2D2WA

Solution structure and dynamics of the dna-binding domain of myocyte nuclear factor
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
101
structure length
101
Chain Sequence
b'ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Forkhead box protein K1
publication title Solution Structure and Backbone Dynamics of the DNA-Binding Domain of Myocyte Nuclear Factor (Foxk1)
rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 13
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2d2wA00
3WTXC 3U2RA 2A68F 1ONVA 4KIGA 2QLZA 1V4RA 4WXCA 4HLYA 2EB7A 3ERED 2UWMA 4EM2A 2MD5A 1JGSA 1ON1A 2ZMEB 4ON0A 1TW2A 4N9IA 3HOTA 3GLXA 4AIJA 3RI4A 3T1BA 5L3GA 2FF4A 3WTWC 5D5WB 1SFXA 3RYPA 4HDVA 1KYWA 1EH6A 1QO0D 1USSA 4KDPA 4KYWA 1KQ0A 2JPCA 4GO1A 2G7HA 2JT1A 2XKPA 4KICA 1U3EM 5IT9Z 5ICGA 4F7ZA 5LEKA 2ZNYA 1SD5A 3HSFA 4YFNF 1HSTA 5K1YA 3H92A 4WX9A 3GZ5A 4H0EA 3FF5A 2OD5A 4A0ZA 2OQGA 4B09A 2O3FA 3QAHA 1A04A 4M6XA 4G7HF 2EV5A 3LA7A 2YR2A 3B02A 1FT9A 2K02A 2BYVE 4G7OF 3F8CA 4IXAA 3KEQA 4HV5A 4MEXF 4LK1F 3P9CA 4M74A 4P96A 2EFQA 4BHCA 4N9HA 5LEJA 1XSXA 1GXQA 3JSOA 2MA3A 1Y0UA 3RKYA 4BXUA 3I0TA 4RGXA 2V1DA 1D8JA 2FRHA 3BPXA 1W7PD 4LG0A 2HEOA 2NAZA 3KP3A 4OIOF 2L54A 3R6SA 1CF7B 5CVRA 4GYGA 2VONA 2Q0OA 5DD8A 4N0BA 1Z6TA 1TLHB 4LLNA 4ZZLA 1FC3A 2D1VA 4AVPA 3K1NA 4LB6B 2FA5A 3LA3A 4JK1X 5E18F 3FX3A 3U9GA 3K1MA 1BI2A 4MGRA 1R1TA 1B9NA 1JE8A 3DEUA 2QBYB 2XGXA 3ROUA 1O3QA 2QWWA 4CZZA 4ZYEA 2GXBA 3DQVC 1J0RA 4A0YA 4EJWA 1FOKA 1R1VA 4HQEA 5BPIA 2RV8A 5LLQA 1HKSA 2UXNA 2P7CB 1S6LA 1K7AA 2DO7A 1BM9A 2HKXA 4I09A 2VBYA 1G3TA 4I0BA 2YU3A 2HR3A 3BZ6A 1TQPA 1ZGAA 5L3CA 1MDMB 3W6KB 3GW2A 4TV7A 1ULYA 5F6FA 3F6VA 4LJZF 5L3BA 2FMYA 4R1HA 4ENKA 1ZH5A 4OIQF 3LA2A 2HQNA 2Y48A 2LSOA 4I7HA 1BOAA 3ABUA 2AS5F 3AAFA 2ZO4A 4CXFA 4RB2C 1OR7A 3F72A 1C0WA 3WGHA 3ULQB 3T8TA 2CSOA 4A0XA 4GYIA 1P2FA 1RI7A 2HS5A 2FQ3A 5LHIA 1KYZA 4ETSA 4YIIA 4M6YA 3J7AO 4RB0A 2VOOA 2XHKA 2XAFA 2D45A 3TDZC 1U5TC 2IW5A 4EV0A 6PAXA 1FBSA 2HFHA 4FX4A 2RNJA 1HW1A 4P9FA 5D5UB 3K0LA 2IA1A 2XIGA 5IT9K 2VE9A 1IXCA 3CLOA 1TQMA 3RDIA 2W84A 1ZG3A 4PZJA 5E1XA 4NHJA 2NRAC 1J7KA 3BP8A 1QNTA 4RB3C 5CVUA 3SZTA 1LEAA 3S2WA 4MTDA 4CO8A 3SHFA 4OOIA 3HTSB 5ICEA 3L00A 1O3RA 4ZYGA 2O61A 1MJAA 2J5PA 1ZG1A 4IPAA 2R7DA 3BOQA 3GXOA 3BY6A 3F8FA 1FZPB 1F1ZA 3K2ZA 5DD4A 3HRUA 3EDPA 2PMHA 3I59A 2M5WA 4IHSA 4M9ZA 3BROA 4PCQA 2V79A 5ICFA 5D8KB 2KIUA 1U2WA 5E20A 4MHGA 2QQ9A 3Q9SA 5KVRA 5E1ZB 1P4XA 3BJOA 2FBHA 1HSJA 2DI3A 5HDGA 2F5DA 1IN5A 4P55A 1FWZA 1B1BA 3T0YA 1P92A 4R8HA 4LG0B 3FZVA 3FMSA 1DUXC 3IHUA 3P7NA 4UNOA 4KN4X 1O57A 1K79A 2WV0A 3VODA 3FXUA 4FHTA 2QM3A 3GO5A 2GWRA 4LLGF 3FMRA 4EMSA 5ICCA 2QVOA 5EEHA 2OQRA 2CO5A 3W6JB 2LNBA 3HHGA 3F22A 2FBIA 3I58A 4PGGA 2EV6A 5DUKA 1Z6RA 5LGUA 4LFUA 1VTNC 3I71A 3O6BB 3ZMDA 2IPQX 2XV4S 4I02A 2E1CA 5LHHA 2BE5F 4IVNA 3F8NA 1BIBA 4ZZDA 2DTRA 3F21A 4G6DA 4KMUX 4OIPF 1LEBA 3J80Z 1E2XA 4HF1A 1WI9A 2HKOA 1CGPA 3BWGA 3R61A 4ESJA 2A5YB 2UXXA 3VOEA 4U88A 4BHBA 1QGPA 3KETA 4GGGA 3ELKA 4CICA 2FBKA 2X0LA 4HBLA 3TOBA 1XCBA 2FXAA 4QLCU 4I2OA 2EA4A 3E6MA 4Y13A 3WODF 3NRVA 2DFIA 1P4AA 2Z5UA 2LDUA 4LLLA 1JXSA 2ZKZA 1XGOA 1YYVA 2W24A 1YS7A 1R23A 2XAHA 4UV8A 2VOPA 2W85A 2HQRA 2VBWA 5DYMA 2PG4A 5BPDA 1MJBA 5FFZA 1U5TA 4KN7X 3CO6C 2FEZA 1R5GA 1RIOH 2P6SA 3IC7A 1P6RA 2EV0A 5L3FA 4FX0A 1ZAOA 1T38A 5TRDA 2MLGA 2HOEA 1TNTA 5K5OA 3O3KA 1W4MA 4ESFA 4BNCA 3ZMTA 4L9JA 3NQOA 3D5LA 5LRSA 1SD4A 3PQKA 2IVMA 4HX7A 3ABTA 4I0AA 3Q5FA 4A6DA 4HX4A 4ZYHA 3G73A 4UVBA 3MFKA 2V1UA 3J81Z 1YFHA 4I01A 3QPTA 1AWCA 3HRTA 5D8LB 2OAZA 1FSEA 4EM1A 3DFGA 2NNYA 3I59B 4Y15A 2RN7A 3V8JA 4KUMA 4BQAA 5J8FA 2L4MA 5CJ9A 4OMZA 3JW4A 3DV8A 2OZUA 1MD0A 5ED4A 2KIMA 5HS8A 3WTZA 1KU2A 1H0MA 3F6OA 2P8TA 3DKWA 1YG2A 3HYIA 1ZN2A 3E6BA 3R0JA 1D3YA 3QP6A 3LFKA 3OV8A 4HF0A 2ESHA 2VC0A 2P6TA 1XMAA 3E3VA 3FXRA 2ZBKA 2FMLA 2DK8A 5FGMA 1S7OA 4JQFA 5H20A 3P9KA 1FY7A 4A12A 3ZMVA 2FNAA 1BBYA 4IF4A 1BIAA 1DPUA 5DEQA 1E17A 3KE2A 3HRSA 1S8NA 1EV7A 2XASA 1EH8A 3WE3A 5HOOA 5FO5A 5BQTA 5ILUA 1T0FA 4EJVA 4O5VA 2YX4A 3C3WA 3WTYC 5AONA 1B6AA 4KIFA 4WK8F 5FFXA 1G3WA 5CYVA 3RKXA 3M1EA 2BEOA 3J80K 4XRFA 2H09A 1TBXA 1PP7U 3WE2A 4D0PA 2M8EA 4HDUA 3KCCA 4O3MA 3TGNA 2OZ6A 2HGCA 1J75A 1OYWA 4WWCA 1GVJA 2CGPA 3C1DA 1OKRA 4L5IA 5DV5A 4IJAA 2Q8KA 2QYOA 3KEOA 4LK0F 3CUQC 1XDSA 3FM5A 1R58A 1J2XA 1KA8A 3M8EA 4KA4A 2RVCA 3E6DA 2WWYA 2Z3YA 4M9SA 2RQPA 1BN5A 3EQLF 5HVQC 1ZLKA 1HKTA 3HHHA 4UXNA 4M72A 4E70A 1YS6A 3QOPA 3O2PE 3BPVA 4UHTA 3HIFA 4UUVA 1QZYA 1XSVA 2DW4A 4DNCA 3DPLC 2LF8A 1IN7A 2DLLA 5CVJA 4R79A 4Q48A 3KZYA 3T5XA 4EQQA 2V9VA 1HQCA 3IL2A 1U5TB 3N4MA 2EFOA 1FLIA 1O7LA 3V7SA 1YO5C 1T39A 3WTUC 1LVAA 3GX4X 4XBFA 1LDJA 5ILVA 3F23A 5HDNA 2HYGD 1LJ9A 1STZA 2K7LA 2ZNZA 3IRQA 3IKVA 3VFZA 3ZP5A 3J81K 2TDXA 1WKMA 4FT8A 2GXGA 5DCMA 2ADUA 1XCVA 1Z7UA 2BBYA 5EEGA 2A3SA 4HF2A 1K78A 5FLXZ 3GVAA 3QU6A 2P7VB 3WTVC 4IRGA 2QUFA 3ZMUA 4RB1A 3RPQA 3CTAA 2ESNA 3GFIA 2PBIA 3HRMA 4L18B 1UCRA 4B8XA 3LAPA 2XRNA 3HSEA 3LAJA 2MH9A 2GQQA 2OBPA 3R60A 3F8BA 3I64A 1TTYA 2LF7A 5HS7A 3Q9VA 1YW8A 2MH2A 3T8RA 5D6FA 5E17F 2VT3A 5LRRA 1FYKA 1UHMA 3KZZA 2L02A 2EFPA 5H6RA 3FM3A 1ZRDA 4WF2A 3R4KA 3WU0A 1I27A 1ZGJA 2RGVA 2GA2A 3R0AA 3WTTC 1UHWA 4HX8A 1HBXG 4O6JA 3HSRA 5DCFA 3L2CA 4L9TA 1IXSB 1I1SA 1IN8A 4GXOA 2O8XA 2OA4A 1TW3A 4RAYA 1FX7A 1I1GA 2DPUA 2LKPA 4A2UA 3NEUA 5J8CA 1G3YA 4HA8A 1ZLJA 2X4HA 3I4PA 2XROA 1S29A 1OPCA 4EJTA 1TNSA 3N97A 3RKWA 1R1UA 2IRFG 3TO9A 5L3EA 4AIHA 2O6GE 3FMQA 2MBFA 5LGTA 1XN7A 4WCGA 1T2KA 1PP8F 4AD9A 3TKYA 4G9YA 4LD5A 5ERIA 1R36A 3EETA 4EJOA 1F9NA 2EWNA 5H6QA 1Z91A 2V1XA 4CGZA 1S3JA 5K5QA 5D5XB 3V8LA 1ZRFA 3LQQA 3CUOA 4HLXA 2F5FA 2HYFA 1ZREA 1GHCA 2RDPA 4RGSA 4L0YB 3ECOA 3L09A 3RIRA 3CUQA 4Q4ZF 2QZ8A 1H9TA 5KK1A 2KKOA 4ASNA 2IJLA 2QQAA 4A6EA 2K4JA 4HQMA 3B73A 4Z2YA 2EA2A 1B59A 1IW7F 4QWQA 5CVIA 3TOAA 4YFXF 2G7UA 4HW0A 3BDDA 1BI1A 3MZYA 1ZARA 1UFMA 3P9IA 3M8FA 2YX7A 4CYDA 4G7ZF 3LSTA 3MQ0A 5LHGA 4NB5A 2XKOA 1R5HA 5IT3A 3QU3A 1IRGA 4KMFA 1O3TA 3M7GA 2E7WA 1WQ2A 3WTSC 1PUEE 1F4KA 3ZN0A 2H27A 3PQJA 4U0YA 2ACJA 5E8IA 4EGZA 1W5TA 1RUNA 4OMYA 5FLXK 2W25A 3E5QA 4DQ2A 1YIOA 4M71A 5D4SA 1ZG5A 4A5MA 1KU3A 3RTRA 3LWFA 4OIRF 4ZYDA 5FB2A 3ZMSA 1DDNA 2ZFWA 5JVTA 3E5UA 5DCMB 1BI0A 4G8XA 4P5OA 3HTUA 1X3UA 1XGNA 1K78B 4KNYA 3L7WA 4HYEA 3D0SA 2ZCWA 1WRJA 1XGMA 3RJPA 1QQIA 1KU7A 4ENJA 2Q2EA 4KT5C 5DUIA 3M9AA 2A6HF 1ODDA 2A07F 3KP2A 2Z99A 4OU0A 4XSXF 4L0ZB 2HTJA 2ETHA 2E7XA 3SZPA 4IHTA 2H6CA 1YLFA 4IRIA 2DQLA 4EVIA 2F2EA 4P9UA 5HLIA 3SXYA 1K6OA 2R3SA 3KP4A 1IN6A 3WGGA 1F5TA 1XDUA 2GIVA 1BC7C 2CW0F 4PGHA 2IP2A 1Q1HA 4Y17A 2IT0A 2M87A 2MC3A 2XVCA 2VC1A 4AWXB 3ZN1A 2P5KA 3C18A 1MJ9A 1IN4A 2V6CA 4U7BA 2J5OA 4ZH4F 4WXDA 2Z9OA 4RGUA 3EUHA 3OOPA 2K4BA 1IRFA 4A5NA 4XLPF 2RKHA 1IF1A 2M1BA 2A6EF 2PN6A 2ZJ2A 3ECHA 3U1DA 2L4AA 4L9VA 1U6GA 3MWMA 3I53A 3K69A 4LMYA 1G3SA 2EFWA 2PJPA 1J59A 2PFBA 4CDGA 2WTEA 3WU1B 4RS8A 1W7PA 1R7JA 2KRFA 3GWZA 4L9NA 1W5SA 1FYMA 2PLYA 3MAJA 1FNNA 1FBUA 1LNWA 3JAMZ 3CUQB 4XLNF 2P5LC 1L0OC 2FU4A 3GEZA 3FWEA 2YSRA 3CDHA 1NHAA 3MCZA 3DP7A 2ISYA 1SFUA 5BOXA 2CWEA 1DP7P 3V8KA 1Z9CA 3E97A 2H6BA 4AIKA 5DDGA 5HDKA 4PDKA 2G9WA 2ELHA 2DPDA 4MQVA 4CHUA 4L5JA 4BH9A 1OYIA 2Y0MA 3V4GA 1U78A 2O03A 3H3ZA 3IKTA 2DK5A 5F1RA 3V7RA 4HAMA 1R00A 3QRFF 2KJBA 1SD6A 3HUGA 1UB9A 1SAXA 2ZXJA 3IWZA 1YW7A 2Z33A 4I98B 3BJAA 2FSWA 1V3FA 4UVAA 1OMIA 1YQAA 4M73A 3K9TA 2QQBA 3GF2A 5LGNA 5J6XA 3QPHA 2JSCA 1XD7A 5A2QZ 1O3SA 2Y75A 3KLOA 1KQ8A 2M45A 2C6YA 2JRTA 3G3ZA 3ZQ7A 5LBQA 4YG2F 2XAQA 2COMA 1O7FA 4MEYF 3KFWX 2PEXA 2A61A 5TJJA 3HOSA 5CVVA 3FHZA 3RYRA 1OYYA 4NQWA 2STTA 2JTVA 2JZYA 4HV6A 1T6SA 1G6NA 3H3UA 1WSUA 2ISZA 2VE8A 2OU2A 1YW9A 4RAZA 2FNPA 3MZHA 2PMUA 4G6QA 2HZTA 2CG4A 2CYYA 5AIQA 2L01A 5AIPA 1IZ1A 3ZPLA 3DF8A 1Z1DA 4KIBA 1P4WA 1XGSA 3COAC 5D6EA 3GFLA 2H94A 1KU9A 4U7DA 3JTHA 3PFIA 1J9IA 2DU9A 3TDUC 1U8RA 3E6CC 1REPC 1BC8C 1FSHA 1T98A 3KP6A 1I6XA 1L3LA 3JTGA 1RNLA 2WC2A 5ILSA 5K5RA 2UZKA 3LQRA 2VBXA 2EJRA 1HKQA 3SFZA 1FYLA 2HDCA 1AOYA 1JHHA 2W57A 2IA2A 5D4RA 2K27A 4U0VA 1D5VA 2DBBA 3KP7A 2YPRA 4MQ9F 2B0LA 2ZMEA 4EJUA 1FBQA 1SD7A 2D2WA 1LDKB 2KJCA 4JBAA 3WGIA 5JHUA 1IUYA 3C7JA 4M9XA 2VXZA 1USTA 4XSZF 4Q5SF 5JFRA 1BI3A 2DQRA 4U0WA 2DAOA 4MNUA 1I5ZA 4EM0B 4K2EA 1RUOA 3JSPA 4Q47A 2VODA 1BJAA 3E5XA 2EFNA 4S04A 4ESBA 3JAMK 1H9GA 2FOKA 3CO7C 1TQIA 2CFXA 3GUDA 5HS9A 3EYIA 3GYHX 5CLSA 2GAUA 1WWXA 5FD6A 2XUBA 1W7PB 4UVCA 3KP5A 4UV9A 1ZRCA 2KIFA 5F64A 2D1HA 4BAYA 1XB4A 5HLHA 2CQKA 4ENNA 2JPBA 3TQNA 1JHFA 2F5CA 2GA1A 1LB2A 3TO7A 3TO6A 3GFJA 5HLGA 1Z05A 2K86A 5BMZA 4KFCA 1FP2A 3IRRA 2AXLA 1ZHFA 5JI6A 2FE3A 3IWFA 3FXQA 1S7AA 4HOBA 4GCVA 2HWVA 5D5VB 1MGTA 3K1PA 1B9MA 1CF7A 3V7CA 1QPMA 2HTSA 1ON2A 3GZ6A 1PDNC 4EGYA 1GXPA 5A2QK 1B4AA 1R22A 4RGRA 2PQ8A 3GFMA 2EK5A 5BS6A 2F5EA 2QBYA 4S05A 1SMYF 1LDDA 2IA0A 4BHPA 2R7FA 2DT5A 1YTYA 4YIFA 1MKMA 2NYXA 5L3DA 5E1WA 1G4DA 1HW5A 2BGCA 2STWA 1EH7A 2BV6A 3DXJF 2E1NA 2RC4A 2NNNA 5E8GA 1D8KA 3WG9A 1DPRA 3DPTA 1XMKA 4BYYA 3QP5A 4WXHA 1QBJA 5JR3A 2A69F 2NS0A 1RZ4A 1QZZA 3CJNA 3KLNA 1HXDA 3MEXA 1MDMA 1IAWA 1MZBA 2P4WA 1XSDA 1IXRC 3VEPA 1LQ1A 1KGSA 2XAJA 4LB5A 2O0YA 1SMTA 2VN2A 2P5VA 3BJ6A 2L3DA 1FPQA 3L9FA 2MLKA 2M30A 5FD5A 2GZWA 2PI0A 2VT2A 1ZYRF 1FP1D 3F8MA 2QENA 4YFKF 1HW2A 4MTEA 3REOA 4HZFA 4IRHA 1SFEA 4OINF 3F3XA 4G94A 2XAGA 2VBZA 3ML6A 3VB2A 4ENMA 4LGWA 3SQNA 1KQ9A 1J5YA 3I5UA 3ZMZA 3EYYA 3RPUA 3ISPA 3I54A
chains in the Genus database with same CATH superfamily
3WTXC 2HOAA 1ETVA 3GZNB 4H4KC 2JWTA 3U2RA 2ID6A 4OAYA 2A68F 1ONVA 1JTYA 1BR2A 3A4CA 4KIGA 4HRIA 1WGXA 2QKLB 1V4RA 1TP4A 2QLZA 4WXCA 5FROA 4HLYA 3VWBA 3S14J 3CJTB 2EB7A 3ERED 2UWMA 1FIAA 4XNFA 2LVSA 2R7TA 4EM2A 5C3EJ 1X4OA 1LVKA 3K4BA 2MD5A 2HDWA 1JGSA 1VQ8I 4BEHB 1ON1A 2ZMEB 4FCYA 3Q0VA 3PUFA 4ON0A 1TW2A 4N9IA 3HOTA 2VL8A 2MGQA 3GLXA 4AIJA 3RI4A 3FIWA 3BCAA 3T1BA 5L3GA 2CUZA 2FF4A 5IYCJ 4BJ5C 4HNVA 5KAFC 3WTWC 4ZJZA 5D5WB 1RR7A 2ZFUA 1SFXA 2BY3A 3RYPA 4ZTJA 4HDVA 1KYWA 2IBDA 3TP3A 4BUPA 1EH6A 1QO0D 4QIWN 1USSA 4KDPA 4JX4A 2DN0A 2IEKA 2DTZA 2OCCH 3FKIJ 4BACA 2HDDA 4KYWA 1KQ0A 1YJ9I 2JPCA 1F36A 4GO1A 4PK4A 2G7HA 2JT1A 1BR4A 2XKPA 5FKKA 4ZDLA 4KICA 1U3EM 5IT9Z 2KDOA 1U9OA 4YEJA 1HLVA 5ICGA 2B63J 3CP8A 4F7ZA 1LFBA 4NDLA 5LEKA 1YJNI 4XN3A 4UUTA 2ZNYA 3CCVI 3W3CA 1SD5A 2DDBA 2Y30A 3HSFA 4YFNF 2V6EA 2V9PA 1DU0A 4JYKA 1HSTA 2IS2A 1RPWA 5K1YA 2R7XA 3H92A 5DTDA 4WX9A 2W7NA 3GZ5A 4H0EA 2VXDA 3AL0B 3FF5A 1MMDA 2VQGA 2OD5A 4A0ZA 2OQGA 4B09A 2O3FA 3QAHA 2KQRA 1ZR2A 1SEUA 1A04A 1FJLA 4M6XA 3PIOF 4G7HF 4DZPA 2EV5A 3CLQA 3LA7A 4AM3A 3CQZJ 2YR2A 3B02A 1FT9A 4F52A 2CV0A 2K02A 2DT6A 2BYVE 3GTOJ 4G7OF 3F8CA 4IXAA 3OYGA 4Y52J 1A31A 3KEQA 3CC7I 4HV5A 4MEXF 3H5NA 4LK1F 1VQPI 3P9CA 4M74A 4P96A 5IP6A 2EFQA 1IDZA 4BHCA 2RAEA 2VLAA 2HU9A 4M3DA 4N9HA 5LEJA 3K70D 1XSXA 1HOMA 1GXQA 3B6AA 3JRFA 3JSOA 4BQOA 3CDLA 2MA3A 2R7VA 1Y0UA 1Y1VJ 3RKYA 4BXUA 3I0TA 1IV6A 4RGXA 1ITYA 2V1DA 3J7YJ 1D8JA 2FRHA 3BPXA 2R7WA 3LSPA 1W7PD 4LG0A 2HEOA 1IRZA 2NAZA 3KP3A 1SFKA 3OWTA 4OIOF 2L54A 3R6SA 4BJ6C 1CF7B 5CVRA 4GYGA 2VONA 2Q0OA 3A01A 5DD8A 4N0BA 4XORA 1Z6TA 1TLHB 3OIPA 3LOCA 1XX5A 4LLNA 4ZZLA 1FC3A 2D1VA 4AVPA 3D5RC 3K1NA 4LB6B 2FA5A 3LA3A 2ECCA 4JK1X 3HOYJ 3DKYA 3BTIA 5E18F 3FX3A 3U9GA 3K1MA 2R5ZB 2BZTA 1BI2A 3DPUA 4MGRA 3GMEA 2YUSA 1IRXA 3DTEA 5GPAA 1R1TA 4V2GA 1B9NA 3ZR8X 1JE8A 2ID3A 3IAM2 3HGYA 3DEUA 2QBYB 4PJJA 2XGXA 3ROUA 1POGA 1O3QA 2DMNA 2QWWA 4CZZA 1IO2A 4ZYEA 2M7BA 2GXBA 3DQVC 1J0RA 4A0YA 4EJWA 2GOXB 3K2AA 1FOKA 1R1VA 3LSIA 4HQEA 4A3MJ 5BPIA 2DA2A 2RV8A 3N05A 5LLQA 1HKSA 2EIJH 2UXNA 3MKWB 3LSMA 2P7CB 1S6LA 2CRGA 5HLTA 1TT0A 2DO7A 1BM9A 2UV1A 