2D31A

Crystal structure of disulfide-linked hla-g dimer
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
274
structure length
269
Chain Sequence
GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGEPLMLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/cell cycle
molecule keywords HLA class I histocompatibility antigen, alpha chain G
publication title Efficient Leukocyte Ig-like Receptor Signaling and Crystal Structure of Disulfide-linked HLA-G Dimer
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 269
sequence length 274
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2d31A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2d31A01
2NY7H 1U3HD 2FGWL 5TDNA 3QUZB 5IHZA 2OR9L 5JW4R 3HN3A 4X4XA 2YUVA 3IFPB 1J05A 1VFAA 5TQ2H 3OKLB 1LNUA 5HJ3B 4ERSH 4XVUD 1HDMA 1PQZB 3H9SD 1EEQA 4PJXA 1DBKH 1NCDL 5ITBL 3MRFB 4HD9A 3D85D 4HIHA 2NYYD 1YNLH 5FGCB 5C0FA 1E4XI 4JPVH 4ZODA 5ADPL 4KVCL 4XVTL 5EWIH 3DXAA 1FNLA 1RZJL 2GK0B 3SGJC 3QQ9C 4W4OA 3SHSA 5IM7A 1JJUA 4YPJA 4YEEA 5DA0B 3D39E 3SKJH 4NQCE 3KPQB 1IL1A 5CZVL 4Y8AA 1BOYA 3LKRB 5C9KA 1KENL 3R8QA 4EZMA 1J1OL 1YMHB 3WLWC 3OPZH 4ONHB 2Y36H 3BP4A 4KI5E 4FABH 5GS0C 1WWAX 5E2VH 3BP7B 2A2QT 1HHIB 5I16A 1B0WA 4Y4KC 4NZRL 1FC1A 1TPXC 4CVUA 4MAYD 3L3IA 4FZEH 4O2EB 2XZCL 4S1QH 4X6DB 5I74C 3REWA 4MNGE 4CL7A 5HPOA 1BGXL 2F54A 5DGQA 4LSQL 5EO0A 3DWTA 1FO0A 2EDWA 3K0WA 3RRQA 4GRMB 4Y5YC 1ZS8B 4X6BA 3CLFL 4DGYH 3OX8A 3PIQA 3QXVA 1OSPL 3TP4A 1LP9B 2DQUH 4JFYA 4Z76A 3CMOH 2XWJA 3O4LB 4PP1D 3HR6A 3GMOA 5HGHB 4GAGL 4GUPA 5IMKB 2Z9TA 4QXGL 1JFQH 1MY7A 2Q6WB 1PZ5A 1GOGA 2WY3A 1JWUB 1UVQA 4JVPA 3MBEC 5DJAA 3O6KH 1DBJH 1K3IA 3FB5B 2ZOLB 5TE6H 2PTTB 3UXFA 4LAQH 3U7YH 1SYVB 4G9FA 4FZ8L 2CRIA 5B39A 2JLLA 2EYRB 3QO1A 3MV01 3MV8A 1CF8L 1UCTA 4H0GA 2RFXA 3O9WA 1OTUD 3DSFH 5E56A 1Y6NR 1A4KB 2YPVH 3PG2A 1VA9A 3VXRD 5JPNB 3SDDB 3T4YB 3L5WA 5J3HD 4LAJH 2Q7YB 4YR6A 2AP2A 2CUMA 4EOWH 4NQVB 2DLTA 4W4NA 1DVFD 4JRWA 3V0VB 2DYPD 1BFVH 1N8ZA 1QSEB 4EDWH 3E6HB 1FZKB 3O11B 4GRWE 1P2CA 4M1CD 1G7JB 3FONA 3QNXB 3GDBA 5IB4B 5DF0A 4HG4K 4LGSB 4X9BA 4I48B 4P9MH 1R5IA 2VJXA 3L7FA 5CUSH 1A6UL 4JY4B 3GGWB 3VXUA 3OAYH 4PLJD 2AEPL 3T2NH 3LKOB 4XI5D 4XAWH 3SQOL 1I8LC 5D7SH 3KHOA 1LK2A 2XWTB 4QTHA 4LSRL 5F7EH 1OPGH 3TBTB 3ZE2F 4C56D 4YXHH 2OSLA 3QUYC 5JORA 3WNLA 4XPFH 5EFIA 2FEEI 3BGFB 3CU7A 5BV7L 2B5IB 3HFMH 2KQMA 4QY8B 3EYVB 4JO2H 1RSFA 1CN4A 4P5MB 1MJ7L 1AI1H 4KI5C 1ZSDB 1J0IA 4PBWD 3PHOA 1CGSH 4RAVB 2ARJB 3TA3D 1YEJH 3EUUA 3S4SG 4PRNA 1U2HA 1IC4H 4IMKA 5JW5B 5FUOL 4Z7WF 8FABA 4LSSH 1KLGA 5DMKA 1UB6B 5EPMA 1SEBB 2V2WA 3RHWK 1TZGH 4JCLA 2YKLL 1H5BB 3SBWA 3MV9E 1H3VA 1FG2B 4G6MH 4ZXBA 1UFUA 3GRWH 1MJJB 4JE4B 3CU1A 4O2CA 3WO4B 3JV4A 5A2LH 5D2LA 1IC5L 1NGXB 1JF6A 4PJEF 1INEL 5E8NB 1T7YA 3RL2B 4MJ6A 1QO3A 2ID5A 3BJLA 2UUDK 3MLXL 3RIFF 3NMEA 5HPMA 1OQXA 2XZZA 4YHIB 3GJFB 5J4MA 4KXZH 3M45A 4OLZH 3UTZB 3O3DB 5E2WL 3GJFH 3CPLB 1S9XB 2VXTL 3DSNA 4L3AA 5E1HB 4LLUA 5EORL 3BKYH 3BIKB 3FQUB 3IYLW 3EYFA 2XTJB 4ONGL 4LLQA 5F1OB 1CDGA 5GRXG 1NBZA 1QR4A 1N3NB 5CD5D 3MRKA 4MXVF 1NGYB 1LDPL 5IG7B 1FH5L 1UWGL 2FX8L 4MGXA 1CU4L 5LAXA 5SWSD 1N4XL 4JR9L 3NACH 1D5BB 3P4LA 4YAQB 1IGJA 1O0VA 3RTQD 3PGCA 1H3PL 1IGTB 3GI8L 4AEHL 4JY6B 3ARXA 5I1IH 4NN6B 4QRUB 1G0DA 3LZFL 1JYNA 4MSWA 4GKSA 1U8IA 4G6FB 4DKEL 3RUGF 3PWPE 4GSDH 4FQLL 4NYLB 1OLZA 2OQJA 4XP5L 1K5NB 2X9XA 1JNNL 3DUUA 4RGNE 3ULVC 5CEZL 2VXUH 3JBG7 5FHAL 3U0PB 1RJZB 4WFGD 5H2BA 3V7AG 1RIVL 3BIAX 5F21B 3DMMD 4ZQKA 4Z7UF 1AHWB 3RWJB 3ARDD 2HH0H 3VFTB 3QDMD 5C0RH 1ZTXH 3UTTE 3KHQA 3L5HA 2Z35B 1T80A 1B4RA 1QBML 3WE6B 3BZFB 4NO0A 4E0RA 4EI5B 2BY0A 1MVFA 3VCLB 1V7NL 2VZTA 4IDJL 2NQCA 4LSPH 4WI6A 2WBKA 2Q1EA 3O2DL 5HYJE 2CDGB 4YHPB 1GGCL 3BFOA 3RNKA 1AXSB 4HJ0D 5DYOB 1UGNA 2FO4B 4RAUB 2GFBB 5E1AA 1HNGA 3CFEB 3H7BB 4PRIA 5D5MB 1SJEB 3GFUA 1ZK9A 2X42A 3QWRA 3QJHA 4QRSB 3JVGC 4C54A 4IHOA 2P4AB 3MV7A 3X3FL 1HIML 5F7LB 2BY1A 4H1LA 3MLUH 1FIGL 1S7TA 3RNQA 2G60L 3I2CL 5ADOL 3S37H 5LG1A 5M7QA 1FVCB 4KVNL 3PL6A 3PGFL 1HSAB 2VLLB 3BPOB 1QPXA 4JY5H 4L8SC 1REIA 5JZ7D 4A6YA 3B2UC 3KJ6L 1WBZA 4XCNB 3MC0A 4G8IA 2E7LE 5HD8D 4JFPA 3H42H 1A8JH 3FOMA 4MQXD 3IU4H 2R0WL 1MCPL 3QAZC 3BN9D 1VFBA 1I3UA 4GXUM 1YEHL 3DETC 3ISWA 5F9JA 4P4KD 1FGNH 1RZJC 1NC2A 4FFWD 4GG8B 3TJHA 4XZUA 4O00A 3UCRA 4LDLB 5DEGB 5DD0L 1XCTA 2H3NB 3RWDB 2M8XA 4NZTL 3P2TA 5DJDA 3TYFB 1YMMB 3G9AB 3OKKB 2FEDC 4OD3L 3S36L 4TSCL 3UJTL 4OZFG 4UNUA 2VQTA 2MFNA 4MWFB 1SBSH 1S7UB 2A77H 1P4IH 4KMTL 4PBVC 2F53A 1HH9B 5GGQH 3RKDC 3PQYA 4R2GC 4Y2DD 2BVQA 4KDVA 4U7KA 3I9GH 4XVJL 4LCWE 2EIBA 3PV6A 1MH5A 1V7ML 1A9EB 2FJFA 4APQD 1QLFA 5FKAA 4M1GH 5ANME 1WZKA 5DD6A 4JGJA 2P5WD 2QADB 3VI3F 1A6ZB 5TQ0H 3ZKND 2AKRB 5HY9B 1DANU 4JFQA 3S35L 2R1WB 3BW9B 4R7NA 1BWMA 1LO4L 1A7QL 3EOYG 4UBDD 2XOTA 5L0QC 5IB3A 2EICA 3NIDF 4P9HL 3C5ZA 4G8GD 4JRYA 5FK9A 3FQRA 1RHHA 5MEND 3Q2CA 3HS0B 3X12A 5C0IA 2V5YA 2E9BA 5DVOA 5B38A 4ELME 2I26N 4PJAB 4MNQB 5J1AB 4K94C 2OK0H 2BSRB 3SE4A 3MGAA 4GKNB 1S5HA 1IGIL 1P1ZA 5HDBE 3V4PL 2IFFL 4GW4B 3HNSH 4MJIA 2R29L 5ESVB 1HILB 5EU3B 4X7FC 1A6VH 3MOBL 4KHXH 