2D31A

Crystal structure of disulfide-linked hla-g dimer
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
274
structure length
269
Chain Sequence
GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGEPLMLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, alpha chain G
publication title Efficient Leukocyte Ig-like Receptor Signaling and Crystal Structure of Disulfide-linked HLA-G Dimer
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/cell cycle
total genus 63
structure length 269
sequence length 274
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2d31A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2d31A01
1T1ZB 3QXTA 4MQ7B 1QKZL 1CG9A 2DLTA 3UZVB 2MPAL 1OGAB 1T20B 3G5XA 1IAOA 2GW5A 1I1RA 5J89A 4GRWE 5SWZD 3P11L 4APQB 3RWFB 2LTQC 1A6TB 3SE4A 1E0OB 5E1AA 5IW6A 2EH7H 3I50L 1NMBH 3MRIB 3PHQA 5IGXH 1KCUH 3KR3H 3Q6FA 3DVGA 3O0RH 5C8JA 5EIVA 1NGYB 2V2WA 5D2NA 3BKCL 2A6JA 3H9SD 4JZJC 5IEHA 1INEH 2NZ9D 4TOYH 1DLHA 3B5GA 4DUWA 3V5KA 3TGXA 5EA0L 2IAMC 1VFBB 4FQ2H 4K9EL 5DUML 4YHNB 3N50A 1RIHH 2LU3A 3CDFA 3JWNC 1BF8A 3G9AB 3QG6A 1RZJC 3QHFL 1D9KA 1CGSL 3VFGH 4UUJB 2EH8H 5FYJD 4PJXB 4DGIL 2GK0A 4MB5A 3S7GA 1TLKA 3W9DA 2DJSA 1CLYH 1N4XL 5FECB 4X9BA 1HIML 4CN4A 2BVOA 4LVOB 4N1HB 5INDB 5ISZA 2BSED 3QJFB 5FKAB 5DTFA 4OV5A 4UILL 5I2IB 3R0MA 2CR6A 1N26A 1JPTH 4XB7A 3GB7A 3WL9A 4MA3A 2VDPL 3RKDD 1XT5A 3JTSA 3L7EA 1VA9A 2ARJQ 2VLMD 1XIWD 1ZVHA 2HWZL 3BDYL 1K4CA 2H8PA 4L3ED 3MLZH 5DHXB 2BERA 3GSQA 1OSZA 3WE6B 5JNYA 4NRXA 1F4WH 5HDBE 2XG4A 4NSKA 1IGCH 1DEEB 3VRIB 3ZL4H 4K3EH 1WT5C 2F5BH 4M93C 5DO2D 3MROB 5HI5D 3V9FA 4XC3L 4G8IA 1JGLL 3DMMD 3TCLA 1A6WL 1QO3A 2CIIA 3CC5B 3SBWA 4GG6A 2B1HH 1RHHB 4PBVC 1MOEA 1GZPA 5F1NA 4Y5YA 5HDQL 4NHCL 4JRWA 3S37H 3NFNA 5FFLA 3IDYC 4NCC1 5E1HB 4C83B 5GGQH 4D94A 1HCFX 3NBNA 4J23A 1T80A 1AR1D 1NJ9A 1ND0B 2AJVH 3MRDA 4YUEL 2JCCE 2ZUTA 1UM4L 5L8KB 3F6IA 4BUGA 1NFKA 3LHPL 2HN7B 1QSVA 4H8WH 1RUPH 4FFVD 3I6KB 4GW1B 1I8LA 5ENWA 2HT3D 1S5IL 4TRPL 4XHQA 1P84J 4KZEH 5IBUG 5EZIL 5HJ3A 3U7YL 2Q7YB 5F93C 1SQ2N 3T0XA 2NTFA 2OQJB 1ZKAA 4QHKI 3NCJL 3ZTJG 4Y4HC 2HT4D 3IU3B 3HHRB 4JAMA 25C8L 3L3GB 2BXZA 1UA6L 3S36L 4OCSH 4AZ8A 3RY5A 1ZLVH 3DX9A 5J11C 1X44A 1H15B 4OF3A 4EI5B 1B4JL 4UIMA 3MREB 5IMOA 5D7JC 4XP1L 4MA8L 3BIAX 1HZHH 3WXVL 3TH3T 5DRZA 3GMPA 4LHUG 4DEPC 5HVHC 5CCKH 4WW2B 4ISVB 4YFEA 2UYLB 3CSYB 5FDWB 2IH3A 3PGDB 4HXBL 3NIGE 1UKSA 1UACL 2DQGH 4IMKA 1T5WA 1GZQA 1KG0B 4NNXA 2ZUQC 2DQDH 3T0BA 3ZMRA 3HR6A 4WW1B 1DN0A 1K5NA 1M4KA 3OKMB 3QIBD 1MRFL 1OW0C 4P4RA 3C9NA 4X6EA 4L8DB 4M5YL 4Z18A 2IAMD 5T3XD 4YEFA 2A38A 4Q9RH 4GAGL 5EUOE 4NZUH 4NNYA 1FO0A 1Q0YH 1C5DB 2NY1C 3EKCA 5DR5L 4LSQL 1X6LA 1NL0H 4H5SA 2OI9C 5F7MC 2YD7A 1TMCB 4TUOA 5KSAD 2VUOA 3R8BB 4EIGB 3S36X 5CJQL 3JXAA 4NQVA 4XVTH 4M1CC 5HGAA 5F8QC 1KB9K 4OIAA 1LEIB 4YFLI 3D0LB 4LRIC 1CFVL 2R2BB 1T1YA 2EE9A 1KTKE 2MQ0A 5C0RL 4HFWA 2YWZA 4UU9A 3L3JB 2X4OB 5TGBB 4TULL 1DBBL 1REIA 1B88A 2PYED 3NN8A 5JXAL 4Q0XH 5MI0B 4GRMB 3H42H 3NIDF 3MODH 4G8GA 1T7XA 1RVFL 4NDMA 4ZUTA 1IC4L 3OQ3B 1S7TA 4LU5L 4KRPB 5FA3B 1C5BH 3FKUS 3SO3B 4BQ6A 1AI1H 3HE7C 4HKJB 4KKAD 2YZ8A 5D1QC 2L0DA 3SOBH 1G0DA 4P2OA 4OF7A 5F97E 5IVXA 1BBDH 2GJ6A 3VRJB 4JDZA 3MGOB 1NLBH 3BVNB 3VJ6B 4JY5L 1MFDH 4J8RA 1YEDA 4J6RH 3EOTH 1OPGH 4LSPL 3DXAD 1HE7A 1MCOL 4LSVH 5IQ7H 1AGFB 3P73A 4OTXL 4LF3A 1HHJB 3CFDA 1CR9H 4P46B 1XGUB 1NAMH 3SJVB 1IGML 3O45A 4IOFD 4OAWA 3TYFB 1BBJB 1O7VA 3PWNA 1ZLUH 3ROLA 5GRYA 3QUYB 4YH6A 3V0WH 4MXQA 2NY2C 5I1EL 4I2XB 3ZKMD 1KBGH 5TQ2H 2DKUA 2GFBA 4HCRL 1Y6KR 1PJ9A 2IC2A 5FYJU 4JPKH 5IMKB 1HILB 5L9DH 5I8OH 4PJBE 2FYYA 2H45A 4PS4H 2Y06L 1BP3B 4RGMC 4OLEA 2Y5TB 3BP4B 4Y4HD 3UTSA 2YKLL 3H9HA 4WO4D 4M1DH 4LP4A 4XWOD 5H94B 5DJ0B 3I6GB 4B7LA 1EBPA 4PRNA 4F9PA 4IRSC 4GBXB 4HAGA 3VD3A 1F4YL 5EOTB 5CZKA 3GMMB 3A6BL 1QKZH 2H6PA 4OM0L 1NCTA 3MNWA 5DWUL 4OZHB 1S7VB 2MPAH 3TIEB 4FTVB 4HWZB 3RRQA 2EYSB 1K3IA 3U7WL 1WISA 4G80A 2P7TB 2VABA 4PGBA 1JPGA 4U1LA 3P11H 3NFSL 3CVHL 2GTZB 2OLDA 3VFMB 1WBZB 4P4KB 1JPST 1SM3L 3I50H 3DO7A 3KPOB 5C86A 2X1QA 3ZLQC 3U79A 5GGRA 2JJSA 4DVBB 2VWEC 4K3HA 3BKCH 4G9DB 2FGWL 4WTZA 2P1YA 1D5MB 2IANB 3MZTA 2R23B 1BQLL 5C0JA 4ETYA 2A73B 3BGFB 3ZT5A 2EDRA 3P40A 5JA9A 5EA0H 3N9GL 1FV1B 4K9EH 5DUMH 1ES0B 1QA9A 2NY1D 3NZ8B 2C5DC 3NIFF 5F7LB 5KOVC 2VSDA 4KROB 4HUXB 1T4KB 3QHFH 1F58L 3F7PC 5HDLA 3RNQB 1CGSH 1CFNB 3REVB 4TVPD 1ZGLP 2AJSL 2W07A 4HKXA 5HHOD 4DGIH 1Z0NA 3ILPB 1RURL 2IQAA 1GGIL 2OCFD 1N4XH 5DRWB 2R0LL 3VDBA 1DANT 2OL3B 2DDQL 2OR8A 1HIMH 3D5OF 2PO6D 1FZKA 1RUAL 4OZGE 2R1WB 2Y23A 3I2CL 4RWHA 1SEBA 4UILH 5ID0B 4R4BB 4XPAL 3I3EA 4V1DE 3DRTA 3VXOB 1WK0A 2VDPH 3ZHDA 2BVPA 2G2RB 2JIXB 1UG9A 4NPYA 4UTAL 32C2B 4FFWD 1GRWA 1F2XK 1A1OB 3EDDA 1NEZA 4EUPA 3MUGA 3PG2A 2HWZH 3GK8L 1NAKL 3VXMD 3BDYH 3GKZA 4GRWH 3PL6A 2BMKA 5D1QD 4MX7A 5CIPH 3ECBA 3DHJA 1KJMB 2RJMA 5CBEA 1OAKL 1E28B 4WFHD 2KDGA 2BOBA 1ZGLA 3FQRB 4HIEA 1DDHA 4HQQL 5CEXB 4GKSA 4XC3H 5E9DD 1JGLH 4P3DB 2JF1A 1A6WH 2E9IA 5B38A 3DV6A 4Y19D 4NWTL 3ES6B 3VE0B 4LIQE 5DC4B 4G9FD 4U1IB 5D1ZA 2PETA 2LAGB 2VAAA 5HDQH 5EIIA 4KQ3L 