2XAUA 3CJQB 3QYFA 3PSIA 1K7AA 4AYBN 4C2UA 3A1YA 2DFFA 4BXXJ 2HKXA 2HNHA 2MW8A 4UB6C 4I09A 2VBYA 1G3TA 4I0BA 5F04A 2D5VA 2PJRA 4RBOA 2YU3A 3LSHA 2HR3A 4HG2A 3BZ6A 3G6EI 1TQPA 3S93A 1ZGAA 5L3CA 4RDUA 4D9JA 1MDMB 3W6KB 3GTLJ 3GW2A 4M3FA 4TV7A 3SDGA 5DM6F 3F0CA 4J00A 3PFYA 4YIRX 2E36A 1ULYA 5F6FA 4C30A 2GOMA 1E3PA 3F6VA 1W5CC 4LJZF 1SVOA 1MBGA 4C3HJ 5L3BA 2H1LA 2FMYA 4R1HA 4ENKA 2AQEA 1ZH5A 4OIQF 3LA2A 3FBNB 2HQNA 3ZQQA 1H89C 1MSFC 1ZTRA 2Y48A 1FMWA 2LSOA 2VKDA 2R5YA 2X6YA 4I7HA 1BOAA 1EJ9A 3ABUA 4E7IA 3IUOA 2AS5F 5HNHA 3AAFA 1WH7A 2HVRA 2ZO4A 4CXFA 3VSKA 4RB2C 1OR7A 3F72A 4RM2A 2JRMA 1C0WA 4V19K 1Y8QB 3WGHA 3ULQB 2MD0A 2ECBA 3T8TA 2I10A 2CSOA 2LP0A 4A0XA 4GYIA 2NOJB 3JRDA 1P2FA 3KYCB 1VFCA 3H3VK 1RI7A 2HS5A 1OJLA 2FQ3A 5LHIA 1V54H 1KYZA 2OV7A 2LRDA 2VKVA 4ETSA 4NUBA 2XGEA 4YIIA 1IDYA 2IS6A 4M6YA 3J7AO 4RB0A 2VOOA 1U0JA 2L7FP 2XHKA 2XAFA 2D45A 3TDZC 1U5TC 2IW5A 4HPQA 4EV0A 2KP6A 6PAXA 1FBSA 2HFHA 3A03A 3LFUA 3IAS2 4FX4A 2RNJA 1HW1A 4P9FA 5D5UB 2LYCA 3K0LA 2IA1A 2XIGA 5IT9K 1ZQ3P 2VE9A 1IXCA 1W0TA 3PIPF 2EBIA 2L9RA 3CLOA 1TQMA 3K4KA 3RDIA 2W84A 5M3MJ 1ZG3A 4PZJA 5E1XA 4NHJA 2BY0A 3HL2A 1VQKI 1PJRA 2NRAC 1J7KA 1H8AC 3ZQIA 5GTHC 3BP8A 1QNTA 2BXZA 4RB3C 4U87A 5CVUA 3SZTA 1ETWA 1LEAA 2AHQA 3S2WA 4MTDA 4CO8A 3OOUA 3KYDB 3SHFA 1GLNA 3DU5A 4OOIA 5GADJ 4A3CJ 2HQ5A 3HTSB 1XG1A 5ICEA 4HNTA 3K4JA 5GAEJ 4C3IJ 3L00A 1ETOA 4D1QA 3OYHA 3WHBA 1O3RA 4C3JJ 2E2HJ 4ZYGA 2O61A 3OSFA 4B4CA 2X85A 3C2BA 3BTCA 1APLC 1MJAA 2J5PA 1ZG1A 3BT9A 3RSNA 1JTXA 3WG7H 4IPAA 2R7DA 3BOQA 4DZJA 4C9YA 3GXOA 1JUMA 3HOWJ 3BY6A 3IH3A 1K4SA 3TW7A 3F8FA 5IYBJ 2JA2A 1FZPB 1SFOJ 1F1ZA 3K2ZA 5DD4A 3HRUA 1T8IA 1B8IA 3JRHA 3EDPA 2PMHA 3I59A 3FKJA 5B66C 2M5WA 2OCEA 4A69C 3RKQA 2BOLA 4IHSA 4M9ZA 4QTRA 3BROA 3A02A 4PCQA 2V79A 1Y0NA 5ICFA 2XRLA 4KISA 2DJNA 2NVUB 4B44A 5D8KB 4XRSA 2KIUA 1U2WA 1RR8C 5E20A 4MHGA 2QQ9A 3Q9SA 5KVRA 1W36D 4V2FA 2BHYA 2Y31A 5E1ZB 4DYQA 1AKHA 4M3BA 3MD2A 1P4XA 3BJOA 3CCQI 2FBHA 3BQZA 2OTJI 1E0EA 1HSJA 2DI3A 5HDGA 2F5DA 1IN5A 4P55A 3ZQHA 1FWZA 4XICA 3BR3A 2PMZN 1B1BA 1WJDA 1UG0A 1JKQC 4BBRJ 3T0YA 2DT7B 3FXLA 1PUFA 3KEYA 1P92A 4CUGA 2MYSA 4R8HA 3OY9A 3GBGA 4LG0B 1FMVA 4IQ4A 3HEFA 3FZVA 3FMSA 1DUXC 3IHUA 1DGWY 1AA7A 4XKBA 3P7NA 3AKZA 3A01B 4UNOA 4KN4X 3ZGKA 1O57A 1K79A 2WV0A 3VODA 3FXUA 4FHTA 3HZJA 1I3QJ 2QM3A 3HKZN 3GO5A 2GWRA 4LLGF 3FMRA 4XLAA 4IOCF 3HOUJ 3ABLH 4EMSA 5ICCA 2QVOA 1T0FC 2E19A 2CQXA 3HPHA 3E1SA 5EEHA 2BHZA 3DTIA 1TL8A 4MO7A 2OQRA 2CO5A 3W6JB 2LNBA 3K4CA 2MG4A 3QYEA 1G2HA 3K10A 2ME0A 3HHGA 3F22A 2FBIA 3I58A 4PGGA 4BY7J 2EV6A 5DUKA 1Z6RA 5LGUA 2EIMH 4LFUA 1VTNC 4DIQA 3VYRB 3I71A 3O6BB 3QQAA 1YHQI 3ABMH 3ZMDA 2IPQX 2XV4S 4I02A 2DFHA 4PJ0C 2E1CA 1X19A 3PNVA 2W4SA 5LHHA 2E35A 2W1OA 5LFAA 2BE5F 4IVNA 5E3NA 3F8NA 2FOWA 1BIBA 4ZZDA 2DTRA 4XM3A 2PJRB 1WPKA 3F21A 4G6DA 3KYLA 5HODA 4KMUX 4XIDA 4OIPF 2V4JC 1H88C 1LEBA 1S5LC 1E2XA 4F91B 3J80Z 4HF1A 1WI9A 1N77A 2HKOA 2WAFA 1CGPA 3BWGA 3R61A 4ESJA 3M1CA 2A5YB 2GM4A 2UXXA 4MFEA 2BY2A 3VOEA 2ZSIB 4U88A 4BHBA 1QGPA 5M5YJ 2JQ7A 1T08B 3KETA 2JMWA 2PMZA 3OYFA 2IGOA 2IXSA 4GGGA 3ELKA 4BXFA 5F08A 2CMPA 4CICA 2FBKA 2X0LA 2Y0SA 4HBLA 3TOBA 3SEQA 2CQNA 2R5YB 1XCBA 2FXAA 4QLCU 1MMSA 4HNUA 4I2OA 2EA4A 3E6MA 3FK7A 4Y13A 4XOTA 3VYSB 2JA6J 4XRMA 1X2MA 3WODF 3NRVA 1K61A 2DFIA 1P4AA 5KNLA 2Z5UA 2R0QC 4CZCA 1MBKA 2KDZA 2LDUA 4LLLA 1JXSA 2CU7A 2ZKZA 1ETXA 1XGOA 1WJEA 1YYVA 2R7SA 2XGCA 3I9V2 3BTLA 2W24A 1YS7A 1R23A 2XAHA 1A6QA 4UV8A 2VOPA 2E71A 2EILH 2XC7A 2YU9J 2W85A 2HQRA 4PSWA 1MBFA 2VBWA 5DYMA 4PFPA 2PG4A 1BW5A 3BQYA 5BPDA 5EYRA 3FISA 1MJBA 4ABZA 3OS0A 1FTZA 5FFZA 1U5TA 4KN7X 5GAHJ 4CCNA 2HPIA 1OR7C 3CO6C 2FEZA 1R5GA 1RIOH 1G59A 3S2DJ 2P6SA 4IZZA 3HOZJ 1FEXA 1Z77A 3IC7A 3W6VA 1P6RA 2EV0A 4FX0A 1ZAOA 2BY1A 5L3FA 5EZGA 1T38A 5TRDA 1UJ8A 2MLGA 2HOEA 1TNTA 2M4GA 3O3KA 5K5OA 3LNQA 4IX7A 2LH9A 4D5FA 1W4MA 2M4KA 4ESFA 3KIOA 4GDFA 5J1RA 4PUSA 4BNCA 1Y1WJ 3ZMTA 4I99C 2ELJA 3BR5A 4L9JA 3NQOA 3G1MA 4KT6A 4CCMA 3ZQFA 2K40A 3OR2C 3H9QA 2JUGA 2LFBA 2M0MA 2JSPA 3D5LA 3SJMA 1IG7A 5LRSA 1D0ZA 1SD4A 3RPUD 3K4MA 1K6YA 3L2VA 1OCRH 1VQ7I 4A3LJ 3PQKA 2IVMA 4HX7A 5FLVA 1Z7LA 3ABTA 3B6CA 4I0AA 3Q5FA 4A6DA 4HX4A 4ZYHA 4RA2A 4UVBA 3G73A 3WHCA 3MFKA 2V1UA 3M4OJ 4XONA 4I6ZA 1FIPA 2ZXWH 3J81Z 1YFHA 4D7NA 1SVLA 4I01A 3QPTA 5M3FJ 3OYAA 2XSJC 1UELB 4EATA 3L2WA 1RKTA 1T33A 3HRTA 5D8LB 2OAZA 1FSEA 2M3AA 2X48A 4EM1A 5LD2C 1AWCA 5FKOA 5EZHA 3DFGA 1CQTA 3PJRA 4LITA 2NNYA 3I4MJ 3K7AJ 3I59B 4QPOA 2RN7A 4Y15A 3V8JA 4KUMA 4BQAA 5J8FA 2L4MA 5CJ9A 2DA4A 4OMZA 4AIDA 1SAUA 3JW4A 3BR1A 1B72A 1GDTA 2V1NA 3DV8A 1WFXA 2OZUA 3LMMA 1MD0A 5JLXA 5ED4A 2KIMA 1Y39A 4E7ZA 2LD5A 1JJ8C 5HS8A 3WTZA 5CQEA 1KU2A 1H0MA 3F6OA 2P8TA 1V5FA 2DXIA 2WAQN 2VI6A 2NVXJ 2QCOA 3DKWA 1YG2A 2K5CA 1AKHB 3HYIA 1ZN2A 3E6BA 3R0JA 1D3YA 3QP6A 3LFKA 3BG9A 3OV8A 4HF0A 3DKXA 1VQLI 2ESHA 4LG3A 2VC0A 2P6TA 1XMAA 5TISC 3E3VA 3FXRA 2H8RA 4GFBA 3AG1H 2ZBKA 2EZHA 2FMLA 2DK8A 5H2FC 5FGMA 1S7OA 2X6WA 4JQFA 5H20A 1PUFB 3P9KA 3BR0A 1FY7A 3HGGA 4A12A 3ZMVA 2FNAA 4NC7A 2LTPA 1BBYA 3MVPA 4IF4A 2XB0X 3S8PA 4XKWA 1BIAA 2V7FA 2M2EA 1DPUA 2IGMA 5DEQA 3VPRA 2R92J 1E17A 3KE2A 3BR6A 1I50J 1QU3A 3HRSA 4RAFA 1S8NA 1EV7A 2XASA 1EH8A 2GXAA 3WE3A 5HOOA 3MZ8A 5FO5A 5BQTA 5ILUA 4JOMA 1T0FA 4B3XA 1D1AA 2VJ5A 4EJVA 5J40A 2E60A 4O5VA 1MSEC 2YX4A 3C3WA 3WTYC 5JVGF 5AONA 1X1DA 1B6AA 2K3PA 3AG2H 4KIFA 4D7MA 4WK8F 2WBMA 2FUG2 5FFXA 1G3WA 5CYVA 2QA4I 3CCEI 3RKXA 2NS8A 2E5ZA 5EJCA 3M1EA 4BJTA 2BEOA 3Q0WA 5FRMA 2XF7A 1QHHD 1KZHA 3J80K 4CCOA 1XTAA 4IEJA 1S72I 2XF5A 4ITVA 4XRFA 2H09A 4IOAF 1TBXA 1PP7U 5E79C 3WE2A 4D0PA 2M8EA 4HDUA 2FQ4A 2JA8J 2V9KA 4L5EA 1R5ID 3KCCA 4O3MA 2JA5J 3TGNA 2OZ6A 2O8KA 2HGCA 4B48A 3X2QH 1J75A 4XMYA 1OYWA 4WWCA 4BE1A 1GVJA 4RLQA 4E7LA 2VQLA 2CGPA 3C1DA 1OKRA 4L5IA 5DV5A 5EG0A 3VYTB 2WAQA 1BA5A 4IJAA 1BJZA 2COBA 2OTLI 2Q8KA 2QYOA 2M8GX 3KEOA 5K7FA 1DGRM 3S15J 4LK0F 2LY2A 3CUQC 1XDSA 4A3BJ 3G4SI 3FM5A 1R58A 1J2XA 4A3IJ 1KA8A 1OFCX 3M8EA 2E2IJ 4KA4A 2Y9ZA 2RVCA 3D5SC 3E6DA 1NG7A 1HC8A 4A3KJ 2WWYA 2Z3YA 2FJ1A 3QPSA 4M9SA 2L9NA 2CS3A 1BN5A 2RQPA 3EQLF 3SYTA 1MH4A 5HVQC 1ZLKA 1UG2A 1HKTA 1K4TA 2RQQA 3HHHA 2H8WA 5CKTA 1UZCA 4UXNA 3H35A 5K7ZA 3HOVJ 2KPMA 3FXKA 4M72A 4DJAA 4E70A 1YS6A 3GTGJ 1MMGA 5J3LA 3QOPA 3O2PE 3BPVA 1VQ4I 3QYBA 4UHTA 3HIFA 2WA0A 4UUVA 1QZYA 3JCUC 1XSVA 2DW4A 4DNCA 3DPLC 2KRCA 2LF8A 1IN7A 2DLLA 3PSFA 5CVJA 1T56A 4R79A 4MIMA 4Q48A 1O4XA 3ASOH 2NVTJ 4M6VA 3KZYA 3ASNH 3T5XA 2AQFA 5GAGJ 4Y3OA 4EQQA 3QPLA 2V9VA 3IH2A 1HQCA 4RMNA 1HDDC 3IL2A 2E1MC 3PUBA 3CMYA 2JA7J 2L9VA 2ZXIA 3HOXJ 1U5TB 3N4MA 2EFOA 1MH3A 3KZIC 1FLIA 1Z67A 2L9SA 1O7LA 5KAIC 3V7SA 3MKLA 1YO5C 1T39A 4RM3A 3DTKA 3WTUC 1LVAA 3G1LA 3GX4X 1ZKGA 4XBFA 1Y8RB 1D5YA 1LDJA 5ILVA 3OS2A 3F23A 5HDNA 2HYGD 1D1BA 2DOFA 1LJ9A 1YOVB 2F4OB 2Q1ZB 1QZEA 1QVUA 1STZA 2K7LA 3LSRA 1XC5A 2ZNZA 4PJMA 3IRQA 2DYRH 3DEEA 1YX3A 3IKVA 4ZTFA 4OAZA 2WADA 1YITI 3VFZA 3ZP5A 2VKHA 3J81K 2TDXA 1WKMA 4FT8A 2GXGA 5DCMA 2ADUA 3VYUB 3JREA 1XCVA 2JN6A 2KFDA 1Z7UA 2BBYA 5EEGA 2A3SA 2CJJA 4HF2A 1K78A 5FLXZ 2P7VB 3GVAA 3QU6A 1XPXA 3WTVC 4IRGA 2QUFA 2X1CA 3ZMUA 3BC8A 4RB1A 3H5RA 3RPQA 3CTAA 3RQIA 3OMYA 2X9DA 3RQ4A 1BL0A 2ESNA 3GFIA 2EH3A 2PBIA 4AU7A 3HRMA 4L18B 2XDVA 1UCRA 4B8XA 3LAPA 2EQRA 2XRNA 3ZQGA 2R4GA 3HSEA 3LAJA 4C2TA 2MH9A 2GQQA 1W0UA 2RREA 2K9LA 2OBPA 3R60A 2IS1A 1V55H 1X1PA 5TGTA 1QHGA 3SDBA 1JUPA 4IHWA 3F8BA 3I64A 1TTYA 2LF7A 3LL7A 4DOZA 5HS7A 3EPZA 2LREA 2BW3A 3D1NI 3CP2A 3Q9VA 1YW8A 5FJ8J 2XPWA 5B1BH 2BVMA 3BLYA 2MH2A 3T8RA 5D6FA 5E17F 3MN2A 2VT3A 1B72B 5LRRA 1FOYA 2W48A 1FYKA 1UHMA 3KZZA 2L02A 2EFPA 5H6RA 3FM3A 2QSGX 2QEXI 3FXJA 2AO9A 3R4KA 4WF2A 2XSDC 1ZRDA 3WU0A 3BG3A 1I27A 2K85A 1QRYA 3HM5A 1R4NB 4DYCA 1ZGJA 1OISA 2RGVA 2GA2A 1YIJI 3R0AA 4BS9A 2M9HA 4LIUA 3WTTC 1UHWA 3DCFA 4HX8A 5JLWA 1HBXG 2E1OA 4O6JA 3CD6I 1DQUA 3HSRA 5DCFA 2AXTC 2KHMA 3L2CA 2ZXHA 4L9TA 1IXSB 2HXIA 1I1SA 1X3WB 5E3OA 4YELA 1IN8A 4GXOA 1Y6IA 1TWHJ 2O8XA 2OA4A 5EDNA 2OC6A 3UNGC 1TW3A 2R7ZJ 4S0HB 4RAYA 1FX7A 1A35A 1I1GA 3DWLE 2DPUA 2Z16A 2E5NA 1A6IA 3OYMA 4BE0A 1PYVA 1JGGA 4IHVA 2MC4A 3DEWA 2LKPA 4A2UA 3NEUA 1LFPA 3EUHC 4LOCA 5J8CA 1G3YA 4HA8A 3OYKA 1ZLJA 2X4HA 3I4PA 3A0BC 2XROA 1S29A 1OPCA 4F3QA 2X51A 2LG4A 4EJTA 1MNEA 1OCZH 1VI0A 1TNSA 2B7EA 3N97A 1R9TJ 3J7ZI 3I55I 1PVEA 1GVDA 3RKWA 1R1UA 5GPCA 4FASD 2IRFG 3TO9A 2Y0SN 5L3EA 4AIHA 4Y7NJ 4J19A 2O6GE 3HXLA 3FMQA 2MBFA 5LGTA 2HZDA 3GTPJ 3H5AA 1XN7A 2CQ7A 4WCGA 1T2KA 2ZJPF 1ETQA 2NOGA 3SZGA 1PP8F 4AD9A 2NVYJ 3TKYA 4G9YA 1VQNI 3IV5A 4Y4RA 1JKRC 4LD5A 4XN0A 1R36A 5ERIA 3EETA 3S1RJ 3AG4H 4EJOA 1FTTA 1OQYA 3ZQCA 1F9NA 3RCOA 3K70C 2DOEA 1AU7A 2EWNA 1D0YA 5H6QA 1X1AA 2FD5A 1Z91A 3CZ6A 1OCTC 1BW6A 2V1XA 3ONQA 4CGZA 3BG5A 1JJ6C 1S3JA 5K5QA 5D5XB 3NWTA 2JK3A 3V8LA 3OYJA 3MMYB 1ZRFA 3LQQA 3OR1C 3CUOA 1R49A 4HLXA 2VJJA 1E3OC 2F5FA 2HYFA 1ZREA 2LBFA 1WZ2A 4II2A 5EG0B 3ESWB 1GHCA 2ICWG 4DBRA 3BG7A 3A0HC 2TRTA 1R6RA 2RDPA 4RGSA 1LKXA 4L0YB 3ECOA 3L09A 3RIRA 1HF0A 1P7IA 3CUQA 4Q4ZF 2K9NA 4XLFA 3OYIA 2QZ8A 2H1KA 5M5WJ 2L0KA 1H9TA 1IUFA 2RNGA 3Q3SA 4B1RA 5KK1A 2KKOA 4ASNA 2KZGA 2IJLA 3G1OA 3CF5F 2QQAA 4A6EA 1G8XA 3BG6A 4XL9A 5F0CA 2K4JA 4HQMA 3B73A 4Z2YA 2EA2A 1B59A 5C4XJ 1IW7F 4QWQA 4F92B 5CVIA 3LSKA 1NTCA 3TOAA 4CYCA 4YFXF 2G7UA 4HW0A 3UR3C 3M3YJ 5J1UA 2MSYA 3BDDA 1BI1A 3MZYA 2DA1A 4ZDOA 1ZARA 1UFMA 1Z3XA 3P9IA 1LFUP 3IH4A 4DYRA 3M8FA 2YX7A 1TWCJ 2KMUA 2OJED 4CYDA 1JUSA 4G7ZF 3LSTA 3G71I 2M0CA 2CFOA 5J4YA 3CDIA 1LUJB 5EGOA 3I4NJ 3MQ0A 5LHGA 4NB5A 3OL3A 1MNDA 4XQFA 2XKOA 3PM1A 1ZR4A 1R5HA 5IT3A 3QU3A 1IRGA 2VPRA 4KMFA 4CA0A 1O3TA 3HJEA 5J47A 3M7GA 4A3DJ 3ZCOA 4J01A 4E7KA 2E7WA 1WQ2A 3WTSC 1TT5B 1PUEE 1OLTA 1S7EA 1F4KA 3SEZA 3ZN0A 2H27A 3PQJA 4U0YA 1JT0A 4AVZA 4E7HA 2ACJA 5E8IA 4EGZA 3SFIA 1W5TA 4CCJA 1RUNA 4OMYA 1Y56A 5FLXK 4IQJA 2W25A 3E5QA 2VJIA 4DQ2A 1YIOA 1RESA 2EIKH 4M71A 3S2HJ 1UAAA 5D4SA 1ZG5A 5E3LA 1YX5A 2X1EA 4A5MA 1KU3A 3RTRA 4GRIA 4BU2A 3QODA 3LWFA 4OIRF 2DFEA 4ZYDA 3K4LA 5FB2A 2KZVA 3OYDA 3ZMSA 1DDNA 2ZFWA 5JVTA 1V5EA 2WV1A 3E5UA 4EEFG 5DCMB 1BI0A 2CH0A 3GCMA 1J09A 2W00A 4G8XA 4P5OA 3DBHB 1F43A 3HTUA 2KRHA 1X3UA 4XLEA 1XGNA 4IKFA 1K78B 4KNYA 1WJBA 1VQ6I 4BBSJ 3L7WA 1MIJA 3W2VA 4HYEA 3GTQJ 2ZJRF 5CPRB 3JRCA 4CH7A 5JHFA 1ZELA 3TL4X 2QQ8A 3D0SA 3GTKJ 2ZCWA 1WRJA 2VPLA 1XGMA 3PNYA 3V42A 3RJPA 1QQIA 3C2HA 4BY1J 1KU7A 3CC4I 2GLOA 1FOWA 4ENJA 2Q2EA 1WJAA 4KT5C 5DUIA 3M9AA 2ZJQF 4BL0B 4A3GJ 2A6HF 1JKOC 1D0XA 1ODDA 4A3JJ 2A07F 3S1NJ 3KP2A 2Z99A 4OU0A 2NXNB 4XSXF 3FDYA 4L0ZB 3GLLA 2HTJA 2ETHA 2E7XA 2BW3B 3SZPA 2H6CA 1YLFA 4X1EA 4IHTA 3ZXSA 4IRIA 3M07A 2DQLA 4EVIA 3KX2A 2QKMB 5F0FA 1ORKA 2F2EA 4JX5A 1UMQA 4P9UA 4UUSA 2XGDA 5HLIA 3JRAA 1DU6A 3S17J 1ENHA 2VQHA 5IOYA 3SXYA 1K6OA 2R3SA 4E6KG 3KP4A 1IN6A 3ZOBA 4CCLA 2L7KA 3WGGA 4KITB 3H0DA 1ZGWA 4A3FJ 1F5TA 4BDYA 1XDUA 2GIVA 4E7SA 1BC7C 1VQ9I 3CMMA 2CUEA 3CCYA 2CW0F 2R7UA 4PGHA 2IP2A 1Q1HA 3FK6A 3HG9A 4Y17A 1VQMI 2M87A 4FQGA 3TBIA 2IT0A 1B8IB 2LMDA 2MC3A 2CV1A 2OUMA 2XVCA 2VC1A 3CCRI 2VB6A 4AWXB 4KJZA 1X1CA 3ZN1A 2P5KA 5KCMA 4XRSG 1SANA 3GTJJ 2R7OA 3C18A 1TWGJ 1MJ9A 3E0JB 2VJ4A 1T95A 1IN4A 2V6CA 4BE2A 2CUFA 3IP4B 4U7BA 3CC2I 2J5OA 2WY8Q 2R7RA 3H36A 3S1MJ 2ZMEC 4ZH4F 4WXDA 2Z9OA 1LE8A 2IGKA 4RGUA 2HI3A 3EUHA 3OOPA 1X2NA 2K4BA 1IRFA 4A5NA 3ZQLA 2GIZA 4XLPF 3L1PA 2O9LA 2RKHA 3CJRB 3VSLA 3S3NA 1IF1A 2CW8A 2JUCA 2M1BA 2A6EF 3L2QA 2HOTA 1SVMA 3BZKA 1R4MB 2PN6A 2ZJ2A 2EZKA 3ECHA 1QPIA 5IP9J 3MKYB 1ETYA 5IP7J 1K83J 3U1DA 2E34A 2L4AA 2TCTA 4B43A 4L9VA 5FLMJ 1U6GA 3JRIA 2OPTA 3CCJI 2G0EA 3BZCA 1W36C 3MWMA 2KLOA 4W97A 3I53A 2O7OA 3K69A 4LMYA 3CCSI 1GV5A 2IAIA 3ZRGA 1WJFA 1G3SA 2EFWA 2KIQA 4JX6A 3CESA 