2D10A

Crystal structure of the radixin ferm domain complexed with the nherf-1 c-terminal tail peptide
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
295
structure length
295
Chain Sequence
b'KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Radixin
molecule tags Cell adhesion
source organism Mus musculus
publication title Structural basis for NHERF recognition by ERM proteins
pubmed doi rcsb
total genus 79
structure length 295
sequence length 295
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2d10A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d10A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2d10A01
4PS8A 1WM2A 3IVFA 2Y8GA 1NI2A 1XR0B 1LXDA 1YX6B 3QJZA 4G0NB 4KZ0A 3ZUNA 4BBNF 2RUKB 2KGXB 3VH4B 1DDVA 1V61A 4TQ0A 3A9JB 3PLUA 2HJ8A 2KX3A 3A9JA 1E8WA 2HTHB 2JP2A 2DYMA 1MPHA 2AWTA 2LVPA 4KIKA 2LOXA 3P7ZA 2KNBA 3L08A 4DX90 4KV2A 1WY8A 1U27A 3NS8A 5D3YA 2C9WB 3IG3A 2FDQA 1UPQA 5HE2A 3QQ8B 4PYZA 2LGDA 2M38A 2QKMA 1WIAA 2E2XA 3CXBB 4K2PA 1WE6A 2ZCCA 4MJSA 1FXTB 5J17A 2VSZA 5JHAA 2MWNB 2P0HA 2WDTB 1LQBA 3TL5A 3UGBB 4FN2A 4KDIC 3DBLI 3VTWA 1XT9B 3ZIMA 3NSUA 3RCPA 1C1YB 4OVUA 2MBBB 2KANA 2O6VA 3TW1A 1WFYA 3MTNB 5JH5C 4JLCA 4AOFA 2DZKA 3X0WA 3T9LA 1UNPA 5DH9B 3ODXA 2XQNM 2D10A 4HXDA 3WAOA 4K7UA 4PQ0A 3ENEA 2COPA 3R66C 3ZDTA 4I6LB 2J0JA 2MP2B 4I6PA 4FA6A 3ALBA 2VKIA 2K39A 5D3WA 4B9KA 4HAWB 3BINA 5IJMA 2DA0A 3FM8C 2LKOA 5GOWB 1OEYJ 1OGWA 2KWUB 4GDKB 2DHZA 5TR5A 3V62A 1GNUA 2ZVNA 2L3ZA 5E6PA 5LXIB 5L81A 2G35A 4ANXA 4RMAA 2MDXA 4DWFA 2OTXA 3QK0A 4H8SA 1L7YA 2DX1A 1UEFA 2LJ5A 4IM0A 2N7EA 4DDGD 2EMTA 4EEWA 5IAAC 1HB8A 2DAJA 1XCGA 2R2OA 3PHWB 2J0KA 2NPTA 3R7QA 3RCZA 1J0GA 3ZKJC 2NVUI 2CHZA 2L76A 1YQBA 3H9DA 2IY0B 3ZDMC 1W1DA 1TQZA 4GMXB 4MY6A 1X86A 4K2OA 2EKEC 5CTRC 5DPTA 3SUZA 4HB0B 2FCNA 3ZRFA 4IM3A 1AQCA 3KYDD 2KDEB 4ZYNA 2BYFA 3KUCB 4W9FA 4HB2B 3EFUA 2IYBA 1ISNA 3HK0A 3TFMA 1RLFA 2IO2B 4B6WA 1ZSQA 3R7RA 2KTRA 1DDWA 3DBHI 1YX5B 4W9EA 2DZMA 1XQQA 4K81A 3DXDA 1WGRA 4YONA 3QWMA 4KHAA 1WMHA 2N1WA 3APFA 3B08A 2DZIA 3N3KB 1IP9A 2RGNB 2O2VB 3UZTA 2DHJA 3DVNV 3FEHA 1EF5A 1OQNA 4URKA 1X1GA 4BOSC 4HK2A 4A20A 3N32A 4JL9A 1WR1A 3M1IB 5D3VA 3SV1A 4FBJB 1P1AA 2NBWB 2RR9A 4A6FA 1WX7A 4GSWA 3KRWA 2KKCA 1KM7A 4E74A 1GG3A 4GPTB 2AYOB 1KOTA 4ZRIA 2NBVB 3A1QA 3KVFB 2NBUA 3VOQA 3TJPA 1ZVRA 1GC6A 4IC7B 2CHWA 4FJYA 4MT7A 3P2BA 4BBKA 1QQGA 2N1VA 1XX0A 2JXXA 2Z0QA 1DROA 1WGHA 3AU4A 4AUQC 3ZNID 3NY5A 2ELAA 1U5EA 4F7HA 4NNJB 1I42A 2ELBA 1P9DU 2W9NA 3PSEB 2O6VD 2CQUA 2MQJA 4F8CB 5L83A 2RVBB 2JZ3B 3W1YA 3D8DA 3D8FA 5DPRA 4ZRKA 1E90A 2Z0EB 3H1UA 3WAPA 2KFJA 5AEKB 1BAKA 2N23A 4W9GA 3PVWA 1GUAB 3H7PB 4GDLA 1N3HA 4IWQA 5DI9B 2JF5A 4E71A 3H7SA 3APCA 1TXDA 3HW2B 3RT3B 2DKPA 2K8CA 2GCLA 1VCBA 5KCVA 3T8MA 2CRFA 3KZ1A 1V5MA 3OLMD 2W2WA 2I1KA 5J3QA 2IY1B 2KFKA 5IA7A 1PMSA 3PPAA 3RUIB 5FR6A 2HE7A 3EC8A 3SHQA 1WJNA 3UIPB 1TGZB 1Q1OA 5J2RA 3AU5A 4MGYE 2BWES 3V6EB 3QA8A 4W9JA 2C7MB 5D27A 4NQLB 1UPRA 2RLOA 1EGXA 5JLJB 2LULA 3IFWB 1H8CA 1ZM0A 3L16A 2DX5A 4ICVA 5LONB 2GS0A 2GBMA 3VTUA 1PQSA 2DYNA 4TKNA 4C0AA 1V88A 1WGUA 1VD2A 4MEMA 1WJUA 3QBVB 4IW0A 2ZPYA 1NU2A 2GMIC 4OVVA 3DVGY 1SGHA 5J3TA 1HBKA 1M94A 2LGXA 4W9IA 2GBJA 1U4AA 4NJ6A 1ZW7A 2G45B 3A98B 4MSMB 3UINB 3UQBA 3GYOA 2BYEA 3MJWA 3KY9A 2MW5A 3OAWA 2CY4A 3ZTDA 1Y19B 2LZ6A 2M4NA 4GOCA 1V5PA 3GZNI 3ODOA 2V76A 3PEGA 3ULCA 4WJ7A 4NQKE 3DXEA 2D9VA 1WRDB 1XD3B 4M0WB 4WJNA 1QC6A 2FCSA 3TBLD 2LI5A 4IAPA 1U5DA 3ML9A 4KAXB 4G50A 2ROZB 1DDMA 3ZVVA 3I3TB 5JHBA 4A5KA 1IYFA 3HM3A 5D3XA 1H10A 3NOBA 2L00B 2ZJDA 1UBIA 3HHMA 4WJQA 4BOZB 2Z0OA 2FCMA 1IRSA 4BKTA 1WX8A 1WZ3A 2V3SA 1P5TA 1U5FA 2NZ8B 3EPYA 5C79A 2KD0A 4IG7B 5E6NA 3AULA 4A6FB 4BKSD 2FIDA 4LDTB 3ULBA 2BKRB 1GJZA 2CODA 2RGFA 4HB3B 3B0AA 2LG1A 1E8ZA 4IWPA 3M62B 4E3CA 2REXA 1P98A 4IWOA 4RM9A 1WZ0A 2FUHB 3VUYA 3PLVA 1C3TA 2Q13A 2KO3A 2KOXA 5JP4A 1BTNA 2BGFA 2XK5B 4EFOA 5DHFB 2IBIB 3CSFA 5FI1A 1Q0WB 3WALA 4DBGA 2KN5A 2DLWA 5CHWA 3RZFA 1LB1A 4BBNC 3ZLZA 4HHVA 1X05A 2HTHA 4IUMB 3ZO5B 4F7UP 2K00A 5CLQB 2JWZA 4KSKC 1K5GB 4RM8A 5G2NA 3ZRCA 4FULA 3WYFB 2L8JA 4CHMA 2K8BA 2DHKA 2KZRA 5CX3A 3GOEA 4XZ4A 3PGEA 4A6KA 3UIOB 1I7AA 2YT0A 2O2VA 1J19A 5KQ1A 3ZTCA 2PJHA 2MLBA 2LVQA 2LOZA 3PTFC 2GBNA 1U2BA 1MG8A 2UWQA 2D9XA 2C5LC 3DCGA 3Q3JA 5C1ZA 1K5DB 1FHOA 5C6RA 4EUTA 4HLEA 4WJPA 2M0XA 3U30A 5DCNA 4ZRJA 3V6CB 2W2XD 4FJZA 2C60A 3VVWB 2JRHA 3PVLA 3PREA 2IZVB 2Z0DB 2LBBA 3TIXA 3WAMA 4ANWA 1ZC4B 3A9KA 1Z5SB 3RYTA 1KLVA 3KRXA 2O6VB 4K7SA 2AEHA 2I1JA 2NCNA 3QWZB 3QARA 3PSCA 5L95C 3PRMB 5HE0A 1V5UA 2D9YA 2KVRA 2YLMA 2CR5A 1OQYA 2DZJA 2L0TA 4NPNA 1XD4A 2KJ6A 2DTCA 3DXCA 3DBRI 1P6SA 2I5CA 3OJ3A 5JHGA 2KK8A 1MIXA 2PZ1A 3CSTA 1EO6A 3IBEA 3K9PB 5D2MB 3ZNGC 3U7DA 3X23A 3SO6A 4DBBA 1WM3A 1NTIA 2RSGA 4WAAA 2N4FA 2KCJA 4CYEA 1KJTA 5D7GA 2RNRB 4MH0E 4W9DA 3SDLC 3BJIA 2ZNVC 2C7NB 4X57B 2MP2A 5AZHA 3DDCB 3PV1A 5E6OA 4Z2MB 1TZ1A 3KW5B 3QCAA 2KQSA 4II2B 2LRWA 2R09A 4IFSA 5CHVC 1P3QU 1ST7A 4GMVA 2CY5A 1V80A 2KTFA 3JW0X 1WXAA 3PS6A 1P3RA 2GOWA 1UELA 2KDBA 2LXCA 5CHFA 3V61A 1S1QB 2UYZB 2J7QB 3F5RA 1WI1A 4L6EA 3Q3FA 5KHQA 3O96A 3MDBC 2LD9A 3AI5A 3DOWA 2D3GA 3VXWA 3AJ4A 2LGYA 4J6IA 3W1SC 5EDSA 2G3QB 3ML8A 1V6EA 3CMMB 2JT4B 4ICUA 4KDLB 4PS7A 5BO4B 1UBQA 2OJRA 4KHBB 2KLCA 1OTRB 4LDTD 4PNKA 3HM6X 5CLLB 3SU8X 3JYUA 2ROVA 1WVHA 1TBEA 4BFRA 1UNQA 2LRUA 1OEYA 4DXAB 1MAIA 3CIKA 2GBRA 1T0YA 2KMCA 2WWZA 3L54A 3QX1A 4MELA 5AZGA 3FP5A 1ACAA 2MKRA 2VRWB 1M7EA 2ADZA 1QZEA 1MIZB 1X1MA 2MCNB 1SHCA 1WGQA 1A5RA 1RFAA 4HWIB 2DKQA 4WVFB 1LFDA 2AL3A 2GCJA 2P0FA 4Z2NA 3HQCA 3ODWA 3TO1A 4HAXB 4D0NB 3DQVA 2J59M 3QC8B 4WWNA 5DHAB 1WE7A 3QAQA 5D6JB 4CHKA 3NHEB 1R4NI 1EVHA 3ML4A 4AWJA 2ZNVB 1FAOA 2ASQA 2LASA 4KZCA 4MM3A 1WGDA 3KUDB 1MK7B 3PRPB 2ZVOA 4LJPB 1M7RA 3PHXB 2DENB 3VQIA 5C23A 1EF1A 5HE1A 3VTVA 3HIZA 4AP4C 2UZRA 4HDOA 4KVGB 2DYQA 2M1MA 3PVUA 4HJKA 1ZKHA 1ZC3B 4DHZB 1AWEA 4TV3A 4DK5A 2A5UA 5HKHA 3TCAA 2CHXA 3A1QB 2W2XC 3A4RA 5G55A 4ASWC 3WA0A 3W1SA 2K1FA 1Y5OA 1Z87A 1YD8U 1DYNA 3D8EA 2LUEA 2MBQA 4KIKB 2KXJA 1UNRA 2H7DA 2CAYA 2WYQA 3JVZX 3PRZA 4HPMB 4II3B 2FIFA 2JRIB 1DBHA 2RQ1A 2COCA 5LLIA 4XWXA 1BWNA 4HB4B 3GYPA 1AARA 1WR6E 1XKEA 2GJYA 2IO1B 2QHOA 1KZGA 1V5OA 3KH0A 4M8NA 5KHOA 4HVBA 4EZJA 3C0RB 2NS5A 1D3ZA 1NBFC 2KDFB 2HRJA 3N7CA 2DFKA 2Y7BA 1Y8RC 1Z2MA 1U5GA 2I5FA 2P0DA 5DIFB 2BKFA 3N30A 4WJOA 2KUPA 1FOEA 1V81A 2YS5A 3PG7A 2NPTB 2PE6B 2N9PC 1H4RA 2K25A 3BY4B 4K1RB 2DAFA 3VAWA 2MBEA 2N9XA 3JSVB 2FJLA 2MFQA 2XBBC 3ZVRA 2L7RA 4JGHB 4KSLC 4LJOB 4W9KA 2BPSA 4MJSB 2MSED 1FHWA 2ZEQA 1Q5WB 2EMSA 2PE9A 4MSQB 2WH5A 1WGYA 1WYWB 3AXCA 2G4SA 4FHKA 3WANA 1HB6A 3FLVA 4EKUA 1UGMA 4WSFA 5J3YA 1WH3A 1WMHB 5HE3A 2YSZA 4MDKE 3RD2A 3FSSA 1WI0A 2KWCA 1UH6A 1SIFA 1RRPB 1WJMA 1B55A 1FGZA 3UQAA 3KUZA 4MGKE 3VFKA 1K8RB 2LVOA 2M8SA 2CKHB 1X11A 2YRYA 4F1SA 2V1YA 2Y8FA 4MGIE 1Q67A 5C16A 3L0WB 2MA9B 2DX5B 2ABDA 3ECIA 2K2JA 1I35A 1BT0A 1RJ2A 2BCJA 2B3AA 2K6QA 2N7DA 2XEWA 4MK0A 4Y94A 1EUVB 2A4ZA 2EJ8A 2P8VA 1R4MI 4JIOU 1WJ1A 3MPXA 4HAVB 2JPHA 1OMWA 5EFXA 2XK5A 4I6NB 1MK9B 2Y5BB 1RRBA 3ZW3A 1W1HA 4A6HA 1I2HA 1LM8B 2HD5B 2D9ZA 2LWPA 4GXBA 4GZUA 4GB9A 4IM2A 2N9EB 4LCDE 4CHJA 4W9LA 1WXSA 3ZNZB 2KX0A 2RPQA 2MWSB 4XC2A 2X18A 2KJRA 1HE8A 2COAA 4YL8A 2GBKA 3D32A 4F7ZA 3PT2B 4NSWA 3APDA 2KQ7A 3LJ3A 3VUWA 1FHXA 3LJUX 2D11A 5FI0A 1SE9A 3QIJA 1WJ4A 3CF6E 3DVNU 1WF9A 1FGYA 4AJWA 4DHJB 1G6JA 2M17A 4NAWB 4A3OA 2OQBA 2Z0PA 2YF0A 4DDID 3ONSA 2ZZPB 4F7GA 2K8HA 3EECA 1E5WA 4GDLB 4GGQA 4BKGA 4TYZA 3NZUA 4FJVB 3ZNHB 4TQ1A 4BVUC 1EAZA 1OY2A 4FHJA 1ZGUB 1NDDA 1WJ6A 4TUUA 1LW3A 3L17A 2FNJB 1V49A 2KFKB 1PFJA 4G3XB 1V5TA 2H7EA 2CU1A 2DHIA 2EC1A 2DYBA 3L13A 1J8CA 3A4SC 1PLSA 4MGZE 3V5WA 1V2YA 4W9HA 4K7WA 5D94A 2DN6A 3VIAA 2KHWB 2IO0B 1CMXB 2L2IA 2KC1A 4PS3A 2V4LA 3QHTA 2KDIA 4DHZE 4NY0A 3L10B 2VRRB 4NJ7A 3O65B 1KZ7A 2KLGA 2WX0A 2ZPNA 3IHPC 1L2NA 2ZCBA 4HDQA 4N9F4 1W1GA 5C5BA 4EZLA 2YVCA 2BF8B 2LXAA 1GC7A 2D9WA 2IO3B 4B95A 3VDZA 3SNHA 1JRUA 2FJ9A 3B1LX 3JSVA 4FADA 4P7IA 2FAZA 2MX2A 5KQ4A 4ANVA 2JY6A 5JZEB 2NR2A 4WWOA 4HPLB 4KHOA 3A8QA 5JHHA 1J0WA 1WGGA 2L05A 4GU2A 4XX5A 5J18A 4K17A 2LYDA 3LDZE 2YS3A 2C7HA 3F0WA 2MBOA 5DPSA 3S2AA 3OANA 1F9JA 4W9CA 4WQOB 2L1CA 4HCNB 1WG7A 1E7UA 3UF8A 4ZDVA 3R3MA 3A9KB 1E7VA 2WX1A 5GMVA 3TVVA 3VUXA 3RULA 4BKSA 2BYVE 3A33B 2PPHA 4GDKA 3T06A 2D2QA 4PYUA 3TMPB 4EOYA 2CS4A 3KYCD 5LOPB 2CB8A 3A8PA 4M8MA 5C5BB 2IFSA 4IOYX 1E8XA 5AZFA 4A3PA 4FLHA 2IYDB 1BTKA 3M3JA 3RZWC 2QKLA 1UZXB 2UVMA 4HCPB 3SYXA 2K6DB 2KJHB 3VHTC 3VH3B 1UD7A 2FCQA 1IPGA 1TTNA 2J0MA 2D4QA 2NMBA 3KSYA 1WXVA 2D07B 2KC2A 2KMAA 2MRPA 2RSUA 1NTYA 4B6HA 1V86A 5DPWA 2G4DB 4WWPA 2BWFA 1P0RA 2KTRB 3DBSA 1U29A 3M63B 4GIVA 2R0DA 2DYOA 1TJ6A 2COFA 4GN1A 4EZKA 3PZDA 3K9OB 1WXMA 1XODA 3H6NA 3P6AA 3EHVA 1KI1B 1YJ1A 2JVCA 2JUOA 2L0FA 2Z59B 4HATB 4HAUB 2KWVB 2R2QA 4AJYB 2MBHA 1WX9A 5LXHA 1X1FA 4HAZB 1MKEA 4ANUA 2AL6A 3U8ZA 4HAYB 3V60A 1V89A 4G11A 2RD0A 3DVGX 3PP2A 2YS1A 3M95A 3NZSA 4JQWC 4DX8A 3MHSD 1YIWA 3SD5A 2JZZA 2PEAA 1RAXA 2N0YA 4EMOA 3H7PA 4DHJD 3OJ4B 3G9WA 2UZSA 3WIMA 2K2UA 4EJNA 3DPDA 4NAWA 4CO7A 1NVLA 1E8YA 1S3SG 2OOBB 2M14A 1V9JA 1FB8A 1NTVA 2YT1A
chains in the Genus database with same CATH superfamily