4NHCH 2VLJE 3T3MF 4RMVA 5C70A 3RTQD 1OTUD 3L7FA 5LAXA 1NGQL 3RWJA 4MJ5A 4KWUA 4OKVA 3WD5L 3AVEA 4YUEH 3W0WD 1ZHNA 1EEQA 4F7MB 1UM4H 1NCAL 1P53A 5D72L 4CADB 4OCNC 4PR5B 5DURD 3CDGA 5JPMA 1U8JA 3QRFM 2NW3A 2PXYC 4HUVB 4LCUB 4N0RA 1CDCA 3LHPH 1RSFA 3BRGC 1IEBA 1U91A 2WSKA 1IVLA 2ORBL 1S5IH 2DIBA 4TRPH 3S3SA 5EIQA 4MB3A 3KYNA 4PJIB 2E7HA 5EZIH 5JW5A 3U7YH 2SEBB 4NKOA 5C09B 3GMRB 3PV7A 5H35B 2AERT 4UDTB 3T1FB 3NCJH 5CEZD 25C8H 1TVHB 5LGJA 1UA6H 4GSDL 3S36H 1A7RL 2W9DL 4P5TC 3IJHA 2VZOA 4IRSD 1B4JH 2J8OA 1FSKB 2DLIA 3IVKB 1DSFL 3KYMA 4P57A 4XP1H 4MA8H 3QDAA 3HC4L 3WXVH 1JI2A 4OQTA 2XTJB 2KZ1B 3BSZL 3AXLA 4HLZG 4RFEB 3PWJA 3OJDA 1FYTB 2DWDA 5HYIA 1U8KA 3WIFA 1OSPL 5FCUL 4RRPA 5L8JB 4HXBH 5SX4I 2ARJB 4N8VG 4JFDB 3FRPA 1UACH 5IVZB 3QQ3A 1KCSL 4X6DF 5TPWL 3GSRA 1U8IB 5H37H 5GGUA 1D6EB 3K46A 5EU5A 3AU1B 1ZHLB 4JGJA 3QAZB 3BH9A 3EFDL 3B2UD 3QEHB 3QDME 1MRFH 4JQXC 5AUMB 5F88A 2C4FT 4M5YH 1EEYA 4U1HA 4W81A 1FQ9C 4KJWD 2EICA 5IFJB 5EO9B 3LKPB 4GAGH 4M62L 3ISWA 2X4UA 1TTFA 1I7TA 1FC2D 4GG6F 1KNOB 5DR5H 4LSQH 2GSGA 5BVJA 1ZT7B 3H0TB 2HRPL 4PGZA 4W4NA 1J0ZA 1KIQA 4AENA 4DCQB 3AS1A 4UQ3B 3BYYA 3C5ZC 5AZEL 5C0BA 5CJQH 4Q74A 1UWEL 2YPKB 1OAQL 1Q94A 4L4TE 3P4LA 1XGPB 1CFVH 1WCBA 2ZSVA 2BNRB 5HPMB 2AP2A 4Z5RA 5C0RH 1LEGB 4X5WA 1SHMA 2OJEB 1D5ZA 2NY0B 5E5MA 4HK0B 1Q38A 2EIBA 4TULH 1DBBH 1FNAA 2D31B 4HDIB 1FZJB 4ODWA 1OGAE 2X2YA 2XWJB 4LVHC 5JXAH 4ZFZA 4JJHA 2F54B 1IQWL 1RVFH 3WLBA 4F3FB 3B9KB 2GITA 3QNXB 3MLTB 4YDVB 1IC4H 4OFDA 4LU5H 2VQ1A 5F72S 3L3IB 2A9NL 4OLXL 2D03L 5IIEA 1D5XB 4X7DC 1AH1A 35C8L 3G6DL 3PQYD 3NH7L 2Z4QB 2FEEL 1U8OB 2P49B 4KUCD 3WNOA 2OM5A 1OQXA 1YN6A 1NLDL 3QUXB 3TBWA 4JY5H 4WV1A 4LSPH 2OX5A 2DICA 1IILE 1HHHB 3JUYA 1MCOH 4MSWB 3IFPB 3MFFB 4P2RB 4OTXH 1Q9OB 3S3JA 4CVXA 2LVCA 4HUUA 3O3EB 4CMMB 4DZ8A 4HKBB 4CMHC 2W9EL 1WTLA 3C5SA 5JOPE 1IGMH 2EEBA 4QT5A 4KVNL 3FO0L 4BK5A 3QH3B 5IMMA 2PXYD 4PJXE 4O2FB 5C6PB 1KGCD 3VXTA 5DDHB 3S96A 5IQ9A 3FAWA 3WBDA 5I1EH 3MBEC 4WEMB 4BQCA 2ICWA 3AS0A 1FVDB 1OB1A 4HCRH 3T3PE 1RAMA 5EO0B 4CDGC 1UEMA 5LG1A 3FB7A 2Y06H 4KGJA 4V2CB 1CDGA 3X12A 4CNIB 5D96C 1YQVL 1YPZA 4KDTA 2YKLH 4OSUL 4P5TD 1V7NL 3VGGA 5J1TC 3LN4A 5KN5B 4OQ1A 1QVOB 1JV5A 2UWEA 2PTTA 1F4YH 2BRRL 1GPOL 3IDIA 5F9DC 3A6BH 5FYKD 5T33L 1I3GL 5EBWA 4O2CA 4OM0H 2CR3A 1NUNB 5DWUH 5I75C 4NQSA 4YHPB 4PYGA 3U7WH 1ZLWK 1EZVX 1JUFB 1NUFA 3LKRA 4MXVE 3NFSH 3CVHH 3WHE0 5FYLD 5GJSL 3DUSB 2EDQA 5BQ7A 1H3WM 3VFPB 1SM3H 3EZJB 4MZ2A 1CICB 4FABL 2CMRL 1XCTA 5F96L 4I5BB 2VYRE 3AUVA 1EXUB 1Z9SA 1KIPB 4OFPA 2FGWH 5E2WL 2DLEA 2X40A 1IQDA 3CH8A 4UQ2A 5LBSL 1BQLH 3HG1D 4QHNA 1P6FA 1ZS8B 2NXZC 4HGMA 4QCIB 3BO8A 4OB5L 5CLWA 3N9GH 3LKSB 3O41A 1QLFB 5ACZB 5JXEC 3A0OA 5F7YC 4ZMAT 4E5XA 4YPJA 4MS8A 3BEWA 5E8PA 5ESQB 4OUUB 3U30B 3X11B 2X1WL 2IPUG 5MEOA 2AJSH 3C5ZD 3SE3A 2Z8RA 1OWRM 1RURH 1GGIH 3LH2L 2W9LA 2XNAB 3DYOA 1BD2D 2R0LH 4EQ3A 2DDQH 1MH5A 1MCLA 5J06A 2WINB 5FUZH 3MNVB 1RUAH 5B39A 3SDXB 3I2CH 2X1PA 2YSSB 1KYOK 4NM8L 4NO3B 2LE9A 3PWLA 4XPAH 2FJGA 2YEZA 3L5WB 5TH2A 1GIGL 1U8QA 3LSOA 4PFEA 4UTAH 5FO8A 2NW2B 3MACL 1UM5L 2Q8AL 1I1AB 3CAFA 2CLRA 2EEDA 3RWHB 3TBSB 3QA3A 3MRRA 3GK8H 5I74C 1NAKH 5C0CA 4NC2B 4NQEB 4PJAA 1VSCA 2P24B 1BAFL 1H3UA 4XNYL 5T5FL 5GGSB 5D5MF 2X41A 3K3QA 2DM2A 1JYNA 1FLRL 2EEAA 1OAKH 1I7ZB 3GSWA 3I3DA 4ZODA 4X7EC 5CMAB 4ODHL 2HVJB 3E2HC 3HLAA 4HQQH 3I85A 4KI1A 4U49A 4LDEB 5D93B 1HH6B 3SKUD 2P5WD 4GLRH 4KRNA 4NWTH 5MEQA 3LQZB 2OZ4L 4Y1AD 2FHFA 4KQ3H 5KANG 1AO7B 5FK9B 3FT4A 3SDAA 5DVNA 3RBGA 1NGQH 5J12B 4BFGA 3WD5H 2XQYG 2G9HB 3ARGC 1JCKA 3MC0A 3MUJA 3ARYA 3QB7C 1NCAH 5D72H 3O6ML 1EPFA 5TF1L 3GM0A 3G5YB 1A9EB 1UKQA 3JTCA 5JZ7C 2ORBH 3IKCA 2VLLB 3AM8C 4P3WA 1K6QL 2V2XB 1CDIA 4QHLB 3AB0B 1AP2B 4UDUB 4DFHA 2L4OA 4GSDH 1A7RH 2W9DH 5DRNA 5F7HA 5KSVB 5SWZB 4JCLA 2EDNA 2GI7A 3UCRA 3WLWC 2ZOLB 1DSFH 3D85D 5DJZB 1VFAB 3HC4H 2UUDH 2FO4A 4X6CB 3GIVA 1M7DA 3F7YB 1AHWA 3BSZH 3O4OC 2DMCA 1G9NC 5I9QC 3H9SB 2Z31C 3RUGA 3ULUE 3KYKL 4JFEA 4PDCE 3GJFB 1OSPH 5FCUH 2X9XA 3UJIL 4Y5VC 3WO3B 2YN3A 1JFQL 4XCEA 1OAUL 1X4ZA 1N8ZA 1KCSH 5TPWH 1R5WB 4RIRA 1J7VR 2YK1L 3EFDH 5DHYB 1P1ZA 4LKXB 1HYRC 3RZCA 3SJVE 1HHGB 2OTPA 4TYUA 1AD9A 3UP1A 4AEFA 4M62H 3RWEB 2DI7A 4U1SB 3RIFF 3CXHK 4P5MA 1MVUA 3EO0B 5GGTA 5TJWK 4X9GA 3T1WA 5EU7E 4K2UL 4M00A 5FGSA 4AJ0A 3G04B 2C3XA 2HRPH 2VXQL 4QRUA 1KLFA 4HWBA 3AC0A 3LQMA 5EULV 5AZEH 1YNLL 2APWA 2DWEA 3Q3GA 1UWEH 1P5UA 1KCVL 4K07A 3JV6A 1OAQH 1M7IB 1S7QB 2GTWA 3STBA 3QI9C 4DGVL 4JQVA 5JLZA 4X0KA 1XIWB 1IGYB 4XVSL 4U1KB 2NXYC 3V5HB 4Q97A 4L3EB 1MELA 4M3JA 3SCMA 1MFNA 3RDTA 3FMGL 2BOCA 4OZHE 5F3HB 4ZO6A 2AAVA 4FTVE 1IQWH 2X1XR 4L29A 5IT2L 3NPSC 2JJVA 4GW4A 2VITB 2P4AB 2NZIA 4D3CL 4S2SB 4HWEL 4YPGB 2CQVA 3O3AA 5GS1C 3UBXB 2A9NH 1CCZA 4OLXH 3UPCA 4KXZI 3GSNA 2D03H 35C8H 3G6DH 3NH7H 5KW9L 3MQIA 3MJ9L 5C0IA 4NCDA 3C09C 2WWKO 4Z7VA 4R97C 1NLDH 5TDPA 1OP5H 2IANE 1EZVY 4MNHB 4TSCL 2CDFA 5BRZA 5TE4L 3IJYB 1CL7I 4L3AA 3PIQB 1RHFA 3DVNA 5D7LD 3VFUA 3O8XB 5KSUB 1ZT1A 4NUJA 4YBLC 2F53D 3GSNL 2V7HA 2W9EH 4ZUWB 4HD9A 1QSFD 4LEOB 3OKLA 1L7IL 4R0LB 1I7UB 4K8RL 4KVNH 1OCWL 