2PJPA 3AFHA 1J59A 1LPQA 2PFBA 4CDGA 2WTEA 3BTJA 2HQAA 1OCPA 2LOOA 3WU1B 1WH5A 4RS8A 1W7PA 2NS7A 3JRGA 1R7JA 4ANJA 2KRFA 1Z21A 3GWZA 3EUAA 1MBHA 3AL0C 4L9NA 1YRNA 1W5SA 1FYMA 2LBFB 2PLYA 3MAJA 2LK2A 1VNDA 1FNNA 1FBUA 2R7QA 2K9MA 1N75A 1LNWA 3F9KA 4N4NB 3JAMZ 2LR8A 3CUQB 2LLKA 4XLNF 2P5LC 1I3AA 1L0OC 1IGNA 2FU4A 2DA5A 3GEZA 1ERDA 3FWEA 2YSRA 3L2UA 3CDHA 4ZYAA 3TMOA 1NHAA 2F48A 3MCZA 1RETA 5M5XJ 3DP7A 2ISYA 3S16J 1SFUA 5BOXA 2CWEA 1JKPC 1DP7P 2DYSH 3V8KA 3OYEA 4CYCB 3S1QJ 1Z9CA 4W1UA 3E97A 1WI3A 2H6BA 4AIKA 5DDGA 3ABKH 5HDKA 4PDKA 1JI8A 2G9WA 2ELHA 2DPDA 4MQVA 4CHUA 3H0GJ 4L5JA 2K3FA 2JVGA 4BH9A 1R71A 1OYIA 2Y0MA 4FTHA 3V4GA 1RRJA 2E2JJ 5FKMA 1U78A 1GV2A 2O03A 2EZIA 2W82A 4UY8I 3H3ZA 1NK3P 2F4IA 5EGOB 3IKTA 2DK5A 2X1DA 3NARA 3OS1A 5FRNA 5F1RA 3V7RA 2B9SA 4HAMA 1R00A 3QRFF 3BR2A 1YJWI 2HVSA 2KJBA 1SD6A 3PO3J 2L5QA 4XLHA 2VKEA 4BGDA 3HUGA 1UB9A 2E1MB 1SAXA 4IHXA 1Q1VA 2A05A 2ZXJA 3IWZA 2QSHX 1YW7A 2X6OA 2Z33A 2I5UA 1D1CA 4I98B 2Z2SB 4E4HA 2P0WA 2FSWA 3BJAA 1V3FA 4UVAA 1OMIA 1QVTA 1YQAA 2M7AA 3L2RA 4M73A 5BNGA 3K9TA 3LSJA 2QQBA 3GF2A 5LGNA 5J6XA 3HC7A 3QPHA 1NK2P 3OYBA 2JJ7A 2JSCA 4FETA 3PNTA 1XD7A 4FE4A 4IO9F 1U9NA 5A2QZ 2NVQJ 2WAEA 1O3SA 2Y75A 2DMTA 3FHNA 3KLOA 5GP9A 1KQ8A 2M45A 5IOZA 2C6YA 1X58A 2JRTA 3G3ZA 3ZQ7A 5LBQA 4YG2F 2XAQA 3KPHA 4IHYA 2COMA 1O7FA 4MEYF 3KFWX 2PEXA 2A61A 5TJJA 3HOSA 5CVVA 3FHZA 4DW6A 3RYRA 1OYYA 3M8JA 4NQWA 1TZLA 1WJCA 2STTA 2JTVA 2JZYA 4HV6A 4OWRB 4M3GA 1T6SA 5B5EC 1G6NA 2KL4A 3H3UA 2VQCA 2Y9YA 1P9QC 1UHSA 2P81A 4F55A 1WSUA 2ISZA 2VE8A 2OU2A 1YW9A 3OYLA 4RAZA 2YS9A 2FNPA 3MZHA 3I56I 2PMUA 4G6QA 2HZTA 4LIVA 3OSGA 2M34A 2CG4A 5DS9A 3HBLA 2EZLA 2CYYA 2EPFA 2Q2EB 2L01A 5AIQA 2ZB9A 5AIPA 5IYDJ 1IZ1A 2ELKA 5C4JJ 3ZPLA 3DF8A 1VZ0A 4NNJA 1Z1DA 2I8DA 2Y69H 4KIBA 4A3EJ 1DP3A 1IC8A 1P4WA 1NH3A 1EF4A 1XGSA 2N8GA 3VDXA 3O8GA 4B3AA 3COAC 1SC7A 5D6EA 1X3ZB 3GFLA 2H94A 5IPAA 4NC8A 1KU9A 4U7DA 3JTHA 3PFIA 3JR9A 1J9IA 1HCRA 2CUJA 4UUSB 4HEA2 2DU9A 4XR6A 3TDUC 2PX9A 1U8RA 3C2GA 5B1AH 1BR1A 4NBQA 1N78A 5FKNA 3E6CC 1REPC 1MBJA 1V5GA 2L7MP 5IY5H 1BC8C 2DOAA 1FSHA 4AYBA 2O5RA 1T98A 1VQ5I 3KP6A 1I6XA 1L3LA 3JTGA 4XKVA 1RNLA 2DMUA 2WC2A 2A5WA 5ILSA 5K5RA 2UZKA 3LQRA 2VBXA 2EJRA 4A93J 1HKQA 1JT6A 2DA3A 3SFZA 4PFOA 5F0HA 3OYNA 1MBEA 2F6CA 5F1JA 3DBRB 1FYLA 2HDCA 1JHHA 1AOYA 2EINH 2W57A 2IA2A 4P1WA 2XPUA 5D4RA 2K27A 1XMXA 4U0VA 1D5VA 1GT0C 2DBBA 1WHUA 4QSHA 3KP7A 4CCKA 1W1WE 2YPRA 1RKWA 4NC6A 1E3HA 3O8HA 3EUKL 2B0LA 4MQ9F 2UUZA 3DLAA 4BEHA 2ZMEA 1Z3YA 4EJUA 4AUXA 2X6XA 1FBQA 1SD7A 2DJIA 2D2WA 1A36A 3FXMA 1LDKB 1LE8B 3U21A 2KJCA 4JBAA 3QWLA 3WGIA 5JHUA 1I6HJ 1IUYA 1HDPA 3C7JA 4M9XA 2HPMA 3OIQA 3P5JA 1WCMJ 2LY9A 1USTA 2VXZA 3H9GA 4XSZF 2LY1A 3DBLB 1HA8A 4Q5SF 2L7ZA 2ME6A 5J4VA 5JFRA 1BI3A 2DQRA 4U0WA 4C2MJ 2DAOA 4AC0A 4MNUA 3G2BA 1I5ZA 1RC9A 4EM0B 3GTMJ 2Z1DA 4RLFA 4MFDA 4K2EA 4N4OB 1IV8A 1RUOA 3JSPA 4Q47A 2WY7Q 2VODA 1BJAA 3E5XA 2IS4A 5GTIC 2EFNA 4S04A 3HPGA 3K6GA 5J1YA 1N25A 2VIXA 2DDAA 4ESBA 1A5JA 3JAMK 1H9GA 2FOKA 1TQIA 2CFXA 3GUDA 5HNFA 3CO7C 5HS9A 3EYIA 4BQNA 3GYHX 2OF7A 2LKSA 5CLSA 2GAUA 2LKXA 4I76A 1WWXA 2FX0A 4X0GA 4F93B 5FD6A 3JRBA 9ANTA 2XUBA 1W7PB 2F4MB 1AHDP 2BVLA 3PO2J 4UVCA 3WU2C 4BKXA 2HYJA 1YRNB 4X6AJ 3KP5A 4Z6YA 4UV9A 1WVRA 3J7AY 1ZRCA 2Y2ZA 3QOEA 2KIFA 2ZSHB 3OIOA 1NG6A 2A6TA 5F64A 3CMEI 2D1HA 3H1CA 4Y33A 2CW7A 4BAYA 1XB4A 5HLHA 1S9HA 1MNMC 2KISA 2CQKA 1Z0XA 3K4NA 2K9QA 2JPBA 3PL8A 4JP0A 3TQNA 4ENNA 1JHFA 2F5CA 2GA1A 4XKCA 4DBQA 3S3OA 4YRVA 4PSXA 2XPVA 4G12A 1LB2A 3TEDA 1MW7A 2QGUA 2XF6A 4QPQA 3TO7A 3TO6A 5C44J 3GFJA 5HLGA 1Z05A 2K86A 5CQGA 5BMZA 1M1EB 3HB9A 4KFCA 3ERMA 1FP2A 3W2WA 3NWSA 3W2AA 4E7JA 3IRRA 2AXLA 1EKEA 1ZHFA 1OCOH 3CCMI 5JI6A 2FE3A 1OCCH 2F5VA 3IWFA 3FXQA 1S7AA 4HOBA 5F27A 4GCVA 2HWVA 4DGWB 5D5VB 1MGTA 3K1PA 4G6TB 3S32A 1U8BA 1GUUA 1B9MA 1CF7A 3V7CA 2WB1N 3A2KA 1QPMA 2HTSA 1ON2A 3GZ6A 1PDNC 3TW6A 2VUMJ 2VASA 4EGYA 3MKZA 1GXPA 1P7JA 5A2QK 1B4AA 4UB8C 4D5CA 4XLCA 2LC2A 5EEAA 3CCUI 3HUGB 1R22A 4RGRA 5FKLA 2R5ZA 3LSGA 1XS9A 2PQ8A 4CSWA 3GFMA 2EK5A 4HSTA 5BS6A 2F5EA 2QBYA 4S05A 1SMYF 1LDDA 2IA0A 4BHPA 1ZK8A 3FXOA 3DU6A 2R7FA 4II3A 5EF6A 1KONA 2DT5A 3AG3H 1YTYA 2HOSA 4YIFA 4BQQA 1MKMA 2NYXA 5L3DA 2R93J 2QF7A 4FISA 3Q0UA 2MFZA 5E1WA 1G4DA 4XOPA 1HW5A 2BGCA 1YI2I 2STWA 1EH7A 2BV6A 1VQOI 3DXJF 2E1NA 2RC4A 1ACIA 2NNNA 3E7LA 5K7HA 2GBYA 5E3MA 5E8GA 1D8KA 3WG9A 2DMPA 2L2OA 1QA6A 1DPRA 4PJLA 3DPTA 1VF9A 1XMKA 4BYYA 3QP5A 4WXHA 5B3SH 3OYCA 1QBJA 5KHDA 4RAGA 4XK4A 3NAUA 5JR3A 2A69F 2NS0A 1RZ4A 4NQWB 1QZZA 3CJNA 3TP0A 2KT0A 3KLNA 3OL4A 3RZOJ 1HXDA 5DM7F 3MEXA 3CF2A 1MDMA 1IAWA 1X4PA 1MZBA 2CQQA 4M3EA 2P4WA 1XSDA 2HVQA 2DA6A 1IXRC 1ETKA 3VEPA 1LQ1A 2V26A 2DODA 2DCEA 1BOBA 1KGSA 2BXYA 3HKZA 4BDZA 3I3LA 2XAJA 4LB5A 1YE9A 1EA3A 1TWFJ 2O0YA 3HDDA 3DLLF 1SMTA 2VN2A 4MLOA 2P5VA 2MABA 4ZDPA 2ZC2A 3BJ6A 2IGNA 1TC3C 4FE7A 2L3DA 4PJNA 1FPQA 3L9FA 1X1BA 2MLKA 2M30A 4ZC3A 1I39A 5FD5A 3UKGA 1FOXA 2WB1A 3RZDJ 2GZWA 3FBIB 2QSFX 2VT2A 2PI0A 1ZYRF 2DA7A 1FP1D 4B47A 2JVHA 3F8MA 1MMNA 1IJWC 2QENA 3CMAI 4YFKF 1HW2A 3H9JA 4MTEA 2XB5A 3REOA 4HZFA 4IRHA 1SFEA 2DMQA 4OINF 3F3XA 4G94A 2XAGA 2VBZA 3ML6A 4IL6C 3VB2A 4ENMA 4LGWA 3U1KA 3CCLI 1MMAA 2HXOA 3SQNA 3S3MA 3BCBA 1KQ9A 2K9SA 2CV2A 1J5YA 3I5UA 3ZMZA 1TWAJ 4HSRA 3EYYA 1WJ5A 3RPUA 3ISPA 3I54A
chains in the Genus database with same CATH topology
3WTXC 3U2RA 2A68F 1ONVA 4KIGA 2QLZA 1V4RA 4WXCA 4HLYA 2EB7A 3ERED 2UWMA 4EM2A 2MD5A 1JGSA 1ON1A 2ZMEB 4ON0A 1TW2A 4N9IA 3HOTA 3GLXA 4AIJA 3RI4A 3T1BA 5L3GA 2FF4A 3WTWC 5D5WB 1SFXA 3RYPA 4HDVA 1KYWA 1EH6A 1QO0D 1USSA 4KDPA 4KYWA 1KQ0A 2JPCA 4GO1A 2G7HA 2JT1A 2XKPA 4KICA 1U3EM 5IT9Z 5ICGA 4F7ZA 5LEKA 2ZNYA 1SD5A 3HSFA 4YFNF 1HSTA 5K1YA 3H92A 4WX9A 3GZ5A 4H0EA 3FF5A 2OD5A 4A0ZA 2OQGA 4B09A 2O3FA 3QAHA 1A04A 4M6XA 4G7HF 2EV5A 3LA7A 2YR2A 3B02A 1FT9A 2K02A 2BYVE 4G7OF 3F8CA 4IXAA 3KEQA 4HV5A 4MEXF 4LK1F 3P9CA 4M74A 4P96A 2EFQA 4BHCA 4N9HA 5LEJA 1XSXA 1GXQA 3JSOA 2MA3A 1Y0UA 3RKYA 4BXUA 3I0TA 4RGXA 2V1DA 1D8JA 2FRHA 3BPXA 1W7PD 4LG0A 2HEOA 2NAZA 3KP3A 4OIOF 2L54A 3R6SA 1CF7B 5CVRA 4GYGA 2VONA 2Q0OA 5DD8A 4N0BA 1Z6TA 1TLHB 4LLNA 4ZZLA 1FC3A 2D1VA 4AVPA 3K1NA 4LB6B 2FA5A 3LA3A 4JK1X 5E18F 3FX3A 3U9GA 3K1MA 1BI2A 4MGRA 1R1TA 1B9NA 1JE8A 3DEUA 2QBYB 2XGXA 3ROUA 1O3QA 2QWWA 4CZZA 4ZYEA 2GXBA 3DQVC 1J0RA 4A0YA 4EJWA 1FOKA 1R1VA 4HQEA 5BPIA 2RV8A 5LLQA 1HKSA 2UXNA 2P7CB 1S6LA 1K7AA 2DO7A 1BM9A 2HKXA 4I09A 2VBYA 1G3TA 4I0BA 2YU3A 2HR3A 3BZ6A 1TQPA 1ZGAA 5L3CA 1MDMB 3W6KB 3GW2A 4TV7A 1ULYA 5F6FA 3F6VA 4LJZF 5L3BA 2FMYA 4R1HA 4ENKA 1ZH5A 4OIQF 3LA2A 2HQNA 2Y48A 2LSOA 4I7HA 1BOAA 3ABUA 2AS5F 3AAFA 2ZO4A 4CXFA 4RB2C 1OR7A 3F72A 1C0WA 3WGHA 3ULQB 3T8TA 2CSOA 4A0XA 4GYIA 1P2FA 1RI7A 2HS5A 2FQ3A 5LHIA 1KYZA 4ETSA 4YIIA 4M6YA 3J7AO 4RB0A 2VOOA 2XHKA 2XAFA 2D45A 3TDZC 1U5TC 2IW5A 4EV0A 6PAXA 1FBSA 2HFHA 4FX4A 2RNJA 1HW1A 4P9FA 5D5UB 3K0LA 2IA1A 2XIGA 5IT9K 2VE9A 1IXCA 3CLOA 1TQMA 3RDIA 2W84A 1ZG3A 4PZJA 5E1XA 4NHJA 2NRAC 1J7KA 3BP8A 1QNTA 4RB3C 5CVUA 3SZTA 1LEAA 3S2WA 4MTDA 4CO8A 3SHFA 4OOIA 3HTSB 5ICEA 3L00A 1O3RA 4ZYGA 2O61A 1MJAA 2J5PA 1ZG1A 4IPAA 2R7DA 3BOQA 3GXOA 3BY6A 3F8FA 1FZPB 1F1ZA 3K2ZA 5DD4A 3HRUA 3EDPA 2PMHA 3I59A 2M5WA 4IHSA 4M9ZA 3BROA 4PCQA 2V79A 5ICFA 5D8KB 2KIUA 1U2WA 5E20A 4MHGA 2QQ9A 3Q9SA 5KVRA 5E1ZB 1P4XA 3BJOA 2FBHA 1HSJA 2DI3A 5HDGA 2F5DA 1IN5A 4P55A 1FWZA 1B1BA 3T0YA 1P92A 4R8HA 4LG0B 3FZVA 3FMSA 1DUXC 3IHUA 3P7NA 4UNOA 4KN4X 1O57A 1K79A 2WV0A 3VODA 3FXUA 4FHTA 2QM3A 3GO5A 2GWRA 4LLGF 3FMRA 4EMSA 5ICCA 2QVOA 5EEHA 2OQRA 2CO5A 3W6JB 2LNBA 3HHGA 3F22A 2FBIA 3I58A 4PGGA 2EV6A 5DUKA 1Z6RA 5LGUA 4LFUA 1VTNC 3I71A 3O6BB 3ZMDA 2IPQX 2XV4S 4I02A 2E1CA 5LHHA 2BE5F 4IVNA 3F8NA 1BIBA 4ZZDA 2DTRA 3F21A 4G6DA 4KMUX 4OIPF 1LEBA 3J80Z 1E2XA 4HF1A 1WI9A 2HKOA 1CGPA 3BWGA 3R61A 4ESJA 2A5YB 2UXXA 3VOEA 4U88A 4BHBA 1QGPA 3KETA 4GGGA 3ELKA 4CICA 2FBKA 2X0LA 4HBLA 3TOBA 1XCBA 2FXAA 4QLCU 4I2OA 2EA4A 3E6MA 4Y13A 3WODF 3NRVA 2DFIA 1P4AA 2Z5UA 2LDUA 4LLLA 1JXSA 2ZKZA 1XGOA 1YYVA 2W24A 1YS7A 1R23A 2XAHA 4UV8A 2VOPA 2W85A 2HQRA 2VBWA 5DYMA 2PG4A 5BPDA 1MJBA 5FFZA 1U5TA 4KN7X 3CO6C 2FEZA 1R5GA 1RIOH 2P6SA 3IC7A 1P6RA 2EV0A 5L3FA 4FX0A 1ZAOA 1T38A 5TRDA 2MLGA 2HOEA 1TNTA 5K5OA 3O3KA 1W4MA 4ESFA 4BNCA 3ZMTA 4L9JA 3NQOA 3D5LA 5LRSA 1SD4A 3PQKA 2IVMA 4HX7A 3ABTA 4I0AA 3Q5FA 4A6DA 4HX4A 4ZYHA 3G73A 4UVBA 3MFKA 2V1UA 3J81Z 1YFHA 4I01A 3QPTA 1AWCA 3HRTA 5D8LB 2OAZA 1FSEA 4EM1A 3DFGA 2NNYA 3I59B 4Y15A 2RN7A 3V8JA 4KUMA 4BQAA 5J8FA 2L4MA 5CJ9A 4OMZA 3JW4A 3DV8A 2OZUA 1MD0A 5ED4A 2KIMA 5HS8A 3WTZA 1KU2A 1H0MA 3F6OA 2P8TA 3DKWA 1YG2A 3HYIA 1ZN2A 3E6BA 3R0JA 1D3YA 3QP6A 3LFKA 3OV8A 4HF0A 2ESHA 2VC0A 2P6TA 1XMAA 3E3VA 3FXRA 2ZBKA 2FMLA 2DK8A 5FGMA 1S7OA 4JQFA 5H20A 3P9KA 1FY7A 4A12A 3ZMVA 2FNAA 1BBYA 4IF4A 1BIAA 1DPUA 5DEQA 1E17A 3KE2A 3HRSA 1S8NA 1EV7A 2XASA 1EH8A 3WE3A 5HOOA 5FO5A 5BQTA 5ILUA 1T0FA 4EJVA 4O5VA 2YX4A 3C3WA 3WTYC 5AONA 1B6AA 4KIFA 4WK8F 5FFXA 1G3WA 5CYVA 3RKXA 3M1EA 2BEOA 3J80K 4XRFA 2H09A 1TBXA 1PP7U 3WE2A 4D0PA 2M8EA 4HDUA 3KCCA 4O3MA 3TGNA 2OZ6A 2HGCA 1J75A 1OYWA 4WWCA 1GVJA 2CGPA 3C1DA 1OKRA 4L5IA 5DV5A 4IJAA 2Q8KA 2QYOA 3KEOA 4LK0F 3CUQC 1XDSA 3FM5A 1R58A 1J2XA 1KA8A 3M8EA 4KA4A 2RVCA 3E6DA 2WWYA 2Z3YA 4M9SA 2RQPA 1BN5A 3EQLF 5HVQC 1ZLKA 1HKTA 3HHHA 4UXNA 4M72A 4E70A 1YS6A 3QOPA 3O2PE 3BPVA 4UHTA 3HIFA 4UUVA 1QZYA 1XSVA 2DW4A 4DNCA 3DPLC 2LF8A 1IN7A 2DLLA 5CVJA 4R79A 4Q48A 3KZYA 3T5XA 4EQQA 2V9VA 1HQCA 3IL2A 1U5TB 3N4MA 2EFOA 1FLIA 1O7LA 3V7SA 1YO5C 1T39A 3WTUC 1LVAA 3GX4X 4XBFA 1LDJA 5ILVA 3F23A 5HDNA 2HYGD 1LJ9A 1STZA 2K7LA 2ZNZA 3IRQA 3IKVA 3VFZA 3ZP5A 3J81K 2TDXA 1WKMA 4FT8A 2GXGA 5DCMA 2ADUA 1XCVA 1Z7UA 2BBYA 5EEGA 2A3SA 4HF2A 1K78A 5FLXZ 3GVAA 3QU6A 2P7VB 3WTVC 4IRGA 2QUFA 3ZMUA 4RB1A 3RPQA 3CTAA 2ESNA 3GFIA 2PBIA 3HRMA 4L18B 1UCRA 4B8XA 3LAPA 2XRNA 3HSEA 3LAJA 2MH9A 2GQQA 2OBPA 3R60A 3F8BA 3I64A 1TTYA 2LF7A 5HS7A 3Q9VA 1YW8A 2MH2A 3T8RA 5D6FA 5E17F 2VT3A 5LRRA 1FYKA 1UHMA 3KZZA 2L02A 2EFPA 5H6RA 3FM3A 1ZRDA 4WF2A 3R4KA 3WU0A 1I27A 1ZGJA 2RGVA 2GA2A 3R0AA 3WTTC 1UHWA 4HX8A 1HBXG 4O6JA 3HSRA 5DCFA 3L2CA 4L9TA 1IXSB 1I1SA 1IN8A 4GXOA 2O8XA 2OA4A 1TW3A 4RAYA 1FX7A 1I1GA 2DPUA 2LKPA 4A2UA 3NEUA 5J8CA 1G3YA 4HA8A 1ZLJA 2X4HA 3I4PA 2XROA 1S29A 1OPCA 4EJTA 1TNSA 3N97A 3RKWA 1R1UA 2IRFG 3TO9A 5L3EA 4AIHA 2O6GE 3FMQA 2MBFA 5LGTA 1XN7A 4WCGA 1T2KA 1PP8F 4AD9A 3TKYA 4G9YA 4LD5A 5ERIA 1R36A 3EETA 4EJOA 1F9NA 2EWNA 5H6QA 1Z91A 2V1XA 4CGZA 1S3JA 5K5QA 5D5XB 3V8LA 1ZRFA 3LQQA 3CUOA 4HLXA 2F5FA 2HYFA 1ZREA 1GHCA 2RDPA 4RGSA 4L0YB 3ECOA 3L09A 3RIRA 3CUQA 4Q4ZF 2QZ8A 1H9TA 5KK1A 2KKOA 4ASNA 2IJLA 2QQAA 4A6EA 2K4JA 4HQMA 3B73A 4Z2YA 2EA2A 1B59A 1IW7F 4QWQA 5CVIA 3TOAA 4YFXF 2G7UA 4HW0A 3BDDA 1BI1A 3MZYA 1ZARA 1UFMA 3P9IA 3M8FA 2YX7A 4CYDA 4G7ZF 3LSTA 3MQ0A 5LHGA 4NB5A 2XKOA 1R5HA 5IT3A 3QU3A 1IRGA 4KMFA 1O3TA 3M7GA 2E7WA 1WQ2A 3WTSC 1PUEE 1F4KA 3ZN0A 2H27A 3PQJA 4U0YA 2ACJA 5E8IA 4EGZA 1W5TA 1RUNA 4OMYA 5FLXK 2W25A 3E5QA 4DQ2A 1YIOA 4M71A 5D4SA 1ZG5A 4A5MA 1KU3A 3RTRA 3LWFA 4OIRF 4ZYDA 5FB2A 3ZMSA 1DDNA 2ZFWA 5JVTA 3E5UA 5DCMB 1BI0A 4G8XA 4P5OA 3HTUA 1X3UA 1XGNA 1K78B 4KNYA 3L7WA 4HYEA 3D0SA 2ZCWA 1WRJA 1XGMA 3RJPA 1QQIA 1KU7A 4ENJA 2Q2EA 4KT5C 5DUIA 3M9AA 2A6HF 1ODDA 2A07F 3KP2A 2Z99A 4OU0A 4XSXF 4L0ZB 2HTJA 2ETHA 2E7XA 3SZPA 4IHTA 2H6CA 1YLFA 4IRIA 2DQLA 4EVIA 2F2EA 4P9UA 5HLIA 3SXYA 1K6OA 2R3SA 3KP4A 1IN6A 3WGGA 1F5TA 1XDUA 2GIVA 1BC7C 2CW0F 4PGHA 2IP2A 1Q1HA 4Y17A 2IT0A 2M87A 2MC3A 2XVCA 2VC1A 4AWXB 3ZN1A 2P5KA 3C18A 1MJ9A 1IN4A 2V6CA 4U7BA 2J5OA 4ZH4F 4WXDA 2Z9OA 4RGUA 3EUHA 3OOPA 2K4BA 1IRFA 4A5NA 4XLPF 2RKHA 1IF1A 2M1BA 2A6EF 