1F4HA 1K4CB 4Q97A 4L4JA 3T0VA 4PGCB 2HT4C 3FO9A 1PYWA 3MFFB 3D18A 3SDXE 3VWJA 32C2A 5IHUL 5F6IC 1FN4A 1J87A 3JWDL 4PRPB 3O45B 2X89D 5CEZE 4Y19D 3BQUC 2HKFH 3JWOL 2OM5A 3P30H 4B41A 4UT9H 5D1ZB 2EZ0C 3P73B 1LEIB 3T0XA 1AP2A 3C8HA 5T3ZL 3MJ8A 4KK8D 2YMXL 5GRJH 2YRPA 1GOFA 3FFCD 5JO5B 3VDAA 2WINB 4QCIB 5DJ8A 4JKPH 2AAVA 3DOSA 4P46D 4P2YA 5F8RC 3RZWA 3WEXA 2P5ED 5KOMC 2BNQE 3AROA 3SE9H 3FQXA 4DEPB 3CVHL 4LQFL 1Q72H 1BM3L 5HI4D 1YY8A 4Y1AE 2D03L 1A6WL 2BJML 1MHPH 5BV7C 4WRLA 3KYNB 3B43A 3RBSA 1K3ZA 3EAKA 1URLA 2UYLB 3C09B 5E8EA 3D39B 3QCUL 4ZS6C 4NQCB 1NAKL 4U0RC 3S98A 1JZ5A 1JNLL 3B5TA 4IS6A 1ADQH 4YBLC 4XBPB 3CSYA 1WITA 4PJDE 5C08B 1HOCA 4UV7L 4LBEB 3QFJD 4F7TB 5CJXA 5FA3B 4LPXA 5L2KE 4HDIA 2V2XA 3PNWB 4M03A 1EO8L 3SKMB 1QVOB 1KIPB 1P4LB 1RY7B 4UTBH 2FR4A 4HPOL 2APVA 2OMNA 3TVMD 3GNMH 1UA6L 2I9TA 4MNGB 3QA3A 4LQ1A 3RVTD 4XMKH 3HMXH 3ZYIA 2BNRB 4ZO9A 3L95B 3VH8G 1HZHH 2Z4QA 2DQGL 3KR3L 3T0WA 4NNPL 4J4PA 3NAAL 4BK5A 3UTSE 4PRBB 2DLGA 3RIFK 5I30L 2ATPA 4NFDA 1I3GL 1MFBH 1HKFA 5C0CE 3U36A 3REVA 5DMJB 5F7KC 4S1RL 3OG6B 4Y16B 4YHOH 3LEYL 4X4XB 2DJSA 1J05B 5HHXL 4PJFE 4ETQA 5FDWA 2FZ3B 1LNUB 4P5TC 3A6CH 1HDMB 1FL3B 4PJXB 1ETZA 2B2XH 3DV4A 1HXYB 5GGTH 4A2MA 1JCKA 4JM2B 2R4RH 3BZEA 1G7IA 1NCCH 1RUPL 4EJ1C 2A74B 3TNMA 5FHBH 2AABL 1HQ4B 1QEWA 3NFSL 4PFEA 4G8EB 3QUZD 2F5BL 4ZFGH 1LO0L 4UMGA 1FDLH 1U93B 3UJIH 1NUDA 1T20A 2GSGB 4PJBE 4RRPA 4HX1A 5TE7L 5E5MA 1X5KA 2CDFB 4K3HA 1GIGL 5I1KL 3GBNL 3P4NB 2NY6C 1PJ9A 1QRKA 3GSVB 3FZUC 2VXVL 4Z0BH 1DR9A 2AJYL 1Q0YH 5IIEA 1FSKC 3RVWC 5DEFB 3UBXI 1I1RA 3KLHD 1HQRB 2VR4A 1MFDH 1NAMA 1TCRA 5BZWA 2J4WH 4WHYG 2QJDA 3MUJA 5EO0B 3ZYOA 3MUGB 1A7RL 5I1HH 3HE7C 5T5NG 2WNGA 4HEME 1X5JA 2NPLX 3PIQB 4P23A 2ESVA 5CP3H 4DVRH 5D93B 15C8H 2AEIT 5LGJA 3OKOB 2BSSA 4LSTL 2AJUL 4WGVB 1G1YA 4K7PX 5A1AA 4RWYL 1XR8A 2FIKA 4JFYB 1QFWL 3ZTJG 4P59L 3QHZL 4JPKH 2A9ML 2H8PB 1T7ZA 3B9KA 2BP3A 1T1YA 2XRAH 4FQXB 4CAGA 3L3GA 4RSVA 5BJTA 2QSCH 4EIZC 1PZ5B 4XNXL 2VL5A 3O2VH 5F1KC 5DXWA 3SO3B 5ACLA 4YXKH 4YDJA 3ZKMD 4R4FL 3QXDA 4LDEB 5AYUH 5DJAB 1YEEH 4MD4A 1CZ8H 4PJ9A 5HXMA 5F6HJ 1KJVA 5F7HA 2D0GA 4MZ3A 3SE8H 4FXKA 5B8CA 3KYOA 1CIUA 3KPLB 1WC7B 3QB7C 2AXGB 5IEHB 1GC1H 2VDRH 1BIHA 3BPCB 3O4LD 5T3ZE 3MV8B 5DZOA 4DQOL 4GH7B 2OTWA 1KEML 2RFXB 3O9WB 1QYGH 4MXWL 5MHSE 2Z91B 3N50A 3DGGA 1A0QH 4NWTL 4WWKC 4UT7H 1W72L 4YR6B 3VFNB 1CYGA 4QKXB 4KJPD 2Y7QB 4QRPE 5F9WC 4O9HL 4MNHB 3T08A 1ZGLM 4RZCA 2HFTA 5FYLE 1G9MH 4DGIL 4BZYA 4UOW0 3FONB 1Z0MA 3UYOD 4E41E 1WT5A 4Q9BA 4Z7VA 3PF2A 1KF9B 3LB6C 1IEAA 3DTXA 1M7DA 3VXUB 1EDQA 5L6YH 3SDDD 1HHJA 1TJHH 3V8CA 3TF7C 3PWLA 4E5XA 2ADIB 4L5FL 2O61A 1FHGA 1F45A 5KVGL 4QTHB 5I8EA 4CMMB 2ZCHL 2F8OA 4LKXA 4Y4FC 3IAGC 2Z92A 1Z3GL 3GMRA 4XP4H 3D0VB 3QDGE 1QSED 3NIFF 3PWPB 1KG0A 4QGYA 1U92A 4WEBL 5IBUB 3DYOA 4HQQH 1AKJB 3B2VH 2HMID 4HGWA 4U1NA 4NT6B 3EJJX 1YN6A 3Q48A 4LEXL 5I8KL 1U0QA 1E28A 3TO4C 4ZFFB 1TTUA 3LN4A 4HT1L 4P9HC 4QHMA 2NX5A 3MRMB 5DMKB 4JQXA 5E08L 4AM0A 2BRRL 3TZVB 2IADA 1KGCD 2J88H 1IAIL 5LJYH 5KSBF 1YNKL 4KPHH 1T1ZA 1OW0C 2R8SL 3IS0X 3DURB 3VXNB 3ZE2E 2BC4B 4XCEA 2Y06H 5BOPA 4NM4H 3NABH 4LU5L 4MQ7A 4MJ5A 1HYSD 2A83B 5IW1B 5HYJB 1JGVH 1NJ9A 1M6OA 5F9OL 4FOMA 3U1SH 1CLCA 4NKOA 5SWZE 1D9KA 4OGYL 3MZTA 5CLTA 2HJKB 1CE6A 5BVPH 1LGVA 4UIKL 4Z7WE 1K2DA 3OXSA 4X6CE 1CFVL 3ARRA 2QQLH 4LLUB 4PJIE 3VFOB 2BHZA 3AGVA 4KRLB 4KK6C 1AFVL 3TPUA 5K9KA 3JWDC 4YGVA 5FB8B 2YRZA 5DQJB 3UZVB 3JWOC 2AV1A 1WTGT 2NY0B 3GMNA 5A40E 3E6FA 2CLZA 4PJEE 5IGXL 1AQDA 1BD2D 4I0PA 4CGTA 1C5DB 5AG8A 2B1HH 1ROWA 1ZGLB 4Q0XH 4FHBD 4OZGF 3RWFA 1BQSA 1OM3H 5LQBH 1S8DB 2UY6A 3VWKC 3OAUL 4MSWB 4L8BA 1LK3H 3LY6A 2OQJB 3UDWC 5IVZA 2XTJD 2W0FA 4WHDA 1GGBH 2DM3A 4HLZG 1KN2L 3V5HA 3MRNA 2I9LA 3EYUL 2DMBA 4DW2H 5FV2A 4XC3L 1W0WB 4MXVE 4Q2ZA 1OTSD 1NDGB 3AB0C 5F1NA 4DN4H 4S1SH 1JFMA 5DRXA 1FPTH 4OCSH 4AH2A 2VABB 1FL5B 4NRZA 4XBEL 4XMLH 4L29B 4KI1A 3GSNL 2FECI 3SGKC 4QNPF 1TQCC 3SGJA 5JMRA 3MA9L 4FN0A 3VXOA 1SM3H 5A2JH 5D2NA 1KLUA 1ZLUH 3AS3A 4HWUA 4R96B 5DVKA 4DFIA 4R97B 3G6DH 4JPWL 2GJZB 2X1QA 5ANMB 5D7IF 2DBLH 2DIJA 4PRIB 3FB6A 2FSEA 3T4AA 4RGMC 1X5IA 3N1QC 3MRJB 5CHNA 3RDTB 1JGLL 5D7LE 1OGAE 1RZFH 4HHAB 3RA7H 4EI5D 1F13A 4Z95H 2P8PA 1EHXA 4HKJA 5EIVA 1ZXQA 3JWNC 4Y4KA 5DR5L 5DSCA 2EYSA 4NO5A 1NGWB 4K3JL 4PP2A 5DQDH 4FQ1H 1PVHA 5M95B 2DQTL 5LGHH 1R5WA 1ZLSH 2ZUQC 3QPXL 2JJUA 2HTKD 4J3UA 5AZEH 3V6BR 3KGRA 4WU7B 4Y5YA 1ZT7B 1GXEA 2FIRT 3FOMB 1QLEL 4ELMB 5CSBA 1CICC 3EYQC 1OQOA 4WFHE 5FYJL 1WWCA 3IDIB 2IBZX 4LVNC 3D2UB 1NC2B 2E27L 3ULUE 4JGMA 5DUMH 1UM5H 1BF2A 1EHNA 1EVUA 2F5AL 2NCMA 2WAHA 2Z31D 1KN4H 5C86A 4NKIL 5D71H 5DJDB 2GKIA 3O4OC 3MBEA 4OQTH 5IBLD 5IVNA 1GGUA 2PF6A 2AGJL 1Z9OA 1MCHA 1UKTA 4OCYL 1SEQL 3ILQD 5F44A 4YLQT 5KSAC 4R4BA 5FXCH 4YPGB 4HFUL 1SJHB 1TNMA 3QEQE 5E0QA 2BVQB 1YC8A 4ZDHB 1EZVY 4B7IA 2VLJA 1QLFB 1UQSA 3OZ9H 4JDVB 4NN7B 5IMOA 4LNVA 5SX5K 1MIEL 1YMMD 4K8RL 1WUNT 4FQIL 4NUJB 4GBXC 4FQCH 4WI5A 1KPRA 4LF3B 2ZOKA 5BZDA 2LQRA 2H2PC 1NGPL 4Y1AB 3O3EB 2A6IB 4F2MB 4DVBA 3IDXH 4PY7B 5AD0B 3KXFA 1B4JL 4LHUB 4GLRI 2P44B 3C5JA 1X5AA 5EZLB 3MROA 1T3FB 