 1KZGA 2M4NA 5CLLB 4MGZE 2MP2A 2GCJA 1BTKA 1NDDA 2N7EA 4E3CA 2M17A 2WYQA 1K5DB 3TCAA 3JVZX 1DDVA 2GBNA 3VH3B 4BBNC 4GPTB 4IM2A 2FCNA 3LDZE 3ZRFA 3NHEB 4X57B 2ELBA 4WJ7A 5D27A 3A9JA 1UPRA 2C5LC 2WX0A 4GOCA 4PYUA 3T9LA 2O2VB 3D32A 4GSWA 3TJPA 4KVGB 2COPA 1ACAA 4ZRKA 3PLUA 1Z5SB 1WVHA 3CMMB 4CHKA 1OTRB 3QBVB 4KDLB 4EZLA 4H8SA 3AI5A 1NTVA 1OEYJ 4FLHA 3MTNB 3PVWA 1GNUA 2D11A 1AARA 2P0FA 2KD0A 4RMAA 5D6JB 3VFKA 5JHBA 2CHXA 3ZW3A 3SU8X 4WWPA 2BPSA 5AZFA 3ALBA 3BINA 4A6FB 4AP4C 1WGUA 4F7ZA 3L13A 2COAA 2K25A 1V5TA 3BY4B 4TQ1A 3WYFB 2GMIC 4HB3B 2GBJA 2L0TA 2IYBA 2K8CA 2MP2B 4GDLA 4MJSB 1NBFC 2PE6B 2PEAA 3DXEA 2CB8A 2R2OA 3VUWA 3CXBB 4B9KA 4PYZA 1J19A 4W9KA 1B55A 2K6DB 5D3XA 5HE1A 2KC2A 2Q13A 1TZ1A 3RCPA 4FJZA 4NJ6A 1RRBA 2K1FA 3F5RA 4JIOU 4EJNA 4KDIC 3EPYA 1J0WA 4MGYE 2R0DA 2M14A 1BAKA 2K8HA 2D3GA 4KSKC 2KTRA 4FN2A 3K9PB 4NJ7A 4EUTA 3ZDMC 2W9NA 5E6OA 1WGYA 3TIXA 4LJPB 2EJ8A 1KLVA 1ISNA 1GC6A 4K2PA 2XQNM 3A4RA 3RZFA 3TFMA 2YS1A 2CQUA 3PPAA 3VXWA 1V5MA 2JRIB 2JZ3B 5D94A 2IO1B 3ODXA 1E90A 3FSSA 3TO1A 1C1YB 1NVLA 4DHZB 2ABDA 3M95A 1DBHA 4AOFA 3QIJA 3A8QA 3RD2A 2GS0A 5C5BA 2K00A 1U5GA 2BKRB 3G9WA 3DBRI 3V6CB 5D3VA 1GJZA 1TQZA 3NZUA 2KK8A 1UNRA 3GOEA 3JYUA 2ADZA 2Y7BA 2JWZA 1Z87A 5J3TA 1V2YA 1OEYA 4IUMB 4MELA 1EAZA 2MQJA 3CSTA 3ZNZB 1V81A 3BJIA 2COFA 3D8DA 1WX9A 2A4ZA 1ST7A 1GUAB 2MLBA 3HIZA 3ML9A 4DDGD 2K39A 2IO2B 1Y8RC 1WZ3A 3L10B 3ZTCA 3IHPC 1TGZB 5E6NA 3K9OB 5EDSA 2RR9A 2PE9A 2KMCA 1L2NA 3VTWA 5JLJB 3RUIB 3H7SA 2DX5A 2VRWB 3VQIA 5L95C 1XKEA 3QQ8B 5DHFB 3OLMD 1KOTA 4K1RB 1DDWA 3KY9A 4B6HA 1W1HA 2MA9B 1TJ6A 2C7MB 3EECA 3RYTA 1V49A 3A33B 2UYZB 2N9EB 1DROA 1EGXA 2CY5A 4KHAA 1VD2A 2KMAA 4DK5A 2R2QA 1F9JA 4WWOA 1U5FA 2DAFA 2O6VA 1WMHB 3L54A 5C6RA 4FBJB 2NS5A 3A1QB 3NSUA 2Y8FA 3F0WA 1WRDB 2LVOA 4KV2A 4NSWA 3WAPA 4EZJA 3UGBB 5DPRA 4BOSC 1TTNA 2JXXA 3DBHI 4ASWC 1SE9A 2DZIA 3PG7A 1K5GB 2KWUB 3APCA 2L3ZA 3DVGY 1A5RA 2BYVE 5KHOA 2DHJA 1YIWA 2YF0A 4AJYB 2UVMA 2NR2A 2D9VA 2CRFA 4L6EA 2ROVA 1YJ1A 2DYBA 2HTHA 2PJHA 2REXA 2RPQA 2Y5BB 2ZEQA 3Q3FA 2KTFA 2E2XA 1YD8U 2LZ6A 2MSED 4DX90 2ZZPB 4M8MA 3P7ZA 2HD5B 3AXCA 4LDTD 1D3ZA 2J0KA 1WX7A 2C7NB 4HCNB 5GOWB 5G55A 2OOBB 3DVNV 1U5EA 1V88A 2DHIA 4EKUA 2PZ1A 1XQQA 2KANA 2KDFB 2MBHA 4F7UP 3A4SC 4MSQB 3V60A 1K8RB 3QARA 1TBEA 5AEKB 2RSUA 3TVVA 3EFUA 2D10A 1X11A 1P9DU 2MWNB 4F1SA 1NTYA 2CKHB 4KAXB 2LRWA 4IWOA 2AL6A 3ZDTA 1MPHA 3L0WB 1UH6A 3PVUA 2FJLA 1HBKA 4HAXB 4HAWB 1E8ZA 2G4SA 2LOZA 3DDCB 3JSVB 4GDKB 4EEWA 2D4QA 1ZKHA 1U2BA 3X0WA 4JQWC 3X23A 3KUCB 1Y19B 2XEWA 4EOYA 2YVCA 3A98B 2KUPA 3Q3JA 1WX8A 2FIDA 2FJ9A 2GBRA 4D0NB 2L8JA 2BCJA 1MG8A 1WR1A 1ZSQA 4JL9A 4TV3A 3L16A 2KC1A 4A3PA 3UZTA 1MIZB 4GGQA 2N7DA 4I6PA 4IWPA 4C0AA 3QCAA 4MM3A 3PREA 4NY0A 3S2AA 2P0DA 1UGMA 3ECIA 1PQSA 3JSVA 1EVHA 3MPXA 4KZCA 3VUYA 4HDQA 4BBNF 5JHGA 2V4LA 2DLWA 2RUKB 3HW2B 4GMVA 5LONB 2KX0A 2K8BA 2LXAA 3O65B 4IW0A 3W1SA 3T06A 2G3QB 2YLMA 3IFWB 2KFKB 2JRHA 1XD3B 1KZ7A 4F8CB 3LJUX 3KRWA 2MFQA 3V5WA 2KGXB 1KJTA 4DBBA 2DHZA 2OJRA 3OJ4B 5IAAC 4E74A 2DYQA 4WJQA 4NNJB 4F7HA 2D9YA 4XWXA 4B6WA 2IYDB 1IP9A 3IG3A 4K7SA 2W2WA 5J2RA 2LG1A 2PPHA 2QKLA 2XK5B 4KSLC 2K2JA 4ZRIA 3QA8A 3QK0A 4HWIB 1SGHA 2NBVB 2K2UA 4PQ0A 3GZNI 4TQ0A 2KXJA 4ZDVA 5C1ZA 2NPTA 1P5TA 4IAPA 2L05A 2LWPA 5AZGA 2L00B 2YT1A 5LLIA 2N0YA 4ZYNA 3ENEA 2HJ8A 5KQ4A 1FOEA 2JVCA 3QX1A 4HB2B 5HE0A 1IYFA 1ZM0A 1FHXA 1GC7A 3KZ1A 2FCQA 2G4DB 2I5FA 2N23A 1HB6A 2DYOA 2KDIA 4IOYX 5D3YA 1RFAA 3H9DA 3OAWA 2MKRA 2J0JA 4GDKA 4HK2A 4ANUA 4G0NB 4BFRA 3PVLA 2M8SA 5DPTA 2KDEB 3VH4B 3NS8A 2JF5A 4PS7A 4HDOA 3UF8A 3UIOB 2J7QB 2JUOA 2RLOA 3N32A 3V61A 4EZKA 5D7GA 3N3KB 2YRYA 1I2HA 3CIKA 5JP4A 1WIAA 3VDZA 5L83A 2LGYA 1ZGUB 3R7QA 1Q67A 1P0RA 2D07B 3A9JB 4DDID 5KHQA 3NY5A 3DPDA 2AL3A 1YX5B 4DHJD 2DN6A 1WJNA 1WM2A 3HQCA 4DX8A 3R3MA 1H4RA 3GYPA 1VCBA 4IWQA 3KRXA 1WGHA 2AYOB 1N3HA 2KWCA 3DVNU 4AJWA 5LXHA 1ZC3B 1XD4A 2FAZA 1V61A 3MHSD 4WVFB 3PRZA 3ZUNA 5CHVC 4IC7B 3ODWA 4IFSA 3N30A 3V62A 5DPWA 3AJ4A 3QHTA 1P98A 3M1IB 2MWSB 4DBGA 3FLVA 1V5UA 2Z0EB 2ELAA 5KCVA 2A5UA 2BWFA 1RJ2A 4MT7A 4W9EA 2B3AA 3PS6A 3VUXA 4LDTB 2LKOA 3A1QA 4FHJA 3IVFA 1S1QB 2DZMA 5FR6A 1J0GA 3ZVVA 4Z2NA 2G35A 1WJ6A 3KW5B 3FP5A 1CMXB 3ZO5B 2IFSA 4DWFA 1WI0A 1E8XA 4MSMB 3WALA 2CS4A 4W9IA 2OTXA 3W1YA 2RVBB 3OANA 4A6KA 1FGZA 3MDBC 4W9DA 5CHWA 2DTCA 1HB8A 1NTIA 2P8VA 4MY6A 5D3WA 1Q5WB 1P6SA 2DX5B 2EKEC 2GBMA 3HHMA 2CODA 4G11A 3UQAA 3ZKJC 2Z0PA 4LCDE 3PP2A 3PV1A 5GMVA 2V1YA 2NBUA 4GN1A 2I5CA 2FIFA 2NZ8B 2MX2A 2GCLA 1FHOA 1OQNA 1R4NI 4N9F4 5CHFA 3R66C 5KQ1A 2ZPYA 2NCNA 1BTNA 2HTHB 1G6JA 2IO0B 2ROZB 2EC1A 1M7EA 1LFDA 2BGFA 3ONSA 4MJSA 1EO6A 1R4MI 2KHWB 4NAWB 2FNJB 2ZNVB 3SUZA 4FJVB 3ML8A 2KLGA 1WE7A 2L0FA 1WXSA 4GXBA 3B1LX 3B08A 3QAQA 2EMSA 4HAUB 2KNBA 5C5BB 3ULBA 1E5WA 2CHZA 3PSEB 4NPNA 3RZWC 3D8EA 3A9KB 3HM3A 3I3TB 1UD7A 3T8MA 3R7RA 1E8WA 2C7HA 2IY0B 2GJYA 1RAXA 2KDBA 1L7YA 2NBWB 2UZSA 5HE2A 1RLFA 4B95A 1FXTB 1U27A 1QQGA 1E7VA 2L7RA 2AEHA 2KQ7A 3AU5A 3P6AA 2MDXA 1WR6E 3RCZA 2KWVB 2FDQA 1XR0B 4W9FA 4HLEA 2KX3A 1V5PA 5TR5A 2LJ5A 2KO3A 2V76A 2KKCA 4HAZB 2NPTB 3DCGA 1WXAA 2HRJA 3AU4A 3VIAA 3M63B 1XODA 1E7UA 2C9WB 3UINB 4KHBB 1OY2A 1X1MA 4HAYB 4GDLB 3UQBA 1LB1A 1WGQA 1MK7B 1P3QU 2KLCA 3DBLI 3MJWA 3PLVA 4HXDA 1YX6B 5LOPB 2KOXA 2W2XD 4HPMB 4TYZA 3PGEA 5C23A 4E71A 1GG3A 1Q0WB 4URKA 4HB0B 3WAOA 1UZXB 3H7PA 2I1KA 2DFKA 1ZW7A 1WJMA 5HE3A 2DZKA 2EMTA 1HE8A 2KFKA 2N1WA 1V80A 4PS8A 4W9JA 2GOWA 3ZIMA 2Z0DB 1OQYA 2CR5A 2MBOA 2I1JA 2DENB 3O96A 2LRUA 1U4AA 3TMPB 4W9CA 1UNPA 2O2VA 5JH5C 4BBKA 2M38A 4IG7B 4G50A 2VSZA 2KVRA 2LI5A 3DVGX 4XZ4A 4TUUA 1XX0A 2DYNA 2Y8GA 3PSCA 5DHAB 1EF1A 3ML4A 5J17A 1WGGA 2M1MA
chains in the Genus database with same CATH superfamily
2WU2B 4GZUA 3P4SB 4C7ZA 4HJKA 1ESFA 1OGWA 1UELA 4II2B 3FEHA 4LNOA 4P6VF 2ACZB 4DHZE 3PZ8A 1KTKA 1TS2A 5BYSA 4R3DA 2M0XA 2LBBA 4WWNA 3SHQA 2LVPA 2LGXA 3AEAB 3W2DA 2ICIA 2DWQA 5IA7A 2ASQA 1I35A 2IBIB 1NI2A 3M3JA 2YS3A 4ICUA 1X86A 4YXDB 2ZJDA 3H6NA 3FKYA 4KIKA 4RM9A 2L76A 4WIPA 3AEDB 2FE8A 1UBQA 3P2BA 1TKGA 2RGFA 1IBXB 2GBKA 3U4EG 2QEJC 1E9MA 2R09A 1WMHA 5FI0A 2KQSA 4RM8A 2EELA 3FC4A 2RSGA 1PMSA 2CY4A 1XT9B 4K3CA 4IM0A 4K7UA 4A20A 2LD9A 2ZPNA 1EUVB 5JHHA 1SBBB 4ZRPA 4A8XC 1AN8A 1ZC4B 3LB8C 4WQOB 2IO3B 2JYEA 1EU3A 2RRFA 4NZLB 2ZKMX 3EFCA 1WI1A 2FCSA 4MH0E 3RULA 2XBBC 3VRBB 2JP2A 3KUDB 1ZDXA 5J3QA 2M19A 2ZCBA 3SDLC 5HG2A 4M01A 2JU6X 1Z2MA 4JWSC 4YTNB 1MAIA 2COCA 1FHWA 5CLQB 3ZNGC 1WJ1A 3GYOA 2KJ6A 2BKFA 4XC2A 2WHIA 2WWZA 2MJ3A 4XYCA 3KUZA 4MGIE 1ET6A 3A9KA 3EGRA 5BYQA 3RNCC 4RGMA 1TY2A 1FO4A 3TW1A 4PK1A 1AWDA 1SE3A 1W1DA 4NQLB 3V6EB 4CSQA 2KCJA 1TS5A 2K3UA 1H8CA 1NU2A 3Q3MC 3AE1B 1UPQA 1V9JA 2W2XC 3PHXB 4ILGB 4XWTA 1UBIA 2G45B 5DPSA 3N1YC 5JZEB 2WNMA 2RDBC 4LTUA 4JPSA 4ANWA 1M94A 4AS1A 5IO9A 3U7DA 3N1ZC 1QILA 2V3SA 1MKEA 3VHTC 3HSAA 3RNFC 5LG4B 2PIAA 2AWTA 2RPVA 2BWES 1IPGA 4NJCA 1T5XD 2N7EA 3AE6B 2KVZA 3TCAA 4BBNC 4GPTB 1T77A 4GOCA 1TKYA 1UPRA 2C5LC 2O2VB 4GSWA 2COPA 1WVHA 4GNKB 3AI5A 1NTVA 2H88B 3MTNB 2D11A 3W5UB 3P4PB 1ZUD2 2CHXA 1PYWD 3SU8X 5AZFA 3ALBA 4F7ZA 3L13A 1V5TA 3WYFB 3NRZA 4MACA 1XCTL 1NBFC 3CXBB 1HEZE 4WQMA 1B55A 2K6DB 1ZP0B 2K1FA 3F5RA 1YMHE 1N60A 4KSKC 4EUTA 4YSZB 2EJ8A 4ITKA 1ISNA 4K2PA 2E6XA 3TFMA 1MPEA 2YS1A 3VXWA 3PPAA 1FXAA 5D94A 2IO1B 3ODXA 3FSSA 3TO1A 1C1YB 2WXQA 4DHZB 3RFZB 2ABDA 5IP4D 3QIJA 1I4QA 2GS0A 1GJZA 3G9WA 3KQ4A 1TQZA 2Y7BA 2JWZA 1V2YA 4MELA 3RI7C 3BVMA 1TJEA 1JALA 2WDRB 2COFA 2A4ZA 1GUAB 2HTME 3L10B 2QCZA 1J7AA 5E6NA 2RMMA 2WXFA 2KMCA 1JROA 3VTWA 3H7SA 5C2TB 2Y3AA 1XKEA 1L0YB 3QQ8B 3DBLB 2C7MB 4KHAA 1XLOA 2DAFA 2INPE 1HZ6A 4KV2A 2Y8FA 1WRDB 2DNFA 2LVOA 4NSWA 1A70A 2ZW1A 3Q14C 3BK2A 3PG7A 3AE2B 3DBHB 5I2SA 2DHJA 3P4RB 1C77A 1YJ1A 2REXA 2Y5BB 2NBVA 2HTHA 2RPQA 3B9JA 3RPFC 2WU5B 2HD5B 4LDTD 3MFGA 1TY0A 5GOWB 2MJEA 5G55A 4PS8A 1XQQA 3A4SC 2HDEA 3V60A 2PKOA 2RSUA 4UDUC 2ONQA 3AE3B 2JYTA 4HAXB 2FJLA 4C00A 4HAWB 1FEHA 3JSVB 2EKIA 1U2BA 2BB6A 3KUCB 1Y19B 2YVCA 2KUPA 4YTPB 2FIDA 2FJ9A 4P1CC 1WR1A 1ENFA 3NVVA 3QCAA 3PREA 1TZOA 1JW9D 1PQSA 1EVHA 3MPXA 4HDQA 5EE9A 2V4LA 2DLWA 1YQ4B 2KX0A 3BYTB 2LXAA 2W55A 3OG5A 3T06A 2G3QB 2YLMA 1KZ7A 3V5WA 2MFQA 4DBBA 2DYQA 4NNJB 4F7HA 4IOIE 2D9YA 4JKGA 4B6WA 3IG3A 2PPHA 2K2JA 4ZRIA 3QA8A 3BIID 1C79A 1JWUD 3A58A 2V3PA 4TQ0A 5I4DA 1P5TA 2L00B 4ZYNA 1SSNA 3QX1A 4HB2B 2FCQA 3KZ1A 2DYOA 2N23A 4JKFA 4G0NB 3SFEB 2QIEB 3NS8A 4PS7A 1B9RA 5D7GA 3N3KB 1UUPA 5L83A 1WIAA 3VDZA 2LGYA 1QLBB 1P0RA 1VCBA 2KWCA 2Z14A 4RF0A 1XD4A 2FAZA 3PRZA 1N62A 1TIFA 3PO0A 2M0AA 1V5UA 2Z0EB 5KCVA 4W9EA 4JKEA 2LKOA 2I2YA 2I38A 4Z2NA 4OSNA 3KW5B 3FP5A 1CQVA 2N9KA 1E8XA 4W9IA 2OTXA 3OANA 1FIQA 1FGZA 1QOBA 3E9SA 2DTCA 1M4VA 1NTIA 2P8VA 1F1HA 2DX5B 2GBMA 4S0RA 2YEPF 3GB1A 3ZKJC 4LCDE 3PP2A 5GMVA 2V1YA 2I5CA 1OQNA 4K3BA 5KQ1A 2ZPYA 2NCNA 1G6JA 2EC1A 2INDC 1QOAA 1R4MI 2KHWB 2QMTA 4NAWB 4ZRQA 2ZNVB 1WE7A 2L0FA 1WXSA 4GXBA 3B08A 5C5BB 3ULBA 3PSEB 5BMGA 2KN4A 3R7RA 1E8WA 1V1PB 1L7YA 3ETRA 2UZSA 4QJ5B 2IJ0A 2KMMA 1FXTB 2OHFA 1FNVA 1WR6E 2MDXA 1V5PA 4MT5A 4WAFA 2LJ5A 2KO3A 2JXTA 1RWSA 2NPTB 3NZ3A 1DYQA 1OY2A 3UQBA 1XCQL 1FRDA 5LOPB 1WGKA 3OWEB 1FXIA 2KDMA 1ZW7A 5HE3A 2EMTA 4ILHA 4LLGM 1ET9A 2GOWA 1OQYA 2DENB 1E10A 4W9CA 4L23A 2M38A 4IG7B 2IDYA 2CJOA 2KVRA 4XZ4A 4TUUA 2DYNA 2Y8GA 2L52A 3FILA 1F2RC 4DQOC 3NJTA 3DHHC 3DHIC 2M1MA 3U12A 3AULA 1B1ZA 4JGHB 2IY1B 1BT0A 1HXYD 2LULA 3ZTDA 2VH1A 3ODOA 2XK5A 3ZLZA 2V0GA 1QF6A 1AYFA 2YSZA 2LHEA 2IGHA 2FUHB 2Z59B 1PGAA 2Y5PA 2LASA 4G3XB 2ZVNA 4WJPA 1WGDA 1ZDVA 3MC0B 2KFJA 1BMLC 1KM7A 1WZ0A 2MHJA 3HM6X 