2D31A

Crystal structure of disulfide-linked hla-g dimer
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
274
structure length
269
Chain Sequence
b'GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGEPLMLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, alpha chain G
molecule tags Immune system/cell cycle
source organism Homo sapiens
publication title Efficient Leukocyte Ig-like Receptor Signaling and Crystal Structure of Disulfide-linked HLA-G Dimer
pubmed doi rcsb
total genus 63
structure length 269
sequence length 274
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2d31A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2d31A01
2LAGB 4ZD3L 4RA0C 1HOCA 4G8EA 1O0VA 2F53E 1WC7B 2R2BA 4QXTA 5EC1A 2R1WA 1S78D 2MHAA 1JZ8A 1BX2B 2ATKB 3UZEA 7CGTA 4G6AC 3WFCL 1XCTA 1AGEA 4AQOA 4G5ZL 5IW1A 2DQUL 5CFHA 5EZIL 2EO1A 4IRJD 1P4IH 4K94C 4I0PA 1SM3H 4MAYD 5DHXB 1N2RA 4R3SA 3QEQE 3CXHJ 4RAUB 2APTA 4JG1H 5DQJB 3D18A 1JGLH 4UBDC 1SMOA 2FJHB 1FNEB 4YIQB 4ETQA 4OCNC 3VMPA 1NBZA 1CFNA 4YZFF 5I2IB 2EDJA 3VFSB 1A7RH 4OZGA 2P1YA 5ETUA 1OM3L 5E4IA 5E70A 2FSEB 3L9RA 2DOCA 4TVSa 1LE5B 1JZ3A 3RZWA 1XGPA 5D1QC 4QKXB 1R3HA 2BERA 3OXRB 3MNZB 1J8HA 1TENA 4YNYA 2VN7A 4LPWA 4PJXF 1MAMH 2XG4A 1HXYA 3UTTB 3KG5A 1U8NA 4NPYB 5ISZE 4QGYA 1UB5B 4C55A 2CO6B 4OFVA 5D5MB 2PTTA 3QHTC 5JDSB 1T22A 1A6UL 3O81A 4PJ7E 1A6TB 1QSED 3HNSH 5CBAA 4K8RC 1RZFL 1CF8H 2YUVA 3ARBA 3MJ7B 1T1YA 4JFEA 2OP4L 4OGAC 5F6IB 2G2RB 4JN1H 5CWSB 3ESUF 4IMLA 3NAAL 4PRHD 2BY1A 5DLML 3UTSD 3IAPA 1OPGL 4QXGL 4KKCC 3B6SB 4O2FA 5C07D 2FECI 1MY7A 5GGVY 1N0XL 2EC9T 3RBGA 2AQ3A 3BO8B 3C60D 1BFOB 3VXSD 4M6OH 3RQ3A 1FYTE 1KPVB 4XHJD 5INCB 4LCCB 3TN0A 2IJ0C 1UYWL 4KTDL 4BH7A 4WGVB 4QYOA 1I8LC 3C5SB 1F11A 5DD0H 1LDPH 3HRZA 2BX5A 1A7QL 3TH4T 4GRWH 4MS8D 4UUJA 1KN2L 3HC4H 2VZVA 4X7EC 4KZDH 2RB8A 1OLLA 3AU1A 2R1YA 1LP9B 5JOFA 1LDSA 1YEDA 3PP3K 3T2NL 4MQTB 2MOVA 3HTLX 3CVHA 1CLZH 4JZJC 5F1KC 1RVFL 2VL5B 3FFCD 3IFOB 4NFDA 1WWBX 4YLQT 3FN0L 4YNYB 5D5MF 5FUZL 3BOVA 3MNZA 4LCCA 4WI8A 5JTWA 2B4CH 3I6GB 4HJ0C 3ZE2E 1IM9A 1XIWC 1KPVA 2VXUL 3H3PH 2NY5L 3DMMC 2BCKB 1OW0A 4QTIL 3LEYL 4WI9A 4X7TA 1CLOH 2H45A 4K71C 3QB7C 3L6FA 3WO3B 1P1ZA 4MD4A 4LVNB 3IAQA 3RWCA 4M7LL 2VDQL 2WUBL 5EWIL 1N0LA 1BWMA 2PUQT 1H3PH 5C0DB 2QHRH 4ZO8A 1M71B 5B4MC 3RX7A 2AK1H 1BZ7B 5CBAB 2Z31A 3JSSA 2V5MA 4DN3H 1A6TA 2GITA 2HFGL 3IGAB 1T0PB 3BQUA 3SDXA 3UROR 1G0YR 1REIA 1T80A 3BH8A 1FIGL 2A83B 2R8SH 2BOCA 2LVEA 1ZLSH 4IOSD 4NPYA 5HHMD 3VU2A 2ZCHH 1WK0A 3DV6B 3GRWL 3O6FC 1KG0B 4JO1L 2XNAA 4LARL 3WDIA 4Z7WF 2DYPB 5F7LB 2AJVL 3O11B 4KVNH 4OUUB 2MPAL 4TTDC 5CJ5A 2WIIB 5DZNA 3V4UL 2W65B 1I1FA 3E1F1 5KTEH 4GQ9L 3VRJA 3FRUA 4GMTL 1NCDH 3ZKNC 3RWJB 2XA8L 4IMKA 5AZEH 1ZAGA 1S7UA 5B3NA 3ORJA 1GGIH 4HS8H 3M1BB 5FCSH 1LGVA 3WLBA 5JHLL 2X4UB 1Y0LB 2A6KB 4CMMA 2QTEA 3BKJL 3TESA 2CJUL 4Z7WE 3DX6A 1ZLWK 3SDDC 2J8UE 3GSNB 2FJHA 3LPWA 5D2NC 4RFNC 1NDMA 1T5WB 4YXKH 3JZ7A 4PRHE 4QHUB 2ZJSH 5IW1B 4LVNC 1AO7A 3OB8A 3CFJA 3T1FB 5HGHA 4UQ2B 4CW1B 3DVNB 1GIGL 5MEOB 1RU9L 5IB3A 4EVNA 2MHAB 3MLUL 1U6AH 2AW2A 3O2DH 1YEFH 5HJ3B 5I1AA 1ZTXH 2FH8A 4JFDA 1KJ2L 3MRHA 1DANT 2X4SB 1TZHA 5DJ2A 4GXVL 3OKKB 2C3GA 3QO0A 1KIPB 4P5MB 4IRSA 1UJ3B 3PG2A 3MV9D 2DLHA 2HJLB 5IB4A 2IAMA 4OF6A 4J6RL 5EBLB 1FO0B 2GHWB 4MA8L 1FV1A 4MXVE 4MXVF 5K9KB 1HINL 3VD9A 1T2QL 3O3DA 4P2RE 5GJTH 2ZUTA 2C3VA 2IH3A 2WANA 5EIIB 3WBDA 1A6PA 4HJGB 1MEXH 2JE8A 3Q6GH 5EUOB 1UM6L 3UBXB 4TSAH 1IKNC 2ICWA 2NY2D 3WUWG 1IAKB 4F9LC 5B39G 1OARH 2A9ML 3EYFB 3QT2A 4S11A 5F3HB 3REVA 1FVCB 1QRND 4XBEH 3CK0L 4JM2C 4C59B 2IALB 1N5AB 1MCOL 4JG0H 5T1LA 5DJXB 4ZFGL 4GQPH 1C1EL 2PETA 4NZRL 4ZFOL 5FYJU 1UZ6F 3D39B 1A7BA 5GS1B 4PRIE 1S5HA 1KFAH 4MNHB 1UWEL 5F1IB 3RUGF 2V2XB 4KHXH 3A6CH 3FQUB 1CN4A 2OL3A 1Q9OA 3QG7H 1DQLH 5EU4B 2D0HA 2CDEA 5HHME 5DQDL 3OJ2C 5DFVC 2P46B 1E28A 3BGAA 4JVUA 3H0TB 4PJ9A 2CDEB 2FRGP 3RGVD 4IHOB 1CVSC 3OBAA 3TZVA 2VXSL 5JQ6L 2X4QA 5T5FL 5H37H 3BKML 1A5FL 4HDIB 4JO2H 4POUB 1NCTA 4HKZA 1PX4A 2A73A 3PUCA 2XZCH 4ZO6A 2B2XH 2YWZA 3EIFA 2OR8A 4AEEA 4D9RE 3RGVC 1LEGB 4FQCL 2Q20A 5SWSA 1RJLA 4O4YH 5ICZB 3RX8A 5GISL 1GGBH 5T3ZH 4P9HH 3QUXA 4LSTL 4YXKL 5CD5D 2M1KA 5I1IH 5F3HA 1EEZA 4OLVL 1CICB 3TCXA 5JW4N 1GSMA 4D9LH 3EHBD 2ICWB 1MCDA 2P48B 3BGMA 3GSOB 3SGDH 3RI5F 5B3JE 3Q48A 3R1GH 4TSCL 2HJKA 3VGFA 5JA8B 1F45A 4OLYH 1M05A 4HDIA 4Y19E 2D4DA 3EHBC 5I73B 4APQC 2EDYA 4Y19A 1I8KA 5E2WH 1YN7A 2HVKA 4O51B 3MR9B 5ICXB 5L8KB 1FE8H 4POZD 2HKHH 2QQLH 1F2QA 1HH9B 5AUMA 1NMAL 5A40E 3KPSE 2DQCL 1B4JH 2AJYL 4OCMC 3MGTA 1YDPB 3MV9E 2VMFA 1BFVH 5D71H 2OJEB 3CC5B 3EO0B 4PJ7B 4N5EA 5F1IA 4IMKC 5GRVL 3PJSA 3BXNB 3T2OA 1A7QH 1NGXA 2X4SA 1AXTL 3FQXA 4E0RB 1BEYH 4YDKH 3HZKA 2XICA 3UO1L 2IALA 1T1WA 1N5YL 2N56A 3T1FA 2V17L 4ZAKD 2VISB 4N0CC 4X4XA 5CSZA 3P30H 3NZ8B 3V95A 2WBJC 2NXYC 1CGUA 2JELL 3T3PF 5JORA 1YYLH 2IWGA 1U91B 1FO0H 1RURL 1T2JA 3DVIA 5FYLL 1MF2L 3BZDA 3QIWD 4PJ5D 1T21B 3M17B 1AC6A 4MXQA 1ADQA 1S7UB 3QPQD 3N0PB 3F7VA 4PRBB 4LLVA 4EBQL 3MUGB 2DQJH 1J18A 3T0ED 2VE6A 4HHAA 4TTGA 3RWIB 3RAJH 4P3DA 3O4OC 5HYQB 2DTMH 1NANH 