2D1LA

Structure of f-actin binding domain imd of mim (missing in metastasis)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
249
structure length
249
Chain Sequence
AGHMEAVIEKECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADMATNTRGGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKKVDAQGRGDIQPQLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMDPHKLPSSSEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metastasis suppressor protein 1
publication title Structural basis for the actin-binding function of missing-in-metastasis
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 101
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08397 IMD IRSp53/MIM homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2d1lA00
1X03A 2C08A 3Q0KA 1ZWWA 4FZSA 1WDZA 1I4LA 1I49A 2EFKA 3G9GA 3M3WA 4H8SA 4DCNC 2RAKA 2Z0VA 4WPCA 2D1LA 4NQIA 3SYVA 2V0OA 3CAZA 1I4DA 2EFLA 2X3XA 2FICA 5C5BB 3Q84A 3LLLA 1Y2OA 1URUA 3HAIA 1I4TA 2D4CA 3HAJA 3I2WA 4I1QA 4DYLA 5C5BA 2X3VA 3HAHA 2RAIA 2Q13A 4NSWA 2Z0OA 3ACOA 4ATMA 2ELBA 4AKVA 3QE6A 2RAJA 3DYTA 2YKTA 4AVMA 4WPEA 3SOGA 2Q12A 3ABHA 2X3WA 2Z0NA 3QWEA 1X04A 4BNEA 3QNIA 3OK8A 3PLTA
chains in the Genus database with same CATH superfamily
2YL6A 4IW0A 2EFKA 4G6QA 2OW6A 3RV0A 2YIBA 1LQ7A 4FZOA 3D52A 2YL8A 1R34A 2FYVA 2KHOA 4I1QA 2RAIA 2NCZA 4AKVA 1GNTA 2RAJA 4AVMA 3D2FA 2Q12A 3ABHA 5TKYA 3CZSA 3D4YA 3EJRA 3DX2A 4JNEA 1QWUA 3Q84A 1QX1A 2F18A 3HAIA 2WYIA 3D2EA 4NSWA 4UDXX 3DDFA 3C7NA 3D50A 1R5EA 4HR1A 1U00A 4EZRA 1HWWA 2JNSA 2X3XA 2FICA 2F7RA 4EZOA 4EZYA 3HAJA 4JNFA 4DYLA 4AZGA 2WYHA 3UITA 4R5JA 2Z0NA 1E2UA 3PLTA 1TQUA 3BUDA 2JNKA 1X03A 1ZWWA 2RT6A 4FZPA 1I4LA 3T49A 2YLLA 2YIVX 5C5BB 4D8JA 1MJGA 3LLLA 2D4CA 1E1DA 3T47A 3DDGA 4F01A 2Z0OA 4IWPA 4JN4A 3SOGA 3OK8A 4EZPA 3QNJA 2X5CA 4AZCA 2D1LA 2OBLA 3SYVA 2V0OA 4IM2A 4E3CA 2X3VA 5KBPA 4JWDA 4JWIA 3O3OB 2YL9A 3RPMA 3KAVA 3QWEA 1HTYA 3O3MB 4EZVA 2F7PA 1R33A 2GAFD 1DKZA 1Y2OA 2PMRA 4EZZA 3ERCC 4AZIA 2ELBA 2LM0A 3T48A 3B52X 4EZXA 2F7OA 3L3OM 2GF4A 3DX0A 3BVWA 4JWCA 1HXKA 4HY9A 3EJTA 3DX3A 3Q0KA 4H6HA 4H8SA 2Z8YA 3I04A 3VKHA 4EZUA 4EZNA 3CZNA 2WINM 4R5KA 3ER9B 3DYTA 2EWFA 4JLCA 4UDYX 2N3KA 4PO2A 3BLBA 3BUQA 4FZSA 1WDZA 4DCNC 3M3WA 4IWOA 2RAKA 2YL5A 4WPCA 5E84A 1I4DA 4FM3A 3BVTA 2EX3B 1OA0A 4M0MA 2GA9D 4KIKA 2YLAA 1OA1A 4HYBA 3EJUA 1TQSA 4WPEA 1QWNA 4NPHA 3EJPA 1I49A 2Z0VA 3DPPA 4JL9A 2OO2A 3BVUA 3OHXM 1URUA 2ALWA 3BUPA 1TQVA 3D51A 1YWMA 1W9MA 1TQWA 1TQTA 3KAWA 2YKTA 3CKDA 3D4ZA 3ER8C 3QNIA 3GI7A 4AZCB 3LMFA 1SU8A 3LVTA 3T4AG 3DPOA 1I4TA 5C5BA 2OBMA 3ACOA 3B53X 4IM3A 4R5LA 2C08A 3I01A 1DKXA 4AZ5A 3CAZA 3QA8A 3B51X 4F00A 2F1BA 3FD9A 4IWQA 1GNLA 