2D10A

Crystal structure of the radixin ferm domain complexed with the nherf-1 c-terminal tail peptide
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
295
structure length
295
Chain Sequence
KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for NHERF recognition by ERM proteins
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Radixin
total genus 79
structure length 295
sequence length 295
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2d10A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d10A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2d10A01
4K7SA 2RUKB 4W9LA 2DHJA 3RYTA 4W9DA 3ODXA 3Q3JA 2FDQA 3VTUA 4LJOB 3ZIMA 3KYDD 1I35A 3ODOA 3PHWB 4K1RB 5J2RA 2C7HA 3AU4A 1UNRA 4A5KA 3N7CA 2N4FA 1GC6A 1C1YB 1V5OA 2CKHB 4II3B 1U5DA 2NVUI 1WGRA 2ZPNA 1KM7A 2C5LC 3ZNHB 5E6PA 2L05A 5DHAB 1WM3A 2C60A 1LM8B 3CF6E 2R2OA 1PMSA 4WJNA 1UPRA 2MKRA 2P0DA 3PS6A 2I1KA 2KZRA 3QBVB 1P3QU 2ZCCA 1S3SG 3S2AA 2NPTB 2ZVOA 4WQOB 5JHHA 4P7IA 2DFKA 2L1CA 2DZKA 5FI0A 4KHOA 1EGXA 1YJ1A 2K25A 3MPXA 1P0RA 4EZKA 4H8SA 4HB0B 4A20A 5CHFA 2UZRA 1EUVB 2WX0A 3QJZA 2BKRB 4IWQA 2W2WA 2KTRA 2MW5A 4ANXA 4DBBA 2BF8B 1GUAB 2L76A 1P5TA 2R0DA 3AI5A 2ZEQA 1L2NA 1BTKA 2YRYA 2KWVB 2LXCA 2PE9A 3OJ3A 5D3WA 3PRPB 3UQBA 3TO1A 3ZNGC 2KC1A 1MPHA 2FJ9A 2L7RA 3H7PA 2RSGA 5DHFB 3P7ZA 4AUQC 3I3TB 3L08A 3VUYA 2CHXA 4GDKA 2OJRA 3APDA 2EMSA 1ACAA 2Y5BB 3TMPB 2UYZB 3QARA 4FN2A 3GZNI 4II2B 3IBEA 2LASA 3JSVA 3D8FA 5DPSA 2N7DA 2CRFA 2L2IA 3QHTA 2G3QB 4IAPA 4FJYA 2BPSA 3L54A 4FA6A 3PSCA 3T06A 4MH0E 1C3TA 1FHXA 4DXAB 2VSZA 4CHJA 3APFA 1Q1OA 1GJZA 3R7RA 2DYOA 3A33B 1NTIA 4ZRKA 4BOSC 4YL8A 3ZRFA 2ADZA 2MLBA 2ZNVC 2J0JA 3RCPA 2ZVNA 3DBHI 3EHVA 1A5RA 2DLWA 4HPLB 4MY6A 1LFDA 3B0AA 2MRPA 4MM3A 4A6FA 2KVRA 4IC7B 2CY4A 1BAKA 3ALBA 2ELBA 2AL3A 2QKLA 3ULBA 2GBNA 2V1YA 2YLMA 2ZCBA 3HM6X 4GIVA 4BOZB 3O65B 3H7PB 4HAXB 4GXBA 4A3PA 1KLVA 5KQ1A 2ZJDA 3A8PA 4A6HA 2LRWA 2OQBA 4HDQA 3QQ8B 3VH4B 2PJHA 3QAQA 1U5GA 4EUTA 4ZDVA 5CHVC 1WF9A 2YVCA 4BBNF 2LVQA 3ML4A 3V6EB 5D94A 5KQ4A 3N3KB 2HTHA 2NBWB 2Z0OA 1XD3B 2KN5A 1J19A 2CQUA 2IY0B 3A9KA 4MT7A 2HTHB 2QHOA 3H1UA 1WFYA 4TUUA 2ZPYA 1IRSA 5J18A 4ZRJA 2A5UA 3CSFA 4W9FA 1NVLA 2HJ8A 3SD5A 2FIFA 2VKIA 5J17A 2GOWA 5JHAA 1WYWB 3F0WA 1V61A 1XQQA 2KFKB 1FXTB 4HLEA 3A4RA 3UF8A 5L83A 3DXEA 2DX5A 1TQZA 4CHMA 3DVNU 3OJ4B 3VIAA 4IWPA 1LW3A 1NI2A 3O96A 5C79A 2KK8A 4I6NB 2K1FA 4HJKA 3A8QA 4KV2A 4BFRA 1RJ2A 3W1YA 2FIDA 2GBMA 3LJUX 3KH0A 4XZ4A 4WSFA 4NQKE 4LCDE 3VQIA 2YT1A 4TQ0A 3KUCB 3C0RB 2EC1A 1T0YA 3EC8A 1WZ0A 2L3ZA 2O6VD 4PYZA 1R4MI 2KC2A 2N0YA 2I1JA 2G4SA 2N9XA 3VTWA 2G4DB 2K8CA 2BWFA 3MTNB 5G2NA 3SNHA 3AXCA 3PVWA 4TYZA 4YONA 4F7UP 4MK0A 1UD7A 2KHWB 2KWCA 3DBSA 5EDSA 1WM2A 1DDWA 1FOEA 1ZW7A 2RGFA 3NHEB 3VH3B 2DTCA 2KDIA 3N30A 5D3VA 1EF1A 2DA0A 2GCLA 1WXSA 2BYEA 5J3QA 1OEYJ 1FGYA 1XODA 2C7NB 2DENB 2KWUB 2IZVB 3KRWA 1X1FA 2LGYA 2RD0A 4KHBB 5DIFB 4ZYNA 2MWSB 2M4NA 4IWOA 4F7GA 2CAYA 1WG7A 4BKGA 3ML8A 5DI9B 1Z5SB 2MP2A 1UNPA 2BYVE 3A1QA 4KSLC 5DH9B 4W9KA 3RULA 4D0NB 2ZNVB 3HIZA 3PLUA 2XEWA 4FJVB 1UEFA 2COFA 1WR1A 4WAAA 5HE3A 1WJNA 2KTRB 4K7UA 4WWPA 4MJSA 5CHWA 2LKOA 3WALA 4BVUC 2GJYA 2WDTB 3FLVA 2YS3A 4K81A 4NNJB 4HAZB 4C0AA 2KFJA 5JLJB 4TKNA 3JW0X 2JVCA 1SHCA 1Q5WB 4B9KA 3CIKA 3D8DA 1AARA 5HKHA 3VUXA 1MIXA 1H8CA 3P6AA 1E8XA 2HE7A 1WR6E 2DHKA 4GGQA 3OANA 2IY1B 3TCAA 3W1SC 4GU2A 2MSED 2RSUA 3DBRI 5C5BB 2LD9A 4PS8A 3TL5A 3CXBB 2IO1B 4DHZB 5CLQB 1OQNA 4CYEA 1ZC4B 3DCGA 1WXVA 1WZ3A 3PRZA 3B1LX 1D3ZA 3M1IB 2GBKA 5EFXA 4HK2A 2LOXA 4FBJB 2ASQA 1K5GB 2DX1A 3H6NA 3KYCD 4NPNA 3VXWA 3PTFC 2LWPA 2NPTA 3A4SC 3PREA 4J6IA 1WGYA 3PVUA 2DZIA 1U5EA 2KXJA 4W9GA 1SIFA 4URKA 5LXIB 5JHGA 4HATB 4FJZA 2Z0DB 2LJ5A 4OVUA 2LVPA 1M94A 1MK7B 5BO4B 2IO0B 4F1SA 2DYNA 1U2BA 2CR5A 3KW5B 2JT4B 5AZHA 2MQJA 5GOWB 4JGHB 2CY5A 1WXMA 1YQBA 2DZMA 2KJHB 3WAOA 1U5FA 1WJ1A 2LYDA 3WANA 3D32A 2AEHA 3OAWA 4MGZE 2RNRB 2VRWB 2DKPA 4WJQA 2DAJA 1TBEA 1TGZB 5JP4A 1WX9A 2M8SA 3ONSA 3D8EA 4JIOU 2LGDA 4IM0A 1UH6A 1WY8A 2PZ1A 3RZWC 4HAUB 3ML9A 2P8VA 1U4AA 2ZZPB 1NTYA 4LDTB 4E71A 3LJ3A 1OMWA 4HAVB 2Z59B 1EAZA 3NZUA 2KD0A 4K2PA 4B6HA 1P3RA 3V6CB 3AULA 1E8ZA 3P2BA 3SUZA 2D2QA 2W2XD 1X1MA 4GOCA 4HHVA 4L6EA 2NBUA 4WJPA 4MGIE 3A98B 4GB9A 2JZ3B 2KTFA 4JL9A 1Y19B 2NS5A 2PE6B 2FAZA 3VHTC 1ST7A 1WH3A 4NJ6A 2J59M 1OEYA 3TVVA 5HE1A 1XR0B 3N32A 2CODA 2M0XA 2CU1A 2O2VB 5DCNA 2Z0EB 1WGQA 5C23A 4G3XB 3VVWB 2GBJA 4HWIB 3UIOB 1CMXB 1WJUA 2C7MB 2FJLA 3IFWB 5KHOA 2MCNB 1I2HA 2L0TA 1NBFC 3U8ZA 1V5MA 1V80A 1WE7A 1KZGA 1ZGUB 2DAFA 4WWOA 3EPYA 5LXHA 1XT9B 3MHSD 5J3TA 2YT0A 4M8NA 3KSYA 3B08A 1UBIA 2MP2B 5IAAC 4HAYB 1E90A 1DDVA 3QIJA 4EKUA 2BYFA 5HE2A 2JRIB 2JWZA 1P9DU 3PV1A 3VDZA 4BKTA 4I6LB 2XK5A 4ANUA 1RLFA 4LJPB 4M0WB 4CHKA 4NAWA 5D7GA 3ZNID 2MDXA 2YS1A 3M63B 4AJWA 2KDFB 2CB8A 2H7EA 4GMXB 1MK9B 3KY9A 3R66C 4RM8A 4F7HA 2JY6A 1YX6B 4KIKA 4GDKB 2EMTA 2BKFA 4W9EA 1V81A 2UZSA 2D07B 3A9JA 3DVGY 3QA8A 4AOFA 4PQ0A 3MDBC 4DHJB 2KJ6A 4GZUA 1KJTA 1AQCA 5LOPB 2LG1A 3UINB 2WX1A 4XX5A 5D27A 4G50A 1W1GA 3PZDA 3QWMA 2V4LA 2KCJA 2YS5A 4KHAA 5D3XA 4ICVA 3UGBB 4BKSA 3M95A 2D9WA 3VUWA 2KQ7A 2KQSA 2LVOA 1M7RA 2L8JA 4FULA 2IYDB 3R3MA 1UPQA 1WGUA 3V61A 4E74A 2GS0A 5KHQA 4HB2B 1KOTA 1ISNA 4DBGA 1WI0A 2D10A 1DYNA 1DBHA 2IO3B 3ENEA 1IYFA 2ABDA 3X23A 2FCNA 3DOWA 4HXDA 2JF5A 2MBBB 4W9IA 3ZUNA 2DX5B 5LONB 4KZCA 4A3OA 3Q3FA 2KDEB 1W1DA 1DDMA 3EFUA 2M1MA 3PHXB 4HCPB 1V6EA 5JH5C 1EVHA 1P6SA 1BTNA 2KJRA 4WJOA 2REXA 2COCA 3GYPA 4KAXB 1V5TA 2RGNB 1V5PA 2D9ZA 2UWQA 3DVGX 3FSSA 1H4RA 5C6RA 2KO3A 4MGYE 1V86A 3RD2A 3W1SA 3WAMA 3OLMD 1ZSQA 2KMCA 2R09A 2KNBA 2D11A 2LULA 4DX90 4GN1A 1OY2A 3SV1A 1YD8U 1ZC3B 3APCA 5G55A 3QK0A 5TR5A 1EF5A 2AYOB 4EFOA 1WXAA 3ZW3A 1UNQA 2MFQA 3AU5A 1I7AA 5J3YA 2IBIB 2L00B 2LGXA 2D9YA 3G9WA 2J0MA 2MBQA 1NTVA 4MSQB 4BKSD 3PT2B 4HVBA 3X0WA 2IYBA 1NDDA 3F5RA 1GG3A 1V5UA 1XKEA 3BINA 3SDLC 2DKQA 4A6FB 1OTRB 2VRRB 2WYQA 4KDLB 2Y7BA 3ZNZB 5L95C 2UVMA 5GMVA 1WX7A 2COPA 2RPQA 1BT0A 2DYMA 1WGGA 1J8CA 3ULCA 2BGFA 2N1VA 4HB3B 3DQVA 2KFKA 2KLGA 3V60A 3ZDTA 1V2YA 2EJ8A 4A6KA 4Y94A 3DBLI 4GDLA 2ROVA 3SHQA 3PG7A 1TXDA 1XD4A 3PRMB 4FHKA 1NU2A 1L7YA 3RUIB 2K39A 4X57B 4XC2A 1N3HA 1AWEA 2JUOA 3M62B 2QKMA 1SE9A 1E7UA 1WJ4A 4WWNA 2Y8FA 1HBKA 3M3JA 1S1QB 2DN6A 2YF0A 3LDZE 3KUZA 3PGEA 3WA0A 2NMBA 1W1HA 5DPTA 1IPGA 1GNUA 5CTRC 5DPRA 2D3GA 4GMVA 3MJWA 5C5BA 4E3CA 1E7VA 1MKEA 2Z0PA 2KDBA 2KX0A 4I6PA 4KSKC 5E6OA 4EZLA 4ANWA 1E8YA 1JRUA 3ZO5B 4EOYA 3PVLA 3DXCA 4RMAA 1TZ1A 2A4ZA 3NS8A 3QWZB 1RRBA 4KVGB 1IP9A 3VAWA 3U7DA 2DZJA 3JYUA 4IOYX 2JRHA 3NSUA 4MELA 2RVBB 3TFMA 4Z2NA 3WIMA 3EECA 2DHZA 1RFAA 1WI1A 2MWNB 3DXDA 1WIAA 3L0WB 3ZTCA 4W9HA 1OQYA 3U30A 2HRJA 2K2UA 1TJ6A 1E8WA 4NJ7A 5JHBA 1SGHA 2Z0QA 3WAPA 2M17A 1KZ7A 4G11A 4DHZE 3GOEA 4IFSA 4KIKB 2JP2A 4N9F4 4WJ7A 2YSZA 2RLOA 2O6VA 4AWJA 2H7DA 2K8BA 3GYOA 1P98A 2D9VA 2GCJA 3TBLD 4DWFA 4ASWC 1Z87A 2KMAA 3RZFA 4F7ZA 2G35A 3TW1A 3PP2A 4M8MA 4TQ1A 5AEKB 3L17A 5IA7A 1G6JA 2KUPA 2DYQA 3BJIA 1K5DB 4NY0A 4PS3A 1I42A 2I5FA 1TTNA 3NY5A 4JQWC 3T8MA 3V62A 2J7QB 2JPHA 1Q0WB 1RAXA 2B3AA 3PPAA 4MDKE 4KDIC 5AZFA 2KX3A 4BBKA 4WVFB 3JVZX 2CS4A 3PEGA 2Y8GA 5FI1A 1DROA 2D4QA 2LBBA 1WE6A 2KANA 1Y8RC 2KKCA 3L16A 4FADA 1XX0A 4ZRIA 3KRXA 2NZ8B 3SYXA 3VOQA 4AJYB 1X86A 4MJSB 4HCNB 4K2OA 1X1GA 2N9PC 3UQAA 1UBQA 3IVFA 2GBRA 1MAIA 1MG8A 2O2VA 2XBBC 3A9JB 3TIXA 4DDID 1B55A 1FGZA 3UZTA 2CHZA 4TV3A 3K9PB 2FUHB 2MBOA 3ZLZA 3HK0A 5L81A 1PQSA 2ELAA 4MEMA 2LUEA 1UGMA 5JZEB 4NAWB 2W2XC 2COAA 4PNKA 4FLHA 4EEWA 2LZ6A 4HAWB 1YIWA 3ZVRA 3ZRCA 2RQ1A 2FCSA 3DVNV 2W9NA 5C1ZA 1J0GA 2M38A 4DX8A 2P0HA 5LLIA 3VTVA 3NZSA 1H10A 2G45B 2XK5B 3KVFB 2FCQA 1KI1B 3R7QA 3L10B 4MGKE 3PLVA 4HB4B 1E5WA 5C16A 5HE0A 1WJ6A 4PS7A 3DDCB 1WMHA 1QQGA 1PFJA 1WVHA 2LOZA 2JXXA 1RRPB 4EMOA 1M7EA 2LRUA 2K6DB 2N1WA 2N7EA 1ZKHA 4EZJA 3CMMB 4ICUA 4PYUA 5FR6A 1X05A 4KZ0A 1J0WA 5AZGA 4GPTB 1UZXB 3QCAA 2GMIC 1WX8A 4EJNA 2CHWA 4AP4C 2WWZA 2DHIA 2NR2A 2AL6A 3L13A 1FB8A 2AWTA 4XWXA 3H7SA 4W9CA 2MX2A 4GSWA 4MSMB 3FP5A 4OVVA 2N23A 1K8RB 4ANVA 1U27A 1V88A 1HB6A 2BCJA 1FAOA 2DYBA 3IG3A 3UIPB 3DPDA 4CO7A 1PLSA 2FNJB 3PSEB 4IW0A 3QC8B 4W9JA 3T9LA 4B95A 1EO6A 2X18A 4JLCA 4IUMB 1LQBA 3KUDB 1Y5OA 1Z2MA 2KGXB 2N9EB 1WJMA 4GDLB 4LDTD 4NQLB 2OTXA 4RM9A 3HW2B 5E6NA 2M14A 3A9KB 3RCZA 3ZTDA 2MA9B 2HD5B 1GC7A 2K6QA 3SU8X 3TJPA 3ZVVA 2LXAA 1U29A 1XCGA 5D3YA 1MIZB 2K00A 1FHWA 3SO6A 2C9WB 2IO2B 2NCNA 4G0NB 4K7WA 1HE8A 5IJMA 2Q13A 3K9OB 4IM3A 1FHOA 2IFSA 2EKEC 1WGHA 5D6JB 1UELA 2K2JA 2K8HA 2V76A 1OGWA 5KCVA 1WMHB 3WYFB 1R4NI 1WRDB 1YX5B 2BWES 1V9JA 2D9XA 1VCBA 1BWNA 2MBHA 2KOXA 2PPHA 3BY4B 3QX1A 4IG7B 2JZZA 4DHJD 3VFKA 4HPMB 2LI5A 2KLCA 1VD2A 4DDGD 3ZKJC 3HHMA 1LB1A 4DK5A 2R2QA 3A1QB 2WH5A 2MBEA 2O6VB 2P0FA 3KZ1A 1LXDA 2NBVB 2L0FA 4IM2A 1Q67A 2E2XA 2J0KA 1F9JA 2V3SA 3JSVB 5CX3A 4HDOA 2XQNM 4NSWA 3V5WA 1QZEA 3RT3B 4BBNC 1QC6A 4F8CB 2OOBB 5DPWA 3HQCA 3H9DA 2RR9A 4K17A 3ZDMC 3NOBA 1ZM0A 3AJ4A 2I5CA 1V49A 1WGDA 3FM8C 5CLLB 3FEHA 2FCMA 1X11A 3CSTA 3ECIA 3HM3A 1P1AA 1HB8A 4B6WA 4FHJA 3IHPC 4Z2MB 5D2MB 2ROZB 1V89A 2PEAA 3ODWA 1ZVRA
chains in the Genus database with same CATH superfamily