1IT9L 1BQLL 3KYOB 3P4MA 4MNGB 2F5AH 3QAZC 4Q0XL 4M00A 3P73A 1D6EB 4PJIE 1X5ZA 1K4DB 2LFGA 5I1HL 3QUZA 2GT9B 4WTWA 2NX5A 3CLFH 1Z5LB 1XZ0A 3D2UD 4AK1A 4O58L 5GS0C 3CFCH 1L4IA 2VL4A 4HG4K 3ES6B 2GSGB 3BH8B 4CL7A 4PB9H 2YRZA 3FT2A 2H32H 2ZSWA 3D9AL 2XA3A 4JFEE 2OYPA 4ERSL 4P23C 4D9RD 2X41A 3O0RL 2KUTA 4KMLB 4EI5B 4JM4H 4KY1L 4QHLA 3ZKMD 1FL5B 5L8LB 1B90A 1AKJA 1ED3B 4KJYA 4Y16D 1OAYH 5DD3H 4MA8H 3WLBB 1UH3A 4LEXH 4KJWC 4F7CB 1NC4A 2EKJA 5A2FA 5CKGA 3BKYH 1U3HC 3PL6C 4YGVA 1ZOXA 1Q9LB 1XT5A 2JJUA 3FRUB 1UG9A 1I7UB 4Y16C 4NJ9L 3I6GA 1NCAH 1VEPA 2WIIA 1T6VN 5CEYB 1CLCA 4QHKI 3GK8H 3LS4L 4AH2B 4LIQE 3F7RA 4HCRA 1QG3A 5T5NF 1LK3L 1WISA 4WW1B 5FF6B 4G7VL 5LCVL 1I7RB 2ZCLL 1FL3B 4JFOA 4FTVA 2L0DA 4UDTB 3T8XA 4M48H 3BQUB 1F11B 4Z8FH 3VJ6B 3MRQA 2V2TA 5TDPB 5BRZB 5IMOB 4RDQG 3VFWB 4KMQA 4A2MA 4R9HA 4WI4A 4JRYD 2EDTA 1PKOA 4YO0B 1CYGA 1RV6X 4L8BB 3KPLB 3P0GB 3SE3C 3G08B 1QSFB 4DZ8B 1QO3B 5BZDB 4LDOB 1MH5B 5EOCL 3UJIH 1I4FB 4PP1C 1AGFB 2E7LE 3HC3H 5F6HJ 4LHUD 4PB0H 3TPUB 4D0CA 1UZ8A 5H37G 2CKNA 4ODBD 2ICEA 1G7QA 5C08D 5DO2D 4X7TB 5HGGS 1YNLL 2VLKE 3VXMA 3NA9L 4G6JH 3LEXA 3U83A 5SX5H 1UM5L 5EO1A 3W5NA 2Y25A 4EN3A 2AXFB 4W81A 1LO0H 3H6JA 4JANB 1J0IA 3QR2A 5BS0A 3BUTA 1AR2A 3RL1B 4OGYL 4LSPH 4IOIA 1MHHA 4DUWA 1HK6A 4R90H 3VXTB 4TPRL 5BS0E 4HXBL 4NM4H 3FFDA 2NY0B 1X44A 1KPRB 1IBGH 3ARQA 1Q94B 4TVPH 5C1MB 4V1DA 1G84A 3G5ZA 3IXTA 4X7DC 4QYOB 3LQAC 2VLKA 1NH6A 1C5CH 1GHFH 3CLFL 4JPKL 5D6DA 4XVUD 2DIAA 3RA7H 3S37X 4MJ6B 1I9JL 1NAMH 5BJTB 4FFEX 1FLRH 2FSEA 4TUKH 2P5WD 5ETUB 2IFFL 4HIIA 1FVDA 1KBGL 1QQDB 1IC4H 1U8PB 3OKEB 4QRUB 4MJ2A 5HBBA 4X5XA 4K7PX 4J3XA 4N0UA 3K4ZA 3QEUA 5EC2A 4PGCA 4DZ8A 4N5UA 4BYHA 3UPRB 1MCEA 4PS4L 2J8UB 1ZXQA 4LNVA 6CGTA 4WIQA 4RAUA 1ORQB 5FKAA 2OX5A 4WEUD 4G8GD 4OQTH 1PQZA 4F58L 5EOCJ 3UBXG 5GRVK 1XF5B 1DJSA 2XKSA 5CMAB 4G7YH 4AL8L 1LDPL 3PWPD 4GW5A 4GRMB 4M03A 2NY3B 5KOVC 2JELH 2GAZA 2EIZB 4EQ2A 1RPQA 4RX4A 3VWJD 5JXAH 5HPOA 2WK2A 3OF6D 3F5WB 4U6VL 5EBMB 2VN4A 3C5ZC 2GTZA 1J8HD 1R3JA 2V17H 1HXYB 3UTTA 4KK6C 2EDKA 4IDLA 2VXQL 2YS4A 3HZMB 3H9ZA 4QWWD 3OXRA 5EOQH 5TE6L 2NY0D 3QDGB 4FFVD 4ORGB 4RRPA 1UWGL 2ZSVB 2DKSA 2HT3D 2Z35A 4OZHE 1O7VA 5GGTA 1DLHA 1ACYH 3QNZA 4DVBB 4MA3B 4U2YA 1F2XK 1L9MA 1KGCD 2NTFA 3CMGA 3QRFM 3F7QA 2B7DT 1OT1A 5DK0A 4GAFB 5HVHC 1HN1A 4FQXD 1FL5A 5JZ7C 2XA8H 2DM7A 3PQYB 2EIEA 3ISWA 1M7DA 2XQBL 2FO4A 1A7OL 5C07A 4RMSA 5IHBA 1FC1A 3G6AA 1AFVL 4R8WL 3FQNB 5IOPB 2K7QA 1RUML 1Y6KR 3G04A 5DT1L 4LIQL 1CDYA 4J4PA 4GAJL 5MEQA 1F58L 1HWGB 2BNQA 4F8TA 3B2VL 4G8GA 2PYEA 4DN4H 4PY8J 4ENEC 1MCBA 1RIVL 3PGDA 2D9QB 4XCNB 4PGDB 4UV7L 4JE4B 1V3MA 5J06A 3CCHB 1CTNA 4PJFA 2Q86A 3MZGB 1IAIL 2Z92B 1N4XL 4ODHL 3O9WC 5IGXL 4Z7VF 3IDMB 1FSKB 4GBXB 4MJID 2EE2A 1JGUH 1NMCB 1YJDH 3C2SA 3FHQA 1JMXA 5GS2H 2LQRA 2FB4L 5GSRA 5C0AE 3S4SB 4AIZA 3N1MC 1AGDA 1JN6A 2DDQH 3OG4B 4NQXA 1A3RH 1RY7B 1YEKH 3P9MA 4LPVA 4Q74A 4X5WA 1QSFE 4MXWL 3K74B 2R2HA 2NY4C 4PV8B 4AG4H 3OX8A 5CSZB 4M4PA 4JFPB 4TSCH 4HAGA 1HILB 2DJSA 2CMRH 4NKMB 2QQKH 4YFEA 5DTFA 2NTSP 3M8OH 4P0DA 3GJFK 5CJXA 2B4CC 4E0RA 4XP1H 1OB1A 4HFUL 4LLAA 4WHDA 5J9PB 2HFEA 1T0NA 3FAWA 4KZEL 2R2EA 2A1WH 4G59A 3V6OA 3TM6A 1F02I 3L3JA 1KEML 4MVBD 4X7FC 5ID0B 4HXAL 4UQ3B 4X0KA 1ACZA 4M6OL 4F15C 5I71B 3ECBB 1YEHH 2ZNXA 5HPMB 2CD0A 4QRRA 1WIOA 2A1WL 1A6WL 3PWUB 4JN2A 4MVBC 4MNQE 4R7DA 3QISA 5DI8B 2D7TH 2AJXL 1SEQL 1R5VB 3STBA 4U1NA 1HQ4A 1QSEB 3DSFL 1KCVL 3HFML 2Z91A 4YDJB 5DS8A 5AWNH 1Y18A 1NGZA 2AEPH 1H15B 4C83B 2CRIA 2MCPH 4MAUL 1GC1C 4P49A 1J12A 3V0WH 2YKLH 2DDQL 3ARGA 3WIHL 3GBNH 4WNQA 3FAXA 4HEME 4MMXC 4KDTA 1NGZB 4Z0XA 4ZFGH 1F4YL 1EX0A 5DS8B 5D7LD 1S7XA 1D5BB 1U41A 1QYGL 4HK0A 5I8CA 2P4AB 3SQBA 2IPTH 1QPPA 2W91A 4OSUH 4ZS7L 1G1YA 4U1MB 2YRLA 4ZTPL 3TNMB 4C58B 3ARFA 4JRYB 3GMPB 2CK0L 4IHOA 3TZVB 2NR6C 2WNGA 4PJ9B 1X5GA 4JDZB 3OAYH 3ULUF 1WICA 4X0KB 1CD1B 1KIRB 5EU4A 1OAKH 1NCWL 3GSVA 5E9DB 1CGYA 1IJ9A 1FRGH 3ALXA 1QKZL 3WLWD 1S9KC 3I02A 2NW2A 4MAYB 5GS1A 1IGJB 3D85B 4L8DA 4N0UE 4OQTL 4XBPB 3PQYD 3IKCA 4LPCA 2P8PA 5IBUB 1U95A 2DMKA 1MCIA 3VFOB 2A2QT 3VXUB 4NHCH 5IQ7L 3P77B 3QWRD 3QZWA 4XMLH 3CX2A 4OFPA 3VMOA 3RWHB 4Q7DA 3C8KB 4HIHA 1NGPL 3MZTA 4WRLA 1JGEA 4Y16B 3T4YB 5BVPL 4PY8I 1FCGA 4BSVA 4FABL 2KPNA 4DFHA 5C8JB 3KPNB 1MLCA 4HULB 5AD0A 1BLNA 4QF1B 1XR9A 3EFDL 4CU7A 5LGKA 1WUNT 4PG2C 3KR3L 1H8NA 3TNNA 4WDIB 2BFVH 5ALCL 1MI5B 2QSTA 2OI9A 3D25A 1A9EA 1C5DB 1NUNB 1TITA 3N85L 1F3RB 4O2CB 5IM7A 1MY5A 2BNRA 4U6XA 4O9HL 5C0IA 1EBPA 2Q76B 1ZT7A 3Q6FA 1JPTL 4QXUL 3RGVB 3HZVB 3U9PH 3PDOB 2EKSA 4YXLL 1I3GH 4WJ5B 3V5HA 3QUMB 3Q5YA 4NRYA 5EZOL 5ACMA 5KSUA 3I75A 2X5PA 3O6LH 4G8GB 4PD4K 4LQ1A 1TVHA 2X1XR 2OQJB 1IE5A 4KGJA 1GAFH 4JFDB 4KXZI 3WXVL 4QRSB 4WHTA 2EXYD 3MRJA 3O2WL 2NZ9C 4ODVH 5LAXA 1A4KA 3B83A 3FO2B 5IB3B 2L4OA 5E7FA 5D1ZB 4ELMB 4OD1L 2WUCL 3RP1A 1XMWA 1ULVA 2ED7A 5I76B 3HR5A 3JWDC 1ZWIA 4RZCA 4Q2ZA 4HKBA 1FAIL 1MREH 5EB9A 2OM5A 3HUJE 3L7FA 3TVMC 4XBGB 3MRBA 4L8SC 3AM8C 4P5TD 4FQQB 3LKSA 3DURA 4H88L 2DQEL 2EICA 5CJQH 4RBPK 3IXAA 5D70L 3BDYL 4ZFFB 1UEYA 2FHBA 5I19L 5D7LE 5I15L 3DV4A 2HN7B 4ZODA 