3R4DA 4JRYB 5DK2B 3ZSSA 1RHHB 3IGAB 4HUWA 1DP0A 5I15L 4DK6A 4FFYL 4CRPA 2WQ8A 1I8LA 4OFPA 5FOBB 1FFOB 2QADD 4DOHB 5IB1A 4HCRH 4Z7QF 5L2KB 1R3JB 1S5HB 3QBTB 43CAA 3VI3E 1ZA6A 3QULB 1FAIH 3QIWC 3QIBC 2ADFH 4MA1C 2EYTB 3WN5C 4JFDA 5ILTL 4N0UA 2JJWA 2XV6B 2ZKHH 1NCWH 4XB8A 4IJ3B 1T5XB 2X4SB 3NIDE 4W6YB 5D70H 1AY1H 3QIUB 4ODSL 4NO2A 4M02A 1YYML 4JO1H 1BREA 2X4UA 2ITDA 2XKNA 2X4QB 1BQLH 3F7YA 2YD3A 4XCYA 4EVNA 3HG1D 5C0AE 5C0CB 1IRAY 2Z93A 1JPFA 1BWWA 1TQBC 2GITA 3U4BL 1DQDH 1JGUH 2E6PA 1ZLVK 4OAWA 1P7QA 4HAGA 4PJFB 1T1WA 4W81A 2VSDA 3HI6H 5K9OB 5IQ9A 1ITCA 1VDGA 5GJTL 1A4JB 1AR1D 4PY8J 1IKFH 3EJYD 3B9AA 3WHE0 3HZKA 3VXSE 3HKFA 2QQKH 2W65B 3I6GB 4PRPD 1CXLA 2OP4H 5B39G 4HIEB 1ZWIA 2F74A 3P40A 4N8VA 5D1ZD 4KDTC 1I7UB 1AH1A 4JFOA 4NDMA 3MLYL 1J88A 1JHLL 3C6LC 2K3TA 4WW2B 2UY7A 3LKSA 1CLZL 1BZ7A 4GKZA 4PJBB 2OJEB 4UUJA 5IK3A 4EUPB 3U46B 2XIDA 1XIWC 4H25A 4M7ZB 2JB5L 4EUPH 4NP4H 5L88H 3HZYA 3EOBA 2EC9U 1T7WA 4HIJB 4IIQA 3F8UB 4R6UA 4YK4B 4OLXH 5DRZA 4ZUUA 1JP5A 1JYVA 3I75A 5J6GA 2OZ4L 5I75C 4M1DL 4I3SH 3VG0L 2BRQA 2FR4B 3CH8A 1UB5A 3RGVD 5KVDH 3D39D 5AWNL 4NQCD 5C09E 3QNYA 5J13C 3AREC 4ZYKA 5C08D 4Q6IC 4CW1A 4XNUL 1FVEA 1HXMA 4QHKJ 3UP1A 4X6FB 2X4RA 4LCIL 1S9WB 4BH7A 1JVKA 1A1NB 5KSVA 1KIRA 4XTRD 2V2TA 4ETQB 2PXYC 1WVZA 2V6HA 2YHGA 3WBDA 4K3DL 4PD4J 4IOFC 4G6JL 3L6FB 1LO3L 4DKFL 3UO1H 3RQ3A 3JV6A 2BNRD 4XC1L 3STBA 3RWEA 4G3YL 2HJFB 3T1FA 3W0WE 3CSGA 2X1XR 5J12B 5FUCC 4Y4HC 1HHKB 3TNMB 2R2BB 2A6DB 1JL8A 2W9DL 1T7VA 4HF5H 4HMDA 5IFJA 3JVGA 5D9SA 4J8RB 2HP4A 4Y16D 1KBGH 3C9NA 1KJMA 1RQ5A 3AS0A 3GB7B 2W91A 4RIRA 1XEDA 5E5MB 2CJUH 3EYSH 3PP4L 5ACZB 1HCFX 1NCAL 5GGUA 35C8L 4L8SA 4QRPB 1Q9WA 1CD0A 3TFKD 3O3AA 2OL3B 2H1PL 2EE6A 4JM2D 3IKCB 2OL3H 5LKNA 3X13A 1P5UA 3OKDA 5FYLH 3O6FD 3BHBA 5BVJA 1MCKA 2NMSA 3T65A 1TCRB 3ULSB 1I9IL 3HUJA 4P2OB 4ESKA 3QFDB 4UDUB 2C3XA 5HHOA 3MYJB 2P49B 1NBQA 3T77B 3PE9A 4UNTA 1CGYA 2VKXA 1HYRC 4WJ5A 1EJ6A 4ZFZA 1SY6L 4YFLI 4LSUL 5E03A 2FIKB 4NNXA 4N68A 2RB8A 1XF1A 5CMAA 4PRHA 4F9PC 4RGOH 2NY5L 1NFKA 2YC1B 3L3GB 1DBBH 4L3CB 1H8OA 5B4MC 1FZOA 3VDBA 4H26A 1PSKL 3THMH 2QTEA 1QSFA 4HXBH 5L8LB 2HAZA 1AQKH 4MD4B 3VFSB 4OM1L 1UADC 3PP3H 4KAQL 2Q3AA 4Y89A 4JO4L 3LSOA 3L5IA 2OI9C 3AAZA 3OAZK 5HYQB 1II4E 3CH1B 4OFVA 2OTUA 3QEHA 3KPSE 5DJZA 2HT3C 2OTWB 3TBVA 1J8KA 1RMFH 1FFPA 4FQXD 3U30B 3UTTA 5BRZE 4AEIL 2FATL 3DGGB 3OR6B 5TDOA 1CDJA 5CJ5A 4H88L 1EH9A 3EO9H 1E4XH 3RWCB 2VXQL 4GW5A 2O5ZH 5JXAL 4C58B 4NO3B 2A6JB 4BFGA 4QXTA 1PX3A 4L8CA 2VLKE 3BSZH 3FAXA 4MQTB 1T0PB 4X6CB 3IT8D 4PJIB 1KCVH 3MV9D 4RZCB 4X6EA 5DJ2A 1MQKL 5D7JC 3IXTA 2SEBA 3WIFB 2OCFD 3DRQA 3RVUC 2L4OA 1NL0L 3V6ZB 1S3KL 1ED3A 2P8MA 4QYOB 3WIIL 1XFPA 3BKML 1TZHB 4LSDA 2F15A 1HKLH 4E5XB 1Z2KA 1DBMH 2O61B 3BXNA 3KYMA 3M1BA 1Y18B 1KIQA 2EKJA 5IMMA 2CKBB 3EGSB 5CZKA 1EGJL 5DRWA 2Z92B 4K3GA 2R2HB 4NC2B 3GMRB 4K8RC 2CKBH 4ODHH 2GJ6B 2ZCKH 1U92B 5IOPA 4NM8L 4PJCE 4P3CH 4F7CA 5FFLA 1YQVL 3EJZC 3BQUA 2IC2A 4HGWB 4F37F 2E9JA 1YN6B 2EDYA 2Q8AL 3QXUA 1MVUB 3BESR 3ARFC 3LN4B 3NFPB 5C0ND 1X5ZA 1B3JA 3P0YH 2KDGA 5ABDE 3CK0L 4AM0B 4KV5F 2IADB 4HKXA 4ZG1A 4CN4A 4RA0C 4OZIE 1FNSL 1JZ6A 1RZ7H 4OCXH 3PWPD 1UM4H 1ZHKB 2FL5A 5HHNB 4XCEB 5I71B 4KKCD 2W9EL 3BRGC 2NY1B 3NIFE 4MQ7B 1AKJD 4WEUD 1U8HA 1H3WM 4QXWA 5IB5B 3ZDZF 1V3KA 5EOTB 1INDH 3DLQR 3K46A 1CFQB 3KPRE 2V7HA 3BVNA 3ZL4H 1D9KB 4D3CH 3W9DA 1IEBB 3VFPA 4H5SB 3TZVD 3LHPL 1K2DB 1F4WL 2VNCA 3MJ9L 4AIZA 4LCWA 4J3XA 3CSBA 1ACZA 4PGDB 1OGAB 3FO2A 1CT8A 3IDGA 3QUXB 4HJGA 5I2IB 4WGWB 1CLYH 1X5HA 3EHBD 5GZND 1MWAL 1AQDB 1OSZA 3CDFA 2JCCE 4RMRA 1UJ3C 5HYJD 1X6NA 4U6XB 3P0VL 1RUAL 4M61B 2RJMA 3GKZA 1FVDA 4XRCB 2VDOH 3LD8B 2QQNL 5B38G 4OZHF 4DN3H 2AXFB 3DROB 2Z0BA 2AJVH 2DQEH 3GSWB 2W0FB 1MFCL 4YHKH 2YD5A 5K33A 4XP1L 5CBAB 1YN7B 4FG6D 5L8JB 5GGVH 4KK5D 1JHKL 2NY0D 1INQA 5JHDE 4YBHA 4X4MA 5KSUA 3ULUH 5JQ6L 2YUZA 1EV2E 3KWWA 3O8XC 2XACC 3I6KB 4QRQB 1L9MA 5E4EB 4P5TA 2IBGA 3LH2H 4NQSA 1HWGB 2D4DA 5E6ID 4LEOB 5DFVD 3WJLC 4KHTL 1HCVA 2DQDL 3OB0H 3DX8A 1HEZB 5C71A 3CVIL 3SDXA 2W59A 5BXFA 4XPBL 3EKCA 5F9DC 1XAUA 1FFQA 1VESA 1VKXB 4D9LL 2AEQH 4PYGA 2FHBA 3L1OH 5GS1B 3FO1A 4YHMH 3MUHL 1J1PL 4UB0L 4LDOB 4MX7A 3BKJH 5DJ6A 2FSEB 3O0RL 5EA0H 2LTQB 1XGRA 4ZS7H 3VFRA 5J9PB 2Y07H 4LL9A 1OD9A 3WUWB 5IVXA 3VW3L 5EOCH 5GS0H 4OB5H 2EYSB 4PP2B 3IJSB 2H6PA 5DJCA 3SGEI 4TOYL 1CR9H 3ALXA 3ROLA 2C4XA 3MRCB 1AD0A 3TYGH 3O2DA 4U6YA 4Y5YB 1TMCA 3LKQA 1L0XA 3HE7A 2I60L 1OARH 3QHFH 5IW6B 4JDTL 2Q76A 3GMPA 1SMAA 4M3JA 1ZHBA 3GSUA 1X4YA 2W9LA 4OLYH 3RDTD 4FTVB 1C1EH 1TJGH 1KCUL 3L3JB 3HE6C 4X7EC 4I18C 4G43B 5IR1A 2DL9A 1EEUA 3OQ3B 2FJHB 5ESAB 5F89B 4YBQC 2YUXA 2EIZB 2OMBA 1IT9H 4JZJB 5EU5A 3IDYB 4MD0B 4OD2A 5DT1H 2D9QB 3MBEB 4M8VA 1NMBL 1EVTC 4FQ2L 3BRDA 1Q1JH 5I1GL 3EO0A 3TT3L 1UM6L 3MQIA 4WIQA 2CLRA 1KPVA 4NUGH 1EEYB 3AVEA 5D1XC 5CAYB 3T0DA 4CNIB 4DTGH 3Q6GH 4QXUL 1MY5A 1PGRB 1PKQA 4PB9L 3D2UD 4U1JA 5JR1H 1ZANL 5J6HB 3BPLB 3IFOB 4X7DC 2UZIL 4G80B 5F1IA 4OJFL 4Q9CA 5A3ID 5IMOB 4HUMB 2G75B 3RVVC 4WWKA 4G7VL 4U6HB 4PY8I 1J0HA 4NQDB 1MCNA 4XX1E 4Q9RH 4M6OH 3BD4A 3VRLF 3VXSB 3AXLA 