1GGOA 2RDHA 3RYTA 2FDQA 3LYYA 3PHWB 4K1RB 2MJEA 1V5OA 3NVZA 2K0PA 1PMSA 2I1KA 2ZCCA 3S2AA 2NPTB 5FI0A 4KHOA 1EGXA 1YJ1A 1FFUA 3RI7C 3N20C 3MPXA 2INPE 4H8SA 2BKRB 2MW5A 1QOGA 2Y5CA 1GUAB 4A8XC 1RM6C 1TKGA 2L7RA 2RSGA 3RNAC 3P7ZA 4AUQC 2CHXA 3NG0A 1F2RC 2EMSA 1ACAA 3TMPB 3QARA 4C56C 5FR3A 3D8FA 2CRFA 4IAPA 2V3PA 4YXDB 1GJZA 1VDVA 1A5RA 2MLBA 2DIKA 2J0JA 3RCPA 2ZNVC 2ZVNA 3DBHI 2QDFA 4MY6A 2QC8A 4RNAA 5GXGB 4IC7B 4Q2JA 4RM9A 1JWSD 2AL3A 4BOZB 2QKLA 1EM7A 3HM6X 4GIVA 1A70A 1BMLC 3V3XA 5KQ1A 1ACCA 1T6BX 2LRWA 2LMCA 1U5GA 1WF9A 1SB3C 1ROEA 1XLOA 3N3KB 4MT7A 2HTHB 2QHOA 1WFYA 4TUUA 2ZPYA 1IRSA 2IGHA 1NVLA 1WGKA 2VKIA 2M56B 2J52A 1OQRA 4C4VA 4OSNA 2SAKA 1FM0D 1JROA 1TQZA 1NI2A 3O96A 3EA6A 3A8QA 3KWLA 4LCDE 1E6EB 4YTMB 1F77A 2D3AA 2OHFA 3N9YC 1HZ6A 2Y5PA 4TQ0A 2L3ZA 2O6VD 4PYZA 2N9XA 2N0YA 2G4SA 3AE5B 3VTWA 2K8CA 4BAXA 4TYZA 2KHWB 1ZW7A 3NHEB 1QLBB 3N30A 1XODA 2LGYA 4O1NA 5DIFB 2Z8LA 4P1CC 5AUKA 4IWOA 2CAYA 3I63C 5DI9B 3RULA 4D0NB 4WWPA 5HE3A 4K7UA 2WDTB 4K81A 4LK0M 4HAZB 4C0AA 4TKNA 2WHIA 5HKHA 5LG4B 3ZYYX 3P6AA 1E8XA 3W1SC 2DHKA 2RSUA 4PS8A 3TL5A 5CLQB 1OQNA 2GBKA 3AH7A 4JWSC 2ASQA 3H6NA 4NPNA 1YNTE 1HZ5A 2NPTA 4D6WA 1J7AA 2LVPA 4QJ3B 3KW5B 2MQJA 3C8YA 1YQBA 4YTNB 1U5FA 3WANA 4HKQA 2RNRB 4WJQA 1QOBA 3D8EA 3RZWC 4DQOC 2ZZPB 1P3RA 3AULA 3AEEB 2D2QA 1X1MA 4LNIA 4MGIE 2KTFA 1ST7A 1OEYA 3N32A 5DCNA 2GBJA 2KQ4X 3UIOB 3GP7A 3GS2A 4KGTA 1SE3A 3Q6BA 1KZGA 2MH7A 3EPYA 1XT9B 3MHSD 3B08A 2PIAA 4FXCA 1VR9A 2BYFA 4C80A 2PTLA 3KQ4A 1UGJA 2YS1A 4TMAB 5BMGA 2EKIA 2H7EA 4GMXB 3KY9A 4RM8A 4F7HA 2JY6A 1YX6B 4KIKA 2WDVB 4W9EA 1V81A 3QA8A 4PQ0A 1ZOYB 1PUTA 2WX1A 5D27A 3CIRB 1W1GA 3QWMA 1R7SA 3M95A 1NYRA 4FULA 2X0SA 3TSSA 1EU4A 3W9CB 4DBGA 2D10A 2IO3B 2G1EA 4L1RA 3SBGA 4W9IA 1PGAA 5LONB 2KDEB 1W1DA 4H2AA 1DDMA 4XDCA 2KR0A 1V8CA 4NZLB 1T3QA 4E71A 1V5PA 4ARIA 2KO3A 2NTTA 4R3DA 2DLBA 1L4DB 2BB5A 2D11A 3ENBA 4GN1A 1OY2A 3SV1A 1YD8U 1ZC3B 1V1PB 2QEJC 4USAA 3SFDB 3SR6A 1I7AA 2MEKA 3G9WA 2WXNA 3PT2B 2IYBA 1V5UA 3BINA 1OTRB 2WLBA 2Y7BA 5GMVA 2COPA 2DYMA 1WGGA 4A9AA 4HB3B 3GZNB 3N1YC 2KFKA 3V60A 3A58A 5IRSA 1PGXA 3PRMB 4FHKA 1NU2A 1L7YA 1MJDA 2K39A 2QKMA 1WJ4A 2Y8FA 1EU3A 2JX5A 3LDZE 3PGEA 1W1HA 1IPGA 4GMVA 5C5BA 2W55A 4I6PA 2KDBA 2KX0A 4ANWA 1E8YA 3U7ZA 1IP9A 3U7DA 2JRHA 3Q8FA 1N60A 3NSUA 4MELA 4Z2NA 4LNKA 4KHBA 4AJWA 1WIAA 3RPFC 3ZTCA 4W9HA 2HRJA 3E9SA 4HPPA 1E8WA 4NJ7A 3WAPA 3GOEA 1FD6A 1K53A 2YSZA 1QOFA 1TS4A 1XLPA 4AWJA 2H7DA 3GYOA 1P98A 4DIXA 4DWFA 4F7ZA 2KMAA 1KF6B 3TW1A 4M8MA 4TQ1A 2DYQA 5IP4D 4RCOA 3IT6B 3T8MA 1ZXIA 3P4SB 3IAS1 4KDIC 5AZFA 4BBKA 3MHZA 1N6ZA 5FI1A 1DROA 1XX0A 5BMHA 2RPVA 4K3CA 4MJSB 4HCNB 1L5PA 3TIXA 2XBBC 3U4EG 4JKEA 1B55A 1FGZA 2ZKMX 2FUHB 2IDYA 2ELAA 2LUEA 3E9LA 3URYA 4RGTA 3AEGB 1HXYD 1GOZA 1YIWA 3TEXA 2W9NA 1H10A 3AM9A 3R7QA 3L10B 1YN5A 2SEBD 3R8BA 1PFJA 1RRPB 1SJHD 2JSVX 3AE6B 4KZ0A 3ETRA 4GPTB 1RWSA 3QCAA 1WX8A 4EJNA 2R61A 4AP4C 2WWZA 3VRAB 2AL6A 3L13A 4W9CA 2PMVA 3FILA 2FE8A 4GSWA 4L1BA 1XO3A 4ANVA 2BCJA 1FPYA 3IG3A 4CO7A 4IUMB 4GDLB 1Y5OA 2N9EB 3BZDB 1TKEA 2FBWB 2B76B 3SU8X 3TJPA 3ZVVA 2LXAA 3NWAA 4ZYSA 4CQNA 3K9OB 1SJED 1WGHA 2EKEC 2J4XA 5D6JB 1UELA 2K2JA 2V76A 3E9PA 2KOXA 2BWES 2PPHA 1V1PA 2MBHA 1BWNA 4IG7B 4DHJD 2JZZA 3VFKA 4DDGD 1YJJA 1ESFA 1YQ4B 4DK5A 3A1QB 3FVCA 2KDMA 4IM2A 3TUOA 1CJEA 1TS2A 2XQNM 4BBNC 2RR9A 1JMLA 3AJ4A 1V49A 3FM8C 5EE1A 3NWFA 3NZ3A 4FHJA 1ZDVA 2ROZB 3ODWA 2AQ2B 4K7SA 4W9LA 1YMHE 4W9DA 3ODXA 3Q3JA 4LJOB 3ZIMA 3KYDD 3ODOA 2BVCA 1UNRA 2NMQA 3N7CA 2N4FA 1GC6A 2CKHB 2WU2B 1U5DA 2NVUI 4WQMA 1PDXA 5J18A 5DHAB 1LM8B 2R2OA 2MKRA 1VZ7A 4OVZA 3QBVB 5AUIA 4WQOB 4P7IA 2DFKA 2DZKA 2GB1A 2K25A 5IO9A 1LGRA 4EZKA 2WXKA 1FXAA 5CHFA 2W2WA 4J3OD 2KTRA 4LNOA 4DBBA 2BF8B 2L76A 1P5TA 3AI5A 2KWVB 1T77A 5D3IB 3PRPB 3TO1A 2JU6X 3ZNGC 1MPHA 3FKYA 1QOAA 3L08A 4GDKA 1K52A 3GZNI 4XE0A 2K8EA 4FJYA 1C3TA 3L54A 4MH0E 4DXAB 4CHJA 4S17A 3AE1B 1NTIA 2H89B 1MFWA 2R82A 5IOIA 2DLWA 4HPLB 3B0AA 2W3RA 3ALBA 3H7PB 2V9HA 4A3PA 2ZJDA 3A8PA 4A6HA 2D3BA 3BK1A 3VH4B 4HDQA 2PJHA 5CHVC 1NEKB 3GE8C 3GB1A 2YVCA 4TSSA 2LVQA 3ML4A 3V6EB 2KN5A 4BZAA 1KH0A 4ZRJA 2A5UA 4W9FA 4LNNA 5J17A 5JHAA 1FXTB 4HLEA 3A4RA 3BWUD 2I2YA 1B9RA 2DX5A 3OJ4B 1VJKA 4KV2A 1RJ2A 3W1YA 2FIDA 2BS3B 3CWIA 3LJUX 4WWMA 4NQKE 2WXQA 3KUCB 4ACFA 1WZ0A 3DBRB 1MVKA 2K9XA 1R4MI 2I1JA 2BWFA 2WXHA 3MTNB 3AXCA 1HEZE 3NWDA 4YONA 4F7UP 4MK0A 2KDIA 1FGYA 2IZVB 3U12A 3RFZB 1KLGD 4F7GA 1FNVA 2MP2A 3KWVA 5DH9B 2ZNVB 1N63A 3PLUA 1IGCA 2XEWA 3TEWA 2LHDA 2COFA 1WJNA 5CHWA 4MJSA 2LKOA 3FLVA 2YS3A 1WRIA 4B9KA 3D8DA 3VUXA 1MIXA 2HE7A 4AS1A 3OANA 4GU2A 1M4VA 4CYEA 4IDIA 1WXVA 3PRZA 5EFXA 3VXWA 3PTFC 2LWPA 2DZIA 1U5EA 1D6EC 2KXJA 4URKA 5BO4B 2Z0DB 2LJ5A 1MK7B 2IO0B 4F1SA 2DYNA 5AZHA 5GOWB 2YEPF 3WAOA 2DZMA 3PZ8A 1I4QA 3RMKC 2VH2A 1BUIC 2K49A 2WXPA 1TGZB 4IM0A 3ML9A 1TZOA 2P8VA 3I5JC 1KRHA 2Z59B 3RN9C 5JVLA 3VR8B 2KD0A 4B6HA 1E8ZA 1WXQA 2W2XD 4GOCA 1FRRA 4HHVA 2NBUA 3VR9B 4WJPA 4JL9A 1Y19B 1WH3A 3FILB 3TVVA 5HE1A 1XR0B 3B2FA 2CODA 2M0XA 2CU1A 3VVWB 5JXVA 1CMXB 4OZAA 1I2HA 3EGRA 2N9LA 1ZGUB 1XLNA 2DAFA 1MHHE 1NI3A 2M0AA 1IBXB 3KSYA 1E90A 3DBLB 2JRIB 2JWZA 3AECB 1P9DU 3VDZA 4ANUA 4NAWA 2MDXA 1ZXHA 2CB8A 3AE7B 2VZKD 1ZE3D 2UZSA 2D07B 3A9JA 4AOFA 4DHJB 2KJ6A 1KJTA 1MPEA 1FNUA 2LG1A 3FC4A 4XX5A 2WDQB 1VBGA 1KLUD 2D9WA 1XF5L 4ZHPA 1RYJA 2LVOA 4LLGM 3V61A 3R3MA 1STEA 5HI1A 1MG4A 5KHQA 4HB2B 4C7YA 3BK2A 2ABDA 3X23A 1MI1A 4HXDA 2D3CA 4KZCA 3EFUA 2M1MA 4HCPB 2QILA 5JH5C 2LGSA 3Q3MC 2REXA 1V5TA 2D9ZA 3DVGX 4MGYE 2Z59A 3FSSA 1V86A 3HIEA 2KNBA 2WXMA 3APCA 2NTSA 1DOXA 5TR5A 1CK1A 4EFOA 1WXAA 1UNQA 2IBIB 5J3YA 2L00B 4MSQB 2D9YA 4HJGE 4BKSD 1NDDA 4D2KA 1XKEA 1I4XA 4A6FB 2JWUA 1VZ8A 2WXRA 3P4PB 2JYEA 2N1VA 3DQVA 1E0ZA 1V2YA 4Y94A 3SHQA 4RGOS 4XC2A 2MJDA 2X8XX 4B0EA 3WA0A 2JZPA 1I4GA 5DPTA 1GNUA 4P16A 4QJ4B 2D3GA 1MKEA 4KSKC 5E6OA 3BYTB 1JRUA 3DXCA 3QWZB 1KFYB 1RRBA 4KVGB 3JYUA 1NVID 1JALA 1SIJA 2WP9B 3NRZA 3TFMA 3EECA 2DHZA 3NVYA 3U30A 1KZ7A 4G11A 4DHZE 2AQ1B 4IFSA 1JWMD 4KIKB 2JP2A 4N9F4 2O6VA 1ET9A 1PYWD 2GCJA 4ASWC 5BYSA 2WS3B 5IA7A 1G6JA 3L17A 1IBXA 5FK9C 1TTNA 4JQWC 2JPHA 2KX3A 3PEGA 3GE3C 3L16A 2Q5WD 2KKCA 4A6QA 2WNMA 3MP9A 2NZ8B 3SYXA 1OFFA 4K2OA 5G5GA 1MG8A 3B77A 4KKJA 3K9PB 5L81A 2Z14A 1PQSA 2WU5B 4MEMA 3AB5A 1UGMA 4XDDA 5JZEB 2LZ6A 2RQ1A 5BMIA 4DX8A 1YN4A 1TS5A 3Q14C 5LLIA 3NZSA 2G45B 3KVFB 1KI1B 3EFCA 3PLVA 4HB4B 2LUMA 5C16A 3DDCB 1WMHA 1WVHA 2BS2B 1GB4A 2N1WA 4EZJA 2K6DB 4US9A 4ZHOA 1SF0A 3CMMB 3Q8BA 1UZXB 2GMIC 2LFIA 2DHIA 1N62A 2AWTA 4XWXA 4WAFA 3FP5A 1L0VB 1K8RB 1U27A 1V88A 2FNJB 4IW0A 1UUPA 3QC8B 4W9JA 4B95A 4JLCA 2X18A 3KUDB 2KGXB 4NQLB 1ENFA 5E6NA 2M14A 4US8A 2QCZA 2MA9B 2K6QA 2J53A 3PO0A 1SE2A 3R2IA 2K00A 4G0NB 2NCNA 4K7WA 4NAMA 2Q13A 4IM3A 2IFSA 3MJ5A 1P7FA 2K8HA 2DBYA 1OGWA 1WRDB 5KCVA 4PS3A 1JW9D 1V9JA 2D9XA 4XWTA 1FCLA 3KLSX 1D4BA 2LI5A 1VD2A 1LB1A 2R2QA 2MBEA 4GOUA 1AN8A 2P0FA 2AX5A 2L0FA 1Q67A 3PZ7A 4S0RA 4HDOA 1QZEA 4JPSA 1QC6A 4F8CB 2OOBB 3HQCA 3H9DA 4M01A 3ZDMC 3ZXRA 1K51A 3B2GA 4ILHA 1ZP0B 3ECIA 3FEHA 1GPXA 2D5GA 1C77A 3IHPC 4HSIA 1V89A 2PEAA 2RUKB 2DHJA 1D5ZC 3VTUA 1XCTL 1I35A 2WGSA 3W2DA 2C7HA 3AU4A 1ZUD2 2W3SA 1KM7A 4C4VB 5E6PA 2L05A 3CF6E 4WJNA 3P42A 1P3QU 2ZVOA 1V1OA 2L1CA 4OHJA 1QILA 1JWBD 4HB0B 1EUVB 2IGDA 2WX0A 3QJZA 1UNSA 1VLBA 4IWQA 3DWGC 2IPKD 4JKCA 5EE3A 2R0DA 2ZEQA 1L2NA 1BTKA 2YRYA 1MI0A 2LXCA 3UQBA 1VZ6A 2KC1A 2X38A 5DHFB 5EE9A 3I3TB 3VUYA 5TSSA 2OJRA 3FAHA 4FN2A 2KACA 3HSAA 4JKGB 4II2B 1TS3A 2LASA 2BBCA 4JX1C 1C4CA 3OWEB 3QHTA 2G3QB 4FA6A 3PSCA 2VSZA 3APFA 4ZRKA 4BOSC 2ADZA 3EHVA 1LFDA 1XXGA 4MM3A 2KVRA 2ELBA 2WXFA 3ULBA 2ZCBA 2BB6A 3BYYB 4HAXB 3O65B 4XWWA 3QQ8B 4HEA1 1MHXA 3QAQA 4EUTA 4ZDVA 2HJ1A 5D94A 2R2YA 2UU7A 1J19A 2CQUA 3NUHB 3NVWA 3H1UA 3P4RB 5H8YE 2LGIA 3F0WA 1V61A 2KFKB 3IXSA 3UF8A 1DIKA 1C78A 3DVNU 2W54A 5C3JB 1LW3A 5I2MA 4I6NB 5C79A 2KK8A 4HJKA 4A55A 3KH0A 2INCC 2YT1A 3EUB2 4GNKB 3C0RB 3EC8A 2KC2A 2G4DB 2Z13A 5G2NA 3PVWA 2KWCA 5EDSA 1WM2A 1DDWA 1FOEA 4N6EB 5D3VA 2DA0A 1KC7A 1I4RA 2BYEA 5J3QA 1OEYJ 2DENB 2KWUB 3KRWA 2V3NA 3ZXVA 1X1FA 2KWDA 4KHBB 3Q3NC 3AEDB 1WG7A 4BKGA 3ML8A 4UDUC 1Z5SB 2BS4B 1UNPA 4L2YA 4W9KA 4KSLC 3HIZA 4FJVB 3O13A 3P4QB 1L0XB 2KTRB 3B9JA 3L4PA 2GJYA 3JW0X 1AARA 2L32A 1WR6E 4NJCA 4GGQA 1D5MC 2RDGA 3DBRI 3CXBB 4DHZB 1ZC4B 1WZ3A 3B1LX 3M1IB 4HK2A 4FBJB 4N58A 5G5HA 3AEBB 4PT5A 3A4SC 3PREA 1WGYA 5LXIB 1SIFA 5JHGA 3J9CA 1M94A 1U2BA 2CJNA 2CR5A 2JT4B 4ZOHC 1WXMA 1WJ1A 1GAQB 2PVGC 4GLSC 3D32A 1N5WA 4MGZE 1TBEA 4JIOU 2LGDA 1T5XD 1UH6A 2PZ1A 4L23A 4HAUB 4RFBA 5HHDG 1J7CA 1NTYA 2BQQA 4LDTB 3LJ3A 2BTEA 4K2PA 1CZPA 4JKGA 4DXFA 2JZ3B 3W5VB 3T3OA 2O2VB 5C23A 2DWQA 3U2SC 5HFYA 2Z0EB 1WGQA 1RFKA 4G3XB 2BT6A 3DCXA 2C7MB 2FJLA 3IFWB 5KHOA 3DHIC 2G9HD 1L6VA 3U8ZA 4WWOA 2AQ3B 2ON8A 3QIJA 4EKUA 1AYFA 5EE0A 4OZCA 4I6LB 4LJPB 1TYGB 3M63B 3NW8A 1MK9B 3R66C 2LHEA 4IKGA 1UWMA 4GDKB 2EMTA 2BKFA 3DVGY 2N9KA 1AQCA 4RGNA 4ICVA 2V4LA 4BKSA 2YS5A 4KHAA 3LXFA 2GUMA 3VUWA 1DYQA 2INDC 2L8JA 1UPQA 4CSQA 4E74A 2GS0A 2KN4A 1WI0A 1DBHA 2FCNA 3ZUNA 1T0QC 3P63A 4DXGA 3E66A 3Q3FA 3PHXB 2GI9A 1EVHA 2YT2A 2JXTA 3GYPA 4KAXB 2RGNB 2ICIA 1H4RA 3W1SA 3RD2A 2INNE 2L52A 2KMCA 4DX90 1DGJA 5G55A 1XCQL 1EF5A 2AYOB 2K3UA 3AU5A 1QKZA 4K3BA 2MBQA 4KKIA 2E6XA 4HVBA 3N1ZC 1GG3A 3SDLC 2DKQA 2WYQA 2VRRB 4KDLB 1EWCA 3ZNZB 5L95C 3MC0B 3AV8A 1WX7A 3U52E 2LEKA 1BT0A 4KGSA 2KLGA 2EJ8A 1F0ZA 1L4ZB 3DBLI 1TY2A 1YJIA 4X57B 1QT9A 1N3HA 1AWEA 1SSNA 2OEDA 1E7UA 1JRPA 4WWNA 3Q69A 1HBKA 3M3JA 1S1QB 2YF0A 2IGGA 3KUZA 5HG2A 2MHJA 2ZW0A 5CTRC 4LNFA 4WURA 3OHMB 2ONQA 2KAJA 3MFGA 4RMAA 2A4ZA 3NS8A 1N61A 3VAWA 2JQRB 4IOYX 2RVBB 3WIMA 1RFAA 1WI1A 1AW7A 3DXDA 2KT7A 3L0WB 2K2UA 5JHBA 1SGHA 2Z0QA 3ZJVA 2M17A 1TIFA 2RDBC 4N59A 2K8BA 5MPOA 1HTQA 2D9VA 4B0MA 3TBLD 2G35A 5AEKB 3BJIA 1K5DB 4NY0A 2N7JA 3OG5A 1RAXA 3PPAA 4MDKE 2XN9C 4WVFB 2PW9A 2KANA 2CS4A 3JVZX 4FADA 1Y8RC 4ZRIA 3VOQA 4HKZE 4AJYB 1X86A 2ZW1A 3RNBC 1X1GA 3UQAA 2GBRA 3IVFA 4DDID 2HDEA 3UZTA 1NYQA 4TV3A 3V05A 4PK1A 2MBOA 3HK0A 1SBBB 2COAA 4EEWA 4HAWB 2FCSA 1J0GA 2M38A 2XK5B 1ZPSA 4HROA 1E5WA 4PS7A 4JK7A 3DHGC 2LRUA 4EMOA 1M7EA 1X05A 3TEYA 2CHWA 2NR2A 5IKCM 2JYTA 1FB8A 1FCCC 3H7SA 5T8IA 1PGBA 2MX2A 4MSMB 2N23A 1ZYIA 4LTUA 1FAOA 2DYBA 3DPDA 1IGDA 1PLSA 3T9LA 1EO6A 1Z2MA 4LDTD 2OTXA 3HW2B 3A9KB 3RCZA 1GC7A 1QF6A 1U29A 5D3YA 1J7BA 3SO6A 1SE4A 1QQRA 1BXTA 1HE8A 5IJMA 1C4PA 1Q10A 1FHOA 3NVVA 5J2RA 1WMHB 1YX5B 1R4NI 3PS6A 2WQYB 3QX1A 1VCBA 2WDRB 3BY4B 2BW2A 4HPMB 1HQRD 3HHMA 3ZKJC 2WH5A 2O6VB 3KZ1A 2E2XA 2J0KA 2V3SA 5CX3A 3V5WA 3Q8CA 4K17A 3NOBA 2I5CA 5CLLB 1X11A 4AQ7A 1HB8A 4B6WA 1P6SA 2RRFA 1HA5A 1ZVRA 3P1MA 1WSPA 3SBTA 3SFEB 4A5KA 4II3B 1C1YB 5E6JA 1UF0A 4EE2A 4JKHA 2WXIA 1WGRA 2ZPNA 1XEEA 2C5LC 3ZNHB 1WM3A 2C60A 3TEZA 1UPRA 2P0DA 2KZRA 4RGMA 1S3SG 5JHHA 