2PN6A 2ZJ2A 3ECHA 3U1DA 2L4AA 4L9VA 1U6GA 3MWMA 3I53A 3K69A 4LMYA 1G3SA 2EFWA 2PJPA 1J59A 2PFBA 4CDGA 2WTEA 3WU1B 4RS8A 1W7PA 1R7JA 2KRFA 3GWZA 4L9NA 1W5SA 1FYMA 2PLYA 3MAJA 1FNNA 1FBUA 1LNWA 3JAMZ 3CUQB 4XLNF 2P5LC 1L0OC 2FU4A 3GEZA 3FWEA 2YSRA 3CDHA 1NHAA 3MCZA 3DP7A 2ISYA 1SFUA 5BOXA 2CWEA 1DP7P 3V8KA 1Z9CA 3E97A 2H6BA 4AIKA 5DDGA 5HDKA 4PDKA 2G9WA 2ELHA 2DPDA 4MQVA 4CHUA 4L5JA 4BH9A 1OYIA 2Y0MA 3V4GA 1U78A 2O03A 3H3ZA 3IKTA 2DK5A 5F1RA 3V7RA 4HAMA 1R00A 3QRFF 2KJBA 1SD6A 3HUGA 1UB9A 1SAXA 2ZXJA 3IWZA 1YW7A 2Z33A 4I98B 3BJAA 2FSWA 1V3FA 4UVAA 1OMIA 1YQAA 4M73A 3K9TA 2QQBA 3GF2A 5LGNA 5J6XA 3QPHA 2JSCA 1XD7A 5A2QZ 1O3SA 2Y75A 3KLOA 1KQ8A 2M45A 2C6YA 2JRTA 3G3ZA 3ZQ7A 5LBQA 4YG2F 2XAQA 2COMA 1O7FA 4MEYF 3KFWX 2PEXA 2A61A 5TJJA 3HOSA 5CVVA 3FHZA 3RYRA 1OYYA 4NQWA 2STTA 2JTVA 2JZYA 4HV6A 1T6SA 1G6NA 3H3UA 1WSUA 2ISZA 2VE8A 2OU2A 1YW9A 4RAZA 2FNPA 3MZHA 2PMUA 4G6QA 2HZTA 2CG4A 2CYYA 5AIQA 2L01A 5AIPA 1IZ1A 3ZPLA 3DF8A 1Z1DA 4KIBA 1P4WA 1XGSA 3COAC 5D6EA 3GFLA 2H94A 1KU9A 4U7DA 3JTHA 3PFIA 1J9IA 2DU9A 3TDUC 1U8RA 3E6CC 1REPC 1BC8C 1FSHA 1T98A 3KP6A 1I6XA 1L3LA 3JTGA 1RNLA 2WC2A 5ILSA 5K5RA 2UZKA 3LQRA 2VBXA 2EJRA 1HKQA 3SFZA 1FYLA 2HDCA 1AOYA 1JHHA 2W57A 2IA2A 5D4RA 2K27A 4U0VA 1D5VA 2DBBA 3KP7A 2YPRA 4MQ9F 2B0LA 2ZMEA 4EJUA 1FBQA 1SD7A 2D2WA 1LDKB 2KJCA 4JBAA 3WGIA 5JHUA 1IUYA 3C7JA 4M9XA 2VXZA 1USTA 4XSZF 4Q5SF 5JFRA 1BI3A 2DQRA 4U0WA 2DAOA 4MNUA 1I5ZA 4EM0B 4K2EA 1RUOA 3JSPA 4Q47A 2VODA 1BJAA 3E5XA 2EFNA 4S04A 4ESBA 3JAMK 1H9GA 2FOKA 3CO7C 1TQIA 2CFXA 3GUDA 5HS9A 3EYIA 3GYHX 5CLSA 2GAUA 1WWXA 5FD6A 2XUBA 1W7PB 4UVCA 3KP5A 4UV9A 1ZRCA 2KIFA 5F64A 2D1HA 4BAYA 1XB4A 5HLHA 2CQKA 4ENNA 2JPBA 3TQNA 1JHFA 2F5CA 2GA1A 1LB2A 3TO7A 3TO6A 3GFJA 5HLGA 1Z05A 2K86A 5BMZA 4KFCA 1FP2A 3IRRA 2AXLA 1ZHFA 5JI6A 2FE3A 3IWFA 3FXQA 1S7AA 4HOBA 4GCVA 2HWVA 5D5VB 1MGTA 3K1PA 1B9MA 1CF7A 3V7CA 1QPMA 2HTSA 1ON2A 3GZ6A 1PDNC 4EGYA 1GXPA 5A2QK 1B4AA 1R22A 4RGRA 2PQ8A 3GFMA 2EK5A 5BS6A 2F5EA 2QBYA 4S05A 1SMYF 1LDDA 2IA0A 4BHPA 2R7FA 2DT5A 1YTYA 4YIFA 1MKMA 2NYXA 5L3DA 5E1WA 1G4DA 1HW5A 2BGCA 2STWA 1EH7A 2BV6A 3DXJF 2E1NA 2RC4A 2NNNA 5E8GA 1D8KA 3WG9A 1DPRA 3DPTA 1XMKA 4BYYA 3QP5A 4WXHA 1QBJA 5JR3A 2A69F 2NS0A 1RZ4A 1QZZA 3CJNA 3KLNA 1HXDA 3MEXA 1MDMA 1IAWA 1MZBA 2P4WA 1XSDA 1IXRC 3VEPA 1LQ1A 1KGSA 2XAJA 4LB5A 2O0YA 1SMTA 2VN2A 2P5VA 3BJ6A 2L3DA 1FPQA 3L9FA 2MLKA 2M30A 5FD5A 2GZWA 2PI0A 2VT2A 1ZYRF 1FP1D 3F8MA 2QENA 4YFKF 1HW2A 4MTEA 3REOA 4HZFA 4IRHA 1SFEA 4OINF 3F3XA 4G94A 2XAGA 2VBZA 3ML6A 3VB2A 4ENMA 4LGWA 3SQNA 1KQ9A 1J5YA 3I5UA 3ZMZA 3EYYA 3RPUA 3ISPA 3I54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTX C;  3U2R A;  2A68 F;  1ONV A;  4KIG A;  2QLZ A;  1V4R A;  4WXC A;  4HLY A;  2EB7 A;  3ERE D;  2UWM A;  4EM2 A;  2MD5 A;  1JGS A;  1ON1 A;  2ZME B;  4ON0 A;  1TW2 A;  4N9I A;  3HOT A;  3GLX A;  4AIJ A;  3RI4 A;  3T1B A;  5L3G A;  2FF4 A;  3WTW C;  5D5W B;  1SFX A;  3RYP A;  4HDV A;  1KYW A;  1EH6 A;  1QO0 D;  1USS A;  4KDP A;  4KYW A;  1KQ0 A;  2JPC A;  4GO1 A;  2G7H A;  2JT1 A;  2XKP A;  4KIC A;  1U3E M;  5IT9 Z;  5ICG A;  4F7Z A;  5LEK A;  2ZNY A;  1SD5 A;  3HSF A;  4YFN F;  1HST A;  5K1Y A;  3H92 A;  4WX9 A;  3GZ5 A;  4H0E A;  3FF5 A;  2OD5 A;  4A0Z A;  2OQG A;  4B09 A;  2O3F A;  3QAH A;  1A04 A;  4M6X A;  4G7H F;  2EV5 A;  3LA7 A;  2YR2 A;  3B02 A;  1FT9 A;  2K02 A;  2BYV E;  4G7O F;  3F8C A;  4IXA A;  3KEQ A;  4HV5 A;  4MEX F;  4LK1 F;  3P9C A;  4M74 A;  4P96 A;  2EFQ A;  4BHC A;  4N9H A;  5LEJ A;  1XSX A;  1GXQ A;  3JSO A;  2MA3 A;  1Y0U A;  3RKY A;  4BXU A;  3I0T A;  4RGX A;  2V1D A;  1D8J A;  2FRH A;  3BPX A;  1W7P D;  4LG0 A;  2HEO A;  2NAZ A;  3KP3 A;  4OIO F;  2L54 A;  3R6S A;  1CF7 B;  5CVR A;  4GYG A;  2VON A;  2Q0O A;  5DD8 A;  4N0B A;  1Z6T A;  1TLH B;  4LLN A;  4ZZL A;  1FC3 A;  2D1V A;  4AVP A;  3K1N A;  4LB6 B;  2FA5 A;  3LA3 A;  4JK1 X;  5E18 F;  3FX3 A;  3U9G A;  3K1M A;  1BI2 A;  4MGR A;  1R1T A;  1B9N A;  1JE8 A;  3DEU A;  2QBY B;  2XGX A;  3ROU A;  1O3Q A;  2QWW A;  4CZZ A;  4ZYE A;  2GXB A;  3DQV C;  1J0R A;  4A0Y A;  4EJW A;  1FOK A;  1R1V A;  4HQE A;  5BPI A;  2RV8 A;  5LLQ A;  1HKS A;  2UXN A;  2P7C B;  1S6L A;  1K7A A;  2DO7 A;  1BM9 A;  2HKX A;  4I09 A;  2VBY A;  1G3T A;  4I0B A;  2YU3 A;  2HR3 A;  3BZ6 A;  1TQP A;  1ZGA A;  5L3C A;  1MDM B;  3W6K B;  3GW2 A;  4TV7 A;  1ULY A;  5F6F A;  3F6V A;  4LJZ F;  5L3B A;  2FMY A;  4R1H A;  4ENK A;  1ZH5 A;  4OIQ F;  3LA2 A;  2HQN A;  2Y48 A;  2LSO A;  4I7H A;  1BOA A;  3ABU A;  2AS5 F;  3AAF A;  2ZO4 A;  4CXF A;  4RB2 C;  1OR7 A;  3F72 A;  1C0W A;  3WGH A;  3ULQ B;  3T8T A;  2CSO A;  4A0X A;  4GYI A;  1P2F A;  1RI7 A;  2HS5 A;  2FQ3 A;  5LHI A;  1KYZ A;  4ETS A;  4YII A;  4M6Y A;  3J7A O;  4RB0 A;  2VOO A;  2XHK A;  2XAF A;  2D45 A;  3TDZ C;  1U5T C;  2IW5 A;  4EV0 A;  6PAX A;  1FBS A;  2HFH A;  4FX4 A;  2RNJ A;  1HW1 A;  4P9F A;  5D5U B;  3K0L A;  2IA1 A;  2XIG A;  5IT9 K;  2VE9 A;  1IXC A;  3CLO A;  1TQM A;  3RDI A;  2W84 A;  1ZG3 A;  4PZJ A;  5E1X A;  4NHJ A;  2NRA C;  1J7K A;  3BP8 A;  1QNT A;  4RB3 C;  5CVU A;  3SZT A;  1LEA A;  3S2W A;  4MTD A;  4CO8 A;  3SHF A;  4OOI A;  3HTS B;  5ICE A;  3L00 A;  1O3R A;  4ZYG A;  2O61 A;  1MJA A;  2J5P A;  1ZG1 A;  4IPA A;  2R7D A;  3BOQ A;  3GXO A;  3BY6 A;  3F8F A;  1FZP B;  1F1Z A;  3K2Z A;  5DD4 A;  3HRU A;  3EDP A;  2PMH A;  3I59 A;  2M5W A;  4IHS A;  4M9Z A;  3BRO A;  4PCQ A;  2V79 A;  5ICF A;  5D8K B;  2KIU A;  1U2W A;  5E20 A;  4MHG A;  2QQ9 A;  3Q9S A;  5KVR A;  5E1Z B;  1P4X A;  3BJO A;  2FBH A;  1HSJ A;  2DI3 A;  5HDG A;  2F5D A;  1IN5 A;  4P55 A;  1FWZ A;  1B1B A;  3T0Y A;  1P92 A;  4R8H A;  4LG0 B;  3FZV A;  3FMS A;  1DUX C;  3IHU A;  3P7N A;  4UNO A;  4KN4 X;  1O57 A;  1K79 A;  2WV0 A;  3VOD A;  3FXU A;  4FHT A;  2QM3 A;  3GO5 A;  2GWR A;  4LLG F;  3FMR A;  4EMS A;  5ICC A;  2QVO A;  5EEH A;  2OQR A;  2CO5 A;  3W6J B;  2LNB A;  3HHG A;  3F22 A;  2FBI A;  3I58 A;  4PGG A;  2EV6 A;  5DUK A;  1Z6R A;  5LGU A;  4LFU A;  1VTN C;  3I71 A;  3O6B B;  3ZMD A;  2IPQ X;  2XV4 S;  4I02 A;  2E1C A;  5LHH A;  2BE5 F;  4IVN A;  3F8N A;  1BIB A;  4ZZD A;  2DTR A;  3F21 A;  4G6D A;  4KMU X;  4OIP F;  1LEB A;  3J80 Z;  1E2X A;  4HF1 A;  1WI9 A;  2HKO A;  1CGP A;  3BWG A;  3R61 A;  4ESJ A;  2A5Y B;  2UXX A;  3VOE A;  4U88 A;  4BHB A;  1QGP A;  3KET A;  4GGG A;  3ELK A;  4CIC A;  2FBK A;  2X0L A;  4HBL A;  3TOB A;  1XCB A;  2FXA A;  4QLC U;  4I2O A;  2EA4 A;  3E6M A;  4Y13 A;  3WOD F;  3NRV A;  2DFI A;  1P4A A;  2Z5U A;  2LDU A;  4LLL A;  1JXS A;  2ZKZ A;  1XGO A;  1YYV A;  2W24 A;  1YS7 A;  1R23 A;  2XAH A;  4UV8 A;  2VOP A;  2W85 A;  2HQR A;  2VBW A;  5DYM A;  2PG4 A;  5BPD A;  1MJB A;  5FFZ A;  1U5T A;  4KN7 X;  3CO6 C;  2FEZ A;  1R5G A;  1RIO H;  2P6S A;  3IC7 A;  1P6R A;  2EV0 A;  5L3F A;  4FX0 A;  1ZAO A;  1T38 A;  5TRD A;  2MLG A;  2HOE A;  1TNT A;  5K5O A;  3O3K A;  1W4M A;  4ESF A;  4BNC A;  3ZMT A;  4L9J A;  3NQO A;  3D5L A;  5LRS A;  1SD4 A;  3PQK A;  2IVM A;  4HX7 A;  3ABT A;  4I0A A;  3Q5F A;  4A6D A;  4HX4 A;  4ZYH A;  3G73 A;  4UVB A;  3MFK A;  2V1U A;  3J81 Z;  1YFH A;  4I01 A;  3QPT A;  1AWC A;  3HRT A;  5D8L B;  2OAZ A;  1FSE A;  4EM1 A;  3DFG A;  2NNY A;  3I59 B;  4Y15 A;  2RN7 A;  3V8J A;  4KUM A;  4BQA A;  5J8F A;  2L4M A;  5CJ9 A;  4OMZ A;  3JW4 A;  3DV8 A;  2OZU A;  1MD0 A;  5ED4 A;  2KIM A;  5HS8 A;  3WTZ A;  1KU2 A;  1H0M A;  3F6O A;  2P8T A;  3DKW A;  1YG2 A;  3HYI A;  1ZN2 A;  3E6B A;  3R0J A;  1D3Y A;  3QP6 A;  3LFK A;  3OV8 A;  4HF0 A;  2ESH A;  2VC0 A;  2P6T A;  1XMA A;  3E3V A;  3FXR A;  2ZBK A;  2FML A;  2DK8 A;  5FGM A;  1S7O A;  4JQF A;  5H20 A;  3P9K A;  1FY7 A;  4A12 A;  3ZMV A;  2FNA A;  1BBY A;  4IF4 A;  1BIA A;  1DPU A;  5DEQ A;  1E17 A;  3KE2 A;  3HRS A;  1S8N A;  1EV7 A;  2XAS A;  1EH8 A;  3WE3 A;  5HOO A;  5FO5 A;  5BQT A;  5ILU A;  1T0F A;  4EJV A;  4O5V A;  2YX4 A;  3C3W A;  3WTY C;  5AON A;  1B6A A;  4KIF A;  4WK8 F;  5FFX A;  1G3W A;  5CYV A;  3RKX A;  3M1E A;  2BEO A;  3J80 K;  4XRF A;  2H09 A;  1TBX A;  1PP7 U;  3WE2 A;  4D0P A;  2M8E A;  4HDU A;  3KCC A;  4O3M A;  3TGN A;  2OZ6 A;  2HGC A;  1J75 A;  1OYW A;  4WWC A;  1GVJ A;  2CGP A;  3C1D A;  1OKR A;  4L5I A;  5DV5 A;  4IJA A;  2Q8K A;  2QYO A;  3KEO A;  4LK0 F;  3CUQ C;  1XDS A;  3FM5 A;  1R58 A;  1J2X A;  1KA8 A;  3M8E A;  4KA4 A;  2RVC A;  3E6D A;  2WWY A;  2Z3Y A;  4M9S A;  2RQP A;  1BN5 A;  3EQL F;  5HVQ C;  1ZLK A;  1HKT A;  3HHH A;  4UXN A;  4M72 A;  4E70 A;  1YS6 A;  3QOP A;  3O2P E;  3BPV A;  4UHT A;  3HIF A;  4UUV A;  1QZY A;  1XSV A;  2DW4 A;  4DNC A;  3DPL C;  2LF8 A;  1IN7 A;  2DLL A;  5CVJ A;  4R79 A;  4Q48 A;  3KZY A;  3T5X A;  4EQQ A;  2V9V A;  1HQC A;  3IL2 A;  1U5T B;  3N4M A;  2EFO A;  1FLI A;  1O7L A;  3V7S A;  1YO5 C;  1T39 A;  3WTU C;  1LVA A;  3GX4 X;  4XBF A;  1LDJ A;  5ILV A;  3F23 A;  5HDN A;  2HYG D;  1LJ9 A;  1STZ A;  2K7L A;  2ZNZ A;  3IRQ A;  3IKV A;  3VFZ A;  3ZP5 A;  3J81 K;  2TDX A;  1WKM A;  4FT8 A;  2GXG A;  5DCM A;  2ADU A;  1XCV A;  1Z7U A;  2BBY A;  5EEG A;  2A3S A;  4HF2 A;  1K78 A;  5FLX Z;  3GVA A;  3QU6 A;  2P7V B;  3WTV C;  4IRG A;  2QUF A;  3ZMU A;  4RB1 A;  3RPQ A;  3CTA A;  2ESN A;  3GFI A;  2PBI A;  3HRM A;  4L18 B;  1UCR A;  4B8X A;  3LAP A;  2XRN A;  3HSE A;  3LAJ A;  2MH9 A;  2GQQ A;  2OBP A;  3R60 A;  3F8B A;  3I64 A;  1TTY A;  2LF7 A;  5HS7 A;  3Q9V A;  1YW8 A;  2MH2 A;  3T8R A;  5D6F A;  5E17 F;  2VT3 A;  5LRR A;  1FYK A;  1UHM A;  3KZZ A;  2L02 A;  2EFP A;  5H6R A;  3FM3 A;  1ZRD A;  4WF2 A;  3R4K A;  3WU0 A;  1I27 A;  1ZGJ A;  2RGV A;  2GA2 A;  3R0A A;  3WTT C;  1UHW A;  4HX8 A;  1HBX G;  4O6J A;  3HSR A;  5DCF A;  3L2C A;  4L9T A;  1IXS B;  1I1S A;  1IN8 A;  4GXO A;  2O8X A;  2OA4 A;  1TW3 A;  4RAY A;  1FX7 A;  1I1G A;  2DPU A;  2LKP A;  4A2U A;  3NEU A;  5J8C A;  1G3Y A;  4HA8 A;  1ZLJ A;  2X4H A;  3I4P A;  2XRO A;  1S29 A;  1OPC A;  4EJT A;  1TNS A;  3N97 A;  3RKW A;  1R1U A;  2IRF G;  3TO9 A;  5L3E A;  4AIH A;  2O6G E;  3FMQ A;  2MBF A;  5LGT A;  1XN7 A;  4WCG A;  1T2K A;  1PP8 F;  4AD9 A;  3TKY A;  4G9Y A;  4LD5 A;  5ERI A;  1R36 A;  3EET A;  4EJO A;  1F9N A;  2EWN A;  5H6Q A;  1Z91 A;  2V1X A;  4CGZ A;  1S3J A;  5K5Q A;  5D5X B;  3V8L A;  1ZRF A;  3LQQ A;  3CUO A;  4HLX A;  2F5F A;  2HYF A;  1ZRE A;  1GHC A;  2RDP A;  4RGS A;  4L0Y B;  3ECO A;  3L09 A;  3RIR A;  3CUQ A;  4Q4Z F;  2QZ8 A;  1H9T A;  5KK1 A;  2KKO A;  4ASN A;  2IJL A;  2QQA A;  4A6E A;  2K4J A;  4HQM A;  3B73 A;  4Z2Y A;  2EA2 A;  1B59 A;  1IW7 F;  4QWQ A;  5CVI A;  3TOA A;  4YFX F;  2G7U A;  4HW0 A;  3BDD A;  1BI1 A;  3MZY A;  1ZAR A;  1UFM A;  3P9I A;  3M8F A;  2YX7 A;  4CYD A;  4G7Z F;  3LST A;  3MQ0 A;  5LHG A;  4NB5 A;  2XKO A;  1R5H A;  5IT3 A;  3QU3 A;  1IRG A;  4KMF A;  1O3T A;  3M7G A;  2E7W A;  1WQ2 A;  3WTS C;  1PUE E;  1F4K A;  3ZN0 A;  2H27 A;  3PQJ A;  4U0Y A;  2ACJ A;  5E8I A;  4EGZ A;  1W5T A;  1RUN A;  4OMY A;  5FLX K;  2W25 A;  3E5Q A;  4DQ2 A;  1YIO A;  4M71 A;  5D4S A;  1ZG5 A;  4A5M A;  1KU3 A;  3RTR A;  3LWF A;  4OIR F;  4ZYD A;  5FB2 A;  3ZMS A;  1DDN A;  2ZFW A;  5JVT A;  3E5U A;  5DCM B;  1BI0 A;  4G8X A;  4P5O A;  3HTU A;  1X3U A;  1XGN A;  1K78 B;  4KNY A;  3L7W A;  4HYE A;  3D0S A;  2ZCW A;  1WRJ A;  1XGM A;  3RJP A;  1QQI A;  1KU7 A;  4ENJ A;  2Q2E A;  4KT5 C;  5DUI A;  3M9A A;  2A6H F;  1ODD A;  2A07 F;  3KP2 A;  2Z99 A;  4OU0 A;  4XSX F;  4L0Z B;  2HTJ A;  2ETH A;  2E7X A;  3SZP A;  4IHT A;  2H6C A;  1YLF A;  4IRI A;  2DQL A;  4EVI A;  