1YPZF 1T1XB 4LPTA 3NN8B 1KCKA 3HI5L 5CEZD 4OKDA 2X44D 4CKVX 4QT5B 2R2CA 5KTEL 2NY5C 5GRUL 1W0YT 2DQCL 2BVOA 3RPIB 1E6JL 4ODTH 4OLWH 2CO7B 4KMLB 2B7DT 4EI6A 4XP9H 1OL0A 4RRPG 3TF7A 4D8PA 3VXMA 1EFXA 2Z8VC 1HNFA 5CD3A 3Q5YA 4I0KA 2BNQD 5JOFB 5IFHL 3L3OB 5JIKA 4Y4FA 2IPUK 3FRPA 4X99A 1NSNL 3QUYB 5HHVH 4Y1AD 3QG6B 2ICWB 2VDKL 5GGSB 5B3JF 3ECBA 3TNNB 4JFDB 4LHUD 1OP5K 3IXAA 5CEYB 5T33H 5DJYB 2X1WL 4CMHC 1ZHNB 3TO4A 2IEPA 4XMPH 3ZT7A 4BFIB 2WBJD 4PRAA 2R69H 5E8OB 1I7TA 4N0CC 2A73B 1TVHB 7FABH 4EVNB 3S3JA 5FDYA 1TNNA 5L2KD 1JBJA 4P2QE 4PREA 2DICA 2NY2C 3QDHA 1OW0A 4TULL 2A6KA 3SKNB 2IG2H 3D0LB 1WAAF 2R56H 3LPFA 3HAEA 5DS8B 1ACYH 2Q7NA 1WIUA 4OCWL 1A02N 1KYOK 4O58H 3BH8B 3QIUD 4U4BA 1XZ0B 3HZKB 1N5YH 2OBGA 4Y5VB 5HGGS 2BZDA 5DD5H 2VO5A 5I8OH 4XPHL 4FQJH 4ZSOB 3UTSD 4N8VB 3O2WH 1IE5A 5C0CD 1F90L 3QJFA 1RU9L 3AU1A 4XWOD 5HYEA 1VFOA 3MOQA 4YWGH 4HUKB 4WHTB 3RVXC 2AK4B 2KH2B 1DQTA 1J0JA 5IROC 2B4CL 2DQFB 5TDPA 1EHLH 2WUBL 1OAUL 1BZ7B 5IB2A 3PWNA 1MAML 5IK3B 3TT1H 3QCTL 3BH9B 4WCYL 3HC3L 4HWEH 1IBGL 5CGMA 4F37K 4N0YH 3MXVL 1CDBA 4JPIB 4X6DF 3VWKA 2ZCLL 1OCWH 4ZUUB 1G7HB 3I75B 1F6AB 4PDCE 4G42B 2YPLA 4IMLA 3UDWA 2L7UA 3CVHA 2V7NA 5KVEH 1OAQH 3N9GH 4ODVL 5FGRA 5C3TA 3D3VE 5KW9L 3ULVH 3BT2L 1AGBA 1LP9F 4WV1B 4E41A 1LE5A 4ZYKB 4CVWA 2VE6A 4CW1B 2VL4A 1A6TB 3WFHA 4JFXA 3U4AA 2VISB 2IAMC 4J3OC 1KC5H 4ALAL 2DWEB 2E7HA 3C5SA 2J2ZA 3WDHA 5T1KA 2Y6SD 3HMWL 4JJ5A 4MXQD 3O41A 2V17H 3HR5B 3SGKA 1A3QA 1FE8L 3JV6B 4MA8L 3T0EE 4F57H 1XF4A 4J1UB 2DI9A 4XXCC 2HFGL 4S1DC 4N5ED 1CDYA 4JZOA 1MLCA 4EXKA 4OCRL 4R3SB 4ZFOB 4HUVB 5IVOA 3GMQA 4U1HA 4TVSa 4MVBD 2J8OA 3KPSB 2IQ9L 3LVEA 2O5YL 1FGVH 3BE1L 5D9SB 4YE4H 1U3HC 2ICCA 4JLRA 1UACL 4MAUH 1YEKL 4RIRB 1CE1L 4NZUH 1UYWL 1FIEA 4ZUVA 4OFYA 1U95A 3UX9B 2G9HA 3LN5B 4XVUC 3WSQL 2XICA 1MFAL 3Q3GA 2NYYC 3F58H 3MA7B 5I73C 2XN9E 3Q6FA 3D9AH 5ITBH 4K2UH 5SWZA 1I1YA 1CICA 4X5WB 4I0CC 4ZO6A 1ZKAA 1GH7A 4Z7WA 5DMGD 3SDAB 5DHVB 2VUYA 3B9DA 4KY1L 1A6PA 1UWEH 1J10A 3FN9A 5DHVH 2Q87A 4F7MB 4MCYB 5I8CA 1S5IH 4OZ4A 4C56E 2XXCB 4QRPD 2W1NA 2WSKA 1EMTL 3LS4H 4PJEA 4YDIH 1MCQA 5A2FA 1QSZA 5CZVH 5TF0A 4BA8A 4L4VE 1F5WA 5FYLD 4PJCB 2GCYA 4M5ZL 5KSAA 1J1OH 5LXGL 1FZOB 4WUUE 4MAYC 4P2OD 1PZUB 4X5XA 4OGXL 4WO4B 2HTLC 5BO1L 5E5RB 1NCBH 4U49A 1KACB 4KU1A 3QWOB 5E2JA 1BGXH 1A6AB 2HRPL 5EUKA 2ZUTA 1QKZH 4OZIB 1GGIL 4J3SA 3B6SB 4PJ7B 3LIZH 4GBXA 1MAKA 1NEZB 3P3YA 4F8TA 1ZT1A 3QDGD 1OSPH 5IWLC 1K85A 3PGDB 4UV4H 1JWMB 2D31B 4PP1C 2JJSC 1RZ8A 4FQHA 1CS6A 5TDOB 4K7PH 5HVHB 4QEGA 4OCMC 1KTLA 4FNLH 3GO1H 1U8NA 3MXWL 1IC7H 3RUGA 3VFWA 4CN1A 4L8CB 5C92A 2L0DA 4KH2A 4OUOA 1BZ9B 1JGDA 3DARA 1CG9B 1E27B 4NPYA 1MUJB 4LVHC 3SJVA 1BQUA 1OLLA 2SEBB 2GEEA 4D0BB 1YECH 3VFUA 3VFVA 5I1CH 1S7VB 4JM4L 4K94H 3MMEA 4Z7UA 2CDEB 3CZFB 4HG4J 1OTUC 2EKSA 1V5JA 3QIBA 2JCCB 3KYKH 2EDNA 5D7LA 3WN5A 1EPFA 5J3HC 5I66A 3M1BB 3UBXB 1MCBA 4GQ9H 1UKSA 3SKOA 1JZ3A 3GHBH 1CBVL 2JB6A 2OLDA 1W72A 3BEWB 4X8JA 4ODBD 5F6IB 1DVFC 1CXKA 5ISZE 4G6AD 5GIRB 4LOUD 3QXAB 5C0DB 4LLVA 5H35A 2CMRH 2X2YA 5EIIA 4OBSA 1NQBA 2CRYA 1N26A 3IDMB 4WFGE 5EBLA 4LPYA 1FNEB 3BQUB 4M1CC 4U1SA 2APBA 3FRUA 4JDZA 3TIDB 4AMKH 2WUCH 3CGTA 1NCNA 3OV6A 2WBWB 3NH7H 1BVLB 5GGRA 2QHLA 4YHYC 2VN4A 3LS5L 4PLJC 4F3FB 3H3PH 2OJZL 4QRTB 4XI5C 2Q86A 4B7LA 1NGQL 4M7JH 2AW2A 4JG1L 4QOKB 2GJ6D 2VDLL 4JZNB 1FBIL 4FXGB 1UZ6F 1C16A 4E9LA 4LSRH 4NQXB 2AK1L 3ARUA 4MDJA 4F9LC 4V3DB 2HT2D 1U8HB 4U33A 3ZDYF 3SCMB 4R26H 4KDTA 1MNUH 3CFDB 1TTGA 2AVGA 5DMYA 5DC9B 5D5MF 3TA3C 3LKPB 2UZXB 1VADA 3UYRH 3C6LA 3V0WL 5GRYA 4JFEB 5HHMA 1BBJB 4YBLB 2AJXH 3WFDH 5DJ0B 43C9B 3L5XL 3DJ9A 4YQXH 3U0TB 1XIWA 2AERT 4KV5E 3MACL 4WUKL 5F3HB 3TBYA 2BOCA 4ZUWA 2BXZA 4PV8A 1KUMA 1CT8B 3DX7A 4I3RL 3RZCB 2XXMB 3PJSB 2NY1D 2K1MA 1J8HA 4LLDB 5E8DL 1MQ8A 4JVUA 3FHQA 3K8MA 4C83B 1ONQA 1JUFB 2JELH 4L9LB 2XZQL 1NMAL 2CK0H 2A9NL 5CP7B 2RCSL 4M5YL 1KNOB 3AREA 1U2CA 3VXQB 5I17A 1T2JA 3B4NA 3NCFB 4Q6IA 3VDCA 1MCIA 1PX4A 2HWZH 3WCYA 3MREA 2H9GA 1AO7A 2ADJA 4U1LB 3FT3A 2NW3B 3W82A 1OGAD 1YEIH 3QUXD 2K9UA 5C0GA 3DUSB 2YPKB 1LQVA 5CD5C 1JK8B 2PYEE 3SQBA 5ITFA 1MPAL 1JN6B 4U6VH 2B4CC 3PXHA 2PXYA 3DIFA 4I13B 4JRXA 2Y9RT 4J2XA 4PJ8B 4P5TB 5LBSH 2ZNXA 4NHUE 3RTQC 3QI9B 5DVNA 5EU6B 1CU4H 5I1JH 3FB7A 1QNZL 1G7MA 3TCLA 4B5EA 1YYLL 2NY7L 4ISVB 4Y4HA 1MHHB 3WKMH 4WFHD 4K7FB 1BFOB 4HS6A 5GZOD 4DZ8B 4N0FA 3DX9B 4YDLB 3V79C 3ULUD 5TQ2L 3KLAA 4Z7OE 1DLHB 4BQCA 1S7WB 1D6VH 5C0AA 3DMMC 1DBKL 5KS9B 3GMMB 3EYOA 1YNLL 1S9VA 3ARDC 3QUMB 3HCVB 3MLRH 4JPVL 3D25B 4AYFA 3VFRB 5GRVK 2YR3A 3QUMH 2NY6B 2V5RA 5EWIL 1B0RB 5DHXB 2LABA 4TUOB 1OT1A 4FQQA 4G8GE 4IMKC 1P4BH 1K6QH 3QEQD 2R1XA 3SKJL 4QRRA 1AGEA 1I8KB 4PJAF 5ESQB 5ICZA 1AD0B 4PR5B 3GSNA 2C1PB 5A2KH 1I4FA 4HJ0C 4K3EH 3GMPB 3KDMA 3OPZL 2Y36L 3P4OA 2R0ZH 4UQ3A 5E2VL 3S5LB 4G5ZH 3ARGB 2MHAB 3DO7A 5CILH 5FA4B 4AT6B 4FZEL 4S1QL 1NFDE 5IQ7H 4F9PA 1JRHI 3Q5OA 2IQAA 1KIUA 4OM0H 1U8LB 4HJJH 4M4RA 5IP4A 4Z8FH 5TH2B 5DQ9A 4OCLC 5E9DA 3V6FA 3BP5B 1X3DA 5KAQG 4PGBA 4DGYL 1WZLA 4RCAA 3V4UL 4NKMA 3HRZA 3PABB 2ZP0T 3QEGH 3VRJA 1T2QH 5GRVL 1FNGB 5JZ7C 2QR0B 2DQUL 4K7PY 