3QJZA 4KZ0A 2Y8GA 4BBNF 4HRSA 5MPOA 4PT5A 4LNIA 3PLUA 2WXQA 3A9JA 2HTHB 2JP2A 1KLUD 1MPHA 2KYWA 2LVPA 2MJDA 2ON8A 4JK7A 2IPKD 1WY8A 3LB8C 3NS8A 1XLNA 3IG3A 2FDQA 5GXGB 5HFYA 1WIAA 2E2XA 3RNBC 2N7JA 2VZKB 1A70A 2WDTB 5LNK1 4KDIC 1STEA 3DBLI 3E66A 1DOXA 5C2TB 4OVUA 1ZE3D 1TS5A 3MTNB 1RYJA 4JLCA 2LUMA 2COPA 2PMVA 2WLBA 1D5XC 4I6PA 5D3WA 4HAWB 2DA0A 5GOWB 2KWUB 3V62A 2DHZA 5E6PA 4RMAA 1SF0A 2OTXA 3QK0A 1UEFA 4EEWA 2N7EA 4QAYA 2I38A 1NEKB 2DAJA 1XCGA 4KX6B 3RCZA 4N58A 3ZKJC 2NVUI 3ZNGC 1W1DA 1X86A 5CTRC 3AE3B 4A55A 3ZQ4A 1BXTA 2BYFA 3KUCB 4HB2B 2IYBA 4YT0B 4W9EA 3UZTA 3V05A 2WU5B 4HROA 2V3PA 1WR1A 3M1IB 1D4BA 1E9MA 2KKCA 3TEWA 1VBGA 3LXFA 3A1QA 1SB3C 1JRPA 1QQRA 1YN5A 4LTUA 2CHWA 2PW9A 2WXLA 3E9SA 1L6VA 1WSPA 4MT7A 3O13A 4BBKA 1QQGA 1J7AA 2N1VA 1XX0A 2Z0QA 5D3IB 3NY5A 2ELAA 1U5EA 4F7HA 2JZPA 2SAKA 2JZ3B 3W1YA 3D8FA 3WAPA 1E90A 1WXQA 4KGTA 3H1UA 3AE2B 3RT3B 3T8MA 4IKGA 2W2WA 1EU4A 2IY1B 3U4EG 3FILB 5IA7A 3PPAA 1TGZB 3UI3A 5J2RA 3AU5A 1JROA 2QCZA 2LULA 1H8CA 3L16A 3ZXRA 2GBMA 2DYNA 2WXNA 1WJUA 2GMIC 2LGXA 2WU2B 4NJ6A 2OJWA 3GYOA 3KY9A 2MW5A 1Y19B 2PVOD 1V5PA 1OFFA 2V76A 4NQKE 3DXEA 4WIPA 1WRDB 4HKQA 2D5GA 1QC6A 3TBLD 3ML9A 4NJCA 3SBGA 3AMZA 5JHBA 4RGOS 3HM3A 5IOIA 2L00B 1QOGA 1NENB 4WJQA 4BOZB 2BS3B 4HJGE 1IRSA 2V3SA 2KD0A 3HRDD 4C7ZA 1FNUA 4P1BC 2RGFA 2LG1A 4JKEA 1P98A 3VUYA 2WHIA 1WZ0A 2KOXA 4EFOA 2XK5B 3RI7C 5DHFB 3U52E 2DLWA 2H89B 1LB1A 4BBNC 3IT6B 1FNWA 1KFYB 4IUMB 3GZNB 3ZO5B 4RM8A 4AS1A 2IGDA 3P63A 1TKGA 2L8JA 2DHKA 4ZRPA 4XZ4A 1T0QC 2O2VA 4Q2JA 3AE4B 1TS4A 2MLBA 4HSIA 3PO0A 1MG8A 3DCGA 3Q3JA 2L32A 3FILA 1VJKA 2RDGA 3U30A 4ZRJA 5HI1A 2J53A 3PREA 3WAMA 4ANWA 1GPXA 1Z5SB 3KRXA 1FRRA 2O6VB 4K7SA 2AEHA 4LLGM 1V5UA 2CR5A 1OQYA 1UWMA 2WXOA 1CK1A 2Y3AA 4JKGB 1I7HA 3J9CA 3PZ7A 1NVID 2PZ1A 3CSTA 1EO6A 1F52A 3IBEA 3K9PB 1WM3A 2N4FA 3TEZA 1KJTA 2RNRB 3BJIA 2C7NB 3C8YA 1JWSD 2Y5CA 2LRWA 4GMVA 1V80A 2GOWA 2KDBA 3AEGB 3V61A 3Q8EA 1L4ZB 3F5RA 1WI1A 3RNAC 3O96A 3DOWA 2LGYA 3DHGC 4J6IA 1ET9A 3BVGA 4PS7A 3CMMB 1VZ6A 4PNKA 3HM6X 1XLOA 2MEKA 2WWZA 2GBRA 1T0YA 3NW8A 1ACAA 4O1NA 1UF0A 3QC8B 3DQVA 5D6JB 3EA6A 3MC9A 4CHKA 2KIGA 2M0AA 1EVHA 3ML4A 4AWJA 1EWCA 1FAOA 1WGDA 1MK7B 1DYQA 1VR9A 2ZVOA 4N6EB 1SBBB 3VTVA 2CU3A 2JXTA 2UZRA 1HZ6A 2DYQA 3PVUA 5I4DA 1ZKHA 3OHMB 4DK5A 4YTPB 3A1QB 3W1SA 2K1FA 1Y5OA 1T0RC 1V1PB 1YD8U 1RWSA 4KIKB 2WYQA 3JVZX 3W2DA 4XWXA 2GJYA 2IO1B 1ROEA 1V5OA 3KH0A 3C0RB 4MH8A 2NS5A 1NBFC 3N7CA 4WJOA 2I5FA 2P0DA 1FOEA 2PE6B 2N9PC 4BKTA 2EKIA 4YTMB 1F2RI 2MBEA 2N9XA 2XBBC 4JGHB 1B9RA 3ZVRA 1YJIA 2BPSA 3AE6B 2PE9A 1SJED 2WH5A 1L0YB 3AXCA 4WSFA 5EE3A 4QJ3B 1I4RA 2J42A 5HE3A 2KWCA 3ETRA 1RRPB 1SE2A 3TEYA 3VFKA 1K8RB 3EUB2 4MGIE 1Q67A 5C16A 3ECIA 2ABDA 2K2JA 3CIRB 3H8HA 2XEWA 2K6QA 4Y94A 1PFDA 1OMWA 2Y5BB 4LNKA 1W1HA 2HD5B 3VQIA 4LCDE 4GXBA 3SEBA 1SJHD 4W9LA 2Z59A 1KH0A 1FPYA 1HE8A 3D32A 1WWTA 5BYSA 3PT2B 3APDA 3LJ3A 1FHXA 5FI0A 3QIJA 1FGYA 2M17A 2Z0PA 2K8HA 1J7BA 4KHBA 1VDVA 3BVMA 4TUUA 1LW3A 4L1RA 2PLPA 3AECB 1V49A 4JWSC 3L13A 3A4SC 3V5WA 4W9HA 4K7WA 2DN6A 2KHWB 3AE1B 4PS3A 2KC1A 4DHZE 3MFGA 2ZPNA 3IHPC 1HEZE 4RFBA 4XWWA 5C5BA 4EZLA 2YVCA 4RGMA 1PDXA 3SNHA 1JRUA 3NWFA 4ANVA 2JY6A 2LMCA 4XX5A 4MT5A 1WGGA 4K17A 1JMLA 3I57A 3OANA 3ENBA 2V9HA 3BWUD 4DXFA 2BYVE 4GDKA 4PYUA 3HSAA 5LOPB 3A8PA 4M8MA 5C5BB 2IFSA 3W5UB 4GLSC 1FM0D 1UZXB 4LNNA 3SYXA 2K6DB 4RH6A 3VH3B 1D6EC 5IO9A 2FCQA 1MI0A 1TTNA 5JVLA 2R82A 2RSUA 4JWUC 4WWPA 2BWFA 3DBSA 3NWDA 5D3DA 4EE2A 3HVDA 3AV8A 3K9OB 4OVZA 1CJEA 3E56A 3EHVA 4ACFA 2Z59B 2L0FA 2MBHA 4HAZB 1MKEA 2AL6A 4D6WA 3V60A 1V89A 2WXHA 2BT6A 2RD0A 2YS1A 3M95A 4DX8A 3MHSD 2JZZA 4EMOA 2AQ2B 1K52A 2NMQA 2M14A 2V4IB 4YSYB 1XR0B 1DDVA 1V61A 3A9JB 2D3CA 3IAS1 4N59A 2AWTA 5AUIA 2ONQA 2LOXA 2RDHA 2KNBA 4KV2A 4DX90 1NI3A 2LGSA 1UPQA 3HUIA 2LEKA 2M38A 1C76A 1FXTB 4B0MA 3UGBB 4FN2A 3ZIMA 1XT9B 3DWMA 1N60A 4USAA 4D2KA 3TW1A 1QILA 5JH5C 4AOFA 3ODXA 4HXDA 3WAOA 3R66C 3ALBA 2K39A 2V3NA 3BINA 3FM8C 2TSSA 1N6ZA 1GNUA 2G35A 4XYCA 2MDXA 4H8SA 2LJ5A 4DDGD 2QC8A 3PHWB 3N1XC 2NPTA 3AE5B 1JALA 3ZDMC 1YQBA 1TQZA 5DPTA 2WXRA 2KDEB 4W9FA 3EFUA 4B6WA 2R2YA 2IGGA 3W5VB 3R7RA 3DBHI 1YX5B 3NJTA 1MHXA 2N1WA 4K81A 3B08A 4YONA 1WMHA 2DIKA 4KHAA 2DHJA 3FEHA 3FVCA 1OQNA 1YNTE 2AQ3B 2JSVX 2W3RA 4HK2A 4JL9A 4FBJB 4OT1A 2NBVA 5D3VA 4OW0A 1P1AA 2Z14A 3KRWA 3BK1A 4GSWA 2WXJA 4RF0A 1V1PA 2AYOB 2KN4A 3KVFB 2NBUA 4FJYA 1QF6A 1WGHA 4US9A 3AU4A 1OQQA 2ELBA 1P9DU 2O6VD 2CQUA 5L83A 4F8CB 3D8DA 5DPRA 4ZRKA 2KFJA 1BAKA 4W9GA 3H7PB 1GUAB 3P4PB 2JF5A 3APCA 1UGJA 2DKPA 1N63A 5KCVA 1VCBA 2CRFA 1PGAA 3OLMD 2I1KA 4L1BA 5FR6A 1P7FA 1WJNA 1M4VA 2QEJC 2BWES 2C7MB 5D27A 4NQLB 3R2IA 4YXDB 5LONB 2GS0A 3VTUA 3AEAB 1PQSA 1V88A 1WGUA 1VD2A 4MEMA 4W9IA 5FR3A 1HBKA 2GBJA 1U4AA 2UU7A 1ZW7A 4JKHA 3A98B 3UINB 3UQBA 2CY4A 3BYYB 2LZ6A 3PEGA 2D9VA 4M0WB 1UNSA 2E3TA 4XGAB 2LI5A 4LK0M 3ZVVA 4A6QA 5BYRA 1H10A 3NOBA 3NRZA 3LYYA 1YJJA 1WX8A 1P5TA 5C79A 1NYRA 4NAMA 5E6NA 3AULA 4A6FB 4LDTB 3ULBA 3B0AA 3AN1A 3M62B 2M56B 2FJUB 4RM9A 5DPWA 4ARCA 2IBIB 3RZFA 3ZLZA 2H88B 4HHVA 1X05A 2HTHA 1MHHE 2JWZA 5G2NA 1K5GB 2IGHA 1TS3A 4CHMA 2KZRA 3GOEA 1F77A 3UIOB 1J19A 4JX1C 5KQ1A 3MHZA 2WS3B 1U2BA 2UWQA 5C1ZA 2D9XA 3Q69A 4EUTA 4HLEA 1OQRA 2IZVB 1ZC4B 3RYTA 4AQ7A 3QARA 2NCNA 3MJ5A 1D5MC 3L4PA 2KVRA 2DNFA 4QJ4B 2Y5PA 4B0EA 1XCTL 3B2GA 2KK8A 5D2MB 3U7DA 4WAAA 3NVYA 2KCJA 1GAQB 4MH0E 3DDCB 1I4PA 1FXIA 1FNVA 3PV1A 3Q8BA 1TZ1A 2KQSA 2N9LA 2R09A 4L2YA 3JW0X 2EELA 1WXAA 5CHFA 3VR9B 1BMLC 1S1QB 1E10A 2J7QB 3MDBC 2LD9A 2OEDA 3VXWA 1JWBD 2G3QB 1YN4A 1JDEA 4BAXA 1C4PA 1OTRB 2KWDA 4LDTD 4LNOA 3SU8X 1WVHA 1UNQA 2YLMA 4MELA 5AZGA 2QMTA 1X1MA 2MCNB 3MP9A 1SHCA 1A5RA 1RM6C 2GCJA 2P0FA 4XDDA 1MVKA 4HAXB 5DHAB 1R4NI 2ZNVB 1NYQA 1ZDVA 2ASQA 1WGKA 4KZCA 2JYEA 4LJPB 1IGCA 4KGRA 3U12A 2JWUA 3VRBB 5HE1A 3V3XA 2YEPB 5HHDG 4HJKA 4DHZB 5HKHA 3P4SB 3WA0A 1TS2A 2KXJA 1T77A 1UNRA 4HPMB 2FIFA 2JRIB 5LLIA 2RQ1A 1AARA 1HTOA 3GYPA 1WR6E 1XKEA 5KHOA 1IP9A 4EZJA 2K0PA 1KBLA 2KDFB 2HRJA 2IO0B 5L95C 2NPTB 2YS5A 3PG7A 2X0SA 1AWDA 2CJOA 2K25A 3VAWA 1AN8A 4KSLC 4RF1A 4LJOB 2B76B 1LO5D 2MSED 1FHWA 2EMSA 1WGYA 1WYWB 4H2AA 3E9PA 4FHKA 3WANA 1C77A 4C00A 1UGMA 1CZPA 1WMHB 1PGXA 4MDKE 4NZLB 3FSSA 1UH6A 1WJMA 4C4VB 1FGZA 3UQAA 1HTQA 1X11A 2YRYA 4F1SA 2V1YA 2BQQA 1L0VB 3N1ZC 1I35A 2B3AA 1QKZA 4MK0A 1EUVB 2A4ZA 4K3BA 3MPXA 4I6NB 2WNMA 1MK9B 1I2HA 1LM8B 4IM2A 1WXSA 2RPQA 5FKAC 4C80A 2JU6X 4F7ZA 2COAA 4JKCA 3RN9C 1KF6B 1AYFA 1MPEA 3CF6E 4REZA 4A3OA 3ABVB 4CSQA 4IDIA 3EECA 4F7GA 1JWAD 1E5WA 4GDLB 4TYZA 3ZNHB 1EAZA 1DGJA 1MJDA 1OY2A 1NDDA 2FNJB 4G3XB 1V5TA 4J3OD 2DYBA 1J8CA 2INDC 1C79A 3QHTA 2KDIA 4P1CC 3AM9A 3Q14C 2WX0A 2ZCBA 4HDQA 1TT5B 2BF8B 1QT9A 4FADA 2FAZA 2QJLA 5KQ4A 2Z4DA 2BS4B 2NR2A 4ZDVA 4HPLB 3A8QA 5JHHA 1T0SC 5J18A 1ENFA 2C7HA 3F0WA 2AX5A 2MBOA 3S2AA 1YN3A 4W9CA 4RCOA 1WG7A 3UF8A 3MC0B 3TVVA 3VUXA 3A33B 3T06A 2D2QA 4EOYA 2CS4A 4ARIA 3NUHB 4JKFA 4IOYX 1E8XA 2GI9A 2K22A 2IYDB 2QKLA 4HCPB 5C3JB 4ZOHC 5FK9C 1IPGA 3ZJUA 2J0MA 2D4QA 2WDVB 2NMBA 3KSYA 1V86A 2G4DB 3WALA 1P0RA 2QDFA 1U29A 2R0DA 2DYOA 2COFA 4GN1A 3NVZA 3EFCA 3GE3C 3WCQA 1KI1B 2JVCA 1TY2A 2KWVB 2R2QA 1WX9A 1VBHA 4HAYB 1N61A 4G11A 3NZSA 1YIWA 1RAXA 4DHJD 2K2UA 4EJNA 4CO7A 1ZGUB 3FKYA 2YT1A 3I63C 2M19A 4QXAB 1KTKA 1YX6B 4WJPA 1I4HA 2MJ3A 3ZUNA 2RUKB 2KGXB 5E6JA 2HJ8A 2KX3A 1E8WA 2DYMA 2BTEA 3P7ZA 3L08A 5I2SA 1U27A 5D3YA 2C9WB 1IBXA 3CXBB 4K2PA 4MJSA 2ZCCA 4JKBA 2VSZA 5JHAA 2MWNB 2P0HA 1JCKB 3TL5A 1C4AA 1FRDA 1C1YB 1J7CA 2MBBB 2KANA 2O6VA 1QOAA 1FCLA 2XQNM 4K7UA 4PQ0A 2IDYA 1CQVA 3ENEA 3ZDTA 2SEBD 2VZKD 4I6LB 4BZAA 2J0JA 4DXGA 3HVZA 4GDKB 2LKOA 3VRAB 5LXIB 5L81A 4DWFA 4IM0A 2DX1A 1PYWD 5IAAC 3ZYYX 1HB8A 1J0GA 3ZXVA 1FXAA 2R61A 3Q3OC 1R4NB 2L76A 3H9DA 2IY0B 2PKOA 4GMXB 2JQRB 3TJPA 2EKEC 4K2OA 3SUZA 4HB0B 3ZJTA 2KR0A 3KYDD 3DHHC 1DDWA 2DZMA 1XQQA 3Q3NC 1WGRA 3RMKC 4OSNA 3APFA 1JWUD 2RGNB 2O2VB 3DVNV 2DLBA 1EF5A 4A20A 3Q8FA 3SV1A 1WYGA 1VZ7A 3AE7B 2RR9A 4A6FA 1WX7A 1GG3A 4WWMA 1P7EA 3VOQA 1ZVRA 4IC7B 1MI1A 3P4RB 3P2BA 1FCCC 2JXXA 1DROA 2QILA 1UWXA 4AUQC 4S0RA 4NNJB 3PSEB 4ILGB 3TSSA 3PVWA 4GDLA 1N3HA 3H7SA 1TXDA 1IUEA 2K8CA 3FAHA 3IT4B 3KZ1A 4KGSA 5BYQA 1SE4A 4P6VF 3RUIB 3SHQA 3EC8A 2RRFA 4MGYE 1JQ4A 1VZ8A 4TSSA 1UPRA 1EGXA 2Z13A 5HG2A 1ZM0A 1MFWA 3R8BA 4ICVA 4TKNA 4C0AA 1N5WA 3BZDB 3QBVB 4IW0A 2ZPYA 1NU2A 4CQNA 1SGHA 5J3TA 1I4GA 1M94A 5M4YB 3MJWA 3OAWA 5BMGA 3RNFC 2M4NA 4GOCA 5EE9A 1ZXHA 2BYTA 1V8CA 3P4QB 4TMAB 1SSNA 3ULCA 2X8XX 3E9LA 2ICIA 2WXGA 1XD3B 3IAM1 2FCSA 4IAPA 4KAXB 2Z8LA 4G50A 2ROZB 1DDMA 5D3XA 2ZJDA 1UBIA 3HHMA 1T5XD 2FCMA 4S17A 2NZ8B 1KLGD 4BKSD 2KDMA 1YQ4B 3ZGZA 2VH1A 3SBTA 2PVGC 4JE3B 2BKRB 2CODA 2ZW0A 4IWPA 4A90A 4E3CA 2REXA 3PLVA 2Q13A 5JP4A 1BTNA 2BGFA 2J4XA 1Y56A 4F7UP 4MM3B 3P42A 4FULA 3WYFB 2K8BA 5CX3A 1EWYC 3N1YC 3GP7A 4A6KA 2E6XA 2YT0A 1FMAD 3ZTCA 2PJHA 2KUQA 3R2TA 2K3UA 3PTFC 2GBNA 4HPPA 1D5ZC 1K5DB 1FHOA 5C6RA 1ZP0B 3RFZB 2HTME 2M0XA 5DCNA 3V6CB 5IP4D 2XN9C 3VVWB 3PVLA 2Z0DB 2LBBA 3TIXA 1KLVA 4LNFA 3QWZB 3PSCA 4PK1A 3AE8B 5HE0A 3Q8CA 2JX5A 3IXSA 4NPNA 4RNAA 1GOZA 2DTCA 3DBRI 1P6SA 3OJ3A 1MIXA 2LGIA 3X23A 3SO6A 1NTIA 2NTTA 4CYEA 3C19A 3SDLC 1DOYA 3GE8C 2ZNVC 4X57B 4C7YA 2MP2A 2W55A 3QCAA 4II2B 4IFSA 1P3QU 1ST7A 1P3RA 2LXCA 2WDRB 3Q3FA 2YT2A 2FE8A 4ZRQA 3W1SC 5EDSA 3HIEA 4QJ5B 5BO4B 1V6EA 4KDLB 1GB4A 1UBQA 2OJRA 4KHBB 2KLCA 3BVZA 4BFRA 1RFKA 1OEYA 4DXAB 3L54A 3CIKA 2KMCA 3OWEB 3QX1A 1M7EA 2ADZA 1MIZB 1WGQA 1RFAA 4HWIB 2DKQA 1LFDA 4D0NB 3O65B 3TO1A 2J59M 1WE7A 3GB1A 2LASA 4MM3A 3KUDB 3PRPB 1XEEA 5LG4B 3PHXB 2DENB 5EE0A 5C23A 3HIZA 1ZC3B 2W54A 1EM7A 2CHXA 2MJEA 3AEDB 2LUEA 1Z87A 1DYNA 2L1AA 2MBQA 4OZCA 5BMHA 1BWNA 2W3SA 4WQMA 2QHOA 4HVBA 3B9JA 2Y7BA 3N30A 1U5GA 2BBCA 3BY4B 3Q6BA 1H4RA 2DAFA 3JSVB 4XDCA 2KT7A 1EU3A 1L4DB 1Q5WB 3A58A 1L6UA 1XO3A 4ZHPA 1HB6A 3FLVA 5J3YA 1ZDXA 1ZPSA 2YSZA 3RD2A 1WI0A 1YOVB 4ZHOA 4MGKE 1B1ZA 2LVOA 2HDEA 2K9XA 2Y8FA 2MA9B 2DX5B 3T3NA 2WXKA 2BCJA 2EJ8A 2P8VA 1R4MI 1N62A 4HAVB 2XK5A 5EFXA 2HJ1A 1RRBA 2LWPA 4GZUA 2N9EB 4CHJA 3ZNZB 3NVWA 2MWSB 1HQRD 2KQ7A 3VUWA 2IJ0A 3LJUX 1WJ4A 2D11A 1F2RC 4DHJB 1WF9A 1G6JA 2BB5A 3N9YC 2OQBA 2YF0A 3ONSA 4GGQA 3B2FA 4TQ1A 4BVUC 2WXPA 1WJ6A 1SE3A 3L17A 2KFKB 3DBLB 2H7EA 2CU1A 2KMMA 1PLSA 4MGZE 3VIAA 1CMXB 3P1MA 4RGNA 4NY0A 2VRRB 4JKGA 1I4QA 2KLGA 2NTSA 1QOBA 2LXAA 2D9WA 4B95A 4YWGG 1PGBA 3B1LX 4P7IA 2MX2A 1V97A 5JZEB 2GB1A 4KHOA 1J0WA 2YS3A 1GB1A 2L1CA 4HCNB 5TSSA 3A9KB 1C4CA 2N0SB 1BUIC 2CB8A 5AZFA 2RDBC 4FLHA 1BTKA 3M3JA 3RZWC 2UVMA 1ZUD2 2KJHB 3VHTC 3B77A 1UD7A 1SXTA 2D07B 2FUG1 2MRPA 5BMIA 3FC4A 2YEPF 4B6HA 2KTRB 3M63B 1TJ6A 3PZDA 1L5PA 3H6NA 4M0WA 2JUOA 4HATB 2KVZA 4ANUA 3U8ZA 5EE1A 4C4VA 3DVGX 3PP2A 1UUPA 4JQWC 3SD5A 3H7PA 3OJ4B 2L83A 3G9WA 2UZSA 4JPSA 