3VVWB 3ZJTA 1LQBA 4ARCA 4BVUC 5HKHA 1V86A 4FULA 3FM8C 1D5XC 5AZHA 3P42A 4YSXB 2JWUA 4W9GA 3N7CA 2DHKA 2H7DA 2AQ1B 3IBEA 1D5ZC 3SYXA 2BVCA 2P0HA 1V5OA 2H7EA 2IZVB 2DKQA 3TBLD 4XX5A 2RGNB 1FPYA 1TKEA 4LNNA 2DKPA 4RFBA 4LJOB 1T0YA 1DGJA 1X1FA 2X18A 1K51A 5FK9C 2WXHA 1QOFA 3PZ7A 3SNHA 4YSYB 3A8PA 3AMZA 4K7WA 2LYDA 5IJMA 1KBLA 1SJHD 2MCNB 2N9PC 2BYTA 4WJOA 4F7GA 3TSSA 2WXKA 2SAKA 1GPXA 3QWMA 5G5GA 2Z0OA 2L83A 3DBSA 4II3B 1NI3A 2DZJA 1WH3A 3MC9A 1XLQA 1QZEA 1UNQA 4MDKE 4Y94A 1LXDA 2BBCA 3PTFC 2O6VB 3GP7A 4M0WB 2QHOA 4MK0A 3IXSA 3KLSX 2DIKA 1X05A 1F77A 1IUEA 1AQCA 1Y5OA 1C3TA 2C60A 1WYWB 2K8EA 4K17A 3QJZA 3QWZB 2MRPA 3ZVRA 4FJYA 2WGSA 2Z0QA 1FM0D 4W9HA 4PNKA 3M62B 4HVBA 3T3NA 3HK0A 5BO4B 2VKIA 2KN5A 1HQRD 2ZNVC 5J3YA 5T8IA 1OMWA 1WE6A 2J59M 1I4GA 4L1RA 2ZVOA 4HATB 1EF5A 1WFYA 2DX1A 4LNKA 3OJ3A 1ROEA 3NZSA 4WJNA 5DIFB 1FB8A 4JK8A 2LGIA 2RQ1A 3TEYA 4KZ0A 4CO7A 4DXGA 2LHDA 3W9CB 1M7RA 4P7IA 4EFOA 1P1AA 1EM7A 3SFDB 2Z4DA 4P16A 2LMCA 2MP2A 1BTKA 1NDDA 1DDVA 2G9HD 4IM2A 1XXGA 3ZRFA 2G1EA 4WJ7A 3T9LA 1GB1A 1ACAA 3CMMB 4CHKA 3QBVB 1KRHA 4H8SA 2LFIA 4FLHA 3PVWA 1AARA 2KD0A 3VFKA 5JHBA 4ZHPA 4A6FB 5IKCM 2N9LA 1L4DB 2MP2B 2IYBA 1SF0A 2QJLA 2CB8A 2R2OA 3VUWA 3GZNB 4NJ6A 1I4RA 2KC2A 1TZ1A 4EJNA 1J0WA 1BAKA 3K9PB 3ZDMC 4XGAB 5E6OA 1KLVA 4LJPB 1GC6A 1N5XA 3A4RA 2XQNM 4HPPA 3RZFA 1L6UA 1V5MA 1WYGA 1VLBA 2KYWA 1NVLA 2R2YA 1VZ8A 3AEBB 3DBRI 2BKRB 3BZDB 3NZUA 2KK8A 3GOEA 3Q3NC 2IPKD 3RT3B 3ZNZB 2MQJA 5BMHA 1V81A 2IGGA 4DDGD 1MFWA 2IO2B 3URYA 1Y8RC 1WZ3A 3BYYB 3IHPC 1TGZB 2XNAC 4C4VB 2RR9A 2PE9A 5JLJB 3RUIB 2VRWB 3VQIA 1N6ZA 5DHFB 4K1RB 1DDWA 3IT6B 1W1HA 2MA9B 1TJ6A 3EECA 3I57A 2N7JA 3A33B 5IRSA 1DROA 2KMAA 4DK5A 1U5FA 2V3NA 1WMHB 2HJ1A 4S17A 3J9CA 2YEPB 1N63A 4EZJA 3UGBB 1TTNA 3DBHI 2WXMA 2L3ZA 5KHOA 1YIWA 4JKDA 2YF0A 2NR2A 2D9VA 2CRFA 3ZYYX 4BBNF 3Q3FA 2WLBA 2DLBA 1L6VA 2LZ6A 2ZZPB 3DCXA 2MSED 5FKAC 2J0KA 1WX7A 2C7NB 2ON8A 3EUB2 1U5EA 3DQVA 4EKUA 2KANA 5LXHA 2V9HA 3QARA 3NVWA 1FCLA 2LRWA 1MPHA 4A3OA 3PVUA 1HBKA 2G4SA 2R61A 4GDKB 2PVOD 3X0WA 3BVGA 4JQWC 3NUHB 2XEWA 4ARIA 3L4PA 2WS3B 2X38A 2BCJA 1SB3C 4GGQA 4C0AA 1L0VB 5D3DA 2P0DA 1UGMA 1FNWA 1C4PA 2R82A 4JX1C 4GMVA 5LONB 4IW0A 3W1SA 3IFWB 1PDXA 2KGXB 1KJTA 2W54A 5IAAC 4WJQA 4FXCA 3RNGC 1E6EB 4K7SA 4B0EA 2XK5B 1FNUA 3R2IA 2WXOA 3QK0A 4HWIB 1SGHA 2NBVB 2KXJA 2NPTA 1UNSA 2LWPA 5AZGA 2N0SB 2YT1A 3ENEA 1V8CA 2HJ8A 1FOEA 1SE4A 3SBTA 2IGDA 4OZCA 1HB6A 4P1BC 4GDKA 2MKRA 2AX5A 2KDEB 3FVCA 3VH4B 2JF5A 4HDOA 1V1PA 2WXIA 2GUMA 3V61A 3ZXRA 2D07B 2AL3A 4DX8A 3MHZA 3GYPA 1Q10A 1MI1A 3DVNU 1N3HA 2QDFA 3ZXVA 1F0ZA 3ZUNA 1YOVB 4WVFB 5CHVC 3ODWA 2CJNA 4WURA 4IFSA 3N30A 5DPWA 5G5HA 3FLVA 1QT9A 2A5UA 4PT5A 4LDTB 2K9XA 3IVFA 2DZMA 1J0GA 2G35A 3VRAB 1CMXB 2IFSA 4DWFA 4A6KA 3TEWA 4D2KA 3MDBC 3Q6BA 5CHWA 4MY6A 5D3WA 1PUTA 1P6SA 2B76B 2CODA 4G11A 4C4VA 3IAS1 4JKAA 4GN1A 2FIFA 2MX2A 1CK1A 1R4NI 4N9F4 5AUIA 3R66C 2ROZB 3U52E 1FD6A 2BGFA 4ACFA 3HVZA 1R4MB 3NWAA 3ML8A 2EMSA 1UD7A 2C7HA 3Q8AA 2GJYA 1RAXA 2KDBA 3NS1A 2WXLA 1RLFA 2BQQA 3BVZA 4M0WA 2KQ7A 2J42A 3AU5A 1HA5A 4QAYA 2V76A 3N1XC 2VZKD 2KKCA 4HAZB 1NYQA 3AU4A 3M63B 3UINB 2FJUB 1YJJA 1X1MA 4GDLB 3B2GA 3DBLI 1R7SA 4TYZA 3PGEA 2JSVX 1GG3A 2Z13A 4ZHOA 3LXFA 1TS4A 3E9PA 2Z0DB 2CR5A 2MBOA 2D3CA 2KAJA 2LRUA 1U4AA 4BBKA 4G50A 2VSZA 2LI5A 4RGNA 4N59A 1T0QC 5DHAB 3PSCA 1EF1A 2BTEA 5IOIA 4OVVA 3P1MA 4ZRJA 3OHMB 2K49A 5FI1A 4NQKE 3LJ3A 3KWVA 4JK9A 3U2SC 4FA6A 4RNAA 2DYMA 2N4FA 3AE7B 4JKGB 2ZCCA 3N20C 4OHJA 2YT0A 2WQYB 3ULCA 2K0PA 2N9XA 2QC8A 1DOYA 4J6IA 5H8YE 1YQBA 4FHKA 3AB5A 1DYNA 5CTRC 4K2OA 3U8ZA 4A5KA 3GE3C 4FADA 4OVZA 2BYFA 4ANVA 2LXCA 2NTSA 1I7AA 1P3RA 2VRRB 3B2FA 2JT4B 4MH8A 4HB4B 4HCPB 3L17A 3CSFA 1SIFA 3VAWA 1WWTA 3CIRB 2MW5A 2LOXA 2K22A 3H8HA 4L2YA 4WAAA 1WY8A 1R4NB 5DI9B 3ZNID 3DXCA 2L2IA 2DA0A 1FAOA 3CWIA 5CX3A 3SV1A 2KZRA 1WXQA 3UIOB 1LM8B 1WM3A 1IRSA 1E8YA 1WJUA 1TS3A 1C76A 1TXDA 3D8FA 3JW0X 1QC6A 1WGRA 3QC8B 3FAHA 2D3BA 1STEA 2K6QA 3W1SC 2O6VD 3Q8EA 2J53A 2NMBA 1CZPA 3I9V1 3CF6E 1DDMA 3SO6A 3T3OA 2KQ4X 3PZDA 3ZRCA 4GB9A 1WG7A 3KVFB 1EWYC 1X1GA 1XLNA 4K81A 1GGOA 1U5DA 3VOQA 1I42A 1BWNA 1W1GA 4KHOA 2JPHA 4RGOS 2KT7A 2LUEA 4W9LA 5C3JB 3ZQ4A 2NTTA 1WJ4A 1J8CA 1WRIA 1XF5L 2JY6A 3PHWB 4I6NB 3HIEA 3TEZA 4AWJA 2WH5A 5G2NA 4ANXA 2CHWA 1GAQB 3AE4B 4JLCA 3Q8BA 4PS3A 2QILA 3WA0A 2NMQA 4BKGA 3U7ZA 2NVUI 3VR9B 5TSSA 1QQRA 4KGSA 4DHJB 1UWXA 1FMAD 2D9XA 5J18A 1WF9A 2QKMA 1NENB 4YL8A 2GI9A 4EMOA 4MM3B 4H2AA 1LW3A 2L1CA 3B0AA 5C79A 3ZJVA 3UIPB 3RNEC 2KJHB 5D2MB 1BXTA 2D9ZA 1T6BX 3DWGC 4BOZB 2HE7A 1T0SC 1Y56A 1KZGA 2M4NA 3NG0A 4JE3B 3ENBA 2GCJA 4E3CA 2M17A 1K5DB 2GBNA 3P63A 2FCNA 3LDZE 3NHEB 3SBGA 5D27A 4X57B 5HHDG 3NWFA 2WX0A 4PYUA 3SEBA 3TJPA 4KVGB 4ZRKA 3MC8A 1OTRB 4KDLB 3AEFB 4JWUC 5D6JB 2BT6A 1QOGA 2BPSA 1K52A 4AP4C 1K53A 1WGUA 2COAA 3BY4B 4TQ1A 2GMIC 4HB3B 2GBJA 2K8CA 4MJSB 4GDLA 2WDVB 2PEAA 4B9KA 4PYZA 3NWDA 5D3XA 2Q13A 1CJEA 1RRBA 1HTQA 3EPYA 2R0DA 2M14A 1T0RC 2K8HA 2KTRA 4NJ7A 1V97A 1WGYA 3TIXA 1SEBD 2JZ3B 3C19A 1E90A 2L1AA 1NVID 3RD2A 2PVGC 5C5BA 2K00A 1U5GA 3V6CB 4O1NA 4C56C 3JYUA 2ADZA 1JWBD 1RM6C 1Z87A 5J3TA 4IUMB 3CSTA 3AE9B 3D8DA 1WX9A 3HIZA 2MLBA 3I63C 3K9OB 5EDSA 4RH6A 1L2NA 2J52A 2DX5A 1UGJA 5GXGB 1MG4A 4GLSC 2UYZB 1EGXA 5EE3A 1VD2A 2FBWB 1F9JA 4KGRA 2O6VA 2NS5A 2LJIA 3F0WA 5DPRA 4ASWC 2KWUB 3APCA 3DVGY 2ROVA 2DYBA 2PJHA 4M8MA 2KTFA 2E2XA 4LNFA 4DX90 1JWSD 3P7ZA 3AV8A 2Z8LA 2OOBB 3DVNV 1FCCC 2MBHA 4M02A 4HROA 1TBEA 3TVVA 2D10A 2X0SA 1P9DU 2MWNB 2BB5A 2CKHB 1YNTE 4IWOA 3ZDTA 3L0WB 1HTOA 1UH6A 1E8ZA 2D4QA 1IGDA 1ZKHA 4YT0B 5MPOA 3X23A 4QXAB 3HRDD 3A98B 4ZYSA 1YQ3B 3Q3JA 1IBXA 4IDIA 2L8JA 1MG8A 4JL9A 2KC1A 3Q8CA 3UZTA 1MIZB 4BAXA 4IWPA 1E7PB 4MM3A 4KKIA 1JWMD 3S2AA 1GOZA 2GB1A 2LGSA 3JSVA 4KZCA 5JHGA 1UWMA 3HW2B 3LYYA 4WH4A 1MHXA 2BW2A 4J3OD 4DXFA 4A90A 4F8CB 2JRHA 1XD3B 3LJUX 3KRWA 2DHZA 4D6WA 2H89B 3C8YA 2OJRA 3OJ4B 4BKTA 4E74A 2KWDA 4LK0M 4XWXA 3HVDA 2IYDB 2WXNA 2X8XX 2W2WA 3AM9A 2LG1A 5J2RA 2QKLA 4KSLC 4ZDVA 3GZNI 2UU7A 1K50A 4IAPA 2L05A 5LLIA 5KQ4A 2JVCA 2LUMA 3AE5B 1ZM0A 3ABVB 2KDIA 3H9DA 4EEWA 1IYFA 1RFAA 4BFRA 2KACA 2J0JA 3PVLA 4RF1A 2PTLA 3N32A 4US9A 2RLOA 4EZKA 3RNBC 1I2HA 2YRYA 5JP4A 4OZBA 3A9JB 5KHQA 1ACCA 3NY5A 3DPDA 4DHJD 1WM2A 3HQCA 3KRXA 2AYOB 1C78A 4KHBA 1V61A 2XN9C 2J4XA 4WWMA 3V62A 2MJDA 1BUIC 3QHTA 4ZOHC 1P98A 3M1IB 4DBGA 1FFUA 2ELAA 2BWFA 1RJ2A 1SIJA 1KC7A 3VUXA 2M56B 4QJ3B 4FHJA 1S1QB 5FR6A 3ZVVA 1YN4A 1ZOYB 5EE1A 1WI0A 4MSMB 2W3SA 1VDVA 4W9DA 2PW9A 1IGCA 4AQ7A 1HB8A 3D32A 2EKEC 2Z0PA 2NZ8B 1FHOA 1LFDA 1EO6A 4XE0A 3R8BA 3QAQA 3B1LX 4HAUB 2KNBA 5HI1A 3RZWC 1DOXA 3D8EA 3A9KB 3HM3A 3I3TB 2SEBD 4L1BA 3T8MA 3E9LA 2IY0B 5HE2A 1RFKA 1PGXA 4B95A 1QKZA 1U27A 1MI0A 2AEHA 3SR6A 1SE2A 2KWVB 1XR0B 1I7HA 4HLEA 3E66A 5TR5A 5BMIA 3E56A 1WXAA 2HRJA 1YN5A 2MEKA 3NW8A 1E7UA 2C9WB 2FUG1 1LB1A 1MK7B 3FILB 2KLCA 1N5WA 3PLVA 4HXDA 1YX6B 5C23A 4E71A 2KUQA 1VBGA 4OW0A 4HB0B 1UZXB 2WP9B 3H7PA 2DFKA 2KFKA 1V80A 3TMPB 2I1JA 3O96A 2O2VA 1XX0A 3ML4A 5J17A 3RMKC 3ZJUA 2E3TA 3N9YC 2BS3B 2Y5CA 4IM3A 5DCNA 3Q3OC 3C0RB 1VZ6A 4Z2MB 2J0MA 1PGBA 1MK9B 4CHJA 3L08A 2MBQA 3WAMA 1I4XA 5AUKA 4HKZE 3KWLA 2YT2A 1MIXA 4A6FA 1UEFA 1D4BA 1SJED 2JZZA 1JRUA 1XEEA 3PEGA 3VTUA 1U29A 3APDA 5EE0A 4I6LB 1RRPB 4MEMA 2UWQA 4OVUA 4JKCA 3ZGZA 3GS2A 3ZNHB 4CHMA 1P7EA 1VBHA 4NAWA 1PFJA 4Q2JA 4WSFA 5DH9B 2KJRA 2ZW0A 3PT2B 3WANA 4US8A 1WXMA 4KGTA 3TEXA 4BKSA 1KLGD 4HJGE 3EC8A 4HPLB 2WX1A 5EFXA 1F52A 3W5VB 2CAYA 1H10A 3EHVA 3WAPA 2CU1A 3H1UA 4GMXB 5E6PA 2RNRB 1KI1B 3PRPB 4OT1A 3SD5A 1PLSA 2DAJA 1WXVA 2LGDA 2RDHA 4LNIA 4TKNA 1V1OA 2UZRA 1YN3A 1JQ4A 1ZYIA 4GU2A 1OFFA 5JXVA 4CYEA 2BF8B 4TMAB 5IN7A 2MBBB 1Q1OA 4QJ4B 2WXRA 2N1VA 4KIKB 1FGYA 1ZVRA 1V6EA 1SHCA 2OQBA 2INCC 4XDDA 1S3SG 4GIVA 5L81A 4ICVA 3TL5A 4YONA 3HUIA 1SXTA 3E9OA 4YTMB 2D9WA 2GLSA 2W82A 2KTRB 3KH0A 2PLPA 2KIGA 3DOWA 2K5PA 1MVKA 4HHVA 1LGRA 2BYEA 3RNAC 2D2QA 2WXJA 3MP9A 3KYDD 3NVZA 4MGKE 1VRAB 2OEDA 3BK1A 1V89A 3NOBA 2D5GA 3DXDA 2RD0A 3AH7A 5LXIB 4DXAB 5M4YB 2WDTB 5C16A 3VTVA 1XCGA 2LVQA 4M8NA 4ILJA 2MBEA 1FRRA 2YS5A 3AE8B 3V05A 3APFA 3H7PB 3U30A 4HAVB 3KYCD 2FCMA 3PRMB 3KSYA 1L5PA 4GOUA 5JHAA 1AWEA 3DHGC 3NVYA 4USAA 4BKSD 1E0ZA 4A6HA 3RN9C 1OQRA 5CLLB 1JRPA 4MGZE 2WYQA 1PFDA 3JVZX 1HZ5A 3VH3B 2ELBA 3A9JA 4AUQC 4N6EB 3I5JC 2MH7A 3AEEB 3MJ5A 3PLUA 1Z5SB 4C7YA 4EZLA 1OEYJ 4AJWA 2KIEA 1GNUA 3IAM1 2P0FA 4RMAA 4YWGG 1TYGB 3ZW3A 4WWPA 3BINA 2Z59A 5H92C 2K25A 1I4HA 4HEA1 2L0TA 3AN1A 2PE6B 3DXEA 1C4CA 1TT5B 1J19A 3DBRB 4W9KA 5HE1A 1UF0A 3RCPA 4FJZA 4JIOU 4MGYE 4KDIC 3Q8FA 1JWAD 2D3GA 4FN2A 2L32A 2W9NA 1JCKB 1VR9A 5LNK1 2CQUA 2JRIB 1JDEA 3M95A 1ZPSA 1DBHA 4AOFA 3A8QA 3Q69A 5D3VA 1UNRA 1AW7A 1JMLA 4EE2A 1OEYA 1EAZA 3BJIA 3ML9A 1ST7A 2K39A 3ZTCA 1NYRA 1MJDA 1FFVA 5L95C 2BS2B 4HSIA 3OLMD 1KOTA 3KY9A 4B6HA 1YJIA 4IKGA 4DIXA 5I2MA 3RYTA 1D5MC 1V49A 2N9EB 2CY5A 2R2QA 4WWOA 1VZ7A 3L54A 5C6RA 4REZA 3A1QB 4FBJB 3NSUA 4NAMA 4BOSC 2JXXA 1SE9A 2DZIA 1K5GB 1A5RA 2QSDA 2BYVE 4AJYB 2UVMA 4L6EA 3IT4B 2ZEQA 2V4IB 1YD8U 3AXCA 4HCNB 2LEKA 2CU3A 1V88A 2PZ1A 2DHIA 2KDFB 4F7UP 4MSQB 1K8RB 5AEKB 1GB4A 3EFUA 1X11A 3UI3A 4F1SA 1NTYA 4KAXB 1LO5D 2AL6A 1OQQA 1D3ZA 1ZE3D 3DDCB 4JK7A 2LOZA 4EOYA 3BWUD 1T3QA 5BYRA 1WX8A 2GBRA 4D0NB 1ZSQA 4OZAA 4TV3A 2JZPA 3L16A 1D6EC 4A3PA 5FR3A 2N7DA 4I6PA 1L0XB 4NY0A 3VR8B 4KX6B 3ECIA 2OJWA 3VUYA 2VH2A 2RUKB 3O65B 2K8BA 3WIMA 2KFKB 2GRIA 1ZXHA 2JQRB 1IP9A 4JKHA 3Q2AC 2JX5A 1I4PA 2K2UA 4PQ0A 5C1ZA 2N0YA 1F2RI 3V3XA 1VJKA 5HE0A 4ANUA 1FHXA 1GC7A 1MHHE 2G4DB 2M8SA 2I5FA 3OAWA 4IOYX 5D3YA 4HK2A 4A9AA 1EWCA 3P4QB 5DPTA 2KR0A 4M00A 3UF8A 4CQNA 2J7QB 2JUOA 3EA6A 2WDQB 1WSPA 4A6QA 1KFYB 3CIKA 1ZGUB 3R7QA 1Q67A 4RCOA 4DDID 1YX5B 2DN6A 1WJNA 3R3MA 1H4RA 4IWQA 1WGHA 1ZC3B 3MHSD 4IC7B 1N61A 2INNE 3AJ4A 2MWSB 5D3IB 4MT7A 1DIKA 2B3AA 3PS6A 1J7BA 3A1QA 4HRSA 1KH0A 1WJ6A 2AQ2B 3ZO5B 3WALA 1L4ZB 2CS4A 3W1YA 4HKQA 1XO3A 2RVBB 1XLPA 1ZXIA 1Q5WB 4NPNA 3UQAA 3HHMA 4XDCA 3PV1A 2NBUA 2W3RA 2GCLA 5CHFA 3DWMA 1EU4A 1BTNA 2HTHB 2IO0B 4B0MA 4C80A 1M7EA 5JVLA 4MJSA 3ONSA 2FNJB 2DBYA 1RYJA 4FJVB 3SUZA 3B77A 2KLGA 4A55A 1E5WA 2CHZA 3WCQA 4N58A 1P7FA 4TSSA 2VZKB 2NBWB 1C4AA 1QQGA 1E7VA 2L7RA 3P6AA 3RCZA 2RDGA 2FDQA 3AEGB 4W9FA 1J7CA 2KX3A 4XWWA 1KLUD 3DCGA 2WXPA 3VIAA 1XODA 4KHBB 2Q5WD 4HAYB 1WGQA 1KF6B 1P3QU 3R2TA 2D3AA 3MJWA 2KOXA 4HPMB 2W2XD 1Q0WB 5E6JA 4JKBA 4URKA 3AECB 3WAOA 2AQ3B 2WXGA 3O13A 2BS4B 2I1KA 1WJMA 2DZKA 2N1WA 1HE8A 1NEKB 2TSSA 4W9JA 3ZIMA 2PMVA 1UNPA 5JH5C 4KKJA 4BZAA 4RGTA 1DOIA 3DVGX 3GE8C 1WGGA 5HFYA 1C9FA 3TUOA