3BVGA 1P0RA 3RNFC 4ZRQA 4A20A 4A90A 2UZRA 2VH1A 4ANXA 5C2TB 1EWYC 3LB8C 1C4AA 3T3NA 2V0GA 2PE9A 3OJ3A 5D3WA 4M00A 1R4MB 1C9FA 3E56A 2FJ9A 3H7PA 2PVOD 4XGAB 5FKAC 3C19A 2KMMA 3APDA 2Y5BB 2UYZB 1FFVA 4P6VF 3IBEA 3JSVA 5DPSA 2N7DA 2L2IA 3W5UB 3Q8EA 2BPSA 3T06A 1F1HA 1FHXA 1Q1OA 1LO5D 3R7RA 2DYOA 3A33B 4YL8A 3ZRFA 4OZBA 4JKAA 2PLPA 2MRPA 4A6FA 1DOIA 2CY4A 1BAKA 2GBNA 2V1YA 4MM3B 2YLMA 3DHHC 4P1BC 1D5XC 4GXBA 1KLVA 2OQBA 2CU3A 4YSXB 4BBNF 5KQ4A 2HTHA 2NBWB 2Z0OA 1XD3B 3A9KA 2IY0B 3R2TA 2WXLA 4YSZB 2PKOA 3CSFA 2HJ8A 3SD5A 1FXIA 2FIFA 2GOWA 1WYWB 1XQQA 5L83A 3DXEA 2V4IB 4CHMA 4IWPA 3VIAA 3HVZA 2K1FA 3ZJTA 4BFRA 2GBMA 1SEBD 3VQIA 4XZ4A 4WSFA 2EC1A 1T0YA 2VZKB 1FEHA 1N5XA 1KTKA 2IJ0A 3NJTA 2K5PA 3SNHA 1UD7A 3DBSA 3VH3B 2RGFA 2Z4DA 4C7ZA 2TSSA 2DTCA 1WXSA 1EF1A 4M8NA 2GCLA 1SXTA 1TKYA 2C7NB 3RNGC 4JK8A 1JDEA 2RD0A 4ZYNA 2WXJA 2MWSB 3Q8AA 2M4NA 3SEBA 2QJLA 4ZRPA 2BYVE 3A1QA 2MJ3A 2QSDA 1L6UA 1UEFA 4QAYA 1WR1A 2H88B 4WAAA 3WALA 4BVUC 2M19A 4NNJB 2KFJA 5JLJB 2JVCA 1SHCA 1Q5WB 3UI3A 3CIKA 1H8CA 2IY1B 3TCAA 2MSED 5C5BB 2LD9A 1I4HA 2IO1B 3DCGA 4YWGG 1R4NB 2YEPB 2QIEB 1D3ZA 1CQVA 1YOVB 2LOXA 4QJ5B 1JWUD 2DX1A 1K5GB 3KYCD 3ZQ4A 3ZJUA 2L1AA 4J6IA 3PVUA 4W9GA 1PFDA 4ITKA 4JE3B 4HATB 4FJZA 4OVUA 3VRBB 4ILJA 2CY5A 2KJHB 2GRIA 2LYDA 2AEHA 3OAWA 2VRWB 2DKPA 2DAJA 4OT1A 5JP4A 1WX9A 2M8SA 3ONSA 1WY8A 1C76A 1VBHA 1U4AA 3MC9A 1OMWA 4HAVB 1EAZA 3NZUA 3V6CB 1E10A 3P2BA 3SUZA 5BYRA 4L6EA 2KIEA 3A98B 4GB9A 2NS5A 2PE6B 2FAZA 3VHTC 4NJ6A 2J59M 2CJOA 3RNEC 3BIID 5BYQA 4HWIB 1WJUA 4YT0B 2MCNB 2L0TA 1FMAD 1FRDA 1NBFC 1V5MA 1V80A 1WE7A 5LXHA 5J3TA 1FIQA 2YT0A 4YSYB 1UBIA 2MP2B 5IAAC 4HAYB 1DDVA 1YN3A 5HE2A 4BKTA 2XK5A 1RLFA 4M0WB 4CHKA 5D7GA 3ZNID 2I38A 1JWAD 2KDFB 4YTPB 3AE8B 1I7HA 2RMMA 4RF0A 4C00A 3MDBC 1XLQA 4GZUA 4REZA 5LOPB 3UINB 4G50A 3PZDA 2KCJA 5D3XA 3UGBB 2KQ7A 1TT5B 2KQSA 2W82A 1M7RA 1JCKB 2IYDB 1WGUA 1KOTA 1ISNA 3ENEA 1Y56A 1DYNA 1IYFA 1OQQA 3DOWA 2MBBB 2JF5A 2KUQA 2DX5B 4A3OA 2ACZB 3BVZA 1KBLA 3E9OA 1V6EA 3NS1A 2KJRA 1BTNA 5M4YB 4M02A 1F2RI 4WJOA 1WYGA 2COCA 2UWQA 4JGHB 5C6RA 3WAMA 1T0SC 3OLMD 1ZSQA 2R09A 2LULA 2FJUB 1UWXA 4KX6B 3H8HA 2E3TA 2K22A 3QK0A 3ZW3A 2MFQA 4ILGB 2LGXA 2J0MA 1NTVA 1B1ZA 4MACA 3X0WA 3F5RA 3HVDA 2UVMA 3IAM1 2RPQA 5H92C 1J8CA 3ULCA 2BGFA 4HRSA 3ZDTA 1P7EA 4GDLA 4A6KA 2Y3AA 3N1XC 2ROVA 1JQ4A 1IUEA 3PG7A 1TXDA 1XD4A 3RUIB 2JUOA 3M62B 4JKFA 1SE9A 2DN6A 3DBHB 2NMBA 4JWUC 3MJWA 2NBVA 2Z0PA 1E7VA 4EZLA 3AE9B 3ZO5B 4EOYA 3PVLA 1C79A 2KVZA 1FNWA 1TZ1A 2QMTA 2KYWA 4IOIE 1DOYA 2DZJA 3RNCC 1I4PA 2MWNB 1OQYA 1TJ6A 4JKDA 1L0YB 3I57A 4WJ7A 2RLOA 4M0WA 4OW0A 2DNFA 1VRAB 1Z87A 3BVMA 1E7PB 3RZFA 3PP2A 2KUPA 1I42A 3WCQA 2I5FA 5IN7A 3NY5A 3AEFB 3V62A 2J7QB 1Q0WB 2B3AA 2LJIA 3PV1A 2Y8GA 1WE6A 5I4DA 2D4QA 2LBBA 4XYCA 3I9V1 2OJWA 2EELA 3KRXA 1WWTA 1AWDA 4RF1A 1ZDXA 3AEAB 2N9PC 1UBQA 1MAIA 2O2VA 3A9JB 1NENB 2FUG1 2CHZA 3ZLZA 3ZGZA 2N0SB 3ABVB 4MT5A 1V97A 4NAWB 1YQ3B 2W2XC 4PNKA 4FLHA 3ZVRA 3ZRCA 3DVNV 5C1ZA 2P0HA 3IT4B 2FCQA 4ARCA 2GLSA 4MGKE 2KIGA 5HE0A 1WJ6A 1QQGA 1K50A 2LOZA 2N7EA 2JXXA 1ZKHA 4ICUA 4PYUA 5FR6A 3Q3OC 1HTOA 5AZGA 1J0WA 1ET6A 5LNK1 4OVVA 2J42A 3DWMA 5D3DA 1TJEA 1HB6A 4KGRA 3UIPB 3PSEB 4QXAB 1E9MA 2BYTA 2L83A 1LQBA 2WXGA 4WIPA 1WJMA 1T0RC 3ZTDA 1FO4A 2HD5B 3HUIA 1XCGA 2C9WB 1MIZB 3AE2B 1FHWA 2IO2B 4MH8A 3AMZA 1F52A 2XNAC 4RH6A 3WYFB 2HTME 3MC8A 3VTVA 2KLCA 4JK9A 5DPRA 4E3CA 2WXOA 1LXDA 2NBVB 1TY0A 3JSVB 1F9JA 3AE4B 5I2SA 1GB1A 4NSWA 3RT3B 3AE3B 3HRDD 3AN1A 4WH4A 5DPWA 1ZM0A 1WGDA 2FCMA 3CSTA 3HM3A 1P1AA 4JKBA 5D2MB 4Z2MB 3Q2AC
chains in the Genus database with same CATH topology
1GGOA 3RYTA 2FDQA 3PHWB 4K1RB 1V5OA 1PMSA 2I1KA 2ZCCA 3S2AA 2NPTB 5FI0A 4KHOA 1EGXA 1YJ1A 3MPXA 4H8SA 2BKRB 2MW5A 1GUAB 2L7RA 2RSGA 3P7ZA 4AUQC 2CHXA 2EMSA 1ACAA 3TMPB 3QARA 3D8FA 2CRFA 4IAPA 1GJZA 1A5RA 2MLBA 2DIKA 2J0JA 3RCPA 2ZNVC 2ZVNA 3DBHI 4MY6A 4IC7B 4RM9A 2AL3A 4BOZB 2QKLA 3HM6X 4GIVA 5KQ1A 2LRWA 1U5GA 1WF9A 3N3KB 4MT7A 2HTHB 2QHOA 1WFYA 4TUUA 2ZPYA 1IRSA 1NVLA 2VKIA 1TQZA 1NI2A 3O96A 3A8QA 4LCDE 4TQ0A 2L3ZA 2O6VD 4PYZA 2N9XA 2N0YA 2G4SA 3VTWA 2K8CA 4TYZA 2KHWB 1ZW7A 3NHEB 3N30A 1XODA 2LGYA 5DIFB 4IWOA 2CAYA 5DI9B 3RULA 4D0NB 4WWPA 5HE3A 4K7UA 2WDTB 4K81A 4HAZB 4C0AA 4TKNA 5HKHA 3P6AA 1E8XA 3W1SC 2DHKA 2RSUA 4PS8A 3TL5A 5CLQB 1OQNA 2GBKA 2ASQA 3H6NA 4NPNA 2NPTA 2LVPA 3KW5B 2MQJA 1YQBA 1U5FA 3WANA 2RNRB 4WJQA 3D8EA 3RZWC 2ZZPB 1P3RA 3AULA 2D2QA 1X1MA 4MGIE 2KTFA 1ST7A 1OEYA 3N32A 5DCNA 2GBJA 3UIOB 1KZGA 3EPYA 1XT9B 3MHSD 3B08A 2BYFA 2YS1A 2H7EA 4GMXB 3KY9A 4RM8A 4F7HA 2JY6A 1YX6B 4KIKA 4W9EA 1V81A 3QA8A 4PQ0A 2WX1A 5D27A 1W1GA 3QWMA 3M95A 4FULA 2X0SA 4DBGA 2D10A 2IO3B 3SBGA 4W9IA 5LONB 2KDEB 1W1DA 1DDMA 4E71A 1V5PA 2KO3A 2D11A 3ENBA 4GN1A 1OY2A 3SV1A 1YD8U 1ZC3B 1I7AA 3G9WA 3PT2B 2IYBA 1V5UA 3BINA 1OTRB 2Y7BA 5GMVA 2COPA 2DYMA 1WGGA 4HB3B 2KFKA 3V60A 3PRMB 4FHKA 1NU2A 1L7YA 2K39A 2QKMA 1WJ4A 2Y8FA 3LDZE 3PGEA 1W1HA 1IPGA 4GMVA 5C5BA 4I6PA 2KDBA 2KX0A 4ANWA 1E8YA 1IP9A 3U7DA 2JRHA 3NSUA 4MELA 4Z2NA 4AJWA 1WIAA 3ZTCA 4W9HA 2HRJA 1E8WA 4NJ7A 3WAPA 3GOEA 2YSZA 4AWJA 2H7DA 3GYOA 1P98A 4DWFA 4F7ZA 2KMAA 3TW1A 4M8MA 4TQ1A 2DYQA 3T8MA 4KDIC 5AZFA 4BBKA 5FI1A 1DROA 1XX0A 4MJSB 4HCNB 3TIXA 2XBBC 4JKEA 1B55A 1FGZA 2FUHB 2ELAA 2LUEA 3E9LA 1YIWA 2W9NA 1H10A 3R7QA 3L10B 1PFJA 1RRPB 4KZ0A 4GPTB 3QCAA 1WX8A 4EJNA 4AP4C 2WWZA 2AL6A 3L13A 4W9CA 4GSWA 4ANVA 2BCJA 3IG3A 4CO7A 4IUMB 4GDLB 1Y5OA 2N9EB 3SU8X 3TJPA 3ZVVA 2LXAA 3K9OB 2EKEC 1WGHA 5D6JB 1UELA 2K2JA 2V76A 3E9PA 2BWES 2KOXA 2PPHA 4IG7B 2MBHA 1BWNA 4DHJD 2JZZA 3VFKA 4DDGD 4DK5A 3A1QB 4IM2A 2XQNM 4BBNC 2RR9A 3AJ4A 1V49A 3FM8C 4FHJA 2ROZB 3ODWA 4K7SA 4W9LA 4W9DA 3ODXA 3Q3JA 4LJOB 3ZIMA 3KYDD 3ODOA 1UNRA 3N7CA 2N4FA 1GC6A 2CKHB 1U5DA 2NVUI 5J18A 5DHAB 1LM8B 2R2OA 2MKRA 3QBVB 4WQOB 4P7IA 2DFKA 2DZKA 2K25A 4EZKA 5CHFA 2W2WA 2KTRA 4DBBA 2BF8B 2L76A 1P5TA 3AI5A 2KWVB 3PRPB 3TO1A 3ZNGC 1MPHA 3L08A 4GDKA 3GZNI 4FJYA 1C3TA 3L54A 4MH0E 4DXAB 4CHJA 1NTIA 2R82A 2DLWA 4HPLB 3B0AA 3ALBA 3H7PB 4A3PA 2ZJDA 3A8PA 4A6HA 3VH4B 4HDQA 2PJHA 5CHVC 2YVCA 2LVQA 3ML4A 3V6EB 2KN5A 4ZRJA 2A5UA 4W9FA 5J17A 5JHAA 1FXTB 4HLEA 3A4RA 2DX5A 3OJ4B 4KV2A 1RJ2A 3W1YA 2FIDA 3LJUX 4NQKE 3KUCB 1WZ0A 1R4MI 2I1JA 2BWFA 3MTNB 3AXCA 4F7UP 4YONA 4MK0A 2KDIA 1FGYA 2IZVB 4F7GA 2MP2A 5DH9B 2ZNVB 3PLUA 2XEWA 2COFA 1WJNA 5CHWA 4MJSA 2LKOA 3FLVA 2YS3A 4B9KA 3D8DA 3VUXA 1MIXA 2HE7A 3OANA 4GU2A 4CYEA 1WXVA 3PRZA 5EFXA 3VXWA 3PTFC 2LWPA 2DZIA 1U5EA 2KXJA 4URKA 5BO4B 2Z0DB 2LJ5A 1MK7B 2IO0B 4F1SA 2DYNA 5AZHA 5GOWB 3WAOA 2DZMA 1TGZB 4IM0A 3ML9A 2P8VA 2Z59B 5JVLA 2KD0A 4B6HA 1E8ZA 2W2XD 4GOCA 4HHVA 2NBUA 4WJPA 4JL9A 1Y19B 1WH3A 3TVVA 5HE1A 1XR0B 2CODA 2M0XA 2CU1A 3VVWB 1CMXB 1I2HA 1ZGUB 2DAFA 3KSYA 1E90A 2JRIB 2JWZA 3VDZA 1P9DU 4ANUA 4NAWA 2MDXA 2CB8A 2UZSA 2D07B 3A9JA 4AOFA 4DHJB 2KJ6A 1KJTA 2LG1A 4XX5A 1VBGA 2D9WA 2LVOA 3V61A 3R3MA 5KHQA 4HB2B 2ABDA 3X23A 4HXDA 4KZCA 3EFUA 2M1MA 4HCPB 5JH5C 2REXA 1V5TA 2D9ZA 3DVGX 4MGYE 3FSSA 1V86A 2KNBA 3APCA 5TR5A 4EFOA 1WXAA 1UNQA 2IBIB 5J3YA 2L00B 4MSQB 2D9YA 4BKSD 1NDDA 1XKEA 4A6FB 2N1VA 3DQVA 1V2YA 4Y94A 3SHQA 4XC2A 3WA0A 5DPTA 1GNUA 2D3GA 1MKEA 4KSKC 5E6OA 1JRUA 3DXCA 3QWZB 1RRBA 4KVGB 3JYUA 3TFMA 3EECA 2DHZA 3U30A 1KZ7A 4G11A 4DHZE 4IFSA 4KIKB 2JP2A 4N9F4 2O6VA 2GCJA 4ASWC 5IA7A 1G6JA 3L17A 1TTNA 4JQWC 2JPHA 2KX3A 3PEGA 3L16A 2KKCA 2NZ8B 3SYXA 4K2OA 1MG8A 3K9PB 5L81A 1PQSA 4MEMA 1UGMA 5JZEB 2LZ6A 2RQ1A 4DX8A 5LLIA 3NZSA 2G45B 3KVFB 1KI1B 3PLVA 4HB4B 5C16A 3DDCB 1WMHA 1WVHA 2N1WA 4EZJA 2K6DB 3CMMB 1UZXB 2GMIC 2DHIA 2AWTA 4XWXA 3FP5A 1K8RB 1U27A 1V88A 2FNJB 4IW0A 3QC8B 4W9JA 4B95A 4JLCA 2X18A 3KUDB 2KGXB 4NQLB 5E6NA 2M14A 2MA9B 2K6QA 2K00A 4G0NB 2NCNA 4K7WA 2Q13A 4IM3A 2IFSA 2K8HA 1OGWA 1WRDB 5KCVA 4PS3A 1V9JA 2D9XA 2LI5A 1VD2A 1LB1A 2R2QA 2MBEA 2P0FA 2L0FA 1Q67A 4HDOA 1QZEA 1QC6A 4F8CB 2OOBB 3HQCA 3H9DA 3ZDMC 4ILHA 3ECIA 3FEHA 3IHPC 1V89A 2PEAA 2RUKB 2DHJA 3VTUA 1I35A 2C7HA 3AU4A 1KM7A 5E6PA 2L05A 3CF6E 4WJNA 1P3QU 2ZVOA 2L1CA 4HB0B 1EUVB 2WX0A 3QJZA 4IWQA 4JKCA 2R0DA 2ZEQA 1L2NA 1BTKA 2YRYA 2LXCA 3UQBA 2KC1A 5DHFB 3I3TB 3VUYA 2OJRA 4FN2A 4JKGB 4II2B 2LASA 3QHTA 2G3QB 4FA6A 3PSCA 2VSZA 3APFA 4ZRKA 4BOSC 2ADZA 3EHVA 1LFDA 4MM3A 2KVRA 2ELBA 2ZCBA 3ULBA 3O65B 4HAXB 3QQ8B 4ZDVA 3QAQA 4EUTA 5D94A 1J19A 2CQUA 3H1UA 3F0WA 1V61A 2KFKB 3UF8A 1DIKA 3DVNU 1LW3A 4I6NB 5C79A 2KK8A 4HJKA 3KH0A 2YT1A 3C0RB 3EC8A 2KC2A 2G4DB 5G2NA 3PVWA 2KWCA 5EDSA 1WM2A 1DDWA 1FOEA 5D3VA 2DA0A 1KC7A 2BYEA 5J3QA 1OEYJ 2DENB 2KWUB 3KRWA 1X1FA 4KHBB 1WG7A 4BKGA 3ML8A 1Z5SB 4W9KA 1UNPA 4KSLC 3HIZA 4FJVB 2KTRB 2GJYA 3JW0X 1AARA 1WR6E 4GGQA 3DBRI 3CXBB 4DHZB 1ZC4B 1WZ3A 3B1LX 3M1IB 4HK2A 4FBJB 3A4SC 3PREA 1WGYA 5LXIB 1SIFA 5JHGA 1M94A 1U2BA 2CR5A 2JT4B 1WXMA 1WJ1A 3D32A 4MGZE 1TBEA 4JIOU 2LGDA 1UH6A 2PZ1A 4HAUB 1NTYA 4LDTB 3LJ3A 4K2PA 4JKGA 2JZ3B 2O2VB 5C23A 2Z0EB 1WGQA 4G3XB 2C7MB 2FJLA 3IFWB 5KHOA 3U8ZA 4WWOA 3QIJA 4EKUA 4I6LB 4LJPB 3M63B 1MK9B 3R66C 4GDKB 2EMTA 2BKFA 3DVGY 1AQCA 4ICVA 2V4LA 4BKSA 2YS5A 4KHAA 3VUWA 2L8JA 1UPQA 4E74A 2GS0A 1WI0A 1DBHA 2FCNA 3ZUNA 3E66A 3Q3FA 3PHXB 1EVHA 3GYPA 4KAXB 2RGNB 1H4RA 3W1SA 3RD2A 2KMCA 4DX90 5G55A 1EF5A 2AYOB 3AU5A 2MBQA 4HVBA 1GG3A 3SDLC 2DKQA 2WYQA 2VRRB 4KDLB 3ZNZB 5L95C 1WX7A 1BT0A 2KLGA 2EJ8A 3DBLI 4X57B 1N3HA 1AWEA 1E7UA 4WWNA 1HBKA 3M3JA 1S1QB 2YF0A 3KUZA 5CTRC 4RMAA 2A4ZA 3NS8A 3VAWA 4IOYX 2RVBB 3WIMA 1RFAA 1WI1A 3DXDA 3L0WB 2K2UA 5JHBA 1SGHA 2Z0QA 2M17A 2K8BA 2D9VA 3TBLD 2G35A 5AEKB 3BJIA 1K5DB 4NY0A 1RAXA 3PPAA 4MDKE 4WVFB 3JVZX 2CS4A 2KANA 4FADA 1Y8RC 4ZRIA 3VOQA 4AJYB 1X86A 1X1GA 3UQAA 2GBRA 3IVFA 4DDID 3UZTA 4TV3A 2MBOA 3HK0A 2COAA 4EEWA 4HAWB 2FCSA 1J0GA 2M38A 2XK5B 1E5WA 4PS7A 4JK7A 2LRUA 4EMOA 1M7EA 1X05A 2CHWA 2NR2A 1FB8A 3H7SA 2MX2A 4MSMB 2N23A 1FAOA 2DYBA 3DPDA 1PLSA 3T9LA 1EO6A 1Z2MA 4LDTD 2OTXA 3HW2B 3A9KB 3RCZA 1GC7A 1U29A 5D3YA 3SO6A 1HE8A 5IJMA 1FHOA 5J2RA 1WMHB 1YX5B 3PS6A 1R4NI 3QX1A 1VCBA 3BY4B 4HPMB 3ZKJC 3HHMA 