5BMFH 3CMOL 5HD8C 4HC1H 1UJTA 3IJHB 1T21A 4MQXC 4TTGA 2OI9A 3QZWB 4FTVD 4NFCA 4GW1A 3BN9C 1UXSA 5C09A 3V7AE 4LPVA 2FX9H 3NTCH 1JFQL 1IAOB 3ES6A 4WI8A 4P4KC 1YEHH 3BWAA 4FFWC 1S7RB 4MS8D 1AXIB 3BI9X 1P53A 5ALCH 2YUWA 3O6KL 3OAYK 5EU7E 1DBJL 4KC3B 1H3GA 1F3DH 4KJWD 3SGDI 5TE6L 1JV5A 2XKUA 1BIIA 3U7YL 1RJLA 5DD0H 5F9WB 1RUQH 5T3XH 1LO5A 1Q38A 1BJ1H 5IT2H 5KN5A 3FFDB 5D7JA 3K4ZA 4MDIB 3DSFL 2YPVL 4Z0XA 3VXPB 3W0WA 4PD4K 3JZ7A 4Y2DC 2EDQA 1RHFA 5D1QD 4KMTH 4X5LA 1FRGL 2HVJB 5DC0A 1K4DB 4EOWL 3LRHA 1P5VA 1MCSA 3VXMB 1EFQA 1Q94A 2CLVA 2C1OB 3BEVA 4NQDD 2J12B 1BFVL 5E2TH 3LEXA 3EO1A 1S9YA 3P9WB 3VXSD 4Y4FB 1MCCA 1XGUB 3ZKNC 5HVFB 1QR1A 4ZNEE 3L3KA 5DO2D 1YPZE 3VG9B 4JB9H 4P9ML 4BKLA 4PLNC 5CUSL 1FV1A 5FCSH 2X4TA 4PJGB 1Q0XH 4UBDC 5SWQB 3D3VB 3T2NL 3WDJA 4XAWL 5F88A 2VAAA 5D7SL 3ARFA 1AGFA 1T0MA 5F7EL 4WFEE 1OPGL 5F7FA 5J11C 1JWSB 4NZDA 4GRLB 2ITCA 3KPMA 5BS0B 2DJ4A 2QV2A 3GJFK 4YXHL 1YDPB 1IILE 4XPFL 5C0EA 3VE0A 4UDTB 3HFML 2AS5M 4JO2L 3QRFM 3QUYD 3FQTB 1NKOA 1MOEA 4LKCA 4PJXF 1CGSL 3EZ8A 2A6KB 1HH6A 2BCKA 3RWGA 1YEJL 4AENA 5B3JE 1IC4L 1BX2B 3WLBA 4LSSL 4JM2F 1BVZA 2IFFH 2PO6D 3T0EB 3HPJA 2EDLA 4PUBH 1TZGL 3OKNB 1H3UA 3K4AA 3C8KB 4G6ML 3GRWL 1LEGA 3NIGF 5T1DH 1AJ7L 1CXHA 5GSRB 4RFOH 5GSVA 2AJZA 4ODWA 3HI1B 5F7WC 4ZUTA 5EZJB 2P48B 4KK8C 5IB2B 3PWNB 25C8H 2WW8A 3DHJA 4HGMA 4OLZL 1H3TA 4DZBA 3VXTA 1UJ3A 3ILPA 5FGCE 2IALB 1OAZH 1P6AB 5BRZA 5JXEA 4P46C 3IETB 3BKYL 4WVRA 1EEZB 4GLRH 2NLJA 4BQBA 3B3IA 3MRBA 4WI7A 5E00B 2YPLB 2J5LC 2V7NB 3WS3B 3OXRB 4S2SB 1F11B 2VLKA 4G7YH 5GS3A 1VEPA 4FRWA 2AK4D 1N6VA 1AGCB 5C6TH 2GSIA 4LASH 1LE5B 3NACL 1QFUH 3O6MH 3KNBA 3O8XA 2AI0H 1AIFB 4LLMB 5I1IL 5INDA 5EN2A 3G6JB 2IF7A 1RPQA 3OGCA 1TFHA 4GSDL 1JNLH 3TIEB 3IJYB 2VDQH 1IM9A 3C5SB 2ATKB 3X11B 3WJLA 4P3DA 3F6IA 5CIPA 1B2WH 2VXUL 3C08H 2DQJH 1QQDA 5DTFB 4HK0B 1NCTA 4WUUB 2P42B 2JIXD 2OZ4A 1IJ9A 3P4MA 4X98A 1EO8H 3FQWA 3TVMC 3UTPE 2H26A 4NZJA 2HH0L 3RVTC 1DTUA 5C0RL 1ZTXL 2JK5B 1HINH 1RZIA 3HC0B 4HH8A 4E42A 3DVNA 4O51A 3W39A 4TNWF 1J1XH 4NC1E 4OV5A 3W81A 4GS7C 4LSPL 5T1LB 4C4KO 1TLKA 4YHNA 1L6XA 5I9QC 1FZJB 2G2RA 5KVMC 4XNQB 3DYMA 1SHMA 2V9QA 4DCQA 3CXHJ 4YDKH 2NXZC 5JLZB 5JDSA 4ZUVB 1LVEA 1R5VA 3LEYH 4O02H 1J11A 1A9BB 4PTUB 1U3YA 3O6LH 3G5XA 3ZYZA 4U1IA 3R0MA 4H0IA 4JG0H 5BOZG 1EJOH 3KPRA 2ED9A 3R0NA 1IGMH 4GXUN 1CICB 1WEJL 3KPSD 3MLUL 2DLEA 4L4TB 4Z5RA 3S37L 4LVNB 1RV6X 3QUZC 2Y5TA 1Q9LB 3IVKA 3HE6A 4I18A 3MRLB 4JY5L 4KZDH 1IQDA 5EBWA 3ZE1F 5I8CB 4OZ4B 1CWVA 3FAWA 5KSBA 5LVEA 1PEZA 3H42L 3O4OB 1QSEE 3IU4L 3MR9A 3JTSA 2D4FA 3FB8B 4DGVH 1D6EA 3G5VB 2YN5A 5ISZB 3VRIB 5H37G 5FGSA 3UYPA 3GBNH 1FGNL 4MYWB 5D1XA 3MO1B 4IRJA 2C3GA 3KLHC 3SDAD 3LKNA 2X4OA 1NUGA 1RUKH 1CFNB 4UU9A 3IDUA 5K9QI 5ETUA 4XCFH 3P9LB 1OY3B 5B22A 5FKPB 5JHDA 5EH1A 4KZEH 1MFEH 1SBSL 3BDXA 2A77L 1SY6A 4IOIB 1P4IL 5GGQL 3VA6A 4NGHH 4Q58C 3F12B 1T4KB 3I9GL 4M8QA 4ZAKB 4OZGA 4PRDA 1S7QB 5FIEA 1KTLB 1PY4A 1XGQB 4WO4D 2DJUA 4M1GL 1U8NB 1SYSA 3ZKMC 4GG6E 1K8DA 3VFWB 3U2SB 4NNYA 5HGAB 5MI0B 2DLIA 5TQ0L 1A7NH 4LIQE 1IGFH 1M7IA 2ADGA 2PTUA 3QH3A 3I3EA 1U91A 1D5XB 3RAJH 3QEUB 5EULV 1IM3A 3L3HA 4RDQF 3RI5F 2ZG2A 3ZKXB 2NY3C 3QIWB 2CGRH 4MA1B 1N6UA 4P2RE 1OGTB 5EOCJ 3GHEH 3IKKA 1MLBB 4KKNA 2JB6B 5JW3L 4KJPC 3DX6B 4X8JB 5DURB 3WL9B 1FCGA 4PJ5A 4M6NH 2OK0L 4LLVB 4OLVH 4TVPH 4HWZA 4LNRB 3VGHA 1S7SB 1IEHA 1KT2B 4XNYH 5AEAA 1YA5A 3U7WL 5I1DB 4I1NB 3G08B 3HNSL 4TQEH 3C60B 1XF2B 1DBAH 4ORGB 3P77B 5EO9A 1TQBB 1JZ8A 1A6VL 1J86A 3BUTA 5CJQH 5E24E 1KELH 2GUOA 4KHXL 5C0BB 3LQAH 5D7IA 4QHNB 1EAJA 2UWEB 1R3KA 3SDDC 1U8PB 4YDVA 4WTXA 5HHPA 1TZIA 1M7XA 3DECA 3BZ4A 1K9TA 1EBPA 2HG5A 1F3JB 2X10A 2R1YB 2HKFL 1OB1A 3P30L 4UT9L 3UTOA 1MI5B 4KWUA 3MRQA 4NOBA 1DQJB 3UEZA 5FYJU 4RX4D 1ZMYA 4Y5XB 4EN3B 3S4SB 1OVZA 1ZEAH 3MZGB 5GRJL 4Q9QH 2HMIC 4HUUA 1OOAA 5GJSH 1I3RB 2R23B 1GPOH 1TETH 5DVLA 4JKPL 5IROA 1VADB 4L8DB 5E99H 5HHMB 1A2YB 4WDIB 1ZVSB 4YC2B 4XGZB 4R90H 3SE9L 2ED8A 4HT1H 1Q72L 3PWVB 1G7LA 3GJEB 4QOKD 5GRZA 1KEGH 1V3MA 1MHPL 2XPGB 5C2BL 3JTTA 1X9QA 1IQWH 2ZUUA 1J8HB 1UZ6E 3BGFC 1N0LA 2B5IC 5CEXB 3SCMD 3EZJB 3CFKA 4LCCC 1YNKH 4IRZH 3MNWA 4DFHA 3EFFB 1HYSC 2AV7B 3QDJA 3ZDYE 4ELMF 1S7XB 1ADQL 1Q9KA 5DK0A 4Q7DA 1LQSR 5D5ME 2GT9B 1BF8A 2B1AH 1P7KB 1VHPA 3CFBA 4JKKA 2X70B 2ADJB 5ENWA 3TJEH 3OL2A 1H8NA 3MJ9A 4UT6H 3QCVH 2W0KA 3WIHH 1T22A 3FRPG 1BJMA 5TFSH 2IAMA 4JHWH 4EUPG 3RZCD 4UTBL 3BDYH 1GHFH 1QA9A 1JIBA 1YEDA 1NFDB 3GNML 3MGOB 1CQKA 1E6OH 4Z78A 4NQEA 2XG5A 3S3SA 4XMKL 3HMXL 1HZHL 1MWAA 2R0KH 1VACB 2ICWJ 2YD1A 4JRXB 1JNHA 5IBTH 1F97A 2EEAA 1FZMB 1TVDA 1A1MA 1WT5C 1A7BA 3HPLB 1DN0B 5CINH 4HEPG 2BDNH 1MFBL 5EC2B 2MCPH 3DVGA 4N90E 4QWWD 3MV11 3W9EB 2XTJC 4NHCH 4YHOL 4HS6B 4L3EA 1HHHB 5DI8B 2AQ2A 3O3BB 4U1KA 4X4YA 3F5WB 3NZ8A 3EDFA 5D72H 2NNAB 1U3HA 4M93B 3A6CL 1YMME 4I5BA 4ENED 1XGPB 2QSQA 1VB9A 5KANG 2B2XL 2RQ8A 1OTSC 3HAEG 1XF3B 1N64H 4PJ8D 1U3ZA 2J1KA 1T0NA 6CGTA 2CPCA 4ZTPL 4XC3H 5EUOB 1QG3A 5GGTL 3QI9D 3DRTA 2R4RL 5EU6D 1NCCL 3U9UA 3H9SA 4YO0B 4NN6C 1KOAA 5FHBL 3D85A 5F93C 2F9BT 4MD5B 2QKIB 5IJKC 4ZFGL 1FDLL 2R1XB 5I0DA 3UJIL 4NCC2 