3FO0H 1HI6A 3KPSE 5E4EC 4JFFD 5A16B 1KELL 3ZTJH 1BFSA 1JK8B 5JZ7D 1PFCA 4HGWA 5EC1A 2HJKA 3T65B 2H3NA 4N8VA 4WGWB 4R7DA 1T7YA 2W65A 3MO1B 4QHUB 5F6HJ 3INUL 3QPXL 5DYOB 1G7MA 3M1BA 1YQVH 4OSUH 1MI5D 5BMFL 3H3KA 1V7NH 4JRYD 4TUJB 2X4NB 5EU4A 3LB6D 4WU5B 4F33A 3WLWD 2LTQB 4UI2A 2Q76B 5ETUA 2BRRH 1GPOH 5T33H 1VFUA 1I3GH 4U2ZA 1L9MA 1PAMA 5DMIL 1A3LL 5IB4A 2DLFL 3ULSB 2Z31D 2EXWD 2YXMA 4JZJB 2VAJA 4NHUA 4RBPH 3EYFA 4R7NA 2F8OA 5L2KA 3QR2A 3IXTB 5D7IB 5GJSH 3LMJL 2IAMB 5L2JB 3KPSA 4XBPB 4FABH 2GHWB 4UBDC 2CMRH 4Q9CA 5F96H 1NGXB 1HSAB 3S8WA 4RDQF 3BKML 2IBGA 2PYFA 4M7ZC 5E2WH 3ILQC 5LBSH 5DJAB 2FZ3A 3WNMA 4EEEA 5JHDD 1OAYL 4OB5H 4OFIA 3PNWB 3V95A 4QNPE 1V5JA 3WFBL 5CEYB 1HSBB 2ENYA 2NPLX 2OL3L 5GXBB 2W0KA 1IAIL 3LKNA 4NFCA 4WHYH 4PJIE 3HE6A 2R4RL 3LQAL 3ALXA 1YA5A 5C09E 1RZIB 3NFPA 2D7MA 5IW1A 3LH2H 1NSNL 4F7TA 2XWBA 43C9B 2PYEB 3QEQA 3QI9D 4CJ1A 3IF1B 3BH8A 3BPCA 3FT3B 2FJHA 3T4YA 2APXA 4NM8H 3QQ4A 3FOMB 4RGNC 5IB5B 3K1KC 3RVXC 1DBAL 3THML 1DE4B 1BJ1J 4JO3L 1KCKA 1GIGH 2XTJE 4M93B 1KJ2A 2EE3A 4NKIL 3O4LD 4BYHA 1G6RA 4DJMA 2C3WA 3MACH 5C0AA 3UTOA 1UM5H 2Q8AH 3VCLA 1UJTA 3PHOA 1FYTE 1BHGA 3QDHA 1YPZF 4MQSB 2VTFA 2N7AA 2AJZB 3HUJA 1ZHBB 5TE6L 4C54A 5T5FH 1BAFH 4XNYH 1IAKB 1WVZA 1RULL 4K9EC 4U6YB 4JFDE 1FLRH 4M4PA 4OZFB 3IDYB 1CXIA 1R3LB 1CGYA 1NUGA 2E7LE 2UWEF 5IJKC 5J8OA 4ODHH 4J3VA 1U95B 1RK0B 4NNPL 1OT2A 4G6AD 4IRJA 3IT8D 5IB3B 2OZ4H 2IWGA 2NTSP 4NT6B 3PUCA 2BRQA 1GC1C 3WKML 1VKXB 3WUWA 4XRCA 3VH8B 3E6FA 5SWSD 3SDCA 3O6MH 1SBBA 4Y4HB 4M6AA 1MEXL 2EO1A 3P2TA 4Y4KA 5TF1H 1UEYA 1J0IA 2MHAA 3IDJA 3CZFA 4WO4B 5J11B 4C56A 1RMFL 3V6OA 3FZUC 1N2RB 3BX7C 3QXWA 3TZVA 5MENA 2B39A 1K8DA 4ZSOE 2BNRE 4OGZA 4KI5F 1G7JA 4NYLA 4XVUC 3KPPB 2VXTL 3KLHC 3QDJD 1JNHA 1K6QH 1MCWM 4PJFB 3U0PB 3U82B 5F9WB 3F7VB 4DEPB 5HVHB 1I3RB 3P9MB 2E7LA 1BJ8A 5HYJE 1MJUL 4F7PA 4R96B 2ESVE 2I25N 1YUHA 4JJ5B 2VOTA 4OFYD 1N6QL 3JVGA 2ZUQB 1AXSA 3W11C 4PRPD 4J1UA 4YNYB 4LMQI 5T5NG 3GFUA 3KYKH 4QY8A 2XZZA 2PW1A 2X4TB 3UJIH 1JFQH 2MNUA 1OAUH 1YEIL 4UBDD 2ATPB 4YFDB 2NY1B 4BH7A 4NBYB 4Y5YC 1NBZB 3MYZA 3RU8L 5B22A 2FIKA 2YK1H 3B6SA 4NZDA 9CGTA 4NO2B 3ILQD 2OI9B 1AIFB 4ZSOA 1P7KA 1QFWI 2G75A 2VIRA 1DQTA 5HHOB 1UZ6E 1GJIA 4D0CB 3V4PL 3AY4A 4LKCB 2B1AL 1AXTL 3WFDL 1A3RL 3HZYA 3QXDA 1RPQA 2GSIA 5HYJA 4G5ZL 4K2UH 5DEFB 1I8LC 2GT9B 4FXLA 4LCYA 2ESVA 5HSFA 1GOHA 4E41D 4RQQA 2VXQH 1FFOB 4AT6B 3OR7B 1TZHB 5EFIB 1YDPB 1YNLH 1IKFL 3MCKA 4G42B 4YX2L 2HFFA 2Y6SC 3CMOL 1LK2B 1KCVH 4ODVL 3GGWA 2G5BB 4DGVH 5DJDB 1K4DA 2WNGA 4U05A 4XVSH 3VXMB 3QFDB 3DI2B 2RCSL 3HE7B 3RVXD 1EGJL 3FQUB 5D1QB 1XGQA 5DQJA 4NQXA 3FMGH 3O6FA 1RJCA 5KZCD 4FQIL 5E9DB 5JDSA 5IT2H 1QUNA 3L5JA 4S0UC 5ICZB 1FL5B 4Y19B 1YY9C 1CD1A 2MMXA 5ILTL 3F5WA 3HFML 4D3CH 4HWEH 4NKMB 2F19L 3R06B 1FNEA 4G9FB 12E8L 4MJIE 1Z9OA 2XZAL 4IMKC 5C9KA 5B3NA 5KW9H 3MJ9H 1VESA 1I4FB 2COQA 3QIUA 1Z5LB 3TA3C 4OZFG 2B4CC 3D39A 3NMEA 2XKUA 4Y16A 1P4BL 4TSCH 5D6DA 3AGVA 3W0WB 3HAEB 1BVLB 5TE4H 5DURB 3ARXA 3PDOA 3RUGF 5F7UA 2H26A 5AD0B 4WTWA 3QNZB 3PWUB 4U7MA 3ZSSA 3GSNH 4RMUA 4IDJL 4YR6A 3RPIB 1D9KD 1RZKL 4OJFL 1N6VA 5LVEA 1L7IH 3KPLB 1OCWH 1DCLA 4RGMB 4PRIA 2ITDB 5E03A 1KELH 3D9AL 3MJGX 1J0KA 2XFXB 4ZYKA 3FZUD 2FSEA 5D9SB 5EZLA 5ISZD 1YMMA 2HKFL 3N1QC 2F74A 1A7NL 3JZ7A 3SDXE 1ZWIB 4IRSB 3OJMB 4XVUD 4HS3B 3KLHD 3VFRB 3WEXB 1FAIL 3INUH 3QPXH 4DZBA 5I66A 2BP3A 3C6LA 3FRUA 2X4SA 4X83A 4PJEB 3FONB 3OKKB 2AEQL 3BHBA 4MJIA 5BMFH 4JN1L 4LASL 3EZ8A 1T1WA 1KULA 3X14B 1V05A 4OBSA 5C6TL 4NQEE 3QWOA 4M7LT 4JY4B 2ADIA 1CFTA 4QYOA 4JANA 5DMIH 3ARWA 1A3LH 3DUUB 3QULB 1A9BA 4CW1A 2DLFH 4HX1A 4N9GB 2Y7QB 4P2OC 4ZTPL 4I77L 5C07B 1CGTA 3EDEA 3NCYS 3ARRA 4YWGL 1T22A 3LMJH 4GKNA 1BFVL 2C1PA 3F12B 3G08B 4OD1L 4CRPA 1AO7E 3TCXA 3BIKA 4K7FA 2BVQB 5F9JA 3BKMH 2E7CA 1MWAB 4I9WE 3U7AA 3U4EA 1ZEAL 4ZQKA 1OAYH 2HTLD 4JFHE 4Z7VF 5HGDA 2YPLA 3OAYK 4HUKB 3WFBH 1JTTA 3V6ZA 4MXQC 4FG6C 1ADQH 2DF3A 3F8UB 2OL3H 2ZUXA 3HPLA 4KK6C 1IAIH 2BFVL 4QHMA 1DQQB 2R4RH 3LQAH 3O11B 1SJEB 2YWYA 1FNHA 2Y6SD 1NSNH 4M3KB 4JHBA 5GZOD 4HXAL 4M9OA 4TTDC 3C8KA 2IPKB 3VXQB 4JN2A 1Z2KA 3DVIA 4HIIA 4XXDB 5JUEL 4HHAB 5SWZE 4KK8C 1CFSB 2VDNL 4F9PC 3UTQA 3LD8C 5IM7A 4EN3A 4OZ4A 1DBAH 3THMH 4NO0A 4X6CE 4JO3H 5EO1B 3PP4L 4NKIH 3PQYB 3QJHB 4MNQD 5GHWL 1QQDA 5IWLA 4QWWC 4KPHL 3H9SE 4JLRA 4HPYL 5CP7A 4EQ2A 1YY9D 3HR5A 1LNUA 4O2EA 5TE6H 1YNTB 1UKTA 1RULH 3DETC 4ZO9A 4FHBD 4JKPL 1F45A 4ZTOL 2AQ3A 4X5XA 2I9LA 2JJSC 1PDKA 3OG6B 2FX8L 1DQDL 3FQXB 4NNPH 3QFJA 3SQOL 5FYJE 2PXYB 4F7EA 4MD4A 3U36B 4MD5A 4OM1L 2KQMA 3ZE0E 3MMEB 3D2UA 1A14L 4LK4A 4O00A 1ONQB 4JVWA 1G7HA 3WKMH 4LQFL 3RGVC 4WJ5B 5K59F 4HC1L 1UWXK 5DI8A 5E5RB 1U8HB 3N0PB 4QRPD 1AXIB 1I1YB 2WWMD 2HLAB 5SWQA 1MEXH 4PPTA 1DQJB 1DUZA 1W0WA 4P5TB 4F57L 4JFYB 1RMFH 1YMHB 2VLME 3MR9B 4WHTB 2C3VA 1FAKT 5GPRA 3WFHA 4Z0XB 2VXTH 4RGOL 4L3EE 3QO1A 1QD0A 2XWTA 1G1CA 1FVEA 4GQ9L 2BNUA 4ZD3L 3CPLB 4JFXB 2MCPL 1NEUA 4G8GD 4NN5C 1CF8L 1DBKL 1MJUH 5HHQA 4FMKA 4HMCA 5EBLA 4CKVX 4HZLB 3R8QA 3U0TB 1IE5A 3VMOA 5I30L 4PJ5A 3PL6C 1N6QH 3BPNC 5DHVB 4PLJC 4DKAA 1J1OL 5JO5B 4DOHB 2EYRB 1F97A 