chains in the Genus database with same CATH topology
4GZUA 4HJKA 1OGWA 1UELA 4II2B 3FEHA 4DHZE 2M0XA 2LBBA 4WWNA 3SHQA 2LVPA 2LGXA 5IA7A 2ASQA 1I35A 2IBIB 1NI2A 3M3JA 2YS3A 4ICUA 1X86A 2ZJDA 3H6NA 4KIKA 4RM9A 2L76A 1UBQA 3P2BA 2RGFA 2GBKA 2R09A 1WMHA 5FI0A 2KQSA 4RM8A 2RSGA 1PMSA 2CY4A 1XT9B 4IM0A 4K7UA 4A20A 2LD9A 2ZPNA 1EUVB 5JHHA 1ZC4B 4WQOB 2IO3B 1WI1A 2FCSA 4MH0E 3RULA 2XBBC 2JP2A 3KUDB 5J3QA 2ZCBA 3SDLC 1Z2MA 1MAIA 2COCA 1FHWA 5CLQB 3ZNGC 1WJ1A 3GYOA 2KJ6A 2BKFA 4XC2A 2WWZA 3KUZA 4MGIE 3A9KA 3TW1A 1W1DA 4NQLB 3V6EB 2KCJA 1H8CA 1NU2A 1UPQA 1V9JA 2W2XC 3PHXB 4ILGB 1UBIA 2G45B 5DPSA 5JZEB 4ANWA 1M94A 3U7DA 2V3SA 1MKEA 3VHTC 2AWTA 2BWES 1IPGA 2N7EA 3TCAA 4BBNC 4GPTB 4GOCA 1UPRA 2C5LC 2O2VB 4GSWA 2COPA 1WVHA 3AI5A 1NTVA 3MTNB 2D11A 2CHXA 3SU8X 5AZFA 3ALBA 4F7ZA 3L13A 1V5TA 3WYFB 1NBFC 3CXBB 1B55A 2K6DB 2K1FA 3F5RA 4KSKC 4EUTA 2EJ8A 1ISNA 4K2PA 3TFMA 2YS1A 3VXWA 3PPAA 5D94A 2IO1B 3ODXA 3FSSA 3TO1A 1C1YB 4DHZB 2ABDA 3QIJA 2GS0A 1GJZA 3G9WA 1TQZA 2Y7BA 2JWZA 1V2YA 4MELA 2COFA 2A4ZA 1GUAB 3L10B 5E6NA 2KMCA 3VTWA 3H7SA 1XKEA 3QQ8B 2C7MB 4KHAA 2DAFA 4KV2A 2Y8FA 1WRDB 2LVOA 4NSWA 3PG7A 2DHJA 1YJ1A 2REXA 2Y5BB 2RPQA 2HTHA 2HD5B 4LDTD 5GOWB 5G55A 4PS8A 1XQQA 3A4SC 3V60A 2RSUA 4HAXB 2FJLA 4HAWB 3JSVB 1U2BA 3KUCB 1Y19B 2YVCA 2KUPA 2FIDA 2FJ9A 1WR1A 3QCAA 3PREA 1PQSA 1EVHA 3MPXA 4HDQA 2V4LA 2DLWA 2KX0A 2LXAA 3T06A 2G3QB 2YLMA 1KZ7A 3V5WA 2MFQA 4DBBA 2DYQA 4NNJB 4F7HA 2D9YA 4JKGA 4B6WA 3IG3A 2PPHA 2K2JA 4ZRIA 3QA8A 4TQ0A 1P5TA 2L00B 4ZYNA 3QX1A 4HB2B 2FCQA 3KZ1A 2DYOA 2N23A 4JKFA 4G0NB 3NS8A 4PS7A 5D7GA 3N3KB 5L83A 1WIAA 3VDZA 2LGYA 1P0RA 1VCBA 2KWCA 1XD4A 2FAZA 3PRZA 1V5UA 2Z0EB 5KCVA 4W9EA 4JKEA 2LKOA 4Z2NA 3KW5B 3FP5A 1E8XA 4W9IA 2OTXA 3OANA 1FGZA 2DTCA 1NTIA 2P8VA 2DX5B 2GBMA 3ZKJC 4LCDE 3PP2A 5GMVA 2V1YA 2I5CA 1OQNA 5KQ1A 2ZPYA 2NCNA 1G6JA 2EC1A 1R4MI 2KHWB 4NAWB 2ZNVB 1WE7A 2L0FA 1WXSA 4GXBA 3B08A 5C5BB 3ULBA 3PSEB 3R7RA 1E8WA 1L7YA 2UZSA 1FXTB 1WR6E 2MDXA 1V5PA 2LJ5A 2KO3A 2NPTB 1OY2A 3UQBA 5LOPB 1ZW7A 5HE3A 2EMTA 4ILHA 2GOWA 1OQYA 2DENB 4W9CA 2M38A 4IG7B 2KVRA 4XZ4A 4TUUA 2DYNA 2Y8GA 2M1MA 3AULA 4JGHB 2IY1B 1BT0A 2LULA 3ZTDA 3ODOA 2XK5A 3ZLZA 2YSZA 2FUHB 2Z59B 2LASA 4G3XB 2ZVNA 4WJPA 1WGDA 2KFJA 1KM7A 1WZ0A 3VVWB 3HM6X 1LQBA 4BVUC 5HKHA 1V86A 4FULA 3FM8C 5AZHA 4W9GA 3N7CA 2DHKA 2H7DA 3IBEA 3SYXA 2P0HA 1V5OA 2H7EA 2IZVB 2DKQA 3TBLD 4XX5A 2RGNB 2DKPA 4LJOB 1T0YA 1X1FA 2X18A 3SNHA 3A8PA 4K7WA 2LYDA 5IJMA 1KBLA 2MCNB 2N9PC 4WJOA 4F7GA 3QWMA 2Z0OA 3DBSA 4II3B 2DZJA 1WH3A 1QZEA 1UNQA 4MDKE 4Y94A 1LXDA 3PTFC 2O6VB 4M0WB 2QHOA 4MK0A 2DIKA 1X05A 1AQCA 1Y5OA 1C3TA 2C60A 1WYWB 4K17A 3QJZA 3QWZB 2MRPA 3ZVRA 4FJYA 2Z0QA 4W9HA 4PNKA 3M62B 4HVBA 3HK0A 5BO4B 2VKIA 2KN5A 2ZNVC 5J3YA 1OMWA 1WE6A 2J59M 2ZVOA 4HATB 1EF5A 1WFYA 2DX1A 3OJ3A 4WJNA 3NZSA 5DIFB 1FB8A 4JK8A 2RQ1A 4KZ0A 4CO7A 1M7RA 4P7IA 4EFOA 1P1AA 2MP2A 1BTKA 1NDDA 1DDVA 4IM2A 3ZRFA 4WJ7A 3T9LA 1ACAA 3CMMB 4CHKA 3QBVB 4H8SA 4FLHA 3PVWA 1AARA 2KD0A 3VFKA 5JHBA 4A6FB 2MP2B 2IYBA 2CB8A 2R2OA 3VUWA 4NJ6A 2KC2A 1TZ1A 4EJNA 1J0WA 1BAKA 3K9PB 3ZDMC 5E6OA 1KLVA 4LJPB 1GC6A 3A4RA 2XQNM 3RZFA 1V5MA 1NVLA 3DBRI 2BKRB 3NZUA 2KK8A 3GOEA 3RT3B 3ZNZB 2MQJA 1V81A 4DDGD 2IO2B 1Y8RC 1WZ3A 3IHPC 1TGZB 2RR9A 2PE9A 5JLJB 3RUIB 2VRWB 3VQIA 5DHFB 4K1RB 1DDWA 1W1HA 2MA9B 1TJ6A 3EECA 3A33B 1DROA 2KMAA 4DK5A 1U5FA 1WMHB 4EZJA 3UGBB 1TTNA 3DBHI 2L3ZA 5KHOA 1YIWA 4JKDA 2YF0A 2NR2A 2D9VA 2CRFA 4BBNF 3Q3FA 2LZ6A 2ZZPB 2MSED 2J0KA 1WX7A 2C7NB 1U5EA 3DQVA 4EKUA 2KANA 5LXHA 3QARA 2LRWA 4A3OA 1MPHA 3PVUA 1HBKA 2G4SA 4GDKB 3X0WA 4JQWC 2XEWA 2BCJA 4GGQA 4C0AA 2P0DA 1UGMA 2R82A 4GMVA 5LONB 4IW0A 3W1SA 3IFWB 2KGXB 1KJTA 5IAAC 4WJQA 4K7SA 2XK5B 3QK0A 4HWIB 1SGHA 2NBVB 2KXJA 2NPTA 2LWPA 5AZGA 2YT1A 3ENEA 2HJ8A 1FOEA 3SBTA 1HB6A 4GDKA 2MKRA 2KDEB 3VH4B 2JF5A 4HDOA 3V61A 2D07B 2AL3A 4DX8A 3GYPA 3DVNU 1N3HA 3ZUNA 4WVFB 5CHVC 3ODWA 4IFSA 3N30A 5DPWA 3FLVA 2A5UA 4LDTB 3IVFA 2DZMA 1J0GA 2G35A 1CMXB 2IFSA 4DWFA 4A6KA 3MDBC 5CHWA 4MY6A 5D3WA 1P6SA 4G11A 2CODA 4JKAA 4GN1A 2FIFA 2MX2A 1R4NI 4N9F4 3R66C 2ROZB 2BGFA 3ML8A 2EMSA 1UD7A 2C7HA 2GJYA 1RAXA 2KDBA 1RLFA 2KQ7A 3AU5A 2V76A 2KKCA 4HAZB 3AU4A 3M63B 3UINB 4GDLB 1X1MA 3DBLI 4TYZA 3PGEA 1GG3A 3E9PA 2Z0DB 2CR5A 2MBOA 2LRUA 1U4AA 4BBKA 4G50A 2VSZA 2LI5A 5DHAB 3PSCA 1EF1A 4OVVA 4ZRJA 5FI1A 4NQKE 3LJ3A 4JK9A 4FA6A 2DYMA 2N4FA 4JKGB 2ZCCA 2YT0A 3ULCA 2N9XA 4J6IA 1YQBA 4FHKA 1DYNA 5CTRC 4K2OA 3U8ZA 4A5KA 4FADA 2BYFA 4ANVA 2LXCA 1I7AA 1P3RA 2VRRB 2JT4B 4HB4B 4HCPB 3L17A 3CSFA 1SIFA 3VAWA 2MW5A 2LOXA 4WAAA 1WY8A 5DI9B 3ZNID 3DXCA 2L2IA 2DA0A 1FAOA 5CX3A 3SV1A 2KZRA 3UIOB 1LM8B 1WM3A 1IRSA 1E8YA 1WJUA 1TXDA 3D8FA 3JW0X 1QC6A 1WGRA 3QC8B 2K6QA 3W1SC 2O6VD 2NMBA 3CF6E 1DDMA 3SO6A 3PZDA 3ZRCA 4GB9A 1WG7A 3KVFB 1X1GA 4K81A 1GGOA 1U5DA 3VOQA 1I42A 1BWNA 1W1GA 4KHOA 2JPHA 4W9LA 2LUEA 1WJ4A 1J8CA 2JY6A 3PHWB 4I6NB 4AWJA 2WH5A 5G2NA 4ANXA 2CHWA 4JLCA 4PS3A 3WA0A 4BKGA 2NVUI 4DHJB 2D9XA 5J18A 1WF9A 2QKMA 4YL8A 4EMOA 1LW3A 2L1CA 3B0AA 5C79A 3UIPB 2KJHB 5D2MB 2D9ZA 4BOZB 2HE7A 1KZGA 2M4NA 3ENBA 2GCJA 4E3CA 2M17A 1K5DB 2GBNA 2FCNA 3LDZE 4X57B 3NHEB 3SBGA 5D27A 2WX0A 4PYUA 3TJPA 4KVGB 4ZRKA 1OTRB 4KDLB 5D6JB 2BPSA 4AP4C 1WGUA 2COAA 3BY4B 4TQ1A 2GMIC 4HB3B 2GBJA 2K8CA 4MJSB 4GDLA 2PEAA 4B9KA 4PYZA 5D3XA 2Q13A 1RRBA 3EPYA 2R0DA 2M14A 2K8HA 2KTRA 4NJ7A 1WGYA 3TIXA 2JZ3B 1E90A 3RD2A 5C5BA 2K00A 1U5GA 3V6CB 3JYUA 2ADZA 1Z87A 5J3TA 4IUMB 3CSTA 3D8DA 1WX9A 3HIZA 2MLBA 3K9OB 5EDSA 1L2NA 2DX5A 2UYZB 1EGXA 1VD2A 1F9JA 2O6VA 2NS5A 3F0WA 5DPRA 4ASWC 2KWUB 3APCA 3DVGY 2ROVA 2DYBA 2PJHA 4M8MA 2KTFA 2E2XA 4DX90 3P7ZA 2OOBB 3DVNV 2MBHA 1TBEA 3TVVA 2D10A 2X0SA 1P9DU 2MWNB 2CKHB 4IWOA 3ZDTA 3L0WB 1UH6A 1E8ZA 2D4QA 1ZKHA 3X23A 3A98B 3Q3JA 2L8JA 1MG8A 4JL9A 2KC1A 3UZTA 1MIZB 4IWPA 4MM3A 3S2AA 3JSVA 4KZCA 5JHGA 3HW2B 4F8CB 2JRHA 1XD3B 3LJUX 4BKTA 3KRWA 2DHZA 3OJ4B 2OJRA 4E74A 4XWXA 2IYDB 2W2WA 5J2RA 2LG1A 2QKLA 4KSLC 4ZDVA 3GZNI 4IAPA 2L05A 5LLIA 5KQ4A 2JVCA 1ZM0A 2KDIA 3H9DA 4EEWA 1IYFA 1RFAA 4BFRA 2J0JA 3PVLA 3N32A 2RLOA 4EZKA 2YRYA 1I2HA 5JP4A 3A9JB 5KHQA 3NY5A 3DPDA 4DHJD 1WM2A 3HQCA 3KRXA 2AYOB 1V61A 3V62A 3QHTA 1P98A 3M1IB 4DBGA 2ELAA 2BWFA 1RJ2A 1KC7A 3VUXA 4FHJA 1S1QB 5FR6A 3ZVVA 1WI0A 4MSMB 4W9DA 3D32A 1HB8A 2EKEC 2Z0PA 2NZ8B 1FHOA 1LFDA 1EO6A 3QAQA 3B1LX 4HAUB 2KNBA 3RZWC 3D8EA 3A9KB 3HM3A 3I3TB 3T8MA 3E9LA 2IY0B 5HE2A 4B95A 1U27A 2AEHA 2KWVB 1XR0B 4HLEA 3E66A 5TR5A 1WXAA 2HRJA 1E7UA 2C9WB 1LB1A 1MK7B 2KLCA 3PLVA 4HXDA 1YX6B 5C23A 4E71A 1VBGA 4HB0B 1UZXB 3H7PA 2DFKA 2KFKA 1V80A 3TMPB 2I1JA 3O96A 2O2VA 1XX0A 3ML4A 5J17A 4IM3A 5DCNA 3C0RB 4Z2MB 2J0MA 1MK9B 4CHJA 3L08A 2MBQA 3WAMA 1MIXA 4A6FA 1UEFA 2JZZA 1JRUA 3PEGA 3VTUA 1U29A 3APDA 4I6LB 1RRPB 4MEMA 2UWQA 4OVUA 4JKCA 3ZNHB 4CHMA 1VBHA 4NAWA 1PFJA 4WSFA 5DH9B 2KJRA 3PT2B 3WANA 1WXMA 4BKSA 3EC8A 4HPLB 2WX1A 5EFXA 2CAYA 1H10A 3EHVA 3WAPA 2CU1A 3H1UA 4GMXB 5E6PA 2RNRB 1KI1B 3PRPB 3SD5A 1PLSA 2DAJA 1WXVA 2LGDA 4TKNA 2UZRA 4GU2A 4CYEA 2BF8B 2MBBB 1Q1OA 2N1VA 4KIKB 1FGYA 1ZVRA 1V6EA 1SHCA 2OQBA 1S3SG 4GIVA 5L81A 4ICVA 3TL5A 4YONA 3E9OA 2D9WA 2KTRB 3KH0A 3DOWA 4HHVA 2BYEA 2D2QA 3KYDD 4MGKE 1V89A 3NOBA 3DXDA 2RD0A 5LXIB 4DXAB 2WDTB 5C16A 3VTVA 1XCGA 2LVQA 4M8NA 4ILJA 2MBEA 2YS5A 3APFA 3H7PB 3U30A 4HAVB 3KYCD 2FCMA 3PRMB 3KSYA 5JHAA 1AWEA 4BKSD 4A6HA 5CLLB 4MGZE 2WYQA 3JVZX 3VH3B 2ELBA 3A9JA 4AUQC 3PLUA 1Z5SB 4EZLA 1OEYJ 4AJWA 1GNUA 4RMAA 2P0FA 3ZW3A 4WWPA 3BINA 2K25A 2L0TA 2PE6B 3DXEA 1J19A 4W9KA 5HE1A 3RCPA 4FJZA 4JIOU 4MGYE 4KDIC 2D3GA 4FN2A 2W9NA 2CQUA 2JRIB 1JDEA 3M95A 1DBHA 4AOFA 3A8QA 5D3VA 1UNRA 1OEYA 1EAZA 3BJIA 3ML9A 1ST7A 2K39A 3ZTCA 5L95C 3OLMD 1KOTA 3KY9A 4B6HA 3RYTA 1V49A 2N9EB 2CY5A 2R2QA 4WWOA 3L54A 5C6RA 4FBJB 3A1QB 3NSUA 4BOSC 2JXXA 1SE9A 2DZIA 1K5GB 1A5RA 2BYVE 4AJYB 2UVMA 4L6EA 2ZEQA 1YD8U 3AXCA 4HCNB 1V88A 2PZ1A 2DHIA 2KDFB 4F7UP 4MSQB 1K8RB 5AEKB 3EFUA 1X11A 4F1SA 1NTYA 4KAXB 2AL6A 1D3ZA 3DDCB 4JK7A 2LOZA 4EOYA 1WX8A 2GBRA 4D0NB 1ZSQA 4TV3A 3L16A 4A3PA 2N7DA 4I6PA 4NY0A 3ECIA 3VUYA 2RUKB 3O65B 2K8BA 3WIMA 2KFKB 1IP9A 4JKHA 2K2UA 4PQ0A 5C1ZA 2N0YA 5HE0A 4ANUA 1FHXA 1GC7A 2M8SA 2G4DB 2I5FA 3OAWA 4IOYX 5D3YA 4HK2A 5DPTA 3UF8A 2J7QB 2JUOA 3CIKA 1ZGUB 3R7QA 1Q67A 4DDID 1YX5B 2DN6A 1WJNA 3R3MA 1H4RA 4IWQA 1WGHA 1ZC3B 3MHSD 4IC7B 3AJ4A 2MWSB 4MT7A 1DIKA 2B3AA 3PS6A 3A1QA 1WJ6A 3ZO5B 3WALA 2CS4A 3W1YA 2RVBB 1Q5WB 4NPNA 3UQAA 3HHMA 3PV1A 2NBUA 2GCLA 5CHFA 1BTNA 2HTHB 2IO0B 1M7EA 5JVLA 4MJSA 3ONSA 2FNJB 4FJVB 3SUZA 2KLGA 1E5WA 2CHZA 2NBWB 1QQGA 1E7VA 