4RQQA 3KJ4B 1FFRA 3G6AB 2HLFD 5IV2A 3DBXA 1EXUB 2NTFA 5ID0A 1I4FB 3WHXA 2MCG1 1AHWC 2NW2A 3KDMB 3KPPA 4WW1B 4N9GB 4OT1H 4G8FA 4UQ3B 3ZE0F 4HV8A 4XNZB 1Q0YL 4LSVH 1LE9B 3DO7B 4S0TD 4FFZH 1WBYA 4LHQB 1S78D 1MFDL 4XXDB 5C07E 3V6OC 4EI5C 4YJZL 2J4WL 1EERB 2EDDA 1BOGA 3LQZA 2W60B 4NCDA 5I1HL 1FYTE 3CCHB 4MAYA 4TNWK 4FFVD 5TGBB 3SPVB 4NKMB 4DVRL 5DR5H 15C8L 4L9DA 2HTKC 2VH5H 4MNQE 1NDMA 4PJAE 1E4KC 3QT2A 3BUYB 5FECA 4JPKL 1I85C 1FNFA 1TXKA 4JAMA 2XRAL 4PJFF 3ARGD 4AIXA 2F58H 4GXVH 1JNJA 3ARBB 4QHLA 1MCWM 2QSCL 1L9NA 3D87B 5IWLA 3O2VL 2ICEA 4YXKL 1DUYB 2JJSA 5FYJH 5AYUL 3CDGA 1YEEL 3LV3A 2FWOA 1CZ8L 3OJ2C 1C7SA 4KROD 3GK8H 3OB8A 1VFMA 4PV9A 2FYYB 2Z31C 3BPOC 2VITB 3GM0A 4OZFB 1R3IH 2IH1A 3SE8L 3I02A 4LLYA 4OZFH 5A16A 5IBLC 4ZO8A 1GC1L 2VDRL 1XR9B 2VLRB 2DL2A 3MRIA 4WW2F 3ILQC 1QYGL 4P2QD 4YNYA 1CXIA 4PJBF 4NKDA 1WBXA 1A0QL 2XQYG 4K71B 4HKZB 1X5LA 4K07A 1MRDH 4U7SA 4UQ2B 4UT7L 2IANB 2PYFA 5HYSB 2P7TA 3VXRA 4OD1H 1IMHC 3V5KA 5T3XD 4MA3B 4U2YA 4ZPVA 2B20A 2BNUA 1G9ML 1VGKA 3MRPA 5FUZH 1ZGLP 5C8JB 2QHRH 3SGEH 1QR1B 2J8UE 1DVFA 3LMJH 2DYPA 2HKHH 3MCKA 5D2NC 2VLMD 1FV1B 1G7PA 4EQ3A 1I7RA 2NY4B 2N1KA 4LRIC 5L6YL 2P24A 3BAEH 1UEYA 2A38A 1TJHL 1I7ZA 2H32B 4HK3N 5C08E 2H32H 4I4WA 4LCYA 1ZHLB 5EOQH 1QLRB 4IRSB 2YRLA 3BKCH 2XFXB 4XP6H 5DJXB 4XP4L 1FLTX 1WZ1H 5I15H 1I8MB 2QADC 4X7TA 1WV7T 3RY5A 3N06B 4HQQL 1MCOH 1C12B 3G04B 3B2VL 4ZOBA 2GY7B 3MTRA 4C56A 1HH6B 3RWGB 2FLRT 4F9LA 1RZGA 2BNRE 1T04A 2PW1A 5JNYA 3D3VD 3P11H 3CC5A 5FO7B 5IHLB 5FEBA 2IBBA 1DE4B 3TA3A 2F8XC 6FABH 4KJYA 3A67H 2J88L 1XGTA 2MNUA 4GRLD 1JMZA 2R15A 3RI5K 5A43C 5BS0D 3T0BA 3MOAH 4KPHL 1DUZA 5E94A 2GTZA 5GSVB 3QQ4A 1QBBA 4W6WB 3BISA 4NM4L 3NABL 2EH8H 5DUPH 4GAYB 1G9NH 3AY4C 4I2XA 3RL1B 3MBXL 2GTWB 2HJLA 2IFGA 2DLHA 1JGVL 3FCTA 4PJXE 2ZPKH 4WTWA 3U1SL 1MEXH 1U8OA 2OYPA 3JUZA 4BZ2H 1UJ3B 3T0ED 3VFMB 1C7TA 4HSQA 1MHEA 5BVPL 3HZVA 5JDJA 2QQLL 4BSWA 1AR1C 3GIVB 1G84A 3EJYC 5FYKU 3FN0H 4P5KA 1MCJA 3RX8A 3NIGE 3MNZA 5AZ2H 3V8OA 1DEDA 4HS3B 3NCYP 1U8MB 2HFEB 3H3BC 2MMXA 4WU5A 1AXTH 5D1ZC 3SY0A 4O4YH 2B1HL 2GSIB 4OI8A 4Q0XL 3DPBA 1ZLUK 3O8XB 5DGRA 1OM3L 5DD3H 5LQBL 2WQRA 5SWSA 1LK3L 3ALWA 5CBEB 1G9EA 3RTQA 2AQ1A 1IC1A 1O5DT 2BSTA 4YIQB 3HLAA 1OP3H 2XN9D 4DEPC 3QUKA 5ID1A 1V3LA 1GGBL 5C0JB 2VIRA 3X3GH 4PJHA 1ORSB 2F54E 4CUCA 1A47A 4DW2L 5GS2H 3VH8B 3KPNA 3P4MB 1FFNB 3TN0B 2H26B 2FBJH 3RGVC 5EG6C 4KK9D 1NC4B 4RBPH 1N5AA 3C09C 4M1DH 5IFAH 4OLEA 2X7LA 4MMXC 2E8ZA 4W68A 3DMMA 4DN4L 4S1SL 1HI6A 4POZD 1FPTL 4OCSL 1T89A 4OV5B 4XNMB 2EDBA 3ARDA 5I1EH 2CR3A 3QDMA 4L4VD 4XH2A 1H15A 1Z0NA 3HNVH 1GZPA 2PW2A 1SJVA 2G2RB 3E2HB 1WZMA 2AQ3A 1SM3L 4WUUD 4XTRC 3BWUC 5JIIA 3GBLA 4X6CF 4OGAD 1U58B 4PJIF 5JDSB 1RK1B 5KG9B 1PG7X 4GJTB 4GG6B 4G9FE 3ZLQC 2DBLL 5FO8B 4PLKD 1X44A 1M1SA 1P69B 1WCBB 3I85A 4R7DA 5C70A 4K3DH 5EZOH 2FH6A 5FF6B 2J6EH 3MV8E 3IDNA 2XG4A 4Z77A 1RZFL 4BZ1H 4LIQH 5TPWH 3RA7L 3ZHDA 4S10A 4Z95L 1KTKE 1TVBB 2JJVA 4X9GA 5T1LD 3K1KC 3OHXB 3MRGA 5DQDL 4FQ1L 3VMPA 5LGHL 4Y16C 4HMEA 1CGXA 1ZLSL 3S88H 5CKGA 12E8H 1RUMH 2LU3A 1JPSH 5AZEL 4NRYA 3UZQA 1LMKA 4P2RB 3GMLA 3J7HA 5FM8A 1F00I 1JI2A 1WWBX 2W92A 2LV4A 5DDHB 4PGEA 4MCZA 2YZ1A 1R3HB 1NGZA 3TFKC 1K8IB 4P48A 5DLMH 1GL4B 4RWHA 1I1FA 4JM2C 1LEKB 1I75A 2FNBA 1JPGA 5DUML 3VXUE 1MIMH 4QHUB 1UM5L 4L4TD 3O6FC 4WHYH 3NA9H 1JGEB 1QZ1A 4DJMA 1OTTD 1KN4L 5D71L 4P4KA 2P45B 3MLPA 5ETUB 4IIQC 5E2UH 4OQTL 5F96H 2WLZA 3ZE1E 3TO2A 4LARH 5H94B 3ZTJH 4O2FB 2DB8A 5ISZD 2P43B 3NFNA 4X9FA 5IEKB 3OKEA 2IMNA 1KB5B 5F70A 5EO1B 3VGAC 4HUXB 4HIXH 4M8QB 1LO2H 3L9RA 2YBRB 1KB5H 4TUJA 1OF2B 3ESUF 2EE9A 4YXLH 3DV6B 4JFFB 3OZ9L 4DWHA 4GAFB 4CVXA 4KTEH 4Y2DA 1K8DB 1WFUA 2YA1A 4OZHA 2FJGB 3MLWH 3NCCB 1C08A 1JF1A 4APQA 4FQCL 1M7IB 5D2LE 5D93C 4ELKA 4PTTB 2XYCA 3E8UH 5I1LA 5J06A 2P5WA 3PDOB 1XF5A 3IDXL 2X4PB 1N59A 2EDOA 3LDBB 3QO0A 5DUBB 4NIKB 5HSFA 4HW6A 4CJ0A 4NBYB 4ZUSA 4MHHG 4ZAKD 4FQXC 3OKMB 5EC1B 1F4XH 2CUHA 1F58H 5DZLA 3IF1A 4M7KH 3CFJA 3UJJH 4D0DA 4CADA 4P3WA 1QRNB 2X4NA 2YSSB 5ICYA 4G8GA 4H88H 3AS1A 5E8PB 4HCRL 4AEEA 5MENA 4OF0A 3ULUF 3MGTA 1YEGL 1ND0B 4JQIH 4EDXA 2DWDA 1JHTA 3NVQA 3RIAF 2HFFB 3CZJA 1IGYA 2MJWA 2ZKHL 5MEQB 3QIWD 1NCWL 2Y23A 1T6VN 5D70L 2ICWI 1AY1L 4JQVC 2HN7A 2XNAB 3PHSA 2DI8A 2EXWD 2CIIB 1G6RB 4JO1L 1BQLL 4X4ZA 1G6RH 3I84A 3FT4A 4TVPD 3OBAA 1G9MC 4PS4H 3BYYA 1DQDL 1JGUL 1A14H 2GY5A 1U8JA 1XCQB 1NBYA 2X89A 4Y19A 1CGWA 4G6KH 3C60D 1YNTA 1CFTB 3QNZA 4HUUB 3MX0A 2PYED 4KDWA 1DQQA 3HI6L 4XPTH 5C0BD 4D0CB 5BQ7A 4V1DB 5T1MB 5IMLB 4V3EB 3UTQA 5C0NC 3WJJC 1IKFL 4N1CA 1UH4A 3FFCA 2R2EB 4ZOEA 5F8QC 2LVCA 3RJDA 4P46A 3IFLL 1UXWB 5D6CB 4JN1H 3QR2A 2P5EA 2EE3A 5EU4B 1MI5D 1AD9A 2GAZA 4HZLA 1CD1A 4ZPTA 4EN3D 1MHCA 4OKVB 1FNSH 1BJ1J 2EO1A 4KKCC 2ILLA 4RGNC 5GISH 3LRGA 5AAWA 1U8QA 3EOAB 4TSAH 3WXWH 3N1FC 1VPOH 4KRPC 1Q9KB 1DQLH 2W9EH 2EDKA 3UPRA 4JHAH 2VC2H 4PRIE 1T66C 4OCNC 4OUUA 5ELIA 3RKPA 2P8LB 2Y5EA 4NP4L 5L88L 3T2QA 1G7QA 3TZVC 3MCLH 3WD5H 3KLSA 4OLXL 1LD9A 3MV7E 4LPWA 3QFJA 3LEVH 2X9WA 5HDQH 3GSRA 1U8KA 4R0LB 4I3SL 3FOLA 5CSZB 3FT2A 1DANT 2VQ1B 5F7YC 5D8JH 4P4RA 4HBCH 4NQEB 