2WH5A 2O6VB 3KZ1A 2E2XA 2J0KA 2V3SA 5CX3A 3V5WA 4K17A 3NOBA 2I5CA 5CLLB 1X11A 1HB8A 4B6WA 1P6SA 1ZVRA 3SBTA 4A5KA 4II3B 1C1YB 4JKHA 1WGRA 2ZPNA 2C5LC 3ZNHB 1WM3A 2C60A 1UPRA 2P0DA 2KZRA 1S3SG 5JHHA 1P0RA 4A20A 2UZRA 4ANXA 2PE9A 3OJ3A 5D3WA 2FJ9A 3H7PA 3APDA 2Y5BB 2UYZB 3IBEA 3JSVA 5DPSA 2N7DA 2L2IA 2BPSA 3T06A 1FHXA 1Q1OA 3R7RA 2DYOA 3A33B 4YL8A 3ZRFA 4JKAA 2MRPA 4A6FA 2CY4A 1BAKA 2GBNA 2V1YA 2YLMA 4GXBA 1KLVA 2OQBA 4BBNF 5KQ4A 2HTHA 2NBWB 2Z0OA 1XD3B 3A9KA 2IY0B 3CSFA 2HJ8A 3SD5A 2FIFA 2GOWA 1WYWB 1XQQA 5L83A 3DXEA 4CHMA 4IWPA 3VIAA 2K1FA 4BFRA 2GBMA 3VQIA 4XZ4A 4WSFA 2EC1A 1T0YA 3SNHA 1UD7A 3DBSA 3VH3B 2RGFA 2DTCA 1WXSA 1EF1A 4M8NA 2GCLA 2C7NB 4JK8A 1JDEA 2RD0A 4ZYNA 2MWSB 2M4NA 2BYVE 3A1QA 1UEFA 1WR1A 4WAAA 3WALA 4BVUC 4NNJB 2KFJA 5JLJB 2JVCA 1SHCA 1Q5WB 3CIKA 1H8CA 2IY1B 3TCAA 2MSED 5C5BB 2LD9A 2IO1B 3DCGA 1D3ZA 2LOXA 2DX1A 1K5GB 3KYCD 4J6IA 3PVUA 4W9GA 4HATB 4FJZA 4OVUA 4ILJA 2CY5A 2KJHB 2LYDA 2AEHA 3OAWA 2VRWB 2DKPA 2DAJA 5JP4A 1WX9A 2M8SA 3ONSA 1WY8A 1VBHA 1U4AA 1OMWA 4HAVB 1EAZA 3NZUA 3V6CB 3P2BA 3SUZA 4L6EA 3A98B 4GB9A 2NS5A 2PE6B 2FAZA 3VHTC 4NJ6A 2J59M 4HWIB 1WJUA 2MCNB 2L0TA 1NBFC 1V80A 1V5MA 1WE7A 5LXHA 5J3TA 2YT0A 1UBIA 2MP2B 5IAAC 4HAYB 1DDVA 5HE2A 4BKTA 2XK5A 1RLFA 4M0WB 4CHKA 5D7GA 3ZNID 2KDFB 3MDBC 4GZUA 5LOPB 3UINB 4G50A 3PZDA 2KCJA 5D3XA 3UGBB 2KQ7A 2KQSA 1M7RA 2IYDB 1WGUA 1KOTA 1ISNA 3ENEA 1DYNA 1IYFA 3DOWA 2JF5A 2MBBB 2DX5B 4A3OA 1KBLA 3E9OA 1V6EA 2KJRA 1BTNA 4WJOA 2COCA 2UWQA 4JGHB 5C6RA 3WAMA 3OLMD 1ZSQA 2R09A 2LULA 3QK0A 3ZW3A 2MFQA 4ILGB 2LGXA 2J0MA 1NTVA 3X0WA 3F5RA 2UVMA 2RPQA 1J8CA 3ULCA 2BGFA 3ZDTA 4GDLA 4A6KA 2ROVA 3PG7A 1TXDA 1XD4A 3RUIB 2JUOA 3M62B 4JKFA 1SE9A 2DN6A 2NMBA 3MJWA 1E7VA 2Z0PA 4EZLA 3ZO5B 4EOYA 3PVLA 1TZ1A 2DZJA 2MWNB 1OQYA 1TJ6A 4JKDA 4WJ7A 2RLOA 1Z87A 3RZFA 3PP2A 2KUPA 1I42A 2I5FA 3NY5A 3V62A 2J7QB 1Q0WB 2B3AA 3PV1A 2Y8GA 1WE6A 2D4QA 2LBBA 3KRXA 2N9PC 1UBQA 1MAIA 2O2VA 3A9JB 2CHZA 3ZLZA 4NAWB 2W2XC 4PNKA 4FLHA 3ZVRA 3ZRCA 3DVNV 5C1ZA 2P0HA 2FCQA 4MGKE 5HE0A 1WJ6A 1QQGA 2LOZA 2JXXA 2N7EA 1ZKHA 4ICUA 4PYUA 5FR6A 5AZGA 1J0WA 4OVVA 1HB6A 3UIPB 3PSEB 1LQBA 1WJMA 3ZTDA 2HD5B 1XCGA 2C9WB 1MIZB 1FHWA 2IO2B 3WYFB 3VTVA 2KLCA 4JK9A 5DPRA 4E3CA 1LXDA 2NBVB 3JSVB 1F9JA 4NSWA 3RT3B 5DPWA 1ZM0A 1WGDA 2FCMA 3CSTA 3HM3A 1P1AA 4JKBA 5D2MB 4Z2MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K7S A;  2RUK B;  4W9L A;  2DHJ A;  3RYT A;  4W9D A;  3ODX A;  3Q3J A;  2FDQ A;  3VTU A;  4LJO B;  3ZIM A;  3KYD D;  1I35 A;  3ODO A;  3PHW B;  4K1R B;  5J2R A;  2C7H A;  3AU4 A;  1UNR A;  4A5K A;  3N7C A;  2N4F A;  1GC6 A;  1C1Y B;  1V5O A;  2CKH B;  4II3 B;  1U5D A;  2NVU I;  1WGR A;  2ZPN A;  1KM7 A;  2C5L C;  3ZNH B;  5E6P A;  2L05 A;  5DHA B;  1WM3 A;  2C60 A;  1LM8 B;  3CF6 E;  2R2O A;  1PMS A;  4WJN A;  1UPR A;  2MKR A;  2P0D A;  3PS6 A;  2I1K A;  2KZR A;  3QBV B;  1P3Q U;  2ZCC A;  1S3S G;  3S2A A;  2NPT B;  2ZVO A;  4WQO B;  5JHH A;  4P7I A;  2DFK A;  2L1C A;  2DZK A;  5FI0 A;  4KHO A;  1EGX A;  1YJ1 A;  2K25 A;  3MPX A;  1P0R A;  4EZK A;  4H8S A;  4HB0 B;  4A20 A;  5CHF A;  2UZR A;  1EUV B;  2WX0 A;  3QJZ A;  2BKR B;  4IWQ A;  2W2W A;  2KTR A;  2MW5 A;  4ANX A;  4DBB A;  2BF8 B;  1GUA B;  2L76 A;  1P5T A;  2R0D A;  3AI5 A;  2ZEQ A;  1L2N A;  1BTK A;  2YRY A;  2KWV B;  2LXC A;  2PE9 A;  3OJ3 A;  5D3W A;  3PRP B;  3UQB A;  3TO1 A;  3ZNG C;  2KC1 A;  1MPH A;  2FJ9 A;  2L7R A;  3H7P A;  2RSG A;  5DHF B;  3P7Z A;  4AUQ C;  3I3T B;  3L08 A;  3VUY A;  2CHX A;  4GDK A;  2OJR A;  3APD A;  2EMS A;  1ACA A;  2Y5B B;  3TMP B;  2UYZ B;  3QAR A;  4FN2 A;  3GZN I;  4II2 B;  3IBE A;  2LAS A;  3JSV A;  3D8F A;  5DPS A;  2N7D A;  2CRF A;  2L2I A;  3QHT A;  2G3Q B;  4IAP A;  4FJY A;  2BPS A;  3L54 A;  4FA6 A;  3PSC A;  3T06 A;  4MH0 E;  1C3T A;  1FHX A;  4DXA B;  2VSZ A;  4CHJ A;  3APF A;  1Q1O A;  1GJZ A;  3R7R A;  2DYO A;  3A33 B;  1NTI A;  4ZRK A;  4BOS C;  4YL8 A;  3ZRF A;  2ADZ A;  2MLB A;  2ZNV C;  2J0J A;  3RCP A;  2ZVN A;  3DBH I;  3EHV A;  1A5R A;  2DLW A;  4HPL B;  4MY6 A;  1LFD A;  3B0A A;  2MRP A;  4MM3 A;  4A6F A;  2KVR A;  4IC7 B;  2CY4 A;  1BAK A;  3ALB A;  2ELB A;  2AL3 A;  2QKL A;  3ULB A;  2GBN A;  2V1Y A;  2YLM A;  2ZCB A;  3HM6 X;  4GIV A;  4BOZ B;  3O65 B;  3H7P B;  4HAX B;  4GXB A;  4A3P A;  1KLV A;  5KQ1 A;  2ZJD A;  3A8P A;  4A6H A;  2LRW A;  2OQB A;  4HDQ A;  3QQ8 B;  3VH4 B;  2PJH A;  3QAQ A;  1U5G A;  4EUT A;  4ZDV A;  5CHV C;  1WF9 A;  2YVC A;  4BBN F;  2LVQ A;  3ML4 A;  3V6E B;  5D94 A;  5KQ4 A;  3N3K B;  2HTH A;  2NBW B;  2Z0O A;  1XD3 B;  2KN5 A;  1J19 A;  2CQU A;  2IY0 B;  3A9K A;  4MT7 A;  2HTH B;  2QHO A;  3H1U A;  1WFY A;  4TUU A;  2ZPY A;  1IRS A;  5J18 A;  4ZRJ A;  2A5U A;  3CSF A;  4W9F A;  1NVL A;  2HJ8 A;  3SD5 A;  2FIF A;  2VKI A;  5J17 A;  2GOW A;  5JHA A;  1WYW B;  3F0W A;  1V61 A;  1XQQ A;  2KFK B;  1FXT B;  4HLE A;  3A4R A;  3UF8 A;  5L83 A;  3DXE A;  2DX5 A;  1TQZ A;  4CHM A;  3DVN U;  3OJ4 B;  3VIA A;  4IWP A;  1LW3 A;  1NI2 A;  3O96 A;  5C79 A;  2KK8 A;  4I6N B;  2K1F A;  4HJK A;  3A8Q A;  4KV2 A;  4BFR A;  1RJ2 A;  3W1Y A;  2FID A;  2GBM A;  3LJU X;  3KH0 A;  4XZ4 A;  4WSF A;  4NQK E;  4LCD E;  3VQI A;  2YT1 A;  4TQ0 A;  3KUC B;  3C0R B;  2EC1 A;  1T0Y A;  3EC8 A;  1WZ0 A;  2L3Z A;  2O6V D;  4PYZ A;  1R4M I;  2KC2 A;  2N0Y A;  2I1J A;  2G4S A;  2N9X A;  3VTW A;  2G4D B;  2K8C A;  2BWF A;  3MTN B;  5G2N A;  3SNH A;  3AXC A;  3PVW A;  4TYZ A;  4YON A;  4F7U P;  4MK0 A;  1UD7 A;  2KHW B;  2KWC A;  3DBS A;  5EDS A;  1WM2 A;  1DDW A;  1FOE A;  1ZW7 A;  2RGF A;  3NHE B;  3VH3 B;  2DTC A;  2KDI A;  3N30 A;  5D3V A;  1EF1 A;  2DA0 A;  2GCL A;  1WXS A;  2BYE A;  5J3Q A;  1OEY J;  1FGY A;  1XOD A;  2C7N B;  2DEN B;  2KWU B;  2IZV B;  3KRW A;  1X1F A;  2LGY A;  2RD0 A;  4KHB B;  5DIF B;  4ZYN A;  2MWS B;  2M4N A;  4IWO A;  4F7G A;  2CAY A;  1WG7 A;  4BKG A;  3ML8 A;  5DI9 B;  1Z5S B;  2MP2 A;  1UNP A;  2BYV E;  3A1Q A;  4KSL C;  5DH9 B;  4W9K A;  3RUL A;  4D0N B;  2ZNV B;  3HIZ A;  3PLU A;  2XEW A;  4FJV B;  1UEF A;  2COF A;  1WR1 A;  4WAA A;  5HE3 A;  1WJN A;  2KTR B;  4K7U A;  4WWP A;  4MJS A;  5CHW A;  2LKO A;  3WAL A;  4BVU C;  2GJY A;  2WDT B;  3FLV A;  2YS3 A;  4K81 A;  4NNJ B;  4HAZ B;  4C0A A;  2KFJ A;  5JLJ B;  4TKN A;  3JW0 X;  2JVC A;  1SHC A;  1Q5W B;  4B9K A;  3CIK A;  3D8D A;  1AAR A;  5HKH A;  3VUX A;  1MIX A;  1H8C A;  3P6A A;  1E8X A;  2HE7 A;  1WR6 E;  2DHK A;  4GGQ A;  3OAN A;  2IY1 B;  3TCA A;  3W1S C;  4GU2 A;  2MSE D;  2RSU A;  3DBR I;  5C5B B;  2LD9 A;  4PS8 A;  3TL5 A;  3CXB B;  2IO1 B;  4DHZ B;  5CLQ B;  1OQN A;  4CYE A;  1ZC4 B;  3DCG A;  1WXV A;  1WZ3 A;  3PRZ A;  3B1L X;  1D3Z A;  3M1I B;  2GBK A;  5EFX A;  4HK2 A;  2LOX A;  4FBJ B;  2ASQ A;  1K5G B;  2DX1 A;  3H6N A;  3KYC D;  4NPN A;  3VXW A;  3PTF C;  2LWP A;  2NPT A;  3A4S C;  3PRE A;  4J6I A;  1WGY A;  3PVU A;  2DZI A;  1U5E A;  2KXJ A;  4W9G A;  1SIF A;  4URK A;  5LXI B;  5JHG A;  4HAT B;  4FJZ A;  2Z0D B;  2LJ5 A;  4OVU A;  2LVP A;  1M94 A;  1MK7 B;  5BO4 B;  2IO0 B;  4F1S A;  2DYN A;  1U2B A;  2CR5 A;  3KW5 B;  2JT4 B;  5AZH A;  2MQJ A;  5GOW B;  4JGH B;  2CY5 A;  1WXM A;  1YQB A;  2DZM A;  2KJH B;  3WAO A;  1U5F A;  1WJ1 A;  2LYD A;  3WAN A;  3D32 A;  2AEH A;  3OAW A;  4MGZ E;  2RNR B;  2VRW B;  2DKP A;  4WJQ A;  2DAJ A;  1TBE A;  1TGZ B;  5JP4 A;  1WX9 A;  2M8S A;  3ONS A;  3D8E A;  4JIO U;  2LGD A;  4IM0 A;  1UH6 A;  1WY8 A;  2PZ1 A;  3RZW C;  4HAU B;  3ML9 A;  2P8V A;  1U4A A;  2ZZP B;  1NTY A;  4LDT B;  4E71 A;  3LJ3 A;  1OMW A;  4HAV B;  2Z59 B;  1EAZ A;  3NZU A;  2KD0 A;  4K2P A;  4B6H A;  1P3R A;  3V6C B;  3AUL A;  1E8Z A;  3P2B A;  3SUZ A;  2D2Q A;  2W2X D;  1X1M A;  4GOC A;  4HHV A;  4L6E A;  2NBU A;  4WJP A;  4MGI E;  3A98 B;  4GB9 A;  2JZ3 B;  2KTF A;  4JL9 A;  1Y19 B;  2NS5 A;  2PE6 B;  2FAZ A;  3VHT C;  1ST7 A;  1WH3 A;  4NJ6 A;  2J59 M;  1OEY A;  3TVV A;  5HE1 A;  1XR0 B;  3N32 A;  2COD A;  2M0X A;  2CU1 A;  2O2V B;  5DCN A;  2Z0E B;  1WGQ A;  5C23 A;  4G3X B;  3VVW B;  2GBJ A;  4HWI B;  3UIO B;  1CMX B;  1WJU A;  2C7M B;  2FJL A;  3IFW B;  5KHO A;  2MCN B;  1I2H A;  2L0T A;  1NBF C;  3U8Z A;  1V5M A;  1V80 A;  1WE7 A;  1KZG A;  1ZGU B;  2DAF A;  4WWO A;  3EPY A;  5LXH A;  1XT9 B;  3MHS D;  5J3T A;  2YT0 A;  4M8N A;  3KSY A;  3B08 A;  1UBI A;  2MP2 B;  5IAA C;  4HAY B;  1E90 A;  1DDV A;  3QIJ A;  4EKU A;  2BYF A;  5HE2 A;  2JRI B;  2JWZ A;  1P9D U;  3PV1 A;  3VDZ A;  4BKT A;  4I6L B;  2XK5 A;  4ANU A;  1RLF A;  4LJP B;  4M0W B;  4CHK A;  4NAW A;  5D7G A;  3ZNI D;  2MDX A;  2YS1 A;  3M63 B;  4AJW A;  2KDF B;  2CB8 A;  2H7E A;  4GMX B;  1MK9 B;  3KY9 A;  3R66 C;  4RM8 A;  4F7H A;  2JY6 A;  1YX6 B;  4KIK A;  4GDK B;  2EMT A;  2BKF A;  4W9E A;  1V81 A;  2UZS A;  2D07 B;  3A9J A;  3DVG Y;  3QA8 A;  4AOF A;  4PQ0 A;  3MDB C;  4DHJ B;  2KJ6 A;  4GZU A;  1KJT A;  1AQC A;  5LOP B;  2LG1 A;  3UIN B;  2WX1 A;  4XX5 A;  5D27 A;  4G50 A;  1W1G A;  3PZD A;  3QWM A;  2V4L A;  2KCJ A;  2YS5 A;  4KHA A;  5D3X A;  4ICV A;  3UGB B;  4BKS A;  3M95 A;  2D9W A;  3VUW A;  2KQ7 A;  2KQS A;  2LVO A;  1M7R A;  2L8J A;  4FUL A;  2IYD B;  3R3M A;  1UPQ A;  1WGU A;  3V61 A;  4E74 A;  2GS0 A;  5KHQ A;  4HB2 B;  1KOT A;  1ISN A;  4DBG A;  1WI0 A;  2D10 A;  1DYN A;  1DBH A;  2IO3 B;  3ENE A;  1IYF A;  2ABD A;  3X23 A;  2FCN A;  3DOW A;  4HXD A;  2JF5 A;  2MBB B;  4W9I A;  3ZUN A;  2DX5 B;  5LON B;  4KZC A;  4A3O A;  3Q3F A;  2KDE B;  1W1D A;  1DDM A;  3EFU A;  2M1M A;  3PHX B;  4HCP B;  1V6E A;  5JH5 C;  1EVH A;  1P6S A;  1BTN A;  2KJR A;  4WJO A;  2REX A;  2COC A;  3GYP A;  4KAX B;  1V5T A;  2RGN B;  1V5P A;  2D9Z A;  2UWQ A;  3DVG X;  3FSS A;  1H4R A;  5C6R A;  2KO3 A;  4MGY E;  1V86 A;  3RD2 A;  3W1S A;  3WAM A;  3OLM D;  1ZSQ A;  2KMC A;  2R09 A;  2KNB A;  2D11 A;  2LUL A;  4DX9 0;  4GN1 A;  1OY2 A;  3SV1 A;  1YD8 U;  