1YYML 3C5ZB 1YY9D 2BOBB 5TPWL 3DROB 4PJHE 1NFDE 4CN1A 5CD5C 1U58B 4ZS6D 1VFUA 5FYJH 4H8WH 4L3CB 1Z9OA 4E9LA 1I9RL 3LRSB 5CJOL 3L7EB 1KG0A 1IQDA 3T0EA 2X05A 2FGWL 1T3FB 4KKBC 5IB5B 3B9KC 2AEPL 5I16A 2W9DH 4UB0H 2EH7H 3VI3E 5DJYB 1AGBA 1KELL 2X4TA 2H3NA 3NGBB 1RUQL 3GGWA 1WLHA 1PQZB 3K8LA 4NO5B 5FDYA 5T1KB 5F89A 3MOQA 1AJ7H 4I13B 1JI1A 1MFNA 3K2UH 1HCFX 1L9NA 5GS0H 2NPLX 3PQYE 1T1XB 2ZP0T 4ZAKA 5DEGB 1EZVX 4OLXH 3S3JA 3RVWD 4Z7QE 3QEUB 1WSST 3EUUA 3S97C 1IC1A 1GH7A 3K1DA 3BSZH 3FQTB 2UWEE 2V7NB 1UWXH 2G9HA 5E5RB 4PLKC 3P9LB 4BSWB 4K71B 2VKXA 1NSNL 4XB7A 2FD6H 4HQQH 2ORBL 4EZMA 2IADA 4AT6A 4K7PH 2AJ3A 1JRHH 3C5JA 1AQKH 4UNTA 3SDDB 3OAYK 1DN0A 5CGYD 4JFXA 1HNFA 2BSED 3DI2B 5BZWB 3DUSB 5FO7B 3HCVA 3S5LA 2XWTA 3SKMA 3RHWF 1E0OB 1E4XH 2C7UB 4Q6IB 4Z77B 5E1AA 1NMBH 4MSWB 2AXGA 3HAEB 3ET9F 4HK3J 2AXFA 5CGYC 3VXRA 2IPKA 1LE9A 2ESVD 2FBOJ 3LKOA 2O61B 2AV7B 4R0LB 2E7BA 1UT9A 4CADB 1BFOA 3TFKD 4I48A 4LCIH 5EN2B 3TPUA 1FZMB 1KB9K 1NAMB 1ZVSB 4M6NH 1CD9B 1WZKA 2AQ2A 5ANMA 3BH9A 1MNUL 1WBXB 3AREB 4IMLB 4YFLI 1WF5A 3HAEH 3PABB 2IQAB 4PJXE 3VDAA 2Y6SC 4HMDA 3TO4C 3JTSB 3OMZA 2VTFA 4D8PB 3BPNC 1N5YH 4PRID 4PIRF 4RSVA 3E8UH 1JNHA 1NCUA 3F6LA 4OLXL 3EKCA 3OQ3B 1CXHA 5LG1A 1S7QB 4LU5L 4OBSA 1VB9A 2AABL 4HPOL 3QUZC 1IKFH 1YC8A 3ZYOA 4NO3B 3B43A 4ZFZB 1FZJB 2AK4B 4H5SA 5CILH 4RGOH 4WO4B 1QLRA 2NY4B 1J87A 2X4RB 1A4JA 3FQWB 1WVZA 4JHBA 5EPMB 5JUEH 4YC2B 5E5UB 1K8IB 4YPJA 1WV7T 5ERWA 2C1OA 1TPXC 4E41B 1FFNA 1QA9B 4I2XE 1JTPA 1YEKL 1EIBA 2XRAL 3QJFA 5D1XB 3QI9B 4A6YB 4ZTOL 1K2DB 4JFHD 1D9KA 4NM8L 2XTJC 5CZXD 2G75B 1MFCH 1IAIM 5DGRA 3OXSA 4QCIA 4XPFL 4JKWA 4Z7WA 5IMMB 1DCLA 3ULUC 3VE0B 1W0WB 2J88L 1FFRA 3QWRA 1H3GA 1G7HA 5FKPB 4OF3A 3UTSB 3OZ9L 3BDBA 1AE6H 1WT5C 5HDQL 4LEOB 3I50L 3FT2B 5DFTA 3PWJB 4KTYA 5JW3H 3IVKA 1UH4A 5LQBH 1NAKH 4KDVA 2EIDA 1UADC 4QXTB 1HYRC 1MCHA 4PJAB 4LMQI 3MNWA 2LVCA 1YC7A 3U4EA 2Y72A 5FYKH 3SQOL 4RNRA 3U30C 3PWNA 4R8WH 1XIWA 3U36B 3MLWL 4UOW1 2AGJH 1TTUA 5HYQA 2JJVA 1IGYB 1RIUL 5FAAA 4HS6A 2RCSH 3NZHH 2N7AA 3D85D 4OB5H 1UXWB 3UDWC 4OV5B 1SEBA 4Z7UA 4UAOC 3M17A 4EKXA 4H26B 4XXCC 4PRPA 5DD1H 1BJ1H 4ZUUA 4BUHA 3TZVC 3BW9B 3AXLB 5GJSL 5E94B 4LHUG 3PV7A 2GSIB 4MA1B 4PJGA 3BUYB 3ARGD 4JFZL 3KLHD 4YR6A 4TULL 2ATPB 4Y1AA 2YC1A 1FFQA 3HE7D 4PUBH 3ERYA 2ZWLT 3TIDA 1ZHNB 4JRXB 5E2JA 1RUAL 3G5YA 2OZ4L 2I5YH 1ZGLA 4LLYA 3TPUE 1KCSL 5T3XD 3LHPL 4DTGH 4U1GC 1EK3A 1EJOH 3T0EE 3T3ME 3PJSB 3X12B 2V5RA 2OJEA 4QHNB 3MREA 1N26A 2JB6A 1BM3H 1K3ZA 4LKCB 1UM5H 4JPIB 1LK2A 3QG7L 4LAJH 3MR9A 1JF1B 2BSRB 4NOFA 3VFMA 3MFFA 3NCYS 4H25B 4HJJH 3Q5TA 3SJVB 1OAXH 4ERSH 2O26U 1BWWA 1G6VK 3OGCA 4NZUL 4JFED 3GSOA 5I8KL 3CXHK 3IJHB 2OTWB 4DEPB 2NY2B 3V5DA 2Z93B 5C0FA 2R4SH 2RQ8A 4JM2A 3FB7B 4N9GA 5IESL 2HWZH 1DEEB 2X1OA 1DN2A 4OD3L 4TULH 1A7NH 3CGTA 3QQ4A 1I8IA 1T20B 1NGQH 4GUPA 4IIQA 5IBTH 3VRLF 4KK8D 4NQVB 3WHE1 3DJ9A 3ZKQD 5GJSH 4G9DB 4WY7L 5SWSB 3KPOA 5BCAA 2YSSA 3NPZB 4UU9B 3AY4C 2VR9A 4RMWA 1R24A 1BQHA 2P8MA 5F7EH 3F58L 3GSXA 1XGYL 3P3YA 4U6TA 3VWKB 3RTQC 1OVZA 4RISH 3L3IA 3K0WA 2VDNL 4Y5YB 3QDJB 1YPZB 3HPLB 1DQJA 4L4JA 4KTEL 1E28B 2YXMA 3CFDA 1TZIA 3TIEB 3HR6A 4OLUL 3V7MA 4XXDA 4GW4B 3SDCB 4KK9D 1WFTA 5CIPA 3CMOL 3PE9A 4N1EA 1L0XA 4NZTL 1EEYB 1JK8B 4YHOL 5FYLD 5A1AA 4NQDA 4Y4KA 2ZUYA 3HE7A 1F97A 4Y2OA 3IRPX 5TE4L 1BJMA 4HGMA 2GJ6E 1CXKA 5ABDE 5KSBF 1GZQA 3MJ6A 1N5AA 2AK1L 2ZUUA 1RZGA 3BPCA 3ZKXC 1P84K 1X5IA 5DYOA 3NN8A 3MV7B 3U0PB 1TFHA 1SY6L 1XGRA 4R4ND 3RVVD 4G7VH 4YHIB 4WU5A 4U1HA 4NNPH 4KHTH 5JMRA 2X9WA 3HUJB 3NZHL 2XFXA 1EMTL 1JNNL 3FHAA 1QRNE 4Y2DD 5TFSL 2AKRB 5BVPH 4NDMB 3SEPA 1QBLH 1WTLA 4UAOB 3BPLC 4QRRD 3L3GB 3F12A 4TRPH 3CD4A 7FABH 4JZOB 5HHMB 1XIWD 3LRHA 3CH1A 2X7LB 4OCWL 2VDKL 1DQQA 3P0VL 2G5BB 5C0RL 4N0YH 3QO0B 2Z31D 5JW3L 4HPOH 1J9CT 5KAQG 4X7SH 4MQSB 1NC2B 2HFGH 4YDKL 3IFPA 1KCSH 3VGEA 1P2CB 2P7TA 4BK4A 4L3EE 4CW1A 2E9WA 2Z31C 4P2RB 5BXFB 3O8XD 4PRIB 3O2DA 2GTWA 3AS2A 3CDYA 1OF2A 3RNQA 2KZ1B 3HPJA 3VWJB 1K3IA 1KLGB 1DR9A 5T1MA 3KJ6L 1VHPA 1MRFH 4LVHC 4KRMB 1OAUH 1AD9A 3L5WB 1R0AL 2OSLB 4HCRH 3T3PE 3PWPE 4BUGA 3MJ9A 2DQHH 5ID1A 5IFAH 2DQJL 5CIPH 2D03L 5C08B 5A2LH 4WENB 4P4KD 4GS7B 5DWUL 3INUL 3P11H 1QBAA 4NN6B 4GRLB 1J8HE 3OKYA 4NC1C 3PIQB 4AIOA 4KROB 2ID5A 3GJFA 5CILL 4BFIB 1W0VB 2LV4A 3VI4E 4Y19D 3T65A 4P2CG 3T0DA 1IEAA 3QCVL 4JREC 2WAHA 3MRMA 4FQLL 4WUUE 2NZIA 1NUGA 3NCJL 1P7QB 3D69B 3KYNA 4ZSOB 2Y06H 5E2UL 1JBJA 3CFBA 3FT4A 5DURD 2DLGA 1MNUH 1UKTA 3QEQA 2ITDA 4HIJA 4RMVA 3TA3B 1OPGH 4QXGH 5HHPA 4HD9A 4F58H 1V7ML 3VA6A 2J88H 4YAQA 3AY4A 1JZ2A 4M1CC 3BZFB 3HI1A 4YHNA 2PW1B 3TWCH 2DWDA 3KPQB 3L6FB 1YNLH 4S1QH 3BP7A 5E1HB 5JPNB 3MV9B 1JZ7A 4WEBL 4NKIH 3MJ9L 4YUEH 5ADOL 4G3YL 1BOGB 5MERA 3LN4A 4LSSH 4LSUH 4XMPL 4PJ5E 5TGBA 2R23B 3S37L 1KT2A 2VL5A 3O6ML 4GAYA 4LCUB 2BSTA 4XMKL 5DVOA 5MP6H 5C6TL 3HG1B 3ZTJG 2W60B 2PTUA 2UZIH 4JPWL 1I9RH 1LP9A 5JOFB 3LV3B 2W0FB 3B9VA 2FIKA 3AMLA 4WVRA 3BIAX 5IBTL 3ZE1F 5BOPA 4PR5B 4F9LA 2ZKHH 4EIZC 3G9VA 2EDDA 2P24B 1PKQB 5INCA 5KAQF 3IDYC 1EXUB 4JM2D 1HQRA 4DKFL 4DZBB 4HIEB 1DUYA 5I1EH 3O4LE 1RJCA 4PJ8B 3BD4A 1AC0A 1CGTA 