1O7DC 3DX4A 4AZHA 2ND0A 2YI9A 1UPXA 1OAOA 2QXLA 4AZ7A 3RV1A 3T46A 1SU6A 3BUBA 3DX1A 2YIAA 2MI7A 3DPQA 2F7QA 4H6IA 4HR1B 4R5GA 1X04A 2O0I1 3VEBA 2PY6A 1O7DB 4AZ6A 3CVRA 3ZEDA 1ZYLA 4AZBA 4EZQA 3O3NB 4KIKB 3EJSA 3I2WA 3KDRA 4B9QA 4E81A 4ATMA 4IM0A 1PS3A 4EZWA 3EJQA 3CV5A 5FLEX 5FIGA 1DKYA 2YI8A 3G9GA 4JWEA 2EFLA 2F1AA 3HAHA 3BVXA 2Q13A 3F7WA 1E9VA 3QE6A 2X3WA 2ZXQA 2ND1A 3VEAA 3I39X 4EZTA 3BVVA 2QKWA 3L3PA 1SU7A 1JQKA 3BUIA 2OW7A 4EZSA 2OZNB 1SUFA 2LXYA 3OWGA 2QFFA 4BNEA 1GN9A 3A98A 4NQIA 4R5IA
chains in the Genus database with same CATH topology
1X03A 2C08A 3Q0KA 1ZWWA 4FZSA 1WDZA 1I4LA 1I49A 2EFKA 3G9GA 3M3WA 4H8SA 4DCNC 2RAKA 2Z0VA 4WPCA 2D1LA 4NQIA 3SYVA 2V0OA 3CAZA 1I4DA 2EFLA 2X3XA 2FICA 5C5BB 3Q84A 3LLLA 1Y2OA 1URUA 3HAIA 1I4TA 2D4CA 3HAJA 3I2WA 4I1QA 4DYLA 5C5BA 2X3VA 3HAHA 2RAIA 2Q13A 4NSWA 2Z0OA 3ACOA 4ATMA 2ELBA 4AKVA 3QE6A 2RAJA 3DYTA 2YKTA 4AVMA 4WPEA 3SOGA 2Q12A 3ABHA 2X3WA 2Z0NA 3QWEA 1X04A 4BNEA 3QNIA 3OK8A 3PLTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X03 A;  2C08 A;  3Q0K A;  1ZWW A;  4FZS A;  1WDZ A;  1I4L A;  1I49 A;  2EFK A;  3G9G A;  3M3W A;  4H8S A;  4DCN C;  2RAK A;  2Z0V A;  4WPC A;  2D1L A;  4NQI A;  3SYV A;  2V0O A;  3CAZ A;  1I4D A;  2EFL A;  2X3X A;  2FIC A;  5C5B B;  3Q84 A;  3LLL A;  1Y2O A;  1URU A;  3HAI A;  1I4T A;  2D4C A;  3HAJ A;  3I2W A;  4I1Q A;  4DYL A;  5C5B A;  2X3V A;  3HAH A;  2RAI A;  2Q13 A;  4NSW A;  2Z0O A;  3ACO A;  4ATM A;  2ELB A;  4AKV A;  3QE6 A;  2RAJ A;  3DYT A;  2YKT A;  4AVM A;  4WPE A;  3SOG A;  2Q12 A;  3ABH A;  2X3W A;  2Z0N A;  3QWE A;  1X04 A;  4BNE A;  3QNI A;  3OK8 A;  3PLT A; 
#chains in the Genus database with same CATH topology
 2YL6 A;  4IW0 A;  2EFK A;  4G6Q A;  2OW6 A;  3RV0 A;  2YIB A;  1LQ7 A;  4FZO A;  3D52 A;  2YL8 A;  1R34 A;  2FYV A;  2KHO A;  4I1Q A;  2RAI A;  2NCZ A;  4AKV A;  1GNT A;  2RAJ A;  4AVM A;  3D2F A;  2Q12 A;  3ABH A;  5TKY A;  3CZS A;  3D4Y A;  3EJR A;  3DX2 A;  4JNE A;  1QWU A;  3Q84 A;  1QX1 A;  2F18 A;  3HAI A;  2WYI A;  3D2E A;  4NSW A;  4UDX X;  3DDF A;  3C7N A;  3D50 A;  1R5E A;  4HR1 A;  1U00 A;  4EZR A;  1HWW A;  2JNS A;  2X3X A;  2FIC A;  2F7R A;  4EZO A;  4EZY A;  3HAJ A;  4JNF A;  4DYL A;  4AZG A;  2WYH A;  3UIT A;  4R5J A;  2Z0N A;  1E2U A;  3PLT A;  1TQU A;  3BUD A;  2JNK A;  1X03 A;  1ZWW A;  2RT6 A;  4FZP A;  1I4L A;  3T49 A;  2YLL A;  2YIV X;  5C5B B;  4D8J A;  1MJG A;  3LLL A;  2D4C A;  1E1D A;  3T47 A;  3DDG A;  4F01 A;  2Z0O A;  4IWP A;  4JN4 A;  3SOG A;  3OK8 A;  4EZP A;  3QNJ A;  2X5C A;  4AZC A;  2D1L A;  2OBL A;  3SYV A;  2V0O A;  4IM2 A;  4E3C A;  2X3V A;  5KBP A;  4JWD A;  4JWI A;  3O3O B;  