1ZC3 B;  3APC A;  5G55 A;  3QK0 A;  5TR5 A;  1EF5 A;  2AYO B;  4EFO A;  1WXA A;  3ZW3 A;  1UNQ A;  2MFQ A;  3AU5 A;  1I7A A;  5J3Y A;  2IBI B;  2L00 B;  2LGX A;  2D9Y A;  3G9W A;  2J0M A;  2MBQ A;  1NTV A;  4MSQ B;  4BKS D;  3PT2 B;  4HVB A;  3X0W A;  2IYB A;  1NDD A;  3F5R A;  1GG3 A;  1V5U A;  1XKE A;  3BIN A;  3SDL C;  2DKQ A;  4A6F B;  1OTR B;  2VRR B;  2WYQ A;  4KDL B;  2Y7B A;  3ZNZ B;  5L95 C;  2UVM A;  5GMV A;  1WX7 A;  2COP A;  2RPQ A;  1BT0 A;  2DYM A;  1WGG A;  1J8C A;  3ULC A;  2BGF A;  2N1V A;  4HB3 B;  3DQV A;  2KFK A;  2KLG A;  3V60 A;  3ZDT A;  1V2Y A;  2EJ8 A;  4A6K A;  4Y94 A;  3DBL I;  4GDL A;  2ROV A;  3SHQ A;  3PG7 A;  1TXD A;  1XD4 A;  3PRM B;  4FHK A;  1NU2 A;  1L7Y A;  3RUI B;  2K39 A;  4X57 B;  4XC2 A;  1N3H A;  1AWE A;  2JUO A;  3M62 B;  2QKM A;  1SE9 A;  1E7U A;  1WJ4 A;  4WWN A;  2Y8F A;  1HBK A;  3M3J A;  1S1Q B;  2DN6 A;  2YF0 A;  3LDZ E;  3KUZ A;  3PGE A;  3WA0 A;  2NMB A;  1W1H A;  5DPT A;  1IPG A;  1GNU A;  5CTR C;  5DPR A;  2D3G A;  4GMV A;  3MJW A;  5C5B A;  4E3C A;  1E7V A;  1MKE A;  2Z0P A;  2KDB A;  2KX0 A;  4I6P A;  4KSK C;  5E6O A;  4EZL A;  4ANW A;  1E8Y A;  1JRU A;  3ZO5 B;  4EOY A;  3PVL A;  3DXC A;  4RMA A;  1TZ1 A;  2A4Z A;  3NS8 A;  3QWZ B;  1RRB A;  4KVG B;  1IP9 A;  3VAW A;  3U7D A;  2DZJ A;  3JYU A;  4IOY X;  2JRH A;  3NSU A;  4MEL A;  2RVB B;  3TFM A;  4Z2N A;  3WIM A;  3EEC A;  2DHZ A;  1RFA A;  1WI1 A;  2MWN B;  3DXD A;  1WIA A;  3L0W B;  3ZTC A;  4W9H A;  1OQY A;  3U30 A;  2HRJ A;  2K2U A;  1TJ6 A;  1E8W A;  4NJ7 A;  5JHB A;  1SGH A;  2Z0Q A;  3WAP A;  2M17 A;  1KZ7 A;  4G11 A;  4DHZ E;  3GOE A;  4IFS A;  4KIK B;  2JP2 A;  4N9F 4;  4WJ7 A;  2YSZ A;  2RLO A;  2O6V A;  4AWJ A;  2H7D A;  2K8B A;  3GYO A;  1P98 A;  2D9V A;  2GCJ A;  3TBL D;  4DWF A;  4ASW C;  1Z87 A;  2KMA A;  3RZF A;  4F7Z A;  2G35 A;  3TW1 A;  3PP2 A;  4M8M A;  4TQ1 A;  5AEK B;  3L17 A;  5IA7 A;  1G6J A;  2KUP A;  2DYQ A;  3BJI A;  1K5D B;  4NY0 A;  4PS3 A;  1I42 A;  2I5F A;  1TTN A;  3NY5 A;  4JQW C;  3T8M A;  3V62 A;  2J7Q B;  2JPH A;  1Q0W B;  1RAX A;  2B3A A;  3PPA A;  4MDK E;  4KDI C;  5AZF A;  2KX3 A;  4BBK A;  4WVF B;  3JVZ X;  2CS4 A;  3PEG A;  2Y8G A;  5FI1 A;  1DRO A;  2D4Q A;  2LBB A;  1WE6 A;  2KAN A;  1Y8R C;  2KKC A;  3L16 A;  4FAD A;  1XX0 A;  4ZRI A;  3KRX A;  2NZ8 B;  3SYX A;  3VOQ A;  4AJY B;  1X86 A;  4MJS B;  4HCN B;  4K2O A;  1X1G A;  2N9P C;  3UQA A;  1UBQ A;  3IVF A;  2GBR A;  1MAI A;  1MG8 A;  2O2V A;  2XBB C;  3A9J B;  3TIX A;  4DDI D;  1B55 A;  1FGZ A;  3UZT A;  2CHZ A;  4TV3 A;  3K9P B;  2FUH B;  2MBO A;  3ZLZ A;  3HK0 A;  5L81 A;  1PQS A;  2ELA A;  4MEM A;  2LUE A;  1UGM A;  5JZE B;  4NAW B;  2W2X C;  2COA A;  4PNK A;  4FLH A;  4EEW A;  2LZ6 A;  4HAW B;  1YIW A;  3ZVR A;  3ZRC A;  2RQ1 A;  2FCS A;  3DVN V;  2W9N A;  5C1Z A;  1J0G A;  2M38 A;  4DX8 A;  2P0H A;  5LLI A;  3VTV A;  3NZS A;  1H10 A;  2G45 B;  2XK5 B;  3KVF B;  2FCQ A;  1KI1 B;  3R7Q A;  3L10 B;  4MGK E;  3PLV A;  4HB4 B;  1E5W A;  5C16 A;  5HE0 A;  1WJ6 A;  4PS7 A;  3DDC B;  1WMH A;  1QQG A;  1PFJ A;  1WVH A;  2LOZ A;  2JXX A;  1RRP B;  4EMO A;  1M7E A;  2LRU A;  2K6D B;  2N1W A;  2N7E A;  1ZKH A;  4EZJ A;  3CMM B;  4ICU A;  4PYU A;  5FR6 A;  1X05 A;  4KZ0 A;  1J0W A;  5AZG A;  4GPT B;  1UZX B;  3QCA A;  2GMI C;  1WX8 A;  4EJN A;  2CHW A;  4AP4 C;  2WWZ A;  2DHI A;  2NR2 A;  2AL6 A;  3L13 A;  1FB8 A;  2AWT A;  4XWX A;  3H7S A;  4W9C A;  2MX2 A;  4GSW A;  4MSM B;  3FP5 A;  4OVV A;  2N23 A;  1K8R B;  4ANV A;  1U27 A;  1V88 A;  1HB6 A;  2BCJ A;  1FAO A;  2DYB A;  3IG3 A;  3UIP B;  3DPD A;  4CO7 A;  1PLS A;  2FNJ B;  3PSE B;  4IW0 A;  3QC8 B;  4W9J A;  3T9L A;  4B95 A;  1EO6 A;  2X18 A;  4JLC A;  4IUM B;  1LQB A;  3KUD B;  1Y5O A;  1Z2M A;  2KGX B;  2N9E B;  1WJM A;  4GDL B;  4LDT D;  4NQL B;  2OTX A;  4RM9 A;  3HW2 B;  5E6N A;  2M14 A;  3A9K B;  3RCZ A;  3ZTD A;  2MA9 B;  2HD5 B;  1GC7 A;  2K6Q A;  3SU8 X;  3TJP A;  3ZVV A;  2LXA A;  1U29 A;  1XCG A;  5D3Y A;  1MIZ B;  2K00 A;  1FHW A;  3SO6 A;  2C9W B;  2IO2 B;  2NCN A;  4G0N B;  4K7W A;  1HE8 A;  5IJM A;  2Q13 A;  3K9O B;  4IM3 A;  1FHO A;  2IFS A;  2EKE C;  1WGH A;  5D6J B;  1UEL A;  2K2J A;  2K8H A;  2V76 A;  1OGW A;  5KCV A;  1WMH B;  3WYF B;  1R4N I;  1WRD B;  1YX5 B;  2BWE S;  1V9J A;  2D9X A;  1VCB A;  1BWN A;  2MBH A;  2KOX A;  2PPH A;  3BY4 B;  3QX1 A;  4IG7 B;  2JZZ A;  4DHJ D;  3VFK A;  4HPM B;  2LI5 A;  2KLC A;  1VD2 A;  4DDG D;  3ZKJ C;  3HHM A;  1LB1 A;  4DK5 A;  2R2Q A;  3A1Q B;  2WH5 A;  2MBE A;  2O6V B;  2P0F A;  3KZ1 A;  1LXD A;  2NBV B;  2L0F A;  4IM2 A;  1Q67 A;  2E2X A;  2J0K A;  1F9J A;  2V3S A;  3JSV B;  5CX3 A;  4HDO A;  2XQN M;  4NSW A;  3V5W A;  1QZE A;  3RT3 B;  4BBN C;  1QC6 A;  4F8C B;  2OOB B;  5DPW A;  3HQC A;  3H9D A;  2RR9 A;  4K17 A;  3ZDM C;  3NOB A;  1ZM0 A;  3AJ4 A;  2I5C A;  1V49 A;  1WGD A;  3FM8 C;  5CLL B;  3FEH A;  2FCM A;  1X11 A;  3CST A;  3ECI A;  3HM3 A;  1P1A A;  1HB8 A;  4B6W A;  4FHJ A;  3IHP C;  4Z2M B;  5D2M B;  2ROZ B;  1V89 A;  2PEA A;  3ODW A;  1ZVR A; 
#chains in the Genus database with same CATH topology
 1GGO A;  2RDH A;  3RYT A;  2FDQ A;  3LYY A;  3PHW B;  4K1R B;  2MJE A;  1V5O A;  3NVZ A;  2K0P A;  1PMS A;  2I1K A;  2ZCC A;  3S2A A;  2NPT B;  5FI0 A;  4KHO A;  1EGX A;  1YJ1 A;  1FFU A;  3RI7 C;  3N20 C;  3MPX A;  2INP E;  4H8S A;  2BKR B;  2MW5 A;  1QOG A;  2Y5C A;  1GUA B;  4A8X C;  1RM6 C;  1TKG A;  2L7R A;  2RSG A;  3RNA C;  3P7Z A;  4AUQ C;  2CHX A;  3NG0 A;  1F2R C;  2EMS A;  1ACA A;  3TMP B;  3QAR A;  4C56 C;  5FR3 A;  3D8F A;  2CRF A;  4IAP A;  2V3P A;  4YXD B;  1GJZ A;  1VDV A;  1A5R A;  2MLB A;  2DIK A;  2J0J A;  3RCP A;  2ZNV C;  2ZVN A;  3DBH I;  2QDF A;  4MY6 A;  2QC8 A;  4RNA A;  5GXG B;  4IC7 B;  4Q2J A;  4RM9 A;  1JWS D;  2AL3 A;  4BOZ B;  2QKL A;  1EM7 A;  3HM6 X;  4GIV A;  1A70 A;  1BML C;  3V3X A;  5KQ1 A;  1ACC A;  1T6B X;  2LRW A;  2LMC A;  1U5G A;  1WF9 A;  1SB3 C;  1ROE A;  1XLO A;  3N3K B;  4MT7 A;  2HTH B;  2QHO A;  1WFY A;  4TUU A;  2ZPY A;  1IRS A;  2IGH A;  1NVL A;  1WGK A;  2VKI A;  2M56 B;  2J52 A;  1OQR A;  4C4V A;  4OSN A;  2SAK A;  1FM0 D;  1JRO A;  1TQZ A;  1NI2 A;  3O96 A;  3EA6 A;  3A8Q A;  3KWL A;  4LCD E;  1E6E B;  4YTM B;  1F77 A;  2D3A A;  2OHF A;  3N9Y C;  1HZ6 A;  2Y5P A;  4TQ0 A;  2L3Z A;  2O6V D;  4PYZ A;  2N9X A;  2N0Y A;  2G4S A;  3AE5 B;  3VTW A;  2K8C A;  4BAX A;  4TYZ A;  2KHW B;  1ZW7 A;  3NHE B;  1QLB B;  3N30 A;  1XOD A;  2LGY A;  4O1N A;  5DIF B;  2Z8L A;  4P1C C;  5AUK A;  4IWO A;  2CAY A;  3I63 C;  5DI9 B;  3RUL A;  4D0N B;  4WWP A;  5HE3 A;  4K7U A;  2WDT B;  4K81 A;  4LK0 M;  4HAZ B;  4C0A A;  4TKN A;  2WHI A;  5HKH A;  5LG4 B;  3ZYY X;  3P6A A;  1E8X A;  3W1S C;  2DHK A;  2RSU A;  4PS8 A;  3TL5 A;  5CLQ B;  1OQN A;  2GBK A;  3AH7 A;  4JWS C;  2ASQ A;  3H6N A;  4NPN A;  1YNT E;  1HZ5 A;  2NPT A;  4D6W A;  1J7A A;  2LVP A;  4QJ3 B;  3KW5 B;  2MQJ A;  3C8Y A;  1YQB A;  4YTN B;  1U5F A;  3WAN A;  4HKQ A;  2RNR B;  4WJQ A;  1QOB A;  3D8E A;  3RZW C;  4DQO C;  2ZZP B;  1P3R A;  3AUL A;  3AEE B;  2D2Q A;  1X1M A;  4LNI A;  4MGI E;  2KTF A;  1ST7 A;  1OEY A;  3N32 A;  5DCN A;  2GBJ A;  2KQ4 X;  3UIO B;  3GP7 A;  3GS2 A;  4KGT A;  1SE3 A;  3Q6B A;  1KZG A;  2MH7 A;  3EPY A;  1XT9 B;  3MHS D;  3B08 A;  2PIA A;  4FXC A;  1VR9 A;  2BYF A;  4C80 A;  2PTL A;  3KQ4 A;  1UGJ A;  2YS1 A;  4TMA B;  5BMG A;  2EKI A;  2H7E A;  4GMX B;  3KY9 A;  4RM8 A;  4F7H A;  2JY6 A;  1YX6 B;  4KIK A;  2WDV B;  4W9E A;  1V81 A;  3QA8 A;  4PQ0 A;  1ZOY B;  1PUT A;  2WX1 A;  5D27 A;  3CIR B;  1W1G A;  3QWM A;  1R7S A;  3M95 A;  1NYR A;  4FUL A;  2X0S A;  3TSS A;  1EU4 A;  3W9C B;  4DBG A;  2D10 A;  2IO3 B;  2G1E A;  4L1R A;  3SBG A;  4W9I A;  1PGA A;  5LON B;  2KDE B;  1W1D A;  4H2A A;  1DDM A;  4XDC A;  2KR0 A;  1V8C A;  4NZL B;  1T3Q A;  4E71 A;  1V5P A;  4ARI A;  2KO3 A;  2NTT A;  4R3D A;  2DLB A;  1L4D B;  2BB5 A;  2D11 A;  3ENB A;  4GN1 A;  1OY2 A;  3SV1 A;  1YD8 U;  1ZC3 B;  1V1P B;  2QEJ C;  4USA A;  3SFD B;  3SR6 A;  1I7A A;  2MEK A;  3G9W A;  2WXN A;  3PT2 B;  2IYB A;  1V5U A;  3BIN A;  1OTR B;  2WLB A;  2Y7B A;  5GMV A;  2COP A;  2DYM A;  1WGG A;  4A9A A;  4HB3 B;  3GZN B;  3N1Y C;  2KFK A;  3V60 A;  3A58 A;  5IRS A;  1PGX A;  3PRM B;  4FHK A;  1NU2 A;  1L7Y A;  1MJD A;  2K39 A;  2QKM A;  1WJ4 A;  2Y8F A;  1EU3 A;  2JX5 A;  3LDZ E;  3PGE A;  1W1H A;  1IPG A;  4GMV A;  5C5B A;  2W55 A;  4I6P A;  2KDB A;  2KX0 A;  4ANW A;  1E8Y A;  3U7Z A;  1IP9 A;  3U7D A;  2JRH A;  3Q8F A;  1N60 A;  3NSU A;  4MEL A;  4Z2N A;  4LNK A;  4KHB A;  4AJW A;  1WIA A;  3RPF C;  3ZTC A;  4W9H A;  2HRJ A;  3E9S A;  4HPP A;  1E8W A;  4NJ7 A;  3WAP A;  3GOE A;  1FD6 A;  1K53 A;  2YSZ A;  1QOF A;  1TS4 A;  1XLP A;  4AWJ A;  2H7D A;  3GYO A;  1P98 A;  4DIX A;  4DWF A;  4F7Z A;  2KMA A;  1KF6 B;  3TW1 A;  4M8M A;  4TQ1 A;  2DYQ A;  5IP4 D;  4RCO A;  3IT6 B;  3T8M A;  1ZXI A;  3P4S B;  3IAS 1;  4KDI C;  5AZF A;  4BBK A;  3MHZ A;  1N6Z A;  5FI1 A;  1DRO A;  1XX0 A;  5BMH A;  2RPV A;  4K3C A;  4MJS B;  4HCN B;  1L5P A;  3TIX A;  2XBB C;  3U4E G;  4JKE A;  1B55 A;  1FGZ A;  2ZKM X;  2FUH B;  2IDY A;  2ELA A;  2LUE A;  3E9L A;  3URY A;  4RGT A;  3AEG B;  1HXY D;  1GOZ A;  1YIW A;  3TEX A;  2W9N A;  1H10 A;  3AM9 A;  3R7Q A;  3L10 B;  1YN5 A;  2SEB D;  3R8B A;  1PFJ A;  1RRP B;  1SJH D;  2JSV X;  3AE6 B;  4KZ0 A;  3ETR A;  4GPT B;  1RWS A;  3QCA A;  1WX8 A;  4EJN A;  2R61 A;  4AP4 C;  2WWZ A;  3VRA B;  2AL6 A;  3L13 A;  4W9C A;  2PMV A;  3FIL A;  2FE8 A;  4GSW A;  4L1B A;  1XO3 A;  4ANV A;  2BCJ A;  1FPY A;  3IG3 A;  4CO7 A;  4IUM B;  4GDL B;  1Y5O A;  2N9E B;  3BZD B;  1TKE A;  2FBW B;  2B76 B;  3SU8 X;  3TJP A;  3ZVV A;  2LXA A;  3NWA A;  4ZYS A;  4CQN A;  3K9O B;  1SJE D;  1WGH A;  2EKE C;  2J4X A;  5D6J B;  1UEL A;  2K2J A;  2V76 