3B6SA 1YUHB 3EDEA 4U6YA 5MI0B 3GMMA 5C0CA 3L1OL 5FCUH 1EJ6A 5IV2A 4LLUA 3C6LC 2YUZA 5E8EB 1AIFA 3CZFA 4PP2A 1MHPL 4D0DB 1IAII 1RHHB 4LCIL 2QADD 5SWQA 2VDMH 2BNUA 4LF3A 3RDTC 4QT5A 3ULVE 3VXRE 4Y4FC 5FM5O 2BVTA 2BY0A 3AS0A 1BM3L 1CD0A 3MMEA 2HT4D 4DKEL 2R0ZL 5D5MA 3BIKB 1ZEAL 3F8UB 4LAQH 4I4WA 3C9NA 4L4VB 3TT1H 5FB8A 5IHUL 5B8CC 2Z0BA 5GZOC 3U7AA 1ZHBA 4NYLA 5DHVB 1JPFA 1QFUH 2HFFB 5L0QC 2AJUL 2E8YA 1OGTB 3P40A 1AI1L 4PJEB 4ZFOB 5HHQA 1ZSDA 1UM4L 3WL9B 2XKNA 5I19H 4JREB 1DE4A 4GOSA 1MUJB 5C6TH 5MP6L 1BF2A 1QACA 1N8ZB 3L95B 4WUUD 1AR1D 5DJZB 5IF0B 2AS5M 1CG9B 3QWOB 1IC7L 2GCYB 4Z7NE 4HSQA 3O4LA 2Q7YA 4F57H 2HKFH 1SJHB 5C0ND 5E6IC 3B9KD 2CH8A 2IANA 3VDBA 1NBQA 3QEHA 5JW5A 5IKCA 4NQCA 3QUYA 4K7PY 3KHQA 4CRPA 4R3SB 3WXWH 1QR1A 1KXQE 3X13B 4N0FB 1B4RA 3MCKB 4OGXL 1FNGB 5H94A 3U46B 2Y7QB 4CBPA 3JBG7 2ZUQC 1SBBA 2APBA 4WTZA 3GMNA 3DVGA 4C56A 1A9BB 3WNKA 2GYSA 1DVFD 3C09C 5JO5B 4F15B 2BC4A 2GK0B 3E0GA 2WW8A 3VXSB 1LEIA 1T6WA 4TQEH 5DC4B 3HNTL 5LBSL 2CLVB 2FECL 4DEPC 4D2NA 2VDRL 1CIUA 4PLOB 4A6YH 1YYMH 1A1MA 4BJLA 2CJUH 4NO2B 4I1NB 1U8JB 2AJUH 5L9DH 4PTTB 4YK4C 4P46A 5DWUH 2HKHL 3NABH 3QPXH 4XMLL 3JV6A 5FA3A 3SDCC 1YZZA 4GMSH 3X14B 3QIWC 4EXKA 2A6JA 1W72H 1DQTA 3R06A 2YPLB 2GUOA 5GXBB 1J7VR 4ZPTA 4HMCA 4APQA 1Q0XL 4H0GA 4LP5A 5JPMA 1OQXA 3VWKC 1I3RB 2H8PB 4U1JB 1D7FA 4D9LL 4OCXL 3DGGA 4K7FB 1S7WB 2VUOA 3QHZH 5J6HA 3ZHLA 4J23A 3ELAT 5M7QA 3TT3H 1X4ZA 2NNAA 3ULVD 2DQTH 5C3LD 3MRGA 3MJ8A 1NEZB 4ODWA 2ICES 3RL2B 5A2JH 5CJBA 4NKOA 2UWEA 1M1SA 2DQFA 1SBSL 1UC6A 3RY6A 1NDGB 3SO5A 3LIZH 2XWJA 3NIFF 4UILH 4FFZH 4EUPA 5F97E 2B1AL 3QCTL 4MCZA 3X11B 2JJSC 5T5FH 4ONHB 1BBJA 1LNUB 4ZDHB 1I7ZB 2E9IA 1PKQE 2FWOB 1BJ8A 5E24E 2APFA 4J8RA 1A64A 3MLXH 4MCYB 3LEYH 3RDTA 3STLA 3PV6A 2VC2L 1TVDA 5LGJB 5CP7B 5JLZB 2B0SH 3QIUB 4HW6A 5C0CD 4ZD3H 3RWFB 4XX1G 4M1DH 5E2TH 1MAML 4NCC2 4XNZB 1M7XA 4XCYA 3ARFD 4X6FB 4JDTH 5H35A 4RAVA 4Y5VC 1P53A 1OT2A 3PGCB 2YN3A 3UYRH 4L8CB 1NKOA 2GI7A 3HRPA 5D7KD 4XCCL 4ODXB 4WGWB 3LY6A 2ARJQ 3C6SA 15C8L 5C9KA 3SO3B 1V3JA 5GGTL 1ZHLA 3QULB 3IJSA 4OZ4A 1QRNB 2W59A 3AFLA 1I7TA 1B0RA 2Q8AH 25C8H 2Y23A 4NUJA 4IRSC 1RJYA 2EH8H 4I77H 4MDJB 4P46D 1FAIH 1MREL 4P9MH 4HIXL 2DQTL 3VRIA 4Z7VA 1F13A 2FIRT 3C6LA 3KPSB 25C8L 2ITCB 3QDAA 2WINA 3E6HB 1U3HB 1XCQB 1ERNA 1U93B 2W9LA 1OTSD 1JNJA 4WFHE 3EYQC 4KI5F 3QO1B 3CH8A 1RFDH 3RWDA 2QR0A 3GSQB 4JO4H 1DBJL 3DVFA 1KEGL 3MBXH 3TBYB 2VC2H 3OPZH 1PGRB 3DYMA 1VGKA 3WJLC 3U4AA 1AQDA 4OQTA 4UV4L 1ZA3A 1DBBH 1WAAA 5EA0L 1HHJA 3WE6A 4U6HA 1HYSC 2QKIB 3DOSA 3U30B 1LD9A 4YQXH 5IFAL 4G6FD 4MWFB 3FB8A 3PGFL 1FQ9C 3FO1A 3MYJA 1JGUL 2V9RA 4K3EL 1INEL 1F3DJ 1S7VA 4RFOL 2DQDL 5DUMH 5FYLH 4KI5E 4X9FA 1P5UA 1HHKB 3MRFA 4R4BB 4LLMB 3OSKA 1HHGB 5EU5A 2DBLH 5T3XL 1L7TH 2MSPA 4E42A 2YUWA 1HHHA 4NWUL 3WEXA 5JHLH 2Y07H 2FEDD 3NCFB 4LNRA 1M7IA 4LLDA 1F58H 3BGFB 4KVCL 5JIHA 3REWB 4CMHC 1K8DB 1U8HB 3HMWL 1BVZA 5IUSA 3TBSA 4B41A 3GMRB 4F7PA 1JGLL 2X70B 1RD6A 5D72H 4LP4A 1OCWL 3DUUB 2BJML 2EYRB 3IKKA 3MOAH 1JHTB 3CLEL 3FQRB 3LSOB 2IFGA 4D9QE 2EYRA 3SQOH 1EJOL 3TCLB 1I8MA 3QIUD 2BXZA 5HYSB 4HUXA 1K5NB 4XNQB 3S34L 3B2UD 4QOKE 5E0QA 3VFNB 5CEXB 5T3ZD 1ZLSL 3QUMH 1G9MH 3TC9A 4FQXA 1JFMA 5C0EB 1OWRM 3I6KB 5EO9A 4NQSA 4QY8A 3C5ZD 2AXJA 4Z0BL 5HGDA 3O6KH 2JB5L 1EHLH 1FNFA 1FIEA 4NC1E 3NABL 3ROOB 5D6CB 1RK0B 3W9DB 2FBJL 2ZCKH 2DLTA 5D7KE 3N85H 4FFZL 4CVXA 1A14H 3WFDH 2HVJB 3V0VB 5HGBB 2BVPA 2FJGB 3BE1L 5B21A 3IRZA 3LQMA 2DM4A 2XRAH 4PJCB 1BVKA 4K3GA 3SJVD 4R90L 5TQ0H 1FL6A 4GG6B 1KCRL 4M1GH 1T0MB 3EYSH 4UDUB 1I1AA 1CXFA 3U6RB 2YEZA 4RA3A 4ORZC 3M45A 2FLBT 4QRQB 4Y5VB 2KQNA 5JZ7D 3QNXA 3RTQD 5ESVA 4X4YA 2EYSB 5KJRH 2C4FU 5JR1L 4AEIH 5DT1H 4OD1H 1NMAH 4RGND 3CUPA 5IP4A 1P9MA 2WINB 1M6OB 4G80B 1VACA 5J6GB 5DDHB 5DR5H 5GGUB 4JY6B 2HKFL 4Y0GA 1OCWH 3BP5A 3SDAD 3V52L 4WW2C 4G8FB 1KCRH 2HTLD 1UQSB 3BPNB 1D3CA 4X80H 2ARJA 2VIRA 4P2OA 3W0WE 4MDJA 2QSCL 2YOCA 4J3OC 3WFEH 5IHZA 3X3GL 5DEFA 1YN6A 2VQUA 1CT8A 5I1DB 4X4ZA 3OR6B 2CKBB 4K8RH 4YWGH 3BP4A 1X9QA 5EUOF 3UZVB 3PWVA 3IS0X 3O3BA 1E4KC 3P0YH 4HPYH 1NGQL 4HZLA 3IAGC 1E27B 2SEBB 3EO9L 3TBTA 1G7PA 2HG5B 5JW4R 4NM4L 3O9WD 3KLSA 1Y6NR 3RY4A 4FQCH 1EO5A 5FO8A 1BZQK 5DRWB 1P6AB 4GG6F 5ACZA 5DK3A 4MA7H 2J7LA 3BMWA 3UJJL 3GUTA 3ZDZF 4NZDA 3RKPA 4IRJB 3BJLA 5DGQA 1HSBB 5F6HI 1G6RL 1RUKL 1RZKL 2YWYA 4M6AA 3RI5K 1HI6A 1VGEL 3ALPA 4CMHB 1V5JA 3MOAL 5DJ0B 1I7ZA 2Y5TA 3G5VA 4HWUA 5F1SA 3WD5L 4KK5D 3PWLB 3O3AB 4P2QB 4GO6B 1LQSR 1FVEA 1CXLA 1CCZA 3BIBX 1VCAA 5I1EL 4P4RB 1DL7H 3DO7B 1TXKA 4LVOB 2QBWA 4UV7H 1QSZA 2EXWC 3QXWA 1OSPH 3OKNB 1SJEA 1YQ2A 2YR3A 1R5IA 1VEMA 1L7TL 3DXAD 1Q9WB 4L9LA 2UUDK 4HUWB 1EGJH 1MCRA 2PXYB 2W9EL 2X4NB 1D5ZB 3ILPA 3KWWA 5E08L 3O6FD 4LFHG 5DA4A 1HZHL 2KDGA 3ARZA 4FMKA 1ONQB 3HA0A 4NHUB 2V7HB 1WEJH 3D0LB 4M62L 1A1NA 4XHQA 1RK1B 5B4MD 3H3KA 2ARWA 1IGIL 5FDWB 1S9WA 3NBNA 1JL8A 3GM0A 1T5XB 4KUCF 3RKDC 1EO7A 1KCKA 2DTML 4JPWH 3VGAB 3WJJA 2JJWA 4LKXA 2A6JB 1TJIH 2F15A 3FB5B 2HT2C 5EU3A 2VABB 3SJVE 1GGIL 4HH9B 4HKXB 1QFPA 1A6AA 2XZAH 1BVLA 1JVKA 3RIFK 1CE1L 4X4MA 4G9FB 4RIRA 2QV2A 3F7YA 4I2XB 