3WIMA 1WRIA 1SIJA 2ZKMX 1NVLA 1E8YA 1C9FA 3EGRA 1V9JA 3KUZA 4PS8A 1WM2A 3IVFA 1LXDA 1NI2A 4G0NB 3PZ8A 1LGRA 3VH4B 4TQ0A 4KIKA 4WH4A 4PYZA 4FXCA 5HE2A 3QQ8B 5AUKA 2LGDA 2QKMA 1HZ5A 1F1HA 1WE6A 2KACA 5J17A 3VTWA 1LQBA 3Q2AC 3NSUA 3RCPA 1WFYA 2K5PA 3AH7A 2DZKA 3X0WA 3T9LA 3AEBB 1UNPA 5DH9B 5G5GA 2D10A 2MP2B 4YTNB 4FA6A 2VKIA 4B9KA 2ACZB 5IJMA 1OEYJ 1OGWA 5TR5A 2ZVNA 2L3ZA 3DBRB 4ANXA 1TY0A 1L7YA 3NVVA 2EMTA 2XNAC 2R2OA 2J0KA 3R7QA 2V0GA 1QLBB 2CHZA 1MG4A 3ZNID 4MY6A 2FCNA 4OZBA 3ZRFA 4IM3A 1AQCA 1F0ZA 4RGTA 4ZYNA 5JXVA 2FBWB 3HK0A 1ISNA 3TFMA 1RLFA 2IO2B 2KAJA 1ZSQA 2KTRA 2X38A 3TEXA 3DXDA 4GNKB 2WXFA 3QWMA 2CJNA 2KQ4X 2DZIA 3N3KB 1XLQA 3RNEC 4URKA 1X1GA 3N32A 2RMMA 2NBWB 1KM7A 4E74A 3AE9B 2BW2A 4GPTB 1KOTA 4ZRIA 2NBVB 1GC6A 1FEHA 2ZW1A 3T3OA 3E9OA 2AQ1B 1FIQA 2D3AA 1I42A 2INCC 1JW9D 2W9NA 4HEA1 4IOIE 5H92C 2MQJA 2RVBB 2Z0EB 5AEKB 1XXGA 2N23A 1IGDA 4IWQA 4E71A 5DI9B 2WP9B 3HW2B 5I2MA 1YQ3B 2GCLA 1GGOA 3NZ3A 1V5MA 1DOIA 2KFKA 5J3QA 5IN7A 1PMSA 2HE7A 3UIPB 1L0XB 1Q1OA 3V6EB 3QA8A 4W9JA 2RLOA 5JLJB 3IFWB 2JYTA 2DX5A 2INPE 1PUTA 3DWGC 4OVVA 4BOSC 3DVGY 3CWIA 1TZOA 2G45B 4MSMB 4M01A 2BYEA 3ZTDA 2W82A 3GZNI 3ODOA 3I9V1 4WJ7A 3AB5A 3Q3MC 4WJNA 1U5DA 3I5JC 1E0ZA 3I3TB 1IYFA 4GOUA 4A5KA 3VR8B 5T8IA 2Z0OA 1WZ3A 1U5FA 3EPYA 4IG7B 1ET6A 1ZYIA 2FIDA 1XCQL 1GJZA 4HB3B 1E8ZA 3URYA 4IWOA 1C3TA 2FUHB 2KO3A 4ILHA 1XF5L 3CSFA 4DBGA 5FI1A 1Q0WB 2KN5A 2RPVA 2K00A 5CLQB 4KSKC 3ZRCA 4C56C 3U7ZA 3PGEA 1I7AA 3ZJVA 2LVQA 2LOZA 2BS2B 2C5LC 2BB6A 2K8EA 2W2XD 4FJZA 2C60A 2JRHA 3A9KA 2GLSA 3BYTB 2WXIA 2I1JA 4OHJA 3PRMB 2DWQA 1FFVA 3RNCC 2D9YA 1DIKA 2DZJA 2L0TA 4ILJA 5G5HA 2GUMA 1XD4A 2KJ6A 4A8XC 3DXCA 3BK2A 2I5CA 1HA5A 2PTLA 5JHGA 3KWLA 1V1OA 4R3DA 4DBBA 1VRAB 2MH7A 2RSGA 5D7GA 4W9DA 4HKZE 5AZHA 5E6OA 4Z2MB 3KW5B 5CHVC 2KTFA 2CY5A 3PS6A 1TYGB 2Q5WD 1UELA 1K53A 3DBHB 2L52A 2UYZB 5KHQA 4L6EA 3AI5A 2D3GA 3TUOA 3AJ4A 4JK8A 3ML8A 4ICUA 2JT4B 4YSXB 3DCXA 4JK9A 5CLLB 3JYUA 2ROVA 1TBEA 1ZXIA 2LRUA 2GRIA 1MAIA 2MHJA 3FP5A 2VRWB 2MKRA 5IRSA 1QZEA 1T6BX 4WVFB 2AL3A 3NS1A 4Z2NA 4WWNA 3HQCA 3ODWA 1JWMD 3QAQA 3NHEB 1Q10A 2BVCA 4KKJA 1M7RA 2J52A 1ESFA 4AP4C 1EF1A 4KVGB 4HDOA 2G9HD 4P16A 2M1MA 1AWEA 4TV3A 3W9CB 2QSDA 2A5UA 3TCAA 5G55A 3A4RA 2W2XC 4ASWC 1ACCA 3D8EA 2K49A 3RPFC 2H7DA 2CAYA 3PRZA 4II3B 1DBHA 2COCA 2N9KA 4HB4B 4M8NA 1KZGA 4DQOC 1K51A 1D3ZA 5CHWA 2DFKA 1Z2MA 5GMVA 1Y8RC 2BKFA 5DIFB 2KUPA 1V81A 4FJVB 4K1RB 4US8A 2FJLA 2MFQA 1ZOYB 4JKDA 2L7RA 4KKIA 4W9KA 3SFDB 4MJSB 3AEEB 2ZEQA 4MSQB 1I4XA 2G4SA 4EKUA 2D3BA 1WH3A 1KRHA 4L23A 2DBYA 3BIID 1C78A 1SIFA 1B55A 4A9AA 2WGSA 2M8SA 2CKHB 4ZYSA 2LFIA 3L0WB 3NWAA 1RJ2A 1BT0A 2N7DA 2INNE 1AW7A 4JIOU 1WJ1A 2JPHA 3RNGC 1E7PB 3ZW3A 4A6HA 2LHDA 4GB9A 2D9ZA 1YMHE 3SR6A 2KX0A 4XC2A 2PIAA 2X18A 2KJRA 4YL8A 2GBKA 2VH2A 3KQ4A 4NSWA 1IBXB 1HXYD 1SE9A 3DVNU 4AJWA 4NAWB 4DDID 2ZZPB 3DHIC 4BKGA 4OZAA 3NZUA 1FD6A 1R4MB 4FHJA 1TKEA 2LHEA 3N20C 1PFJA 4M02A 2DHIA 2EC1A 1TIFA 1V2YA 5D94A 1QOFA 2L2IA 2V4LA 3L10B 4NJ7A 1VLBA 1KZ7A 2WDQB 1L2NA 4N9F4 1W1GA 2I2YA 2G1EA 3NG0A 1GC7A 2WQYB 2IO3B 3VDZA 2LJIA 2FJ9A 3JSVA 4WURA 1KC7A 1T3QA 3KWVA 4JKAA 4WWOA 3Q8AA 4YSZB 2L05A 4GU2A 2LYDA 3LDZE 2WXMA 5DPSA 1F9JA 4WQOB 1E6EB 1E7UA 1R7SA 4ITKA 2KIEA 3R3MA 1E7VA 2WX1A 4BKSA 3RULA 1TKYA 3TMPB 2PPHA 1TJEA 3KYCD 4UDUC 4K3CA 4A3PA 3GS2A 1K50A 4MACA 2KC2A 1N5XA 2KMAA 1WXVA 3KLSX 1NTYA 4DIXA 1XLPA 4M00A 1SEBD 4GIVA 4XE0A 4EZKA 3U2SC 2QIEB 1WXMA 5IKCM 1XODA 3P6AA 1YJ1A 2OHFA 4HAUB 1FFUA 4AJYB 5LXHA 1X1FA 3SFEB 1FO4A 4WAFA 3MC8A 2PEAA 2N0YA 5H8YE 3AEFB 3DPDA 3OG5A 4NAWA 4XWTA 1S3SG 2OOBB 1FB8A 1NTVA
chains in the Genus database with same CATH topology
3QJZA 4KZ0A 2Y8GA 4BBNF 3PLUA 3A9JA 2HTHB 2JP2A 1MPHA 2LVPA 4JK7A 1WY8A 3NS8A 3IG3A 2FDQA 1WIAA 2E2XA 2WDTB 4KDIC 3DBLI 3E66A 4OVUA 3MTNB 4JLCA 2COPA 4I6PA 5D3WA 4HAWB 2DA0A 5GOWB 2KWUB 3V62A 2DHZA 5E6PA 4RMAA 2OTXA 3QK0A 1UEFA 4EEWA 2N7EA 2DAJA 1XCGA 3RCZA 3ZKJC 2NVUI 3ZNGC 1W1DA 1X86A 5CTRC 2BYFA 3KUCB 4HB2B 2IYBA 4W9EA 3UZTA 1WR1A 3M1IB 2KKCA 1VBGA 3A1QA 2CHWA 4MT7A 4BBKA 1QQGA 2N1VA 1XX0A 2Z0QA 3NY5A 2ELAA 1U5EA 4F7HA 2JZ3B 3W1YA 3D8FA 3WAPA 1E90A 3H1UA 3RT3B 3T8MA 2W2WA 2IY1B 5IA7A 3PPAA 1TGZB 5J2RA 3AU5A 2LULA 1H8CA 3L16A 2GBMA 2DYNA 1WJUA 2GMIC 2LGXA 4NJ6A 3GYOA 3KY9A 2MW5A 1Y19B 1V5PA 2V76A 4NQKE 3DXEA 1WRDB 1QC6A 3TBLD 3ML9A 3SBGA 5JHBA 3HM3A 2L00B 4WJQA 4BOZB 1IRSA 2V3SA 2KD0A 2RGFA 2LG1A 4JKEA 1P98A 3VUYA 1WZ0A 2KOXA 4EFOA 2XK5B 5DHFB 2DLWA 4BBNC 1LB1A 4IUMB 3ZO5B 4RM8A 2L8JA 2DHKA 4XZ4A 2O2VA 2MLBA 1MG8A 3DCGA 3Q3JA 3U30A 4ZRJA 3PREA 3WAMA 4ANWA 1Z5SB 3KRXA 2O6VB 4K7SA 2AEHA 1V5UA 2CR5A 1OQYA 4JKGB 2PZ1A 3CSTA 1EO6A 3IBEA 3K9PB 1WM3A 2N4FA 1KJTA 2RNRB 3BJIA 2C7NB 2LRWA 4GMVA 1V80A 2GOWA 2KDBA 3V61A 3F5RA 1WI1A 3O96A 3DOWA 2LGYA 4J6IA 4PS7A 3CMMB 4PNKA 3HM6X 2WWZA 2GBRA 1T0YA 1ACAA 3QC8B 3DQVA 5D6JB 4CHKA 1EVHA 3ML4A 4AWJA 1FAOA 1WGDA 1MK7B 2ZVOA 3VTVA 2UZRA 2DYQA 3PVUA 1ZKHA 4DK5A 3A1QB 3W1SA 2K1FA 1Y5OA 1YD8U 4KIKB 2WYQA 3JVZX 4XWXA 2GJYA 2IO1B 1V5OA 3KH0A 3C0RB 2NS5A 1NBFC 3N7CA 4WJOA 2I5FA 2P0DA 1FOEA 2PE6B 2N9PC 4BKTA 2MBEA 2N9XA 2XBBC 4JGHB 3ZVRA 2BPSA 2PE9A 2WH5A 3AXCA 4WSFA 5HE3A 2KWCA 1RRPB 3VFKA 1K8RB 4MGIE 1Q67A 5C16A 3ECIA 2ABDA 2K2JA 2XEWA 2K6QA 4Y94A 1OMWA 2Y5BB 3VQIA 1W1HA 2HD5B 4LCDE 4GXBA 4W9LA 1HE8A 3D32A 3PT2B 3APDA 3LJ3A 1FHXA 5FI0A 3QIJA 1FGYA 2M17A 2Z0PA 2K8HA 4TUUA 1LW3A 1V49A 3L13A 3A4SC 3V5WA 4W9HA 4K7WA 2DN6A 2KHWB 4PS3A 2KC1A 4DHZE 2ZPNA 3IHPC 5C5BA 4EZLA 2YVCA 3SNHA 1JRUA 4ANVA 2JY6A 4XX5A 1WGGA 4K17A 3OANA 3ENBA 2BYVE 4GDKA 4PYUA 5LOPB 3A8PA 4M8MA 5C5BB 2IFSA 1UZXB 3SYXA 2K6DB 3VH3B 2FCQA 1TTNA 5JVLA 2R82A 2RSUA 4WWPA 2BWFA 3DBSA 3K9OB 3EHVA 2Z59B 2L0FA 2MBHA 4HAZB 1MKEA 2AL6A 3V60A 1V89A 2RD0A 2YS1A 3M95A 4DX8A 3MHSD 2JZZA 4EMOA 2M14A 1XR0B 1DDVA 1V61A 3A9JB 2AWTA 2LOXA 2KNBA 4KV2A 4DX90 1UPQA 2M38A 1FXTB 3UGBB 4FN2A 3ZIMA 1XT9B 3TW1A 5JH5C 4AOFA 3ODXA 4HXDA 3WAOA 3R66C 3ALBA 2K39A 3BINA 3FM8C 1GNUA 2G35A 2MDXA 4H8SA 2LJ5A 4DDGD 3PHWB 2NPTA 3ZDMC 1YQBA 1TQZA 5DPTA 2KDEB 4W9FA 3EFUA 4B6WA 3R7RA 3DBHI 1YX5B 2N1WA 4K81A 3B08A 4YONA 1WMHA 2DIKA 4KHAA 2DHJA 3FEHA 1OQNA 4HK2A 4JL9A 4FBJB 5D3VA 1P1AA 4GSWA 3KRWA 2AYOB 3KVFB 2NBUA 4FJYA 1WGHA 3AU4A 2ELBA 1P9DU 2O6VD 2CQUA 5L83A 4F8CB 3D8DA 5DPRA 4ZRKA 2KFJA 1BAKA 4W9GA 3H7PB 1GUAB 2JF5A 3APCA 2DKPA 1VCBA 5KCVA 2CRFA 3OLMD 2I1KA 5FR6A 1WJNA 2BWES 2C7MB 5D27A 4NQLB 5LONB 2GS0A 3VTUA 1PQSA 1V88A 1WGUA 1VD2A 4MEMA 4W9IA 1HBKA 2GBJA 1U4AA 1ZW7A 4JKHA 3A98B 3UINB 3UQBA 2CY4A 2LZ6A 3PEGA 2D9VA 4M0WB 2LI5A 3ZVVA 1H10A 3NOBA 1WX8A 1P5TA 5C79A 5E6NA 3AULA 4A6FB 4LDTB 3ULBA 3B0AA 3M62B 4RM9A 5DPWA 2IBIB 3RZFA 3ZLZA 4HHVA 1X05A 2HTHA 2JWZA 5G2NA 1K5GB 4CHMA 2KZRA 3GOEA 3UIOB 1J19A 5KQ1A 1U2BA 2UWQA 5C1ZA 2D9XA 4EUTA 4HLEA 2IZVB 1ZC4B 3RYTA 3QARA 2NCNA 2KVRA 2KK8A 5D2MB 3U7DA 4WAAA 2KCJA 4MH0E 3DDCB 3PV1A 1TZ1A 2KQSA 2R09A 3JW0X 1WXAA 5CHFA 1S1QB 2J7QB 3MDBC 2LD9A 3VXWA 2G3QB 1JDEA 1OTRB 4LDTD 3SU8X 1WVHA 2YLMA 1UNQA 4MELA 5AZGA 1X1MA 2MCNB 1SHCA 1A5RA 2GCJA 2P0FA 4HAXB 5DHAB 1R4NI 2ZNVB 2ASQA 4KZCA 4LJPB 5HE1A 4HJKA 4DHZB 5HKHA 3WA0A 2KXJA 1UNRA 4HPMB 2FIFA 2JRIB 5LLIA 2RQ1A 1AARA 3GYPA 1IP9A 1WR6E 1XKEA 5KHOA 4EZJA 1KBLA 5L95C 2HRJA 2KDFB 2IO0B 2NPTB 2YS5A 3PG7A 3VAWA 2X0SA 2K25A 4KSLC 4LJOB 2MSED 1FHWA 2EMSA 1WGYA 1WYWB 3WANA 3E9PA 4FHKA 1UGMA 1WMHB 4MDKE 3FSSA 1UH6A 1WJMA 1FGZA 3UQAA 1X11A 2YRYA 4F1SA 2V1YA 1I35A 2B3AA 4MK0A 1EUVB 2A4ZA 3MPXA 4I6NB 1MK9B 1I2HA 1LM8B 4IM2A 1WXSA 2RPQA 4F7ZA 2COAA 4JKCA 3CF6E 4A3OA 3EECA 4F7GA 1E5WA 4GDLB 4TYZA 3ZNHB 1EAZA 1OY2A 1NDDA 2FNJB 4G3XB 1V5TA 2DYBA 1J8CA 3QHTA 2KDIA 2WX0A 2ZCBA 4HDQA 2BF8B 4FADA 2FAZA 5KQ4A 2NR2A 4ZDVA 4HPLB 3A8QA 5JHHA 5J18A 2C7HA 3F0WA 2MBOA 3S2AA 4W9CA 1WG7A 3UF8A 3TVVA 3VUXA 3A33B 3T06A 2D2QA 4EOYA 2CS4A 4JKFA 4IOYX 1E8XA 2IYDB 2QKLA 4HCPB 1IPGA 2J0MA 2D4QA 2NMBA 3KSYA 1V86A 2G4DB 3WALA 1P0RA 1U29A 2R0DA 2DYOA 2COFA 4GN1A 1KI1B 2JVCA 2KWVB 2R2QA 1WX9A 1VBHA 4HAYB 4G11A 3NZSA 1YIWA 1RAXA 4DHJD 2K2UA 4EJNA 4CO7A 4WJPA 1ZGUB 2YT1A 1YX6B 3ZUNA 2RUKB 2KGXB 2HJ8A 2KX3A 1E8WA 2DYMA 3P7ZA 3L08A 1U27A 5D3YA 2C9WB 3CXBB 4K2PA 4MJSA 2ZCCA 4JKBA 2VSZA 5JHAA 2MWNB 2P0HA 3TL5A 1C1YB 2MBBB 2KANA 2O6VA 2XQNM 4K7UA 4PQ0A 3ENEA 3ZDTA 4I6LB 2J0JA 4GDKB 2LKOA 5LXIB 5L81A 4DWFA 4IM0A 2DX1A 5IAAC 1HB8A 1J0GA 2L76A 3H9DA 2IY0B 4GMXB 3TJPA 2EKEC 4K2OA 3SUZA 4HB0B 3KYDD 1DDWA 2DZMA 1XQQA 1WGRA 3APFA 2RGNB 2O2VB 3DVNV 1EF5A 4A20A 3SV1A 2RR9A 4A6FA 1WX7A 1GG3A 3VOQA 1ZVRA 4IC7B 3P2BA 2JXXA 1DROA 4AUQC 4NNJB 3PSEB 4ILGB 3PVWA 4GDLA 1N3HA 3H7SA 1TXDA 2K8CA 3KZ1A 3RUIB 3SHQA 3EC8A 4MGYE 1UPRA 1EGXA 1ZM0A 4ICVA 4TKNA 4C0AA 3QBVB 4IW0A 2ZPYA 1NU2A 1SGHA 5J3TA 1M94A 3MJWA 3OAWA 2M4NA 4GOCA 3ULCA 3E9LA 1XD3B 2FCSA 4IAPA 4KAXB 4G50A 2ROZB 1DDMA 5D3XA 2ZJDA 1UBIA 3HHMA 2FCMA 2NZ8B 4BKSD 3SBTA 2BKRB 2CODA 4IWPA 4E3CA 2REXA 3PLVA 2Q13A 5JP4A 1BTNA 2BGFA 4F7UP 4FULA 3WYFB 2K8BA 5CX3A 4A6KA 2YT0A 3ZTCA 2PJHA 3PTFC 2GBNA 1K5DB 1FHOA 5C6RA 2M0XA 5DCNA 3V6CB 3VVWB 3PVLA 2Z0DB 2LBBA 3TIXA 1KLVA 3QWZB 3PSCA 5HE0A 4NPNA 2DTCA 3DBRI 1P6SA 3OJ3A 1MIXA 3X23A 3SO6A 1NTIA 4CYEA 3SDLC 4X57B 2ZNVC 2MP2A 3QCAA 4II2B 4IFSA 1P3QU 1ST7A 1P3RA 2LXCA 3Q3FA 3W1SC 5EDSA 5BO4B 1V6EA 4KDLB 1UBQA 2OJRA 4KHBB 2KLCA 4BFRA 1OEYA 4DXAB 3L54A 3CIKA 2KMCA 3QX1A 1M7EA 2ADZA 1MIZB 1WGQA 1RFAA 4HWIB 2DKQA 1LFDA 4D0NB 3O65B 3TO1A 2J59M 1WE7A 2LASA 4MM3A 3KUDB 3PRPB 3PHXB 2DENB 5C23A 3HIZA 1ZC3B 2CHXA 1Z87A 2LUEA 1DYNA 2MBQA 1BWNA 2QHOA 4HVBA 2Y7BA 3N30A 1U5GA 3BY4B 1H4RA 2DAFA 3JSVB 1Q5WB 1HB6A 3FLVA 5J3YA 2YSZA 3RD2A 1WI0A 4MGKE 2LVOA 2Y8FA 2MA9B 2DX5B 2BCJA 2EJ8A 2P8VA 1R4MI 4HAVB 2XK5A 5EFXA 1RRBA 2LWPA 4GZUA 2N9EB 4CHJA 3ZNZB 2MWSB 2KQ7A 3VUWA 3LJUX 1WJ4A 2D11A 4DHJB 1WF9A 1G6JA 2OQBA 2YF0A 3ONSA 4GGQA 4TQ1A 4BVUC 1WJ6A 3L17A 2KFKB 2H7EA 2CU1A 1PLSA 4MGZE 3VIAA 1CMXB 4NY0A 2VRRB 4JKGA 2KLGA 2LXAA 2D9WA 4B95A 3B1LX 4P7IA 2MX2A 5JZEB 4KHOA 1J0WA 2YS3A 2L1CA 4HCNB 3A9KB 2CB8A 