5MERA 2GJ6D 4H20L 5KVEL 3L95B 3RIFK 3HG1B 3H7BB 5GRXG 1DFBL 5EU3B 1YEIH 5HDOA 2AXFB 5D1ZC 3RU8H 3S98A 3E3QE 3DOSA 5I1AB 3V4UL 1NC4B 1PKQA 4WFED 4Y4FA 4URTB 1FZOB 2PTVA 3C5ZB 1BX2B 3OKNA 1WBYA 3UPRB 3OR6B 3V4PH 5F71A 1BD2B 1MNUL 4U1JB 5AYUL 1C12A 4MXQD 1FG2A 1AXTH 2B1AH 3W9EB 1A3RH 3WFDH 5CKAA 4KK6D 2ADGA 1DBJL 3BEVA 3BESR 3WS3B 2IJ0C 5FGRA 2JB5L 1YJDC 4G5ZH 5JA8B 1H0DA 3DMMA 5DJ2A 3VFOB 4RX4A 1XAUA 4Z7UA 1OGTB 2A6KA 3VI3E 1T1XB 4PGDA 4FN0A 1P69B 3EYVB 1IKFH 2AVGA 4LVHB 4YX2H 2EDOA 1TCRA 3K81A 3CMOH 2D7QA 4GRWF 1Q72L 4ODVH 5HHVL 1U36A 3RVVC 3IDXL 1H5BA 1CZ8L 1IGJB 1ETZA 5DJXA 1AC0A 3QEUA 2RCSH 4M7JL 1EGJH 1KB9J 4RNRB 5IBLC 5BJTB 3FB5B 5F9AC 5IKCB 1EH9A 1KXTB 1T3FA 2PN5A 4QWWD 1R24B 4HK3J 4R4NC 3S35X 4FQIH 4F7CA 1QLEL 5CJ8A 3NABL 2P5WB 5ILTH 2RGSA 3HFMH 2GQHA 2F19H 5T3XE 1RUML 12E8H 4I18A 4Y1AB 2ZJSL 3DTXA 4CMHB 2XZAH 2OTUA 4TNVF 2HFEA 3FB6A 5KSBA 1PYWA 3QPQC 4XTRD 3RA7L 3TFKD 1P4BH 4HJGB 5DK2A 2VH5L 2DYPD 1GL4B 3MA7A 1INQB 3VG0L 1NPUA 2IMNA 4IDJH 5DK3A 3UTZB 3TH4T 1RZKH 4OJFH 3BP6A 4Q2ZB 3M17A 1MCSA 5JQHC 3ZDYE 3IFOB 5FOBA 3KYOB 3D9AH 5D96B 3ZDXE 2ZG2A 3ZYIA 3U4BL 4M8QA 4O51B 2PYEE 1JRHI 4X80L 1WC7A 2HKFH 1WQVT 1A7NH 3QIBA 3VWKA 3G9VA 3PXJA 2Q1EA 4ONHA 1BOGB 2AJ3B 3PHSA 1FAIH 5HDBF 3HZKA 4U3HA 3BGMA 3CSGA 5GSRB 5I75B 2AEQH 4GT7A 4JN1H 4LASH 1XGRA 1MIEL 3S4SG 2WUBL 5JIKA 2ICEB 2VUYA 1B0RB 5C6TH 2XOTA 4PLJD 5KSAA 3L6FB 5DD0L 5F1SA 5DA0B 5AEAA 4X7CC 5T3XL 4L8CB 3MOBL 4ZTPH 2Z92A 2FATL 2DQTL 3CGTA 4I77H 5IV2B 4IMLA 2VE6A 3EOBB 4XHJD 1CN4A 5A3ID 3O3UN 4OFKA 2NXZB 1R3JB 3KNBB 1A1MA 1J9CT 3SGEI 1JN6A 4G43B 4YWGH 3O3DB 4WV1C 5DJCA 1BFVH 5J6HA 3QT2A 3MRJB 4OD1H 4C59B 2ADFL 4GRLA 4KV5E 1FDLL 2QLVB 1EMTL 4POUB 3MLVL 4PTTA 5BZWA 1C16B 1M05B 4HKZA 5AAMA 4WTXA 3V8OA 3HNTL 1JPFA 2AKRB 4WENB 1ZEAH 4IHOA 5IK3B 2GAZB 5K9KA 3QUZA 5C7XL 1B0GB 4PGEA 4F9LA 1RJYA 2BFVH 3TH2T 2GJZA 4DVRL 1UENA 3CUPB 1NC2D 4YHIA 3DXAA 4NQUA 2JE8A 1QR1A 3MRFA 4NUGL 1UB6A 4PJFE 1T66D 1H3GA 3ARUA 2I24N 4HXAH 4KDTC 3QHTC 3RVVD 3GNML 3FFDB 1T0NA 4DK3A 5JUEH 2XPGB 1X5FA 2VISA 5I74B 4Z78A 1P2CB 3OKEB 2APBA 2VDNH 1IAIM 4HK3N 4PREA 5JMRA 5BXFB 4NOFA 3EAKA 4RMRA 5GGSY 3PP4H 4MDJB 3E2HB 4R4ND 5E4IA 4XWGL 1J05A 5GHWH 3V4VL 1ZLSL 4KPHH 5IHLB 4RMSA 5D8JL 1CLZL 5JW4R 1XR9B 3T0EA 5EBMA 4HPYH 5EUKA 1WCQA 3A6CL 4Z95L 3PGCB 2ILLA 3IETA 4PB9L 2PR4L 3NGBC 5D7LB 5E8NA 3VGAB 8FABB 2HLFC 3ARFA 4JKPH 4ZTOH 2X42A 2F53B 3B5TA 2C1OA 1X5LA 4K94C 3QPQD 3ARGB 4PV8B 1QSFB 2FX8H 1DQDH 1CTNA 4PJCB 4TVPE 4YBQC 4YGAB 1JZ6A 3ELAT 3SQOH 4J3WA 2ZPKL 5HHOE 4OM1H 4XCYA 3ARDA 2HAZA 4YHKL 1A14H 1X5AA 1JGDA 3CD4A 3OAZK 1T04A 5DT1L 2H32B 2WQRA 3MGTA 4MS8C 3RJDA 4LQFH 4HC1H 4U1MB 4W6XB 5BOPA 4JZOB 1MY7A 5TDNB 4HLJA 1SYVA 1JNLL 5DD6A 5D6CA 5C0BD 4H25B 3SE3C 2ADJA 1MUJA 3RWIB 3AS3A 4Z9KB 5C3TA 1MI5B 4F57H 4S1RL 3V52L 1OP3K 3BYTA 3N1MC 2IADA 2OS7A 5DQ9B 1QNZL 3VXME 3VFTB 4RGOH 2CDEA 5C0ND 3MV8A 2HA1A 3LZFL 4GQ9H 1XGYL 1R5VB 4ZD3H 3DARA 3O4OB 4WFHE 5I9QB 4PRBB 5IFHL 2VR9A 2Z31B 2MCPH 5I71C 1KTLB 1CF8H 1DBKH 5E9DE 3KWWB 1BECA 4LLDB 4XNMA 3IU4L 4RFNC 5K33A 4Y19E 3ARSA 5I30H 1RUKL 2VDRL 3GJFH 1FNSL 1A4KA 1EAJA 2YXFA 3CNKA 1E27A 4G9FE 1HHKA 1J1OH 1YEHL 3TVMD 4UNVA 3UO1L 3HKFA 3DNKA 3UJTL 4H20H 5KVEH 3U6RB 3MYJB 1TFHA 2PO6A 3I9GL 4MA7L 4I13B 1IM9A 1O7SA 2CKNA 3W0WE 2DI9A 1DFBH 3KDMB 5FAAA 5JHDB 5FKPA 1VGKB 4LPXA 1A7QL 4EDXA 1QFUL 1SYSB 2CIKA 3T4AB 4LNRA 2FLBT 5CINL 4EI6B 2M26A 1FHGA 1AQDA 3QNYB 4LLQA 3SGDH 3SDAC 1LE5B 4X4XA 3V4UH 2JK5B 2CLZB 3KAAA 1XZ0A 2NNAB 3MLSL 4OLUL 4PJGE 1MNUH 1IM3B 5AYUH 5CEZE 2YD3A 3QI9B 3EYOA 4NQTA 1DBJH 4KU1A 2V5RA 2JB5H 2GJJA 2NXYB 4LRNL 5DGQA 3RI5F 1UCBL 1WBXA 4I4WB 1R6VA 4JRXB 1TETL 3HS0B 4PJEE 1B9ZA 1TVBA 4XMPL 1MQ8A 2V7NA 1Q72H 5HHVH 3NPSB 4YXHL 3RTQA 2J6EA 3IDXH 3P77A 3WYRA 4K3GA 4Z7QE 1CZ8H 2Q8BL 2X9YA 1ZVSA 4I3GA 4M7JH 5GS1B 1U92B 1L9NA 3BZ4A 4HH9B 2VWEE 2CKBA 3DX7A 3WJLA 4R97B 1EDQA 1AHWC 5I8EA 5C07E 3BOVA 3ABZA 2NX5D 4I0CC 1QLEH 3NABH 1QFWL 2GIYA 4LLMB 2A77L 3TBVB 5FDYA 4OCXL 4IS6B 4PJGA 3BJLA 1RUMH 3SKNA 1EFXB 4YBLB 2ZJSH 3BISA 4G8EB 1CXLA 5GGVL 5IG7A 4D9QD 4UOW1 5A43C 2IH1B 1A6ZB 3K8KA 1FRGL 5CSBA 4YBQD 4Q6IB 3RA7H 5E4EB 3RZCC 2VH5H 1FFNB 3MJ7B 1HXMB 3ZHKA 1Q9LA 4I0PA 1CI5A 4KI5D 4HSQA 3VG0H 4MS8D 3FJTA 4C58B 1JGEB 4LARL 4MAUL 3U0WL 2ARWA 3IDMB 4DN3L 5CEZL 1VFMA 1ZA6A 3CFKB 4PV9A 3RJQB 4R4FL 3QDJB 4WEUD 4D9LL 1I8MA 1WAAE 3U4BH 2BY1A 3STLA 3NCBB 4X80H 4N0UA 5IMLA 4JQVC 3ULUC 1L6ZA 5BZDA 3LEVL 3OXRA 3MJ8B 1UB5A 1S7RB 4QRRD 3OHXA 4PRPB 2W38A 3VI4E 1KEML 2X44D 3PQYE 2I9TA 3RDTC 4Z7UF 2ZOKB 2A6DB 2J7LA 4NN6C 3OAUL 2YD1A 2WUBH 2R0WL 5IB1A 5C0CD 3OX8B 2BC4B 5HVWA 4AIXA 5DD0H 4MD0B 3FN9A 5D7KD 5T3XH 3MOBH 1BVKB 4M7ZB 2FATH 2DQTH 2APVA 4KRMB 4ODXB 1MHCA 1S9XB 4XBGA 5C08A 4K8RC 1MWAL 1IKNA 2UVFA 1C08A 2LFGA 3BUYA 3L3DA 4FQXA 4XAWL 1KGCE 2BCKA 5F3BB 2VZSA 5CGTA 2ADFH 4UIKL 5EC2A 5IOPB 5TDOB 1FDLH 1EMTH 3SDAD 3MLVH 4Q58C 1MJJB 4ZUSB 1JWMA 3OG4B 4C55A 5E00B 3HNTH 4E41B 5HVGB 1FORL 4N0CC 4WUUA 2Y36L 1G7PA 1A5FL 1UFUA 1MCKA 4LSSL 5C71A 2EIZA 5C7XH 5KG9B 4NOBA 4ZNCD 5DEGB 5EU6A 3PXHA 4QRTB 5FM8A 2BSTA 