1MFBL 5EUKA 1F3JA 1QFOA 4GAGH 3U7WH 1J0JA 4PRPE 2VLLB 5F7KC 3EBAA 3NGBC 2YBRB 3CDGA 4OZFA 2H32B 3L1OH 5FCUL 4DTGL 2OS7A 3KDMB 5IJVA 1PG7W 3WN5A 1C08A 4LLQA 2UVEA 3SCMB 3O2DL 3CVIH 4PRHA 4GKNB 3EOBB 4PRAA 3WFEL 4S1SL 3L3DB 3I85A 1NGYA 2MQCA 4Z95H 3PHOB 3S36L 3UTSE 5JXAL 1AE6L 3W9EA 3D1MC 5ESAB 2D2OA 4XPHL 5EOTA 3B2VH 3ZKSD 4TSBL 3VGDA 1PJ9A 3ZE1E 3MRCA 4MD0A 1NGYB 2B5IC 2W92A 5DJAA 1LK3H 5TDNB 3QUYB 3SCMA 3QYCA 5CSBA 4Y5XA 3SN6N 5IBUG 3LN9A 5FOBA 3U0WH 1KF9B 2ADIA 3MJ9H 4YUEL 4OLYL 2WQRA 4OV6F 2ADJB 1U92A 2DN7A 2W07A 3W0WA 4Y5YC 1KJ2A 4OT1L 1I1AC 4U31A 2CO7B 1MFDH 2NY2C 2FB4H 3RA7L 2HJFB 5CZVL 4JFQB 1WCBA 1SY6H 1FG9C 5B22A 1BVLB 1JYXA 2XACC 3WSQL 2XKNB 3MRLA 4LSRH 3TA3D 5C0BA 1FSKC 3GSRB 4LCWB 4OM0H 2A6DA 4FZ8L 4HLZG 1MOEA 1DSFL 5KVDL 1MWAA 5J12C 1FJ1A 4ZYKB 2K9UA 3OZ9H 4JFYA 1RK1A 3VFPB 1IC5L 3AREC 3CVHL 4RGMB 1G9EA 4TVPE 3DXAE 2VWEE 4QRRE 2QJDA 4XAWL 4PJIA 2JCCA 5DMGC 3H9HA 1KTLB 3S98A 2BNUB 5AG8A 3O45A 4EIGB 4R0LC 5GHWL 5D7SH 4E41D 5CEZE 4ODTH 4X9BA 3S88L 1KLFA 3MUZ1 4UT9L 5AZ2H 5JNYA 1CGSL 3EDJA 3LS5H 3HHRB 4Y4FD 2M2DA 4YHLH 4PJ8A 1WBYA 3BVNA 4OAWB 3O3AA 1G9NL 4PJDA 3RTQB 4L3ED 3FMGL 5M94B 4OLVH 1MRFL 3MNVB 2BFVL 4KDWA 4CVUA 4W6XB 1A1OB 4K3DH 4PRPD 2HA1A 1XGTA 2FIKB 3OKMA 4WWKD 2P5EB 5KSAD 1QVOA 4YH6A 2IPTL 4MZ2A 3RWGB 1MFAH 1QYGH 3SKOA 3LQZB 5F3BB 5BO1L 1F4YH 5FV1L 2R9HC 3LKPA 2YPVH 5F8QC 1KN4H 3TJHA 1I9EA 3BESR 4JLRB 4UIKL 3VFGH 2D7PA 5I1LB 2SEBA 4KKBD 4L4VD 2FR4B 4BQ6A 1FYTB 4Y4HA 1QHOA 2F58H 5MENA 4KPHL 3O3BB 1ZANH 3U7WL 3E2HC 1FPTH 3AB0B 1YEJL 1QLFA 3IDNA 3HI1B 4YHNB 3MRKB 5DEFB 5IHZB 5HHOA 4KHXL 2ARJB 2D7TL 2HLAB 3H9SB 2Q87A 4G5ZH 3SHSA 4JHAH 4ZUSA 4KTEH 5JA9A 4HJ0D 4PB0L 1WZ1L 2CKBL 3MXWL 3VFUB 4YHYC 4R4FH 4P9ML 1XF3B 4HEPG 2ESVA 3IDGB 3BZEB 2C26A 3D9AH 4MNQA 5GGSB 2CXGA 4ZAKC 4F3FA 1AXSA 4WV1A 1Q9KA 3I2CH 4R2GC 1DVFC 2RAMA 2EYSA 4PY7B 1CBVL 1CFQA 3ZL4L 4WY7H 4YK4B 3T3MF 3ZE0F 5HYJB 4NWTL 1RHFA 1CXIA 1T04A 4M3JA 5LJYH 1ZS8A 4MB5A 4PJCA 4TPRH 5GISH 4HS3B 4JDTL 4HGWB 3QPQC 2J6EL 2BNRD 1AHWA 4J3WA 3T0EC 2BP3A 3HC0A 4POYA 4BK5A 2OR9H 5I1KL 3W9DA 4CNIA 4CVZA 2NXYD 1A6ZA 1JUFB 2NMSA 5DQ9A 1IQWH 1OOAA 4I3RH 3IJYA 1ORSB 1QFHA 3FOLA 3FT3A 5T3XE 9CGTA 2OJZL 4TUOA 5GHWH 1A0QL 5GGQH 5F7UA 4ISVA 3I9GL 3VWKD 5A43C 1W0YT 5DQDH 1BZ9A 5TJWK 3CSGA 1EERB 1K85A 2AEWA 1ND0B 1NJ9A 4OCYH 4BSJA 5CEZD 5J13C 4AZ8A 5IB1B 3BD3A 3TBVA 3ZYZA 2WY3A 2CIKB 5C09A 3AM8A 4QHMA 3IFNL 3ZYJA 4PRIA 5F7MC 2R0KH 2VR4A 3D5OF 5SV3A 5KSBA 5H2BA 4ZPVB 1P2CA 3KLAB 5HI3C 1IGML 3FQRA 3LSOA 3O4LD 4ODUB 3QUKB 4Q9QL 1J1XL 2FDBP 4JQVC 3RU8L 4YJZL 4AM0A 5IVXE 2H2SC 3BAEL 1DBMH 1INDL 3QXAA 5TE7H 3U4BL 2NXZC 3KYKL 5I30H 2YD8A 4MXQC 3R0NA 3CH1B 2R69H 4CU6A 4NZJA 4OT1H 5I8EA 4HS8L 4EJ1C 4NQCD 4Z7OF 4YBLC 3LS4H 3NMEA 5AZEL 4AENB 4G6FB 5C6PB 3UDWA 3QG6A 1JZ5A 3K80A 4LGPB 3GSWB 3QG6B 2ZOKB 4CNIB 1T83C 2E27L 3K8KA 5HY9B 5D2NA 3S6CA 5GJTL 3SGDI 3R1GL 2XFXB 4XPAH 3FN0H 2XPGB 4L4VE 2FL5A 2WV3A 5DZOA 2RCSL 4BA8A 4CN6A 2E7HA 3B9KB 2MJWA 3LH2H 2OXGA 2VNCA 3DX8A 1XGRB 5HDBE 1TQCB 3O2WH 1MIML 3PL6D 1JV5B 1IC5H 3MYZA 3PF2A 1HHJB 3WE6B 1P7KB 3DSNA 4LRIA 4XNYL 4N5EC 5BQ7A 3JWDH 4X6CE 1E4JA 3HMWH 2AVGA 3OKOA 3QH3A 3KYMB 32C2B 2E9JA 1FFPB 1OGAD 3DBXB 2Y06L 1F3DH 5E00A 3JUZA 5IWLA 5KSBB 2VLRB 1VADB 2CIKA 3LD8C 5C09B 1KB5A 5IB1A 1TDQA 1S5IH 3IDGA 5I9QC 1TETL 5E56A 1DQDL 1RI8A 4CGTA 5DRXA 4U4BA 5B8CB 1T66C 3MRPA 4M6NL 2VR5A 4XXDB 4Z7VB 5BMFL 1I1RA 1ETZB 4QRPB 1QZ1A 3O3EB 1S8DB 3GMQA 3IU3A 1EZVY 5SWZB 1HE7A 5B39A 2X1WL 1MCWM 3DRQB 2DQHL 2X4OB 4FA8A 1IAOA 4V2CB 4XP9L 4FXKB 2BNRE 1P4BH 3JVGA 4X98A 1MFEL 4HKJB 5E8PB 4HF5L 1HKLL 3STZA 4JFDD 5DFVD 1DBJH 1MRDH 3AAZA 4GBXD 3TV3L 5FO9B 4XBEL 2HAZA 3A67H 4X6FA 3EDFA 3SKNA 4JPKH 4NNXA 3MCG1 4LCCC 1QVOB 1A02N 4XAWH 1OAZL 1XH3A 4LSVL 1IZJA 5E95B 1NAKL 3Q3GA 3SKJH 4XVJH 3ARGC 4LVEA 3VI3F 4JCMA 3UTZB 1FH5H 4JZJA 5CEZH 3I50H 1MWAL 1MI5D 2LAAA 1QPXA 2P49B 3LN5B 2PXYD 4Z5RA 3HE7C 4NKDB 4OKVA 1LO5A 1MAKA 1G0DA 4KMTL 3JWDL 5ENWB 3S36H 5C9JB 4G9FE 5E8NA 1BBJB 4D0BB 1KPUB 1RULH 3D3VB 2ILLA 1MJJB 3P4NB 4PV9A 3E3QC 3FFCA 3QFJD 3VFMB 3KXFD 4DKDC 4XPFH 5D1XD 1B4JL 3GMLB 4HWNA 3DIFB 4Z7QF 2APXA 3WIIH 3S9DB 4BZ1L 1UCBH 5GIRB 1U8LA 1L6ZA 3MREB 1A2YB 4U1KB 1C7TA 1JGDA 3HC3L 3LKNA 3UX9B 3ZDYE 3VH8A 1CFTA 2NY1D 4OD2A 3LKPB 3VXPA 3Q5OA 1RJZB 1DVFA 4MQ7A 4M6MH 4OCRH 4WV1C 2VRAA 2DLEA 3LQZA 4JRXA 3OKLA 5JPMB 4PTUA 1N59B 5FGCE 3EJZD 2P5EA 5SWZD 3KYKH 4ZYKA 1FP5A 4KDTC 3LD8B 2NY7L 1IGIH 3P4OA 4BKLA 4X7CC 5EDXA 2BMKB 3HB3C 5KANG 4PPTA 1X5HA 5IESH 5C0GB 3VWJC 3AS1A 4UT7L 3RZCB 3DYPA 4F7EB 4Z95L 2IAMC 3PDGA 4PJDB 3RTQA 3D3VE 4HWEH 1HH6A 4OAWA 3C08H 3H7BA 5CINL 5KSVB 3GI8H 2D7OA 2IGFH 4MQXC 2VAAA 2D4FA 3PWPB 3UPCA 3G9AB 4PBWD 5CJXC 2CRYA 4MA1C 4QWWC 1HHIA 1G9NC 1GGCL 2G60H 5D7LB 4PLJD 1F4WL 1EFXD 3MACH 1VPOL 1DL7L 4KROC 3SDAB 3M8OL 1RUQH 4JRYE 3PWNB 3MOBH 4X4ME 5DUBA 5KJRL 5JXED 1K9TA 1WBZB 2V2WA 4PLJC 1DQLL 5KW9H 4PJIB 4Y7MA 1IEHA 2BVQB 3DTXA 4XZUB 1MQKH 2PR4L 1V7MH 3I3BA 3CSPA 2DM3A 3G6JA 2WBWB 5EOTB 1B0GA 2QADB 3B9AA 3PWJA 4LEOA 4H8WL 4ZSOE 3RPIB 1FJ1B 1UCBL 5EFIA 3IDXH 3K3QA 4DGYL 4RFEB 