5AZFA 4FLHA 1BTKA 3M3JA 3RZWC 2UVMA 2KJHB 3VHTC 1UD7A 2D07B 2MRPA 4B6HA 2KTRB 3M63B 1TJ6A 3PZDA 3H6NA 2JUOA 4HATB 4ANUA 3U8ZA 3DVGX 3PP2A 4JQWC 3SD5A 3H7PA 3OJ4B 3G9WA 2UZSA 3WIMA 1NVLA 1E8YA 1V9JA 3KUZA 4PS8A 1WM2A 3IVFA 1LXDA 1NI2A 4G0NB 3VH4B 4TQ0A 4KIKA 4PYZA 5HE2A 3QQ8B 2LGDA 2QKMA 1WE6A 5J17A 3VTWA 1LQBA 3NSUA 3RCPA 1WFYA 2DZKA 3X0WA 3T9LA 1UNPA 5DH9B 2D10A 2MP2B 4FA6A 2VKIA 4B9KA 5IJMA 1OEYJ 1OGWA 5TR5A 2ZVNA 2L3ZA 4ANXA 1L7YA 2EMTA 2R2OA 2J0KA 3R7QA 2CHZA 3ZNID 4MY6A 2FCNA 3ZRFA 4IM3A 1AQCA 4ZYNA 3HK0A 1ISNA 3TFMA 1RLFA 2IO2B 1ZSQA 2KTRA 3DXDA 3QWMA 2DZIA 3N3KB 4URKA 1X1GA 3N32A 2NBWB 1KM7A 4E74A 4GPTB 1KOTA 4ZRIA 2NBVB 1GC6A 3E9OA 1I42A 2W9NA 2MQJA 2RVBB 2Z0EB 5AEKB 2N23A 4IWQA 4E71A 5DI9B 3HW2B 2GCLA 1GGOA 1V5MA 2KFKA 5J3QA 1PMSA 2HE7A 3UIPB 1Q1OA 3V6EB 3QA8A 4W9JA 2RLOA 5JLJB 3IFWB 2DX5A 4BOSC 4OVVA 3DVGY 2G45B 4MSMB 2BYEA 3ZTDA 3GZNI 3ODOA 4WJ7A 4WJNA 1U5DA 3I3TB 1IYFA 4A5KA 2Z0OA 1WZ3A 1U5FA 3EPYA 4IG7B 2FIDA 1GJZA 4HB3B 1E8ZA 4IWOA 1C3TA 2FUHB 2KO3A 4ILHA 3CSFA 4DBGA 5FI1A 1Q0WB 2KN5A 2K00A 5CLQB 4KSKC 3ZRCA 3PGEA 1I7AA 2LVQA 2LOZA 2C5LC 2W2XD 4FJZA 2C60A 2JRHA 3A9KA 2I1JA 3PRMB 2D9YA 1DIKA 2DZJA 2L0TA 4ILJA 1XD4A 2KJ6A 3DXCA 2I5CA 5JHGA 4DBBA 2RSGA 5D7GA 4W9DA 5AZHA 5E6OA 4Z2MB 3KW5B 5CHVC 2KTFA 2CY5A 3PS6A 1UELA 2UYZB 5KHQA 4L6EA 3AI5A 2D3GA 3AJ4A 4JK8A 3ML8A 4ICUA 2JT4B 4JK9A 5CLLB 3JYUA 2ROVA 1TBEA 2LRUA 1MAIA 3FP5A 2VRWB 2MKRA 1QZEA 4WVFB 2AL3A 4Z2NA 4WWNA 3HQCA 3ODWA 3QAQA 3NHEB 1M7RA 4AP4C 1EF1A 4KVGB 4HDOA 2M1MA 1AWEA 4TV3A 2A5UA 3TCAA 5G55A 3A4RA 2W2XC 4ASWC 3D8EA 2H7DA 2CAYA 3PRZA 4II3B 1DBHA 2COCA 4HB4B 4M8NA 1KZGA 1D3ZA 5CHWA 2DFKA 1Z2MA 5GMVA 1Y8RC 2BKFA 5DIFB 2KUPA 1V81A 4FJVB 4K1RB 2FJLA 2MFQA 4JKDA 2L7RA 4W9KA 4MJSB 2ZEQA 4MSQB 2G4SA 4EKUA 1WH3A 1SIFA 1B55A 2M8SA 2CKHB 3L0WB 1BT0A 1RJ2A 2N7DA 4JIOU 1WJ1A 2JPHA 3ZW3A 4A6HA 4GB9A 2D9ZA 2KX0A 4XC2A 2X18A 2KJRA 4YL8A 2GBKA 4NSWA 1SE9A 3DVNU 4AJWA 4NAWB 4DDID 2ZZPB 4BKGA 3NZUA 4FHJA 1PFJA 2DHIA 2EC1A 1V2YA 5D94A 2L2IA 2V4LA 3L10B 4NJ7A 1KZ7A 1L2NA 4N9F4 1W1GA 1GC7A 2IO3B 3VDZA 2FJ9A 3JSVA 1KC7A 4JKAA 4WWOA 2L05A 4GU2A 2LYDA 3LDZE 5DPSA 1F9JA 4WQOB 1E7UA 3R3MA 1E7VA 2WX1A 4BKSA 3RULA 3TMPB 2PPHA 3KYCD 4A3PA 2KC2A 1WXVA 2KMAA 1NTYA 4GIVA 4EZKA 1WXMA 1XODA 3P6AA 1YJ1A 4HAUB 4AJYB 5LXHA 1X1FA 2PEAA 2N0YA 3DPDA 4NAWA 1S3SG 2OOBB 1FB8A 1NTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PS8 A;  1WM2 A;  3IVF A;  2Y8G A;  1NI2 A;  1XR0 B;  1LXD A;  1YX6 B;  3QJZ A;  4G0N B;  4KZ0 A;  3ZUN A;  4BBN F;  2RUK B;  2KGX B;  3VH4 B;  1DDV A;  1V61 A;  4TQ0 A;  3A9J B;  3PLU A;  2HJ8 A;  2KX3 A;  3A9J A;  1E8W A;  2HTH B;  2JP2 A;  2DYM A;  1MPH A;  2AWT A;  2LVP A;  4KIK A;  2LOX A;  3P7Z A;  2KNB A;  3L08 A;  4DX9 0;  4KV2 A;  1WY8 A;  1U27 A;  3NS8 A;  5D3Y A;  2C9W B;  3IG3 A;  2FDQ A;  1UPQ A;  5HE2 A;  3QQ8 B;  4PYZ A;  2LGD A;  2M38 A;  2QKM A;  1WIA A;  2E2X A;  3CXB B;  4K2P A;  1WE6 A;  2ZCC A;  4MJS A;  1FXT B;  5J17 A;  2VSZ A;  5JHA A;  2MWN B;  2P0H A;  2WDT B;  1LQB A;  3TL5 A;  3UGB B;  4FN2 A;  4KDI C;  3DBL I;  3VTW A;  1XT9 B;  3ZIM A;  3NSU A;  3RCP A;  1C1Y B;  4OVU A;  2MBB B;  2KAN A;  2O6V A;  3TW1 A;  1WFY A;  3MTN B;  5JH5 C;  4JLC A;  4AOF A;  2DZK A;  3X0W A;  3T9L A;  1UNP A;  5DH9 B;  3ODX A;  2XQN M;  2D10 A;  4HXD A;  3WAO A;  4K7U A;  4PQ0 A;  3ENE A;  2COP A;  3R66 C;  3ZDT A;  4I6L B;  2J0J A;  2MP2 B;  4I6P A;  4FA6 A;  3ALB A;  2VKI A;  2K39 A;  5D3W A;  4B9K A;  4HAW B;  3BIN A;  5IJM A;  2DA0 A;  3FM8 C;  2LKO A;  5GOW B;  1OEY J;  1OGW A;  2KWU B;  4GDK B;  2DHZ A;  5TR5 A;  3V62 A;  1GNU A;  2ZVN A;  2L3Z A;  5E6P A;  5LXI B;  5L81 A;  2G35 A;  4ANX A;  4RMA A;  2MDX A;  4DWF A;  2OTX A;  3QK0 A;  4H8S A;  1L7Y A;  2DX1 A;  1UEF A;  2LJ5 A;  4IM0 A;  2N7E A;  4DDG D;  2EMT A;  4EEW A;  5IAA C;  1HB8 A;  2DAJ A;  1XCG A;  2R2O A;  3PHW B;  2J0K A;  2NPT A;  3R7Q A;  3RCZ A;  1J0G A;  3ZKJ C;  2NVU I;  2CHZ A;  2L76 A;  1YQB A;  3H9D A;  2IY0 B;  3ZDM C;  1W1D A;  1TQZ A;  4GMX B;  4MY6 A;  1X86 A;  4K2O A;  2EKE C;  5CTR C;  5DPT A;  3SUZ A;  4HB0 B;  2FCN A;  3ZRF A;  4IM3 A;  1AQC A;  3KYD D;  2KDE B;  4ZYN A;  2BYF A;  3KUC B;  4W9F A;  4HB2 B;  3EFU A;  2IYB A;  1ISN A;  3HK0 A;  3TFM A;  1RLF A;  2IO2 B;  4B6W A;  1ZSQ A;  3R7R A;  2KTR A;  1DDW A;  3DBH I;  1YX5 B;  4W9E A;  2DZM A;  1XQQ A;  4K81 A;  3DXD A;  1WGR A;  4YON A;  3QWM A;  4KHA A;  1WMH A;  2N1W A;  3APF A;  3B08 A;  2DZI A;  3N3K B;  1IP9 A;  2RGN B;  2O2V B;  3UZT A;  2DHJ A;  3DVN V;  3FEH A;  1EF5 A;  1OQN A;  4URK A;  1X1G A;  4BOS C;  4HK2 A;  4A20 A;  3N32 A;  4JL9 A;  1WR1 A;  3M1I B;  5D3V A;  3SV1 A;  4FBJ B;  1P1A A;  2NBW B;  2RR9 A;  4A6F A;  1WX7 A;  4GSW A;  3KRW A;  2KKC A;  1KM7 A;  4E74 A;  1GG3 A;  4GPT B;  2AYO B;  1KOT A;  4ZRI A;  2NBV B;  3A1Q A;  3KVF B;  2NBU A;  3VOQ A;  3TJP A;  1ZVR A;  1GC6 A;  4IC7 B;  2CHW A;  4FJY A;  4MT7 A;  3P2B A;  4BBK A;  1QQG A;  2N1V A;  1XX0 A;  2JXX A;  2Z0Q A;  1DRO A;  1WGH A;  3AU4 A;  4AUQ C;  3ZNI D;  3NY5 A;  2ELA A;  1U5E A;  4F7H A;  4NNJ B;  1I42 A;  2ELB A;  1P9D U;  2W9N A;  3PSE B;  2O6V D;  2CQU A;  2MQJ A;  4F8C B;  5L83 A;  2RVB B;  2JZ3 B;  3W1Y A;  3D8D A;  3D8F A;  5DPR A;  4ZRK A;  1E90 A;  2Z0E B;  3H1U A;  3WAP A;  2KFJ A;  5AEK B;  1BAK A;  2N23 A;  4W9G A;  3PVW A;  1GUA B;  3H7P B;  4GDL A;  1N3H A;  4IWQ A;  5DI9 B;  2JF5 A;  4E71 A;  3H7S A;  3APC A;  1TXD A;  3HW2 B;  3RT3 B;  2DKP A;  2K8C A;  2GCL A;  1VCB A;  5KCV A;  3T8M A;  2CRF A;  3KZ1 A;  1V5M A;  3OLM D;  2W2W A;  2I1K A;  5J3Q A;  2IY1 B;  2KFK A;  5IA7 A;  1PMS A;  3PPA A;  3RUI B;  5FR6 A;  2HE7 A;  3EC8 A;  3SHQ A;  1WJN A;  3UIP B;  1TGZ B;  1Q1O A;  5J2R A;  3AU5 A;  4MGY E;  2BWE S;  3V6E B;  3QA8 A;  4W9J A;  2C7M B;  5D27 A;  4NQL B;  1UPR A;  2RLO A;  1EGX A;  5JLJ B;  2LUL A;  3IFW B;  1H8C A;  1ZM0 A;  3L16 A;  2DX5 A;  4ICV A;  5LON B;  2GS0 A;  2GBM A;  3VTU A;  1PQS A;  2DYN A;  4TKN A;  4C0A A;  1V88 A;  1WGU A;  1VD2 A;  4MEM A;  1WJU A;  3QBV B;  4IW0 A;  2ZPY A;  1NU2 A;  2GMI C;  4OVV A;  3DVG Y;  1SGH A;  5J3T A;  1HBK A;  1M94 A;  2LGX A;  4W9I A;  2GBJ A;  1U4A A;  4NJ6 A;  1ZW7 A;  2G45 B;  3A98 B;  4MSM B;  3UIN B;  3UQB A;  3GYO A;  2BYE A;  3MJW A;  3KY9 A;  2MW5 A;  3OAW A;  2CY4 A;  3ZTD A;  1Y19 B;  2LZ6 A;  2M4N A;  4GOC A;  1V5P A;  3GZN I;  3ODO A;  2V76 A;  3PEG A;  3ULC A;  4WJ7 A;  4NQK E;  3DXE A;  2D9V A;  1WRD B;  1XD3 B;  4M0W B;  4WJN A;  1QC6 A;  2FCS A;  3TBL D;  2LI5 A;  4IAP A;  1U5D A;  3ML9 A;  4KAX B;  4G50 A;  2ROZ B;  1DDM A;  3ZVV A;  3I3T B;  5JHB A;  4A5K A;  1IYF A;  3HM3 A;  5D3X A;  1H10 A;  3NOB A;  2L00 B;  2ZJD A;  1UBI A;  3HHM A;  4WJQ A;  4BOZ B;  2Z0O A;  2FCM A;  1IRS A;  4BKT A;  1WX8 A;  1WZ3 A;  2V3S A;  1P5T A;  1U5F A;  2NZ8 B;  3EPY A;  5C79 A;  2KD0 A;  4IG7 B;  5E6N A;  3AUL A;  4A6F B;  4BKS D;  2FID A;  4LDT B;  3ULB A;  2BKR B;  1GJZ A;  2COD A;  2RGF A;  4HB3 B;  3B0A A;  2LG1 A;  1E8Z A;  4IWP A;  3M62 B;  4E3C A;  2REX A;  1P98 A;  4IWO A;  4RM9 A;  1WZ0 A;  2FUH B;  3VUY A;  3PLV A;  1C3T A;  2Q13 A;  2KO3 A;  2KOX A;  5JP4 A;  1BTN A;  2BGF A;  2XK5 B;  4EFO A;  5DHF B;  2IBI B;  3CSF A;  5FI1 A;  1Q0W B;  3WAL A;  4DBG A;  2KN5 A;  2DLW A;  5CHW A;  3RZF A;  1LB1 A;  4BBN C;  3ZLZ A;  4HHV A;  1X05 A;  2HTH A;  4IUM B;  3ZO5 B;  4F7U P;  2K00 A;  5CLQ B;  2JWZ A;  4KSK C;  1K5G B;  4RM8 A;  5G2N A;  3ZRC A;  4FUL A;  3WYF B;  2L8J A;  4CHM A;  2K8B A;  2DHK A;  2KZR A;  5CX3 A;  3GOE A;  4XZ4 A;  3PGE A;  4A6K A;  3UIO B;  1I7A A;  2YT0 A;  2O2V A;  1J19 A;  5KQ1 A;  3ZTC A;  2PJH A;  2MLB A;  2LVQ A;  2LOZ A;  3PTF C;  2GBN A;  1U2B A;  1MG8 A;  2UWQ A;  2D9X A;  2C5L C;  3DCG A;  3Q3J A;  5C1Z A;  1K5D B;  1FHO A;  5C6R A;  4EUT A;  4HLE A;  4WJP A;  2M0X A;  3U30 A;  5DCN A;  4ZRJ A;  3V6C B;  2W2X D;  4FJZ A;  2C60 A;  3VVW B;  2JRH A;  3PVL A;  3PRE A;  2IZV B;  2Z0D B;  2LBB A;  3TIX A;  3WAM A;  4ANW A;  1ZC4 B;  3A9K A;  1Z5S B;  3RYT A;  1KLV A;  3KRX A;  2O6V B;  4K7S A;  2AEH A;  2I1J A;  2NCN A;  3QWZ B;  3QAR A;  3PSC A;  5L95 C;  3PRM B;  5HE0 A;  1V5U A;  2D9Y A;  2KVR A;  2YLM A;  2CR5 A;  1OQY A;  2DZJ A;  2L0T A;  4NPN A;  1XD4 A;  2KJ6 A;  2DTC A;  3DXC A;  3DBR I;  1P6S A;  2I5C A;  3OJ3 A;  5JHG A;  2KK8 A;  1MIX A;  2PZ1 A;  3CST A;  1EO6 A;  3IBE A;  3K9P B;  5D2M B;  3ZNG C;  3U7D A;  3X23 A;  3SO6 A;  4DBB A;  1WM3 A;  1NTI A;  2RSG A;  4WAA A;  2N4F A;  2KCJ A;  4CYE A;  1KJT A;  5D7G A;  2RNR B;  4MH0 E;  4W9D A;  3SDL C;  3BJI A;  2ZNV C;  2C7N B;  4X57 B;  2MP2 A;  5AZH A;  3DDC B;  3PV1 A;  5E6O A;  4Z2M B;  1TZ1 A;  3KW5 B;  3QCA A;  2KQS A;  4II2 B;  2LRW A;  2R09 A;  4IFS A;  5CHV C;  1P3Q U;  1ST7 A;  4GMV A;  2CY5 A;  1V80 A;  2KTF A;  3JW0 X;  1WXA A;  3PS6 A;  1P3R A;  2GOW A;  1UEL A;  2KDB A;  2LXC A;  5CHF A;  3V61 A;  1S1Q B;  2UYZ B;  2J7Q B;  3F5R A;  1WI1 A;  4L6E A;  3Q3F A;  5KHQ A;  3O96 A;  3MDB C;  2LD9 A;  3AI5 A;  3DOW A;  2D3G A;  3VXW A;  3AJ4 A;  2LGY A;  4J6I A;  3W1S C;  5EDS A;  2G3Q B;  3ML8 A;  1V6E A;  3CMM B;  2JT4 B;  4ICU A;  4KDL B;  4PS7 A;  5BO4 B;  1UBQ A;  2OJR A;  4KHB B;  2KLC A;  1OTR B;  4LDT D;  4PNK A;  3HM6 X;  5CLL B;  3SU8 X;  3JYU A;  2ROV A;  1WVH A;  1TBE A;  4BFR A;  1UNQ A;  2LRU A;  1OEY A;  4DXA B;  1MAI A;  3CIK A;  2GBR A;  1T0Y A;  2KMC A;  2WWZ A;  3L54 A;  3QX1 A;  4MEL A;  5AZG A;  3FP5 A;  1ACA A;  2MKR A;  2VRW B;  1M7E A;  2ADZ A;  1QZE A;  1MIZ B;  1X1M A;  2MCN B;  1SHC A;  1WGQ A;  1A5R A;  1RFA A;  4HWI B;  2DKQ A;  4WVF B;  1LFD A;  2AL3 A;  2GCJ A;  2P0F A;  4Z2N A;  3HQC A;  3ODW A;  3TO1 A;  4HAX B;  4D0N B;  3DQV A;  2J59 M;  3QC8 B;  4WWN A;  5DHA B;  1WE7 A;  3QAQ A;  5D6J B;  4CHK A;  3NHE B;  1R4N I;  1EVH A;  3ML4 A;  4AWJ A;  2ZNV B;  1FAO