2VC2L 2E3VA 1F02I 4FMFA 4DVRH 4FXGB 2Z8WC 5FYKE 1IZKA 4NUGH 4KKLC 4YK4C 1CG9B 4DKDC 4N68A 2X4PA 3KYAA 1MLBA 4EXKA 2PTUA 3G5XB 1IAOB 2R0ZL 1Y0LA 3GNMH 4WI6A 1FE8L 1ZLUK 4NQCA 5FYLE 5DVKA 1INDL 5E1AB 5IW6B 5JORA 3PHQB 3BGFC 4W70A 3Q6FB 1S5HA 3DVGB 5C8JB 1IEAA 4P2QA 2V2WB 5BW7A 2I07A 4DOHE 5D2NB 4XWGH 5IJVA 2A6JB 2KH2B 3V4VH 1ZLSH 4OZFH 4XXCC 1F3RB 3QXVA 5D8JH 1CLZH 5GQBA 4KROC 3T2PA 5IEHB 3A6CH 4Z95H 3HG1E 1DLHB 2I27N 3LEYL 1FZMA 3V5KB 4PB9H 2PR4H 3ULVF 4TQEL 2N56A 1DL7L 4AEEA 1HXYA 4GKZA 3RX8A 1S7UA 3QG6B 3H2WA 1D9KB 1YYML 5T1MA 1VADA 5HI3C 3LQAC 1KEGL 2GK0B 2ZPKH 3V0VA 3W9DB 4JFPA 4YHKH 1BD2E 5DT1H 1GH7A 5JDJA 2BVOB 3S4SA 1CT8A 1T2JA 5ISZB 3FO2A 1FL3A 5DTFB 1ZSDA 1H3PL 1MHEA 4OV5B 2JTDA 5IVNA 3RIAF 3HE6C 1JNLH 3GB7B 2RAMA 3WL9B 4MA3B 3BXNA 5J7CC 3OKOA 4FNLL 2E27L 3JTSB 3L7EB 4XPBL 5D2LA 3ZDZF 2APTA 5AG9A 1J0JA 2QQLL 1UH3A 5FYKL 4S1RH 3V52H 3HPJA 4U7KA 1NH6A 2VR5A 3BRFA 1QNZH 1GAFL 1K4CB 2H8PB 3FFCD 3SCMD 2VKWA 3GSQB 3MA9L 1OSZB 5FYLL 2EDEA 4ZXBA 4NRXB 2YUXA 5JNYB 3LZFH 4ZO8A 1L8JA 1XGYH 2XIDA 4NSKB 3RDTD 2RFXA 2WIMA 5IFHH 3V5DA 3MNZA 2GYSA 2P5EA 2R1XA 2X70A 4G8IB 3OMZA 1KB5A 3TCLB 3IU4H 1QO3B 3HRPA 1SMOA 2CIIB 4LOUD 4EJ1C 2P5WE 1EO7A 4GG6B 1SEQL 1T2XA 1RUKH 2NCMA 5E8OA 2VDRH 3LDBC 1FNSH 1ZOXA 5K9OA 1GZPB 5F1NB 4Y5YB 2R15A 1YEHH 4Y1AE 1KXQE 3UO1H 3NFNB 4XBEL 4LDLB 3UJTH 3I9GH 4MA7H 4LLUA 1NJ9B 3MRDB 1QFOA 5BRZD 3SGKA 2XY1A 1A7QH 3JV0A 1QFUH 4IRJC 4M7KL 3WN5A 4KGLA 5IR1A 5CINH 3T3PF 5C92A 5ENWB 3VMPA 1E4JA 5HJ3B 4J3SA 5IVOA 3WCYA 3MLSH 5DQDL 4OLUH 3VFSA 3SDCC 2NLJA 2NTFB 1I85A 3R1GL 1CLOL 4JO1L 4H0IA 4JAMB 4LCWA 2XTJC 3A67L 3DX9B 3TBYA 3TZVC 1L7TL 2Z9TA 4LRNH 4UIMB 5IMOB 1UCBH 3V7MA 3EJYD 3KJ4C 4F37F 1QSED 1S9YA 1TETH 5DRZB 4PJHA 3GMPB 4EBQL 1NANH 1FFPA 4XMPH 2E7LC 4YXHH 1JWSA 2A0LC 1L0XA 5F44A 2Q8BH 4TNVK 2IH3B 5C6WH 5INCA 3MRHA 4PJ7A 4MMZC 5D1XA 2OTWA 1A7OL 4U1NA 4I48A 1X5KA 1T5WB 1GZQB 3JVGC 5HY9A 4NNXB 4S1SL 1YY8A 4AQ1B 1DN0B 1OTTC 1K5NB 4WHDA 1LQSR 2VDLL 2VXVL 4P4RB 5L2KD 3C9NB 1GGUA 4X6EB 2AK4A 4PG9A 1QFWH 2A77H 4OCXH 3V2AR 1VB9A 1T0MA 5I8CA 3HAEH 5GGVY 4NNYB 1FO0B 2AXHA 4HJ0C 5GGVH 1XGTA 4PBWD 4WY7L 1FRGH 4AIZA 2P47B 5HI3D 3UC0L 4H5SB 5I17A 1NMAL 1QLRA 4TUOB 4BZ1L 1X5YA 5CS7A 4MHHG 3D85A 4NQVB 5HGAB 3HCVA 3AY4C 5J1AA 4LARH 1ROWA 4MAUH 4WI4A 3U0WH 4DN3H 5CEZH 1T1YB 5B21A 1W8OA 4R4FH 3RWGA 4HFWB 3OV6A 4UU9B 1HNGA 1I9RL 1BF2A 4D9LH 4F15C 4D8PA 1B0WA 3NN8B 3QEQD 4WW2F 5FA4A 2XKNA 4G8GB 2P8LA 1NGZA 3QG7L 1JYWA 4NDMB 4R2GC 1CTOA 4XB8A 5JOFA 3BP5A 5CZXC 4ZUTB 1HNFA 1S7TB 3BPLC 3VD7A 3LEVH 3ZYOA 5DUPL 4BKLA 2NR6C 4P2OB 5IVXB 1KEMH 2GJ6B 4KZDL 3O6FC 2YA1A 5C0AD 1I75A 4JDZB 3OAUH 5DZOA 2LABA 2R0WH 4J8RB 1YEDB 2CJUL 2NY5C 1Y6MR 5DVMA 1BLNA 1AGBA 2P8PA 5D7LE 3P73B 1VCAA 4L5FL 4LF3B 2YBRA 4EVNA 2F53E 1S9VA 3CFDB 4LFHD 3FO9A 4GMSL 2BHZA 2IMMA 1QSFE 3QIUC 1P6AB 3O45B 4OAWB 4Y16C 5HHNA 1MWAH 3OZ9L 3PWNB 5D6DC 3ROLB 3IRPX 4JFFE 2AV7A 1OF2A 2DLHA 4WVRA 4XAWH 1WGOA 2J8UA 4UIKH 4XH2A 4DGYL 5DMJB 4QRQA 2GFBB 4JFQA 5HI4C 4IOSD 1PG7X 1PQZA 1JWUA 5F70A 1P5VA 3B8YA 1FORH 2FYYB 3SDCD 5CJBA 1UVQA 3WIHL 4WI7A 4YBHA 1ZHKA 4Y4KD 2Y36H 1A5FH 5ESAA 2HKHL 3UTSB 4ZPTA 3H9HB 4LSSH 4U6XA 1MI5E 4C56D 4JRYE 3TZVD 5MEND 5DZNA 2IQ9L 3Q6GL 4R3SA 4PRNB 2VC2H 1CDUA 1JZ2A 1BIIA 3LD8B 4X6BA 1I3VA 5GRVK 1RJLA 1TJIL 2H6PB 3MNWB 3UYPA 1A1NA 3C6LC 1CICC 4ELMA 5HYQA 2R0ZH 4G80B 3B9AA 2VABB 4PGBB 1FE8H 4PRAA 1JPGB 4U1LB 1JGVL 5IW3A 4MMXC 3QCUL 1INDH 5ERWA 5C9JA 2QR0A 2E7MA 5A1AA 3DO7B 1CFQA 4JFFA 2NYYC 1BZQK 5KS9A 4YDKL 1I7RA 4DWHA 3LKOA 5GGRB 1T21A 2DRUA 4XPTL 1A2YA 1CGUA 2DS4A 1OTTD 2QADD 1GOFA 2VQUA 5FUCE 1ZTXL 1ZK9A 5C0JB 2FNBA 4QGYA 3LEYH 5JHDE 1DANU 1B3JA 5E6IA 4PBXA 5J6GA 4TQEH 1QA9B 1DL7H 1SBSL 1WFTA 3S5LA 4JRYA 1T2QL 1K2DA 3VXUD 1YYMH 1W0YT 1KCRL 3W2DL 4N90D 3KXFA 1NMCC 1KEGH 4HKXB 4NO5A 2O5YL 2W0FA 3KPNA 1G7LA 3BQUD 2IQAB 2D7PA 3EHBD 3O9WA 4KDWA 1FZKB 5ADOL 2EO9A 1SEBB 1H3PH 4HW6A 1QOKA 5IB2A 4P9HL 3CFIC 4PYHA 2VB5A 2CK0L 5E8EA 3DRTB 1F11A 2R2EA 2BVPB 4FNLH 4YJZL 2E27H 1FH5L 2UV3A 4XPBH 5JR1L 4NPYB 2QQLH 5JIIA 5FYKH 4NN5B 3O4LE 5GS3A 3KLAA 4CUCA 1E4XL 2V9TA 4PJ9A 1HQ4A 1NEZB 4EUPB 3MUGB 1WLHA 1GAFH 4G6KL 1QEWA 2B8OT 3IAGC 4NKDA 3PL6B 2W0LA 3BPNB 2BMKB 4H88L 3MA9H 4MX7B 1TPXC 3DIFA 2NR6D 5FYLH 3ECBB 5C0DA 4RMWA 1HWHB 3MLXL 5CBEB 4P49A 4PJDA 2M8XA 1XR8A 2BOBB 3O6FD 5B8CA 1ZGLB 4HIEB 5DHVH 4YDJA 1DDHB 6FABL 4GKSB 2BDNL 1B4RA 5IWLC 5B38B 1FCGA 3LS5L 3DV6B 3N1FC 1SEQH 2YUVA 2NY6C 3H8NA 2YS4A 5D1ZB 2VAAB 4FP8L 5EIIB 4XMLL 4XBEH 1EAPA 3L7FB 1MSPA 5LAXB 1TZIA 4MJ5B 1IAMA 3RWJB 4OKVB 3D39D 4X4ZA 1ZHNB 5KVMC 5JPMB 3CDGB 1U8JB 3RI5K 2NW3B 3GRWL 4M7KH 4NC0B 3QISA 4OLVL 1IEBB 1U91B 3O4LA 3SDDD 4A2LA 3KYNB 1DQLL 5E2UL 3RL1A 5JW5B 1N5AA 4WI8A 2W59A 3QDJE 4NKOB 4LBEA 3DJ9A 5DQDH 5KVGL 4JR9L 5JPNA 2FEDD 5CZVL 4CL7A 3IB4A 3R1GH 1CLOH 5IEKA 4JO1H 5LGJB 1UWGL 3W5NA 1YMMD 3A67H 3G5ZA 4LVEA 3IJHB 5GISL 3VRLF 4JFOA 3UEZA 3C5JA 3EJZC 2P42B 1BFOA 1L7TH 3UROR 2GY7B 1A7BA 1DZBA 4HV8A 3KYMB 4P57B 1RK1A 2KZWA 3EOYG 2NZ9C 2O5ZL 1FGNL 5LKNA 1CGVA 4PRPE 4EBQH 1PX4A 3GSUA 4FFZL 4WWKA 3SGJA 3AXLB 