4HUVA 2CLZB 4PJGE 5F88A 5C0BB 4OD3H 2H9GB 4WTZG 3RY5A 1JRHL 5JW5B 4JQIL 2FZ3B 2X1QA 3QIBC 2D3VA 5D7IA 4FS0A 4L5FH 1K2DA 1SJHA 4XHJC 4U1GB 1H3TA 3ZYIA 3VG9B 4V3DB 4MLSA 3V4VH 3RVVC 5FA4A 3BDYH 5DD1L 1AP2B 3QIBD 1S7SB 5ITBL 4ZQKA 3ZKMC 3RZCA 2BVYA 2H1PH 1CL7L 3MLSH 2XWBB 5LXGH 4AEIL 2VITA 5I1CL 3V2AR 1HSAA 1JYWA 5ICYB 3KXFE 4JG1L 1LILA 4QRPE 1ZANL 4JZNA 4OGXH 2DB8A 3GO1H 3HE6D 4PJIF 5JQHC 5EZIH 4KI5D 1C16A 4M7JH 3BHBB 1NEZG 1XGUA 1A1NB 1RUKH 3CXDL 4XC3L 5LXGL 1JJUA 3GRWH 5FGRA 2EH7L 4HH8A 5ITBH 3VH8B 1QBBA 4QT5B 4Y1AD 5DC0A 3HE6C 3LKNB 4HBCL 4G8GE 4PRAB 5KZCD 4TUJA 3UMTA 1N0XH 2X44D 1C08B 1WWCA 4LLQB 4A6YL 2FX9L 1GJIA 1BEYL 4PDCE 4MJ5B 3AREA 5BMFH 1M4KA 2FEEL 4NQEE 4TNVF 4HPYL 4X6BB 1NAMA 1INEH 5IK3B 4FQ2H 5MEPB 3SDXE 4S2SA 4CADA 3U1SL 5AYUH 5E4EB 3ROLB 5CJQL 1ZHKB 2F54A 5HHNB 5IVXB 1PKQA 3VH8G 4AYFA 5DJ0A 4Z0BH 3VXRB 4JVPA 4NHCL 3LS5L 3V6FA 5T3ZE 3MLRL 4PP1D 3G5XB 4WI6A 1JMZA 5LKNA 1S9VB 1PZ5A 2BRRH 4IRJA 3QIBA 4PGBB 5FDWA 1OTUD 1N59A 1JRHI 4JFXB 2C1PB 5D8JH 1ODAA 3JV4A 5I1CH 5I1GH 4GRWB 1MCWW 4NRXA 4RCAA 2CDFB 4XPAL 3VXPB 4JO3H 2J4WL 1NCWH 2FHFA 4N1CA 4MD5A 1OAKL 4OI7A 4G6KL 5CHNA 5KVFH 1BIIA 4U1KA 1Q9WA 3S3SA 5TDOB 1H5BA 5TQ0L 1IRAY 1AXTH 2XN9E 3U9PL 4TUKL 4L1HA 4EN3C 3D2UB 3W2DL 2P5ED 5SWZA 1TJHL 4JHWH 2VIRB 4P2OB 4JJ5A 3CIQA 3CMOH 3C8HA 1IEBB 2AJZB 1FGVL 1DBML 5DRNB 3RVXD 4LOUD 2Y5TB 2ITDB 1AH1A 1JZ4A 5GS3A 3TT1L 3WIHH 4G80A 4Z5RB 5F89B 4HC1A 5IVXF 1H8SA 1Z2KA 3SY0A 2IBZX 3MA9L 1HSBA 4HUNB 3G6DH 4M6ML 4OCRL 2YA1A 3GUTB 3F58H 3NACL 3KYMA 4P4KB 4NNXB 3H42H 3LPGA 2BNQD 5EA0H 1PSKH 1MSPA 1IEAB 3T77B 3VGGA 4I9WD 2OL3H 5CKAA 5TH2A 1FN4B 4GRWF 4BFIA 4X98B 1FNHA 1QSFD 2EYTB 4OLEA 4YBHA 1EO8H 4M43L 2DD8H 3DROA 5DF0A 2GQHA 2HVJA 4R96B 5K59E 4XNMB 4DOHE 5HYSG 3EYUH 3WS3B 4P23B 5K9QI 4S1SH 2QEJA 1PW3A 5EBWA 2Q8AL 4DGIL 3F7PC 1GGUA 1VKXA 3BFOA 5IHLB 2UV3A 5T1MB 5EULV 4JFFE 4Y1AE 4CDHA 4KZEH 2KQMA 3BSZL 1A5FH 5IROC 2HP4A 4JKLA 5DRZA 5AEAA 4ONGL 3ME0A 4QTHA 1VERA 2O5ZH 1M6OA 4ZTPH 1C12A 3UEZA 4CUCA 4KRPB 1VADA 4NQED 4RMQA 3DNKA 4Z18A 5HI5C 5CBEB 1TVBB 4X4YB 2GIYA 3DMMB 5ESQA 3C6LD 4M7LT 3QNXB 5LAXB 1LEKA 4Y5VA 4K8RD 4YQXL 4GH7B 4ETYA 2ZOLB 3IDJA 3DUUA 4MNQD 4OGAD 3QA3A 1KYOJ 3RDTD 2VLJE 4FFWD 3TBSB 4Z7UE 5IMKB 2EE6A 4S0TD 3NACH 2HT4C 5L2KD 3OKDB 5IEHA 3QXDA 1DQQB 2N1KA 1ND0A 1NJ9B 4NJAH 1OAUL 3WDHA 1ADQH 1T4KB 3AB0C 1W72B 4P3WA 5FK9B 1HHHB 4PUBL 4U2ZA 3WEXB 4P57A 4XNUL 1EVTC 4F37K 3EOTH 3F6IA 2FD6L 2ZOKA 2F53B 3O9WA 3S96B 1MCJA 3Q6GL 3L3KB 3MACL 2F8OA 1B88A 4JGJA 5HGDB 5C2BL 1A47A 3MBEB 1NQBA 1FH5L 5J4MA 3I6KA 3NFSL 3TT3L 4N8CL 2DF3A 2HRPH 1QSVA 4UNUA 1T7VA 3TVMA 1VFBB 3OKDA 5IEHB 3MGOB 3MRIB 3MRNB 2XN9D 1UB6B 2P42B 3MV7A 3E3QA 1AFVH 1F6AB 5KN5B 1HXMA 4PG9B 1DANU 1LHZA 1AJ7L 3QUKA 1HXMB 3O4OB 2OTUA 5F96H 3D39E 5F9DC 5H2BB 2NLJB 5D9SA 3KNBB 5D93B 4QHMB 1JGVH 3QSKB 3LDBB 1IFHL 1C12B 2DS4A 2NY4D 4ODVL 1U8QB 5LQBL 3BZEA 4RMTA 1U8MA 5MI0C 4WFHD 2XI9A 1NLBH 4NUGH 1HCVA 1FG2A 1RZIB 5GRJL 3SDCA 4M93C 4TNWF 1KIRA 4TNVK 4AJ0A 1K4CA 4XVTL 1YPZA 2R69L 1A3QA 2DQIH 4I9WE 1YECL 1JE6A 3U1SH 1U36A 1D5MA 3SGKA 4H20H 4NM8H 1DTUA 2PW2A 1I1CA 3L5XL 5HGAA 3RVWC 3MV01 2VH5L 3RPKA 3FRPA 3KR3H 3TBWB 4HS3A 2WZPD 3O3UN 3PL6B 4W4OC 5EZJB 1ZA6A 3ARGB 3JWNC 4Q6IC 1AQDB 4XP5H 5F9WB 5C0AB 2DWEB 2J4WH 5DSCB 3LKQB 5DK2B 3QIUA 4U1IA 3WXWL 5F71A 5B38A 1KULA 3QO1A 4PY7A 5CP7A 3EGSB 5EORH 5IEKB 4MNQB 1IGFH 2RBLA 4F2MB 1BREA 3C6LB 3BRFA 2XY1A 4DAGH 1X7QB 3SDDD 3T1WA 4D9QD 2VWEC 3E8UL 4EUPB 3ULUH 2Y6SD 3TO4D 1MCPH 2VLJD 3NIFE 5JNYB 2D7MA 3ULVC 4OCSH 4P99A 1I7TB 1UKSA 1BQSA 4L4TB 3BYYA 2QQQA 2VERN 1MCQA 2DQIL 2OTPA 2D0GA 5DMJB 1W8NA 1JPGB 1T0NB 3MBED 5FUCE 4G8IA 4MD5B 1KTLA 3TJHD 5I0DA 1IGTB 5EOQL 3DGGB 4E41E 5CGMA 4FP8L 4PJCF 4M61B 4K3HA 4PJCE 4XCFH 5A16A 1PAMA 3JV4B 1HILA 3NPSB 3VFPA 1PX3A 3VG0L 4MB3A 3WS6A 1WJ3A 8CGTA 3GJEA 4N8VB 3V6BR 1XGTB 3TJEH 1D5IL 3BT2H 5L2KB 2F74A 3RUGB 3PV6B 3GEWB 3EDDA 5HD8D 4ESKA 5EU6E 4NIKB 1TQCC 5IW3A 1I9IL 3FO0L 2DM2A 3BW9A 3KS0H 4CN4A 1H0DA 2VXVL 5KW9L 4WO4C 4WUKL 3PNWA 3WJLA 3ARFC 4OLZL 2EDQA 5A2IH 1XGYH 4NO0A 1NBYB 3OJDA 3UJTL 1J05B 5IFJB 2O5ZL 1MHPH 3D39D 3FOMB 2ENSA 1DUZB 3SE3A 4HS6B 3E6FA 4UI2A 4N8CH 4N8VG 4WO4D 3ZKXB 5HYJD 1GGCH 2G60L 4XGZB 5E2UH 1X5AA 2EH8L 4I77L 5AG9A 3MRGB 1TMCA 2WQ8A 4EDXA 1GRWA 4RNRB 1FBIH 1BMGA 3H9HB 3W0WD 1S7WA 4D3CH 4QNPE 1U2HA 4GKSB 5HYEA 2FJFB 2OP4H 1I3UA 4Y4HC 2BVEA 3IVKB 2ZZUT 4TSAL 5E5MA 3G6AB 1X5XA 4JZNB 3FMGH 4ZXBD 3R06B 1G7HB 3CPLB 2VITB 4M1DL 5DMKA 3R4DA 3LZFH 2V5TA 3QEHB 2NZ9D 1BOYA 3VD5A 5IMMA 5HHNA 3WNPA 4MS8A 1PYWB 3GFUA 2HJFA 1NCAL 2H32A 1UCTA 2OMBA 4NJ9H 4PFEA 2RGSA 1QLEH 2FATL 4PJDE 3OAUL 5E6YA 3UAJC 2Q6WA 1XFPA 4WWKA 1PYWA 4HIXH 4OF7A 3QJHB 4NNYB 1DE4B 1H3XA 1JCKA 2ESVE 2I5YL 2J8OA 2PCPA 3BN3B 3MUHL 4HKXA 4P59L 3T04D 3UJJH 5C0JB 1UGNA 1PVHA 3VGHA 4HXAH 1SMAA 5ECJE 2GTZB 1E4KA 4L4VA 1FGNL 1LO3H 4PJHF 3RPIA 3THMH 3ZMRA 4ZFZA 4OM1H 1GZPB 1XGUB 4XVJL 1KXTB 2FEDC 2EE3A 4JY4B 1XF5A 3W9EB 4HT1L 3KHOA 4GAJH 2BVQA 3DTXB 2ZG1A 4OTXL 1AY1H 3A6BH 5ICYA 3ARDD 3HI5H 2NY1B 2VSDA 4APQD 3C2AH 2XZQH 2NW3B 5C0JA 2HH0H 1WWAX 