A;  2ASQ A;  2LAS A;  4KZC A;  4MM3 A;  1WGD A;  3KUD B;  1MK7 B;  3PRP B;  2ZVO A;  4LJP B;  1M7R A;  3PHX B;  2DEN B;  3VQI A;  5C23 A;  1EF1 A;  5HE1 A;  3VTV A;  3HIZ A;  4AP4 C;  2UZR A;  4HDO A;  4KVG B;  2DYQ A;  2M1M A;  3PVU A;  4HJK A;  1ZKH A;  1ZC3 B;  4DHZ B;  1AWE A;  4TV3 A;  4DK5 A;  2A5U A;  5HKH A;  3TCA A;  2CHX A;  3A1Q B;  2W2X C;  3A4R A;  5G55 A;  4ASW C;  3WA0 A;  3W1S A;  2K1F A;  1Y5O A;  1Z87 A;  1YD8 U;  1DYN A;  3D8E A;  2LUE A;  2MBQ A;  4KIK B;  2KXJ A;  1UNR A;  2H7D A;  2CAY A;  2WYQ A;  3JVZ X;  3PRZ A;  4HPM B;  4II3 B;  2FIF A;  2JRI B;  1DBH A;  2RQ1 A;  2COC A;  5LLI A;  4XWX A;  1BWN A;  4HB4 B;  3GYP A;  1AAR A;  1WR6 E;  1XKE A;  2GJY A;  2IO1 B;  2QHO A;  1KZG A;  1V5O A;  3KH0 A;  4M8N A;  5KHO A;  4HVB A;  4EZJ A;  3C0R B;  2NS5 A;  1D3Z A;  1NBF C;  2KDF B;  2HRJ A;  3N7C A;  2DFK A;  2Y7B A;  1Y8R C;  1Z2M A;  1U5G A;  2I5F A;  2P0D A;  5DIF B;  2BKF A;  3N30 A;  4WJO A;  2KUP A;  1FOE A;  1V81 A;  2YS5 A;  3PG7 A;  2NPT B;  2PE6 B;  2N9P C;  1H4R A;  2K25 A;  3BY4 B;  4K1R B;  2DAF A;  3VAW A;  2MBE A;  2N9X A;  3JSV B;  2FJL A;  2MFQ A;  2XBB C;  3ZVR A;  2L7R A;  4JGH B;  4KSL C;  4LJO B;  4W9K A;  2BPS A;  4MJS B;  2MSE D;  1FHW A;  2ZEQ A;  1Q5W B;  2EMS A;  2PE9 A;  4MSQ B;  2WH5 A;  1WGY A;  1WYW B;  3AXC A;  2G4S A;  4FHK A;  3WAN A;  1HB6 A;  3FLV A;  4EKU A;  1UGM A;  4WSF A;  5J3Y A;  1WH3 A;  1WMH B;  5HE3 A;  2YSZ A;  4MDK E;  3RD2 A;  3FSS A;  1WI0 A;  2KWC A;  1UH6 A;  1SIF A;  1RRP B;  1WJM A;  1B55 A;  1FGZ A;  3UQA A;  3KUZ A;  4MGK E;  3VFK A;  1K8R B;  2LVO A;  2M8S A;  2CKH B;  1X11 A;  2YRY A;  4F1S A;  2V1Y A;  2Y8F A;  4MGI E;  1Q67 A;  5C16 A;  3L0W B;  2MA9 B;  2DX5 B;  2ABD A;  3ECI A;  2K2J A;  1I35 A;  1BT0 A;  1RJ2 A;  2BCJ A;  2B3A A;  2K6Q A;  2N7D A;  2XEW A;  4MK0 A;  4Y94 A;  1EUV B;  2A4Z A;  2EJ8 A;  2P8V A;  1R4M I;  4JIO U;  1WJ1 A;  3MPX A;  4HAV B;  2JPH A;  1OMW A;  5EFX A;  2XK5 A;  4I6N B;  1MK9 B;  2Y5B B;  1RRB A;  3ZW3 A;  1W1H A;  4A6H A;  1I2H A;  1LM8 B;  2HD5 B;  2D9Z A;  2LWP A;  4GXB A;  4GZU A;  4GB9 A;  4IM2 A;  2N9E B;  4LCD E;  4CHJ A;  4W9L A;  1WXS A;  3ZNZ B;  2KX0 A;  2RPQ A;  2MWS B;  4XC2 A;  2X18 A;  2KJR A;  1HE8 A;  2COA A;  4YL8 A;  2GBK A;  3D32 A;  4F7Z A;  3PT2 B;  4NSW A;  3APD A;  2KQ7 A;  3LJ3 A;  3VUW A;  1FHX A;  3LJU X;  2D11 A;  5FI0 A;  1SE9 A;  3QIJ A;  1WJ4 A;  3CF6 E;  3DVN U;  1WF9 A;  1FGY A;  4AJW A;  4DHJ B;  1G6J A;  2M17 A;  4NAW B;  4A3O A;  2OQB A;  2Z0P A;  2YF0 A;  4DDI D;  3ONS A;  2ZZP B;  4F7G A;  2K8H A;  3EEC A;  1E5W A;  4GDL B;  4GGQ A;  4BKG A;  4TYZ A;  3NZU A;  4FJV B;  3ZNH B;  4TQ1 A;  4BVU C;  1EAZ A;  1OY2 A;  4FHJ A;  1ZGU B;  1NDD A;  1WJ6 A;  4TUU A;  1LW3 A;  3L17 A;  2FNJ B;  1V49 A;  2KFK B;  1PFJ A;  4G3X B;  1V5T A;  2H7E A;  2CU1 A;  2DHI A;  2EC1 A;  2DYB A;  3L13 A;  1J8C A;  3A4S C;  1PLS A;  4MGZ E;  3V5W A;  1V2Y A;  4W9H A;  4K7W A;  5D94 A;  2DN6 A;  3VIA A;  2KHW B;  2IO0 B;  1CMX B;  2L2I A;  2KC1 A;  4PS3 A;  2V4L A;  3QHT A;  2KDI A;  4DHZ E;  4NY0 A;  3L10 B;  2VRR B;  4NJ7 A;  3O65 B;  1KZ7 A;  2KLG A;  2WX0 A;  2ZPN A;  3IHP C;  1L2N A;  2ZCB A;  4HDQ A;  4N9F 4;  1W1G A;  5C5B A;  4EZL A;  2YVC A;  2BF8 B;  2LXA A;  1GC7 A;  2D9W A;  2IO3 B;  4B95 A;  3VDZ A;  3SNH A;  1JRU A;  2FJ9 A;  3B1L X;  3JSV A;  4FAD A;  4P7I A;  2FAZ A;  2MX2 A;  5KQ4 A;  4ANV A;  2JY6 A;  5JZE B;  2NR2 A;  4WWO A;  4HPL B;  4KHO A;  3A8Q A;  5JHH A;  1J0W A;  1WGG A;  2L05 A;  4GU2 A;  4XX5 A;  5J18 A;  4K17 A;  2LYD A;  3LDZ E;  2YS3 A;  2C7H A;  3F0W A;  2MBO A;  5DPS A;  3S2A A;  3OAN A;  1F9J A;  4W9C A;  4WQO B;  2L1C A;  4HCN B;  1WG7 A;  1E7U A;  3UF8 A;  4ZDV A;  3R3M A;  3A9K B;  1E7V A;  2WX1 A;  5GMV A;  3TVV A;  3VUX A;  3RUL A;  4BKS A;  2BYV E;  3A33 B;  2PPH A;  4GDK A;  3T06 A;  2D2Q A;  4PYU A;  3TMP B;  4EOY A;  2CS4 A;  3KYC D;  5LOP B;  2CB8 A;  3A8P A;  4M8M A;  5C5B B;  2IFS A;  4IOY X;  1E8X A;  5AZF A;  4A3P A;  4FLH A;  2IYD B;  1BTK A;  3M3J A;  3RZW C;  2QKL A;  1UZX B;  2UVM A;  4HCP B;  3SYX A;  2K6D B;  2KJH B;  3VHT C;  3VH3 B;  1UD7 A;  2FCQ A;  1IPG A;  1TTN A;  2J0M A;  2D4Q A;  2NMB A;  3KSY A;  1WXV A;  2D07 B;  2KC2 A;  2KMA A;  2MRP A;  2RSU A;  1NTY A;  4B6H A;  1V86 A;  5DPW A;  2G4D B;  4WWP A;  2BWF A;  1P0R A;  2KTR B;  3DBS A;  1U29 A;  3M63 B;  4GIV A;  2R0D A;  2DYO A;  1TJ6 A;  2COF A;  4GN1 A;  4EZK A;  3PZD A;  3K9O B;  1WXM A;  1XOD A;  3H6N A;  3P6A A;  3EHV A;  1KI1 B;  1YJ1 A;  2JVC A;  2JUO A;  2L0F A;  2Z59 B;  4HAT B;  4HAU B;  2KWV B;  2R2Q A;  4AJY B;  2MBH A;  1WX9 A;  5LXH A;  1X1F A;  4HAZ B;  1MKE A;  4ANU A;  2AL6 A;  3U8Z A;  4HAY B;  3V60 A;  1V89 A;  4G11 A;  2RD0 A;  3DVG X;  3PP2 A;  2YS1 A;  3M95 A;  3NZS A;  4JQW C;  4DX8 A;  3MHS D;  1YIW A;  3SD5 A;  2JZZ A;  2PEA A;  1RAX A;  2N0Y A;  4EMO A;  3H7P A;  4DHJ D;  3OJ4 B;  3G9W A;  2UZS A;  3WIM A;  2K2U A;  4EJN A;  3DPD A;  4NAW A;  4CO7 A;  1NVL A;  1E8Y A;  1S3S G;  2OOB B;  2M14 A;  1V9J A;  1FB8 A;  1NTV A;  2YT1 A; 
#chains in the Genus database with same CATH topology
 3QJZ A;  4KZ0 A;  2Y8G A;  4BBN F;  4HRS A;  5MPO A;  4PT5 A;  4LNI A;  3PLU A;  2WXQ A;  3A9J A;  2HTH B;  2JP2 A;  1KLU D;  1MPH A;  2KYW A;  2LVP A;  2MJD A;  2ON8 A;  4JK7 A;  2IPK D;  1WY8 A;  3LB8 C;  3NS8 A;  1XLN A;  3IG3 A;  2FDQ A;  5GXG B;  5HFY A;  1WIA A;  2E2X A;  3RNB C;  2N7J A;  2VZK B;  1A70 A;  2WDT B;  5LNK 1;  4KDI C;  1STE A;  3DBL I;  3E66 A;  1DOX A;  5C2T B;  4OVU A;  1ZE3 D;  1TS5 A;  3MTN B;  1RYJ A;  4JLC A;  2LUM A;  2COP A;  2PMV A;  2WLB A;  1D5X C;  4I6P A;  5D3W A;  4HAW B;  2DA0 A;  5GOW B;  2KWU B;  3V62 A;  2DHZ A;  5E6P A;  4RMA A;  1SF0 A;  2OTX A;  3QK0 A;  1UEF A;  4EEW A;  2N7E A;  4QAY A;  2I38 A;  1NEK B;  2DAJ A;  1XCG A;  4KX6 B;  3RCZ A;  4N58 A;  3ZKJ C;  2NVU I;  3ZNG C;  1W1D A;  1X86 A;  5CTR C;  3AE3 B;  4A55 A;  3ZQ4 A;  1BXT A;  2BYF A;  3KUC B;  4HB2 B;  2IYB A;  4YT0 B;  4W9E A;  3UZT A;  3V05 A;  2WU5 B;  4HRO A;  2V3P A;  1WR1 A;  3M1I B;  1D4B A;  1E9M A;  2KKC A;  3TEW A;  1VBG A;  3LXF A;  3A1Q A;  1SB3 C;  1JRP A;  1QQR A;  1YN5 A;  4LTU A;  2CHW A;  2PW9 A;  2WXL A;  3E9S A;  1L6V A;  1WSP A;  4MT7 A;  3O13 A;  4BBK A;  1QQG A;  1J7A A;  2N1V A;  1XX0 A;  2Z0Q A;  5D3I B;  3NY5 A;  2ELA A;  1U5E A;  4F7H A;  2JZP A;  2SAK A;  2JZ3 B;  3W1Y A;  3D8F A;  3WAP A;  1E90 A;  1WXQ A;  4KGT A;  3H1U A;  3AE2 B;  3RT3 B;  3T8M A;  4IKG A;  2W2W A;  1EU4 A;  2IY1 B;  3U4E G;  3FIL B;  5IA7 A;  3PPA A;  1TGZ B;  3UI3 A;  5J2R A;  3AU5 A;  1JRO A;  2QCZ A;  2LUL A;  1H8C A;  3L16 A;  3ZXR A;  2GBM A;  2DYN A;  2WXN A;  1WJU A;  2GMI C;  2LGX A;  2WU2 B;  4NJ6 A;  2OJW A;  3GYO A;  3KY9 A;  2MW5 A;  1Y19 B;  2PVO D;  1V5P A;  1OFF A;  2V76 A;  4NQK E;  3DXE A;  4WIP A;  1WRD B;  4HKQ A;  2D5G A;  1QC6 A;  3TBL D;  3ML9 A;  4NJC A;  3SBG A;  3AMZ A;  5JHB A;  4RGO S;  3HM3 A;  5IOI A;  2L00 B;  1QOG A;  1NEN B;  4WJQ A;  4BOZ B;  2BS3 B;  4HJG E;  1IRS A;  2V3S A;  2KD0 A;  3HRD D;  4C7Z A;  1FNU A;  4P1B C;  2RGF A;  2LG1 A;  4JKE A;  1P98 A;  3VUY A;  2WHI A;  1WZ0 A;  2KOX A;  4EFO A;  2XK5 B;  3RI7 C;  5DHF B;  3U52 E;  2DLW A;  2H89 B;  1LB1 A;  4BBN C;  3IT6 B;  1FNW A;  1KFY B;  4IUM B;  3GZN B;  3ZO5 B;  4RM8 A;  4AS1 A;  2IGD A;  3P63 A;  1TKG A;  2L8J A;  2DHK A;  4ZRP A;  4XZ4 A;  1T0Q C;  2O2V A;  4Q2J A;  3AE4 B;  1TS4 A;  2MLB A;  4HSI A;  3PO0 A;  1MG8 A;  3DCG A;  3Q3J A;  2L32 A;  3FIL A;  1VJK A;  2RDG A;  3U30 A;  4ZRJ A;  5HI1 A;  2J53 A;  3PRE A;  3WAM A;  4ANW A;  1GPX A;  1Z5S B;  3KRX A;  1FRR A;  2O6V B;  4K7S A;  2AEH A;  4LLG M;  1V5U A;  2CR5 A;  1OQY A;  1UWM A;  2WXO A;  1CK1 A;  2Y3A A;  4JKG B;  1I7H A;  3J9C A;  3PZ7 A;  1NVI D;  2PZ1 A;  3CST A;  1EO6 A;  1F52 A;  3IBE A;  3K9P B;  1WM3 A;  2N4F A;  3TEZ A;  1KJT A;  2RNR B;  3BJI A;  2C7N B;  3C8Y A;  1JWS D;  2Y5C A;  2LRW A;  4GMV A;  1V80 A;  2GOW A;  2KDB A;  3AEG B;  3V61 A;  3Q8E A;  1L4Z B;  3F5R A;  1WI1 A;  3RNA C;  3O96 A;  3DOW A;  2LGY A;  3DHG C;  4J6I A;  1ET9 A;  3BVG A;  4PS7 A;  3CMM B;  1VZ6 A;  4PNK A;  3HM6 X;  1XLO A;  2MEK A;  2WWZ A;  2GBR A;  1T0Y A;  3NW8 A;  1ACA A;  4O1N A;  1UF0 A;  3QC8 B;  3DQV A;  5D6J B;  3EA6 A;  3MC9 A;  4CHK A;  2KIG A;  2M0A A;  1EVH A;  3ML4 A;  4AWJ A;  1EWC A;  1FAO A;  1WGD A;  1MK7 B;  1DYQ A;  1VR9 A;  2ZVO A;  4N6E B;  1SBB B;  3VTV A;  2CU3 A;  2JXT A;  2UZR A;  1HZ6 A;  2DYQ A;  3PVU A;  5I4D A;  1ZKH A;  3OHM B;  4DK5 A;  4YTP B;  3A1Q B;  3W1S A;  2K1F A;  1Y5O A;  1T0R C;  1V1P B;  1YD8 U;  1RWS A;  4KIK B;  2WYQ A;  3JVZ X;  3W2D A;  4XWX A;  2GJY A;  2IO1 B;  1ROE A;  1V5O A;  3KH0 A;  3C0R B;  4MH8 A;  2NS5 A;  1NBF C;  3N7C A;  4WJO A;  2I5F A;  2P0D A;  1FOE A;  2PE6 B;  2N9P C;  4BKT A;  2EKI A;  4YTM B;  1F2R I;  2MBE A;  2N9X A;  2XBB C;  4JGH B;  1B9R A;  3ZVR A;  1YJI A;  2BPS A;  3AE6 B;  2PE9 A;  1SJE D;  2WH5 A;  1L0Y B;  3AXC A;  4WSF A;  5EE3 A;  4QJ3 B;  1I4R A;  2J42 A;  5HE3 A;  2KWC A;  3ETR A;  1RRP B;  1SE2 A;  3TEY A;  3VFK A;  1K8R B;  3EUB 2;  4MGI E;  1Q67 A;  5C16 A;  3ECI A;  2ABD A;  2K2J A;  3CIR B;  3H8H A;  2XEW A;  2K6Q A;  4Y94 A;  1PFD A;  1OMW A;  2Y5B B;  4LNK A;  1W1H A;  2HD5 B;  3VQI A;  4LCD E;  4GXB A;  3SEB A;  1SJH D;  4W9L A;  2Z59 A;  1KH0 A;  1FPY A;  1HE8 A;  3D32 A;  1WWT A;  5BYS A;  3PT2 B;  3APD A;  3LJ3 A;  1FHX A;  5FI0 A;  3QIJ A;  1FGY A;  2M17 A;  2Z0P A;  2K8H A;  1J7B A;  4KHB A;  1VDV A;  3BVM A;  4TUU A;  1LW3 A;  4L1R A;  2PLP A;  3AEC B;  1V49 A;  4JWS C;  3L13 A;  3A4S C;  3V5W A;  4W9H A;  4K7W A;  2DN6 A;  2KHW B;  3AE1 B;  4PS3 A;  2KC1 A;  4DHZ E;  3MFG A;  2ZPN A;  3IHP C;  1HEZ E;  4RFB A;  4XWW A;  5C5B A;  4EZL A;  2YVC A;  4RGM A;  1PDX A;  