3OPZL 4LEXL 3PWJB 3OJDB 4NN7C 1KXVC 2DWDB 2DAVA 3FQWA 5D2LF 1U8KB 4GH7B 3WIFB 1FC1A 4XGZA 5SWSA 4CVZA 3VGFA 2NYYD 4GAYA 2CGRL 1A7OH 4G6FD 3QQ3B 2YD4A 3GSRB 4NRZA 4S1SH 4ZFFA 2DIJA 5GGUB 1BZ7A 5EU5B 1QPXA 2EDLA 3K4DA 3BH9B 4J2XA 2VDLH 2VXVH 1ZA3A 4U1HB 5F88B 1EEYB 3WNKA 1FCCA 1A6AA 1J8HD 1URLA 4YHZL 4LLVA 3L3HA 2X4UB 4HULB 4X4YA 2ED8A 2DN7A 1I7TB 1UT9A 1R0AL 2FJFA 3D69A 1G9MC 1P7QA 2GSGB 3GSOA 5BVJB 2O61A 1KPRA 4GMTL 4PJIF 4WY7H 3UYRL 4P99A 5SV3A 3UC0H 1NMAH 4E41E 1KIQB 1RY7B 4AENB 4BZ1H 2V17L 4KTDL 4WEBL 5C0BB 3J7HA 2YPLD 5EZJA 4B53A 2X09A 5DD5L 4DUXA 3D6GA 2VLRA 1Q94B 4S10A 5FEBA 1WCBB 2ZSVB 4YGVA 4YO0A 3HMXA 4Z5RB 4QF1A 1KENL 5DLML 1V3KA 3DMMC 1QBAA 3VWJA 2DQFA 4X5WB 1QFPA 1D5ZB 1I9RH 1AGEA 5E5MB 2WP3T 2EZ0D 4ODWB 5EOCL 3BD3A 4ZFZB 1KLUA 3U46A 4EDWL 2ZWLT 4OD3L 1UQSA 2C7UA 3QG7H 3WLBB 1H5BC 4PP1D 2GITB 5B4MC 3T3ME 5EN2A 5LCVL 2VQ1B 4EN3D 1NEZG 4FQHA 4EUPG 4NO0D 5DUPH 4BK4A 5IIEB 2Q6WA 3S6CA 1CE6A 5D2NE 4KZDH 5SV4A 1YN6B 2BSRA 4AL8L 3TBWB 5F7KC 4FFVC 4M5ZL 4PJHF 2NY6D 2CJUH 2VXUL 4WV1B 3TNMA 5GRUL 5E0QA 4R0LC 4U1GC 3TWCL 3GZKA 5DSCA 3RPKA 3LS4L 4XZUA 4CVXB 4HUUB 4L5FH 1MFEL 1EEUA 4L8SA 1WZ1L 4I18C 4DZ8B 1NCUA 1N0XL 3M07A 4PJ7F 4FZ8L 3C5SB 4GMSH 5DD1L 2YRLA 4QT5B 3K7UA 3QFJD 5HGGS 5IMMB 4KTEL 3OZ9H 4LPWA 2QBWA 4N8CL 3ZTNL 3MV9A 3WJJA 1MFAL 3D2UD 4JPVL 5K9QI 3KPMA 3VXTB 3S96B 5IQ9B 3DX8A 3WHE1 4DGYH 2ICWB 4LSDA 2ITCA 5ISZE 5GS0C 3DHMA 1OB1B 2EDHA 3L9RA 3PABA 5E5UB 3FB7B 3WIHH 4GUPA 3X12B 3DWTA 1YPZB 2HKHH 4QTHA 4O02L 1CK0L 3EJZD 1DLFL 5FM5O 2IQ9H 3Q6GH 4WIQA 3LN4B 3NTCL 4X6DE 1JV5B 4PLKD 3QIBC 2UWEB 2PTTB 2WMPA 3VWKC 3IDIB 1TJIH 5EBWB 3QDGA 4O2CB 1AR2A 3WFZA 1QRND 4NQSB 1U3HA 4XCFL 3LKRB 3O6LL 1JGVH 1U8PA 3BMVA 5FF6A 2UY7A 4MNGE 5KVDL 3NGBB 3QCUH 4IJ3C 4J4PA 5BQ7B 4GG6E 4PJ5D 1WUNT 3BMWA 3ARZA 1G7QA 1EJ6A 4YDKH 5KSAC 4RRPG 1XCTB 1RZ8A 4XPTH 3FRPG 5I15L 1GC1L 4CU6A 1IQDB 1ZTXH 4FXKA 4UQ2B 2QKIA 4QHNB 1UZ6F 3RX5A 4NZJA 3BO8B 2J12B 3FOLA 3RIAK 3O41B 4S0SD 1W0VA 4E5XB 2WW8A 1UXWA 1SBSH 3BEWB 4GRLC 5E8PB 4BSWA 1WT5A 2H32H 1T2QH 3L5XH 5C3LD 1KCRH 3W2DH 4Y4FD 4X6DA 5MEOB 5I1KL 4Z7WA 5F7DA 4BFIA 1II4E 2O5YH 3CSBA 5HGHA 4YDLB 4RBPK 1MCIA 3CK0L 4L9LA 1MH5B 3QHZL 4KKAC 3QUZC 4AH2A 5CD3A 3B83A 4I1NB 4GXVL 5B39B 5ADOH 5E08L 4F9LC 4RX4D 4P9HH 2J8UF 3TIDA 2CK0H 2H41A 3PWLB 4MNGA 2FJGB 2YEZB 3DSNA 4XPGL 5EG6C 3DV4A 5JR1H 1FH5H 1MCRA 5TH2B 5I71B 1U8QB 1HYSC 3LSOB 5FO8B 4OGAC 4QXUL 3ZHLA 1MRDL 1E4XH 3NCCB 1G9NH 2CLRB 4RFNB 5B4MD 4BFEA 3QA3B 3MRRB 3HRZA 2MQCA 5C0CB 4G6KH 2FGZA 4PJAB 2KUTA 1QHPA 3ZKQD 4IOFC 4H88H 4WFGD 4KMLB 2K9UA 4M61A 3MLXH 3GSWB 3NCYP 4KJYA 1TENA 1RJZA 4RDQG 1A22B 3HLAB 6FABH 2BDNH 3PJSA 3ZKMC 4DKFL 3VXRA 2CK2A 3T0EC 5LWYL 5I1IL 3LS5H 4GKOA 5MEQB 5E24E 5D7JA 3WS6C 4ELMF 3RQ3A 1XF3A 3ARFC 4FP8H 4H1LG 4O5LL 4XMLH 4N0FA 3FT4B 3SDAB 2OBGA 2OR7A 3TO2A 3BIBX 5E94A 4WO4C 5KS9F 4XWOC 3JV4A 1QZ1A 5MEPA 2EYTA 1KTDA 4QRPE 1OM3L 5A40E 3GRWH 4F37K 2XG5A 3ARDC 4JKMA 5GS0D 4OLVH 3SE9L 3CX2A 4ZS7L 5F9WC 4MNQA 3C8DA 5BS0A 5I1JL 5ICYA 5ANMA 3IKCB 4PRDA 3OBAA 1DQLH 4W4OC 1J1XL 5E2UH 5FGCE 3ZE1F 1GXEA 5KVGH 4JR9H 5CZVH 4I0KA 3QWQB 4JPIA 2HP4A 1SJHA 4KAQL 1UWGH 5DRNB 4G8GE 2A2QT 5GISH 1VEPA 1F4AA 3WFCL 2J88L 2XA8L 4Z77A 3VWKD 2X89A 1WZMA 3VMNA 5AG8A 4HJJL 2O5ZH 4MWFA 1FGNH 1TNNA 2FO4B 3GIVB 5T1KD 1M7DB 1LO4L 3B9EA 4FFZH 1AHWB 5IVXE 3UTTA 2GJ6E 3ULVD 3OPZH 4LEXH 4FQQA 3RUGB 4G59A 3CFBA 1LE9A 4JFEB 2B4CL 1MCCA 3GKWL 2FDBP 1TNMA 3NCMA 4XCEB 2CGRH 4QRPA 1N8ZB 3MRMA 3RAJL 1EVTC 1KPVA 1T0PB 4RAVA 4K23L 4RIRB 1EO8L 3VDAA 2VN7A 3KHOA 1FO0L 1P1ZB 2JJTA 3RZCB 2EC8A 2EKJA 3PWPA 2PO6C 3Q2CA 4WFEE 4PJDF 1ZT4A 3T8XA 2K7QA 4PB0L 4YHZH 3Q5TA 3LCYA 1IT9L 1AD9B 1P4LA 4GRLD 5K9QG 3EDJA 4POZC 1R0AH 4P5MB 1MVUB 3F65A 2H9GA 4GMTH 3UYRH 4FFWC 4Q9BA 4QRUB 5HHPA 2XV6B 1GSMA 4RA0C 1KLGA 2V17H 4RISL 4P23A 4WDIA 5CP3H 4KTDH 4WEBH 4NFBA 4YZFF 1K3ZA 3TNNA 1M6OA 2DWEB 3UTSE 3Q3GB 3MXWL 3QUZD 5DD5H 5C2BL 4BQ8A 3JV6B 4ORGA 2GTWB 3MV01 5D5ME 3MRNA 3VDCA 5JLZB 4X0KB 5ABDE 5I73C 3OJ2C 5ICXA 1KENH 5DLMH 5B39G 4PP2A 3SCMB 4J12A 1HYSD 2NY3D 4OGAD 3RDTB 2BOCB 2CRMA 3OWEA 5EOCH 4LGPB 4NN6B 5FCSH 4EDWH 4OD3H 2ED9A 4L29B 2ZSWA 3BP7A 4IM8A 4KFZC 3RTQC 5TQ0L 1OTUC 4GW4B 4OIBA 2RBLA 5LCVH 1ULVA 3MRPA 3O3AB 3GI9L 4A6YA 1CE1L 3GSNB 5DUBA 5C0IB 3VXNA 3WJLC 4Z7VB 4RZCA 1VEMA 3T0ED 1JMZA 3FQNA 5TDPB 4AL8H 1OL0A 4M02A 4M5ZH 3UTPD 2CDFB 5F9OL 2VXUH 2E9BA 5BRZB 5GRUH 1H3VA 3GBML 2C3GA 5J1SC 3TWCH 3VFUB 3DVNB 3AREA 3ARFD 3LS4H 3GJEA 3SEPA 1ZT1B 1NCCL 4NUJB 1MFEH 1PZ5A 1WZ1H 1FGVL 3V8CA 1IC7L 1N0XH 2V7HB 4FZ8H 2HJLA 2HYMA 5D5MA 3OKLB 5DD1H 4YXKL 1HI6B 4KTEH 4N8CH 3ZTNH 3ARDD 1MFAH 4JPVH 4HGWB 5EC1B 1X5HA 2HJKB 4CN6A 3OTTA 1X5ZA 1HQRA 1LP9A 2H3NB 3W81A 4N8VB 3OGOE 2R0KL 4R7DB 2W65B 2YA0A 1BM3L 4YK4B 1G7MB 3M1BB 4NKQB 5HHMA 4E42A 2QQNL 2Y07L 4JKWA 4AM0A 5DJ8A 4D0BA 4O02H 4CAGA 3RVWC 5EU4B 1CK0H 4UT9L 5IESL 1DLFH 4GOSA 4NGHL 4Y8DC 3TPKA 4K7PL 4F33B 2X1OA 3NTCH 3MUHL 3MRCA 3B2UC 3TFKA 2ICWJ 3C60A 5ETUB 2EECA 3D1MC 1TITA 3RVUD 4HIJA 2DYPA 3MV8D 4IOIA 4KJWC 1GVIA 5IB4B 2HH0L 4NHUB 4FA8A 3EYFB 4XCFH 4R7NB 4LAQL 