5KVDL 5C07B 5ECJE 2BVPB 4WTZA 5GZNC 5IKCB 2CRZA 1FYTB 4LLWA 1YPZA 5DRNB 3TVMA 1BLNB 4HH9A 3AC0A 1DN2A 1ZT4B 4OIBA 4CVZA 3GI9H 1B88A 2MKWA 4BH8B 4HLZH 4L3EB 2ERJB 4S0SD 1ORQA 3MRRB 5EBMA 4X4YB 2YEZB 4FG6C 1ZA3A 5AUMB 4HIIB 1FL6A 1I1AB 2BMKA 4KK5C 2NY0C 1U42A 3UO1L 4ZNCD 4JFZH 3B9VA 4ODUA 3D69B 5F7DB 2ZNWA 3R1GH 4HFWA 5C7XL 4ODXB 1PLGH 4NRXA 4P57A 2EE2A 3M17A 4UIMB 3AS2A 5ICXA 2MSPA 1RURH 3ROOA 5DZNA 5D6DC 2F53E 2E7LC 5E6IC 2Q8BH 1JTOA 3PQYE 2EIEA 1N2RB 4JEGB 4HF5L 4UILL 4YUEH 2UZYB 1KBGL 1YUHB 3FL7A 3OR7B 2Y72A 4MZ2A 5D96C 3QUZA 5MEOB 2CJUL 3EYSL 1TENA 1WFOA 3IFPA 3KPPB 1MSPA 3M07A 1RVFH 3PP3K 2VTFA 3OKLA 1PG7W 1U6AH 5HJ3A 2OL3L 3FQNB 2PNDA 3L7EB 1PQZA 2BOBB 5JA8B 3MRFA 2XQYK 5FM5O 5FYLL 2NR6D 2J8UB 5FO9B 2PR4H 1WAAA 2LVEA 4QF1A 2PKDA 3KAAA 3PDGA 4JRYE 3U0WH 4IBLT 3LQZB 1F4YL 1CQYA 1L0QA 5F7NC 2GK0A 3RWIA 1NANI 3MRDA 1QBAA 4X8XA 4DOHE 3KPQA 1FG9C 4R97C 3T1WA 3MJ7B 4XHQA 3QQ3A 3LKRA 4RGOL 4KKAD 3PWUA 1DBBL 3RDTC 4JDTH 3ZE0E 1YMHA 2VOTA 4ONHA 3BYTA 4GO6B 3THML 1HHIA 4JJHA 3E1F1 3CDGB 5EZIH 1KFAH 4HXBL 4HGKC 1AQKL 3PWJB 4O2EA 4PV9B 3V52H 3I50H 4XVSH 4X6DA 2DS4A 2IH1B 1GVIA 2P46B 4WFED 1YEFH 5JPMB 2CRMA 4X80H 4GRMA 1ZS8A 4UTAH 5TDNB 5IHZB 4LVHB 4POYA 1RMFL 4YNYB 3MODH 4XHJD 2I07A 4FQ2H 4GMSH 4H20L 1LP9A 3ARBD 3I3DA 1VFAB 4OBRA 3O4LA 3EO9L 1E4XL 2O5ZL 4KUZH 2P7TB 5J1TC 4RFEA 2BSED 5CWSA 4HIHB 4MA7H 2Q6WA 1VEOA 5C0FB 3BSZL 3SDCD 5A3IC 1JWUA 1KCVL 1OAXH 2V5SA 4POUB 3ULVF 3MRPB 1QHPA 3U6RA 2VLRD 3Q5TA 3DXAB 4J6RH 1YY9D 2DYPB 3FB5A 1PD6A 2PTTA 5IM7B 3CXHK 1HKLL 1YJDH 1IL1B 2I24N 4K9EH 5CSGA 4JO3H 1DBML 1C5CH 2IAND 3ZTNH 2KZ1B 4D94A 1F02I 5GRUH 4KRNA 1N0XH 5JPNA 1LDSA 1UWXH 3SDDA 4GAJH 3T4YA 3BP4B 3V4VH 3QXWA 2CKBL 1FLRH 4ODHL 1JRHH 2ZCKL 5I16B 3STZA 2Q7YA 2VDMH 1CGTA 4X7TB 4P3CL 4NQVA 3L3IB 3V0VA 3REWB 4OLUH 1QSEA 3E6HA 2F54B 1FZKA 1RZGB 2NY4D 3GSOA 1Q8MA 1A3RH 1FO0B 1T04B 4X6BB 3QNXA 5IB4A 1UCBH 3P0YL 1FO0H 3OX8B 2IPTH 4IDLA 4I48A 3KPTA 1FORH 4JY4A 3GGWA 1XGTB 4IRSD 4R4ND 1KYOJ 4Y8DC 4Z76B 1RZ7L 2XWJB 3OJMB 3GMOB 2WBJC 4OCXL 2B0SH 3MLSH 4W6XB 1UM4L 2I5YH 4NQUA 5EDXA 1PW3A 2XWTA 3BO8A 4GUPB 5L9DH 1X6LA 4TRPH 4WFFD 1INDL 3ARYA 4Y7MA 1UVQB 3SGDH 2M26A 5F72S 1U8OB 4LCCA 3EYVA 3ZL4L 4P5MA 4D3CL 1ZSDA 3UTPD 1S9KC 1CFSA 2R9HD 1MHEB 4RAVA 3HZVB 2ARJA 3X14A 4IJ3C 2FX7H 4G9FB 3RIAK 4BSWB 1R3LA 4AEFA 5B39B 3QIUC 5JW5A 3GKWL 1B6UA 4M7LH 3QO1B 1UB6A 1SEBA 4P5KB 4WI4A 5CGTA 3MNZB 3GRWA 4U3CA 1H5BA 1CLYL 1DSFH 1FG2A 3OB0K 4WU5B 1DJSA 4LLAA 1MJJA 3L5WB 4ZTOH 4LGPB 4XWOC 3RFZC 2PCPA 2BVEA 5CS7A 5E8NA 4M9PA 3RL2A 2VDOL 1BD2A 4PJCF 1N8ZB 5SWSB 1L6ZA 4DN3L 1OAUH 1P2CB 3CDCA 2D7OA 2ZUWA 4LVOB 2AJVL 2DQEL 4YHIA 4Z18A 3GJFA 2C7UA 4YHKL 3UTZA 3O3DA 3CPLA 1R5IB 2VIRB 4PJHB 3L7FB 2DMCA 5GGVL 8CGTA 5L7XH 3FQUA 2YA0A 3KPNB 3ULUL 3WNOA 3A6OA 2P1YA 2ESVE 1N3NA 4OZIF 1ITBB 1LK2B 4PJ7F 4RNRA 2FEEL 4WW2C 1NGYA 5JW4Q 1NH6A 5IG7A 3LH2L 1DQMH 2QLVB 3IFNH 2OSLB 5JORB 5JHLH 4M7ZC 5EFIB 3E3QE 3QDMB 1D5BA 4YAQA 3K1DA 2YN3A 1GGTA 2YXFA 2AJSH 4JY6A 4NOFA 4HPYH 1H15B 4QRUA 3PHOB 1GZPB 2VAJA 1V05A 5GS2D 4PRNB 5IJKA 5TF1H 4NYLA 1K5NA 2Y6SC 2AEQL 8FABB 4MXQC 1KLGB 1ZLWH 2DD8H 3V9FA 3TN0D 3L1OL 5EPMB 4YHML 2V2WB 1NC4D 1RJZA 3BKJL 4ZXBB 5EA0L 4ZS7L 4O2CB 4N5EC 3JV4B 1AHWA 5D2LB 4PPTA 3RWJA 3VFTA 2Y07L 1PEWA 2JCCF 1WJ3A 5IF0A 2Z35A 3F7QA 1Y6MR 4M43H 5EOCL 4MJ6B 4MVBC 4OB5L 1QO3B 5I18H 3S34H 5HPMB 3I6LD 3BX7C 1CR9L 2BHYA 4XX1G 3WFBH 3V6OA 4EI5A 2F8VA 3VCLA 1KXTB 2GHWB 3TYGL 4JREB 2MWCA 2LAAA 1OARL 3QHFL 1WWWX 4NC0B 2CDGA 3EYFB 1E4JA 1NGZB 4LLQB 1E4KA 4OLYL 1AXSA 1L7TH 1NBZB 4LGRB 2FO4A 4RAUA 2GFBA 4NWUH 1TJGL 5J12C 1I85A 2OS7A 3MRKB 3CFEA 3H7BA 2OX5A 2J7LA 5D5MA 1SJEA 4OI9A 3UROR 4QRSA 3H7LA 5LAXB 5DMGC 5A2IH 1IT9L 1IGJB 1I1CA 5DT1L 3PGCB 1RD6A 4TSBH 2XWBA 4P2RD 4KJQD 1VCAA 3DGCR 1Q1JL 2GJ6E 1FVCA 4GKSB 1U8IB 2VLLA 2Z31A 3U79A 3DUUB 4NUGL 5J56B 3CXDH 4W70A 4XCNA 4N8CL 1WFTA 3Q6GL 2APFA 1BECA 5JR1L 5H2BB 4F58H 4ZQKB 2NX5E 4X9IA 2EH7H 4S0UC 4B0MM 4P2OC 2VWEE 1KCSH 2WWMD 4M5ZH 1R0AH 4H8WH 4TPRH 1OHQA 2K7PA 4RMWA 4HS8H 4GG8A 4YHLH 1JZ2A 4LRNH 2ZSWA 1C5BH 4Q9RL 4M6OL 3U7AA 4MB3A 2H3NA 3RWDA 4B53A 4G6FD 4LHJB 4NO0B 4E0RB 3TYFA 1YMMA 3MLZH 1XF5B 3OKKA 2DTMH 4XBGA 1NKRA 1T03H 1UZ8A 3E3QC 1T83C 4ODTL 4MWFA 1S7UA 4OLWL 3RNKB 4WI9A 3QPQD 4LRIA 4M6MH 2VUOA 3IF1B 4JFFD 5E1AB 3CFJB 4XP9L 1IKNA 1BMGA 5HI5D 4HWBL 3TPUE 1A9EA 5FM5M 3QJHB 5MENB 5J11B 3MGTB 1O7SA 4IHOB 3HHRB 3MV7B 2VDPH 5HHVL 4WY7H 5FM4A 3TM6A 1VGEH 4NJAH 5B3NA 2CD0A 1JHTB 2YS4A 3AUVA 4H1LB 1S7TB 2Q3ZA 3RNQB 1A6ZA 1N6QH 2AKRA 4H1LH 3PL6B 5HY9A 2R1WA 3U30C 1O7VA 1GRWA 3BW9A 5T33L 5DFTA 4A6YB 1WBZB 4JM4H 4Q74A 4UAOC 4G8IB 4XMPL 4A6YH 4JFPB 4AL8H 2X09A 1SVZA 2R69L 1Z5LA 3BPNB 7FABL 3FT4B 1VFBB 3EOTH 1AC6A 3MRHA 4XPAH 4N0CD 5F9JB 4G6AC 4LOUC 3SN6N 1UKQA 3EDEA 4FQPA 3CAFA 5KS9F 4Y19B 4XZUB 2D7TH 5J1AA 2IG2L 1YNTB 3HG1A 2BSRA 1XCTB 1E0OB 4YH6A 2R56L 5T5FH 3AY4A 3B8SA 1ACYL 3UTQB 3M8OH 4O58L 3S36X 3NBNA 1D5IH 5ESVA 3FFCB 1N5YL 5EU3A 4UNVA 5DD5L 1IZKA 2R0LH 1MRCH 2C3VA 3LS5H 3MFFA 3ZKQD 3O2WL 2F53B 2GAZB 2CXGA 1CD1B 3FO0H 3PQYB 4N90D 4AJ0A 3QDAA 