2L7RA 3P6AA 3RCZA 2FDQA 4W9FA 2KX3A 3DCGA 3VIAA 1XODA 4KHBB 4HAYB 1WGQA 1P3QU 3MJWA 2KOXA 4HPMB 2W2XD 1Q0WB 4JKBA 4URKA 3WAOA 2I1KA 1WJMA 2DZKA 2N1WA 1HE8A 4W9JA 3ZIMA 1UNPA 5JH5C 3DVGX 1WGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OVV A;  3AUL A;  4JGH B;  4IM3 A;  4GZU A;  5DCN A;  3C0R B;  2IY1 B;  3DQV A;  1BT0 A;  2LUL A;  4ZRJ A;  4Z2M B;  3ZTD A;  4HJK A;  2J0M A;  5J18 A;  5FI1 A;  4NQK E;  1OGW A;  1MK9 B;  4CHJ A;  3L08 A;  3ODO A;  3LJ3 A;  2MBQ A;  1UEL A;  2XK5 A;  3WAM A;  3ZLZ A;  4II2 B;  3FEH A;  4FA6 A;  2DYM A;  2YSZ A;  2N4F A;  1MIX A;  4DHZ E;  4A6F A;  2FUH B;  2Z59 B;  1UEF A;  2ZCC A;  2M0X A;  2YT0 A;  2LAS A;  2LBB A;  3ULC A;  2JZZ A;  2ZVN A;  4G3X B;  4WJP A;  2LVP A;  4WWN A;  2LGX A;  1JRU A;  2N9X A;  3SHQ A;  4J6I A;  3PEG A;  1WGD A;  1YQB A;  4FHK A;  3VTU A;  1U29 A;  3APD A;  1DYN A;  5IA7 A;  2KFJ A;  1RRP B;  4I6L B;  2UWQ A;  4MEM A;  5CTR C;  1KM7 A;  2ASQ A;  1WZ0 A;  2IBI B;  3HM6 X;  1NI2 A;  4OVU A;  3VVW B;  1I35 A;  4K2O A;  3M3J A;  2YS3 A;  3U8Z A;  4A5K A;  4CHM A;  1LQB A;  3ZNH B;  4BVU C;  4ICU A;  1X86 A;  1V86 A;  4FAD A;  4FUL A;  2BYF A;  3FM8 C;  2LXC A;  4ANV A;  2ZJD A;  1I7A A;  1P3R A;  2VRR B;  3H6N A;  4KIK A;  2JT4 B;  1PFJ A;  4NAW A;  4RM9 A;  4HB4 B;  2L76 A;  4HCP B;  5AZH A;  3L17 A;  4WSF A;  5DH9 B;  1SIF A;  2KJR A;  3CSF A;  3PT2 B;  4W9G A;  3VAW A;  3WAN A;  3N7C A;  2MW5 A;  2DHK A;  2LOX A;  2H7D A;  1UBQ A;  4WAA A;  1WY8 A;  1WXM A;  3P2B A;  2RGF A;  5DI9 B;  2GBK A;  3IBE A;  3ZNI D;  4BKS A;  3DXC A;  3SYX A;  2L2I A;  2DA0 A;  1FAO A;  2R09 A;  3EC8 A;  2P0H A;  4HPL B;  2WX1 A;  1V5O A;  2H7E A;  3SV1 A;  5EFX A;  2IZV B;  2KZR A;  2DKQ A;  1WMH A;  5CX3 A;  3TBL D;  5FI0 A;  2RGN B;  4XX5 A;  2CAY A;  1H10 A;  1LM8 B;  2KQS A;  3EHV A;  2CU1 A;  4RM8 A;  2DKP A;  1WM3 A;  1IRS A;  2RSG A;  4GMX B;  3H1U A;  1E8Y A;  1PMS A;  5E6P A;  2RNR B;  2CY4 A;  1WJU A;  1XT9 B;  4LJO B;  1KI1 B;  3PRP B;  4IM0 A;  1T0Y A;  3SD5 A;  1X1F A;  2X18 A;  1PLS A;  2DAJ A;  1WXV A;  4K7U A;  1TXD A;  2LD9 A;  2LGD A;  2ZPN A;  4A20 A;  3D8F A;  3SNH A;  4TKN A;  3A8P A;  2UZR A;  5JHH A;  1EUV B;  3JW0 X;  1QC6 A;  1WGR A;  3QC8 B;  4GU2 A;  4K7W A;  4CYE A;  2BF8 B;  2LYD A;  1ZC4 B;  4WQO B;  5IJM A;  2K6Q A;  2IO3 B;  2MCN B;  3W1S C;  2MBB B;  2O6V D;  2N9P C;  4WJO A;  2NMB A;  4F7G A;  1WI1 A;  3CF6 E;  2FCS A;  1DDM A;  3QWM A;  3SO6 A;  2Z0O A;  1Q1O A;  3PZD A;  3DBS A;  4MH0 E;  4II3 B;  2N1V A;  4KIK B;  2DZJ A;  1FGY A;  1WH3 A;  1WG7 A;  4GB9 A;  1ZVR A;  3KVF B;  3RUL A;  3ZRC A;  2XBB C;  1X1G A;  1V6E A;  2JP2 A;  1SHC A;  1UNQ A;  2OQB A;  1QZE A;  4MDK E;  3KUD B;  4Y94 A;  1S3S G;  5J3Q A;  1LXD A;  3PTF C;  2O6V B;  4GIV A;  5L81 A;  2ZCB A;  4ICV A;  3SDL C;  3TL5 A;  4K81 A;  4M0W B;  4YON A;  2QHO A;  4MK0 A;  1Z2M A;  1MAI A;  1U5D A;  3VOQ A;  2COC A;  1X05 A;  1FHW A;  1I42 A;  2D9W A;  1BWN A;  5CLQ B;  3ZNG C;  1WJ1 A;  1W1G A;  3GYO A;  2KJ6 A;  4KHO A;  1AQC A;  2BKF A;  2JPH A;  2LUE A;  2WWZ A;  4W9L A;  4XC2 A;  1Y5O A;  1C3T A;  2C60 A;  3KUZ A;  4MGI E;  1WYW B;  3A9K A;  2KTR B;  3KH0 A;  4K17 A;  3QJZ A;  1WJ4 A;  1J8C A;  3QWZ B;  2MRP A;  3DOW A;  3ZVR A;  2JY6 A;  4HHV A;  2BYE A;  3TW1 A;  3PHW B;  4FJY A;  4I6N B;  5HKH A;  4AWJ A;  2D2Q A;  1W1D A;  2Z0Q A;  3KYD D;  4NQL B;  3V6E B;  2WH5 A;  4MGK E;  5G2N A;  4A3O A;  4W9H A;  2KCJ A;  4ANX A;  1V89 A;  2CHW A;  3RT3 B;  3NOB A;  4PNK A;  4JLC A;  3M62 B;  1H8C A;  1NU2 A;  4HVB A;  3DXD A;  4PS3 A;  2RD0 A;  3WA0 A;  5LXI B;  4DXA B;  3HK0 A;  1UPQ A;  2WDT B;  5BO4 B;  5C16 A;  1V9J A;  3VTV A;  1XCG A;  2W2X C;  2VKI A;  2LVQ A;  2NVU I;  3PHX B;  4BKG A;  4M8N A;  1UBI A;  2KN5 A;  2MBE A;  2ZNV C;  4DHJ B;  2G45 B;  2YS5 A;  5J3Y A;  1OMW A;  1WE6 A;  2J59 M;  5DPS A;  3WIM A;  3APF A;  3H7P B;  5JZE B;  3U30 A;  2D9X A;  4HAT B;  2ZVO A;  4BKT A;  1EF5 A;  4HAV B;  1WFY A;  4ANW A;  2DX1 A;  3KYC D;  1WF9 A;  2FCM A;  2QKM A;  3OJ3 A;  3NZS A;  4WJN A;  5DIF B;  1FB8 A;  1M94 A;  3U7D A;  4YL8 A;  3PRM B;  3KSY A;  4EMO A;  2RQ1 A;  1LW3 A;  2L1C A;  2V3S A;  1MKE A;  5C79 A;  3B0A A;  4KZ0 A;  3UIP B;  3VHT C;  4CO7 A;  2KJH B;  5D2M B;  4AUQ C;  1AWE A;  5JHA A;  1M7R A;  4P7I A;  2D9Z A;  1P1A A;  4BKS D;  4EFO A;  2AWT A;  4A6H A;  4BOZ B;  2HE7 A;  2BWE S;  1IPG A;  1KZG A;  2M4N A;  5CLL B;  4MGZ E;  2MP2 A;  2GCJ A;  1BTK A;  1NDD A;  2N7E A;  4E3C A;  2M17 A;  2WYQ A;  1K5D B;  3TCA A;  3JVZ X;  1DDV A;  2GBN A;  3VH3 B;  4BBN C;  4GPT B;  4IM2 A;  2FCN A;  3LDZ E;  3ZRF A;  3NHE B;  4X57 B;  2ELB A;  4WJ7 A;  5D27 A;  3A9J A;  1UPR A;  2C5L C;  2WX0 A;  4GOC A;  4PYU A;  3T9L A;  2O2V B;  3D32 A;  4GSW A;  3TJP A;  4KVG B;  2COP A;  1ACA A;  4ZRK A;  3PLU A;  1Z5S B;  1WVH A;  3CMM B;  4CHK A;  1OTR B;  3QBV B;  4KDL B;  4EZL A;  4H8S A;  3AI5 A;  1NTV A;  1OEY J;  4FLH A;  3MTN B;  3PVW A;  1GNU A;  2D11 A;  1AAR A;  2P0F A;  2KD0 A;  4RMA A;  5D6J B;  3VFK A;  5JHB A;  2CHX A;  3ZW3 A;  3SU8 X;  4WWP A;  2BPS A;  5AZF A;  3ALB A;  3BIN A;  4A6F B;  4AP4 C;  1WGU A;  4F7Z A;  3L13 A;  2COA A;  2K25 A;  1V5T A;  3BY4 B;  4TQ1 A;  3WYF B;  2GMI C;  4HB3 B;  2GBJ A;  2L0T A;  2IYB A;  2K8C A;  2MP2 B;  4GDL A;  4MJS B;  1NBF C;  2PE6 B;  2PEA A;  3DXE A;  2CB8 A;  2R2O A;  3VUW A;  3CXB B;  4B9K A;  4PYZ A;  1J19 A;  4W9K A;  1B55 A;  2K6D B;  5D3X A;  5HE1 A;  2KC2 A;  2Q13 A;  1TZ1 A;  3RCP A;  4FJZ A;  4NJ6 A;  1RRB A;  2K1F A;  3F5R A;  4JIO U;  4EJN A;  4KDI C;  3EPY A;  1J0W A;  4MGY E;  2R0D A;  2M14 A;  1BAK A;  2K8H A;  2D3G A;  4KSK C;  2KTR A;  4FN2 A;  3K9P B;  4NJ7 A;  4EUT A;  3ZDM C;  2W9N A;  5E6O A;  1WGY A;  3TIX A;  4LJP B;  2EJ8 A;  1KLV A;  1ISN A;  1GC6 A;  4K2P A;  2XQN M;  3A4R A;  3RZF A;  3TFM A;  2YS1 A;  2CQU A;  3PPA A;  3VXW A;  1V5M A;  2JRI B;  2JZ3 B;  5D94 A;  2IO1 B;  3ODX A;  1E90 A;  3FSS A;  3TO1 A;  1C1Y B;  1NVL A;  4DHZ B;  2ABD A;  3M95 A;  1DBH A;  4AOF A;  3QIJ A;  3A8Q A;  3RD2 A;  2GS0 A;  5C5B A;  2K00 A;  1U5G A;  2BKR B;  3G9W A;  3DBR I;  3V6C B;  5D3V A;  1GJZ A;  1TQZ A;  3NZU A;  2KK8 A;  1UNR A;  3GOE A;  3JYU A;  2ADZ A;  2Y7B A;  2JWZ A;  1Z87 A;  5J3T A;  1V2Y A;  1OEY A;  4IUM B;  4MEL A;  1EAZ A;  2MQJ A;  3CST A;  3ZNZ B;  1V81 A;  3BJI A;  2COF A;  3D8D A;  1WX9 A;  2A4Z A;  1ST7 A;  1GUA B;  2MLB A;  3HIZ A;  3ML9 A;  4DDG D;  2K39 A;  2IO2 B;  1Y8R C;  1WZ3 A;  3L10 B;  3ZTC A;  3IHP C;  1TGZ B;  5E6N A;  3K9O B;  5EDS A;  2RR9 A;  2PE9 A;  2KMC A;  1L2N A;  3VTW A;  5JLJ B;  3RUI B;  3H7S A;  2DX5 A;  2VRW B;  3VQI A;  5L95 C;  1XKE A;  3QQ8 B;  5DHF B;  3OLM D;  1KOT A;  4K1R B;  1DDW A;  3KY9 A;  4B6H A;  1W1H A;  2MA9 B;  1TJ6 A;  2C7M B;  3EEC A;  3RYT A;  1V49 A;  3A33 B;  2UYZ B;  2N9E B;  1DRO A;  1EGX A;  2CY5 A;  4KHA A;  1VD2 A;  2KMA A;  4DK5 A;  2R2Q A;  1F9J A;  4WWO A;  1U5F A;  2DAF A;  2O6V A;  1WMH B;  3L54 A;  5C6R A;  4FBJ B;  2NS5 A;  3A1Q B;  3NSU A;  2Y8F A;  3F0W A;  1WRD B;  2LVO A;  4KV2 A;  4NSW A;  3WAP A;  4EZJ A;  3UGB B;  5DPR A;  4BOS C;  1TTN A;  2JXX A;  3DBH I;  4ASW C;  1SE9 A;  2DZI A;  3PG7 A;  1K5G B;  2KWU B;  3APC A;  2L3Z A;  3DVG Y;  1A5R A;  2BYV E;  5KHO A;  2DHJ A;  1YIW A;  2YF0 A;  4AJY B;  2UVM A;  2NR2 A;  2D9V A;  2CRF A;  4L6E A;  2ROV A;  1YJ1 A;  2DYB A;  2HTH A;  2PJH A;  2REX A;  2RPQ A;  2Y5B B;  2ZEQ A;  3Q3F A;  2KTF A;  2E2X A;  1YD8 U;  2LZ6 A;  2MSE D;  4DX9 0;  2ZZP B;  4M8M A;  3P7Z A;  2HD5 B;  3AXC A;  4LDT D;  1D3Z A;  2J0K A;  1WX7 A;  2C7N B;  4HCN B;  5GOW B;  5G55 A;  2OOB B;  3DVN V;  1U5E A;  1V88 A;  2DHI A;  4EKU A;  2PZ1 A;  1XQQ A;  2KAN A;  2KDF B;  2MBH A;  4F7U P;  3A4S C;  4MSQ B;  3V60 A;  1K8R B;  3QAR A;  1TBE A;  5AEK B;  2RSU A;  3TVV A;  3EFU A;  2D10 A;  1X11 A;  1P9D U;  2MWN B;  4F1S A;  1NTY A;  2CKH B;  4KAX B;  2LRW A;  4IWO A;  2AL6 A;  3ZDT A;  1MPH A;  3L0W B;  1UH6 A;  3PVU A;  2FJL A;  1HBK A;  4HAX B;  4HAW B;  1E8Z A;  2G4S A;  2LOZ A;  3DDC B;  3JSV B;  4GDK B;  4EEW A;  2D4Q A;  1ZKH A;  1U2B A;  3X0W A;  4JQW C;  3X23 A;  3KUC B;  1Y19 B;  2XEW A;  4EOY A;  2YVC A;  3A98 B;  2KUP A;  3Q3J A;  1WX8 A;  2FID A;  2FJ9 A;  2GBR A;  4D0N B;  2L8J A;  2BCJ A;  1MG8 A;  1WR1 A;  1ZSQ A;  4JL9 A;  4TV3 A;  3L16 A;  2KC1 A;  4A3P A;  3UZT A;  1MIZ B;  4GGQ A;  2N7D A;  4I6P A;  4IWP A;  4C0A A;  3QCA A;  4MM3 A;  3PRE A;  4NY0 A;  3S2A A;  2P0D A;  1UGM A;  3ECI A;  1PQS A;  3JSV A;  1EVH A;  3MPX A;  4KZC A;  3VUY A;  4HDQ A;  4BBN F;  5JHG A;  2V4L A;  2DLW A;  2RUK B;  3HW2 B;  4GMV A;  5LON B;  2KX0 A;  2K8B A;  2LXA A;  3O65 B;  4IW0 A;  3W1S A;  3T06 A;  2G3Q B;  2YLM A;  3IFW B;  2KFK B;  2JRH A;  1XD3 B;  1KZ7 A;  4F8C B;  3LJU X;  3KRW A;  2MFQ A;  3V5W A;  2KGX B;  1KJT A;  4DBB A;  2DHZ A;  2OJR A;  3OJ4 B;  5IAA C;  4E74 A;  2DYQ A;  4WJQ A;  4NNJ B;  4F7H A;  2D9Y A;  4XWX A;  4B6W A;  2IYD B;  1IP9 A;  3IG3 A;  4K7S A;  2W2W A;  5J2R A;  2LG1 A;  2PPH A;  2QKL A;  2XK5 B;  4KSL C;  2K2J A;  4ZRI A;  3QA8 A;  3QK0 A;  4HWI B;  1SGH A;  2NBV B;  2K2U A;  4PQ0 A;  3GZN I;  4TQ0 A;  2KXJ A;  4ZDV A;  5C1Z A;  2NPT A;  1P5T A;  4IAP A;  2L05 A;  2LWP A;  5AZG A;  2L00 B;  2YT1 A;  5LLI A;  2N0Y A;  4ZYN A;  3ENE A;  2HJ8 A;  5KQ4 A;  1FOE A;  2JVC A;  3QX1 A;  4HB2 B;  5HE0 A;  1IYF A;  1ZM0 A;  