2F2E A;  4P9U A;  5HLI A;  3SXY A;  1K6O A;  2R3S A;  3KP4 A;  1IN6 A;  3WGG A;  1F5T A;  1XDU A;  2GIV A;  1BC7 C;  2CW0 F;  4PGH A;  2IP2 A;  1Q1H A;  4Y17 A;  2IT0 A;  2M87 A;  2MC3 A;  2XVC A;  2VC1 A;  4AWX B;  3ZN1 A;  2P5K A;  3C18 A;  1MJ9 A;  1IN4 A;  2V6C A;  4U7B A;  2J5O A;  4ZH4 F;  4WXD A;  2Z9O A;  4RGU A;  3EUH A;  3OOP A;  2K4B A;  1IRF A;  4A5N A;  4XLP F;  2RKH A;  1IF1 A;  2M1B A;  2A6E F;  2PN6 A;  2ZJ2 A;  3ECH A;  3U1D A;  2L4A A;  4L9V A;  1U6G A;  3MWM A;  3I53 A;  3K69 A;  4LMY A;  1G3S A;  2EFW A;  2PJP A;  1J59 A;  2PFB A;  4CDG A;  2WTE A;  3WU1 B;  4RS8 A;  1W7P A;  1R7J A;  2KRF A;  3GWZ A;  4L9N A;  1W5S A;  1FYM A;  2PLY A;  3MAJ A;  1FNN A;  1FBU A;  1LNW A;  3JAM Z;  3CUQ B;  4XLN F;  2P5L C;  1L0O C;  2FU4 A;  3GEZ A;  3FWE A;  2YSR A;  3CDH A;  1NHA A;  3MCZ A;  3DP7 A;  2ISY A;  1SFU A;  5BOX A;  2CWE A;  1DP7 P;  3V8K A;  1Z9C A;  3E97 A;  2H6B A;  4AIK A;  5DDG A;  5HDK A;  4PDK A;  2G9W A;  2ELH A;  2DPD A;  4MQV A;  4CHU A;  4L5J A;  4BH9 A;  1OYI A;  2Y0M A;  3V4G A;  1U78 A;  2O03 A;  3H3Z A;  3IKT A;  2DK5 A;  5F1R A;  3V7R A;  4HAM A;  1R00 A;  3QRF F;  2KJB A;  1SD6 A;  3HUG A;  1UB9 A;  1SAX A;  2ZXJ A;  3IWZ A;  1YW7 A;  2Z33 A;  4I98 B;  3BJA A;  2FSW A;  1V3F A;  4UVA A;  1OMI A;  1YQA A;  4M73 A;  3K9T A;  2QQB A;  3GF2 A;  5LGN A;  5J6X A;  3QPH A;  2JSC A;  1XD7 A;  5A2Q Z;  1O3S A;  2Y75 A;  3KLO A;  1KQ8 A;  2M45 A;  2C6Y A;  2JRT A;  3G3Z A;  3ZQ7 A;  5LBQ A;  4YG2 F;  2XAQ A;  2COM A;  1O7F A;  4MEY F;  3KFW X;  2PEX A;  2A61 A;  5TJJ A;  3HOS A;  5CVV A;  3FHZ A;  3RYR A;  1OYY A;  4NQW A;  2STT A;  2JTV A;  2JZY A;  4HV6 A;  1T6S A;  1G6N A;  3H3U A;  1WSU A;  2ISZ A;  2VE8 A;  2OU2 A;  1YW9 A;  4RAZ A;  2FNP A;  3MZH A;  2PMU A;  4G6Q A;  2HZT A;  2CG4 A;  2CYY A;  5AIQ A;  2L01 A;  5AIP A;  1IZ1 A;  3ZPL A;  3DF8 A;  1Z1D A;  4KIB A;  1P4W A;  1XGS A;  3COA C;  5D6E A;  3GFL A;  2H94 A;  1KU9 A;  4U7D A;  3JTH A;  3PFI A;  1J9I A;  2DU9 A;  3TDU C;  1U8R A;  3E6C C;  1REP C;  1BC8 C;  1FSH A;  1T98 A;  3KP6 A;  1I6X A;  1L3L A;  3JTG A;  1RNL A;  2WC2 A;  5ILS A;  5K5R A;  2UZK A;  3LQR A;  2VBX A;  2EJR A;  1HKQ A;  3SFZ A;  1FYL A;  2HDC A;  1AOY A;  1JHH A;  2W57 A;  2IA2 A;  5D4R A;  2K27 A;  4U0V A;  1D5V A;  2DBB A;  3KP7 A;  2YPR A;  4MQ9 F;  2B0L A;  2ZME A;  4EJU A;  1FBQ A;  1SD7 A;  2D2W A;  1LDK B;  2KJC A;  4JBA A;  3WGI A;  5JHU A;  1IUY A;  3C7J A;  4M9X A;  2VXZ A;  1UST A;  4XSZ F;  4Q5S F;  5JFR A;  1BI3 A;  2DQR A;  4U0W A;  2DAO A;  4MNU A;  1I5Z A;  4EM0 B;  4K2E A;  1RUO A;  3JSP A;  4Q47 A;  2VOD A;  1BJA A;  3E5X A;  2EFN A;  4S04 A;  4ESB A;  3JAM K;  1H9G A;  2FOK A;  3CO7 C;  1TQI A;  2CFX A;  3GUD A;  5HS9 A;  3EYI A;  3GYH X;  5CLS A;  2GAU A;  1WWX A;  5FD6 A;  2XUB A;  1W7P B;  4UVC A;  3KP5 A;  4UV9 A;  1ZRC A;  2KIF A;  5F64 A;  2D1H A;  4BAY A;  1XB4 A;  5HLH A;  2CQK A;  4ENN A;  2JPB A;  3TQN A;  1JHF A;  2F5C A;  2GA1 A;  1LB2 A;  3TO7 A;  3TO6 A;  3GFJ A;  5HLG A;  1Z05 A;  2K86 A;  5BMZ A;  4KFC A;  1FP2 A;  3IRR A;  2AXL A;  1ZHF A;  5JI6 A;  2FE3 A;  3IWF A;  3FXQ A;  1S7A A;  4HOB A;  4GCV A;  2HWV A;  5D5V B;  1MGT A;  3K1P A;  1B9M A;  1CF7 A;  3V7C A;  1QPM A;  2HTS A;  1ON2 A;  3GZ6 A;  1PDN C;  4EGY A;  1GXP A;  5A2Q K;  1B4A A;  1R22 A;  4RGR A;  2PQ8 A;  3GFM A;  2EK5 A;  5BS6 A;  2F5E A;  2QBY A;  4S05 A;  1SMY F;  1LDD A;  2IA0 A;  4BHP A;  2R7F A;  2DT5 A;  1YTY A;  4YIF A;  1MKM A;  2NYX A;  5L3D A;  5E1W A;  1G4D A;  1HW5 A;  2BGC A;  2STW A;  1EH7 A;  2BV6 A;  3DXJ F;  2E1N A;  2RC4 A;  2NNN A;  5E8G A;  1D8K A;  3WG9 A;  1DPR A;  3DPT A;  1XMK A;  4BYY A;  3QP5 A;  4WXH A;  1QBJ A;  5JR3 A;  2A69 F;  2NS0 A;  1RZ4 A;  1QZZ A;  3CJN A;  3KLN A;  1HXD A;  3MEX A;  1MDM A;  1IAW A;  1MZB A;  2P4W A;  1XSD A;  1IXR C;  3VEP A;  1LQ1 A;  1KGS A;  2XAJ A;  4LB5 A;  2O0Y A;  1SMT A;  2VN2 A;  2P5V A;  3BJ6 A;  2L3D A;  1FPQ A;  3L9F A;  2MLK A;  2M30 A;  5FD5 A;  2GZW A;  2PI0 A;  2VT2 A;  1ZYR F;  1FP1 D;  3F8M A;  2QEN A;  4YFK F;  1HW2 A;  4MTE A;  3REO A;  4HZF A;  4IRH A;  1SFE A;  4OIN F;  3F3X A;  4G94 A;  2XAG A;  2VBZ A;  3ML6 A;  3VB2 A;  4ENM A;  4LGW A;  3SQN A;  1KQ9 A;  1J5Y A;  3I5U A;  3ZMZ A;  3EYY A;  3RPU A;  3ISP A;  3I54 A; 
#chains in the Genus database with same CATH topology
 3WTX C;  2HOA A;  1ETV A;  3GZN B;  4H4K C;  2JWT A;  3U2R A;  2ID6 A;  4OAY A;  2A68 F;  1ONV A;  1JTY A;  1BR2 A;  3A4C A;  4KIG A;  4HRI A;  1WGX A;  2QKL B;  1V4R A;  1TP4 A;  2QLZ A;  4WXC A;  5FRO A;  4HLY A;  3VWB A;  3S14 J;  3CJT B;  2EB7 A;  3ERE D;  2UWM A;  1FIA A;  4XNF A;  2LVS A;  2R7T A;  4EM2 A;  5C3E J;  1X4O A;  1LVK A;  3K4B A;  2MD5 A;  2HDW A;  1JGS A;  1VQ8 I;  4BEH B;  1ON1 A;  2ZME B;  4FCY A;  3Q0V A;  3PUF A;  4ON0 A;  1TW2 A;  4N9I A;  3HOT A;  2VL8 A;  2MGQ A;  3GLX A;  4AIJ A;  3RI4 A;  3FIW A;  3BCA A;  3T1B A;  5L3G A;  2CUZ A;  2FF4 A;  5IYC J;  4BJ5 C;  4HNV A;  5KAF C;  3WTW C;  4ZJZ A;  5D5W B;  1RR7 A;  2ZFU A;  1SFX A;  2BY3 A;  3RYP A;  4ZTJ A;  4HDV A;  1KYW A;  2IBD A;  3TP3 A;  4BUP A;  1EH6 A;  1QO0 D;  4QIW N;  1USS A;  4KDP A;  4JX4 A;  2DN0 A;  2IEK A;  2DTZ A;  2OCC H;  3FKI J;  4BAC A;  2HDD A;  4KYW A;  1KQ0 A;  1YJ9 I;  2JPC A;  1F36 A;  4GO1 A;  4PK4 A;  2G7H A;  2JT1 A;  1BR4 A;  2XKP A;  5FKK A;  4ZDL A;  4KIC A;  1U3E M;  5IT9 Z;  2KDO A;  1U9O A;  4YEJ A;  1HLV A;  5ICG A;  2B63 J;  3CP8 A;  4F7Z A;  1LFB A;  4NDL A;  5LEK A;  1YJN I;  4XN3 A;  4UUT A;  2ZNY A;  3CCV I;  3W3C A;  1SD5 A;  2DDB A;  2Y30 A;  3HSF A;  4YFN F;  2V6E A;  2V9P A;  1DU0 A;  4JYK A;  1HST A;  2IS2 A;  1RPW A;  5K1Y A;  2R7X A;  3H92 A;  5DTD A;  4WX9 A;  2W7N A;  3GZ5 A;  4H0E A;  2VXD A;  3AL0 B;  3FF5 A;  1MMD A;  2VQG A;  2OD5 A;  4A0Z A;  2OQG A;  4B09 A;  2O3F A;  3QAH A;  2KQR A;  1ZR2 A;  1SEU A;  1A04 A;  1FJL A;  4M6X A;  3PIO F;  4G7H F;  4DZP A;  2EV5 A;  3CLQ A;  3LA7 A;  4AM3 A;  3CQZ J;  2YR2 A;  3B02 A;  1FT9 A;  4F52 A;  2CV0 A;  2K02 A;  2DT6 A;  2BYV E;  3GTO J;  4G7O F;  3F8C A;  4IXA A;  3OYG A;  4Y52 J;  1A31 A;  3KEQ A;  3CC7 I;  4HV5 A;  4MEX F;  3H5N A;  4LK1 F;  1VQP I;  3P9C A;  4M74 A;  4P96 A;  5IP6 A;  2EFQ A;  1IDZ A;  4BHC A;  2RAE A;  2VLA A;  2HU9 A;  4M3D A;  4N9H A;  5LEJ A;  3K70 D;  1XSX A;  1HOM A;  1GXQ A;  3B6A A;  3JRF A;  3JSO A;  4BQO A;  3CDL A;  2MA3 A;  2R7V A;  1Y0U A;  1Y1V J;  3RKY A;  4BXU A;  3I0T A;  1IV6 A;  4RGX A;  1ITY A;  2V1D A;  3J7Y J;  1D8J A;  2FRH A;  3BPX A;  2R7W A;  3LSP A;  1W7P D;  4LG0 A;  2HEO A;  1IRZ A;  2NAZ A;  3KP3 A;  1SFK A;  3OWT A;  4OIO F;  2L54 A;  3R6S A;  4BJ6 C;  1CF7 B;  5CVR A;  4GYG A;  2VON A;  2Q0O A;  3A01 A;  5DD8 A;  4N0B A;  4XOR A;  1Z6T A;  1TLH B;  3OIP A;  3LOC A;  1XX5 A;  4LLN A;  4ZZL A;  1FC3 A;  2D1V A;  4AVP A;  3D5R C;  3K1N A;  4LB6 B;  2FA5 A;  3LA3 A;  2ECC A;  4JK1 X;  3HOY J;  3DKY A;  3BTI A;  5E18 F;  3FX3 A;  3U9G A;  3K1M A;  2R5Z B;  2BZT A;  1BI2 A;  3DPU A;  4MGR A;  3GME A;  2YUS A;  1IRX A;  3DTE A;  5GPA A;  1R1T A;  4V2G A;  1B9N A;  3ZR8 X;  1JE8 A;  2ID3 A;  3IAM 2;  3HGY A;  3DEU A;  2QBY B;  4PJJ A;  2XGX A;  3ROU A;  1POG A;  1O3Q A;  2DMN A;  2QWW A;  4CZZ A;  1IO2 A;  4ZYE A;  2M7B A;  2GXB A;  3DQV C;  1J0R A;  4A0Y A;  4EJW A;  2GOX B;  3K2A A;  1FOK A;  1R1V A;  3LSI A;  4HQE A;  4A3M J;  5BPI A;  2DA2 A;  2RV8 A;  3N05 A;  5LLQ A;  1HKS A;  2EIJ H;  2UXN A;  3MKW B;  3LSM A;  2P7C B;  1S6L A;  2CRG A;  5HLT A;  1TT0 A;  2DO7 A;  1BM9 A;  2UV1 A;  2XAU A;  3CJQ B;  3QYF A;  3PSI A;  1K7A A;  4AYB N;  4C2U A;  3A1Y A;  2DFF A;  4BXX J;  2HKX A;  2HNH A;  2MW8 A;  4UB6 C;  4I09 A;  2VBY A;  1G3T A;  4I0B A;  5F04 A;  2D5V A;  2PJR A;  4RBO A;  2YU3 A;  3LSH A;  2HR3 A;  4HG2 A;  3BZ6 A;  3G6E I;  1TQP A;  3S93 A;  1ZGA A;  5L3C A;  4RDU A;  4D9J A;  1MDM B;  3W6K B;  3GTL J;  3GW2 A;  4M3F A;  4TV7 A;  3SDG A;  5DM6 F;  3F0C A;  4J00 A;  3PFY A;  4YIR X;  2E36 A;  1ULY A;  5F6F A;  4C30 A;  2GOM A;  1E3P A;  3F6V A;  1W5C C;  4LJZ F;  1SVO A;  1MBG A;  4C3H J;  5L3B A;  2H1L A;  2FMY A;  4R1H A;  4ENK A;  2AQE A;  1ZH5 A;  4OIQ F;  3LA2 A;  3FBN B;  2HQN A;  3ZQQ A;  1H89 C;  1MSF C;  1ZTR A;  2Y48 A;  1FMW A;  2LSO A;  2VKD A;  2R5Y A;  2X6Y A;  4I7H A;  1BOA A;  1EJ9 A;  3ABU A;  4E7I A;  3IUO A;  2AS5 F;  5HNH A;  3AAF A;  1WH7 A;  2HVR A;  2ZO4 A;  4CXF A;  3VSK A;  4RB2 C;  1OR7 A;  3F72 A;  4RM2 A;  2JRM A;  1C0W A;  4V19 K;  1Y8Q B;  3WGH A;  3ULQ B;  2MD0 A;  2ECB A;  3T8T A;  2I10 A;  2CSO A;  2LP0 A;  4A0X A;  4GYI A;  2NOJ B;  3JRD A;  1P2F A;  3KYC B;  1VFC A;  3H3V K;  1RI7 A;  2HS5 A;  1OJL A;  2FQ3 A;  5LHI A;  1V54 H;  1KYZ A;  2OV7 A;  2LRD A;  2VKV A;  4ETS A;  4NUB A;  2XGE A;  4YII A;  1IDY A;  2IS6 A;  4M6Y A;  3J7A O;  4RB0 A;  2VOO A;  1U0J A;  2L7F P;  2XHK A;  2XAF A;  2D45 A;  3TDZ C;  1U5T C;  2IW5 A;  4HPQ A;  4EV0 A;  2KP6 A;  6PAX A;  1FBS A;  2HFH A;  3A03 A;  3LFU A;  3IAS 2;  4FX4 A;  2RNJ A;  1HW1 A;  4P9F A;  5D5U B;  2LYC A;  3K0L A;  2IA1 A;  2XIG A;  5IT9 K;  1ZQ3 P;  2VE9 A;  1IXC A;  1W0T A;  3PIP F;  2EBI A;  2L9R A;  3CLO A;  1TQM A;  3K4K A;  3RDI A;  2W84 A;  5M3M J;  1ZG3 A;  4PZJ A;  5E1X A;  4NHJ A;  2BY0 A;  3HL2 A;  1VQK I;  1PJR A;  2NRA C;  1J7K A;  1H8A C;  3ZQI A;  5GTH C;  3BP8 A;  1QNT A;  2BXZ A;  4RB3 C;  4U87 A;  5CVU A;  3SZT A;  1ETW A;  1LEA A;  2AHQ A;  3S2W A;  4MTD A;  4CO8 A;  3OOU A;  3KYD B;  3SHF A;  1GLN A;  3DU5 A;  4OOI A;  5GAD J;  4A3C J;  2HQ5 A;  3HTS B;  1XG1 A;  5ICE A;  4HNT A;  3K4J A;  5GAE J;  4C3I J;  3L00 A;  1ETO A;  4D1Q A;  3OYH A;  3WHB A;  1O3R A;  4C3J J;  2E2H J;  4ZYG A;  2O61 A;  3OSF A;  4B4C A;  2X85 A;  3C2B A;  3BTC A;  1APL C;  1MJA A;  2J5P A;  1ZG1 A;  3BT9 A;  3RSN A;  1JTX A;  3WG7 H;  4IPA A;  2R7D A;  3BOQ A;  4DZJ A;  4C9Y A;  3GXO A;  1JUM A;  3HOW J;  3BY6 A;  3IH3 A;  1K4S A;  3TW7 A;  3F8F A;  5IYB J;  2JA2 A;  1FZP B;  1SFO J;  1F1Z A;  3K2Z A;  5DD4 A;  3HRU A;  1T8I A;  1B8I A;  3JRH A;  3EDP A;  2PMH A;  3I59 A;  3FKJ A;  5B66 C;  2M5W A;  2OCE A;  4A69 C;  3RKQ A;  2BOL A;  4IHS A;  4M9Z A;  4QTR A;  3BRO A;  3A02 A;  4PCQ A;  2V79 A;  1Y0N A;  5ICF A;  2XRL A;  4KIS A;  2DJN A;  2NVU B;  4B44 A;  5D8K B;  4XRS A;  2KIU A;  1U2W A;  1RR8 C;  5E20 A;  4MHG A;  2QQ9 A;  3Q9S A;  5KVR A;  1W36 D;  4V2F A;  2BHY A;  2Y31 A;  5E1Z B;  4DYQ A;  1AKH A;  4M3B A;  3MD2 A;  1P4X A;  3BJO A;  3CCQ I;  2FBH A;  3BQZ A;  2OTJ I;  1E0E A;  1HSJ A;  2DI3 A;  5HDG A;  2F5D A;  1IN5 A;  4P55 A;  3ZQH A;  1FWZ A;  4XIC A;  3BR3 A;  2PMZ N;  1B1B A;  1WJD A;  1UG0 A;  1JKQ C;  4BBR J;  3T0Y A;  2DT7 B;  3FXL A;  1PUF A;  3KEY A;  1P92 A;  4CUG A;  2MYS A;  4R8H A;  3OY9 A;  3GBG A;  4LG0 B;  1FMV A;  4IQ4 A;  3HEF A;  3FZV A;  3FMS A;  1DUX C;  3IHU A;  1DGW Y;  1AA7 A;  4XKB A;  3P7N A;  3AKZ A;  3A01 B;  4UNO A;  4KN4 X;  3ZGK A;  1O57 A;  1K79 A;  2WV0 A;  3VOD A;  3FXU A;  4FHT A;  3HZJ A;  1I3Q J;  2QM3 A;  3HKZ N;  3GO5 A;  2GWR A;  4LLG F;  3FMR A;  4XLA A;  4IOC F;  3HOU J;  3ABL H;  4EMS A;  5ICC A;  2QVO A;  1T0F C;  2E19 A;  2CQX A;  3HPH A;  3E1S A;  5EEH A;  2BHZ A;  3DTI A;  1TL8 A;  4MO7 A;  2OQR A;  2CO5 A;  3W6J B;  2LNB A;  3K4C A;  2MG4 A;  3QYE A;  1G2H A;  3K10 A;  2ME0 A;  3HHG A;  3F22 A;  2FBI A;  3I58 A;  4PGG A;  4BY7 J;  2EV6 A;  5DUK A;  1Z6R A;  5LGU A;  2EIM H;  4LFU A;  1VTN C;  4DIQ A;  3VYR B;  