3L3DA 4YWGL 2NXYC 2J5LB 4PRPA 3O45A 3DVFA 3HRPA 1MH5B 3PV6B 1TIUA 2FJFB 2HT2C 1EHLL 5D1ZA 4OSUH 5FKAB 3P73A 3ZO0A 3TT1L 1LEIA 4V1DD 3ZDXF 5DD6B 3TH4T 4HWEL 3VFGH 5JW4M 4N0YL 5JO5A 3S35X 4JFQB 1LD9B 1OCWL 2WINA 3JV5A 4QCIA 4R7NB 3ORJA 1LHZA 5FYKH 2XZAH 3O81A 1IFHH 3FT2B 4OF3A 5KVEL 5IB3B 1OAQL 3N9GL 4M3KB 3WDIA 4P4RB 5I71C 3C5ZB 3ULVL 3QSKB 5FK9B 2NY1C 4TYUA 3FQRB 4LLWB 1CLOH 2C3WA 3X12B 5C0IB 3KYNA 5B38B 3RGVA 2UYLA 1ADQA 3D39A 3T3PE 3TBSA 5J7CC 4NQCA 3U83A 1OAYH 4FTVE 4CVZB 1KC5L 1MF2H 4XBPA 5I19H 5D4QA 5C08A 1CIDA 1P1ZB 2DDQH 4F7TA 4MJIB 3BMVA 1T7XA 3PNWA 3QUXC 1ZA3B 2V17L 5C07D 1D3CA 1RZKH 1FL6B 2BMKB 4KGLA 3SKMA 2A0LD 1QVOA 3EFDH 3FO9B 1KIPA 1PYWB 4RISH 4F57L 3D18B 1F2QA 1KV3A 3VWJB 1FYTD 32C2B 1FN4B 2NXZB 3U9PH 3HMXA 3G5YA 5F97E 4MNGA 5K59F 5AYQA 4F7PA 4MNQD 4I9WE 2BNRA 3L95A 5ICXB 3ROOB 1HE7A 3LD8C 4ZFOL 1AP2B 1FGVL 1E4WH 1UG9A 3PDDA 4YE4L 3MJ8B 3EDJA 3UAJC 4PRBA 4MAUL 5GZOC 4YX2H 4NZUL 5DJ8B 2H2SD 1I1AD 2EDRA 3WEXB 3ULUC 1MRFL 5ALBL 4NQDE 4Y16A 1G1CA 3CLEH 3FQXB 2FZ3A 5E4EC 1YY8B 3F58L 3UZEA 3D9AL 1FL3A 4KQ4H 4PJGF 4K2UL 3KXFE 5GGTA 2V9RA 4M62H 3TFKA 1HXYA 4QF1B 4DUXA 4FP8H 4AG4H 2IPUG 1MREH 3QP3A 3KPOA 4JM2A 3BZDA 5E8EB 4JKLA 2A74A 1UWEL 2Y25A 4IS6B 1HQ4A 3O6FA 3RBGA 1VSCA 3C2AH 3CSYB 3KS0H 4G8EA 4OTXH 1HOCB 3RWIB 1S5IL 4LPUA 3MRDB 5HYFA 2VZSA 3QG7H 1U93A 4F15C 5GS1C 3LS4L 4HDIB 4YDIL 3NCJL 2V2XB 2GSGA 3QQ3B 3FJTA 2XA8H 2FB4H 4U31A 1BJ8A 2LTQC 2CDFA 3PWUB 5J0BA 4LPCA 3P4NA 2EC9T 3B83A 1JPTH 4JFDE 3P0GB 4EQ2A 2I9TB 4N0UE 3GSVA 2I25N 3F6LA 3QA3B 1G0XA 4OIIH 1MCFA 5J1SC 4N9OB 5DEFA 1RULH 1QPPA 1HQRA 1IGCH 2Z4QB 1NCBL 5IESH 4HMCA 2HTLD 5TE4H 2VXSH 1QKZL 3MUGA 1RIHH 3OF6D 5CP3A 3LIZL 2ATPB 1A7OH 3U36B 2BVTA 2DM2A 3V4UH 3REVB 1OP9A 4UV4L 1A3LH 3WNPA 2I07B 3OKOA 2YK1H 4I77H 4K7PL 2BFVH 5F3BA 5FDWB 4YFEA 2PETA 2DKSA 2H8PA 4FNLL 4OIAA 2ORBL 1ETZB 2NY3B 3GO1L 4FQXA 4RFEB 5CWSB 4QGTA 4MS8C 1IC7L 1QFWI 3DV4B 4F80A 4B50A 3WNNA 2ENYA 4JZJC 1KPUA 3IDYC 1CK0H 3BZEB 4ZSOE 1G7IB 3U6RB 4KJWC 4PG9A 1QEWB 2ZUSA 1YECL 5I1CL 1NFIA 1UH2A 4K94L 2AK4E 3MV9A 3KPLA 1WC7A 2AXGA 5IEHA 4XAKE 3G6JF 1T20B 3BPCA 3KYKL 4HX1B 3VU2A 1MJUL 2X6MA 4NBZB 3BPLC 4GQ9L 2Z91A 2C4FT 3WS6C 1IVLA 1NLBH 5D1QC 3GHBL 4JQVA 5GHWL 5JUEH 3CJJA 5DMIH 2AEWA 2BX5A 3R8BB 3STZB 2CMRL 1FRGH 5IIEB 3VFNA 3DXAD 3H0TA 2Y7QA 4XCCH 3WFZA 3ULVE 2WLYA 4MNHA 1NAMB 4KQ3H 5BZWB 1FYHB 4AMKL 1NAMH 1X5XA 3GSOB 2WUCL 5DO2C 5FCUH 3NH7L 1DLFH 4KRMB 4P23B 2ESVB 3INUH 3T8XA 5MP6H 5LGJB 3H3PL 2BSSB 1KJ2L 1XR8B 4M7JL 3GBMH 3WJJA 3N1PC 2ADIA 3B9KB 1T1YB 2O5XH 3W2DH 3BO8B 1NMCC 1BBDL 4JANA 4CMMA 5BJTB 1W2KT 2CUIA 1GAFL 5GRWA 4JKMA 2VL5B 4R26L 1MNUL 3D0VA 4YDJB 2G5RA 3QXDB 2F54D 3PWPA 3SDYH 1F6FB 2X05A 4LCCB 2BY3A 4PJ9B 3UYRL 1AKJA 1BQHG 4DAGH 1CFSB 1KJVB 4NT6A 2HA1A 1L7IH 3X14B 2AJXL 4FXKB 3WFDL 5B8CB 3KYOB 2PO6C 4PB0L 3WFCH 4YQXL 4X7SH 1R3LB 4ZFFA 3MRMA 2XY1A 2ZG3A 1A1OA 4JKWA 3RPKA 3TZVA 3RX7A 4KTDH 3NGBB 3CFCH 2ICES 5JOPE 1AJ7H 2PCPB 2JELL 5FGBC 3DURA 3ELAT 3VXNA 2BC4A 1IAII 2CK0L 3BGAA 2VDNH 1BD2B 1CVSC 1ODAA 2A83A 3HB3D 4G9FD 5IW1A 5HYJA 2F19H 2HWZL 5KZCB 4KKLD 2C7UB 4Y5VC 3MV8D 1R24A 4Z7VB 1YEIL 2HJKA 3HUJE 3O9WD 3VFOA 1IEAB 3DTXB 4NN5C 2FD6H 1M7DB 1DFBH 5HHOE 3WUZA 1HHJB 2ZUXA 4U6VL 3PWLB 1J5OH 5FB8A 5LWYH 3TWCH 5DQJA 3MLVH 5K9JH 4RNRB 5I8EB 5LBSL 3TPKA 4NJ9H 4LKXB 5I1JL 1RFDH 1C5DA 1MCRA 2EXYD 4PRHE 1ZGLA 1KG0B 5DWUH 1QACA 3RWHA 4UI2A 3WKML 1S8DA 4U1NB 3H8NA 3U48A 3H6JA 5D6DA 2E7LA 5E6IA 4ONFH 3TCXA 1E28B 3VXUD 1QSFE 2C9AA 3H9HA 4QHMB 2NX5B 4AK1A 1D6VL 4OF5A 1AE6H 2NZIA 4HWNA 4WV1C 3MLRL 3TV3H 5MERA 1W0WA 4PJ7E 1T1ZB 3QUML 3A6BH 1NDGA 3FHAA 5CCKH 5IF0B 5LCVH 2GQHA 4MJ5B 1FCCA 1P4BL 5C6WH 1K6QL 4ORZC 2VABA 1FL5A 1NJ9B 1M6OB 1NUFA 2P47B 4NKOB 4L29A 1A7PH 2Q20A 1CE6B 4NCC1 4MHHI 3OXSB 4K3EL 4ZXBD 3DHMA 3EDKA 3K7UA 2R0ZL 3TPUB 3WXVH 5K9KB 4YFLF 4YGVB 2E7MA 3NZHH 4R96A 4G5ZL 3W5MA 2HLAA 3QRGH 5CILL 5ANMA 2GJZA 1PG7H 2AV1B 2UWEF 2DIAA 3GMNB 1TTFA 3MPCA 5IQ7L 3E6FB 4M48H 2CLZB 5DK3A 2DQIH 4OM0L 2ED7A 3MRJA 4HJJL 4Z8FL 4I0PB 2N7AA 3RDTA 4NSKA 1F8TH 4HHAA 1BAFL 4WTZG 3WKNA 3RWFB 5JXEC 1WEJH 2XWBB 3QEGL 1T2QL 1NGWA 1BEYH 2Z31B 4L8BB 5BMFL 4HC1L 5IVZB 4WU7A 3LRSA 4Z7OF 2DKMA 2FX9L 1ZT7A 3V5HB 3NTCL 3MRNB 3HNTH 2I9LB 2PTVA 3VMNA 4XPGH 4ELMA 5MEPA 3MSPA 2M1KA 1OT2A 4Q2ZB 3IDIA 4U1GC 5ALCL 3SDAC 3D2UA 5F1NB 2DLFH 1FNHA 3DI2B 2VERN 2ZSWB 1WQVT 4EBQH 1I9RL 5DRXB 2MPAH 4QOKE 5T3XL 1RUQL 1F42A 4AH2B 4NRZB 5IT2L 2FECL 4O5LH 4OQTA 3RY4A 2BY2A 1QBLH 4XBGB 1UZ8B 2ZJSH 1EK3A 4OFKA 4GFTB 3VXOB 5D2NB 1KLUB 1X7QA 3K4DA 2WV3A 5I6XC 4YPGA 4JFEE 1SJHA 4WO4C 3FB6B 3T4AB 1SMOA 5E2TL 4ZDHA 3ARVA 5CHNB 3PXJA 1NLDH 5J89A 4JDVA 1NFDF 4NO0D 4KKBD 2P8PB 4HKJB 5HYSG 5I76A 4JB9L 2Z8SA 3PHQA 2BNQA 2EO9A 1TPXB 4Y4KB 1J9CT 5DSCB 4NO5B 4NUJA 1CL7H 4LF3A 1Q0XL 5I74B 1R5WB 2V5MA 4Y1AA 3O3EA 2A6IA 1YQ2A 5DD1H 4F2MA 4UINH 5HVHC 4PY7A 5AD0A 4LHUA 3FN3A 5EZLA 4PRID 1Z5LB 1Q9OA 1KLFA 1T3FA 4U05A 5DK2A 4QTIH 3IGAA 3QWRD 4X83A 3VA2C 3MRHB 3MV7D 1NBVL 4F33A 2W0LA 4PJDA 2DQHH 1XGYH 2WBJA 4HCRA 5JW3H 5FOBA 1FFOA 1CGUA 1GGYA 4X4ME 1KCRH 3CD4A 3HG1B 1I9JH<