3S37H 4XGZA 5GS2D 5DVMA 3QQNA 2HRLA 4MDIB 1WBXA 5F44A 4FFYH 3NCCB 2YBRA 3CDGB 3B4NA 5TFSH 4JPVH 2V5YA 3S88H 4XP9H 3FKUS 5ADPH 5T1KD 2D03H 1NBYA 1U8PA 1X5LA 2VAAB 2YD4A 3OJDB 5EUKB 2XZQL 4BZ1H 5A3IC 4HLZH 5DJZA 1RZJL 5FYKL 4OI8A 4R0LA 1AY1L 4QO1A 5KOMC 4FMFA 3CSYA 1NCBL 2X2YA 4K94H 2P24A 3B3IB 4CVWA 1OY3B 5B3JF 2VABA 2BMKA 2VOTA 4I3SH 2C5DC 1CD8A 2CLZA 4S0SD 4TQEL 3RUGA 4NYLB 1R3KB 4JDVB 5DVKA 3HB3D 2CXKA 4FQIL 1CICC 3HCVB 3S5LB 5CAYB 4AMKH 4O4YL 4N8VA 1NPUA 4LSQL 5HXMA 4JFHE 3FONA 4PJHB 3BE1H 3SO3C 3MLVH 3G6JB 4MQXD 4PJFE 1YMMD 4GKSA 5DD6A 1NCNA 2VAJA 1RZ8A 4OCYL 5E6IA 3SBWC 5HHOD 2I27N 5ITFB 1QBMH 4LHJB 4YHKH 2PO6B 4M7JL 4HZLB 2R56H 4GJTB 1UACL 3NCYP 4I3SL 5GGRA 4GT7A 2ICEB 1SJEB 3KPQA 3RVUC 1T7YA 5JXEC 1NFKA 3NTCH 1U8IB 2WWKO 3GMMB 3MODL 5C0CB 3GHEH 3V5KA 2HH0L 4PYGA 1FVEB 1FE8L 3LB6C 5DEGA 4LFHD 3GKZA 5KSVA 3SDAC 1DUYB 1WGOA 3PNWB 3QQ3B 5ENWA 5IMOA 4OKVB 5DDHA 2A0LD 1HI6B 1CGXA 4L9DA 5SWSD 1OP3K 1QRKA 3U9UA 4P9HL 8FABA 5HSFA 1GXEA 3ARBC 5DSCA 4PTUB 3HAEG 4QRQA 1CGVA 4OF8A 5FF6A 4Y2DA 4LCUA 3L7EA 1F4HA 3AAZB 1FL6B 5IHUH 5TGBB 3QXVA 1NCCH 4HWBL 3ZE2F 4TOYH 4PGEA 4G8IB 5E2VH 3V6ZB 4KJWD 4WFGE 2PF6A 2QHLA 3V0VA 5GIRA 1HEZB 1KJVB 3BP7B 3UTTE 1IQWL 3Q0HA 4NN5C 4LSRL 4JFDE 4OLZH 3ARWA 2BZDA 4J4PD 3BDXA 2I24N 1EHXA 1R5WB 3DURB 3FFCB 3WN5C 3D3VA 5C0EA 1RZIA 1KPUA 4P48A 1KJ2H 3VFVB 3BD5A 1L0YA 5EOCH 2N7BA 3UJIL 2GTWB 1WAAF 2E7CA 1KEGH 5D1ZC 1DDHA 1K5NA 4KRPD 4XNQA 1FAKT 1F42A 1KJMB 3EGSA 4RWHA 1OWWA 3MA9H 2OTUB 4BFBD 1FFPA 4RGMC 1FDLL 4RWYL 3S35L 1JHTA 5E08H 3DXAB 4UTBH 3DECA 5E4EC 3U4BH 1D6VH 1F6AA 4JFZH 5ACLA 2X70A 1INDH 5GRXG 3P73B 4UDUA 1ZA6B 2J5LB 4NZUH 4X6EA 2L7UA 4IJ3B 4U1LB 5JW4Q 2NY5C 1K8DA 3MV8A 4WJ5A 3GIVB 5KS9E 3PIQA 4OGYH 4RFNB 2FEEI 2DMBA 2PW2B 4HHAB 5C08A 4CVXB 4JZOA 5DO2C 1R3IH 4G3YH 5HY9A 1SQ2N 5H8DA 3L3OB 1AD9B 1A3RL 1EO8L 2H6PA 1LP9E 4WEBH 1S8DA 2J8UF 3MLZH 3O3EA 5I17A 5HHOE 1UACH 4NT6B 3HPJB 3MRPB 2CDGB 4OCLC 4FN0A 1MFBH 3N1PC 3NCMA 3QXDB 5DJDA 12E8L 2G5RA 5HVGB 1LD9B 1KTKE 4NQEB 4IRZH 2N4IA 2Y36H 3QXAB 1ZA3B 1EBAA 4PBXA 1VGKB 4X6CB 2ZOLA 1FORH 3D3VD 5JW4M 4YXLH 2BRQA 4Z9KB 1N64L 3WUZA 2DL2A 2VDLL 4ZPVA 4R97B 3MXVL 4F7PB 4PB9L 1GIGH 4H20L 2XOTA 2HWZL 2MQ0A 1FDLH 4RWYH 2G5BA 1VFBA 1DEDA 1E6OL 5J1AA 5E9DA 4OZHA 4UIMB 2NY3D 2GJ6D 2VQTA 3NFNB 3RVXC 3WNOA 4Z7VE 5I0ZA 5KVEL 5MHSD 5K9JL 1KB9J 5JHDD 3M07A 1F6FB 4HC1L 2A74B 1NCDL 4XXCA 5FHBL 3FOLB 4FTVE 3H9SD 4G42B 2VXUH 5GZNC 4PGZA 4H0IA 4ODTL 4P23A 5IG7A 4U7MA 3VWKA 4UT6L 1Z9LA 1ZE3C 3SPVA 3HC0B 4WFGD 4U1HB 1W72A 2VDPL 1XF4B 1YMMA 4OJFH 1R24B 3C6SB 2EYTA 3GIVA 3LOWA 4NQDD 1FPTL 1FN4A 1CICA 5F1NA 2QKIA 4C57C 1RZGB 4DQOL 4CKVX 3QUXB 2IMNA 3TPKA 1QBML 4KWUA 3DXAA 1OQOA 4N9GB 2QR0B 4JM2B 4X6CA 5ESQB 1KUMA 4R7NA 3V5DB 1Q9KB 2CLRA 2Z91B 5IW6B 1FIGH 1WT5A 4MCYA 5FECA 1HQ4B 4MX7B 4EI5C 4U6VH 3OGCB 2VLRD 2ZG3A 2VYRE 1Z3GH 1XF3A 1OGAB 5CIPB 1MCSA 4G7YL 4GW4A 5DLMH 2E5EA 5D71L 3ESVF 1QHPA 3GB7B 3RRQA 4RBPH 5ALBL 5GRJH 2H6PB 1VKXB 3QDJA 1FLTX 4JPIA 1ZT4B 5EBWB 5MENE 4OZGF 5FM8A 4Y4FB 3L3IB 5ID0A 2AEQL 3HG1D 3NCEB 3ZT5A 3IJSB 1JYVA 1KJVA 2D0FA 3GSXB 5F6IC 4YHLL 4R96A 5IJKA 2VZ3A 3ARTA 3KAAA 4NQCE 2FR4A 4MNHA 1CLZL 4UU9A 4WHYH 5JHDA 2Q7NA 2XQYK 4HC1H 3D39A 3QUYC 4EOWL 1CDUA 2PYED 3QXTA 5HYIA 2VKWA 2OLDA 4RAVB 2OMNA 1AQKL 1DFBH 4KK9C 1H3VA 4XNXH 4JFFB 4O02L 1DEEA 3TIDB 3EYFA 3MV7E 3DLQR 4APQB 2R2HB 2C3WA 1QFWM 2IC2A 4YR6B 1IBGL 4TVPL 3HMXL 3S8WA 4NQXB 4HJGA 1AD0A 4YBLB 1FORL 5E8DH 4H26A 5DJCB 3OWEA 1U2CA 2YPKB 2QHRL 1OGAE 2HLAA 2R9HD 5K9KA 4DVRL 2XWJB 3D2UA 3QBTB 3WFZA 4GKOA 3B5GA 4Q97A 4OLUH 2IAMB 1IGCL 2UYLA 4HFUH 1MJ8H 1P4IL 3U7YL 1H5BB 3O6KL 4IIQC 3BN9D 5I75B 4HV8A 2I60H 3OTTA 5CHNB 2PO6A 4JLRA 5CP3H 1CDHA 1PG7X 2BDNL 3RWEB 3DVGB 1D9KD 4C56B 2BNQB 4KJQD 3G5YB 4FZEH 5F3BA 2ENYA 5MEOA 3RWGA 3PP3H 2I60L 4ONFL 2R0LH 4JFYB 1NUFA 4TSBH 5D93C 4XX1E 3QIBB 2FO4B 1HSAB 1A1OA 5E99L 4R2GD 3VG9C 3V6FB 5I6XC 5FA3B 3VE0A 3DX6B 5F72S 2DQEH 4ZUUB 1F90L 1AP2A 2CSPA 3LPFA 2Q7YB 4S2SB 3SKUD 4XTRC 1U8JA 5D1XA 1KLUB 2IQ9H 1SEBB 4KU1A 3V5KB 4DJMA 3JV5A 4M43H 1QP1A 1YNKL 2J6EA 3V7AE 4X8XA 4NC2B 4MDIA 3T4AA 2VLRE 2HTKC 2C9AA 5EU7C 3UJTH 4G9FD 3UTQB 1XIWB 3O45B 4PJEA 1OL0A 3A0OA 5E2TL 2I07A 2X9YA 1QLRB 5DD6B 1G1CA 4HK3N 3GMNB 1KCLA 4YDLB 4JY4A 2A9NL 5MEND 4GRMA 3GBML 3BIKA 1J5OL 1AO7E 3U7YH 4XZUA 2GITB 3MCKA 3GNMH 2YZ8A 2I07B 3WIIL 2A6DB 1Q1JH 3L3DA 4LF3B 4I3GA 3VXRD 4ZOAA 1N6QH 3P4LA 3UTQA 5HI3D 2J8UA 4ZO7A 1PD6A 1YECH 2I9LA 3SGEI 1NMCC 3D6GA 3TO2A 2G75A 5FYJL 1KB5H 2JB5H 3B5TA 1UM6H 4WWKB 1EHLL 3E2HA 4ACPA 3MV7D 4U6YB 1ITCA 3QIWA 2ADJA 1CG9A 2EDRA 4MXQD 3NIDE 4I48B 5EIVA 4I2XA 5FIEA 4RIRB 3QUZD 1J1PL 5ERWB 5BV7C 3TO2B 2QSCH 4KRNA 1LE9B 2NW3A 5EBGA 1I85C 4MSWA 4LKXB 3WD5H 1A4JB 5HD8C 3P4OB 5IMLB 3V4UH 1T2XA 4YHYB 5ELIA 1IGFL 1MIMH 2QL1A 4ELMF 2R1YB 3VFGL 1Z0NA 2V7HA 3D0LA 3LCYA 1JHKL 1RQ5A 3LN4B 5DXWA 2V2WB 2J5LC 2B39A 1UJ3C 1U0QA 4D8PA 4EDXB 5KVGH 4CAGA 4L9LB 4J3VA 4NP4L 2HMID 2PCPB 2X40A 4Q9RH 5DUPL 5BRZD 1UH2A 1RZ7L 1J88A 4M5ZH 4XP6L 4DN3L 2DAVA 4LLUB 5E8OB 5FYJE 5IV2B 1DBKL 3BQUD 3EZJB 1URLA 4PJ9D 1N6UA 