3I71 A;  3O6B B;  3QQA A;  1YHQ I;  3ABM H;  3ZMD A;  2IPQ X;  2XV4 S;  4I02 A;  2DFH A;  4PJ0 C;  2E1C A;  1X19 A;  3PNV A;  2W4S A;  5LHH A;  2E35 A;  2W1O A;  5LFA A;  2BE5 F;  4IVN A;  5E3N A;  3F8N A;  2FOW A;  1BIB A;  4ZZD A;  2DTR A;  4XM3 A;  2PJR B;  1WPK A;  3F21 A;  4G6D A;  3KYL A;  5HOD A;  4KMU X;  4XID A;  4OIP F;  2V4J C;  1H88 C;  1LEB A;  1S5L C;  1E2X A;  4F91 B;  3J80 Z;  4HF1 A;  1WI9 A;  1N77 A;  2HKO A;  2WAF A;  1CGP A;  3BWG A;  3R61 A;  4ESJ A;  3M1C A;  2A5Y B;  2GM4 A;  2UXX A;  4MFE A;  2BY2 A;  3VOE A;  2ZSI B;  4U88 A;  4BHB A;  1QGP A;  5M5Y J;  2JQ7 A;  1T08 B;  3KET A;  2JMW A;  2PMZ A;  3OYF A;  2IGO A;  2IXS A;  4GGG A;  3ELK A;  4BXF A;  5F08 A;  2CMP A;  4CIC A;  2FBK A;  2X0L A;  2Y0S A;  4HBL A;  3TOB A;  3SEQ A;  2CQN A;  2R5Y B;  1XCB A;  2FXA A;  4QLC U;  1MMS A;  4HNU A;  4I2O A;  2EA4 A;  3E6M A;  3FK7 A;  4Y13 A;  4XOT A;  3VYS B;  2JA6 J;  4XRM A;  1X2M A;  3WOD F;  3NRV A;  1K61 A;  2DFI A;  1P4A A;  5KNL A;  2Z5U A;  2R0Q C;  4CZC A;  1MBK A;  2KDZ A;  2LDU A;  4LLL A;  1JXS A;  2CU7 A;  2ZKZ A;  1ETX A;  1XGO A;  1WJE A;  1YYV A;  2R7S A;  2XGC A;  3I9V 2;  3BTL A;  2W24 A;  1YS7 A;  1R23 A;  2XAH A;  1A6Q A;  4UV8 A;  2VOP A;  2E71 A;  2EIL H;  2XC7 A;  2YU9 J;  2W85 A;  2HQR A;  4PSW A;  1MBF A;  2VBW A;  5DYM A;  4PFP A;  2PG4 A;  1BW5 A;  3BQY A;  5BPD A;  5EYR A;  3FIS A;  1MJB A;  4ABZ A;  3OS0 A;  1FTZ A;  5FFZ A;  1U5T A;  4KN7 X;  5GAH J;  4CCN A;  2HPI A;  1OR7 C;  3CO6 C;  2FEZ A;  1R5G A;  1RIO H;  1G59 A;  3S2D J;  2P6S A;  4IZZ A;  3HOZ J;  1FEX A;  1Z77 A;  3IC7 A;  3W6V A;  1P6R A;  2EV0 A;  4FX0 A;  1ZAO A;  2BY1 A;  5L3F A;  5EZG A;  1T38 A;  5TRD A;  1UJ8 A;  2MLG A;  2HOE A;  1TNT A;  2M4G A;  3O3K A;  5K5O A;  3LNQ A;  4IX7 A;  2LH9 A;  4D5F A;  1W4M A;  2M4K A;  4ESF A;  3KIO A;  4GDF A;  5J1R A;  4PUS A;  4BNC A;  1Y1W J;  3ZMT A;  4I99 C;  2ELJ A;  3BR5 A;  4L9J A;  3NQO A;  3G1M A;  4KT6 A;  4CCM A;  3ZQF A;  2K40 A;  3OR2 C;  3H9Q A;  2JUG A;  2LFB A;  2M0M A;  2JSP A;  3D5L A;  3SJM A;  1IG7 A;  5LRS A;  1D0Z A;  1SD4 A;  3RPU D;  3K4M A;  1K6Y A;  3L2V A;  1OCR H;  1VQ7 I;  4A3L J;  3PQK A;  2IVM A;  4HX7 A;  5FLV A;  1Z7L A;  3ABT A;  3B6C A;  4I0A A;  3Q5F A;  4A6D A;  4HX4 A;  4ZYH A;  4RA2 A;  4UVB A;  3G73 A;  3WHC A;  3MFK A;  2V1U A;  3M4O J;  4XON A;  4I6Z A;  1FIP A;  2ZXW H;  3J81 Z;  1YFH A;  4D7N A;  1SVL A;  4I01 A;  3QPT A;  5M3F J;  3OYA A;  2XSJ C;  1UEL B;  4EAT A;  3L2W A;  1RKT A;  1T33 A;  3HRT A;  5D8L B;  2OAZ A;  1FSE A;  2M3A A;  2X48 A;  4EM1 A;  5LD2 C;  1AWC A;  5FKO A;  5EZH A;  3DFG A;  1CQT A;  3PJR A;  4LIT A;  2NNY A;  3I4M J;  3K7A J;  3I59 B;  4QPO A;  2RN7 A;  4Y15 A;  3V8J A;  4KUM A;  4BQA A;  5J8F A;  2L4M A;  5CJ9 A;  2DA4 A;  4OMZ A;  4AID A;  1SAU A;  3JW4 A;  3BR1 A;  1B72 A;  1GDT A;  2V1N A;  3DV8 A;  1WFX A;  2OZU A;  3LMM A;  1MD0 A;  5JLX A;  5ED4 A;  2KIM A;  1Y39 A;  4E7Z A;  2LD5 A;  1JJ8 C;  5HS8 A;  3WTZ A;  5CQE A;  1KU2 A;  1H0M A;  3F6O A;  2P8T A;  1V5F A;  2DXI A;  2WAQ N;  2VI6 A;  2NVX J;  2QCO A;  3DKW A;  1YG2 A;  2K5C A;  1AKH B;  3HYI A;  1ZN2 A;  3E6B A;  3R0J A;  1D3Y A;  3QP6 A;  3LFK A;  3BG9 A;  3OV8 A;  4HF0 A;  3DKX A;  1VQL I;  2ESH A;  4LG3 A;  2VC0 A;  2P6T A;  1XMA A;  5TIS C;  3E3V A;  3FXR A;  2H8R A;  4GFB A;  3AG1 H;  2ZBK A;  2EZH A;  2FML A;  2DK8 A;  5H2F C;  5FGM A;  1S7O A;  2X6W A;  4JQF A;  5H20 A;  1PUF B;  3P9K A;  3BR0 A;  1FY7 A;  3HGG A;  4A12 A;  3ZMV A;  2FNA A;  4NC7 A;  2LTP A;  1BBY A;  3MVP A;  4IF4 A;  2XB0 X;  3S8P A;  4XKW A;  1BIA A;  2V7F A;  2M2E A;  1DPU A;  2IGM A;  5DEQ A;  3VPR A;  2R92 J;  1E17 A;  3KE2 A;  3BR6 A;  1I50 J;  1QU3 A;  3HRS A;  4RAF A;  1S8N A;  1EV7 A;  2XAS A;  1EH8 A;  2GXA A;  3WE3 A;  5HOO A;  3MZ8 A;  5FO5 A;  5BQT A;  5ILU A;  4JOM A;  1T0F A;  4B3X A;  1D1A A;  2VJ5 A;  4EJV A;  5J40 A;  2E60 A;  4O5V A;  1MSE C;  2YX4 A;  3C3W A;  3WTY C;  5JVG F;  5AON A;  1X1D A;  1B6A A;  2K3P A;  3AG2 H;  4KIF A;  4D7M A;  4WK8 F;  2WBM A;  2FUG 2;  5FFX A;  1G3W A;  5CYV A;  2QA4 I;  3CCE I;  3RKX A;  2NS8 A;  2E5Z A;  5EJC A;  3M1E A;  4BJT A;  2BEO A;  3Q0W A;  5FRM A;  2XF7 A;  1QHH D;  1KZH A;  3J80 K;  4CCO A;  1XTA A;  4IEJ A;  1S72 I;  2XF5 A;  4ITV A;  4XRF A;  2H09 A;  4IOA F;  1TBX A;  1PP7 U;  5E79 C;  3WE2 A;  4D0P A;  2M8E A;  4HDU A;  2FQ4 A;  2JA8 J;  2V9K A;  4L5E A;  1R5I D;  3KCC A;  4O3M A;  2JA5 J;  3TGN A;  2OZ6 A;  2O8K A;  2HGC A;  4B48 A;  3X2Q H;  1J75 A;  4XMY A;  1OYW A;  4WWC A;  4BE1 A;  1GVJ A;  4RLQ A;  4E7L A;  2VQL A;  2CGP A;  3C1D A;  1OKR A;  4L5I A;  5DV5 A;  5EG0 A;  3VYT B;  2WAQ A;  1BA5 A;  4IJA A;  1BJZ A;  2COB A;  2OTL I;  2Q8K A;  2QYO A;  2M8G X;  3KEO A;  5K7F A;  1DGR M;  3S15 J;  4LK0 F;  2LY2 A;  3CUQ C;  1XDS A;  4A3B J;  3G4S I;  3FM5 A;  1R58 A;  1J2X A;  4A3I J;  1KA8 A;  1OFC X;  3M8E A;  2E2I J;  4KA4 A;  2Y9Z A;  2RVC A;  3D5S C;  3E6D A;  1NG7 A;  1HC8 A;  4A3K J;  2WWY A;  2Z3Y A;  2FJ1 A;  3QPS A;  4M9S A;  2L9N A;  2CS3 A;  1BN5 A;  2RQP A;  3EQL F;  3SYT A;  1MH4 A;  5HVQ C;  1ZLK A;  1UG2 A;  1HKT A;  1K4T A;  2RQQ A;  3HHH A;  2H8W A;  5CKT A;  1UZC A;  4UXN A;  3H35 A;  5K7Z A;  3HOV J;  2KPM A;  3FXK A;  4M72 A;  4DJA A;  4E70 A;  1YS6 A;  3GTG J;  1MMG A;  5J3L A;  3QOP A;  3O2P E;  3BPV A;  1VQ4 I;  3QYB A;  4UHT A;  3HIF A;  2WA0 A;  4UUV A;  1QZY A;  3JCU C;  1XSV A;  2DW4 A;  4DNC A;  3DPL C;  2KRC A;  2LF8 A;  1IN7 A;  2DLL A;  3PSF A;  5CVJ A;  1T56 A;  4R79 A;  4MIM A;  4Q48 A;  1O4X A;  3ASO H;  2NVT J;  4M6V A;  3KZY A;  3ASN H;  3T5X A;  2AQF A;  5GAG J;  4Y3O A;  4EQQ A;  3QPL A;  2V9V A;  3IH2 A;  1HQC A;  4RMN A;  1HDD C;  3IL2 A;  2E1M C;  3PUB A;  3CMY A;  2JA7 J;  2L9V A;  2ZXI A;  3HOX J;  1U5T B;  3N4M A;  2EFO A;  1MH3 A;  3KZI C;  1FLI A;  1Z67 A;  2L9S A;  1O7L A;  5KAI C;  3V7S A;  3MKL A;  1YO5 C;  1T39 A;  4RM3 A;  3DTK A;  3WTU C;  1LVA A;  3G1L A;  3GX4 X;  1ZKG A;  4XBF A;  1Y8R B;  1D5Y A;  1LDJ A;  5ILV A;  3OS2 A;  3F23 A;  5HDN A;  2HYG D;  1D1B A;  2DOF A;  1LJ9 A;  1YOV B;  2F4O B;  2Q1Z B;  1QZE A;  1QVU A;  1STZ A;  2K7L A;  3LSR A;  1XC5 A;  2ZNZ A;  4PJM A;  3IRQ A;  2DYR H;  3DEE A;  1YX3 A;  3IKV A;  4ZTF A;  4OAZ A;  2WAD A;  1YIT I;  3VFZ A;  3ZP5 A;  2VKH A;  3J81 K;  2TDX A;  1WKM A;  4FT8 A;  2GXG A;  5DCM A;  2ADU A;  3VYU B;  3JRE A;  1XCV A;  2JN6 A;  2KFD A;  1Z7U A;  2BBY A;  5EEG A;  2A3S A;  2CJJ A;  4HF2 A;  1K78 A;  5FLX Z;  2P7V B;  3GVA A;  3QU6 A;  1XPX A;  3WTV C;  4IRG A;  2QUF A;  2X1C A;  3ZMU A;  3BC8 A;  4RB1 A;  3H5R A;  3RPQ A;  3CTA A;  3RQI A;  3OMY A;  2X9D A;  3RQ4 A;  1BL0 A;  2ESN A;  3GFI A;  2EH3 A;  2PBI A;  4AU7 A;  3HRM A;  4L18 B;  2XDV A;  1UCR A;  4B8X A;  3LAP A;  2EQR A;  2XRN A;  3ZQG A;  2R4G A;  3HSE A;  3LAJ A;  4C2T A;  2MH9 A;  2GQQ A;  1W0U A;  2RRE A;  2K9L A;  2OBP A;  3R60 A;  2IS1 A;  1V55 H;  1X1P A;  5TGT A;  1QHG A;  3SDB A;  1JUP A;  4IHW A;  3F8B A;  3I64 A;  1TTY A;  2LF7 A;  3LL7 A;  4DOZ A;  5HS7 A;  3EPZ A;  2LRE A;  2BW3 A;  3D1N I;  3CP2 A;  3Q9V A;  1YW8 A;  5FJ8 J;  2XPW A;  5B1B H;  2BVM A;  3BLY A;  2MH2 A;  3T8R A;  5D6F A;  5E17 F;  3MN2 A;  2VT3 A;  1B72 B;  5LRR A;  1FOY A;  2W48 A;  1FYK A;  1UHM A;  3KZZ A;  2L02 A;  2EFP A;  5H6R A;  3FM3 A;  2QSG X;  2QEX I;  3FXJ A;  2AO9 A;  3R4K A;  4WF2 A;  2XSD C;  1ZRD A;  3WU0 A;  3BG3 A;  1I27 A;  2K85 A;  1QRY A;  3HM5 A;  1R4N B;  4DYC A;  1ZGJ A;  1OIS A;  2RGV A;  2GA2 A;  1YIJ I;  3R0A A;  4BS9 A;  2M9H A;  4LIU A;  3WTT C;  1UHW A;  3DCF A;  4HX8 A;  5JLW A;  1HBX G;  2E1O A;  4O6J A;  3CD6 I;  1DQU A;  3HSR A;  5DCF A;  2AXT C;  2KHM A;  3L2C A;  2ZXH A;  4L9T A;  1IXS B;  2HXI A;  1I1S A;  1X3W B;  5E3O A;  4YEL A;  1IN8 A;  4GXO A;  1Y6I A;  1TWH J;  2O8X A;  2OA4 A;  5EDN A;  2OC6 A;  3UNG C;  1TW3 A;  2R7Z J;  4S0H B;  4RAY A;  1FX7 A;  1A35 A;  1I1G A;  3DWL E;  2DPU A;  2Z16 A;  2E5N A;  1A6I A;  3OYM A;  4BE0 A;  1PYV A;  1JGG A;  4IHV A;  2MC4 A;  3DEW A;  2LKP A;  4A2U A;  3NEU A;  1LFP A;  3EUH C;  4LOC A;  5J8C A;  1G3Y A;  4HA8 A;  3OYK A;  1ZLJ A;  2X4H A;  3I4P A;  3A0B C;  2XRO A;  1S29 A;  1OPC A;  4F3Q A;  2X51 A;  2LG4 A;  4EJT A;  1MNE A;  1OCZ H;  1VI0 A;  1TNS A;  2B7E A;  3N97 A;  1R9T J;  3J7Z I;  3I55 I;  1PVE A;  1GVD A;  3RKW A;  1R1U A;  5GPC A;  4FAS D;  2IRF G;  3TO9 A;  2Y0S N;  5L3E A;  4AIH A;  4Y7N J;  4J19 A;  2O6G E;  3HXL A;  3FMQ A;  2MBF A;  5LGT A;  2HZD A;  3GTP J;  3H5A A;  1XN7 A;  2CQ7 A;  4WCG A;  1T2K A;  2ZJP F;  1ETQ A;  2NOG A;  3SZG A;  1PP8 F;  4AD9 A;  2NVY J;  3TKY A;  4G9Y A;  1VQN I;  3IV5 A;  4Y4R A;  1JKR C;  4LD5 A;  4XN0 A;  1R36 A;  5ERI A;  3EET A;  3S1R J;  3AG4 H;  4EJO A;  1FTT A;  1OQY A;  3ZQC A;  1F9N A;  3RCO A;  3K70 C;  2DOE A;  1AU7 A;  2EWN A;  1D0Y A;  5H6Q A;  1X1A A;  2FD5 A;  1Z91 A;  3CZ6 A;  1OCT C;  1BW6 A;  2V1X A;  3ONQ A;  4CGZ A;  3BG5 A;  1JJ6 C;  1S3J A;  5K5Q A;  5D5X B;  3NWT A;  2JK3 A;  3V8L A;  3OYJ A;  3MMY B;  1ZRF A;  3LQQ A;  3OR1 C;  3CUO A;  1R49 A;  4HLX A;  2VJJ A;  1E3O C;  2F5F A;  2HYF A;  1ZRE A;  2LBF A;  1WZ2 A;  4II2 A;  5EG0 B;  3ESW B;  1GHC A;  2ICW G;  4DBR A;  3BG7 A;  3A0H C;  2TRT A;  1R6R A;  2RDP A;  4RGS A;  1LKX A;  4L0Y B;  3ECO A;  3L09 A;  3RIR A;  1HF0 A;  1P7I A;  3CUQ A;  4Q4Z F;  2K9N A;  4XLF A;  3OYI A;  2QZ8 A;  2H1K A;  5M5W J;  2L0K A;  1H9T A;  1IUF A;  2RNG A;  3Q3S A;  4B1R A;  5KK1 A;  2KKO A;  4ASN A;  2KZG A;  2IJL A;  3G1O A;  3CF5 F;  2QQA A;  4A6E A;  1G8X A;  3BG6 A;  4XL9 A;  5F0C A;  2K4J A;  4HQM A;  3B73 A;  4Z2Y A;  2EA2 A;  1B59 A;  5C4X J;  1IW7 F;  4QWQ A;  4F92 B;  5CVI A;  3LSK A;  1NTC A;  3TOA A;  4CYC A;  4YFX F;  2G7U A;  4HW0 A;  3UR3 C;  3M3Y J;  5J1U A;  2MSY A;  3BDD A;  1BI1 A;  3MZY A;  2DA1 A;  4ZDO A;  1ZAR A;  1UFM A;  1Z3X A;  3P9I A;  1LFU P;  3IH4 A;  4DYR A;  3M8F A;  2YX7 A;  1TWC J;  2KMU A;  2OJE D;  4CYD A;  1JUS A;  4G7Z F;  3LST A;  3G71 I;  2M0C A;  2CFO A;  5J4Y A;  3CDI A;  1LUJ B;  5EGO A;  3I4N J;  3MQ0 A;  5LHG A;  4NB5 A;  3OL3 A;  1MND A;  4XQF A;  2XKO A;  3PM1 A;  1ZR4 A;  1R5H A;  5IT3 A;  3QU3 A;  1IRG A;  2VPR A;  4KMF A;  4CA0 A;  1O3T A;  3HJE A;  5J47 A;  3M7G A;  4A3D J;  3ZCO A;  4J01 A;  4E7K A;  2E7W A;  1WQ2 A;  3WTS C;  1TT5 B;  1PUE E;  1OLT A;  1S7E A;  1F4K A;  3SEZ A;  3ZN0 A;  2H27 A;  3PQJ A;  4U0Y A;  1JT0 A;  4AVZ A;  4E7H A;  2ACJ A;  5E8I A;  4EGZ A;  3SFI A;  1W5T A;  4CCJ A;  1RUN A;  4OMY A;  1Y56 A;  5FLX K;  4IQJ A;  2W25 A;  3E5Q A;  2VJI A;  4DQ2 A;  1YIO A;  1RES A;  2EIK H;  4M71 A;  3S2H J;  1UAA A;  5D4S A;  1ZG5 A;  5E3L A;  1YX5 A;  2X1E A;  4A5M A;  1KU3 A;  3RTR A;  4GRI A;  4BU2 A;  3QOD A;  3LWF A;  4OIR F;  2DFE A;  4ZYD A;  3K4L A;  5FB2 A;  2KZV A;  3OYD A;  3ZMS A;  1DDN A;  2ZFW A;  5JVT A;  1V5E A;  2WV1 A;  3E5U A;  4EEF G;  5DCM B;  1BI0 A;  2CH0 A;  3GCM A;  1J09 A;  2W00 A;  4G8X A;  4P5O A;  3DBH B;  1F43 A;  3HTU A;  2KRH A;  1X3U A;  4XLE A;  1XGN A;  4IKF A;  1K78 B;  4KNY A;  1WJB A;  1VQ6 I;  4BBS J;  3L7W A;  1MIJ A;  3W2V A;  4HYE A;  3GTQ J;  2ZJR F;  5CPR B;  3JRC A;  4CH7 A;  5JHF A;  1ZEL A;  3TL4 X;  2QQ8 A;  3D0S A;  3GTK J;  2ZCW A;  1WRJ A;  2VPL A;  1XGM A;  3PNY A;  3V42 A;  3RJP A;  1QQI A;  3C2H A;  4BY1 J;  1KU7 A;  3CC4 I;  2GLO A;  1FOW A;  4ENJ A;  2Q2E A;  1WJA A;  4KT5 C;  5DUI A;  3M9A A;  2ZJQ F;  4BL0 B;  4A3G