4B41A 3O6LH 1LD9A 2WLZA 5F7FA 5L2KB 2DBLL 4XVJL 1MIML 4S1DC 3U83A 5KVDH 3KPSB 4JM4L 3WNLA 1P9MA 2BY2A 3DPBA 3SE8L 4XX1E 4P9ML 5I15H 3V0AC 1GC1H 2PYFB 1OD7A 3BWAA 4LCIL 4JHWL 1IM9D 4BSVA 3REWA 3TYGL 4K55A 2FZ3B 5CUSL 1MY5A 3BPOC 3P9LA 1IKNC 1N3NA 2P46B 3RNKA 4TN9A 4POZD 4PGJA 4WI3A 4FQXC 2AJUL 1U3YA 4V2BA 5FGBC 4KKCD 4QXTA 4NC1C 4P0DA 3MLUL 3LKNB 4QOKA 1NBYA 1F3DJ 1TJGL 3HE6B 5I1KH 1U58A 1SJXA 3NFPB 4L4VA 5IW1B 2F5AL 2J8HA 4F7TB 2XWBB 3CK0H 4K7PX 1JL8A 3QHZH 3QEQB 4JGMA 1J86A 4N1EA 4GXVH 5E08H 3BH8B 3BPCB 2FJHB 3T4YB 3QEGL 3QQ4B 5IROA 3FQTA 1OWWA 4XPGH 4PG2A 4NQDA 3O2DA 1KJ2B 4TVSa 1G6RB 4ZFOA 4QXUH 5C0AB 3VCLB 1MRDH 3PHOB 3VA6A 5D7IF 3B3IA 3VG9C 1YEFL 1WIUA 1K8IA 3HUJB 2YD2A 3LDBB 4YIQA 1QBML 1WTGT 4M1GL 1NCNA 3ZT6A 3UXFA 3IDNA 5HYSA 1EHAA 3RBSA 3HZVA 1FVCA 4DKFH 4X98A 5LWYH 5I1IH 1C7SA 1JI1A 4IRJB 1SY6A 3TESA 1MHPL 1NC2A 3PWVA 4Y7MA 2A83A 4O5LH 4X7TA 3QUMA 2DM7A 1QACA 1A3QA 3KJ6L 3WUWB 4PY7A 3ZDYF 4XRCB 1U8LA 3E6FB 1YJDL 3ZDXF 1R3IL 3SDCB 4I0PD 4JHAL 1LO0L 1M71A 1OM3H 4Y4KB 5C0BE 4KRPD 2RB8A 4DAGL 2MHAB 4HS6A 4PTUA 3TO4A 3IDJB 3CZFB 3BUTA 1EVUA 1E4KC 3SE9H 1X3DA 4C56B 3VFWA 5HVFB 3TZVB 4ZS7H 5I1JH 5MENB 4S0TD 1K8DB 2AV1A 2D9QB 3FT2A 3WV0A 7FABL 5HGBA 1G7JB 1WEJL 3KJ4B 4NYLB 3UYOD 1J1XH 2X9WA 1LHZA 1KPUA 1JNHB 2A6IA 4XCNA 2YC1A 5IHZA 1YC7A 3DUHA 3RVWD 4LIQL 3EYUL 4Z7WF 1MQKL 4KAQH 2E6QA 3ORJA 4OQTL 4DFIA 4F7PB 5F7EL 1J88A 1WWAX 3WFCH 2J88H 3LN5A 4WNQA 2XA8H 3MJ6A 3D25A 1YUHB 4P3CL 4P46D 1PZUB 4KJPC 4HJJH 4FQPA 4LSTL 1AXSB 1LO4H 4J1UB 4NJ9L 2QADB 3LRSA 4QY8B 5B3JE 4S1DD 2PW1B 3ZKSD 2B4CH 3GKWH 3QO0A 3ME0A 5HD8C 5FO7A 3RAJH 4PD4K 4BH7B 4R90L 4K23H 1EO8H 3SHSA 2FIKB 3B6SB 4Y2OA 1FO0H 3BT2L 5C08D 1X4XA 4ZSOB 3L3OA 1P7KB 3ESVF 2G75B 2VIRB 2O93L 4PB0H 3HI6L 3SGKC 4GBXD 1IT9H 1JZ7A 4UB0L 4FQXD 5DK0A 3UMTA 1HKLL 3HZYB 3WN5C 3QXDB 4PGCA 5K9JL 4QHKJ 3VXSA 2GSIB 4WHCA 5HYJB 4LCYB 4HG4K 2ESVB 4RQQB 4JY6A 2C26A 4DTGL 4MDIA 4RISH 4WUUD 4F15B 3QCTL 3MCKB 1UJ3A 4P4KD 3T0AA 1I85C 1EFQA 1YPZE 2HFFB 3MXWH 4XC1L 5C2BH 3TVMA 1LO5A 5C0GA 4U0QB 4KK9D 3GGWB 5EU6D 4R2GB 1K4DB 3LIZL 1MLCA 3ARVA 3BPLB 2UWEE 4WI5A 3SPVA 4H1LA 3KPRA 1XGQB 3U9UA 3LRGA 3QUKA 5DQJB 4NQXB 2CD0A 4OLYL 3O6FB 2HFGL 5GZND 4KHXL 3MBEA 4XCCL 5JDSB 3B5HA 2NX5E 5TQ0H 4NQCD 1CD1B 1LO2L 3F5WB 5ID1A 4ZAKA 3GI9H 1KIUA 1FNEB 3DGCR 5D1XC 1CE1H 3QQNA 5C2UB 3X17A 3P4NA 4P2QD 5CSZA 4RWYL 3D0VA 3RVTD 3MUY1 4D9QE 2BY3A 3QIUB 2YR3A 1X5IA 3D39B 4Y16B 5F9OH 4LFHG 4BA8A 3GBMH 2R9HC 3JWDC 3PDOB 2M2DA 4JO4L 2H26B 3FTGA 3CX5K 1NCCH 1XF1A 4Z76A 2QTEA 1FGVH 3PV6A 4YR6B 3Q5OA 4PY8I 3OAYH 3KPTA 4YXKH 1F42A 1NGWA 5DJ6A 5GS2D 4ZUUA 4EIZC 3WUWG 4PRIB 5CJXA 5I1DA 3KPQA 1IL1A 5F8RC 1X5JA 2EIDA 4ZYKB 1QYGL 2FSEB 5EZLB 1JIBA 1YMMB 2F74B 3RP1A 4HEME 2JKXA 5C0EA 3VFVA 1S7XA 2NX5A 3TBTA 2HJFA 2R0KH 2WBJA 4V3EB 1BM3H 4DZBB 5I66B 1PY4A 3D3VA 3IDGA 4EZMA 3C6LB 3V6FA 3FRUB 1A64A 2QQNH 2X4SB 4QRRE 5JXEA 2Y07H 4MJIB 3BHBB 3IAQA 5A2KH 3BGAA 3OF6A 4K7PY 4UT9H 5IESH 1T1WB 4NGHH 4X6FA 1R5IA 4K7PH 5FO9A 4KJPD 5C0CE 3TLRA 3QWOB 4PJAE 4M8VA 2HMIC 2ADIB 1CFTB 5DVLA 5L7XL 4QYOB 4ZXBD 4G6FB 4JANB 4OF8A 2Q3AA 1A9BB 4CW1B 5D7KE 2HH0H 4HX1B 2P5ED 5GGRY 1U2HA 3Q0HA 1PX3A 4K94L 4LAQH 5DJYA 1F58H 2DBLH 4XVJH 2QJDA 3DBXA 1MIMH 5HD8D 1T22B 3GMNA 4JM4H 3JSSA 4GKNB 2C1PB 3C6SA 3EGSA 2X4RA 4WCYL 4UT6L 3SE8H 1EA9C 3BIKB 4K7FB 4P9MH 4W6WB 3MX0A 4G6JL 5F9JB 1NMCB 3K4AA 4LCIH 1N7ML 4JHWH 2VDKL 2Y72A 3MRQA 3TYGH 2WANA 3U4EB 5CUSH 1FJ1A 4ZQKB 4XP6L 2R2HA 5DC0A 2YD5A 4PRHA 2YPLB 5HGDB 1PW3A 4YC2C 4QRRA 2JJWA 3V6ZB 2AJUH 1HCVA 3FN3A 4R6UA 3HPLB 3T0WA 4TTGA 1GYAA 3MLUH 1TJGH 1FYTD 1UM6L 4QHMB 1CXEA 1BGXL 1PGRB 1Z9MA 4ODTL 2F5AH 1XCQA 3EDFA 1ZANL 4LCWD 1U0QA 4ERSL 3VW3L 4Z7QF 5FM4A 2EDYA 3C8KB 3JWOL 1HEZA 1DUYA 4JN2B 2WBKA 4HIIB 5H37G 1FL6A 2B5IC 3QEGH 2OR9L 3UTQB 1TPXB 4EUPH 3X3FL 4HBQA 5IM7B 4EN3B 4GLRI 4OZ4B 2QQKL 1LP9F 3P0VL 3T04D 4NO0B 3TV3L 3VGAC 1QQDB 1IGTA 1CDBA 3RUGE 3OSKA 3P0YL 2BNQA 2ZZUT 4JLRB 4JFEE 5CP7B 1YEFH 2DQHL 2NY6B 3HR5B 1LNUB 4O2EB 2E9WA 5D1XD 1QBMH 3R0NA 4M1GH 3VD4A 3AS2A 3FO1A 4X5XB 1NDGA 2I9LB 2VZTA 2CLVA 1F13A 4KK5C 3W39A 3FCTA 3NZHL 2AK4D 4BZ2L 1I8IA 1GGYA 2R9HD 3QFJB 1ACYL 1MCHA 2Z93A 4H26A 4F7EB 4MD4B 4XNQA 1MHPH 2VL5A 4MD5B 5J4MA 5E6IC 3D2UB 2W1NA 1G7HB 3DRQA 3SDYL 1T5XA 3KJ6H 2E9JA 1MCBA 2F54D 4P9HC 3BI9X 4OFVA 3LB6C 4QTIL 1YJDH 5DI8B 3WNNA 1R3IH 3O6KL 4BSJA 1WAAF 2AQ1A 4JHAH 3B9KD 1LO0H 4P5KA 4Y5VA 5SWQB 3TT1L 1DUZB 1W0WB 2ZKHL 4DAGH 2PW2A 3ZE2F 1Y6NR 2YRPA 1MAKA 1F3JA 3U4AA 2EXWC 2C3VB 7FABH 3MRKA 1KACB 2X6MA 3WFHB 1W72A 1WEJH 2LU4A 3RL2A 3QUXD 3FFCE 3QO1B 2XWTB 2P8MA 1FVEB 2WV3A 3HI1A 3VI4F 2BNUB 2V5YA 3EYUH 4LIQH 4NN7B 1MQKH 4P2RD 4OQTH 4LHJB 5F7EH 5HHQB 1AFVL 5EBLB 5FUCC 2HMID 2AXGA 1QRKA 4P3CH 3MRLA 1W72L 1AD0A 1CU4L 4PJ5B 2J1KA 4LSTH 1I9JL 2BY0A 2CRIA 1NFIA 3LN9A 4CU8A 5MERB 4NJ9H 2ZNXA 3VXPA 4Z7VE 2DKSA 1SVZA 4ENED 5TE7L 4MJ6A 4X8XA 3ZYJA 5M94B 5BRZE 1WWCA 2Q86A 4HT1L 1MJ7L 3MLPA 1F00I 4R90H 2V2TA 5GSVA 2R8SL 1RIVL 1JF1A 1F2QA 2GEEA 4L3CA 4U3CA 1HKFA 1I9IL 3BT2H 1PKQB 4Y4FB 5GGTL 3DGGA 3OKNB 3P4OA 2DLGA 4ZS6C 3HI6H 3FFCA 