3FOMA 3FL7A 4PJBB 1KLUA 1QSFA 2ED8A 3P4NA 2YPKA 4Y4HD 4JFEB 4DGYH 4YFDB 3TA3A 3VFWA 3IDXL 1IARB 2AI0L 1LO5B 1N64H 2IPKB 4GXUM 1ZGLP 2ADGA 3UTZA 4LAQL 4GMTH 2IMMA 3CPLA 4DQOH 2F8XC 1JTOA 3U0WL 3SKMB 4W4OA 2X4TB 4F37F 4FQ1L 5FO7A 1T5XA 3GJEB 1FL3A 2IBZY 4JFOB 1S9WB 5CSGA 1G7MB 3P9WB 5E5MB 1QNZL 3TO4A 2BSTB 4WTXA 5I1GL 1IQDB 3T0EB 2AK4E 3LRSA 1RJZA 3DGCR 3HI6H 4MQ7B 1IGTA 3MUJA 4YHPB 2HG5A 1W0VA 2Y07L 3RWEA 5E9DE 3BPLB 1F4WH 3GJFB 2W1NA 4QRPD 2VLMD 4HV8B 3FO9A 1U8LB 2G9HB 5GZND 2E6PA 3KGRA 2MNUA 4YGVB 2BSSB 3OR6A 3ZTJH 5I71C 4Y4FA 2DWDB 2OSLA 3SE9H 1AO7D 1DUZA 2LTQB 2R39A 4UT7H 1BD2B 5IFJA 1CS6A 5HVFB 4ZAKB 5EWIH 2OK0L 3IFLH 4KQ4L 1X7QA 4PJBF 4YE4H 3MXVH 3D18B 4OIIH 5D96C 6FABL 1H0DB 3LMJL 4ZG1A 5C9JA 1QD0A 3J8F7 1CTOA 1MELA 2A6IB 3S5LG 1AD0B 3GGWB 2CLRB 3WIHA 4P2RA 2F74B 2ATKA 1G9ML 4X6DA 1A4KB 3FB6B 5K93A 2R1WB 5I16B 3TN0C 4JFFA 2GT9A 5A16B 4JQXC 3V0WL 2YA2A 4ZOCA 3JWOL 5FO8B 3MXWH 2WLZA 3GBMH 1JV5A 2NY1C 1BVKB 3MBXL 1Q0YL 3PDOA 5HHVL 1EV2E 3UPAA 1TNNA 2NYYC 4ZNEE 1XF4A 1YMMB 1Z9MA 4KV5F 4MHHG 5HGAB 5GGVH 2Z8VC 2X4OA 4K23L 2YD2A 1CL7H 2NY6D 3MLSL 5I1JH 4LLVB 2DTSA 3GSWA 5F7EL 1YN6B 3L5WA 5T1LD 2CUMA 4OLWH 1T21A 4ONGH 2E9BA 4UIKH 3GMQB 1OD7A 1CICD 3NFSH 4F57L 2A74A 2CUIA 4UBDD 4AEHH 4XBGA 1KLGA 15C8H 2KKQA 4DUXA 1FG2B 5I8EB 3C08L 5CINH 1OGAA 5JORB 4JO3L 3OF6A 4JY6A 2R0WL 4YHIA 4PJFF 1EPFA 1GVIA 2YMXH 5LCVH 5CUSL 5FYJD 3ZE0E 4DUVA 5FECB 2P5EE 4K07A 3CSBA 4I0PC 1DQML 1Q1JL 4U1IB 2EC9U 4NN7C 2L7JA 2DWEA 5J11C 4RDQF 3MRJB 1NC2A 4XBPA 4JGUA 3B9EA 3FQXB 2YEZB 4NKIL 3S36X 1RSFA 4XT1C 5EZJA 4DWHA 2EDEA 4Z6AT 1TJGL 4HJJL 1YEFL 5HYJE 1P5VA 4JO4L 3VG0H 3RIFF 3RX5A 4NN5B 3EO1B 1OAYL 4IM8A 4ISVB 4G6MH 2BNQE 3L3KA 2AK4D 5TPWH 3O9WB 4DOHB 4R4BA 3ARBD 1BLNB 3QCTH 2XV6B 4PJ8C 4NQSB 1S7VB 1AHWB 2OZ4H 2J3SA 3NFNA 4V3EB 3MLVL 4OZHB 4UIMA 3FO1B 1G6RA 2DBJA 5J1AB 1WITA 1KEMH 4JAMB 4MWFA 5E8DL 4LSQH 4R2GB 1Q8MA 3KNBA 3A67L 1MWAH 3QQ4B 1H3WM 4FZ8H 3ARXA 4U7KA 4L3EB 2GKIA 1GZQB 1LEKB 2P8PB 1J0HA 3HI6L 4PG9A 4AIXA 4M8VA 2DQCH 1IGJA 4NQTA 1KELH 2QSQA 3IJHA 4EUPG 4NQEA 1KJMA 3REWA 1JK8A 3EAKA 2ESVB 4JJHA 2CDGA 3QRGL 3GSNL 5DRZB 3CAFA 1P4BL 4E42B 5EZOH 4LASL 1KBGH 1AXIB 1R5WA 2AI0H 1ORSA 3FT3B 3IJYB 4IDJH 5BW7A 1A6ZB 1JUFA 1UWGH 5DQ9B 3L3OA 2F53A 3NIGF 4LKCA 3IF1A 3WS3A 5C7XH 1UM4H 4XNMA 1QFUL 1FYTA 1TJHH 1JNLH 4W6WB 3X3GH 5I1LA 1HIML 1VSCA 4PGEB 1B2WL 1LO2H 3MV8B 5TH2B 2EEDA 3PGCA 4X6EB 1TCMA 5T1LB 3QA3B 2R29L 5JIKA 2B4CL 2HT2D 5I6XB 1CU4H 4X5LA 1JNLL 1PEWA 3TBYA 4M5YL 4X6DB 3WHXB 4ALAH 4FG6D 3DMMA 3LH2L 5C7XL 3VD7A 2ATPA 4Y1AB 4WV1B 1CI5A 3U9UB 8FABB 5K33A 3AUVA 4U1NB 4OZFH 4J8RB 7FABL 1R5VA 3ILQC 4YHZL 4TRPL 4ZO9A 1MRDL 4QTHB 1NL0L 4ZUSB 5I1KH 2IGFL 5HPMA 2X4PA 5IVZB 2VXTL 1KJ3L 3UTPD 2OCFD 1U8IA 2CRMA 3IDNB 5BV7L 1GC1H 5J12B 2AQ1A 4B0MM 3VD3A 1HEZA 4NBXB 1YMME 3FO9B 1CFBA 3S3PA 4L4TD 2AABH 1TZHB 1A6VL 5ITFA 3S35H 4LU5H 4YHPA 4K7FA 2JF1A 2CDFA 1CBVH 4NRXB 5I1AB 5KVGL 1A7PL 4NKMA 3TO4B 3FONB 4PJHA 2W9EH 2UUDH 3SE4C 1G7MA 4LSSL 4LSUL 4XMPH 5I8KH 4P4KA 4N68A 2YK1H 1NBVL 3GI9L 2GUOB 1PZ5B 4YX2H 2MCPL 4X6DF 5E03A 4PJGB 1E6JL 2R4RL 2ADGB 4HX1B 4WI7A 3MNVA 1U3JA 3BGFC 3MLZL 4Z7WB 4M9OA 1FNAA 5C0RH 3QQ3A 1ZHKA 2F54B 4X83A 2QSVA 2BHZA 3MOBL 2NTFB 3L5HA 4A6YA 5IK3A 4PJBA 1VGEH 4MAYC 4X6BA 2VJXA 3K46A 5D7IF 2H2PD 1NDGA 1I75A 4KMTH 5L0QB 2C1OB 4YX2L 2YRPA 1V8HA 1C1EH 4UINH 5I73C 4GLRH 1ZTXL 4XCNA 1SY6A 3MLUH 2DYPA 1OP9A 1DQMH 3GSUB 5DJAB 1G0XA 3I84A 2WIMA 2B1HL 2X4RA 4KKLC 1BF8A 5I1HH 5FUCC 3RIAF 4YBQD 4OF0A 1C16B 2F5AL 3L3HA 2EDFA 2LTQC 5KBNC 1S7QA 3GBNL 3PHOA 4IEFB 1CDJA 1J5OH 5FKPA 1M7DB 1ORQA 1LQVA 3HUJF 2W0PA 3EOBA 1M71A 3X14A 3I6LE 3LEVL 5C0DA 3SGEH 4N1HB 2GEEA 2LE9A 2PR4H 4PJGF 3VXUD 3QP3A 4QCIB 5I1JL 5IVXA 4N0UB 4NO0D 1YA5A 5DD3L 4EI6B 4ZMAT 1V05A 2J12B 5FA4B 1FZMA 1TZGL 4PJBE 1SEQH 3QJFB 1U92B 3S4SG 1Q72H 3QIWB 1P7HL 4YDIL 3OB0H 5IF0A 3ULUE 3E2HB 4LARH 1DLHB 1QA9A 4EI6A 3L95A 3HS0B 1J8KA 1YNKH 5FHAH 2FZ3A 5KSAC 2F5BH 1A6AB 3WNMA 4HH9A 3GI8L 3VXOB 3RBSA 1MRCL 4P2OC 3AMKA 5GZOD 1RZKC 3T0WA 3ZDZE 1EUTA 4U0RC 1R3JB 5HDQH 4WO4A 1Z0MA 3Q1SL 2QLVB 5EBMA 3UTPE 5L88L 2AK4A 3FFDB 2YPVL 3UTOA 3L3HB 4G6KH 4GW5B 1B0GB 3HRZB 5H94B 3U46A 3C5SA 4KFZC 4L4TE 1QR1B 5EO1B 3WO4C 3LEXB 4GKNA 2EDXA 1TMCB 1L6XA 3VXMD 2WWMD 1CDIA 3SDAA 5E2WL 2FNBA 2IQAA 4J3SA 4X80L 5ADPL 1R5IB 3T4AB 4LASH 2IANB 5D7JC 3OKNA 3GSNH 4WI5A 1HHIB 2YPLD 3PWPA 4KHTL 5EN2A 2G2RA 4NCDA 3F7YB 1N8ZA 1HQRB 3G5VB 3DMMD 5I8OL 4RGOL 2VLKB 5DMKB 1IAIH 2X89D 5J8OA 1CU4L 1F4AA 3I3DA 3O8XC 5GRZA 1CIDA 1JPFB 1J1XH 1FO0L 3O6LL 1P69B 4WFFD 4N8PA 1CZ8H 1UB5A 1NKRA 4AMKL 1H9VA 4J3TA 1CK0H 5MHSE 2GK2A 1I3GL 1KYOK 5CCKH 3C9NB 1P7QD 3OKLB 3T09A 4NCC1 5DRWA 1MCFA 4KJPC 3MPCA 4FTVD 1UZ6E 3B9DA 3GKWL 4NWUH 2FJFA 1DVFB 2MFNA 4OFYD 1OAZH 4P3CL 2F19L 1MFCL 4OD2B 4EN3B 4X9HA 1WBZA 1CZ8L 2BY3A 1IVLA 3VXNB 4X7SL 4NBYB 1RUPL 1Q9LA 2OJZH 5JPNA 2DI7A 1G7QB 1LWRA 4YGAB 3CZFB 5DUPH 2CKBA 2UYLB 3RKDD 1LMKA 4ZFFA 2D7QA 5J3HC 5FGBC 3GMLA 1UA6H 4TVPD 4P4RA 1JHLL 4ZNCD 4KJYB 4NO0B 1L0QA 3G08A 3LEVH 1BAFL 4KC3B 1MJJA 1KFAL 4PV9B 1EXUA 4HKBB 4F7EA 4F2MA