J;  2A6H F;  1JKO C;  1D0X A;  1ODD A;  4A3J J;  2A07 F;  3S1N J;  3KP2 A;  2Z99 A;  4OU0 A;  2NXN B;  4XSX F;  3FDY A;  4L0Z B;  3GLL A;  2HTJ A;  2ETH A;  2E7X A;  2BW3 B;  3SZP A;  2H6C A;  1YLF A;  4X1E A;  4IHT A;  3ZXS A;  4IRI A;  3M07 A;  2DQL A;  4EVI A;  3KX2 A;  2QKM B;  5F0F A;  1ORK A;  2F2E A;  4JX5 A;  1UMQ A;  4P9U A;  4UUS A;  2XGD A;  5HLI A;  3JRA A;  1DU6 A;  3S17 J;  1ENH A;  2VQH A;  5IOY A;  3SXY A;  1K6O A;  2R3S A;  4E6K G;  3KP4 A;  1IN6 A;  3ZOB A;  4CCL A;  2L7K A;  3WGG A;  4KIT B;  3H0D A;  1ZGW A;  4A3F J;  1F5T A;  4BDY A;  1XDU A;  2GIV A;  4E7S A;  1BC7 C;  1VQ9 I;  3CMM A;  2CUE A;  3CCY A;  2CW0 F;  2R7U A;  4PGH A;  2IP2 A;  1Q1H A;  3FK6 A;  3HG9 A;  4Y17 A;  1VQM I;  2M87 A;  4FQG A;  3TBI A;  2IT0 A;  1B8I B;  2LMD A;  2MC3 A;  2CV1 A;  2OUM A;  2XVC A;  2VC1 A;  3CCR I;  2VB6 A;  4AWX B;  4KJZ A;  1X1C A;  3ZN1 A;  2P5K A;  5KCM A;  4XRS G;  1SAN A;  3GTJ J;  2R7O A;  3C18 A;  1TWG J;  1MJ9 A;  3E0J B;  2VJ4 A;  1T95 A;  1IN4 A;  2V6C A;  4BE2 A;  2CUF A;  3IP4 B;  4U7B A;  3CC2 I;  2J5O A;  2WY8 Q;  2R7R A;  3H36 A;  3S1M J;  2ZME C;  4ZH4 F;  4WXD A;  2Z9O A;  1LE8 A;  2IGK A;  4RGU A;  2HI3 A;  3EUH A;  3OOP A;  1X2N A;  2K4B A;  1IRF A;  4A5N A;  3ZQL A;  2GIZ A;  4XLP F;  3L1P A;  2O9L A;  2RKH A;  3CJR B;  3VSL A;  3S3N A;  1IF1 A;  2CW8 A;  2JUC A;  2M1B A;  2A6E F;  3L2Q A;  2HOT A;  1SVM A;  3BZK A;  1R4M B;  2PN6 A;  2ZJ2 A;  2EZK A;  3ECH A;  1QPI A;  5IP9 J;  3MKY B;  1ETY A;  5IP7 J;  1K83 J;  3U1D A;  2E34 A;  2L4A A;  2TCT A;  4B43 A;  4L9V A;  5FLM J;  1U6G A;  3JRI A;  2OPT A;  3CCJ I;  2G0E A;  3BZC A;  1W36 C;  3MWM A;  2KLO A;  4W97 A;  3I53 A;  2O7O A;  3K69 A;  4LMY A;  3CCS I;  1GV5 A;  2IAI A;  3ZRG A;  1WJF A;  1G3S A;  2EFW A;  2KIQ A;  4JX6 A;  3CES A;  2PJP A;  3AFH A;  1J59 A;  1LPQ A;  2PFB A;  4CDG A;  2WTE A;  3BTJ A;  2HQA A;  1OCP A;  2LOO A;  3WU1 B;  1WH5 A;  4RS8 A;  1W7P A;  2NS7 A;  3JRG A;  1R7J A;  4ANJ A;  2KRF A;  1Z21 A;  3GWZ A;  3EUA A;  1MBH A;  3AL0 C;  4L9N A;  1YRN A;  1W5S A;  1FYM A;  2LBF B;  2PLY A;  3MAJ A;  2LK2 A;  1VND A;  1FNN A;  1FBU A;  2R7Q A;  2K9M A;  1N75 A;  1LNW A;  3F9K A;  4N4N B;  3JAM Z;  2LR8 A;  3CUQ B;  2LLK A;  4XLN F;  2P5L C;  1I3A A;  1L0O C;  1IGN A;  2FU4 A;  2DA5 A;  3GEZ A;  1ERD A;  3FWE A;  2YSR A;  3L2U A;  3CDH A;  4ZYA A;  3TMO A;  1NHA A;  2F48 A;  3MCZ A;  1RET A;  5M5X J;  3DP7 A;  2ISY A;  3S16 J;  1SFU A;  5BOX A;  2CWE A;  1JKP C;  1DP7 P;  2DYS H;  3V8K A;  3OYE A;  4CYC B;  3S1Q J;  1Z9C A;  4W1U A;  3E97 A;  1WI3 A;  2H6B A;  4AIK A;  5DDG A;  3ABK H;  5HDK A;  4PDK A;  1JI8 A;  2G9W A;  2ELH A;  2DPD A;  4MQV A;  4CHU A;  3H0G J;  4L5J A;  2K3F A;  2JVG A;  4BH9 A;  1R71 A;  1OYI A;  2Y0M A;  4FTH A;  3V4G A;  1RRJ A;  2E2J J;  5FKM A;  1U78 A;  1GV2 A;  2O03 A;  2EZI A;  2W82 A;  4UY8 I;  3H3Z A;  1NK3 P;  2F4I A;  5EGO B;  3IKT A;  2DK5 A;  2X1D A;  3NAR A;  3OS1 A;  5FRN A;  5F1R A;  3V7R A;  2B9S A;  4HAM A;  1R00 A;  3QRF F;  3BR2 A;  1YJW I;  2HVS A;  2KJB A;  1SD6 A;  3PO3 J;  2L5Q A;  4XLH A;  2VKE A;  4BGD A;  3HUG A;  1UB9 A;  2E1M B;  1SAX A;  4IHX A;  1Q1V A;  2A05 A;  2ZXJ A;  3IWZ A;  2QSH X;  1YW7 A;  2X6O A;  2Z33 A;  2I5U A;  1D1C A;  4I98 B;  2Z2S B;  4E4H A;  2P0W A;  2FSW A;  3BJA A;  1V3F A;  4UVA A;  1OMI A;  1QVT A;  1YQA A;  2M7A A;  3L2R A;  4M73 A;  5BNG A;  3K9T A;  3LSJ A;  2QQB A;  3GF2 A;  5LGN A;  5J6X A;  3HC7 A;  3QPH A;  1NK2 P;  3OYB A;  2JJ7 A;  2JSC A;  4FET A;  3PNT A;  1XD7 A;  4FE4 A;  4IO9 F;  1U9N A;  5A2Q Z;  2NVQ J;  2WAE A;  1O3S A;  2Y75 A;  2DMT A;  3FHN A;  3KLO A;  5GP9 A;  1KQ8 A;  2M45 A;  5IOZ A;  2C6Y A;  1X58 A;  2JRT A;  3G3Z A;  3ZQ7 A;  5LBQ A;  4YG2 F;  2XAQ A;  3KPH A;  4IHY A;  2COM A;  1O7F A;  4MEY F;  3KFW X;  2PEX A;  2A61 A;  5TJJ A;  3HOS A;  5CVV A;  3FHZ A;  4DW6 A;  3RYR A;  1OYY A;  3M8J A;  4NQW A;  1TZL A;  1WJC A;  2STT A;  2JTV A;  2JZY A;  4HV6 A;  4OWR B;  4M3G A;  1T6S A;  5B5E C;  1G6N A;  2KL4 A;  3H3U A;  2VQC A;  2Y9Y A;  1P9Q C;  1UHS A;  2P81 A;  4F55 A;  1WSU A;  2ISZ A;  2VE8 A;  2OU2 A;  1YW9 A;  3OYL A;  4RAZ A;  2YS9 A;  2FNP A;  3MZH A;  3I56 I;  2PMU A;  4G6Q A;  2HZT A;  4LIV A;  3OSG A;  2M34 A;  2CG4 A;  5DS9 A;  3HBL A;  2EZL A;  2CYY A;  2EPF A;  2Q2E B;  2L01 A;  5AIQ A;  2ZB9 A;  5AIP A;  5IYD J;  1IZ1 A;  2ELK A;  5C4J J;  3ZPL A;  3DF8 A;  1VZ0 A;  4NNJ A;  1Z1D A;  2I8D A;  2Y69 H;  4KIB A;  4A3E J;  1DP3 A;  1IC8 A;  1P4W A;  1NH3 A;  1EF4 A;  1XGS A;  2N8G A;  3VDX A;  3O8G A;  4B3A A;  3COA C;  1SC7 A;  5D6E A;  1X3Z B;  3GFL A;  2H94 A;  5IPA A;  4NC8 A;  1KU9 A;  4U7D A;  3JTH A;  3PFI A;  3JR9 A;  1J9I A;  1HCR A;  2CUJ A;  4UUS B;  4HEA 2;  2DU9 A;  4XR6 A;  3TDU C;  2PX9 A;  1U8R A;  3C2G A;  5B1A H;  1BR1 A;  4NBQ A;  1N78 A;  5FKN A;  3E6C C;  1REP C;  1MBJ A;  1V5G A;  2L7M P;  5IY5 H;  1BC8 C;  2DOA A;  1FSH A;  4AYB A;  2O5R A;  1T98 A;  1VQ5 I;  3KP6 A;  1I6X A;  1L3L A;  3JTG A;  4XKV A;  1RNL A;  2DMU A;  2WC2 A;  2A5W A;  5ILS A;  5K5R A;  2UZK A;  3LQR A;  2VBX A;  2EJR A;  4A93 J;  1HKQ A;  1JT6 A;  2DA3 A;  3SFZ A;  4PFO A;  5F0H A;  3OYN A;  1MBE A;  2F6C A;  5F1J A;  3DBR B;  1FYL A;  2HDC A;  1JHH A;  1AOY A;  2EIN H;  2W57 A;  2IA2 A;  4P1W A;  2XPU A;  5D4R A;  2K27 A;  1XMX A;  4U0V A;  1D5V A;  1GT0 C;  2DBB A;  1WHU A;  4QSH A;  3KP7 A;  4CCK A;  1W1W E;  2YPR A;  1RKW A;  4NC6 A;  1E3H A;  3O8H A;  3EUK L;  2B0L A;  4MQ9 F;  2UUZ A;  3DLA A;  4BEH A;  2ZME A;  1Z3Y A;  4EJU A;  4AUX A;  2X6X A;  1FBQ A;  1SD7 A;  2DJI A;  2D2W A;  1A36 A;  3FXM A;  1LDK B;  1LE8 B;  3U21 A;  2KJC A;  4JBA A;  3QWL A;  3WGI A;  5JHU A;  1I6H J;  1IUY A;  1HDP A;  3C7J A;  4M9X A;  2HPM A;  3OIQ A;  3P5J A;  1WCM J;  2LY9 A;  1UST A;  2VXZ A;  3H9G A;  4XSZ F;  2LY1 A;  3DBL B;  1HA8 A;  4Q5S F;  2L7Z A;  2ME6 A;  5J4V A;  5JFR A;  1BI3 A;  2DQR A;  4U0W A;  4C2M J;  2DAO A;  4AC0 A;  4MNU A;  3G2B A;  1I5Z A;  1RC9 A;  4EM0 B;  3GTM J;  2Z1D A;  4RLF A;  4MFD A;  4K2E A;  4N4O B;  1IV8 A;  1RUO A;  3JSP A;  4Q47 A;  2WY7 Q;  2VOD A;  1BJA A;  3E5X A;  2IS4 A;  5GTI C;  2EFN A;  4S04 A;  3HPG A;  3K6G A;  5J1Y A;  1N25 A;  2VIX A;  2DDA A;  4ESB A;  1A5J A;  3JAM K;  1H9G A;  2FOK A;  1TQI A;  2CFX A;  3GUD A;  5HNF A;  3CO7 C;  5HS9 A;  3EYI A;  4BQN A;  3GYH X;  2OF7 A;  2LKS A;  5CLS A;  2GAU A;  2LKX A;  4I76 A;  1WWX A;  2FX0 A;  4X0G A;  4F93 B;  5FD6 A;  3JRB A;  9ANT A;  2XUB A;  1W7P B;  2F4M B;  1AHD P;  2BVL A;  3PO2 J;  4UVC A;  3WU2 C;  4BKX A;  2HYJ A;  1YRN B;  4X6A J;  3KP5 A;  4Z6Y A;  4UV9 A;  1WVR A;  3J7A Y;  1ZRC A;  2Y2Z A;  3QOE A;  2KIF A;  2ZSH B;  3OIO A;  1NG6 A;  2A6T A;  5F64 A;  3CME I;  2D1H A;  3H1C A;  4Y33 A;  2CW7 A;  4BAY A;  1XB4 A;  5HLH A;  1S9H A;  1MNM C;  2KIS A;  2CQK A;  1Z0X A;  3K4N A;  2K9Q A;  2JPB A;  3PL8 A;  4JP0 A;  3TQN A;  4ENN A;  1JHF A;  2F5C A;  2GA1 A;  4XKC A;  4DBQ A;  3S3O A;  4YRV A;  4PSX A;  2XPV A;  4G12 A;  1LB2 A;  3TED A;  1MW7 A;  2QGU A;  2XF6 A;  4QPQ A;  3TO7 A;  3TO6 A;  5C44 J;  3GFJ A;  5HLG A;  1Z05 A;  2K86 A;  5CQG A;  5BMZ A;  1M1E B;  3HB9 A;  4KFC A;  3ERM A;  1FP2 A;  3W2W A;  3NWS A;  3W2A A;  4E7J A;  3IRR A;  2AXL A;  1EKE A;  1ZHF A;  1OCO H;  3CCM I;  5JI6 A;  2FE3 A;  1OCC H;  2F5V A;  3IWF A;  3FXQ A;  1S7A A;  4HOB A;  5F27 A;  4GCV A;  2HWV A;  4DGW B;  5D5V B;  1MGT A;  3K1P A;  4G6T B;  3S32 A;  1U8B A;  1GUU A;  1B9M A;  1CF7 A;  3V7C A;  2WB1 N;  3A2K A;  1QPM A;  2HTS A;  1ON2 A;  3GZ6 A;  1PDN C;  3TW6 A;  2VUM J;  2VAS A;  4EGY A;  3MKZ A;  1GXP A;  1P7J A;  5A2Q K;  1B4A A;  4UB8 C;  4D5C A;  4XLC A;  2LC2 A;  5EEA A;  3CCU I;  3HUG B;  1R22 A;  4RGR A;  5FKL A;  2R5Z A;  3LSG A;  1XS9 A;  2PQ8 A;  4CSW A;  3GFM A;  2EK5 A;  4HST A;  5BS6 A;  2F5E A;  2QBY A;  4S05 A;  1SMY F;  1LDD A;  2IA0 A;  4BHP A;  1ZK8 A;  3FXO A;  3DU6 A;  2R7F A;  4II3 A;  5EF6 A;  1KON A;  2DT5 A;  3AG3 H;  1YTY A;  2HOS A;  4YIF A;  4BQQ A;  1MKM A;  2NYX A;  5L3D A;  2R93 J;  2QF7 A;  4FIS A;  3Q0U A;  2MFZ A;  5E1W A;  1G4D A;  4XOP A;  1HW5 A;  2BGC A;  1YI2 I;  2STW A;  1EH7 A;  2BV6 A;  1VQO I;  3DXJ F;  2E1N A;  2RC4 A;  1ACI A;  2NNN A;  3E7L A;  5K7H A;  2GBY A;  5E3M A;  5E8G A;  1D8K A;  3WG9 A;  2DMP A;  2L2O A;  1QA6 A;  1DPR A;  4PJL A;  3DPT A;  1VF9 A;  1XMK A;  4BYY A;  3QP5 A;  4WXH A;  5B3S H;  3OYC A;  1QBJ A;  5KHD A;  4RAG A;  4XK4 A;  3NAU A;  5JR3 A;  2A69 F;  2NS0 A;  1RZ4 A;  4NQW B;  1QZZ A;  3CJN A;  3TP0 A;  2KT0 A;  3KLN A;  3OL4 A;  3RZO J;  1HXD A;  5DM7 F;  3MEX A;  3CF2 A;  1MDM A;  1IAW A;  1X4P A;  1MZB A;  2CQQ A;  4M3E A;  2P4W A;  1XSD A;  2HVQ A;  2DA6 A;  1IXR C;  1ETK A;  3VEP A;  1LQ1 A;  2V26 A;  2DOD A;  2DCE A;  1BOB A;  1KGS A;  2BXY A;  3HKZ A;  4BDZ A;  3I3L A;  2XAJ A;  4LB5 A;  1YE9 A;  1EA3 A;  1TWF J;  2O0Y A;  3HDD A;  3DLL F;  1SMT A;  2VN2 A;  4MLO A;  2P5V A;  2MAB A;  4ZDP A;  2ZC2 A;  3BJ6 A;  2IGN A;  1TC3 C;  4FE7 A;  2L3D A;  4PJN A;  1FPQ A;  3L9F A;  1X1B A;  2MLK A;  2M30 A;  4ZC3 A;  1I39 A;  5FD5 A;  3UKG A;  1FOX A;  2WB1 A;  3RZD J;  2GZW A;  3FBI B;  2QSF X;  2VT2 A;  2PI0 A;  1ZYR F;  2DA7 A;  1FP1 D;  4B47 A;  2JVH A;  3F8M A;  1MMN A;  1IJW C;  2QEN A;  3CMA I;  4YFK F;  1HW2 A;  3H9J A;  4MTE A;  2XB5 A;  3REO A;  4HZF A;  4IRH A;  1SFE A;  2DMQ A;  4OIN F;  3F3X A;  4G94 A;  2XAG A;  2VBZ A;  3ML6 A;  4IL6 C;  3VB2 A;  4ENM A;  4LGW A;  3U1K A;  3CCL I;  1MMA A;  2HXO A;  3SQN A;  3S3M A;  3BCB A;  1KQ9 A;  2K9S A;  2CV2 A;  1J5Y A;  3I5U A;  3ZMZ A;  1TWA J;  4HSR A;  3EYY A;  1WJ5 A;  3RPU A;  3ISP A;  3I54 A; 
#chains in the Genus database with same CATH homology
 3WTX C;  3U2R A;  2A68 F;  1ONV A;  4KIG A;  2QLZ A;  1V4R A;  4WXC A;  4HLY A;  2EB7 A;  3ERE D;  2UWM A;  4EM2 A;  2MD5 A;  1JGS A;  1ON1 A;  2ZME B;  4ON0 A;  1TW2 A;  4N9I A;  3HOT A;  3GLX A;  4AIJ A;  3RI4 A;  3T1B A;  5L3G A;  2FF4 A;  3WTW C;  5D5W B;  1SFX A;  3RYP A;  4HDV A;  1KYW A;  1EH6 A;  1QO0 D;  1USS A;  4KDP A;  4KYW A;  1KQ0 A;  2JPC A;  4GO1 A;  2G7H A;  2JT1 A;  2XKP A;  4KIC A;  1U3E M;  5IT9 Z;  5ICG A;  4F7Z A;  5LEK A;  2ZNY A;  1SD5 A;  3HSF A;  4YFN F;  1HST A;  5K1Y A;  3H92 A;  4WX9 A;  3GZ5 A;  4H0E A;  3FF5 A;  2OD5 A;  4A0Z A;  2OQG A;  4B09 A;  2O3F A;  3QAH A;  1A04 A;  4M6X A;  4G7H F;  2EV5 A;  3LA7 A;  2YR2 A;  3B02 A;  1FT9 A;  2K02 A;  2BYV E;  4G7O F;  3F8C A;  4IXA A;  3KEQ A;  4HV5 A;  4MEX F;  4LK1 F;  3P9C A;  4M74 A;  4P96 A;  2EFQ A;  4BHC A;  4N9H A;  5LEJ A;  1XSX A;  1GXQ A;  3JSO A;  2MA3 A;  1Y0U A;  3RKY A;  4BXU A;  3I0T A;  4RGX A;  2V1D A;  1D8J A;  2FRH A;  3BPX A;  1W7P D;  4LG0 A;  2HEO A;  2NAZ A;  3KP3 A;  4OIO F;  2L54 A;  3R6S A;  1CF7 B;  5CVR A;  4GYG A;  2VON A;  2Q0O A;  5DD8 A;  4N0B A;  1Z6T A;  1TLH B;  4LLN A;  4ZZL A;  1FC3 A;  2D1V A;  4AVP A;  3K1N A;  4LB6 B;  2FA5 A;  3LA3 A;  4JK1 X;  5E18 F;  3FX3 A;  3U9G A;  3K1M A;  1BI2 A;  4MGR A;  1R1T A;  1B9N A;  1JE8 A;  3DEU A;  2QBY B;  2XGX A;  3ROU A;  1O3Q A;  2QWW A;  4CZZ A;  4ZYE A;  2GXB A;  3DQV C;  1J0R A;  4A0Y A;  4EJW A;  1FOK A;  1R1V A;  4HQE A;  5BPI A;  2RV8 A;  5LLQ A;  1HKS A;  2UXN A;  2P7C B;  1S6L A;  1K7A A;  2DO7 A;  1BM9 A;  2HKX A;  4I09 A;  2VBY A;  1G3T A;  4I0B A;  2YU3 A;  2HR3 A;  3BZ6 A;  1TQP A;  1ZGA A;  5L3C A;  1MDM B;  3W6K B;  3GW2 A;  4TV7 A;  1ULY A;  5F6F A;  3F6V