3BD5A 5ESVA 1ORQA 1WBYB 4UB0H 1JPSL 2CPCA 5HHXL 2V5MA 1UZ8A 4HWBL 1C12B 1FG2B 1HKLH 4BJLA 3MV7A 5K9JH 2ADGB 5IHBA 2AEIT 3BEVB 4OI8A 1ODAA 1H0DB 3DMMB 5DJ2B 1TTGA 5CKGA 4ODBD 4DTGH 5A2JH 4Z7UB 2A6KB 3ULUL 1QSEE 5H2BA 4PGDB 2YZ1A 3QCTH 1VPOL 3VGDA 1TCRB 4XC1H 4JHZA 4MQTB 4OGYL 1OLZA 2FEEI 1H5BB 5CGYD 5E2JA 1QP1A 2Z35A 3LIZH 3P4MA 1A6PA 2VN4A 1ETZB 5DJXB 5DS8A 5I8KL 5A2LH 3QEUB 2YD9A 1X5GA 4FOMA 2FCBA 1G0YR 4G6AC 4KKBC 1T3FB 5F1IA 1D3CA 2HFGH 4HMEA 43CAA 3SO5A 4KHXH 2A74A 1XF4A 1T89A 4NHUE 3SGJC 1WIPA 4XCCH 4F7CB 4Z7NF 5L2KE 1S8DA 4U1GB 1LO2H 4Q6IC 1NKRA 3KG5A 5K59E 3X13A 4I18B 1U3ZA 1L0QA 3DTXB 5CHNA 4GG8A 4XNXL 4RWYH 2OTUB 4KK5D 2HFEB 3FB6B 3P9WB 5KSBB 1PYWB 3WKNA 4LVNC 5BCAA 3IYLW 5DK2B 2FX9L 5MP6L 1OAXL 1G1YA 5E6ID 3MA7B 1QSEA 4JO4H 2VLKA 2WM0A 5EWIL 2EE6A 4MJ4A 4S11A 3BP6B 1JYVA 3M17B 1NAMA 1I1AD 3KXFD 5EZOL 3ESUF 5FOBB 4U31A 1K9TA 3LV3A 1DVFA 3H9ZA 1JZ8A 1QYGH 4LDOB 4M8QB 3IFLL 2VR4A 3TEUA 3O9WD 3QEQE 1WC7B 5F21B 4ZPVA 4YQXL 3QIBB 3VWKB 3D18A 2XYCA 3SQBA 4CVWA 1E4WL 1NAML 4ONHB 2D7TL 3VWJC 3HZKB 3BGMB 2XN9A 3WDHA 4P48A 1XGRB 3O3BA 5C0AE 3BZEA 4PJ9D 1AO7D 1LQVA 4LL9A 3Q1SL 4GAFB 1N6UA 4IJ3B 3HUJE 1GGCL 1CBVL 5KOMC 2V5TA 5L7XH 5KSAB 3FB8A 1U8MA 3HB3C 1EIBA 1CQKA 1UXSA 1D5IL 2AK1L 3EOAA 2Z92B 5A2FA 4IMLB 2VE6B 3PGFL 3RWDA 4K94H 1F3DH 4X7FC 1A1MB 4X4ME 5JIPA 1JN6B 2UZIL 5DJCB 4KQ4L 5J6HB 2CDGA 4TUKL 4WCYH 4GRLB 4UT6H 4EKXA 3ZKXC 4PTTB 4L8SC 1BQHG 5DA4A 5BZWB 4G6JH 5T1DL 4HKZB 3OAZH 3IJSA 1DEDA 3WDIA 1N7MH 2VDKH 1JPFB 2V9QA 4YAQA 4ZS6D 4XI5D 4XP6H 1F8TL 1HDMA 4J3XA 3TF7A 2Q7NA 4IHOB 4QLRA 5K9KB 1NFDA 3WJJC 5GIRA 4OZIA 3QUZB 4Y0GA 1EJOL 1B6UA 4C56E 4PGEB 4Q7DA 3V6OE 1D5BA 3G6JA 1XH3A 4ETQA 5MENE 2FL5A 5IJKA 4BH8A 1RJYB 1HHIA 3U2SA 5J9PA 2GJZB 1UM6H 4PY8J 1RZGA 1OP3H 1BGXH 1HOCA 2JB6A 2KPNA 4JM2A 4YHIB 3DXAB 1QR1B 3MRFB 1C8PA 4ODTH 3SE4C 1UB6B 1J10A 2NY3B 1ZANH 5ALBL 4ERSH 3VW3H 3G5VA 3OKDA 3JWOH 1T0NB 1XF5A 1KJ2L 5D2NC 2VISB 4C4KT 3H7LA 1G6RL 4Z78B 4M4RA 2OR9H 4X4MA 3X3FH 4PREB 2QQKH 2ICCA 4KKBD 3P0VH 3IGAA 1ORSA 3TV3H 4WWKD 1J05B 2GKIA 3P0YH 1SVCP 2WY3A 3T0EB 1U3HC 4NRYA 5EBMB 5I76A 4HUMB 1NDMA 5EUKB 2DQHH 4I3SL 1R3HA 1D9KC 3RHWF 3IETB 3HZMA 3EYSL 4J4PC 4HUWA 5E8NB 1JZ5A 4KDVA 3ARFB 5I1CL 2EC9T 5CIPA 1OVZA 3GSVA 2XXMB 5CLTA 2C1OB 3OB0K 2WIIA 4B7IA 4LLAA 3BD4A 3EO1A 2AI0L 5IF0A 3VXUE 3NZHH 1O5DT 4N90E 4BZ2H 1ACYH 3WXWL 1Y18A 2ATKA 4ONFL 1ZGLM 4XCYB 2FR4A 3ARDB 1H8NA 1JGDB 1WFNA 1T04B 2CUMA 4JDVA 1FFQA 5SX5H 3MGTB 1P7QD 1YN7A 3SDYH 2OK0L 5AAWA 5DMKA 1N59A 4QTIH 3O6KH 1SYVB 3VD5A 1IJ9A 5DD6B 4RMTA 5D6CB 2CO7B 3O2VL 2ADJB 3TT1H 1MUJB 2ZKHH 2OXGA 5DRXA 1BZ9A 4L9LC 3BW9A 2VLRD 2EKSA 2VDML 3DROA 1GHFL 2B7DT 2IADB 5T1LA 5F89A 3VWJD 2CDEB 3UAJD 1DBML 4Y2DA 1E6JL 3SBWC 3MV8B 2Z91A 2CRYA 5C0FA 3O8XD 3TN0A 3EBAA 4X8JA 4GQPH 5L88L 4XNMB 1R3KA 1AFVH 3VXUA 4UZGA 4BM7A 5T3ZD 1X7QA 1W72H 1CU4H 5CGMA 3TT3L 3HB3D 1A4KB 1E27B 1I9JH 3BQUA 1HHKB 2HTLC 1G0XA 4PJCF 2PO6B 3GMLA 3QZWG 1S3KL 1JF5A 1IM9B 3D39E 4O4YL 5FB8A 5TE7H 1FIGL 3VFNA 5FKPB 4EDXB 4HT1H 2CIKB 1MJ7H 4K71B 4LNRB 2IALA 3CFJA 2R8SH 4HZAA 1AQDB 1S7WA 1RIVH 1KIRA 1KF9B 4LLQB 1VACA 3LKQA 5A2IH 5GZOC 4X4XB 1I9IH 2F8XC 3ERYA 1EX0A 4WU7A 2ERJC 5GGTH 4WI2A 1XZ0B 4CVUA 4PRIE 4F2MA 3RWCA 2VO5A 3MV9D 3IAPA 1JPSH 1AE6L 2JCCA 5HHXH 4HWBH 4N0YL 3EYOB 2OSLA 1YMME 2CXGA 5I73B 3OGCA 3STZA 2YRZA 3TA3A 3GMOA 1WBXB 3ULUH 5KJRL 2XACC 2W60A 4OGXL 1NQBA 1VPOH 1TVBB 3F62A 1AJ7L 2V7NB 1I1FA 1Q9KA 4OD2A 4OGYH 3I02A 3DURA 1BWWA 3RTQB 3P77B 3N85L 4JKLA 2BSSA 3T2QA 5I8KH 1CVSC 1ZVSB 3KGRA 2UZXB 4DKEL 2NY5L 1A4JA 3BZ4B 3QDGD 2H2SC 4UV4L 2CKBB 3DX7B 5E56A 4L8BA 1U3HD 4Y5XA 5I8EB 2XXCB 3T08A 4JKKA 1CQYA 3U48A 3SDDA 1V8HA 5CAYB 4J4PD 4Q6YA 4K8RH 1J8HE 4ELKA 4PJGB 4WHYG 3BKJL 4EOWL 3SKNB 2WWMC 5IG7B 1TTUA 4XNXH 4U0RC 4XP5L 1ITCA 2ZUVA 3P3YA 1U8NA 2JJTC 4GW5A 5MP6H 2FX9H 3T2NL 1OAXH 1U93A 1Q9LB 4I0PB 5TF0A 1KUMA 3G6AA 2DJUA 2YPLE 5EWIH 1S9KC 2DQUL 2DL2A 1MCNA 4OF6A 2PCPA 4HLZH 5EUOA 1ZA6B 1X5XA 4PV9B 5EZOH 1W8NA 4N8PA 3RY6A 2NMSA 1S7SA 1V7ML 2V9RA 4P23C 1I8MB 3O81A 3IFLH 3STLB 3HC0A 5GRVL 3L3KA 3I6LD 4HIHA 4N0UB 1I8KA 4HCRA 5IMLB 4YQXH 1XF2A 4JE4B 4KKNA 5BZDB 1E4WH 4LSRL 1KOAA 4U6HA 3I75A 2D7TH 3OXRB 2Q20A 5EPMA 1J8HA 3BDBA 1UB5B 3ARBA 3OHXB 4L1DA 1F6AA 3E8UL 1JE6A 2I9TB 1X9QA 3BAEL 3DYMA 4X99A 1S9WA 3Q1SH 5IB1B 2P48B 1QG3A 3CFEA 1GGCH 3ZSTA 1CBVH 1XFPA 2DTML 1T7WA 3RFZC 5J13C 3JTTA 1IEHA 1A7PL 1FIEA 2FD6L 1D5IH 2AK1H 3IXAA 3TPUE 4RAUA 4JQIL 1MHCB 3PGFH 4XBGB 5C08B 3QXAA 4WFFD 3VXRD 1T7VA 2J2ZA 1IAII 3BPOB 4U2YA 3CVHA 2UZIH 3QFJE 5D7JD 4KQ4H 1C08B 3BUYB 3L3DB 4FQXB 4TUKH 4X5LA 2BCKB 3AREC 3LY6A 3B43A 5EC2B 1TQBC 1HH9A 1FFRA 4YEEA 5I6XC 5CWSA 4M9PA 2D0FA 1CGXA 1JWMB 5T1DH 1UADC 1PD6A 4KJQC 1ED3A 4QGTA 2KKQA 3OXSA 4WUUB 1F8TH 1G7PB 2FWOA 3SKJL 1EJOH 3CH1A 2EIZB 3BZFA 2ZCHL 5BS0D 2AEWA 5EU6B 2E8ZA 3T77A 2BSTB 2X7LA 1BQSA 5I1HL 3TC9A 1OTSC 4J7RA 3CCHA 2X4PB 4PJBA 1MLBB 5ALBH 1QRNE 3TPUA 5JW4Q 1LDSA 1RV6X 1Y0LB 2DD8L 3VG9B 4R26L 4F80A 1KJ2H 2RHEA 3RGVA 1G6RH 2XICA 4NQCB 2X89D 2YPVL 5ELIA 4XTRC 1KJVA 2FBJL 3TFKC 4PJ5E 3C60C 5JORB