2YL9 A;  3RPM A;  3KAV A;  3QWE A;  1HTY A;  3O3M B;  4EZV A;  2F7P A;  1R33 A;  2GAF D;  1DKZ A;  1Y2O A;  2PMR A;  4EZZ A;  3ERC C;  4AZI A;  2ELB A;  2LM0 A;  3T48 A;  3B52 X;  4EZX A;  2F7O A;  3L3O M;  2GF4 A;  3DX0 A;  3BVW A;  4JWC A;  1HXK A;  4HY9 A;  3EJT A;  3DX3 A;  3Q0K A;  4H6H A;  4H8S A;  2Z8Y A;  3I04 A;  3VKH A;  4EZU A;  4EZN A;  3CZN A;  2WIN M;  4R5K A;  3ER9 B;  3DYT A;  2EWF A;  4JLC A;  4UDY X;  2N3K A;  4PO2 A;  3BLB A;  3BUQ A;  4FZS A;  1WDZ A;  4DCN C;  3M3W A;  4IWO A;  2RAK A;  2YL5 A;  4WPC A;  5E84 A;  1I4D A;  4FM3 A;  3BVT A;  2EX3 B;  1OA0 A;  4M0M A;  2GA9 D;  4KIK A;  2YLA A;  1OA1 A;  4HYB A;  3EJU A;  1TQS A;  4WPE A;  1QWN A;  4NPH A;  3EJP A;  1I49 A;  2Z0V A;  3DPP A;  4JL9 A;  2OO2 A;  3BVU A;  3OHX M;  1URU A;  2ALW A;  3BUP A;  1TQV A;  3D51 A;  1YWM A;  1W9M A;  1TQW A;  1TQT A;  3KAW A;  2YKT A;  3CKD A;  3D4Z A;  3ER8 C;  3QNI A;  3GI7 A;  4AZC B;  3LMF A;  1SU8 A;  3LVT A;  3T4A G;  3DPO A;  1I4T A;  5C5B A;  2OBM A;  3ACO A;  3B53 X;  4IM3 A;  4R5L A;  2C08 A;  3I01 A;  1DKX A;  4AZ5 A;  3CAZ A;  3QA8 A;  3B51 X;  4F00 A;  2F1B A;  3FD9 A;  4IWQ A;  1GNL A;  1O7D C;  3DX4 A;  4AZH A;  2ND0 A;  2YI9 A;  1UPX A;  1OAO A;  2QXL A;  4AZ7 A;  3RV1 A;  3T46 A;  1SU6 A;  3BUB A;  3DX1 A;  2YIA A;  2MI7 A;  3DPQ A;  2F7Q A;  4H6I A;  4HR1 B;  4R5G A;  1X04 A;  2O0I 1;  3VEB A;  2PY6 A;  1O7D B;  4AZ6 A;  3CVR A;  3ZED A;  1ZYL A;  4AZB A;  4EZQ A;  3O3N B;  4KIK B;  3EJS A;  3I2W A;  3KDR A;  4B9Q A;  4E81 A;  4ATM A;  4IM0 A;  1PS3 A;  4EZW A;  3EJQ A;  3CV5 A;  5FLE X;  5FIG A;  1DKY A;  2YI8 A;  3G9G A;  4JWE A;  2EFL A;  2F1A A;  3HAH A;  3BVX A;  2Q13 A;  3F7W A;  1E9V A;  3QE6 A;  2X3W A;  2ZXQ A;  2ND1 A;  3VEA A;  3I39 X;  4EZT A;  3BVV A;  2QKW A;  3L3P A;  1SU7 A;  1JQK A;  3BUI A;  2OW7 A;  4EZS A;  2OZN B;  1SUF A;  2LXY A;  3OWG A;  2QFF A;  4BNE A;  1GN9 A;  3A98 A;  4NQI A;  4R5I A; 
#chains in the Genus database with same CATH homology
 1X03 A;  2C08 A;  3Q0K A;  1ZWW A;  4FZS A;  1WDZ A;  1I4L A;  1I49 A;  2EFK A;  3G9G A;  3M3W A;  4H8S A;  4DCN C;  2RAK A;  2Z0V A;  4WPC A;  2D1L A;  4NQI A;  3SYV A;  2V0O A;  3CAZ A;  1I4D A;  2EFL A;  2X3X A;  2FIC A;  5C5B B;  3Q84 A;  3LLL A;  1Y2O A;  1URU A;  3HAI A;  1I4T A;  2D4C A;  3HAJ A;  3I2W A;  4I1Q A;  4DYL A;  5C5B A;  2X3V A;  3HAH A;  2RAI A;  2Q13 A;  4NSW A;  2Z0O A;  3ACO A;  4ATM A;  2ELB A;  4AKV A;  3QE6 A;  2RAJ A;  3DYT A;  2YKT A;  4AVM A;  4WPE A;  3SOG A;  2Q12 A;  3ABH A;  2X3W A;  2Z0N A;  3QWE A;  1X04 A;  4BNE A;  3QNI A;  3OK8 A;  3PLT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...