A;  3E9P A;  2KOX A;  2BWE S;  2PPH A;  1V1P A;  2MBH A;  1BWN A;  4IG7 B;  4DHJ D;  2JZZ A;  3VFK A;  4DDG D;  1YJJ A;  1ESF A;  1YQ4 B;  4DK5 A;  3A1Q B;  3FVC A;  2KDM A;  4IM2 A;  3TUO A;  1CJE A;  1TS2 A;  2XQN M;  4BBN C;  2RR9 A;  1JML A;  3AJ4 A;  1V49 A;  3FM8 C;  5EE1 A;  3NWF A;  3NZ3 A;  4FHJ A;  1ZDV A;  2ROZ B;  3ODW A;  2AQ2 B;  4K7S A;  4W9L A;  1YMH E;  4W9D A;  3ODX A;  3Q3J A;  4LJO B;  3ZIM A;  3KYD D;  3ODO A;  2BVC A;  1UNR A;  2NMQ A;  3N7C A;  2N4F A;  1GC6 A;  2CKH B;  2WU2 B;  1U5D A;  2NVU I;  4WQM A;  1PDX A;  5J18 A;  5DHA B;  1LM8 B;  2R2O A;  2MKR A;  1VZ7 A;  4OVZ A;  3QBV B;  5AUI A;  4WQO B;  4P7I A;  2DFK A;  2DZK A;  2GB1 A;  2K25 A;  5IO9 A;  1LGR A;  4EZK A;  2WXK A;  1FXA A;  5CHF A;  2W2W A;  4J3O D;  2KTR A;  4LNO A;  4DBB A;  2BF8 B;  2L76 A;  1P5T A;  3AI5 A;  2KWV B;  1T77 A;  5D3I B;  3PRP B;  3TO1 A;  2JU6 X;  3ZNG C;  1MPH A;  3FKY A;  1QOA A;  3L08 A;  4GDK A;  1K52 A;  3GZN I;  4XE0 A;  2K8E A;  4FJY A;  1C3T A;  3L54 A;  4MH0 E;  4DXA B;  4CHJ A;  4S17 A;  3AE1 B;  1NTI A;  2H89 B;  1MFW A;  2R82 A;  5IOI A;  2DLW A;  4HPL B;  3B0A A;  2W3R A;  3ALB A;  3H7P B;  2V9H A;  4A3P A;  2ZJD A;  3A8P A;  4A6H A;  2D3B A;  3BK1 A;  3VH4 B;  4HDQ A;  2PJH A;  5CHV C;  1NEK B;  3GE8 C;  3GB1 A;  2YVC A;  4TSS A;  2LVQ A;  3ML4 A;  3V6E B;  2KN5 A;  4BZA A;  1KH0 A;  4ZRJ A;  2A5U A;  4W9F A;  4LNN A;  5J17 A;  5JHA A;  1FXT B;  4HLE A;  3A4R A;  3BWU D;  2I2Y A;  1B9R A;  2DX5 A;  3OJ4 B;  1VJK A;  4KV2 A;  1RJ2 A;  3W1Y A;  2FID A;  2BS3 B;  3CWI A;  3LJU X;  4WWM A;  4NQK E;  2WXQ A;  3KUC B;  4ACF A;  1WZ0 A;  3DBR B;  1MVK A;  2K9X A;  1R4M I;  2I1J A;  2BWF A;  2WXH A;  3MTN B;  3AXC A;  1HEZ E;  3NWD A;  4YON A;  4F7U P;  4MK0 A;  2KDI A;  1FGY A;  2IZV B;  3U12 A;  3RFZ B;  1KLG D;  4F7G A;  1FNV A;  2MP2 A;  3KWV A;  5DH9 B;  2ZNV B;  1N63 A;  3PLU A;  1IGC A;  2XEW A;  3TEW A;  2LHD A;  2COF A;  1WJN A;  5CHW A;  4MJS A;  2LKO A;  3FLV A;  2YS3 A;  1WRI A;  4B9K A;  3D8D A;  3VUX A;  1MIX A;  2HE7 A;  4AS1 A;  3OAN A;  4GU2 A;  1M4V A;  4CYE A;  4IDI A;  1WXV A;  3PRZ A;  5EFX A;  3VXW A;  3PTF C;  2LWP A;  2DZI A;  1U5E A;  1D6E C;  2KXJ A;  4URK A;  5BO4 B;  2Z0D B;  2LJ5 A;  1MK7 B;  2IO0 B;  4F1S A;  2DYN A;  5AZH A;  5GOW B;  2YEP F;  3WAO A;  2DZM A;  3PZ8 A;  1I4Q A;  3RMK C;  2VH2 A;  1BUI C;  2K49 A;  2WXP A;  1TGZ B;  4IM0 A;  3ML9 A;  1TZO A;  2P8V A;  3I5J C;  1KRH A;  2Z59 B;  3RN9 C;  5JVL A;  3VR8 B;  2KD0 A;  4B6H A;  1E8Z A;  1WXQ A;  2W2X D;  4GOC A;  1FRR A;  4HHV A;  2NBU A;  3VR9 B;  4WJP A;  4JL9 A;  1Y19 B;  1WH3 A;  3FIL B;  3TVV A;  5HE1 A;  1XR0 B;  3B2F A;  2COD A;  2M0X A;  2CU1 A;  3VVW B;  5JXV A;  1CMX B;  4OZA A;  1I2H A;  3EGR A;  2N9L A;  1ZGU B;  1XLN A;  2DAF A;  1MHH E;  1NI3 A;  2M0A A;  1IBX B;  3KSY A;  1E90 A;  3DBL B;  2JRI B;  2JWZ A;  3AEC B;  1P9D U;  3VDZ A;  4ANU A;  4NAW A;  2MDX A;  1ZXH A;  2CB8 A;  3AE7 B;  2VZK D;  1ZE3 D;  2UZS A;  2D07 B;  3A9J A;  4AOF A;  4DHJ B;  2KJ6 A;  1KJT A;  1MPE A;  1FNU A;  2LG1 A;  3FC4 A;  4XX5 A;  2WDQ B;  1VBG A;  1KLU D;  2D9W A;  1XF5 L;  4ZHP A;  1RYJ A;  2LVO A;  4LLG M;  3V61 A;  3R3M A;  1STE A;  5HI1 A;  1MG4 A;  5KHQ A;  4HB2 B;  4C7Y A;  3BK2 A;  2ABD A;  3X23 A;  1MI1 A;  4HXD A;  2D3C A;  4KZC A;  3EFU A;  2M1M A;  4HCP B;  2QIL A;  5JH5 C;  2LGS A;  3Q3M C;  2REX A;  1V5T A;  2D9Z A;  3DVG X;  4MGY E;  2Z59 A;  3FSS A;  1V86 A;  3HIE A;  2KNB A;  2WXM A;  3APC A;  2NTS A;  1DOX A;  5TR5 A;  1CK1 A;  4EFO A;  1WXA A;  1UNQ A;  2IBI B;  5J3Y A;  2L00 B;  4MSQ B;  2D9Y A;  4HJG E;  4BKS D;  1NDD A;  4D2K A;  1XKE A;  1I4X A;  4A6F B;  2JWU A;  1VZ8 A;  2WXR A;  3P4P B;  2JYE A;  2N1V A;  3DQV A;  1E0Z A;  1V2Y A;  4Y94 A;  3SHQ A;  4RGO S;  4XC2 A;  2MJD A;  2X8X X;  4B0E A;  3WA0 A;  2JZP A;  1I4G A;  5DPT A;  1GNU A;  4P16 A;  4QJ4 B;  2D3G A;  1MKE A;  4KSK C;  5E6O A;  3BYT B;  1JRU A;  3DXC A;  3QWZ B;  1KFY B;  1RRB A;  4KVG B;  3JYU A;  1NVI D;  1JAL A;  1SIJ A;  2WP9 B;  3NRZ A;  3TFM A;  3EEC A;  2DHZ A;  3NVY A;  3U30 A;  1KZ7 A;  4G11 A;  4DHZ E;  2AQ1 B;  4IFS A;  1JWM D;  4KIK B;  2JP2 A;  4N9F 4;  2O6V A;  1ET9 A;  1PYW D;  2GCJ A;  4ASW C;  5BYS A;  2WS3 B;  5IA7 A;  1G6J A;  3L17 A;  1IBX A;  5FK9 C;  1TTN A;  4JQW C;  2JPH A;  2KX3 A;  3PEG A;  3GE3 C;  3L16 A;  2Q5W D;  2KKC A;  4A6Q A;  2WNM A;  3MP9 A;  2NZ8 B;  3SYX A;  1OFF A;  4K2O A;  5G5G A;  1MG8 A;  3B77 A;  4KKJ A;  3K9P B;  5L81 A;  2Z14 A;  1PQS A;  2WU5 B;  4MEM A;  3AB5 A;  1UGM A;  4XDD A;  5JZE B;  2LZ6 A;  2RQ1 A;  5BMI A;  4DX8 A;  1YN4 A;  1TS5 A;  3Q14 C;  5LLI A;  3NZS A;  2G45 B;  3KVF B;  1KI1 B;  3EFC A;  3PLV A;  4HB4 B;  2LUM A;  5C16 A;  3DDC B;  1WMH A;  1WVH A;  2BS2 B;  1GB4 A;  2N1W A;  4EZJ A;  2K6D B;  4US9 A;  4ZHO A;  1SF0 A;  3CMM B;  3Q8B A;  1UZX B;  2GMI C;  2LFI A;  2DHI A;  1N62 A;  2AWT A;  4XWX A;  4WAF A;  3FP5 A;  1L0V B;  1K8R B;  1U27 A;  1V88 A;  2FNJ B;  4IW0 A;  1UUP A;  3QC8 B;  4W9J A;  4B95 A;  4JLC A;  2X18 A;  3KUD B;  2KGX B;  4NQL B;  1ENF A;  5E6N A;  2M14 A;  4US8 A;  2QCZ A;  2MA9 B;  2K6Q A;  2J53 A;  3PO0 A;  1SE2 A;  3R2I A;  2K00 A;  4G0N B;  2NCN A;  4K7W A;  4NAM A;  2Q13 A;  4IM3 A;  2IFS A;  3MJ5 A;  1P7F A;  2K8H A;  2DBY A;  1OGW A;  1WRD B;  5KCV A;  4PS3 A;  1JW9 D;  1V9J A;  2D9X A;  4XWT A;  1FCL A;  3KLS X;  1D4B A;  2LI5 A;  1VD2 A;  1LB1 A;  2R2Q A;  2MBE A;  4GOU A;  1AN8 A;  2P0F A;  2AX5 A;  2L0F A;  1Q67 A;  3PZ7 A;  4S0R A;  4HDO A;  1QZE A;  4JPS A;  1QC6 A;  4F8C B;  2OOB B;  3HQC A;  3H9D A;  4M01 A;  3ZDM C;  3ZXR A;  1K51 A;  3B2G A;  4ILH A;  1ZP0 B;  3ECI A;  3FEH A;  1GPX A;  2D5G A;  1C77 A;  3IHP C;  4HSI A;  1V89 A;  2PEA A;  2RUK B;  2DHJ A;  1D5Z C;  3VTU A;  1XCT L;  1I35 A;  2WGS A;  3W2D A;  2C7H A;  3AU4 A;  1ZUD 2;  2W3S A;  1KM7 A;  4C4V B;  5E6P A;  2L05 A;  3CF6 E;  4WJN A;  3P42 A;  1P3Q U;  2ZVO A;  1V1O A;  2L1C A;  4OHJ A;  1QIL A;  1JWB D;  4HB0 B;  1EUV B;  2IGD A;  2WX0 A;  3QJZ A;  1UNS A;  1VLB A;  4IWQ A;  3DWG C;  2IPK D;  4JKC A;  5EE3 A;  2R0D A;  2ZEQ A;  1L2N A;  1BTK A;  2YRY A;  1MI0 A;  2LXC A;  3UQB A;  1VZ6 A;  2KC1 A;  2X38 A;  5DHF B;  5EE9 A;  3I3T B;  3VUY A;  5TSS A;  2OJR A;  3FAH A;  4FN2 A;  2KAC A;  3HSA A;  4JKG B;  4II2 B;  1TS3 A;  2LAS A;  2BBC A;  4JX1 C;  1C4C A;  3OWE B;  3QHT A;  2G3Q B;  4FA6 A;  3PSC A;  2VSZ A;  3APF A;  4ZRK A;  4BOS C;  2ADZ A;  3EHV A;  1LFD A;  1XXG A;  4MM3 A;  2KVR A;  2ELB A;  2WXF A;  3ULB A;  2ZCB A;  2BB6 A;  3BYY B;  4HAX B;  3O65 B;  4XWW A;  3QQ8 B;  4HEA 1;  1MHX A;  3QAQ A;  4EUT A;  4ZDV A;  2HJ1 A;  5D94 A;  2R2Y A;  2UU7 A;  1J19 A;  2CQU A;  3NUH B;  3NVW A;  3H1U A;  3P4R B;  5H8Y E;  2LGI A;  3F0W A;  1V61 A;  2KFK B;  3IXS A;  3UF8 A;  1DIK A;  1C78 A;  3DVN U;  2W54 A;  5C3J B;  1LW3 A;  5I2M A;  4I6N B;  5C79 A;  2KK8 A;  4HJK A;  4A55 A;  3KH0 A;  2INC C;  2YT1 A;  3EUB 2;  4GNK B;  3C0R B;  3EC8 A;  2KC2 A;  2G4D B;  2Z13 A;  5G2N A;  3PVW A;  2KWC A;  5EDS A;  1WM2 A;  1DDW A;  1FOE A;  4N6E B;  5D3V A;  2DA0 A;  1KC7 A;  1I4R A;  2BYE A;  5J3Q A;  1OEY J;  2DEN B;  2KWU B;  3KRW A;  2V3N A;  3ZXV A;  1X1F A;  2KWD A;  4KHB B;  3Q3N C;  3AED B;  1WG7 A;  4BKG A;  3ML8 A;  4UDU C;  1Z5S B;  2BS4 B;  1UNP A;  4L2Y A;  4W9K A;  4KSL C;  3HIZ A;  4FJV B;  3O13 A;  3P4Q B;  1L0X B;  2KTR B;  3B9J A;  3L4P A;  2GJY A;  3JW0 X;  1AAR A;  2L32 A;  1WR6 E;  4NJC A;  4GGQ A;  1D5M C;  2RDG A;  3DBR I;  3CXB B;  4DHZ B;  1ZC4 B;  1WZ3 A;  3B1L X;  3M1I B;  4HK2 A;  4FBJ B;  4N58 A;  5G5H A;  3AEB B;  4PT5 A;  3A4S C;  3PRE A;  1WGY A;  5LXI B;  1SIF A;  5JHG A;  3J9C A;  1M94 A;  1U2B A;  2CJN A;  2CR5 A;  2JT4 B;  4ZOH C;  1WXM A;  1WJ1 A;  1GAQ B;  2PVG C;  4GLS C;  3D32 A;  1N5W A;  4MGZ E;  1TBE A;  4JIO U;  2LGD A;  1T5X D;  1UH6 A;  2PZ1 A;  4L23 A;  4HAU B;  4RFB A;  5HHD G;  1J7C A;  1NTY A;  2BQQ A;  4LDT B;  3LJ3 A;  2BTE A;  4K2P A;  1CZP A;  4JKG A;  4DXF A;  2JZ3 B;  3W5V B;  3T3O A;  2O2V B;  5C23 A;  2DWQ A;  3U2S C;  5HFY A;  2Z0E B;  1WGQ A;  1RFK A;  4G3X B;  2BT6 A;  3DCX A;  2C7M B;  2FJL A;  3IFW B;  5KHO A;  3DHI C;  2G9H D;  1L6V A;  3U8Z A;  4WWO A;  2AQ3 B;  2ON8 A;  3QIJ A;  4EKU A;  1AYF A;  5EE0 A;  4OZC A;  4I6L B;  4LJP B;  1TYG B;  3M63 B;  3NW8 A;  1MK9 B;  3R66 C;  2LHE A;  4IKG A;  1UWM A;  4GDK B;  2EMT A;  2BKF A;  3DVG Y;  2N9K A;  1AQC A;  4RGN A;  4ICV A;  2V4L A;  4BKS A;  2YS5 A;  4KHA A;  3LXF A;  2GUM A;  3VUW A;  1DYQ A;  2IND C;  2L8J A;  1UPQ A;  4CSQ A;  4E74 A;  2GS0 A;  2KN4 A;  1WI0 A;  1DBH A;  2FCN A;  3ZUN A;  1T0Q C;  3P63 A;  4DXG A;  3E66 A;  3Q3F A;  3PHX B;  2GI9 A;  1EVH A;  2YT2 A;  2JXT A;  3GYP A;  4KAX B;  2RGN B;  2ICI A;  1H4R A;  3W1S A;  3RD2 A;  2INN E;  2L52 A;  2KMC A;  4DX9 0;  1DGJ A;  5G55 A;  1XCQ L;  1EF5 A;  2AYO B;  2K3U A;  3AU5 A;  1QKZ A;  4K3B A;  2MBQ A;  4KKI A;  2E6X A;  4HVB A;  3N1Z C;  1GG3 A;  3SDL C;  2DKQ A;  2WYQ A;  2VRR B;  4KDL B;  1EWC A;  3ZNZ B;  5L95 C;  3MC0 B;  3AV8 A;  1WX7 A;  3U52 E;  2LEK A;  1BT0 A;  4KGS A;  2KLG A;  2EJ8 A;  1F0Z A;  1L4Z B;  3DBL I;  1TY2 A;  1YJI A;  4X57 B;  1QT9 A;  1N3H A;  1AWE A;  1SSN A;  2OED A;  1E7U A;  1JRP A;  4WWN A;  3Q69 A;  1HBK A;  3M3J A;  1S1Q B;  2YF0 A;  2IGG A;  3KUZ A;  5HG2 A;  2MHJ A;  2ZW0 A;  5CTR C;  4LNF A;  4WUR A;  3OHM B;  2ONQ A;  2KAJ A;  3MFG A;  4RMA A;  2A4Z A;  3NS8 A;  1N61 A;  3VAW A;  2JQR B;  4IOY X;  2RVB B;  3WIM A;  1RFA A;  1WI1 A;  1AW7 A;  3DXD A;  2KT7 A;  3L0W B;  2K2U A;  5JHB A;  1SGH A;  2Z0Q A;  3ZJV A;  2M17 A;  1TIF A;  2RDB C;  4N59 A;  2K8B A;  5MPO A;  1HTQ A;  2D9V A;  4B0M A;  3TBL D;  2G35 A;  5AEK B;  3BJI A;  1K5D B;  4NY0 A;  2N7J A;  3OG5 A;  1RAX A;  3PPA A;  4MDK E;  