A;  4LJZ F;  5L3B A;  2FMY A;  4R1H A;  4ENK A;  1ZH5 A;  4OIQ F;  3LA2 A;  2HQN A;  2Y48 A;  2LSO A;  4I7H A;  1BOA A;  3ABU A;  2AS5 F;  3AAF A;  2ZO4 A;  4CXF A;  4RB2 C;  1OR7 A;  3F72 A;  1C0W A;  3WGH A;  3ULQ B;  3T8T A;  2CSO A;  4A0X A;  4GYI A;  1P2F A;  1RI7 A;  2HS5 A;  2FQ3 A;  5LHI A;  1KYZ A;  4ETS A;  4YII A;  4M6Y A;  3J7A O;  4RB0 A;  2VOO A;  2XHK A;  2XAF A;  2D45 A;  3TDZ C;  1U5T C;  2IW5 A;  4EV0 A;  6PAX A;  1FBS A;  2HFH A;  4FX4 A;  2RNJ A;  1HW1 A;  4P9F A;  5D5U B;  3K0L A;  2IA1 A;  2XIG A;  5IT9 K;  2VE9 A;  1IXC A;  3CLO A;  1TQM A;  3RDI A;  2W84 A;  1ZG3 A;  4PZJ A;  5E1X A;  4NHJ A;  2NRA C;  1J7K A;  3BP8 A;  1QNT A;  4RB3 C;  5CVU A;  3SZT A;  1LEA A;  3S2W A;  4MTD A;  4CO8 A;  3SHF A;  4OOI A;  3HTS B;  5ICE A;  3L00 A;  1O3R A;  4ZYG A;  2O61 A;  1MJA A;  2J5P A;  1ZG1 A;  4IPA A;  2R7D A;  3BOQ A;  3GXO A;  3BY6 A;  3F8F A;  1FZP B;  1F1Z A;  3K2Z A;  5DD4 A;  3HRU A;  3EDP A;  2PMH A;  3I59 A;  2M5W A;  4IHS A;  4M9Z A;  3BRO A;  4PCQ A;  2V79 A;  5ICF A;  5D8K B;  2KIU A;  1U2W A;  5E20 A;  4MHG A;  2QQ9 A;  3Q9S A;  5KVR A;  5E1Z B;  1P4X A;  3BJO A;  2FBH A;  1HSJ A;  2DI3 A;  5HDG A;  2F5D A;  1IN5 A;  4P55 A;  1FWZ A;  1B1B A;  3T0Y A;  1P92 A;  4R8H A;  4LG0 B;  3FZV A;  3FMS A;  1DUX C;  3IHU A;  3P7N A;  4UNO A;  4KN4 X;  1O57 A;  1K79 A;  2WV0 A;  3VOD A;  3FXU A;  4FHT A;  2QM3 A;  3GO5 A;  2GWR A;  4LLG F;  3FMR A;  4EMS A;  5ICC A;  2QVO A;  5EEH A;  2OQR A;  2CO5 A;  3W6J B;  2LNB A;  3HHG A;  3F22 A;  2FBI A;  3I58 A;  4PGG A;  2EV6 A;  5DUK A;  1Z6R A;  5LGU A;  4LFU A;  1VTN C;  3I71 A;  3O6B B;  3ZMD A;  2IPQ X;  2XV4 S;  4I02 A;  2E1C A;  5LHH A;  2BE5 F;  4IVN A;  3F8N A;  1BIB A;  4ZZD A;  2DTR A;  3F21 A;  4G6D A;  4KMU X;  4OIP F;  1LEB A;  3J80 Z;  1E2X A;  4HF1 A;  1WI9 A;  2HKO A;  1CGP A;  3BWG A;  3R61 A;  4ESJ A;  2A5Y B;  2UXX A;  3VOE A;  4U88 A;  4BHB A;  1QGP A;  3KET A;  4GGG A;  3ELK A;  4CIC A;  2FBK A;  2X0L A;  4HBL A;  3TOB A;  1XCB A;  2FXA A;  4QLC U;  4I2O A;  2EA4 A;  3E6M A;  4Y13 A;  3WOD F;  3NRV A;  2DFI A;  1P4A A;  2Z5U A;  2LDU A;  4LLL A;  1JXS A;  2ZKZ A;  1XGO A;  1YYV A;  2W24 A;  1YS7 A;  1R23 A;  2XAH A;  4UV8 A;  2VOP A;  2W85 A;  2HQR A;  2VBW A;  5DYM A;  2PG4 A;  5BPD A;  1MJB A;  5FFZ A;  1U5T A;  4KN7 X;  3CO6 C;  2FEZ A;  1R5G A;  1RIO H;  2P6S A;  3IC7 A;  1P6R A;  2EV0 A;  5L3F A;  4FX0 A;  1ZAO A;  1T38 A;  5TRD A;  2MLG A;  2HOE A;  1TNT A;  5K5O A;  3O3K A;  1W4M A;  4ESF A;  4BNC A;  3ZMT A;  4L9J A;  3NQO A;  3D5L A;  5LRS A;  1SD4 A;  3PQK A;  2IVM A;  4HX7 A;  3ABT A;  4I0A A;  3Q5F A;  4A6D A;  4HX4 A;  4ZYH A;  3G73 A;  4UVB A;  3MFK A;  2V1U A;  3J81 Z;  1YFH A;  4I01 A;  3QPT A;  1AWC A;  3HRT A;  5D8L B;  2OAZ A;  1FSE A;  4EM1 A;  3DFG A;  2NNY A;  3I59 B;  4Y15 A;  2RN7 A;  3V8J A;  4KUM A;  4BQA A;  5J8F A;  2L4M A;  5CJ9 A;  4OMZ A;  3JW4 A;  3DV8 A;  2OZU A;  1MD0 A;  5ED4 A;  2KIM A;  5HS8 A;  3WTZ A;  1KU2 A;  1H0M A;  3F6O A;  2P8T A;  3DKW A;  1YG2 A;  3HYI A;  1ZN2 A;  3E6B A;  3R0J A;  1D3Y A;  3QP6 A;  3LFK A;  3OV8 A;  4HF0 A;  2ESH A;  2VC0 A;  2P6T A;  1XMA A;  3E3V A;  3FXR A;  2ZBK A;  2FML A;  2DK8 A;  5FGM A;  1S7O A;  4JQF A;  5H20 A;  3P9K A;  1FY7 A;  4A12 A;  3ZMV A;  2FNA A;  1BBY A;  4IF4 A;  1BIA A;  1DPU A;  5DEQ A;  1E17 A;  3KE2 A;  3HRS A;  1S8N A;  1EV7 A;  2XAS A;  1EH8 A;  3WE3 A;  5HOO A;  5FO5 A;  5BQT A;  5ILU A;  1T0F A;  4EJV A;  4O5V A;  2YX4 A;  3C3W A;  3WTY C;  5AON A;  1B6A A;  4KIF A;  4WK8 F;  5FFX A;  1G3W A;  5CYV A;  3RKX A;  3M1E A;  2BEO A;  3J80 K;  4XRF A;  2H09 A;  1TBX A;  1PP7 U;  3WE2 A;  4D0P A;  2M8E A;  4HDU A;  3KCC A;  4O3M A;  3TGN A;  2OZ6 A;  2HGC A;  1J75 A;  1OYW A;  4WWC A;  1GVJ A;  2CGP A;  3C1D A;  1OKR A;  4L5I A;  5DV5 A;  4IJA A;  2Q8K A;  2QYO A;  3KEO A;  4LK0 F;  3CUQ C;  1XDS A;  3FM5 A;  1R58 A;  1J2X A;  1KA8 A;  3M8E A;  4KA4 A;  2RVC A;  3E6D A;  2WWY A;  2Z3Y A;  4M9S A;  2RQP A;  1BN5 A;  3EQL F;  5HVQ C;  1ZLK A;  1HKT A;  3HHH A;  4UXN A;  4M72 A;  4E70 A;  1YS6 A;  3QOP A;  3O2P E;  3BPV A;  4UHT A;  3HIF A;  4UUV A;  1QZY A;  1XSV A;  2DW4 A;  4DNC A;  3DPL C;  2LF8 A;  1IN7 A;  2DLL A;  5CVJ A;  4R79 A;  4Q48 A;  3KZY A;  3T5X A;  4EQQ A;  2V9V A;  1HQC A;  3IL2 A;  1U5T B;  3N4M A;  2EFO A;  1FLI A;  1O7L A;  3V7S A;  1YO5 C;  1T39 A;  3WTU C;  1LVA A;  3GX4 X;  4XBF A;  1LDJ A;  5ILV A;  3F23 A;  5HDN A;  2HYG D;  1LJ9 A;  1STZ A;  2K7L A;  2ZNZ A;  3IRQ A;  3IKV A;  3VFZ A;  3ZP5 A;  3J81 K;  2TDX A;  1WKM A;  4FT8 A;  2GXG A;  5DCM A;  2ADU A;  1XCV A;  1Z7U A;  2BBY A;  5EEG A;  2A3S A;  4HF2 A;  1K78 A;  5FLX Z;  3GVA A;  3QU6 A;  2P7V B;  3WTV C;  4IRG A;  2QUF A;  3ZMU A;  4RB1 A;  3RPQ A;  3CTA A;  2ESN A;  3GFI A;  2PBI A;  3HRM A;  4L18 B;  1UCR A;  4B8X A;  3LAP A;  2XRN A;  3HSE A;  3LAJ A;  2MH9 A;  2GQQ A;  2OBP A;  3R60 A;  3F8B A;  3I64 A;  1TTY A;  2LF7 A;  5HS7 A;  3Q9V A;  1YW8 A;  2MH2 A;  3T8R A;  5D6F A;  5E17 F;  2VT3 A;  5LRR A;  1FYK A;  1UHM A;  3KZZ A;  2L02 A;  2EFP A;  5H6R A;  3FM3 A;  1ZRD A;  4WF2 A;  3R4K A;  3WU0 A;  1I27 A;  1ZGJ A;  2RGV A;  2GA2 A;  3R0A A;  3WTT C;  1UHW A;  4HX8 A;  1HBX G;  4O6J A;  3HSR A;  5DCF A;  3L2C A;  4L9T A;  1IXS B;  1I1S A;  1IN8 A;  4GXO A;  2O8X A;  2OA4 A;  1TW3 A;  4RAY A;  1FX7 A;  1I1G A;  2DPU A;  2LKP A;  4A2U A;  3NEU A;  5J8C A;  1G3Y A;  4HA8 A;  1ZLJ A;  2X4H A;  3I4P A;  2XRO A;  1S29 A;  1OPC A;  4EJT A;  1TNS A;  3N97 A;  3RKW A;  1R1U A;  2IRF G;  3TO9 A;  5L3E A;  4AIH A;  2O6G E;  3FMQ A;  2MBF A;  5LGT A;  1XN7 A;  4WCG A;  1T2K A;  1PP8 F;  4AD9 A;  3TKY A;  4G9Y A;  4LD5 A;  5ERI A;  1R36 A;  3EET A;  4EJO A;  1F9N A;  2EWN A;  5H6Q A;  1Z91 A;  2V1X A;  4CGZ A;  1S3J A;  5K5Q A;  5D5X B;  3V8L A;  1ZRF A;  3LQQ A;  3CUO A;  4HLX A;  2F5F A;  2HYF A;  1ZRE A;  1GHC A;  2RDP A;  4RGS A;  4L0Y B;  3ECO A;  3L09 A;  3RIR A;  3CUQ A;  4Q4Z F;  2QZ8 A;  1H9T A;  5KK1 A;  2KKO A;  4ASN A;  2IJL A;  2QQA A;  4A6E A;  2K4J A;  4HQM A;  3B73 A;  4Z2Y A;  2EA2 A;  1B59 A;  1IW7 F;  4QWQ A;  5CVI A;  3TOA A;  4YFX F;  2G7U A;  4HW0 A;  3BDD A;  1BI1 A;  3MZY A;  1ZAR A;  1UFM A;  3P9I A;  3M8F A;  2YX7 A;  4CYD A;  4G7Z F;  3LST A;  3MQ0 A;  5LHG A;  4NB5 A;  2XKO A;  1R5H A;  5IT3 A;  3QU3 A;  1IRG A;  4KMF A;  1O3T A;  3M7G A;  2E7W A;  1WQ2 A;  3WTS C;  1PUE E;  1F4K A;  3ZN0 A;  2H27 A;  3PQJ A;  4U0Y A;  2ACJ A;  5E8I A;  4EGZ A;  1W5T A;  1RUN A;  4OMY A;  5FLX K;  2W25 A;  3E5Q A;  4DQ2 A;  1YIO A;  4M71 A;  5D4S A;  1ZG5 A;  4A5M A;  1KU3 A;  3RTR A;  3LWF A;  4OIR F;  4ZYD A;  5FB2 A;  3ZMS A;  1DDN A;  2ZFW A;  5JVT A;  3E5U A;  5DCM B;  1BI0 A;  4G8X A;  4P5O A;  3HTU A;  1X3U A;  1XGN A;  1K78 B;  4KNY A;  3L7W A;  4HYE A;  3D0S A;  2ZCW A;  1WRJ A;  1XGM A;  3RJP A;  1QQI A;  1KU7 A;  4ENJ A;  2Q2E A;  4KT5 C;  5DUI A;  3M9A A;  2A6H F;  1ODD A;  2A07 F;  3KP2 A;  2Z99 A;  4OU0 A;  4XSX F;  4L0Z B;  2HTJ A;  2ETH A;  2E7X A;  3SZP A;  4IHT A;  2H6C A;  1YLF A;  4IRI A;  2DQL A;  4EVI A;  2F2E A;  4P9U A;  5HLI A;  3SXY A;  1K6O A;  2R3S A;  3KP4 A;  1IN6 A;  3WGG A;  1F5T A;  1XDU A;  2GIV A;  1BC7 C;  2CW0 F;  4PGH A;  2IP2 A;  1Q1H A;  4Y17 A;  2IT0 A;  2M87 A;  2MC3 A;  2XVC A;  2VC1 A;  4AWX B;  3ZN1 A;  2P5K A;  3C18 A;  1MJ9 A;  1IN4 A;  2V6C A;  4U7B A;  2J5O A;  4ZH4 F;  4WXD A;  2Z9O A;  4RGU A;  3EUH A;  3OOP A;  2K4B A;  1IRF A;  4A5N A;  4XLP F;  2RKH A;  1IF1 A;  2M1B A;  2A6E F;  2PN6 A;  2ZJ2 A;  3ECH A;  3U1D A;  2L4A A;  4L9V A;  1U6G A;  3MWM A;  3I53 A;  3K69 A;  4LMY A;  1G3S A;  2EFW A;  2PJP A;  1J59 A;  2PFB A;  4CDG A;  2WTE A;  3WU1 B;  4RS8 A;  1W7P A;  1R7J A;  2KRF A;  3GWZ A;  4L9N A;  1W5S A;  1FYM A;  2PLY A;  3MAJ A;  1FNN A;  1FBU A;  1LNW A;  3JAM Z;  3CUQ B;  4XLN F;  2P5L C;  1L0O C;  2FU4 A;  3GEZ A;  3FWE A;  2YSR A;  3CDH A;  1NHA A;  3MCZ A;  3DP7 A;  2ISY A;  1SFU A;  5BOX A;  2CWE A;  1DP7 P;  3V8K A;  1Z9C A;  3E97 A;  2H6B A;  4AIK A;  5DDG A;  5HDK A;  4PDK A;  2G9W A;  2ELH A;  2DPD A;  4MQV A;  4CHU A;  4L5J A;  4BH9 A;  1OYI A;  2Y0M A;  3V4G A;  1U78 A;  2O03 A;  3H3Z A;  3IKT A;  2DK5 A;  5F1R A;  3V7R A;  4HAM A;  1R00 A;  3QRF F;  2KJB A;  1SD6 A;  3HUG A;  1UB9 A;  1SAX A;  2ZXJ A;  3IWZ A;  1YW7 A;  2Z33 A;  4I98 B;  3BJA A;  2FSW A;  1V3F A;  4UVA A;  1OMI A;  1YQA A;  4M73 A;  3K9T A;  2QQB A;  3GF2 A;  5LGN A;  5J6X A;  3QPH A;  2JSC A;  1XD7 A;  5A2Q Z;  1O3S A;  2Y75 A;  3KLO A;  1KQ8 A;  2M45 A;  2C6Y A;  2JRT A;  3G3Z A;  3ZQ7 A;  5LBQ A;  4YG2 F;  2XAQ A;  2COM A;  1O7F A;  4MEY F;  3KFW X;  2PEX A;  2A61 A;  5TJJ A;  3HOS A;  5CVV A;  3FHZ A;  3RYR A;  1OYY A;  4NQW A;  2STT A;  2JTV A;  2JZY A;  4HV6 A;  1T6S A;  1G6N A;  3H3U A;  1WSU A;  2ISZ A;  2VE8 A;  2OU2 A;  1YW9 A;  4RAZ A;  2FNP A;  3MZH A;  2PMU A;  4G6Q A;  2HZT A;  2CG4 A;  2CYY A;  5AIQ A;  2L01 A;  5AIP A;  1IZ1 A;  3ZPL A;  3DF8 A;  1Z1D A;  4KIB A;  1P4W A;  1XGS A;  3COA C;  5D6E A;  3GFL A;  2H94 A;  1KU9 A;  4U7D A;  3JTH A;  3PFI A;  1J9I A;  2DU9 A;  3TDU C;  1U8R A;  3E6C C;  1REP C;  1BC8 C;  1FSH A;  1T98 A;  3KP6 A;  1I6X A;  1L3L A;  3JTG A;  1RNL A;  2WC2 A;  5ILS A;  5K5R A;  2UZK A;  3LQR A;  2VBX A;  2EJR A;  1HKQ A;  3SFZ A;  1FYL A;  2HDC A;  1AOY A;  1JHH A;  2W57 A;  2IA2 A;  5D4R A;  2K27 A;  4U0V A;  1D5V A;  2DBB A;  3KP7 A;  2YPR A;  4MQ9 F;  2B0L A;  2ZME A;  4EJU A;  1FBQ A;  1SD7 A;  2D2W A;  1LDK B;  2KJC A;  4JBA A;  3WGI A;  5JHU A;  1IUY A;  3C7J A;  4M9X A;  2VXZ A;  1UST A;  4XSZ F;  4Q5S F;  5JFR A;  1BI3 A;  2DQR A;  4U0W A;  2DAO A;  4MNU A;  1I5Z A;  4EM0 B;  4K2E A;  1RUO A;  3JSP A;  4Q47 A;  2VOD A;  1BJA A;  3E5X A;  2EFN A;  4S04 A;  4ESB A;  3JAM K;  1H9G A;  2FOK A;  3CO7 C;  1TQI A;  2CFX A;  3GUD A;  5HS9 A;  3EYI A;  3GYH X;  5CLS A;  2GAU A;  1WWX A;  5FD6 A;  2XUB A;  1W7P B;  4UVC A;  3KP5 A;  4UV9 A;  1ZRC A;  2KIF A;  5F64 A;  2D1H A;  4BAY A;  1XB4 A;  5HLH A;  2CQK A;  4ENN A;  2JPB A;  3TQN A;  1JHF A;  2F5C A;  2GA1 A;  1LB2 A;  3TO7 A;  3TO6 A;  3GFJ A;  5HLG A;  1Z05 A;  2K86 A;  5BMZ A;  4KFC A;  1FP2 A;  3IRR A;  2AXL A;  1ZHF A;  5JI6 A;  2FE3 A;  3IWF A;  3FXQ A;  1S7A A;  4HOB A;  4GCV A;  2HWV A;  5D5V B;  1MGT A;  3K1P A;  1B9M A;  1CF7 A;  3V7C A;  1QPM A;  2HTS A;  1ON2 A;  3GZ6 A;  1PDN C;  4EGY A;  1GXP A;  5A2Q K;  1B4A A;  1R22 A;  4RGR A;  2PQ8 A;  3GFM A;  2EK5 A;  5BS6 A;  2F5E A;  2QBY A;  4S05 A;  1SMY F;  1LDD A;  2IA0 A;  4BHP A;  2R7F A;  2DT5 A;  1YTY A;  4YIF A;  1MKM A;  2NYX A;  5L3D A;  5E1W A;  1G4D A;  1HW5 A;  2BGC A;  2STW A;  1EH7 A;  2BV6 A;  3DXJ F;  2E1N A;  2RC4 A;  2NNN A;  5E8G A;  1D8K A;  3WG9 A;  1DPR A;  3DPT A;  1XMK A;  4BYY A;  3QP5 A;  4WXH A;  1QBJ A;  5JR3 A;  2A69 F;  2NS0 A;  1RZ4 A;  1QZZ A;  3CJN A;  3KLN A;  1HXD A;  3MEX A;  1MDM A;  1IAW A;  1MZB A;  2P4W A;  1XSD A;  1IXR C;  3VEP A;  1LQ1 A;  1KGS A;  2XAJ A;  4LB5 A;  2O0Y A;  1SMT A;  2VN2 A;  2P5V A;  3BJ6 A;  2L3D A;  1FPQ A;  3L9F A;  2MLK A;  2M30 A;  5FD5 A;  2GZW A;  2PI0 A;  2VT2 A;  1ZYR F;  1FP1 D;  3F8M A;  2QEN A;  4YFK F;  1HW2 A;  4MTE A;  3REO A;  4HZF A;  4IRH A;  1SFE A;  4OIN F;  3F3X A;  4G94 A;  2XAG A;  2VBZ A;  3ML6 A;  3VB2 A;  4ENM A;  4LGW A;  3SQN A;  1KQ9 A;  1J5Y A;  3I5U A;  3ZMZ A;  3EYY A;  3RPU A;  3ISP A;  3I54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...