3SNH A;  1JRU A;  3NWF A;  4ANV A;  2JY6 A;  2LMC A;  4XX5 A;  4MT5 A;  1WGG A;  4K17 A;  1JML A;  3I57 A;  3OAN A;  3ENB A;  2V9H A;  3BWU D;  4DXF A;  2BYV E;  4GDK A;  4PYU A;  3HSA A;  5LOP B;  3A8P A;  4M8M A;  5C5B B;  2IFS A;  3W5U B;  4GLS C;  1FM0 D;  1UZX B;  4LNN A;  3SYX A;  2K6D B;  4RH6 A;  3VH3 B;  1D6E C;  5IO9 A;  2FCQ A;  1MI0 A;  1TTN A;  5JVL A;  2R82 A;  2RSU A;  4JWU C;  4WWP A;  2BWF A;  3DBS A;  3NWD A;  5D3D A;  4EE2 A;  3HVD A;  3AV8 A;  3K9O B;  4OVZ A;  1CJE A;  3E56 A;  3EHV A;  4ACF A;  2Z59 B;  2L0F A;  2MBH A;  4HAZ B;  1MKE A;  2AL6 A;  4D6W A;  3V60 A;  1V89 A;  2WXH A;  2BT6 A;  2RD0 A;  2YS1 A;  3M95 A;  4DX8 A;  3MHS D;  2JZZ A;  4EMO A;  2AQ2 B;  1K52 A;  2NMQ A;  2M14 A;  2V4I B;  4YSY B;  1XR0 B;  1DDV A;  1V61 A;  3A9J B;  2D3C A;  3IAS 1;  4N59 A;  2AWT A;  5AUI A;  2ONQ A;  2LOX A;  2RDH A;  2KNB A;  4KV2 A;  4DX9 0;  1NI3 A;  2LGS A;  1UPQ A;  3HUI A;  2LEK A;  2M38 A;  1C76 A;  1FXT B;  4B0M A;  3UGB B;  4FN2 A;  3ZIM A;  1XT9 B;  3DWM A;  1N60 A;  4USA A;  4D2K A;  3TW1 A;  1QIL A;  5JH5 C;  4AOF A;  3ODX A;  4HXD A;  3WAO A;  3R66 C;  3ALB A;  2K39 A;  2V3N A;  3BIN A;  3FM8 C;  2TSS A;  1N6Z A;  1GNU A;  2G35 A;  4XYC A;  2MDX A;  4H8S A;  2LJ5 A;  4DDG D;  2QC8 A;  3PHW B;  3N1X C;  2NPT A;  3AE5 B;  1JAL A;  3ZDM C;  1YQB A;  1TQZ A;  5DPT A;  2WXR A;  2KDE B;  4W9F A;  3EFU A;  4B6W A;  2R2Y A;  2IGG A;  3W5V B;  3R7R A;  3DBH I;  1YX5 B;  3NJT A;  1MHX A;  2N1W A;  4K81 A;  3B08 A;  4YON A;  1WMH A;  2DIK A;  4KHA A;  2DHJ A;  3FEH A;  3FVC A;  1OQN A;  1YNT E;  2AQ3 B;  2JSV X;  2W3R A;  4HK2 A;  4JL9 A;  4FBJ B;  4OT1 A;  2NBV A;  5D3V A;  4OW0 A;  1P1A A;  2Z14 A;  3KRW A;  3BK1 A;  4GSW A;  2WXJ A;  4RF0 A;  1V1P A;  2AYO B;  2KN4 A;  3KVF B;  2NBU A;  4FJY A;  1QF6 A;  1WGH A;  4US9 A;  3AU4 A;  1OQQ A;  2ELB A;  1P9D U;  2O6V D;  2CQU A;  5L83 A;  4F8C B;  3D8D A;  5DPR A;  4ZRK A;  2KFJ A;  1BAK A;  4W9G A;  3H7P B;  1GUA B;  3P4P B;  2JF5 A;  3APC A;  1UGJ A;  2DKP A;  1N63 A;  5KCV A;  1VCB A;  2CRF A;  1PGA A;  3OLM D;  2I1K A;  4L1B A;  5FR6 A;  1P7F A;  1WJN A;  1M4V A;  2QEJ C;  2BWE S;  2C7M B;  5D27 A;  4NQL B;  3R2I A;  4YXD B;  5LON B;  2GS0 A;  3VTU A;  3AEA B;  1PQS A;  1V88 A;  1WGU A;  1VD2 A;  4MEM A;  4W9I A;  5FR3 A;  1HBK A;  2GBJ A;  1U4A A;  2UU7 A;  1ZW7 A;  4JKH A;  3A98 B;  3UIN B;  3UQB A;  2CY4 A;  3BYY B;  2LZ6 A;  3PEG A;  2D9V A;  4M0W B;  1UNS A;  2E3T A;  4XGA B;  2LI5 A;  4LK0 M;  3ZVV A;  4A6Q A;  5BYR A;  1H10 A;  3NOB A;  3NRZ A;  3LYY A;  1YJJ A;  1WX8 A;  1P5T A;  5C79 A;  1NYR A;  4NAM A;  5E6N A;  3AUL A;  4A6F B;  4LDT B;  3ULB A;  3B0A A;  3AN1 A;  3M62 B;  2M56 B;  2FJU B;  4RM9 A;  5DPW A;  4ARC A;  2IBI B;  3RZF A;  3ZLZ A;  2H88 B;  4HHV A;  1X05 A;  2HTH A;  1MHH E;  2JWZ A;  5G2N A;  1K5G B;  2IGH A;  1TS3 A;  4CHM A;  2KZR A;  3GOE A;  1F77 A;  3UIO B;  1J19 A;  4JX1 C;  5KQ1 A;  3MHZ A;  2WS3 B;  1U2B A;  2UWQ A;  5C1Z A;  2D9X A;  3Q69 A;  4EUT A;  4HLE A;  1OQR A;  2IZV B;  1ZC4 B;  3RYT A;  4AQ7 A;  3QAR A;  2NCN A;  3MJ5 A;  1D5M C;  3L4P A;  2KVR A;  2DNF A;  4QJ4 B;  2Y5P A;  4B0E A;  1XCT L;  3B2G A;  2KK8 A;  5D2M B;  3U7D A;  4WAA A;  3NVY A;  2KCJ A;  1GAQ B;  4MH0 E;  3DDC B;  1I4P A;  1FXI A;  1FNV A;  3PV1 A;  3Q8B A;  1TZ1 A;  2KQS A;  2N9L A;  2R09 A;  4L2Y A;  3JW0 X;  2EEL A;  1WXA A;  5CHF A;  3VR9 B;  1BML C;  1S1Q B;  1E10 A;  2J7Q B;  3MDB C;  2LD9 A;  2OED A;  3VXW A;  1JWB D;  2G3Q B;  1YN4 A;  1JDE A;  4BAX A;  1C4P A;  1OTR B;  2KWD A;  4LDT D;  4LNO A;  3SU8 X;  1WVH A;  1UNQ A;  2YLM A;  4MEL A;  5AZG A;  2QMT A;  1X1M A;  2MCN B;  3MP9 A;  1SHC A;  1A5R A;  1RM6 C;  2GCJ A;  2P0F A;  4XDD A;  1MVK A;  4HAX B;  5DHA B;  1R4N I;  2ZNV B;  1NYQ A;  1ZDV A;  2ASQ A;  1WGK A;  4KZC A;  2JYE A;  4LJP B;  1IGC A;  4KGR A;  3U12 A;  2JWU A;  3VRB B;  5HE1 A;  3V3X A;  2YEP B;  5HHD G;  4HJK A;  4DHZ B;  5HKH A;  3P4S B;  3WA0 A;  1TS2 A;  2KXJ A;  1T77 A;  1UNR A;  4HPM B;  2FIF A;  2JRI B;  5LLI A;  2RQ1 A;  1AAR A;  1HTO A;  3GYP A;  1WR6 E;  1XKE A;  5KHO A;  1IP9 A;  4EZJ A;  2K0P A;  1KBL A;  2KDF B;  2HRJ A;  2IO0 B;  5L95 C;  2NPT B;  2YS5 A;  3PG7 A;  2X0S A;  1AWD A;  2CJO A;  2K25 A;  3VAW A;  1AN8 A;  4KSL C;  4RF1 A;  4LJO B;  2B76 B;  1LO5 D;  2MSE D;  1FHW A;  2EMS A;  1WGY A;  1WYW B;  4H2A A;  3E9P A;  4FHK A;  3WAN A;  1C77 A;  4C00 A;  1UGM A;  1CZP A;  1WMH B;  1PGX A;  4MDK E;  4NZL B;  3FSS A;  1UH6 A;  1WJM A;  4C4V B;  1FGZ A;  3UQA A;  1HTQ A;  1X11 A;  2YRY A;  4F1S A;  2V1Y A;  2BQQ A;  1L0V B;  3N1Z C;  1I35 A;  2B3A A;  1QKZ A;  4MK0 A;  1EUV B;  2A4Z A;  4K3B A;  3MPX A;  4I6N B;  2WNM A;  1MK9 B;  1I2H A;  1LM8 B;  4IM2 A;  1WXS A;  2RPQ A;  5FKA C;  4C80 A;  2JU6 X;  4F7Z A;  2COA A;  4JKC A;  3RN9 C;  1KF6 B;  1AYF A;  1MPE A;  3CF6 E;  4REZ A;  4A3O A;  3ABV B;  4CSQ A;  4IDI A;  3EEC A;  4F7G A;  1JWA D;  1E5W A;  4GDL B;  4TYZ A;  3ZNH B;  1EAZ A;  1DGJ A;  1MJD A;  1OY2 A;  1NDD A;  2FNJ B;  4G3X B;  1V5T A;  4J3O D;  2DYB A;  1J8C A;  2IND C;  1C79 A;  3QHT A;  2KDI A;  4P1C C;  3AM9 A;  3Q14 C;  2WX0 A;  2ZCB A;  4HDQ A;  1TT5 B;  2BF8 B;  1QT9 A;  4FAD A;  2FAZ A;  2QJL A;  5KQ4 A;  2Z4D A;  2BS4 B;  2NR2 A;  4ZDV A;  4HPL B;  3A8Q A;  5JHH A;  1T0S C;  5J18 A;  1ENF A;  2C7H A;  3F0W A;  2AX5 A;  2MBO A;  3S2A A;  1YN3 A;  4W9C A;  4RCO A;  1WG7 A;  3UF8 A;  3MC0 B;  3TVV A;  3VUX A;  3A33 B;  3T06 A;  2D2Q A;  4EOY A;  2CS4 A;  4ARI A;  3NUH B;  4JKF A;  4IOY X;  1E8X A;  2GI9 A;  2K22 A;  2IYD B;  2QKL A;  4HCP B;  5C3J B;  4ZOH C;  5FK9 C;  1IPG A;  3ZJU A;  2J0M A;  2D4Q A;  2WDV B;  2NMB A;  3KSY A;  1V86 A;  2G4D B;  3WAL A;  1P0R A;  2QDF A;  1U29 A;  2R0D A;  2DYO A;  2COF A;  4GN1 A;  3NVZ A;  3EFC A;  3GE3 C;  3WCQ A;  1KI1 B;  2JVC A;  1TY2 A;  2KWV B;  2R2Q A;  1WX9 A;  1VBH A;  4HAY B;  1N61 A;  4G11 A;  3NZS A;  1YIW A;  1RAX A;  4DHJ D;  2K2U A;  4EJN A;  4CO7 A;  1ZGU B;  3FKY A;  2YT1 A;  3I63 C;  2M19 A;  4QXA B;  1KTK A;  1YX6 B;  4WJP A;  1I4H A;  2MJ3 A;  3ZUN A;  2RUK B;  2KGX B;  5E6J A;  2HJ8 A;  2KX3 A;  1E8W A;  2DYM A;  2BTE A;  3P7Z A;  3L08 A;  5I2S A;  1U27 A;  5D3Y A;  2C9W B;  1IBX A;  3CXB B;  4K2P A;  4MJS A;  2ZCC A;  4JKB A;  2VSZ A;  5JHA A;  2MWN B;  2P0H A;  1JCK B;  3TL5 A;  1C4A A;  1FRD A;  1C1Y B;  1J7C A;  2MBB B;  2KAN A;  2O6V A;  1QOA A;  1FCL A;  2XQN M;  4K7U A;  4PQ0 A;  2IDY A;  1CQV A;  3ENE A;  3ZDT A;  2SEB D;  2VZK D;  4I6L B;  4BZA A;  2J0J A;  4DXG A;  3HVZ A;  4GDK B;  2LKO A;  3VRA B;  5LXI B;  5L81 A;  4DWF A;  4IM0 A;  2DX1 A;  1PYW D;  5IAA C;  3ZYY X;  1HB8 A;  1J0G A;  3ZXV A;  1FXA A;  2R61 A;  3Q3O C;  1R4N B;  2L76 A;  3H9D A;  2IY0 B;  2PKO A;  4GMX B;  2JQR B;  3TJP A;  2EKE C;  4K2O A;  3SUZ A;  4HB0 B;  3ZJT A;  2KR0 A;  3KYD D;  3DHH C;  1DDW A;  2DZM A;  1XQQ A;  3Q3N C;  1WGR A;  3RMK C;  4OSN A;  3APF A;  1JWU D;  2RGN B;  2O2V B;  3DVN V;  2DLB A;  1EF5 A;  4A20 A;  3Q8F A;  3SV1 A;  1WYG A;  1VZ7 A;  3AE7 B;  2RR9 A;  4A6F A;  1WX7 A;  1GG3 A;  4WWM A;  1P7E A;  3VOQ A;  1ZVR A;  4IC7 B;  1MI1 A;  3P4R B;  3P2B A;  1FCC C;  2JXX A;  1DRO A;  2QIL A;  1UWX A;  4AUQ C;  4S0R A;  4NNJ B;  3PSE B;  4ILG B;  3TSS A;  3PVW A;  4GDL A;  1N3H A;  3H7S A;  1TXD A;  1IUE A;  2K8C A;  3FAH A;  3IT4 B;  3KZ1 A;  4KGS A;  5BYQ A;  1SE4 A;  4P6V F;  3RUI B;  3SHQ A;  3EC8 A;  2RRF A;  4MGY E;  1JQ4 A;  1VZ8 A;  4TSS A;  1UPR A;  1EGX A;  2Z13 A;  5HG2 A;  1ZM0 A;  1MFW A;  3R8B A;  4ICV A;  4TKN A;  4C0A A;  1N5W A;  3BZD B;  3QBV B;  4IW0 A;  2ZPY A;  1NU2 A;  4CQN A;  1SGH A;  5J3T A;  1I4G A;  1M94 A;  5M4Y B;  3MJW A;  3OAW A;  5BMG A;  3RNF C;  2M4N A;  4GOC A;  5EE9 A;  1ZXH A;  2BYT A;  1V8C A;  3P4Q B;  4TMA B;  1SSN A;  3ULC A;  2X8X X;  3E9L A;  2ICI A;  2WXG A;  1XD3 B;  3IAM 1;  2FCS A;  4IAP A;  4KAX B;  2Z8L A;  4G50 A;  2ROZ B;  1DDM A;  5D3X A;  2ZJD A;  1UBI A;  3HHM A;  1T5X D;  2FCM A;  4S17 A;  2NZ8 B;  1KLG D;  4BKS D;  2KDM A;  1YQ4 B;  3ZGZ A;  2VH1 A;  3SBT A;  2PVG C;  4JE3 B;  2BKR B;  2COD A;  2ZW0 A;  4IWP A;  4A90 A;  4E3C A;  2REX A;  3PLV A;  2Q13 A;  5JP4 A;  1BTN A;  2BGF A;  2J4X A;  1Y56 A;  4F7U P;  4MM3 B;  3P42 A;  4FUL A;  3WYF B;  2K8B A;  5CX3 A;  1EWY C;  3N1Y C;  3GP7 A;  4A6K A;  2E6X A;  2YT0 A;  1FMA D;  3ZTC A;  2PJH A;  2KUQ A;  3R2T A;  2K3U A;  3PTF C;  2GBN A;  4HPP A;  1D5Z C;  1K5D B;  1FHO A;  5C6R A;  1ZP0 B;  3RFZ B;  2HTM E;  2M0X A;  5DCN A;  3V6C B;  5IP4 D;  2XN9 C;  3VVW B;  3PVL A;  2Z0D B;  2LBB A;  3TIX A;  1KLV A;  4LNF A;  3QWZ B;  3PSC A;  4PK1 A;  3AE8 B;  5HE0 A;  3Q8C A;  2JX5 A;  3IXS A;  4NPN A;  4RNA A;  1GOZ A;  2DTC A;  3DBR I;  1P6S A;  3OJ3 A;  1MIX A;  2LGI A;  3X23 A;  3SO6 A;  1NTI A;  2NTT A;  4CYE A;  3C19 A;  3SDL C;  1DOY A;  3GE8 C;  2ZNV C;  4X57 B;  4C7Y A;  2MP2 A;  2W55 A;  3QCA A;  4II2 B;  4IFS A;  1P3Q U;  1ST7 A;  1P3R A;  2LXC A;  2WDR B;  3Q3F A;  2YT2 A;  2FE8 A;  4ZRQ A;  3W1S C;  5EDS A;  3HIE A;  4QJ5 B;  5BO4 B;  1V6E A;  4KDL B;  1GB4 A;  1UBQ A;  2OJR A;  4KHB B;  2KLC A;  3BVZ A;  4BFR A;  1RFK A;  1OEY A;  4DXA B;  3L54 A;  3CIK A;  2KMC A;  3OWE B;  3QX1 A;  1M7E A;  2ADZ A;  1MIZ B;  1WGQ A;  1RFA A;  4HWI B;  2DKQ A;  1LFD A;  4D0N B;  3O65 B;  3TO1 A;  2J59 M;  1WE7 A;  3GB1 A;  2LAS A;  4MM3 A;  3KUD B;  3PRP B;  1XEE A;  5LG4 B;  3PHX B;  2DEN B;  5EE0 A;  5C23 A;  3HIZ A;  1ZC3 B;  2W54 A;  1EM7 A;  2CHX A;  2MJE A;  3AED B;  2LUE A;  1Z87 A;  1DYN A;  2L1A A;  2MBQ A;  4OZC A;  5BMH A;  1BWN A;  2W3S A;  4WQM A;  2QHO A;  4HVB A;  3B9J A;  2Y7B A;  3N30 A;  1U5G A;  2BBC A;  3BY4 B;  3Q6B A;  1H4R A;  2DAF A;  3JSV B;  4XDC A;  2KT7 A;  1EU3 A;  1L4D B;  1Q5W B;  3A58 A;  1L6U A;  1XO3 A;  4ZHP A;  1HB6 A;  