2XN9 C;  4WVF B;  2PW9 A;  2KAN A;  2CS4 A;  3JVZ X;  4FAD A;  1Y8R C;  4ZRI A;  3VOQ A;  4HKZ E;  4AJY B;  1X86 A;  2ZW1 A;  3RNB C;  1X1G A;  3UQA A;  2GBR A;  3IVF A;  4DDI D;  2HDE A;  3UZT A;  1NYQ A;  4TV3 A;  3V05 A;  4PK1 A;  2MBO A;  3HK0 A;  1SBB B;  2COA A;  4EEW A;  4HAW B;  2FCS A;  1J0G A;  2M38 A;  2XK5 B;  1ZPS A;  4HRO A;  1E5W A;  4PS7 A;  4JK7 A;  3DHG C;  2LRU A;  4EMO A;  1M7E A;  1X05 A;  3TEY A;  2CHW A;  2NR2 A;  5IKC M;  2JYT A;  1FB8 A;  1FCC C;  3H7S A;  5T8I A;  1PGB A;  2MX2 A;  4MSM B;  2N23 A;  1ZYI A;  4LTU A;  1FAO A;  2DYB A;  3DPD A;  1IGD A;  1PLS A;  3T9L A;  1EO6 A;  1Z2M A;  4LDT D;  2OTX A;  3HW2 B;  3A9K B;  3RCZ A;  1GC7 A;  1QF6 A;  1U29 A;  5D3Y A;  1J7B A;  3SO6 A;  1SE4 A;  1QQR A;  1BXT A;  1HE8 A;  5IJM A;  1C4P A;  1Q10 A;  1FHO A;  3NVV A;  5J2R A;  1WMH B;  1YX5 B;  1R4N I;  3PS6 A;  2WQY B;  3QX1 A;  1VCB A;  2WDR B;  3BY4 B;  2BW2 A;  4HPM B;  1HQR D;  3HHM A;  3ZKJ C;  2WH5 A;  2O6V B;  3KZ1 A;  2E2X A;  2J0K A;  2V3S A;  5CX3 A;  3V5W A;  3Q8C A;  4K17 A;  3NOB A;  2I5C A;  5CLL B;  1X11 A;  4AQ7 A;  1HB8 A;  4B6W A;  1P6S A;  2RRF A;  1HA5 A;  1ZVR A;  3P1M A;  1WSP A;  3SBT A;  3SFE B;  4A5K A;  4II3 B;  1C1Y B;  5E6J A;  1UF0 A;  4EE2 A;  4JKH A;  2WXI A;  1WGR A;  2ZPN A;  1XEE A;  2C5L C;  3ZNH B;  1WM3 A;  2C60 A;  3TEZ A;  1UPR A;  2P0D A;  2KZR A;  4RGM A;  1S3S G;  5JHH A;  3BVG A;  1P0R A;  3RNF C;  4ZRQ A;  4A20 A;  4A90 A;  2UZR A;  2VH1 A;  4ANX A;  5C2T B;  1EWY C;  3LB8 C;  1C4A A;  3T3N A;  2V0G A;  2PE9 A;  3OJ3 A;  5D3W A;  4M00 A;  1R4M B;  1C9F A;  3E56 A;  2FJ9 A;  3H7P A;  2PVO D;  4XGA B;  5FKA C;  3C19 A;  2KMM A;  3APD A;  2Y5B B;  2UYZ B;  1FFV A;  4P6V F;  3IBE A;  3JSV A;  5DPS A;  2N7D A;  2L2I A;  3W5U B;  3Q8E A;  2BPS A;  3T06 A;  1F1H A;  1FHX A;  1Q1O A;  1LO5 D;  3R7R A;  2DYO A;  3A33 B;  4YL8 A;  3ZRF A;  4OZB A;  4JKA A;  2PLP A;  2MRP A;  4A6F A;  1DOI A;  2CY4 A;  1BAK A;  2GBN A;  2V1Y A;  4MM3 B;  2YLM A;  3DHH C;  4P1B C;  1D5X C;  4GXB A;  1KLV A;  2OQB A;  2CU3 A;  4YSX B;  4BBN F;  5KQ4 A;  2HTH A;  2NBW B;  2Z0O A;  1XD3 B;  3A9K A;  2IY0 B;  3R2T A;  2WXL A;  4YSZ B;  2PKO A;  3CSF A;  2HJ8 A;  3SD5 A;  1FXI A;  2FIF A;  2GOW A;  1WYW B;  1XQQ A;  5L83 A;  3DXE A;  2V4I B;  4CHM A;  4IWP A;  3VIA A;  3HVZ A;  2K1F A;  3ZJT A;  4BFR A;  2GBM A;  1SEB D;  3VQI A;  4XZ4 A;  4WSF A;  2EC1 A;  1T0Y A;  2VZK B;  1FEH A;  1N5X A;  1KTK A;  2IJ0 A;  3NJT A;  2K5P A;  3SNH A;  1UD7 A;  3DBS A;  3VH3 B;  2RGF A;  2Z4D A;  4C7Z A;  2TSS A;  2DTC A;  1WXS A;  1EF1 A;  4M8N A;  2GCL A;  1SXT A;  1TKY A;  2C7N B;  3RNG C;  4JK8 A;  1JDE A;  2RD0 A;  4ZYN A;  2WXJ A;  2MWS B;  3Q8A A;  2M4N A;  3SEB A;  2QJL A;  4ZRP A;  2BYV E;  3A1Q A;  2MJ3 A;  2QSD A;  1L6U A;  1UEF A;  4QAY A;  1WR1 A;  2H88 B;  4WAA A;  3WAL A;  4BVU C;  2M19 A;  4NNJ B;  2KFJ A;  5JLJ B;  2JVC A;  1SHC A;  1Q5W B;  3UI3 A;  3CIK A;  1H8C A;  2IY1 B;  3TCA A;  2MSE D;  5C5B B;  2LD9 A;  1I4H A;  2IO1 B;  3DCG A;  4YWG G;  1R4N B;  2YEP B;  2QIE B;  1D3Z A;  1CQV A;  1YOV B;  2LOX A;  4QJ5 B;  1JWU D;  2DX1 A;  1K5G B;  3KYC D;  3ZQ4 A;  3ZJU A;  2L1A A;  4J6I A;  3PVU A;  4W9G A;  1PFD A;  4ITK A;  4JE3 B;  4HAT B;  4FJZ A;  4OVU A;  3VRB B;  4ILJ A;  2CY5 A;  2KJH B;  2GRI A;  2LYD A;  2AEH A;  3OAW A;  2VRW B;  2DKP A;  2DAJ A;  4OT1 A;  5JP4 A;  1WX9 A;  2M8S A;  3ONS A;  1WY8 A;  1C76 A;  1VBH A;  1U4A A;  3MC9 A;  1OMW A;  4HAV B;  1EAZ A;  3NZU A;  3V6C B;  1E10 A;  3P2B A;  3SUZ A;  5BYR A;  4L6E A;  2KIE A;  3A98 B;  4GB9 A;  2NS5 A;  2PE6 B;  2FAZ A;  3VHT C;  4NJ6 A;  2J59 M;  2CJO A;  3RNE C;  3BII D;  5BYQ A;  4HWI B;  1WJU A;  4YT0 B;  2MCN B;  2L0T A;  1FMA D;  1FRD A;  1NBF C;  1V5M A;  1V80 A;  1WE7 A;  5LXH A;  5J3T A;  1FIQ A;  2YT0 A;  4YSY B;  1UBI A;  2MP2 B;  5IAA C;  4HAY B;  1DDV A;  1YN3 A;  5HE2 A;  4BKT A;  2XK5 A;  1RLF A;  4M0W B;  4CHK A;  5D7G A;  3ZNI D;  2I38 A;  1JWA D;  2KDF B;  4YTP B;  3AE8 B;  1I7H A;  2RMM A;  4RF0 A;  4C00 A;  3MDB C;  1XLQ A;  4GZU A;  4REZ A;  5LOP B;  3UIN B;  4G50 A;  3PZD A;  2KCJ A;  5D3X A;  3UGB B;  2KQ7 A;  1TT5 B;  2KQS A;  2W82 A;  1M7R A;  1JCK B;  2IYD B;  1WGU A;  1KOT A;  1ISN A;  3ENE A;  1Y56 A;  1DYN A;  1IYF A;  1OQQ A;  3DOW A;  2MBB B;  2JF5 A;  2KUQ A;  2DX5 B;  4A3O A;  2ACZ B;  3BVZ A;  1KBL A;  3E9O A;  1V6E A;  3NS1 A;  2KJR A;  1BTN A;  5M4Y B;  4M02 A;  1F2R I;  4WJO A;  1WYG A;  2COC A;  2UWQ A;  4JGH B;  5C6R A;  3WAM A;  1T0S C;  3OLM D;  1ZSQ A;  2R09 A;  2LUL A;  2FJU B;  1UWX A;  4KX6 B;  3H8H A;  2E3T A;  2K22 A;  3QK0 A;  3ZW3 A;  2MFQ A;  4ILG B;  2LGX A;  2J0M A;  1NTV A;  1B1Z A;  4MAC A;  3X0W A;  3F5R A;  3HVD A;  2UVM A;  3IAM 1;  2RPQ A;  5H92 C;  1J8C A;  3ULC A;  2BGF A;  4HRS A;  3ZDT A;  1P7E A;  4GDL A;  4A6K A;  2Y3A A;  3N1X C;  2ROV A;  1JQ4 A;  1IUE A;  3PG7 A;  1TXD A;  1XD4 A;  3RUI B;  2JUO A;  3M62 B;  4JKF A;  1SE9 A;  2DN6 A;  3DBH B;  2NMB A;  4JWU C;  3MJW A;  2NBV A;  2Z0P A;  1E7V A;  4EZL A;  3AE9 B;  3ZO5 B;  4EOY A;  3PVL A;  1C79 A;  2KVZ A;  1FNW A;  1TZ1 A;  2QMT A;  2KYW A;  4IOI E;  1DOY A;  2DZJ A;  3RNC C;  1I4P A;  2MWN B;  1OQY A;  1TJ6 A;  4JKD A;  1L0Y B;  3I57 A;  4WJ7 A;  2RLO A;  4M0W A;  4OW0 A;  2DNF A;  1VRA B;  1Z87 A;  3BVM A;  1E7P B;  3RZF A;  3PP2 A;  2KUP A;  1I42 A;  3WCQ A;  2I5F A;  5IN7 A;  3NY5 A;  3AEF B;  3V62 A;  2J7Q B;  1Q0W B;  2B3A A;  2LJI A;  3PV1 A;  2Y8G A;  1WE6 A;  5I4D A;  2D4Q A;  2LBB A;  4XYC A;  3I9V 1;  2OJW A;  2EEL A;  3KRX A;  1WWT A;  1AWD A;  4RF1 A;  1ZDX A;  3AEA B;  2N9P C;  1UBQ A;  1MAI A;  2O2V A;  3A9J B;  1NEN B;  2FUG 1;  2CHZ A;  3ZLZ A;  3ZGZ A;  2N0S B;  3ABV B;  4MT5 A;  1V97 A;  4NAW B;  1YQ3 B;  2W2X C;  4PNK A;  4FLH A;  3ZVR A;  3ZRC A;  3DVN V;  5C1Z A;  2P0H A;  3IT4 B;  2FCQ A;  4ARC A;  2GLS A;  4MGK E;  2KIG A;  5HE0 A;  1WJ6 A;  1QQG A;  1K50 A;  2LOZ A;  2N7E A;  2JXX A;  1ZKH A;  4ICU A;  4PYU A;  5FR6 A;  3Q3O C;  1HTO A;  5AZG A;  1J0W A;  1ET6 A;  5LNK 1;  4OVV A;  2J42 A;  3DWM A;  5D3D A;  1TJE A;  1HB6 A;  4KGR A;  3UIP B;  3PSE B;  4QXA B;  1E9M A;  2BYT A;  2L83 A;  1LQB A;  2WXG A;  4WIP A;  1WJM A;  1T0R C;  3ZTD A;  1FO4 A;  2HD5 B;  3HUI A;  1XCG A;  2C9W B;  1MIZ B;  3AE2 B;  1FHW A;  2IO2 B;  4MH8 A;  3AMZ A;  1F52 A;  2XNA C;  4RH6 A;  3WYF B;  2HTM E;  3MC8 A;  3VTV A;  2KLC A;  4JK9 A;  5DPR A;  4E3C A;  2WXO A;  1LXD A;  2NBV B;  1TY0 A;  3JSV B;  1F9J A;  3AE4 B;  5I2S A;  1GB1 A;  4NSW A;  3RT3 B;  3AE3 B;  3HRD D;  3AN1 A;  4WH4 A;  5DPW A;  1ZM0 A;  1WGD A;  2FCM A;  3CST A;  3HM3 A;  1P1A A;  4JKB A;  5D2M B;  4Z2M B;  3Q2A C; 
#chains in the Genus database with same CATH homology
 1GGO A;  3RYT A;  2FDQ A;  3PHW B;  4K1R B;  1V5O A;  1PMS A;  2I1K A;  2ZCC A;  3S2A A;  2NPT B;  5FI0 A;  4KHO A;  1EGX A;  1YJ1 A;  3MPX A;  4H8S A;  2BKR B;  2MW5 A;  1GUA B;  2L7R A;  2RSG A;  3P7Z A;  4AUQ C;  2CHX A;  2EMS A;  1ACA A;  3TMP B;  3QAR A;  3D8F A;  2CRF A;  4IAP A;  1GJZ A;  1A5R A;  2MLB A;  2DIK A;  2J0J A;  3RCP A;  2ZNV C;  2ZVN A;  3DBH I;  4MY6 A;  4IC7 B;  4RM9 A;  2AL3 A;  4BOZ B;  2QKL A;  3HM6 X;  4GIV A;  5KQ1 A;  2LRW A;  1U5G A;  1WF9 A;  3N3K B;  4MT7 A;  2HTH B;  2QHO A;  1WFY A;  4TUU A;  2ZPY A;  1IRS A;  1NVL A;  2VKI A;  1TQZ A;  1NI2 A;  3O96 A;  3A8Q A;  4LCD E;  4TQ0 A;  2L3Z A;  2O6V D;  4PYZ A;  2N9X A;  2N0Y A;  2G4S A;  3VTW A;  2K8C A;  4TYZ A;  2KHW B;  1ZW7 A;  3NHE B;  3N30 A;  1XOD A;  2LGY A;  5DIF B;  4IWO A;  2CAY A;  5DI9 B;  3RUL A;  4D0N B;  4WWP A;  5HE3 A;  4K7U A;  2WDT B;  4K81 A;  4HAZ B;  4C0A A;  4TKN A;  5HKH A;  3P6A A;  1E8X A;  3W1S C;  2DHK A;  2RSU A;  4PS8 A;  3TL5 A;  5CLQ B;  1OQN A;  2GBK A;  2ASQ A;  3H6N A;  4NPN A;  2NPT A;  2LVP A;  3KW5 B;  2MQJ A;  1YQB A;  1U5F A;  3WAN A;  2RNR B;  4WJQ A;  3D8E A;  3RZW C;  2ZZP B;  1P3R A;  3AUL A;  2D2Q A;  1X1M A;  4MGI E;  2KTF A;  1ST7 A;  1OEY A;  3N32 A;  5DCN A;  2GBJ A;  3UIO B;  1KZG A;  3EPY A;  1XT9 B;  3MHS D;  3B08 A;  2BYF A;  2YS1 A;  2H7E A;  4GMX B;  3KY9 A;  4RM8 A;  4F7H A;  2JY6 A;  1YX6 B;  4KIK A;  4W9E A;  1V81 A;  3QA8 A;  4PQ0 A;  2WX1 A;  5D27 A;  1W1G A;  3QWM A;  3M95 A;  4FUL A;  2X0S A;  4DBG A;  2D10 A;  2IO3 B;  3SBG A;  4W9I A;  5LON B;  2KDE B;  1W1D A;  1DDM A;  4E71 A;  1V5P A;  2KO3 A;  2D11 A;  3ENB A;  4GN1 A;  1OY2 A;  3SV1 A;  1YD8 U;  1ZC3 B;  1I7A A;  3G9W A;  3PT2 B;  2IYB A;  1V5U A;  3BIN A;  1OTR B;  2Y7B A;  5GMV A;  2COP A;  2DYM A;  1WGG A;  4HB3 B;  2KFK A;  3V60 A;  3PRM B;  4FHK A;  1NU2 A;  1L7Y A;  2K39 A;  2QKM A;  1WJ4 A;  2Y8F A;  3LDZ E;  3PGE A;  1W1H A;  1IPG A;  4GMV A;  5C5B A;  4I6P A;  2KDB A;  2KX0 A;  4ANW A;  1E8Y A;  1IP9 A;  3U7D A;  2JRH A;  3NSU A;  4MEL A;  4Z2N A;  4AJW A;  1WIA A;  3ZTC A;  4W9H A;  2HRJ A;  1E8W A;  4NJ7 A;  3WAP A;  3GOE A;  2YSZ A;  4AWJ A;  2H7D A;  3GYO A;  1P98 A;  4DWF A;  4F7Z A;  2KMA A;  3TW1 A;  4M8M A;  4TQ1 A;  2DYQ A;  3T8M A;  4KDI C;  5AZF A;  4BBK A;  5FI1 A;  1DRO A;  1XX0 A;  4MJS B;  4HCN B;  3TIX A;  2XBB C;  4JKE A;  1B55 A;  1FGZ A;  2FUH B;  2ELA A;  2LUE A;  3E9L A;  1YIW A;  2W9N A;  1H10 A;  3R7Q A;  3L10 B;  1PFJ A;  1RRP B;  4KZ0 A;  4GPT B;  3QCA A;  1WX8 A;  4EJN A;  4AP4 C;  2WWZ A;  2AL6 A;  3L13 A;  4W9C A;  4GSW A;  4ANV A;  2BCJ A;  3IG3 A;  4CO7 A;  4IUM B;  4GDL B;  1Y5O A;  2N9E B;  3SU8 X;  3TJP A;  3ZVV A;  2LXA A;  3K9O B;  2EKE C;  1WGH A;  5D6J B;  1UEL A;  2K2J A;  2V76 A;  3E9P A;  2BWE S;  2KOX A;  2PPH A;  4IG7 B;  2MBH A;  1BWN A;  4DHJ D;  2JZZ A;  3VFK A;  4DDG D;  4DK5 A;  3A1Q B;  4IM2 A;  2XQN M;  4BBN C;  2RR9 A;  3AJ4 A;  1V49 A;  3FM8 C;  4FHJ A;  2ROZ B;  3ODW A;  4K7S A;  4W9L A;  4W9D A;  3ODX A;  3Q3J A;  4LJO B;  