1FHX A;  1GC7 A;  3KZ1 A;  2FCQ A;  2G4D B;  2I5F A;  2N23 A;  1HB6 A;  2DYO A;  2KDI A;  4IOY X;  5D3Y A;  1RFA A;  3H9D A;  3OAW A;  2MKR A;  2J0J A;  4GDK A;  4HK2 A;  4ANU A;  4G0N B;  4BFR A;  3PVL A;  2M8S A;  5DPT A;  2KDE B;  3VH4 B;  3NS8 A;  2JF5 A;  4PS7 A;  4HDO A;  3UF8 A;  3UIO B;  2J7Q B;  2JUO A;  2RLO A;  3N32 A;  3V61 A;  4EZK A;  5D7G A;  3N3K B;  2YRY A;  1I2H A;  3CIK A;  5JP4 A;  1WIA A;  3VDZ A;  5L83 A;  2LGY A;  1ZGU B;  3R7Q A;  1Q67 A;  1P0R A;  2D07 B;  3A9J B;  4DDI D;  5KHQ A;  3NY5 A;  3DPD A;  2AL3 A;  1YX5 B;  4DHJ D;  2DN6 A;  1WJN A;  1WM2 A;  3HQC A;  4DX8 A;  3R3M A;  1H4R A;  3GYP A;  1VCB A;  4IWQ A;  3KRX A;  1WGH A;  2AYO B;  1N3H A;  2KWC A;  3DVN U;  4AJW A;  5LXH A;  1ZC3 B;  1XD4 A;  2FAZ A;  1V61 A;  3MHS D;  4WVF B;  3PRZ A;  3ZUN A;  5CHV C;  4IC7 B;  3ODW A;  4IFS A;  3N30 A;  3V62 A;  5DPW A;  3AJ4 A;  3QHT A;  1P98 A;  3M1I B;  2MWS B;  4DBG A;  3FLV A;  1V5U A;  2Z0E B;  2ELA A;  5KCV A;  2A5U A;  2BWF A;  1RJ2 A;  4MT7 A;  4W9E A;  2B3A A;  3PS6 A;  3VUX A;  4LDT B;  2LKO A;  3A1Q A;  4FHJ A;  3IVF A;  1S1Q B;  2DZM A;  5FR6 A;  1J0G A;  3ZVV A;  4Z2N A;  2G35 A;  1WJ6 A;  3KW5 B;  3FP5 A;  1CMX B;  3ZO5 B;  2IFS A;  4DWF A;  1WI0 A;  1E8X A;  4MSM B;  3WAL A;  2CS4 A;  4W9I A;  2OTX A;  3W1Y A;  2RVB B;  3OAN A;  4A6K A;  1FGZ A;  3MDB C;  4W9D A;  5CHW A;  2DTC A;  1HB8 A;  1NTI A;  2P8V A;  4MY6 A;  5D3W A;  1Q5W B;  1P6S A;  2DX5 B;  2EKE C;  2GBM A;  3HHM A;  2COD A;  4G11 A;  3UQA A;  3ZKJ C;  2Z0P A;  4LCD E;  3PP2 A;  3PV1 A;  5GMV A;  2V1Y A;  2NBU A;  4GN1 A;  2I5C A;  2FIF A;  2NZ8 B;  2MX2 A;  2GCL A;  1FHO A;  1OQN A;  1R4N I;  4N9F 4;  5CHF A;  3R66 C;  5KQ1 A;  2ZPY A;  2NCN A;  1BTN A;  2HTH B;  1G6J A;  2IO0 B;  2ROZ B;  2EC1 A;  1M7E A;  1LFD A;  2BGF A;  3ONS A;  4MJS A;  1EO6 A;  1R4M I;  2KHW B;  4NAW B;  2FNJ B;  2ZNV B;  3SUZ A;  4FJV B;  3ML8 A;  2KLG A;  1WE7 A;  2L0F A;  1WXS A;  4GXB A;  3B1L X;  3B08 A;  3QAQ A;  2EMS A;  4HAU B;  2KNB A;  5C5B B;  3ULB A;  1E5W A;  2CHZ A;  3PSE B;  4NPN A;  3RZW C;  3D8E A;  3A9K B;  3HM3 A;  3I3T B;  1UD7 A;  3T8M A;  3R7R A;  1E8W A;  2C7H A;  2IY0 B;  2GJY A;  1RAX A;  2KDB A;  1L7Y A;  2NBW B;  2UZS A;  5HE2 A;  1RLF A;  4B95 A;  1FXT B;  1U27 A;  1QQG A;  1E7V A;  2L7R A;  2AEH A;  2KQ7 A;  3AU5 A;  3P6A A;  2MDX A;  1WR6 E;  3RCZ A;  2KWV B;  2FDQ A;  1XR0 B;  4W9F A;  4HLE A;  2KX3 A;  1V5P A;  5TR5 A;  2LJ5 A;  2KO3 A;  2V76 A;  2KKC A;  4HAZ B;  2NPT B;  3DCG A;  1WXA A;  2HRJ A;  3AU4 A;  3VIA A;  3M63 B;  1XOD A;  1E7U A;  2C9W B;  3UIN B;  4KHB B;  1OY2 A;  1X1M A;  4HAY B;  4GDL B;  3UQB A;  1LB1 A;  1WGQ A;  1MK7 B;  1P3Q U;  2KLC A;  3DBL I;  3MJW A;  3PLV A;  4HXD A;  1YX6 B;  5LOP B;  2KOX A;  2W2X D;  4HPM B;  4TYZ A;  3PGE A;  5C23 A;  4E71 A;  1GG3 A;  1Q0W B;  4URK A;  4HB0 B;  3WAO A;  1UZX B;  3H7P A;  2I1K A;  2DFK A;  1ZW7 A;  1WJM A;  5HE3 A;  2DZK A;  2EMT A;  1HE8 A;  2KFK A;  2N1W A;  1V80 A;  4PS8 A;  4W9J A;  2GOW A;  3ZIM A;  2Z0D B;  1OQY A;  2CR5 A;  2MBO A;  2I1J A;  2DEN B;  3O96 A;  2LRU A;  1U4A A;  3TMP B;  4W9C A;  1UNP A;  2O2V A;  5JH5 C;  4BBK A;  2M38 A;  4IG7 B;  4G50 A;  2VSZ A;  2KVR A;  2LI5 A;  3DVG X;  4XZ4 A;  4TUU A;  1XX0 A;  2DYN A;  2Y8G A;  3PSC A;  5DHA B;  1EF1 A;  3ML4 A;  5J17 A;  1WGG A;  2M1M A; 
#chains in the Genus database with same CATH topology
 2WU2 B;  4GZU A;  3P4S B;  4C7Z A;  4HJK A;  1ESF A;  1OGW A;  1UEL A;  4II2 B;  3FEH A;  4LNO A;  4P6V F;  2ACZ B;  4DHZ E;  3PZ8 A;  1KTK A;  1TS2 A;  5BYS A;  4R3D A;  2M0X A;  2LBB A;  4WWN A;  3SHQ A;  2LVP A;  2LGX A;  3AEA B;  3W2D A;  2ICI A;  2DWQ A;  5IA7 A;  2ASQ A;  1I35 A;  2IBI B;  1NI2 A;  3M3J A;  2YS3 A;  4ICU A;  1X86 A;  4YXD B;  2ZJD A;  3H6N A;  3FKY A;  4KIK A;  4RM9 A;  2L76 A;  4WIP A;  3AED B;  2FE8 A;  1UBQ A;  3P2B A;  1TKG A;  2RGF A;  1IBX B;  2GBK A;  3U4E G;  2QEJ C;  1E9M A;  2R09 A;  1WMH A;  5FI0 A;  2KQS A;  4RM8 A;  2EEL A;  3FC4 A;  2RSG A;  1PMS A;  2CY4 A;  1XT9 B;  4K3C A;  4IM0 A;  4K7U A;  4A20 A;  2LD9 A;  2ZPN A;  1EUV B;  5JHH A;  1SBB B;  4ZRP A;  4A8X C;  1AN8 A;  1ZC4 B;  3LB8 C;  4WQO B;  2IO3 B;  2JYE A;  1EU3 A;  2RRF A;  4NZL B;  2ZKM X;  3EFC A;  1WI1 A;  2FCS A;  4MH0 E;  3RUL A;  2XBB C;  3VRB B;  2JP2 A;  3KUD B;  1ZDX A;  5J3Q A;  2M19 A;  2ZCB A;  3SDL C;  5HG2 A;  4M01 A;  2JU6 X;  1Z2M A;  4JWS C;  4YTN B;  1MAI A;  2COC A;  1FHW A;  5CLQ B;  3ZNG C;  1WJ1 A;  3GYO A;  2KJ6 A;  2BKF A;  4XC2 A;  2WHI A;  2WWZ A;  2MJ3 A;  4XYC A;  3KUZ A;  4MGI E;  1ET6 A;  3A9K A;  3EGR A;  5BYQ A;  3RNC C;  4RGM A;  1TY2 A;  1FO4 A;  3TW1 A;  4PK1 A;  1AWD A;  1SE3 A;  1W1D A;  4NQL B;  3V6E B;  4CSQ A;  2KCJ A;  1TS5 A;  2K3U A;  1H8C A;  1NU2 A;  3Q3M C;  3AE1 B;  1UPQ A;  1V9J A;  2W2X C;  3PHX B;  4ILG B;  4XWT A;  1UBI A;  2G45 B;  5DPS A;  3N1Y C;  5JZE B;  2WNM A;  2RDB C;  4LTU A;  4JPS A;  4ANW A;  1M94 A;  4AS1 A;  5IO9 A;  3U7D A;  3N1Z C;  1QIL A;  2V3S A;  1MKE A;  3VHT C;  3HSA A;  3RNF C;  5LG4 B;  2PIA A;  2AWT A;  2RPV A;  2BWE S;  1IPG A;  4NJC A;  1T5X D;  2N7E A;  3AE6 B;  2KVZ A;  3TCA A;  4BBN C;  4GPT B;  1T77 A;  4GOC A;  1TKY A;  1UPR A;  2C5L C;  2O2V B;  4GSW A;  2COP A;  1WVH A;  4GNK B;  3AI5 A;  1NTV A;  2H88 B;  3MTN B;  2D11 A;  3W5U B;  3P4P B;  1ZUD 2;  2CHX A;  1PYW D;  3SU8 X;  5AZF A;  3ALB A;  4F7Z A;  3L13 A;  1V5T A;  3WYF B;  3NRZ A;  4MAC A;  1XCT L;  1NBF C;  3CXB B;  1HEZ E;  4WQM A;  1B55 A;  2K6D B;  1ZP0 B;  2K1F A;  3F5R A;  1YMH E;  1N60 A;  4KSK C;  4EUT A;  4YSZ B;  2EJ8 A;  4ITK A;  1ISN A;  4K2P A;  2E6X A;  3TFM A;  1MPE A;  2YS1 A;  3VXW A;  3PPA A;  1FXA A;  5D94 A;  2IO1 B;  3ODX A;  3FSS A;  3TO1 A;  1C1Y B;  2WXQ A;  4DHZ B;  3RFZ B;  2ABD A;  5IP4 D;  3QIJ A;  1I4Q A;  2GS0 A;  1GJZ A;  3G9W A;  3KQ4 A;  1TQZ A;  2Y7B A;  2JWZ A;  1V2Y A;  4MEL A;  3RI7 C;  3BVM A;  1TJE A;  1JAL A;  2WDR B;  2COF A;  2A4Z A;  1GUA B;  2HTM E;  3L10 B;  2QCZ A;  1J7A A;  5E6N A;  2RMM A;  2WXF A;  2KMC A;  1JRO A;  3VTW A;  3H7S A;  5C2T B;  2Y3A A;  1XKE A;  1L0Y B;  3QQ8 B;  3DBL B;  2C7M B;  4KHA A;  1XLO A;  2DAF A;  2INP E;  1HZ6 A;  4KV2 A;  2Y8F A;  1WRD B;  2DNF A;  2LVO A;  4NSW A;  1A70 A;  2ZW1 A;  3Q14 C;  3BK2 A;  3PG7 A;  3AE2 B;  3DBH B;  5I2S A;  2DHJ A;  3P4R B;  1C77 A;  1YJ1 A;  2REX A;  2Y5B B;  2NBV A;  2HTH A;  2RPQ A;  3B9J A;  3RPF C;  2WU5 B;  2HD5 B;  4LDT D;  3MFG A;  1TY0 A;  5GOW B;  2MJE A;  5G55 A;  4PS8 A;  1XQQ A;  3A4S C;  2HDE A;  3V60 A;  2PKO A;  2RSU A;  4UDU C;  2ONQ A;  3AE3 B;  2JYT A;  4HAX B;  2FJL A;  4C00 A;  4HAW B;  1FEH A;  3JSV B;  2EKI A;  1U2B A;  2BB6 A;  3KUC B;  1Y19 B;  2YVC A;  2KUP A;  4YTP B;  2FID A;  2FJ9 A;  4P1C C;  1WR1 A;  1ENF A;  3NVV A;  3QCA A;  3PRE A;  1TZO A;  1JW9 D;  1PQS A;  1EVH A;  3MPX A;  4HDQ A;  5EE9 A;  2V4L A;  2DLW A;  1YQ4 B;  2KX0 A;  3BYT B;  2LXA A;  2W55 A;  3OG5 A;  3T06 A;  2G3Q B;  2YLM A;  1KZ7 A;  3V5W A;  2MFQ A;  4DBB A;  2DYQ A;  4NNJ B;  4F7H A;  4IOI E;  2D9Y A;  4JKG A;  4B6W A;  3IG3 A;  2PPH A;  2K2J A;  4ZRI A;  3QA8 A;  3BII D;  1C79 A;  1JWU D;  3A58 A;  2V3P A;  4TQ0 A;  5I4D A;  1P5T A;  2L00 B;  4ZYN A;  1SSN A;  3QX1 A;  4HB2 B;  2FCQ A;  3KZ1 A;  2DYO A;  2N23 A;  4JKF A;  4G0N B;  3SFE B;  2QIE B;  3NS8 A;  4PS7 A;  1B9R A;  5D7G A;  3N3K B;  1UUP A;  5L83 A;  1WIA A;  3VDZ A;  2LGY A;  1QLB B;  1P0R A;  1VCB A;  2KWC A;  2Z14 A;  4RF0 A;  1XD4 A;  2FAZ A;  3PRZ A;  1N62 A;  1TIF A;  3PO0 A;  2M0A A;  1V5U A;  2Z0E B;  5KCV A;  4W9E A;  4JKE A;  2LKO A;  2I2Y A;  2I38 A;  4Z2N A;  4OSN A;  3KW5 B;  3FP5 A;  1CQV A;  2N9K A;  1E8X A;  4W9I A;  2OTX A;  3OAN A;  1FIQ A;  1FGZ A;  1QOB A;  3E9S A;  2DTC A;  1M4V A;  1NTI A;  2P8V A;  1F1H A;  2DX5 B;  2GBM A;  4S0R A;  2YEP F;  3GB1 A;  3ZKJ C;  4LCD E;  3PP2 A;  5GMV A;  2V1Y A;  2I5C A;  1OQN A;  4K3B A;  5KQ1 A;  2ZPY A;  2NCN A;  1G6J A;  2EC1 A;  2IND C;  1QOA A;  1R4M I;  2KHW B;  2QMT A;  4NAW B;  4ZRQ A;  2ZNV B;  1WE7 A;  2L0F A;  1WXS A;  4GXB A;  3B08 A;  5C5B B;  3ULB A;  3PSE B;  5BMG A;  2KN4 A;  3R7R A;  1E8W A;  1V1P B;  1L7Y A;  3ETR A;  2UZS A;  4QJ5 B;  2IJ0 A;  2KMM A;  1FXT B;  2OHF A;  1FNV A;  1WR6 E;  2MDX A;  1V5P A;  4MT5 A;  4WAF A;  2LJ5 A;  2KO3 A;  2JXT A;  1RWS A;  2NPT B;  3NZ3 A;  1DYQ A;  1OY2 A;  3UQB A;  1XCQ L;  1FRD A;  5LOP B;  1WGK A;  3OWE B;  1FXI A;  2KDM A;  1ZW7 A;  5HE3 A;  2EMT A;  4ILH A;  4LLG M;  1ET9 A;  2GOW A;  1OQY A;  2DEN B;  1E10 A;  4W9C A;  4L23 A;  2M38 A;  4IG7 B;  2IDY A;  2CJO A;  2KVR A;  4XZ4 A;  4TUU A;  2DYN A;  2Y8G A;  2L52 A;  3FIL A;  1F2R C;  4DQO C;  3NJT A;  3DHH C;  3DHI C;  2M1M A;  3U12 A;  3AUL A;  1B1Z A;  4JGH B;  2IY1 B;  1BT0 A;  1HXY D;  2LUL A;  3ZTD A;  2VH1 A;  3ODO A;  2XK5 A;  3ZLZ A;  2V0G A;  1QF6 A;  1AYF A;  2YSZ A;  2LHE A;  2IGH A;  2FUH B;  2Z59 B;  1PGA A;  2Y5P A;  2LAS A;  4G3X B;  2ZVN A;  4WJP A;  1WGD A;  1ZDV A;  3MC0 B;  2KFJ A;  1BML C;  1KM7 A;  1WZ0 A;  2MHJ A;  3HM6 X;  3VVW B;  3ZJT A;  1LQB A;  4ARC A;  4BVU C;  5HKH A;  1V86 A;  4FUL A;  3FM8 C;  1D5X C;  5AZH A;  3P42 A;  4YSX B;  2JWU A;  4W9G A;  3N7C A;  2DHK A;  2H7D A;  2AQ1 B;  3IBE A;  1D5Z C;  3SYX A;  2BVC A;  2P0H A;  1V5O A;  2H7E A;  2IZV B;  2DKQ A;  3TBL D;  4XX5 A;  2RGN B;  1FPY A;  1TKE A;  4LNN A;  