3FLV A;  5J3Y A;  1ZDX A;  1ZPS A;  2YSZ A;  3RD2 A;  1WI0 A;  1YOV B;  4ZHO A;  4MGK E;  1B1Z A;  2LVO A;  2HDE A;  2K9X A;  2Y8F A;  2MA9 B;  2DX5 B;  3T3N A;  2WXK A;  2BCJ A;  2EJ8 A;  2P8V A;  1R4M I;  1N62 A;  4HAV B;  2XK5 A;  5EFX A;  2HJ1 A;  1RRB A;  2LWP A;  4GZU A;  2N9E B;  4CHJ A;  3ZNZ B;  3NVW A;  2MWS B;  1HQR D;  2KQ7 A;  3VUW A;  2IJ0 A;  3LJU X;  1WJ4 A;  2D11 A;  1F2R C;  4DHJ B;  1WF9 A;  1G6J A;  2BB5 A;  3N9Y C;  2OQB A;  2YF0 A;  3ONS A;  4GGQ A;  3B2F A;  4TQ1 A;  4BVU C;  2WXP A;  1WJ6 A;  1SE3 A;  3L17 A;  2KFK B;  3DBL B;  2H7E A;  2CU1 A;  2KMM A;  1PLS A;  4MGZ E;  3VIA A;  1CMX B;  3P1M A;  4RGN A;  4NY0 A;  2VRR B;  4JKG A;  1I4Q A;  2KLG A;  2NTS A;  1QOB A;  2LXA A;  2D9W A;  4B95 A;  4YWG G;  1PGB A;  3B1L X;  4P7I A;  2MX2 A;  1V97 A;  5JZE B;  2GB1 A;  4KHO A;  1J0W A;  2YS3 A;  1GB1 A;  2L1C A;  4HCN B;  5TSS A;  3A9K B;  1C4C A;  2N0S B;  1BUI C;  2CB8 A;  5AZF A;  2RDB C;  4FLH A;  1BTK A;  3M3J A;  3RZW C;  2UVM A;  1ZUD 2;  2KJH B;  3VHT C;  3B77 A;  1UD7 A;  1SXT A;  2D07 B;  2FUG 1;  2MRP A;  5BMI A;  3FC4 A;  2YEP F;  4B6H A;  2KTR B;  3M63 B;  1TJ6 A;  3PZD A;  1L5P A;  3H6N A;  4M0W A;  2JUO A;  4HAT B;  2KVZ A;  4ANU A;  3U8Z A;  5EE1 A;  4C4V A;  3DVG X;  3PP2 A;  1UUP A;  4JQW C;  3SD5 A;  3H7P A;  3OJ4 B;  2L83 A;  3G9W A;  2UZS A;  4JPS A;  3WIM A;  1WRI A;  1SIJ A;  2ZKM X;  1NVL A;  1E8Y A;  1C9F A;  3EGR A;  1V9J A;  3KUZ A;  4PS8 A;  1WM2 A;  3IVF A;  1LXD A;  1NI2 A;  4G0N B;  3PZ8 A;  1LGR A;  3VH4 B;  4TQ0 A;  4KIK A;  4WH4 A;  4PYZ A;  4FXC A;  5HE2 A;  3QQ8 B;  5AUK A;  2LGD A;  2QKM A;  1HZ5 A;  1F1H A;  1WE6 A;  2KAC A;  5J17 A;  3VTW A;  1LQB A;  3Q2A C;  3NSU A;  3RCP A;  1WFY A;  2K5P A;  3AH7 A;  2DZK A;  3X0W A;  3T9L A;  3AEB B;  1UNP A;  5DH9 B;  5G5G A;  2D10 A;  2MP2 B;  4YTN B;  4FA6 A;  2VKI A;  4B9K A;  2ACZ B;  5IJM A;  1OEY J;  1OGW A;  5TR5 A;  2ZVN A;  2L3Z A;  3DBR B;  4ANX A;  1TY0 A;  1L7Y A;  3NVV A;  2EMT A;  2XNA C;  2R2O A;  2J0K A;  3R7Q A;  2V0G A;  1QLB B;  2CHZ A;  1MG4 A;  3ZNI D;  4MY6 A;  2FCN A;  4OZB A;  3ZRF A;  4IM3 A;  1AQC A;  1F0Z A;  4RGT A;  4ZYN A;  5JXV A;  2FBW B;  3HK0 A;  1ISN A;  3TFM A;  1RLF A;  2IO2 B;  2KAJ A;  1ZSQ A;  2KTR A;  2X38 A;  3TEX A;  3DXD A;  4GNK B;  2WXF A;  3QWM A;  2CJN A;  2KQ4 X;  2DZI A;  3N3K B;  1XLQ A;  3RNE C;  4URK A;  1X1G A;  3N32 A;  2RMM A;  2NBW B;  1KM7 A;  4E74 A;  3AE9 B;  2BW2 A;  4GPT B;  1KOT A;  4ZRI A;  2NBV B;  1GC6 A;  1FEH A;  2ZW1 A;  3T3O A;  3E9O A;  2AQ1 B;  1FIQ A;  2D3A A;  1I42 A;  2INC C;  1JW9 D;  2W9N A;  4HEA 1;  4IOI E;  5H92 C;  2MQJ A;  2RVB B;  2Z0E B;  5AEK B;  1XXG A;  2N23 A;  1IGD A;  4IWQ A;  4E71 A;  5DI9 B;  2WP9 B;  3HW2 B;  5I2M A;  1YQ3 B;  2GCL A;  1GGO A;  3NZ3 A;  1V5M A;  1DOI A;  2KFK A;  5J3Q A;  5IN7 A;  1PMS A;  2HE7 A;  3UIP B;  1L0X B;  1Q1O A;  3V6E B;  3QA8 A;  4W9J A;  2RLO A;  5JLJ B;  3IFW B;  2JYT A;  2DX5 A;  2INP E;  1PUT A;  3DWG C;  4OVV A;  4BOS C;  3DVG Y;  3CWI A;  1TZO A;  2G45 B;  4MSM B;  4M01 A;  2BYE A;  3ZTD A;  2W82 A;  3GZN I;  3ODO A;  3I9V 1;  4WJ7 A;  3AB5 A;  3Q3M C;  4WJN A;  1U5D A;  3I5J C;  1E0Z A;  3I3T B;  1IYF A;  4GOU A;  4A5K A;  3VR8 B;  5T8I A;  2Z0O A;  1WZ3 A;  1U5F A;  3EPY A;  4IG7 B;  1ET6 A;  1ZYI A;  2FID A;  1XCQ L;  1GJZ A;  4HB3 B;  1E8Z A;  3URY A;  4IWO A;  1C3T A;  2FUH B;  2KO3 A;  4ILH A;  1XF5 L;  3CSF A;  4DBG A;  5FI1 A;  1Q0W B;  2KN5 A;  2RPV A;  2K00 A;  5CLQ B;  4KSK C;  3ZRC A;  4C56 C;  3U7Z A;  3PGE A;  1I7A A;  3ZJV A;  2LVQ A;  2LOZ A;  2BS2 B;  2C5L C;  2BB6 A;  2K8E A;  2W2X D;  4FJZ A;  2C60 A;  2JRH A;  3A9K A;  2GLS A;  3BYT B;  2WXI A;  2I1J A;  4OHJ A;  3PRM B;  2DWQ A;  1FFV A;  3RNC C;  2D9Y A;  1DIK A;  2DZJ A;  2L0T A;  4ILJ A;  5G5H A;  2GUM A;  1XD4 A;  2KJ6 A;  4A8X C;  3DXC A;  3BK2 A;  2I5C A;  1HA5 A;  2PTL A;  5JHG A;  3KWL A;  1V1O A;  4R3D A;  4DBB A;  1VRA B;  2MH7 A;  2RSG A;  5D7G A;  4W9D A;  4HKZ E;  5AZH A;  5E6O A;  4Z2M B;  3KW5 B;  5CHV C;  2KTF A;  2CY5 A;  3PS6 A;  1TYG B;  2Q5W D;  1UEL A;  1K53 A;  3DBH B;  2L52 A;  2UYZ B;  5KHQ A;  4L6E A;  3AI5 A;  2D3G A;  3TUO A;  3AJ4 A;  4JK8 A;  3ML8 A;  4ICU A;  2JT4 B;  4YSX B;  3DCX A;  4JK9 A;  5CLL B;  3JYU A;  2ROV A;  1TBE A;  1ZXI A;  2LRU A;  2GRI A;  1MAI A;  2MHJ A;  3FP5 A;  2VRW B;  2MKR A;  5IRS A;  1QZE A;  1T6B X;  4WVF B;  2AL3 A;  3NS1 A;  4Z2N A;  4WWN A;  3HQC A;  3ODW A;  1JWM D;  3QAQ A;  3NHE B;  1Q10 A;  2BVC A;  4KKJ A;  1M7R A;  2J52 A;  1ESF A;  4AP4 C;  1EF1 A;  4KVG B;  4HDO A;  2G9H D;  4P16 A;  2M1M A;  1AWE A;  4TV3 A;  3W9C B;  2QSD A;  2A5U A;  3TCA A;  5G55 A;  3A4R A;  2W2X C;  4ASW C;  1ACC A;  3D8E A;  2K49 A;  3RPF C;  2H7D A;  2CAY A;  3PRZ A;  4II3 B;  1DBH A;  2COC A;  2N9K A;  4HB4 B;  4M8N A;  1KZG A;  4DQO C;  1K51 A;  1D3Z A;  5CHW A;  2DFK A;  1Z2M A;  5GMV A;  1Y8R C;  2BKF A;  5DIF B;  2KUP A;  1V81 A;  4FJV B;  4K1R B;  4US8 A;  2FJL A;  2MFQ A;  1ZOY B;  4JKD A;  2L7R A;  4KKI A;  4W9K A;  3SFD B;  4MJS B;  3AEE B;  2ZEQ A;  4MSQ B;  1I4X A;  2G4S A;  4EKU A;  2D3B A;  1WH3 A;  1KRH A;  4L23 A;  2DBY A;  3BII D;  1C78 A;  1SIF A;  1B55 A;  4A9A A;  2WGS A;  2M8S A;  2CKH B;  4ZYS A;  2LFI A;  3L0W B;  3NWA A;  1RJ2 A;  1BT0 A;  2N7D A;  2INN E;  1AW7 A;  4JIO U;  1WJ1 A;  2JPH A;  3RNG C;  1E7P B;  3ZW3 A;  4A6H A;  2LHD A;  4GB9 A;  2D9Z A;  1YMH E;  3SR6 A;  2KX0 A;  4XC2 A;  2PIA A;  2X18 A;  2KJR A;  4YL8 A;  2GBK A;  2VH2 A;  3KQ4 A;  4NSW A;  1IBX B;  1HXY D;  1SE9 A;  3DVN U;  4AJW A;  4NAW B;  4DDI D;  2ZZP B;  3DHI C;  4BKG A;  4OZA A;  3NZU A;  1FD6 A;  1R4M B;  4FHJ A;  1TKE A;  2LHE A;  3N20 C;  1PFJ A;  4M02 A;  2DHI A;  2EC1 A;  1TIF A;  1V2Y A;  5D94 A;  1QOF A;  2L2I A;  2V4L A;  3L10 B;  4NJ7 A;  1VLB A;  1KZ7 A;  2WDQ B;  1L2N A;  4N9F 4;  1W1G A;  2I2Y A;  2G1E A;  3NG0 A;  1GC7 A;  2WQY B;  2IO3 B;  3VDZ A;  2LJI A;  2FJ9 A;  3JSV A;  4WUR A;  1KC7 A;  1T3Q A;  3KWV A;  4JKA A;  4WWO A;  3Q8A A;  4YSZ B;  2L05 A;  4GU2 A;  2LYD A;  3LDZ E;  2WXM A;  5DPS A;  1F9J A;  4WQO B;  1E6E B;  1E7U A;  1R7S A;  4ITK A;  2KIE A;  3R3M A;  1E7V A;  2WX1 A;  4BKS A;  3RUL A;  1TKY A;  3TMP B;  2PPH A;  1TJE A;  3KYC D;  4UDU C;  4K3C A;  4A3P A;  3GS2 A;  1K50 A;  4MAC A;  2KC2 A;  1N5X A;  2KMA A;  1WXV A;  3KLS X;  1NTY A;  4DIX A;  1XLP A;  4M00 A;  1SEB D;  4GIV A;  4XE0 A;  4EZK A;  3U2S C;  2QIE B;  1WXM A;  5IKC M;  1XOD A;  3P6A A;  1YJ1 A;  2OHF A;  4HAU B;  1FFU A;  4AJY B;  5LXH A;  1X1F A;  3SFE B;  1FO4 A;  4WAF A;  3MC8 A;  2PEA A;  2N0Y A;  5H8Y E;  3AEF B;  3DPD A;  3OG5 A;  4NAW A;  4XWT A;  1S3S G;  2OOB B;  1FB8 A;  1NTV A; 
#chains in the Genus database with same CATH homology
 3QJZ A;  4KZ0 A;  2Y8G A;  4BBN F;  3PLU A;  3A9J A;  2HTH B;  2JP2 A;  1MPH A;  2LVP A;  4JK7 A;  1WY8 A;  3NS8 A;  3IG3 A;  2FDQ A;  1WIA A;  2E2X A;  2WDT B;  4KDI C;  3DBL I;  3E66 A;  4OVU A;  3MTN B;  4JLC A;  2COP A;  4I6P A;  5D3W A;  4HAW B;  2DA0 A;  5GOW B;  2KWU B;  3V62 A;  2DHZ A;  5E6P A;  4RMA A;  2OTX A;  3QK0 A;  1UEF A;  4EEW A;  2N7E A;  2DAJ A;  1XCG A;  3RCZ A;  3ZKJ C;  2NVU I;  3ZNG C;  1W1D A;  1X86 A;  5CTR C;  2BYF A;  3KUC B;  4HB2 B;  2IYB A;  4W9E A;  3UZT A;  1WR1 A;  3M1I B;  2KKC A;  1VBG A;  3A1Q A;  2CHW A;  4MT7 A;  4BBK A;  1QQG A;  2N1V A;  1XX0 A;  2Z0Q A;  3NY5 A;  2ELA A;  1U5E A;  4F7H A;  2JZ3 B;  3W1Y A;  3D8F A;  3WAP A;  1E90 A;  3H1U A;  3RT3 B;  3T8M A;  2W2W A;  2IY1 B;  5IA7 A;  3PPA A;  1TGZ B;  5J2R A;  3AU5 A;  2LUL A;  1H8C A;  3L16 A;  2GBM A;  2DYN A;  1WJU A;  2GMI C;  2LGX A;  4NJ6 A;  3GYO A;  3KY9 A;  2MW5 A;  1Y19 B;  1V5P A;  2V76 A;  4NQK E;  3DXE A;  1WRD B;  1QC6 A;  3TBL D;  3ML9 A;  3SBG A;  5JHB A;  3HM3 A;  2L00 B;  4WJQ A;  4BOZ B;  1IRS A;  2V3S A;  2KD0 A;  2RGF A;  2LG1 A;  4JKE A;  1P98 A;  3VUY A;  1WZ0 A;  2KOX A;  4EFO A;  2XK5 B;  5DHF B;  2DLW A;  4BBN C;  1LB1 A;  4IUM B;  3ZO5 B;  4RM8 A;  2L8J A;  2DHK A;  4XZ4 A;  2O2V A;  2MLB A;  1MG8 A;  3DCG A;  3Q3J A;  3U30 A;  4ZRJ A;  3PRE A;  3WAM A;  4ANW A;  1Z5S B;  3KRX A;  2O6V B;  4K7S A;  2AEH A;  1V5U A;  2CR5 A;  1OQY A;  4JKG B;  2PZ1 A;  3CST A;  1EO6 A;  3IBE A;  3K9P B;  1WM3 A;  2N4F A;  1KJT A;  2RNR B;  3BJI A;  2C7N B;  2LRW A;  4GMV A;  1V80 A;  2GOW A;  2KDB A;  3V61 A;  3F5R A;  1WI1 A;  3O96 A;  3DOW A;  2LGY A;  4J6I A;  4PS7 A;  3CMM B;  4PNK A;  3HM6 X;  2WWZ A;  2GBR A;  1T0Y A;  1ACA A;  3QC8 B;  3DQV A;  5D6J B;  4CHK A;  1EVH A;  3ML4 A;  4AWJ A;  1FAO A;  1WGD A;  1MK7 B;  2ZVO A;  3VTV A;  2UZR A;  2DYQ A;  3PVU A;  1ZKH A;  4DK5 A;  3A1Q B;  3W1S A;  2K1F A;  1Y5O A;  1YD8 U;  4KIK B;  2WYQ A;  3JVZ X;  4XWX A;  2GJY A;  2IO1 B;  1V5O A;  3KH0 A;  3C0R B;  2NS5 A;  1NBF C;  3N7C A;  4WJO A;  2I5F A;  2P0D A;  1FOE A;  2PE6 B;  2N9P C;  4BKT A;  2MBE A;  2N9X A;  2XBB C;  4JGH B;  3ZVR A;  2BPS A;  2PE9 A;  2WH5 A;  3AXC A;  4WSF A;  5HE3 A;  2KWC A;  1RRP B;  3VFK A;  1K8R B;  4MGI E;  1Q67 A;  5C16 A;  3ECI A;  2ABD A;  2K2J A;  2XEW A;  2K6Q A;  4Y94 A;  1OMW A;  2Y5B B;  3VQI A;  1W1H A;  2HD5 B;  4LCD E;  4GXB A;  4W9L A;  1HE8 A;  3D32 A;  3PT2 B;  3APD A;  3LJ3 A;  1FHX A;  5FI0 A;  3QIJ A;  1FGY A;  2M17 A;  2Z0P A;  2K8H A;  4TUU A;  1LW3 A;  1V49 A;  3L13 A;  3A4S C;  3V5W A;  4W9H A;  4K7W A;  2DN6 A;  2KHW B;  4PS3 A;  2KC1 A;  4DHZ E;  2ZPN A;  3IHP C;  5C5B A;  4EZL A;  2YVC A;  3SNH A;  1JRU A;  4ANV A;  2JY6 A;  4XX5 A;  1WGG A;  4K17 A;  3OAN A;  3ENB A;  2BYV E;  4GDK A;  4PYU A;  5LOP B;  3A8P A;  4M8M A;  5C5B B;  2IFS A;  1UZX B;  3SYX A;  2K6D B;  3VH3 B;  2FCQ A;  1TTN A;  5JVL A;  2R82 A;  2RSU A;  4WWP A;  2BWF A;  3DBS A;  3K9O B;  3EHV A;  2Z59 B;  2L0F A;  2MBH A;  4HAZ B;  1MKE A;  2AL6 A;  3V60 A;  1V89 A;  2RD0 A;  2YS1 A;  3M95 A;  4DX8 A;  3MHS D;  2JZZ A;  4EMO A;  2M14 A;  1XR0 B;  1DDV A;  1V61 A;  3A9J B;  2AWT A;  2LOX A;  2KNB A;  4KV2 A;  4DX9 0;  1UPQ A;  2M38 A;  1FXT B;  3UGB B;  4FN2 A;  3ZIM A;  1XT9 B;  3TW1 A;  5JH5 C;  4AOF A;  3ODX A;  4HXD A;  3WAO A;  3R66 C;  3ALB A;  2K39 A;  3BIN A;  3FM8 C;  1GNU A;  2G35 A;  2MDX A;  4H8S A;  2LJ5 A;  4DDG D;  3PHW B;  2NPT A;  3ZDM C;  1YQB A;  1TQZ A;  5DPT A;  2KDE B;  4W9F A;  3EFU A;  4B6W A;  3R7R A;  3DBH I;  1YX5 B;  2N1W A;  4K81 A;  3B08 A;  4YON A;  1WMH A;  2DIK A;  4KHA A;  2DHJ A;  3FEH A;  1OQN A;  4HK2 A;  4JL9 A;  4FBJ B;  5D3V A;  1P1A A;  4GSW A;  3KRW A;  2AYO B;  3KVF B;  2NBU A;  4FJY A;  1WGH A;  3AU4 A;  2ELB A;  1P9D U;  2O6V D;  2CQU A;  5L83 A;  4F8C B;  3D8D A;  5DPR A;  4ZRK A;  2KFJ A;  1BAK A;  4W9G A;  3H7P B;  1GUA B;  2JF5 A;  3APC A;  2DKP A;  1VCB A;  5KCV A;  2CRF A;  3OLM D;  2I1K A;  5FR6 A;  1WJN A;  2BWE S;  2C7M B;  5D27 A;  4NQL B;  5LON B;  2GS0 A;  3VTU A;  1PQS A;  1V88 A;  1WGU A;  1VD2 A;  4MEM A;  4W9I A;  1HBK A;  2GBJ A;  1U4A A;  1ZW7 A;  4JKH A;  3A98 B;  3UIN B;  3UQB A;  2CY4 A;  2LZ6 A;  3PEG A;  2D9V A;  4M0W B;  2LI5 A;  3ZVV A;  1H10 A;  3NOB A;  1WX8 A;  1P5T A;  5C79 A;  5E6N A;  3AUL A;  4A6F B;  4LDT B;  3ULB A;  3B0A A;  3M62 B;  4RM9 A;  5DPW A;  2IBI B;  3RZF A;  3ZLZ A;  4HHV A;  1X05 A;  2HTH A;  2JWZ A;  5G2N A;  1K5G B;  4CHM A;  2KZR A;  3GOE A;  3UIO B;  1J19 A;  5KQ1 A;  1U2B A;  2UWQ A;  5C1Z A;  2D9X A;  4EUT A;  4HLE A;  2IZV B;  1ZC4 B;  3RYT A;  3QAR A;  2NCN A;  2KVR A;  2KK8 A;  5D2M B;  3U7D A;  4WAA A;  2KCJ A;  4MH0 E;  3DDC B;  3PV1 A;  1TZ1 A;  2KQS A;  2R09 A;  3JW0 X;  1WXA A;  5CHF A;  1S1Q B;  2J7Q B;  3MDB C;  2LD9 A;  3VXW A;  2G3Q B;  1JDE A;  1OTR B;  4LDT D;  3SU8 X;  1WVH A;  2YLM A;  1UNQ A;  4MEL A;  5AZG A;  1X1M A;  2MCN B;  1SHC A;  1A5R A;  2GCJ A;  2P0F A;  4HAX B;  5DHA B;  1R4N I;  2ZNV B;  2ASQ A;  4KZC A;  4LJP B;  5HE1 A;  4HJK A;  4DHZ B;  5HKH A;  3WA0 A;  2KXJ A;  1UNR A;  4HPM B;  2FIF A;  2JRI B;  5LLI A;  2RQ1 A;  1AAR A;  3GYP A;  1IP9 A;  1WR6 E;  1XKE A;  5KHO A;  4EZJ A;  1KBL A;  5L95 C;  2HRJ A;  2KDF B;  2IO0 B;  2NPT B;  2YS5 A;  3PG7 A;  3VAW A;  2X0S A;  2K25 A;  4KSL C;  4LJO B;  2MSE D;  1FHW A;  2EMS A;  1WGY A;  1WYW B;  3WAN A;  3E9P A;  4FHK A;  1UGM A;  1WMH B;  4MDK E;  3FSS A;  1UH6 A;  1WJM A;  1FGZ A;  3UQA A;  1X11 A;  2YRY A;  4F1S A;  2V1Y A;  1I35 A;  2B3A A;  4MK0 A;  1EUV B;  2A4Z A;  3MPX A;  4I6N B;  1MK9 B;  1I2H A;  1LM8 B;  4IM2 A;  1WXS A;  2RPQ A;  4F7Z A;  2COA A;  4JKC A;  3CF6 E;  4A3O A;  3EEC A;  4F7G A;  1E5W A;  4GDL B;  4TYZ A;  3ZNH B;  1EAZ A;  1OY2 A;  1NDD A;  2FNJ B;  4G3X B;  1V5T A;  2DYB A;  1J8C A;  3QHT A;  2KDI A;  2WX0 A;  2ZCB A;  4HDQ A;  2BF8 B;  4FAD A;  2FAZ A;  5KQ4 A;  2NR2 A;  4ZDV A;  4HPL B;  3A8Q A;  5JHH A;  5J18 A;  2C7H A;  3F0W A;  2MBO A;  3S2A A;  4W9C A;  1WG7 A;  3UF8 A;  3TVV A;  3VUX A;  3A33 B;  3T06 A;  2D2Q A;  4EOY A;  2CS4 A;  4JKF A;  4IOY X;  1E8X A;  2IYD B;  2QKL A;  4HCP B;  1IPG A;  2J0M A;  2D4Q A;  2NMB A;  3KSY A;  1V86 A;  2G4D B;  3WAL A;  1P0R A;  1U29 A;  2R0D A;  2DYO A;  2COF A;  4GN1 A;  1KI1 B;  2JVC A;  2KWV B;  2R2Q A;  1WX9 A;  1VBH A;  4HAY B;  4G11 A;  3NZS A;  1YIW A;  1RAX A;  4DHJ D;  2K2U A;  4EJN A;  4CO7 A;  4WJP A;  1ZGU B;  2YT1 A;  1YX6 B;  3ZUN A;  2RUK B;  2KGX B;  2HJ8 A;  2KX3 A;  1E8W A;  2DYM A;  3P7Z A;  3L08 A;  1U27 A;  5D3Y A;  2C9W B;  3CXB B;  4K2P A;  4MJS A;  2ZCC A;  4JKB A;  2VSZ A;  5JHA A;  2MWN B;  2P0H A;  3TL5 A;  1C1Y B;  2MBB B;  2KAN A;  2O6V A;  2XQN M;  4K7U A;  4PQ0 A;  3ENE A;  3ZDT A;  4I6L B;  2J0J A;  4GDK B;  2LKO A;  5LXI B;  5L81 A;  4DWF A;  4IM0 A;  2DX1 A;  5IAA C;  1HB8 A;  1J0G A;  2L76 A;  3H9D A;  2IY0 B;  4GMX B;  3TJP A;  2EKE C;  4K2O A;  3SUZ A;  4HB0 B;  3KYD D;  1DDW A;  2DZM A;  1XQQ A;  1WGR A;  3APF A;  2RGN B;  2O2V B;  3DVN V;  1EF5 A;  4A20 A;  3SV1 A;  2RR9 A;  4A6F A;  1WX7 A;  1GG3 A;  3VOQ A;  1ZVR A;  4IC7 B;  3P2B A;  2JXX A;  1DRO A;  4AUQ C;  4NNJ B;  3PSE B;  4ILG B;  3PVW A;  4GDL A;  1N3H A;  3H7S A;  1TXD A;  2K8C A;  3KZ1 A;  3RUI B;  3SHQ A;  3EC8 A;  4MGY E;  1UPR A;  1EGX A;  1ZM0 A;  4ICV A;  4TKN A;  4C0A A;  3QBV B;  4IW0 A;  2ZPY A;  1NU2 A;  1SGH A;  5J3T A;  1M94 A;  3MJW A;  3OAW A;  2M4N A;  4GOC A;  3ULC A;  3E9L A;  1XD3 B;  2FCS A;  4IAP A;  4KAX B;  4G50 A;  2ROZ B;  1DDM A;  5D3X A;  2ZJD A;  1UBI A;  3HHM A;  2FCM A;  2NZ8 B;  4BKS D;  3SBT A;  2BKR B;  2COD A;  4IWP A;  4E3C A;  2REX A;  3PLV A;  2Q13 A;  5JP4 A;  1BTN A;  2BGF A;  4F7U P;  4FUL A;  3WYF B;  2K8B A;  5CX3 A;  4A6K A;  2YT0 A;  3ZTC A;  2PJH A;  3PTF C;  2GBN A;  1K5D B;  1FHO A;  5C6R A;  2M0X A;  5DCN A;  3V6C B;  3VVW B;  3PVL A;  2Z0D B;  2LBB A;  3TIX A;  1KLV A;  3QWZ B;  3PSC A;  5HE0 A;  4NPN A;  2DTC A;  3DBR I;  1P6S A;  3OJ3 A;  1MIX A;  3X23 A;  3SO6 A;  1NTI A;  4CYE A;  3SDL C;  4X57 B;  2ZNV C;  2MP2 A;  3QCA A;  4II2 B;  4IFS A;  1P3Q U;  1ST7 A;  1P3R A;  2LXC A;  3Q3F A;  3W1S C;  5EDS A;  5BO4 B;  1V6E A;  4KDL B;  1UBQ A;  2OJR A;  4KHB B;  2KLC A;  4BFR A;  1OEY A;  4DXA B;  3L54 A;  3CIK A;  2KMC A;  3QX1 A;  1M7E A;  2ADZ A;  1MIZ B;  1WGQ A;  1RFA A;  4HWI B;  2DKQ A;  1LFD A;  4D0N B;  3O65 B;  3TO1 A;  2J59 M;  1WE7 A;  2LAS A;  4MM3 A;  3KUD B;  3PRP B;  3PHX B;  2DEN B;  5C23 A;  3HIZ A;  1ZC3 B;  2CHX A;  1Z87 A;  2LUE A;  1DYN A;  2MBQ A;  1BWN A;  2QHO A;  4HVB A;  2Y7B A;  3N30 A;  1U5G A;  3BY4 B;  1H4R A;  2DAF A;  3JSV B;  1Q5W B;  1HB6 A;  3FLV A;  5J3Y A;  2YSZ A;  3RD2 A;  1WI0 A;  4MGK E;  2LVO A;  2Y8F A;  2MA9 B;  2DX5 B;  2BCJ A;  2EJ8 A;  2P8V A;  1R4M I;  4HAV B;  2XK5 A;  5EFX A;  1RRB A;  2LWP A;  4GZU A;  2N9E B;  4CHJ A;  3ZNZ B;  2MWS B;  2KQ7 A;  3VUW A;  3LJU X;  1WJ4 A;  2D11 A;  4DHJ B;  1WF9 A;  1G6J A;  2OQB A;  2YF0 A;  3ONS A;  4GGQ A;  4TQ1 A;  4BVU C;  1WJ6 A;  3L17 A;  2KFK B;  2H7E A;  2CU1 A;  1PLS A;  4MGZ E;  3VIA A;  1CMX B;  4NY0 A;  2VRR B;  4JKG A;  2KLG A;  2LXA A;  2D9W A;  4B95 A;  3B1L X;  4P7I A;  2MX2 A;  5JZE B;  4KHO A;  1J0W A;  2YS3 A;  2L1C A;  4HCN B;  3A9K B;  2CB8 A;  5AZF A;  4FLH A;  1BTK A;  3M3J A;  3RZW C;  2UVM A;  2KJH B;  3VHT C;  1UD7 A;  2D07 B;  2MRP A;  4B6H A;  2KTR B;  3M63 B;  1TJ6 A;  3PZD A;  3H6N A;  2JUO A;  4HAT B;  4ANU A;  3U8Z A;  3DVG X;  3PP2 A;  4JQW C;  3SD5 A;  3H7P A;  3OJ4 B;  3G9W A;  2UZS A;  3WIM A;  1NVL A;  1E8Y A;  1V9J A;  3KUZ A;  4PS8 A;  1WM2 A;  3IVF A;  1LXD A;  1NI2 A;  4G0N B;  3VH4 B;  4TQ0 A;  4KIK A;  4PYZ A;  5HE2 A;  3QQ8 B;  2LGD A;  2QKM A;  1WE6 A;  5J17 A;  3VTW A;  1LQB A;  3NSU A;  3RCP A;  1WFY A;  2DZK A;  3X0W A;  3T9L A;  1UNP A;  5DH9 B;  2D10 A;  2MP2 B;  4FA6 A;  2VKI A;  4B9K A;  5IJM A;  1OEY J;  1OGW A;  5TR5 A;  2ZVN A;  2L3Z A;  4ANX A;  1L7Y A;  2EMT A;  2R2O A;  2J0K A;  3R7Q A;  2CHZ A;  3ZNI D;  4MY6 A;  2FCN A;  3ZRF A;  4IM3 A;  1AQC A;  4ZYN A;  3HK0 A;  1ISN A;  3TFM A;  1RLF A;  2IO2 B;  1ZSQ A;  2KTR A;  3DXD A;  3QWM A;  2DZI A;  3N3K B;  4URK A;  1X1G A;  3N32 A;  2NBW B;  1KM7 A;  4E74 A;  4GPT B;  1KOT A;  4ZRI A;  2NBV B;  1GC6 A;  3E9O A;  1I42 A;  2W9N A;  2MQJ A;  2RVB B;  2Z0E B;  5AEK B;  2N23 A;  4IWQ A;  4E71 A;  5DI9 B;  3HW2 B;  2GCL A;  1GGO A;  1V5M A;  2KFK A;  5J3Q A;  1PMS A;  2HE7 A;  3UIP B;  1Q1O A;  3V6E B;  3QA8 A;  4W9J A;  2RLO A;  5JLJ B;  3IFW B;  2DX5 A;  4BOS C;  4OVV A;  3DVG Y;  2G45 B;  4MSM B;  2BYE A;  3ZTD A;  3GZN I;  3ODO A;  4WJ7 A;  4WJN A;  1U5D A;  3I3T B;  1IYF A;  4A5K A;  2Z0O A;  1WZ3 A;  1U5F A;  3EPY A;  4IG7 B;  2FID A;  1GJZ A;  4HB3 B;  1E8Z A;  4IWO A;  1C3T A;  2FUH B;  2KO3 A;  4ILH A;  3CSF A;  4DBG A;  5FI1 A;  1Q0W B;  2KN5 A;  2K00 A;  5CLQ B;  4KSK C;  3ZRC A;  3PGE A;  1I7A A;  2LVQ A;  2LOZ A;  2C5L C;  2W2X D;  4FJZ A;  2C60 A;  2JRH A;  3A9K A;  2I1J A;  3PRM B;  2D9Y A;  1DIK A;  2DZJ A;  2L0T A;  4ILJ A;  1XD4 A;  2KJ6 A;  3DXC A;  2I5C A;  5JHG A;  4DBB A;  2RSG A;  5D7G A;  4W9D A;  5AZH A;  5E6O A;  4Z2M B;  3KW5 B;  5CHV C;  2KTF A;  2CY5 A;  3PS6 A;  1UEL A;  2UYZ B;  5KHQ A;  4L6E A;  3AI5 A;  2D3G A;  3AJ4 A;  4JK8 A;  3ML8 A;  4ICU A;  2JT4 B;  4JK9 A;  5CLL B;  3JYU A;  2ROV A;  1TBE A;  2LRU A;  1MAI A;  3FP5 A;  2VRW B;  2MKR A;  1QZE A;  4WVF B;  2AL3 A;  4Z2N A;  4WWN A;  3HQC A;  3ODW A;  3QAQ A;  3NHE B;  1M7R A;  4AP4 C;  1EF1 A;  4KVG B;  4HDO A;  2M1M A;  1AWE A;  4TV3 A;  2A5U A;  3TCA A;  5G55 A;  3A4R A;  2W2X C;  4ASW C;  3D8E A;  2H7D A;  2CAY A;  3PRZ A;  4II3 B;  1DBH A;  2COC A;  4HB4 B;  4M8N A;  1KZG A;  1D3Z A;  5CHW A;  2DFK A;  1Z2M A;  5GMV A;  1Y8R C;  2BKF A;  5DIF B;  2KUP A;  1V81 A;  4FJV B;  4K1R B;  2FJL A;  2MFQ A;  4JKD A;  2L7R A;  4W9K A;  4MJS B;  2ZEQ A;  4MSQ B;  2G4S A;  4EKU A;  1WH3 A;  1SIF A;  1B55 A;  2M8S A;  2CKH B;  3L0W B;  1BT0 A;  1RJ2 A;  2N7D A;  4JIO U;  1WJ1 A;  2JPH A;  3ZW3 A;  4A6H A;  4GB9 A;  2D9Z A;  2KX0 A;  4XC2 A;  2X18 A;  2KJR A;  4YL8 A;  2GBK A;  4NSW A;  1SE9 A;  3DVN U;  4AJW A;  4NAW B;  4DDI D;  2ZZP B;  4BKG A;  3NZU A;  4FHJ A;  1PFJ A;  2DHI A;  2EC1 A;  1V2Y A;  5D94 A;  2L2I A;  2V4L A;  3L10 B;  4NJ7 A;  1KZ7 A;  1L2N A;  4N9F 4;  1W1G A;  1GC7 A;  2IO3 B;  3VDZ A;  2FJ9 A;  3JSV A;  1KC7 A;  4JKA A;  4WWO A;  2L05 A;  4GU2 A;  2LYD A;  3LDZ E;  5DPS A;  1F9J A;  4WQO B;  1E7U A;  3R3M A;  1E7V A;  2WX1 A;  4BKS A;  3RUL A;  3TMP B;  2PPH A;  3KYC D;  4A3P A;  2KC2 A;  1WXV A;  2KMA A;  1NTY A;  4GIV A;  4EZK A;  1WXM A;  1XOD A;  3P6A A;  1YJ1 A;  4HAU B;  4AJY B;  5LXH A;  1X1F A;  2PEA A;  2N0Y A;  3DPD A;  4NAW A;  1S3S G;  2OOB B;  1FB8 A;  1NTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...