3ZIM A;  3KYD D;  3ODO A;  1UNR A;  3N7C A;  2N4F A;  1GC6 A;  2CKH B;  1U5D A;  2NVU I;  5J18 A;  5DHA B;  1LM8 B;  2R2O A;  2MKR A;  3QBV B;  4WQO B;  4P7I A;  2DFK A;  2DZK A;  2K25 A;  4EZK A;  5CHF A;  2W2W A;  2KTR A;  4DBB A;  2BF8 B;  2L76 A;  1P5T A;  3AI5 A;  2KWV B;  3PRP B;  3TO1 A;  3ZNG C;  1MPH A;  3L08 A;  4GDK A;  3GZN I;  4FJY A;  1C3T A;  3L54 A;  4MH0 E;  4DXA B;  4CHJ A;  1NTI A;  2R82 A;  2DLW A;  4HPL B;  3B0A A;  3ALB A;  3H7P B;  4A3P A;  2ZJD A;  3A8P A;  4A6H A;  3VH4 B;  4HDQ A;  2PJH A;  5CHV C;  2YVC A;  2LVQ A;  3ML4 A;  3V6E B;  2KN5 A;  4ZRJ A;  2A5U A;  4W9F A;  5J17 A;  5JHA A;  1FXT B;  4HLE A;  3A4R A;  2DX5 A;  3OJ4 B;  4KV2 A;  1RJ2 A;  3W1Y A;  2FID A;  3LJU X;  4NQK E;  3KUC B;  1WZ0 A;  1R4M I;  2I1J A;  2BWF A;  3MTN B;  3AXC A;  4F7U P;  4YON A;  4MK0 A;  2KDI A;  1FGY A;  2IZV B;  4F7G A;  2MP2 A;  5DH9 B;  2ZNV B;  3PLU A;  2XEW A;  2COF A;  1WJN A;  5CHW A;  4MJS A;  2LKO A;  3FLV A;  2YS3 A;  4B9K A;  3D8D A;  3VUX A;  1MIX A;  2HE7 A;  3OAN A;  4GU2 A;  4CYE A;  1WXV A;  3PRZ A;  5EFX A;  3VXW A;  3PTF C;  2LWP A;  2DZI A;  1U5E A;  2KXJ A;  4URK A;  5BO4 B;  2Z0D B;  2LJ5 A;  1MK7 B;  2IO0 B;  4F1S A;  2DYN A;  5AZH A;  5GOW B;  3WAO A;  2DZM A;  1TGZ B;  4IM0 A;  3ML9 A;  2P8V A;  2Z59 B;  5JVL A;  2KD0 A;  4B6H A;  1E8Z A;  2W2X D;  4GOC A;  4HHV A;  2NBU A;  4WJP A;  4JL9 A;  1Y19 B;  1WH3 A;  3TVV A;  5HE1 A;  1XR0 B;  2COD A;  2M0X A;  2CU1 A;  3VVW B;  1CMX B;  1I2H A;  1ZGU B;  2DAF A;  3KSY A;  1E90 A;  2JRI B;  2JWZ A;  3VDZ A;  1P9D U;  4ANU A;  4NAW A;  2MDX A;  2CB8 A;  2UZS A;  2D07 B;  3A9J A;  4AOF A;  4DHJ B;  2KJ6 A;  1KJT A;  2LG1 A;  4XX5 A;  1VBG A;  2D9W A;  2LVO A;  3V61 A;  3R3M A;  5KHQ A;  4HB2 B;  2ABD A;  3X23 A;  4HXD A;  4KZC A;  3EFU A;  2M1M A;  4HCP B;  5JH5 C;  2REX A;  1V5T A;  2D9Z A;  3DVG X;  4MGY E;  3FSS A;  1V86 A;  2KNB A;  3APC A;  5TR5 A;  4EFO A;  1WXA A;  1UNQ A;  2IBI B;  5J3Y A;  2L00 B;  4MSQ B;  2D9Y A;  4BKS D;  1NDD A;  1XKE A;  4A6F B;  2N1V A;  3DQV A;  1V2Y A;  4Y94 A;  3SHQ A;  4XC2 A;  3WA0 A;  5DPT A;  1GNU A;  2D3G A;  1MKE A;  4KSK C;  5E6O A;  1JRU A;  3DXC A;  3QWZ B;  1RRB A;  4KVG B;  3JYU A;  3TFM A;  3EEC A;  2DHZ A;  3U30 A;  1KZ7 A;  4G11 A;  4DHZ E;  4IFS A;  4KIK B;  2JP2 A;  4N9F 4;  2O6V A;  2GCJ A;  4ASW C;  5IA7 A;  1G6J A;  3L17 A;  1TTN A;  4JQW C;  2JPH A;  2KX3 A;  3PEG A;  3L16 A;  2KKC A;  2NZ8 B;  3SYX A;  4K2O A;  1MG8 A;  3K9P B;  5L81 A;  1PQS A;  4MEM A;  1UGM A;  5JZE B;  2LZ6 A;  2RQ1 A;  4DX8 A;  5LLI A;  3NZS A;  2G45 B;  3KVF B;  1KI1 B;  3PLV A;  4HB4 B;  5C16 A;  3DDC B;  1WMH A;  1WVH A;  2N1W A;  4EZJ A;  2K6D B;  3CMM B;  1UZX B;  2GMI C;  2DHI A;  2AWT A;  4XWX A;  3FP5 A;  1K8R B;  1U27 A;  1V88 A;  2FNJ B;  4IW0 A;  3QC8 B;  4W9J A;  4B95 A;  4JLC A;  2X18 A;  3KUD B;  2KGX B;  4NQL B;  5E6N A;  2M14 A;  2MA9 B;  2K6Q A;  2K00 A;  4G0N B;  2NCN A;  4K7W A;  2Q13 A;  4IM3 A;  2IFS A;  2K8H A;  1OGW A;  1WRD B;  5KCV A;  4PS3 A;  1V9J A;  2D9X A;  2LI5 A;  1VD2 A;  1LB1 A;  2R2Q A;  2MBE A;  2P0F A;  2L0F A;  1Q67 A;  4HDO A;  1QZE A;  1QC6 A;  4F8C B;  2OOB B;  3HQC A;  3H9D A;  3ZDM C;  4ILH A;  3ECI A;  3FEH A;  3IHP C;  1V89 A;  2PEA A;  2RUK B;  2DHJ A;  3VTU A;  1I35 A;  2C7H A;  3AU4 A;  1KM7 A;  5E6P A;  2L05 A;  3CF6 E;  4WJN A;  1P3Q U;  2ZVO A;  2L1C A;  4HB0 B;  1EUV B;  2WX0 A;  3QJZ A;  4IWQ A;  4JKC A;  2R0D A;  2ZEQ A;  1L2N A;  1BTK A;  2YRY A;  2LXC A;  3UQB A;  2KC1 A;  5DHF B;  3I3T B;  3VUY A;  2OJR A;  4FN2 A;  4JKG B;  4II2 B;  2LAS A;  3QHT A;  2G3Q B;  4FA6 A;  3PSC A;  2VSZ A;  3APF A;  4ZRK A;  4BOS C;  2ADZ A;  3EHV A;  1LFD A;  4MM3 A;  2KVR A;  2ELB A;  2ZCB A;  3ULB A;  3O65 B;  4HAX B;  3QQ8 B;  4ZDV A;  3QAQ A;  4EUT A;  5D94 A;  1J19 A;  2CQU A;  3H1U A;  3F0W A;  1V61 A;  2KFK B;  3UF8 A;  1DIK A;  3DVN U;  1LW3 A;  4I6N B;  5C79 A;  2KK8 A;  4HJK A;  3KH0 A;  2YT1 A;  3C0R B;  3EC8 A;  2KC2 A;  2G4D B;  5G2N A;  3PVW A;  2KWC A;  5EDS A;  1WM2 A;  1DDW A;  1FOE A;  5D3V A;  2DA0 A;  1KC7 A;  2BYE A;  5J3Q A;  1OEY J;  2DEN B;  2KWU B;  3KRW A;  1X1F A;  4KHB B;  1WG7 A;  4BKG A;  3ML8 A;  1Z5S B;  4W9K A;  1UNP A;  4KSL C;  3HIZ A;  4FJV B;  2KTR B;  2GJY A;  3JW0 X;  1AAR A;  1WR6 E;  4GGQ A;  3DBR I;  3CXB B;  4DHZ B;  1ZC4 B;  1WZ3 A;  3B1L X;  3M1I B;  4HK2 A;  4FBJ B;  3A4S C;  3PRE A;  1WGY A;  5LXI B;  1SIF A;  5JHG A;  1M94 A;  1U2B A;  2CR5 A;  2JT4 B;  1WXM A;  1WJ1 A;  3D32 A;  4MGZ E;  1TBE A;  4JIO U;  2LGD A;  1UH6 A;  2PZ1 A;  4HAU B;  1NTY A;  4LDT B;  3LJ3 A;  4K2P A;  4JKG A;  2JZ3 B;  2O2V B;  5C23 A;  2Z0E B;  1WGQ A;  4G3X B;  2C7M B;  2FJL A;  3IFW B;  5KHO A;  3U8Z A;  4WWO A;  3QIJ A;  4EKU A;  4I6L B;  4LJP B;  3M63 B;  1MK9 B;  3R66 C;  4GDK B;  2EMT A;  2BKF A;  3DVG Y;  1AQC A;  4ICV A;  2V4L A;  4BKS A;  2YS5 A;  4KHA A;  3VUW A;  2L8J A;  1UPQ A;  4E74 A;  2GS0 A;  1WI0 A;  1DBH A;  2FCN A;  3ZUN A;  3E66 A;  3Q3F A;  3PHX B;  1EVH A;  3GYP A;  4KAX B;  2RGN B;  1H4R A;  3W1S A;  3RD2 A;  2KMC A;  4DX9 0;  5G55 A;  1EF5 A;  2AYO B;  3AU5 A;  2MBQ A;  4HVB A;  1GG3 A;  3SDL C;  2DKQ A;  2WYQ A;  2VRR B;  4KDL B;  3ZNZ B;  5L95 C;  1WX7 A;  1BT0 A;  2KLG A;  2EJ8 A;  3DBL I;  4X57 B;  1N3H A;  1AWE A;  1E7U A;  4WWN A;  1HBK A;  3M3J A;  1S1Q B;  2YF0 A;  3KUZ A;  5CTR C;  4RMA A;  2A4Z A;  3NS8 A;  3VAW A;  4IOY X;  2RVB B;  3WIM A;  1RFA A;  1WI1 A;  3DXD A;  3L0W B;  2K2U A;  5JHB A;  1SGH A;  2Z0Q A;  2M17 A;  2K8B A;  2D9V A;  3TBL D;  2G35 A;  5AEK B;  3BJI A;  1K5D B;  4NY0 A;  1RAX A;  3PPA A;  4MDK E;  4WVF B;  3JVZ X;  2CS4 A;  2KAN A;  4FAD A;  1Y8R C;  4ZRI A;  3VOQ A;  4AJY B;  1X86 A;  1X1G A;  3UQA A;  2GBR A;  3IVF A;  4DDI D;  3UZT A;  4TV3 A;  2MBO A;  3HK0 A;  2COA A;  4EEW A;  4HAW B;  2FCS A;  1J0G A;  2M38 A;  2XK5 B;  1E5W A;  4PS7 A;  4JK7 A;  2LRU A;  4EMO A;  1M7E A;  1X05 A;  2CHW A;  2NR2 A;  1FB8 A;  3H7S A;  2MX2 A;  4MSM B;  2N23 A;  1FAO A;  2DYB A;  3DPD A;  1PLS A;  3T9L A;  1EO6 A;  1Z2M A;  4LDT D;  2OTX A;  3HW2 B;  3A9K B;  3RCZ A;  1GC7 A;  1U29 A;  5D3Y A;  3SO6 A;  1HE8 A;  5IJM A;  1FHO A;  5J2R A;  1WMH B;  1YX5 B;  3PS6 A;  1R4N I;  3QX1 A;  1VCB A;  3BY4 B;  4HPM B;  3ZKJ C;  3HHM A;  2WH5 A;  2O6V B;  3KZ1 A;  2E2X A;  2J0K A;  2V3S A;  5CX3 A;  3V5W A;  4K17 A;  3NOB A;  2I5C A;  5CLL B;  1X11 A;  1HB8 A;  4B6W A;  1P6S A;  1ZVR A;  3SBT A;  4A5K A;  4II3 B;  1C1Y B;  4JKH A;  1WGR A;  2ZPN A;  2C5L C;  3ZNH B;  1WM3 A;  2C60 A;  1UPR A;  2P0D A;  2KZR A;  1S3S G;  5JHH A;  1P0R A;  4A20 A;  2UZR A;  4ANX A;  2PE9 A;  3OJ3 A;  5D3W A;  2FJ9 A;  3H7P A;  3APD A;  2Y5B B;  2UYZ B;  3IBE A;  3JSV A;  5DPS A;  2N7D A;  2L2I A;  2BPS A;  3T06 A;  1FHX A;  1Q1O A;  3R7R A;  2DYO A;  3A33 B;  4YL8 A;  3ZRF A;  4JKA A;  2MRP A;  4A6F A;  2CY4 A;  1BAK A;  2GBN A;  2V1Y A;  2YLM A;  4GXB A;  1KLV A;  2OQB A;  4BBN F;  5KQ4 A;  2HTH A;  2NBW B;  2Z0O A;  1XD3 B;  3A9K A;  2IY0 B;  3CSF A;  2HJ8 A;  3SD5 A;  2FIF A;  2GOW A;  1WYW B;  1XQQ A;  5L83 A;  3DXE A;  4CHM A;  4IWP A;  3VIA A;  2K1F A;  4BFR A;  2GBM A;  3VQI A;  4XZ4 A;  4WSF A;  2EC1 A;  1T0Y A;  3SNH A;  1UD7 A;  3DBS A;  3VH3 B;  2RGF A;  2DTC A;  1WXS A;  1EF1 A;  4M8N A;  2GCL A;  2C7N B;  4JK8 A;  1JDE A;  2RD0 A;  4ZYN A;  2MWS B;  2M4N A;  2BYV E;  3A1Q A;  1UEF A;  1WR1 A;  4WAA A;  3WAL A;  4BVU C;  4NNJ B;  2KFJ A;  5JLJ B;  2JVC A;  1SHC A;  1Q5W B;  3CIK A;  1H8C A;  2IY1 B;  3TCA A;  2MSE D;  5C5B B;  2LD9 A;  2IO1 B;  3DCG A;  1D3Z A;  2LOX A;  2DX1 A;  1K5G B;  3KYC D;  4J6I A;  3PVU A;  4W9G A;  4HAT B;  4FJZ A;  4OVU A;  4ILJ A;  2CY5 A;  2KJH B;  2LYD A;  2AEH A;  3OAW A;  2VRW B;  2DKP A;  2DAJ A;  5JP4 A;  1WX9 A;  2M8S A;  3ONS A;  1WY8 A;  1VBH A;  1U4A A;  1OMW A;  4HAV B;  1EAZ A;  3NZU A;  3V6C B;  3P2B A;  3SUZ A;  4L6E A;  3A98 B;  4GB9 A;  2NS5 A;  2PE6 B;  2FAZ A;  3VHT C;  4NJ6 A;  2J59 M;  4HWI B;  1WJU A;  2MCN B;  2L0T A;  1NBF C;  1V80 A;  1V5M A;  1WE7 A;  5LXH A;  5J3T A;  2YT0 A;  1UBI A;  2MP2 B;  5IAA C;  4HAY B;  1DDV A;  5HE2 A;  4BKT A;  2XK5 A;  1RLF A;  4M0W B;  4CHK A;  5D7G A;  3ZNI D;  2KDF B;  3MDB C;  4GZU A;  5LOP B;  3UIN B;  4G50 A;  3PZD A;  2KCJ A;  5D3X A;  3UGB B;  2KQ7 A;  2KQS A;  1M7R A;  2IYD B;  1WGU A;  1KOT A;  1ISN A;  3ENE A;  1DYN A;  1IYF A;  3DOW A;  2JF5 A;  2MBB B;  2DX5 B;  4A3O A;  1KBL A;  3E9O A;  1V6E A;  2KJR A;  1BTN A;  4WJO A;  2COC A;  2UWQ A;  4JGH B;  5C6R A;  3WAM A;  3OLM D;  1ZSQ A;  2R09 A;  2LUL A;  3QK0 A;  3ZW3 A;  2MFQ A;  4ILG B;  2LGX A;  2J0M A;  1NTV A;  3X0W A;  3F5R A;  2UVM A;  2RPQ A;  1J8C A;  3ULC A;  2BGF A;  3ZDT A;  4GDL A;  4A6K A;  2ROV A;  3PG7 A;  1TXD A;  1XD4 A;  3RUI B;  2JUO A;  3M62 B;  4JKF A;  1SE9 A;  2DN6 A;  2NMB A;  3MJW A;  1E7V A;  2Z0P A;  4EZL A;  3ZO5 B;  4EOY A;  3PVL A;  1TZ1 A;  2DZJ A;  2MWN B;  1OQY A;  1TJ6 A;  4JKD A;  4WJ7 A;  2RLO A;  1Z87 A;  3RZF A;  3PP2 A;  2KUP A;  1I42 A;  2I5F A;  3NY5 A;  3V62 A;  2J7Q B;  1Q0W B;  2B3A A;  3PV1 A;  2Y8G A;  1WE6 A;  2D4Q A;  2LBB A;  3KRX A;  2N9P C;  1UBQ A;  1MAI A;  2O2V A;  3A9J B;  2CHZ A;  3ZLZ A;  4NAW B;  2W2X C;  4PNK A;  4FLH A;  3ZVR A;  3ZRC A;  3DVN V;  5C1Z A;  2P0H A;  2FCQ A;  4MGK E;  5HE0 A;  1WJ6 A;  1QQG A;  2LOZ A;  2JXX A;  2N7E A;  1ZKH A;  4ICU A;  4PYU A;  5FR6 A;  5AZG A;  1J0W A;  4OVV A;  1HB6 A;  3UIP B;  3PSE B;  1LQB A;  1WJM A;  3ZTD A;  2HD5 B;  1XCG A;  2C9W B;  1MIZ B;  1FHW A;  2IO2 B;  3WYF B;  3VTV A;  2KLC A;  4JK9 A;  5DPR A;  4E3C A;  1LXD A;  2NBV B;  3JSV B;  1F9J A;  4NSW A;  3RT3 B;  5DPW A;  1ZM0 A;  1WGD A;  2FCM A;  3CST A;  3HM3 A;  1P1A A;  4JKB A;  5D2M B;  4Z2M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...