2DKP A;  4RFB A;  4LJO B;  1T0Y A;  1DGJ A;  1X1F A;  2X18 A;  1K51 A;  5FK9 C;  2WXH A;  1QOF A;  3PZ7 A;  3SNH A;  4YSY B;  3A8P A;  3AMZ A;  4K7W A;  2LYD A;  5IJM A;  1KBL A;  1SJH D;  2MCN B;  2N9P C;  2BYT A;  4WJO A;  4F7G A;  3TSS A;  2WXK A;  2SAK A;  1GPX A;  3QWM A;  5G5G A;  2Z0O A;  2L83 A;  3DBS A;  4II3 B;  1NI3 A;  2DZJ A;  1WH3 A;  3MC9 A;  1XLQ A;  1QZE A;  1UNQ A;  4MDK E;  4Y94 A;  1LXD A;  2BBC A;  3PTF C;  2O6V B;  3GP7 A;  4M0W B;  2QHO A;  4MK0 A;  3IXS A;  3KLS X;  2DIK A;  1X05 A;  1F77 A;  1IUE A;  1AQC A;  1Y5O A;  1C3T A;  2C60 A;  1WYW B;  2K8E A;  4K17 A;  3QJZ A;  3QWZ B;  2MRP A;  3ZVR A;  4FJY A;  2WGS A;  2Z0Q A;  1FM0 D;  4W9H A;  4PNK A;  3M62 B;  4HVB A;  3T3N A;  3HK0 A;  5BO4 B;  2VKI A;  2KN5 A;  1HQR D;  2ZNV C;  5J3Y A;  5T8I A;  1OMW A;  1WE6 A;  2J59 M;  1I4G A;  4L1R A;  2ZVO A;  4HAT B;  1EF5 A;  1WFY A;  2DX1 A;  4LNK A;  3OJ3 A;  1ROE A;  3NZS A;  4WJN A;  5DIF B;  1FB8 A;  4JK8 A;  2LGI A;  2RQ1 A;  3TEY A;  4KZ0 A;  4CO7 A;  4DXG A;  2LHD A;  3W9C B;  1M7R A;  4P7I A;  4EFO A;  1P1A A;  1EM7 A;  3SFD B;  2Z4D A;  4P16 A;  2LMC A;  2MP2 A;  1BTK A;  1NDD A;  1DDV A;  2G9H D;  4IM2 A;  1XXG A;  3ZRF A;  2G1E A;  4WJ7 A;  3T9L A;  1GB1 A;  1ACA A;  3CMM B;  4CHK A;  3QBV B;  1KRH A;  4H8S A;  2LFI A;  4FLH A;  3PVW A;  1AAR A;  2KD0 A;  3VFK A;  5JHB A;  4ZHP A;  4A6F B;  5IKC M;  2N9L A;  1L4D B;  2MP2 B;  2IYB A;  1SF0 A;  2QJL A;  2CB8 A;  2R2O A;  3VUW A;  3GZN B;  4NJ6 A;  1I4R A;  2KC2 A;  1TZ1 A;  4EJN A;  1J0W A;  1BAK A;  3K9P B;  3ZDM C;  4XGA B;  5E6O A;  1KLV A;  4LJP B;  1GC6 A;  1N5X A;  3A4R A;  2XQN M;  4HPP A;  3RZF A;  1L6U A;  1V5M A;  1WYG A;  1VLB A;  2KYW A;  1NVL A;  2R2Y A;  1VZ8 A;  3AEB B;  3DBR I;  2BKR B;  3BZD B;  3NZU A;  2KK8 A;  3GOE A;  3Q3N C;  2IPK D;  3RT3 B;  3ZNZ B;  2MQJ A;  5BMH A;  1V81 A;  2IGG A;  4DDG D;  1MFW A;  2IO2 B;  3URY A;  1Y8R C;  1WZ3 A;  3BYY B;  3IHP C;  1TGZ B;  2XNA C;  4C4V B;  2RR9 A;  2PE9 A;  5JLJ B;  3RUI B;  2VRW B;  3VQI A;  1N6Z A;  5DHF B;  4K1R B;  1DDW A;  3IT6 B;  1W1H A;  2MA9 B;  1TJ6 A;  3EEC A;  3I57 A;  2N7J A;  3A33 B;  5IRS A;  1DRO A;  2KMA A;  4DK5 A;  1U5F A;  2V3N A;  1WMH B;  2HJ1 A;  4S17 A;  3J9C A;  2YEP B;  1N63 A;  4EZJ A;  3UGB B;  1TTN A;  3DBH I;  2WXM A;  2L3Z A;  5KHO A;  1YIW A;  4JKD A;  2YF0 A;  2NR2 A;  2D9V A;  2CRF A;  3ZYY X;  4BBN F;  3Q3F A;  2WLB A;  2DLB A;  1L6V A;  2LZ6 A;  2ZZP B;  3DCX A;  2MSE D;  5FKA C;  2J0K A;  1WX7 A;  2C7N B;  2ON8 A;  3EUB 2;  1U5E A;  3DQV A;  4EKU A;  2KAN A;  5LXH A;  2V9H A;  3QAR A;  3NVW A;  1FCL A;  2LRW A;  1MPH A;  4A3O A;  3PVU A;  1HBK A;  2G4S A;  2R61 A;  4GDK B;  2PVO D;  3X0W A;  3BVG A;  4JQW C;  3NUH B;  2XEW A;  4ARI A;  3L4P A;  2WS3 B;  2X38 A;  2BCJ A;  1SB3 C;  4GGQ A;  4C0A A;  1L0V B;  5D3D A;  2P0D A;  1UGM A;  1FNW A;  1C4P A;  2R82 A;  4JX1 C;  4GMV A;  5LON B;  4IW0 A;  3W1S A;  3IFW B;  1PDX A;  2KGX B;  1KJT A;  2W54 A;  5IAA C;  4WJQ A;  4FXC A;  3RNG C;  1E6E B;  4K7S A;  4B0E A;  2XK5 B;  1FNU A;  3R2I A;  2WXO A;  3QK0 A;  4HWI B;  1SGH A;  2NBV B;  2KXJ A;  2NPT A;  1UNS A;  2LWP A;  5AZG A;  2N0S B;  2YT1 A;  3ENE A;  1V8C A;  2HJ8 A;  1FOE A;  1SE4 A;  3SBT A;  2IGD A;  4OZC A;  1HB6 A;  4P1B C;  4GDK A;  2MKR A;  2AX5 A;  2KDE B;  3FVC A;  3VH4 B;  2JF5 A;  4HDO A;  1V1P A;  2WXI A;  2GUM A;  3V61 A;  3ZXR A;  2D07 B;  2AL3 A;  4DX8 A;  3MHZ A;  3GYP A;  1Q10 A;  1MI1 A;  3DVN U;  1N3H A;  2QDF A;  3ZXV A;  1F0Z A;  3ZUN A;  1YOV B;  4WVF B;  5CHV C;  3ODW A;  2CJN A;  4WUR A;  4IFS A;  3N30 A;  5DPW A;  5G5H A;  3FLV A;  1QT9 A;  2A5U A;  4PT5 A;  4LDT B;  2K9X A;  3IVF A;  2DZM A;  1J0G A;  2G35 A;  3VRA B;  1CMX B;  2IFS A;  4DWF A;  4A6K A;  3TEW A;  4D2K A;  3MDB C;  3Q6B A;  5CHW A;  4MY6 A;  5D3W A;  1PUT A;  1P6S A;  2B76 B;  2COD A;  4G11 A;  4C4V A;  3IAS 1;  4JKA A;  4GN1 A;  2FIF A;  2MX2 A;  1CK1 A;  1R4N I;  4N9F 4;  5AUI A;  3R66 C;  2ROZ B;  3U52 E;  1FD6 A;  2BGF A;  4ACF A;  3HVZ A;  1R4M B;  3NWA A;  3ML8 A;  2EMS A;  1UD7 A;  2C7H A;  3Q8A A;  2GJY A;  1RAX A;  2KDB A;  3NS1 A;  2WXL A;  1RLF A;  2BQQ A;  3BVZ A;  4M0W A;  2KQ7 A;  2J42 A;  3AU5 A;  1HA5 A;  4QAY A;  2V76 A;  3N1X C;  2VZK D;  2KKC A;  4HAZ B;  1NYQ A;  3AU4 A;  3M63 B;  3UIN B;  2FJU B;  1YJJ A;  1X1M A;  4GDL B;  3B2G A;  3DBL I;  1R7S A;  4TYZ A;  3PGE A;  2JSV X;  1GG3 A;  2Z13 A;  4ZHO A;  3LXF A;  1TS4 A;  3E9P A;  2Z0D B;  2CR5 A;  2MBO A;  2D3C A;  2KAJ A;  2LRU A;  1U4A A;  4BBK A;  4G50 A;  2VSZ A;  2LI5 A;  4RGN A;  4N59 A;  1T0Q C;  5DHA B;  3PSC A;  1EF1 A;  2BTE A;  5IOI A;  4OVV A;  3P1M A;  4ZRJ A;  3OHM B;  2K49 A;  5FI1 A;  4NQK E;  3LJ3 A;  3KWV A;  4JK9 A;  3U2S C;  4FA6 A;  4RNA A;  2DYM A;  2N4F A;  3AE7 B;  4JKG B;  2ZCC A;  3N20 C;  4OHJ A;  2YT0 A;  2WQY B;  3ULC A;  2K0P A;  2N9X A;  2QC8 A;  1DOY A;  4J6I A;  5H8Y E;  1YQB A;  4FHK A;  3AB5 A;  1DYN A;  5CTR C;  4K2O A;  3U8Z A;  4A5K A;  3GE3 C;  4FAD A;  4OVZ A;  2BYF A;  4ANV A;  2LXC A;  2NTS A;  1I7A A;  1P3R A;  2VRR B;  3B2F A;  2JT4 B;  4MH8 A;  4HB4 B;  4HCP B;  3L17 A;  3CSF A;  1SIF A;  3VAW A;  1WWT A;  3CIR B;  2MW5 A;  2LOX A;  2K22 A;  3H8H A;  4L2Y A;  4WAA A;  1WY8 A;  1R4N B;  5DI9 B;  3ZNI D;  3DXC A;  2L2I A;  2DA0 A;  1FAO A;  3CWI A;  5CX3 A;  3SV1 A;  2KZR A;  1WXQ A;  3UIO B;  1LM8 B;  1WM3 A;  1IRS A;  1E8Y A;  1WJU A;  1TS3 A;  1C76 A;  1TXD A;  3D8F A;  3JW0 X;  1QC6 A;  1WGR A;  3QC8 B;  3FAH A;  2D3B A;  1STE A;  2K6Q A;  3W1S C;  2O6V D;  3Q8E A;  2J53 A;  2NMB A;  1CZP A;  3I9V 1;  3CF6 E;  1DDM A;  3SO6 A;  3T3O A;  2KQ4 X;  3PZD A;  3ZRC A;  4GB9 A;  1WG7 A;  3KVF B;  1EWY C;  1X1G A;  1XLN A;  4K81 A;  1GGO A;  1U5D A;  3VOQ A;  1I42 A;  1BWN A;  1W1G A;  4KHO A;  2JPH A;  4RGO S;  2KT7 A;  2LUE A;  4W9L A;  5C3J B;  3ZQ4 A;  2NTT A;  1WJ4 A;  1J8C A;  1WRI A;  1XF5 L;  2JY6 A;  3PHW B;  4I6N B;  3HIE A;  3TEZ A;  4AWJ A;  2WH5 A;  5G2N A;  4ANX A;  2CHW A;  1GAQ B;  3AE4 B;  4JLC A;  3Q8B A;  4PS3 A;  2QIL A;  3WA0 A;  2NMQ A;  4BKG A;  3U7Z A;  2NVU I;  3VR9 B;  5TSS A;  1QQR A;  4KGS A;  4DHJ B;  1UWX A;  1FMA D;  2D9X A;  5J18 A;  1WF9 A;  2QKM A;  1NEN B;  4YL8 A;  2GI9 A;  4EMO A;  4MM3 B;  4H2A A;  1LW3 A;  2L1C A;  3B0A A;  5C79 A;  3ZJV A;  3UIP B;  3RNE C;  2KJH B;  5D2M B;  1BXT A;  2D9Z A;  1T6B X;  3DWG C;  4BOZ B;  2HE7 A;  1T0S C;  1Y56 A;  1KZG A;  2M4N A;  3NG0 A;  4JE3 B;  3ENB A;  2GCJ A;  4E3C A;  2M17 A;  1K5D B;  2GBN A;  3P63 A;  2FCN A;  3LDZ E;  3NHE B;  3SBG A;  5D27 A;  4X57 B;  5HHD G;  3NWF A;  2WX0 A;  4PYU A;  3SEB A;  3TJP A;  4KVG B;  4ZRK A;  3MC8 A;  1OTR B;  4KDL B;  3AEF B;  4JWU C;  5D6J B;  2BT6 A;  1QOG A;  2BPS A;  1K52 A;  4AP4 C;  1K53 A;  1WGU A;  2COA A;  3BY4 B;  4TQ1 A;  2GMI C;  4HB3 B;  2GBJ A;  2K8C A;  4MJS B;  4GDL A;  2WDV B;  2PEA A;  4B9K A;  4PYZ A;  3NWD A;  5D3X A;  2Q13 A;  1CJE A;  1RRB A;  1HTQ A;  3EPY A;  2R0D A;  2M14 A;  1T0R C;  2K8H A;  2KTR A;  4NJ7 A;  1V97 A;  1WGY A;  3TIX A;  1SEB D;  2JZ3 B;  3C19 A;  1E90 A;  2L1A A;  1NVI D;  3RD2 A;  2PVG C;  5C5B A;  2K00 A;  1U5G A;  3V6C B;  4O1N A;  4C56 C;  3JYU A;  2ADZ A;  1JWB D;  1RM6 C;  1Z87 A;  5J3T A;  4IUM B;  3CST A;  3AE9 B;  3D8D A;  1WX9 A;  3HIZ A;  2MLB A;  3I63 C;  3K9O B;  5EDS A;  4RH6 A;  1L2N A;  2J52 A;  2DX5 A;  1UGJ A;  5GXG B;  1MG4 A;  4GLS C;  2UYZ B;  1EGX A;  5EE3 A;  1VD2 A;  2FBW B;  1F9J A;  4KGR A;  2O6V A;  2NS5 A;  2LJI A;  3F0W A;  5DPR A;  4ASW C;  2KWU B;  3APC A;  3DVG Y;  2ROV A;  2DYB A;  2PJH A;  4M8M A;  2KTF A;  2E2X A;  4LNF A;  4DX9 0;  1JWS D;  3P7Z A;  3AV8 A;  2Z8L A;  2OOB B;  3DVN V;  1FCC C;  2MBH A;  4M02 A;  4HRO A;  1TBE A;  3TVV A;  2D10 A;  2X0S A;  1P9D U;  2MWN B;  2BB5 A;  2CKH B;  1YNT E;  4IWO A;  3ZDT A;  3L0W B;  1HTO A;  1UH6 A;  1E8Z A;  2D4Q A;  1IGD A;  1ZKH A;  4YT0 B;  5MPO A;  3X23 A;  4QXA B;  3HRD D;  3A98 B;  4ZYS A;  1YQ3 B;  3Q3J A;  1IBX A;  4IDI A;  2L8J A;  1MG8 A;  4JL9 A;  2KC1 A;  3Q8C A;  3UZT A;  1MIZ B;  4BAX A;  4IWP A;  1E7P B;  4MM3 A;  4KKI A;  1JWM D;  3S2A A;  1GOZ A;  2GB1 A;  2LGS A;  3JSV A;  4KZC A;  5JHG A;  1UWM A;  3HW2 B;  3LYY A;  4WH4 A;  1MHX A;  2BW2 A;  4J3O D;  4DXF A;  4A90 A;  4F8C B;  2JRH A;  1XD3 B;  3LJU X;  3KRW A;  2DHZ A;  4D6W A;  2H89 B;  3C8Y A;  2OJR A;  3OJ4 B;  4BKT A;  4E74 A;  2KWD A;  4LK0 M;  4XWX A;  3HVD A;  2IYD B;  2WXN A;  2X8X X;  2W2W A;  3AM9 A;  2LG1 A;  5J2R A;  2QKL A;  4KSL C;  4ZDV A;  3GZN I;  2UU7 A;  1K50 A;  4IAP A;  2L05 A;  5LLI A;  5KQ4 A;  2JVC A;  2LUM A;  3AE5 B;  1ZM0 A;  3ABV B;  2KDI A;  3H9D A;  4EEW A;  1IYF A;  1RFA A;  4BFR A;  2KAC A;  2J0J A;  3PVL A;  4RF1 A;  2PTL A;  3N32 A;  4US9 A;  2RLO A;  4EZK A;  3RNB C;  1I2H A;  2YRY A;  5JP4 A;  4OZB A;  3A9J B;  5KHQ A;  1ACC A;  3NY5 A;  3DPD A;  4DHJ D;  1WM2 A;  3HQC A;  3KRX A;  2AYO B;  1C78 A;  4KHB A;  1V61 A;  2XN9 C;  2J4X A;  4WWM A;  3V62 A;  2MJD A;  1BUI C;  3QHT A;  4ZOH C;  1P98 A;  3M1I B;  4DBG A;  1FFU A;  2ELA A;  2BWF A;  1RJ2 A;  1SIJ A;  1KC7 A;  3VUX A;  2M56 B;  4QJ3 B;  4FHJ A;  1S1Q B;  5FR6 A;  3ZVV A;  1YN4 A;  1ZOY B;  5EE1 A;  1WI0 A;  4MSM B;  2W3S A;  1VDV A;  4W9D A;  2PW9 A;  1IGC A;  4AQ7 A;  1HB8 A;  3D32 A;  2EKE C;  2Z0P A;  2NZ8 B;  1FHO A;  1LFD A;  1EO6 A;  4XE0 A;  3R8B A;  3QAQ A;  3B1L X;  4HAU B;  2KNB A;  5HI1 A;  3RZW C;  1DOX A;  3D8E A;  3A9K B;  3HM3 A;  3I3T B;  2SEB D;  4L1B A;  3T8M A;  3E9L A;  2IY0 B;  5HE2 A;  1RFK A;  1PGX A;  4B95 A;  1QKZ A;  1U27 A;  1MI0 A;  2AEH A;  3SR6 A;  1SE2 A;  2KWV B;  1XR0 B;  1I7H A;  4HLE A;  3E66 A;  5TR5 A;  5BMI A;  3E56 A;  1WXA A;  2HRJ A;  1YN5 A;  2MEK A;  3NW8 A;  1E7U A;  2C9W B;  2FUG 1;  1LB1 A;  1MK7 B;  3FIL B;  2KLC A;  1N5W A;  3PLV A;  4HXD A;  1YX6 B;  5C23 A;  4E71 A;  2KUQ A;  1VBG A;  4OW0 A;  4HB0 B;  1UZX B;  2WP9 B;  3H7P A;  2DFK A;  2KFK A;  1V80 A;  3TMP B;  2I1J A;  3O96 A;  2O2V A;  1XX0 A;  3ML4 A;  5J17 A;  3RMK C;  3ZJU A;  2E3T A;  3N9Y C;  2BS3 B;  2Y5C A;  4IM3 A;  5DCN A;  3Q3O C;  3C0R B;  1VZ6 A;  4Z2M B;  2J0M A;  1PGB A;  1MK9 B;  4CHJ A;  3L08 A;  2MBQ A;  3WAM A;  1I4X A;  5AUK A;  4HKZ E;  3KWL A;  2YT2 A;  1MIX A;  4A6F A;  1UEF A;  1D4B A;  1SJE D;  2JZZ A;  1JRU A;  1XEE A;  3PEG A;  3VTU A;  1U29 A;  3APD A;  5EE0 A;  4I6L B;  1RRP B;  4MEM A;  2UWQ A;  4OVU A;  4JKC A;  3ZGZ A;  3GS2 A;  3ZNH B;  4CHM A;  1P7E A;  1VBH A;  4NAW A;  1PFJ A;  4Q2J A;  4WSF A;  5DH9 B;  2KJR A;  2ZW0 A;  3PT2 B;  3WAN A;  4US8 A;  1WXM A;  4KGT A;  3TEX A;  4BKS A;  1KLG D;  4HJG E;  3EC8 A;  4HPL B;  2WX1 A;  5EFX A;  1F52 A;  3W5V B;  2CAY A;  1H10 A;  3EHV A;  3WAP A;  2CU1 A;  3H1U A;  4GMX B;  5E6P A;  2RNR B;  1KI1 B;  3PRP B;  4OT1 A;  3SD5 A;  1PLS A;  2DAJ A;  1WXV A;  2LGD A;  2RDH A;  4LNI A;  4TKN A;  1V1O A;  2UZR A;  1YN3 A;  1JQ4 A;  1ZYI A;  4GU2 A;  1OFF A;  5JXV A;  4CYE A;  2BF8 B;  4TMA B;  5IN7 A;  2MBB B;  1Q1O A;  4QJ4 B;  2WXR A;  2N1V A;  4KIK B;  1FGY A;  1ZVR A;  1V6E A;  1SHC A;  2OQB A;  2INC C;  4XDD A;  1S3S G;  4GIV A;  5L81 A;  4ICV A;  3TL5 A;  4YON A;  3HUI A;  1SXT A;  3E9O A;  4YTM B;  2D9W A;  2GLS A;  2W82 A;  2KTR B;  3KH0 A;  2PLP A;  2KIG A;  3DOW A;  2K5P A;  1MVK A;  4HHV A;  1LGR A;  2BYE A;  3RNA C;  2D2Q A;  2WXJ A;  3MP9 A;  3KYD D;  3NVZ A;  4MGK E;  1VRA B;  2OED A;  3BK1 A;  1V89 A;  3NOB A;  2D5G A;  3DXD A;  2RD0 A;  3AH7 A;  5LXI B;  4DXA B;  5M4Y B;  2WDT B;  5C16 A;  3VTV A;  1XCG A;  2LVQ A;  4M8N A;  4ILJ A;  2MBE A;  1FRR A;  2YS5 A;  3AE8 B;  3V05 A;  3APF A;  3H7P B;  3U30 A;  4HAV B;  3KYC D;  2FCM A;  3PRM B;  3KSY A;  1L5P A;  4GOU A;  5JHA A;  1AWE A;  3DHG C;  3NVY A;  4USA A;  4BKS D;  1E0Z A;  4A6H A;  3RN9 C;  1OQR A;  5CLL B;  1JRP A;  4MGZ E;  2WYQ A;  1PFD A;  3JVZ X;  1HZ5 A;  3VH3 B;  2ELB A;  3A9J A;  4AUQ C;  4N6E B;  3I5J C;  2MH7 A;  3AEE B;  3MJ5 A;  3PLU A;  1Z5S B;  4C7Y A;  4EZL A;  1OEY J;  4AJW A;  2KIE A;  1GNU A;  3IAM 1;  2P0F A;  4RMA A;  4YWG G;  1TYG B;  3ZW3 A;  4WWP A;  3BIN A;  2Z59 A;  5H92 C;  2K25 A;  1I4H A;  4HEA 1;  2L0T A;  3AN1 A;  2PE6 B;  3DXE A;  1C4C A;  1TT5 B;  1J19 A;  3DBR B;  4W9K A;  5HE1 A;  1UF0 A;  3RCP A;  4FJZ A;  4JIO U;  4MGY E;  4KDI C;  3Q8F A;  1JWA D;  2D3G A;  4FN2 A;  2L32 A;  2W9N A;  1JCK B;  1VR9 A;  5LNK 1;  2CQU A;  2JRI B;  1JDE A;  3M95 A;  1ZPS A;  1DBH A;  4AOF A;  3A8Q A;  3Q69 A;  5D3V A;  1UNR A;  1AW7 A;  1JML A;  4EE2 A;  1OEY A;  1EAZ A;  3BJI A;  3ML9 A;  1ST7 A;  2K39 A;  3ZTC A;  1NYR A;  1MJD A;  1FFV A;  5L95 C;  2BS2 B;  4HSI A;  3OLM D;  1KOT A;  3KY9 A;  4B6H A;  1YJI A;  4IKG A;  4DIX A;  5I2M A;  3RYT A;  1D5M C;  1V49 A;  2N9E B;  2CY5 A;  2R2Q A;  4WWO A;  1VZ7 A;  3L54 A;  5C6R A;  4REZ A;  3A1Q B;  4FBJ B;  3NSU A;  4NAM A;  4BOS C;  2JXX A;  1SE9 A;  2DZI A;  1K5G B;  1A5R A;  2QSD A;  2BYV E;  4AJY B;  2UVM A;  4L6E A;  3IT4 B;  2ZEQ A;  2V4I B;  1YD8 U;  3AXC A;  4HCN B;  2LEK A;  2CU3 A;  1V88 A;  2PZ1 A;  2DHI A;  2KDF B;  4F7U P;  4MSQ B;  1K8R B;  5AEK B;  1GB4 A;  3EFU A;  1X11 A;  3UI3 A;  4F1S A;  1NTY A;  4KAX B;  1LO5 D;  2AL6 A;  1OQQ A;  1D3Z A;  1ZE3 D;  3DDC B;  4JK7 A;  2LOZ A;  4EOY A;  3BWU D;  1T3Q A;  5BYR A;  1WX8 A;  2GBR A;  4D0N B;  1ZSQ A;  4OZA A;  4TV3 A;  2JZP A;  3L16 A;  1D6E C;  4A3P A;  5FR3 A;  2N7D A;  4I6P A;  1L0X B;  4NY0 A;  3VR8 B;  4KX6 B;  3ECI A;  2OJW A;  3VUY A;  2VH2 A;  2RUK B;  3O65 B;  2K8B A;  3WIM A;  2KFK B;  2GRI A;  1ZXH A;  2JQR B;  1IP9 A;  4JKH A;  3Q2A C;  2JX5 A;  1I4P A;  2K2U A;  4PQ0 A;  5C1Z A;  2N0Y A;  1F2R I;  3V3X A;  1VJK A;  5HE0 A;  4ANU A;  1FHX A;  1GC7 A;  1MHH E;  2G4D B;  2M8S A;  2I5F A;  3OAW A;  4IOY X;  5D3Y A;  4HK2 A;  4A9A A;  1EWC A;  3P4Q B;  5DPT A;  2KR0 A;  4M00 A;  3UF8 A;  4CQN A;  2J7Q B;  2JUO A;  3EA6 A;  2WDQ B;  1WSP A;  4A6Q A;  1KFY B;  3CIK A;  1ZGU B;  3R7Q A;  1Q67 A;  4RCO A;  4DDI D;  1YX5 B;  2DN6 A;  1WJN A;  3R3M A;  1H4R A;  4IWQ A;  1WGH A;  1ZC3 B;  3MHS D;  4IC7 B;  1N61 A;  2INN E;  3AJ4 A;  2MWS B;  5D3I B;  4MT7 A;  1DIK A;  2B3A A;  3PS6 A;  1J7B A;  3A1Q A;  4HRS A;  1KH0 A;  1WJ6 A;  2AQ2 B;  3ZO5 B;  3WAL A;  1L4Z B;  2CS4 A;  3W1Y A;  4HKQ A;  1XO3 A;  2RVB B;  1XLP A;  1ZXI A;  1Q5W B;  4NPN A;  3UQA A;  3HHM A;  4XDC A;  3PV1 A;  2NBU A;  2W3R A;  2GCL A;  5CHF A;  3DWM A;  1EU4 A;  1BTN A;  2HTH B;  2IO0 B;  4B0M A;  4C80 A;  1M7E A;  5JVL A;  4MJS A;  3ONS A;  2FNJ B;  2DBY A;  1RYJ A;  4FJV B;  3SUZ A;  3B77 A;  2KLG A;  4A55 A;  1E5W A;  2CHZ A;  3WCQ A;  4N58 A;  1P7F A;  4TSS A;  2VZK B;  2NBW B;  1C4A A;  1QQG A;  1E7V A;  2L7R A;  3P6A A;  3RCZ A;  2RDG A;  2FDQ A;  3AEG B;  4W9F A;  1J7C A;  2KX3 A;  4XWW A;  1KLU D;  3DCG A;  2WXP A;  3VIA A;  1XOD A;  4KHB B;  2Q5W D;  4HAY B;  1WGQ A;  1KF6 B;  1P3Q U;  3R2T A;  2D3A A;  3MJW A;  2KOX A;  4HPM B;  2W2X D;  1Q0W B;  5E6J A;  4JKB A;  4URK A;  3AEC B;  3WAO A;  2AQ3 B;  2WXG A;  3O13 A;  2BS4 B;  2I1K A;  1WJM A;  2DZK A;  2N1W A;  1HE8 A;  1NEK B;  2TSS A;  4W9J A;  3ZIM A;  2PMV A;  1UNP A;  5JH5 C;  4KKJ A;  4BZA A;  4RGT A;  1DOI A;  3DVG X;  3GE8 C;  1WGG A;  5HFY A;  1C9F A;  3TUO A; 
#chains in the Genus database with same CATH homology
 4GZU A;  4HJK A;  1OGW A;  1UEL A;  4II2 B;  3FEH A;  4DHZ E;  2M0X A;  2LBB A;  4WWN A;  3SHQ A;  2LVP A;  2LGX A;  5IA7 A;  2ASQ A;  1I35 A;  2IBI B;  1NI2 A;  3M3J A;  2YS3 A;  4ICU A;  1X86 A;  2ZJD A;  3H6N A;  4KIK A;  4RM9 A;  2L76 A;  1UBQ A;  3P2B A;  2RGF A;  2GBK A;  2R09 A;  1WMH A;  5FI0 A;  2KQS A;  4RM8 A;  2RSG A;  1PMS A;  2CY4 A;  1XT9 B;  4IM0 A;  4K7U A;  4A20 A;  2LD9 A;  2ZPN A;  1EUV B;  5JHH A;  1ZC4 B;  4WQO B;  2IO3 B;  1WI1 A;  2FCS A;  4MH0 E;  3RUL A;  2XBB C;  2JP2 A;  3KUD B;  5J3Q A;  2ZCB A;  3SDL C;  1Z2M A;  1MAI A;  2COC A;  1FHW A;  5CLQ B;  3ZNG C;  1WJ1 A;  3GYO A;  2KJ6 A;  2BKF A;  4XC2 A;  2WWZ A;  3KUZ A;  4MGI E;  3A9K A;  3TW1 A;  1W1D A;  4NQL B;  3V6E B;  2KCJ A;  1H8C A;  1NU2 A;  1UPQ A;  1V9J A;  2W2X C;  3PHX B;  4ILG B;  1UBI A;  2G45 B;  5DPS A;  5JZE B;  4ANW A;  1M94 A;  3U7D A;  2V3S A;  1MKE A;  3VHT C;  2AWT A;  2BWE S;  1IPG A;  2N7E A;  3TCA A;  4BBN C;  4GPT B;  4GOC A;  1UPR A;  2C5L C;  2O2V B;  4GSW A;  2COP A;  1WVH A;  3AI5 A;  1NTV A;  3MTN B;  2D11 A;  2CHX A;  3SU8 X;  5AZF A;  3ALB A;  4F7Z A;  3L13 A;  1V5T A;  3WYF B;  1NBF C;  3CXB B;  1B55 A;  2K6D B;  2K1F A;  3F5R A;  4KSK C;  4EUT A;  2EJ8 A;  1ISN A;  4K2P A;  3TFM A;  2YS1 A;  3VXW A;  3PPA A;  5D94 A;  2IO1 B;  3ODX A;  3FSS A;  3TO1 A;  1C1Y B;  4DHZ B;  2ABD A;  3QIJ A;  2GS0 A;  1GJZ A;  3G9W A;  1TQZ A;  2Y7B A;  2JWZ A;  1V2Y A;  4MEL A;  2COF A;  2A4Z A;  1GUA B;  3L10 B;  5E6N A;  2KMC A;  3VTW A;  3H7S A;  1XKE A;  3QQ8 B;  2C7M B;  4KHA A;  2DAF A;  4KV2 A;  2Y8F A;  1WRD B;  2LVO A;  4NSW A;  3PG7 A;  2DHJ A;  1YJ1 A;  2REX A;  2Y5B B;  2RPQ A;  2HTH A;  2HD5 B;  4LDT D;  5GOW B;  5G55 A;  4PS8 A;  1XQQ A;  3A4S C;  3V60 A;  2RSU A;  4HAX B;  2FJL A;  4HAW B;  3JSV B;  1U2B A;  3KUC B;  1Y19 B;  2YVC A;  2KUP A;  2FID A;  2FJ9 A;  1WR1 A;  3QCA A;  3PRE A;  1PQS A;  1EVH A;  3MPX A;  4HDQ A;  2V4L A;  2DLW A;  2KX0 A;  2LXA A;  3T06 A;  2G3Q B;  2YLM A;  1KZ7 A;  3V5W A;  2MFQ A;  4DBB A;  2DYQ A;  4NNJ B;  4F7H A;  2D9Y A;  4JKG A;  4B6W A;  3IG3 A;  2PPH A;  2K2J A;  4ZRI A;  3QA8 A;  4TQ0 A;  1P5T A;  2L00 B;  4ZYN A;  3QX1 A;  4HB2 B;  2FCQ A;  3KZ1 A;  2DYO A;  2N23 A;  4JKF A;  4G0N B;  3NS8 A;  4PS7 A;  5D7G A;  3N3K B;  5L83 A;  1WIA A;  3VDZ A;  2LGY A;  1P0R A;  1VCB A;  2KWC A;  1XD4 A;  2FAZ A;  3PRZ A;  1V5U A;  2Z0E B;  5KCV A;  4W9E A;  4JKE A;  2LKO A;  4Z2N A;  3KW5 B;  3FP5 A;  1E8X A;  4W9I A;  2OTX A;  3OAN A;  1FGZ A;  2DTC A;  1NTI A;  2P8V A;  2DX5 B;  2GBM A;  3ZKJ C;  4LCD E;  3PP2 A;  5GMV A;  2V1Y A;  2I5C A;  1OQN A;  5KQ1 A;  2ZPY A;  2NCN A;  1G6J A;  2EC1 A;  1R4M I;  2KHW B;  4NAW B;  2ZNV B;  1WE7 A;  2L0F A;  1WXS A;  4GXB A;  3B08 A;  5C5B B;  3ULB A;  3PSE B;  3R7R A;  1E8W A;  1L7Y A;  2UZS A;  1FXT B;  1WR6 E;  2MDX A;  1V5P A;  2LJ5 A;  2KO3 A;  2NPT B;  1OY2 A;  3UQB A;  5LOP B;  1ZW7 A;  5HE3 A;  2EMT A;  4ILH A;  2GOW A;  1OQY A;  2DEN B;  4W9C A;  2M38 A;  4IG7 B;  2KVR A;  4XZ4 A;  4TUU A;  2DYN A;  2Y8G A;  2M1M A;  3AUL A;  4JGH B;  2IY1 B;  1BT0 A;  2LUL A;  3ZTD A;  3ODO A;  2XK5 A;  3ZLZ A;  2YSZ A;  2FUH B;  2Z59 B;  2LAS A;  4G3X B;  2ZVN A;  4WJP A;  1WGD A;  2KFJ A;  1KM7 A;  1WZ0 A;  3VVW B;  3HM6 X;  1LQB A;  4BVU C;  5HKH A;  1V86 A;  4FUL A;  3FM8 C;  5AZH A;  4W9G A;  3N7C A;  2DHK A;  2H7D A;  3IBE A;  3SYX A;  2P0H A;  1V5O A;  2H7E A;  2IZV B;  2DKQ A;  3TBL D;  4XX5 A;  2RGN B;  2DKP A;  4LJO B;  1T0Y A;  1X1F A;  2X18 A;  3SNH A;  3A8P A;  4K7W A;  2LYD A;  5IJM A;  1KBL A;  2MCN B;  2N9P C;  4WJO A;  4F7G A;  3QWM A;  2Z0O A;  3DBS A;  4II3 B;  2DZJ A;  1WH3 A;  1QZE A;  1UNQ A;  4MDK E;  4Y94 A;  1LXD A;  3PTF C;  2O6V B;  4M0W B;  2QHO A;  4MK0 A;  2DIK A;  1X05 A;  1AQC A;  1Y5O A;  1C3T A;  2C60 A;  1WYW B;  4K17 A;  3QJZ A;  3QWZ B;  2MRP A;  3ZVR A;  4FJY A;  2Z0Q A;  4W9H A;  4PNK A;  3M62 B;  4HVB A;  3HK0 A;  5BO4 B;  2VKI A;  2KN5 A;  2ZNV C;  5J3Y A;  1OMW A;  1WE6 A;  2J59 M;  2ZVO A;  4HAT B;  1EF5 A;  1WFY A;  2DX1 A;  3OJ3 A;  4WJN A;  3NZS A;  5DIF B;  1FB8 A;  4JK8 A;  2RQ1 A;  4KZ0 A;  4CO7 A;  1M7R A;  4P7I A;  4EFO A;  1P1A A;  2MP2 A;  1BTK A;  1NDD A;  1DDV A;  4IM2 A;  3ZRF A;  4WJ7 A;  3T9L A;  1ACA A;  3CMM B;  4CHK A;  3QBV B;  4H8S A;  4FLH A;  3PVW A;  1AAR A;  2KD0 A;  3VFK A;  5JHB A;  4A6F B;  2MP2 B;  2IYB A;  2CB8 A;  2R2O A;  3VUW A;  4NJ6 A;  2KC2 A;  1TZ1 A;  4EJN A;  1J0W A;  1BAK A;  3K9P B;  3ZDM C;  5E6O A;  1KLV A;  4LJP B;  1GC6 A;  3A4R A;  2XQN M;  3RZF A;  1V5M A;  1NVL A;  3DBR I;  2BKR B;  3NZU A;  2KK8 A;  3GOE A;  3RT3 B;  3ZNZ B;  2MQJ A;  1V81 A;  4DDG D;  2IO2 B;  1Y8R C;  1WZ3 A;  3IHP C;  1TGZ B;  2RR9 A;  2PE9 A;  5JLJ B;  3RUI B;  2VRW B;  3VQI A;  5DHF B;  4K1R B;  1DDW A;  1W1H A;  2MA9 B;  1TJ6 A;  3EEC A;  3A33 B;  1DRO A;  2KMA A;  4DK5 A;  1U5F A;  1WMH B;  4EZJ A;  3UGB B;  1TTN A;  3DBH I;  2L3Z A;  5KHO A;  1YIW A;  4JKD A;  2YF0 A;  2NR2 A;  2D9V A;  2CRF A;  4BBN F;  3Q3F A;  2LZ6 A;  2ZZP B;  2MSE D;  2J0K A;  1WX7 A;  2C7N B;  1U5E A;  3DQV A;  4EKU A;  2KAN A;  5LXH A;  3QAR A;  2LRW A;  4A3O A;  1MPH A;  3PVU A;  1HBK A;  2G4S A;  4GDK B;  3X0W A;  4JQW C;  2XEW A;  2BCJ A;  4GGQ A;  4C0A A;  2P0D A;  1UGM A;  2R82 A;  4GMV A;  5LON B;  4IW0 A;  3W1S A;  3IFW B;  2KGX B;  1KJT A;  5IAA C;  4WJQ A;  4K7S A;  2XK5 B;  3QK0 A;  4HWI B;  1SGH A;  2NBV B;  2KXJ A;  2NPT A;  2LWP A;  5AZG A;  2YT1 A;  3ENE A;  2HJ8 A;  1FOE A;  3SBT A;  1HB6 A;  4GDK A;  2MKR A;  2KDE B;  3VH4 B;  2JF5 A;  4HDO A;  3V61 A;  2D07 B;  2AL3 A;  4DX8 A;  3GYP A;  3DVN U;  1N3H A;  3ZUN A;  4WVF B;  5CHV C;  3ODW A;  4IFS A;  3N30 A;  5DPW A;  3FLV A;  2A5U A;  4LDT B;  3IVF A;  2DZM A;  1J0G A;  2G35 A;  1CMX B;  2IFS A;  4DWF A;  4A6K A;  3MDB C;  5CHW A;  4MY6 A;  5D3W A;  1P6S A;  4G11 A;  2COD A;  4JKA A;  4GN1 A;  2FIF A;  2MX2 A;  1R4N I;  4N9F 4;  3R66 C;  2ROZ B;  2BGF A;  3ML8 A;  2EMS A;  1UD7 A;  2C7H A;  2GJY A;  1RAX A;  2KDB A;  1RLF A;  2KQ7 A;  3AU5 A;  2V76 A;  2KKC A;  4HAZ B;  3AU4 A;  3M63 B;  3UIN B;  4GDL B;  1X1M A;  3DBL I;  4TYZ A;  3PGE A;  1GG3 A;  3E9P A;  2Z0D B;  2CR5 A;  2MBO A;  2LRU A;  1U4A A;  4BBK A;  4G50 A;  2VSZ A;  2LI5 A;  5DHA B;  3PSC A;  1EF1 A;  4OVV A;  4ZRJ A;  5FI1 A;  4NQK E;  3LJ3 A;  4JK9 A;  4FA6 A;  2DYM A;  2N4F A;  4JKG B;  2ZCC A;  2YT0 A;  3ULC A;  2N9X A;  4J6I A;  1YQB A;  4FHK A;  1DYN A;  5CTR C;  4K2O A;  3U8Z A;  4A5K A;  4FAD A;  2BYF A;  4ANV A;  2LXC A;  1I7A A;  1P3R A;  2VRR B;  2JT4 B;  4HB4 B;  4HCP B;  3L17 A;  3CSF A;  1SIF A;  3VAW A;  2MW5 A;  2LOX A;  4WAA A;  1WY8 A;  5DI9 B;  3ZNI D;  3DXC A;  2L2I A;  2DA0 A;  1FAO A;  5CX3 A;  3SV1 A;  2KZR A;  3UIO B;  1LM8 B;  1WM3 A;  1IRS A;  1E8Y A;  1WJU A;  1TXD A;  3D8F A;  3JW0 X;  1QC6 A;  1WGR A;  3QC8 B;  2K6Q A;  3W1S C;  2O6V D;  2NMB A;  3CF6 E;  1DDM A;  3SO6 A;  3PZD A;  3ZRC A;  4GB9 A;  1WG7 A;  3KVF B;  1X1G A;  4K81 A;  1GGO A;  1U5D A;  3VOQ A;  1I42 A;  1BWN A;  1W1G A;  4KHO A;  2JPH A;  4W9L A;  2LUE A;  1WJ4 A;  1J8C A;  2JY6 A;  3PHW B;  4I6N B;  4AWJ A;  2WH5 A;  5G2N A;  4ANX A;  2CHW A;  4JLC A;  4PS3 A;  3WA0 A;  4BKG A;  2NVU I;  4DHJ B;  2D9X A;  5J18 A;  1WF9 A;  2QKM A;  4YL8 A;  4EMO A;  1LW3 A;  2L1C A;  3B0A A;  5C79 A;  3UIP B;  2KJH B;  5D2M B;  2D9Z A;  4BOZ B;  2HE7 A;  1KZG A;  2M4N A;  3ENB A;  2GCJ A;  4E3C A;  2M17 A;  1K5D B;  2GBN A;  2FCN A;  3LDZ E;  4X57 B;  3NHE B;  3SBG A;  5D27 A;  2WX0 A;  4PYU A;  3TJP A;  4KVG B;  4ZRK A;  1OTR B;  4KDL B;  5D6J B;  2BPS A;  4AP4 C;  1WGU A;  2COA A;  3BY4 B;  4TQ1 A;  2GMI C;  4HB3 B;  2GBJ A;  2K8C A;  4MJS B;  4GDL A;  2PEA A;  4B9K A;  4PYZ A;  5D3X A;  2Q13 A;  1RRB A;  3EPY A;  2R0D A;  2M14 A;  2K8H A;  2KTR A;  4NJ7 A;  1WGY A;  3TIX A;  2JZ3 B;  1E90 A;  3RD2 A;  5C5B A;  2K00 A;  1U5G A;  3V6C B;  3JYU A;  2ADZ A;  1Z87 A;  5J3T A;  4IUM B;  3CST A;  3D8D A;  1WX9 A;  3HIZ A;  2MLB A;  3K9O B;  5EDS A;  1L2N A;  2DX5 A;  2UYZ B;  1EGX A;  1VD2 A;  1F9J A;  2O6V A;  2NS5 A;  3F0W A;  5DPR A;  4ASW C;  2KWU B;  3APC A;  3DVG Y;  2ROV A;  2DYB A;  2PJH A;  4M8M A;  2KTF A;  2E2X A;  4DX9 0;  3P7Z A;  2OOB B;  3DVN V;  2MBH A;  1TBE A;  3TVV A;  2D10 A;  2X0S A;  1P9D U;  2MWN B;  2CKH B;  4IWO A;  3ZDT A;  3L0W B;  1UH6 A;  1E8Z A;  2D4Q A;  1ZKH A;  3X23 A;  3A98 B;  3Q3J A;  2L8J A;  1MG8 A;  4JL9 A;  2KC1 A;  3UZT A;  1MIZ B;  4IWP A;  4MM3 A;  3S2A A;  3JSV A;  4KZC A;  5JHG A;  3HW2 B;  4F8C B;  2JRH A;  1XD3 B;  3LJU X;  4BKT A;  3KRW A;  2DHZ A;  3OJ4 B;  2OJR A;  4E74 A;  4XWX A;  2IYD B;  2W2W A;  5J2R A;  2LG1 A;  2QKL A;  4KSL C;  4ZDV A;  3GZN I;  4IAP A;  2L05 A;  5LLI A;  5KQ4 A;  2JVC A;  1ZM0 A;  2KDI A;  3H9D A;  4EEW A;  1IYF A;  1RFA A;  4BFR A;  2J0J A;  3PVL A;  3N32 A;  2RLO A;  4EZK A;  2YRY A;  1I2H A;  5JP4 A;  3A9J B;  5KHQ A;  3NY5 A;  3DPD A;  4DHJ D;  1WM2 A;  3HQC A;  3KRX A;  2AYO B;  1V61 A;  3V62 A;  3QHT A;  1P98 A;  3M1I B;  4DBG A;  2ELA A;  2BWF A;  1RJ2 A;  1KC7 A;  3VUX A;  4FHJ A;  1S1Q B;  5FR6 A;  3ZVV A;  1WI0 A;  4MSM B;  4W9D A;  3D32 A;  1HB8 A;  2EKE C;  2Z0P A;  2NZ8 B;  1FHO A;  1LFD A;  1EO6 A;  3QAQ A;  3B1L X;  4HAU B;  2KNB A;  3RZW C;  3D8E A;  3A9K B;  3HM3 A;  3I3T B;  3T8M A;  3E9L A;  2IY0 B;  5HE2 A;  4B95 A;  1U27 A;  2AEH A;  2KWV B;  1XR0 B;  4HLE A;  3E66 A;  5TR5 A;  1WXA A;  2HRJ A;  1E7U A;  2C9W B;  1LB1 A;  1MK7 B;  2KLC A;  3PLV A;  4HXD A;  1YX6 B;  5C23 A;  4E71 A;  1VBG A;  4HB0 B;  1UZX B;  3H7P A;  2DFK A;  2KFK A;  1V80 A;  3TMP B;  2I1J A;  3O96 A;  2O2V A;  1XX0 A;  3ML4 A;  5J17 A;  4IM3 A;  5DCN A;  3C0R B;  4Z2M B;  2J0M A;  1MK9 B;  4CHJ A;  3L08 A;  2MBQ A;  3WAM A;  1MIX A;  4A6F A;  1UEF A;  2JZZ A;  1JRU A;  3PEG A;  3VTU A;  1U29 A;  3APD A;  4I6L B;  1RRP B;  4MEM A;  2UWQ A;  4OVU A;  4JKC A;  3ZNH B;  4CHM A;  1VBH A;  4NAW A;  1PFJ A;  4WSF A;  5DH9 B;  2KJR A;  3PT2 B;  3WAN A;  1WXM A;  4BKS A;  3EC8 A;  4HPL B;  2WX1 A;  5EFX A;  2CAY A;  1H10 A;  3EHV A;  3WAP A;  2CU1 A;  3H1U A;  4GMX B;  5E6P A;  2RNR B;  1KI1 B;  3PRP B;  3SD5 A;  1PLS A;  2DAJ A;  1WXV A;  2LGD A;  4TKN A;  2UZR A;  4GU2 A;  4CYE A;  2BF8 B;  2MBB B;  1Q1O A;  2N1V A;  4KIK B;  1FGY A;  1ZVR A;  1V6E A;  1SHC A;  2OQB A;  1S3S G;  4GIV A;  5L81 A;  4ICV A;  3TL5 A;  4YON A;  3E9O A;  2D9W A;  2KTR B;  3KH0 A;  3DOW A;  4HHV A;  2BYE A;  2D2Q A;  3KYD D;  4MGK E;  1V89 A;  3NOB A;  3DXD A;  2RD0 A;  5LXI B;  4DXA B;  2WDT B;  5C16 A;  3VTV A;  1XCG A;  2LVQ A;  4M8N A;  4ILJ A;  2MBE A;  2YS5 A;  3APF A;  3H7P B;  3U30 A;  4HAV B;  3KYC D;  2FCM A;  3PRM B;  3KSY A;  5JHA A;  1AWE A;  4BKS D;  4A6H A;  5CLL B;  4MGZ E;  2WYQ A;  3JVZ X;  3VH3 B;  2ELB A;  3A9J A;  4AUQ C;  3PLU A;  1Z5S B;  4EZL A;  1OEY J;  4AJW A;  1GNU A;  4RMA A;  2P0F A;  3ZW3 A;  4WWP A;  3BIN A;  2K25 A;  2L0T A;  2PE6 B;  3DXE A;  1J19 A;  4W9K A;  5HE1 A;  3RCP A;  4FJZ A;  4JIO U;  4MGY E;  4KDI C;  2D3G A;  4FN2 A;  2W9N A;  2CQU A;  2JRI B;  1JDE A;  3M95 A;  1DBH A;  4AOF A;  3A8Q A;  5D3V A;  1UNR A;  1OEY A;  1EAZ A;  3BJI A;  3ML9 A;  1ST7 A;  2K39 A;  3ZTC A;  5L95 C;  3OLM D;  1KOT A;  3KY9 A;  4B6H A;  3RYT A;  1V49 A;  2N9E B;  2CY5 A;  2R2Q A;  4WWO A;  3L54 A;  5C6R A;  4FBJ B;  3A1Q B;  3NSU A;  4BOS C;  2JXX A;  1SE9 A;  2DZI A;  1K5G B;  1A5R A;  2BYV E;  4AJY B;  2UVM A;  4L6E A;  2ZEQ A;  1YD8 U;  3AXC A;  4HCN B;  1V88 A;  2PZ1 A;  2DHI A;  2KDF B;  4F7U P;  4MSQ B;  1K8R B;  5AEK B;  3EFU A;  1X11 A;  4F1S A;  1NTY A;  4KAX B;  2AL6 A;  1D3Z A;  3DDC B;  4JK7 A;  2LOZ A;  4EOY A;  1WX8 A;  2GBR A;  4D0N B;  1ZSQ A;  4TV3 A;  3L16 A;  4A3P A;  2N7D A;  4I6P A;  4NY0 A;  3ECI A;  3VUY A;  2RUK B;  3O65 B;  2K8B A;  3WIM A;  2KFK B;  1IP9 A;  4JKH A;  2K2U A;  4PQ0 A;  5C1Z A;  2N0Y A;  5HE0 A;  4ANU A;  1FHX A;  1GC7 A;  2M8S A;  2G4D B;  2I5F A;  3OAW A;  4IOY X;  5D3Y A;  4HK2 A;  5DPT A;  3UF8 A;  2J7Q B;  2JUO A;  3CIK A;  1ZGU B;  3R7Q A;  1Q67 A;  4DDI D;  1YX5 B;  2DN6 A;  1WJN A;  3R3M A;  1H4R A;  4IWQ A;  1WGH A;  1ZC3 B;  3MHS D;  4IC7 B;  3AJ4 A;  2MWS B;  4MT7 A;  1DIK A;  2B3A A;  3PS6 A;  3A1Q A;  1WJ6 A;  3ZO5 B;  3WAL A;  2CS4 A;  3W1Y A;  2RVB B;  1Q5W B;  4NPN A;  3UQA A;  3HHM A;  3PV1 A;  2NBU A;  2GCL A;  5CHF A;  1BTN A;  2HTH B;  2IO0 B;  1M7E A;  5JVL A;  4MJS A;  3ONS A;  2FNJ B;  4FJV B;  3SUZ A;  2KLG A;  1E5W A;  2CHZ A;  2NBW B;  1QQG A;  1E7V A;  2L7R A;  3P6A A;  3RCZ A;  2FDQ A;  4W9F A;  2KX3 A;  3DCG A;  3VIA A;  1XOD A;  4KHB B;  4HAY B;  1WGQ A;  1P3Q U;  3MJW A;  2KOX A;  4HPM B;  2W2X D;  1Q0W B;  4JKB A;  4URK A;  3WAO A;  2I1K A;  1WJM A;  2DZK A;  2N1W A;  1HE8 A;  4W9J A;  3ZIM A;  1UNP A;  5JH5 C;  3DVG X;  1WGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...