2D3DA

Crystal structure of the rna binding sam domain of saccharomyces cerevisiae vts1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
83
structure length
83
Chain Sequence
SMNPKSLTDPKLLKNIPMWLKSLRLHKYSDALSGTPWIELIYLDDETLEKKGVLALGARRKLLKAFGIVIDYKERDLIDRSAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vts1 protein
publication title The NMR and X-ray Structures of the Saccharomyces cerevisiae Vts1 SAM Domain Define a Surface for the Recognition of RNA Hairpins
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 32
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2005-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2d3dA00
1B4FA 2Y9TA 2ESEA 3BS5A 1WWUA 1X9XA 1UQVA 1X66A 1UCVA 4PZNA 2KSOA 5L1MA 4RQNA 5J8YA 1SV0A 1V38A 1PK1A 4NL9A 2F3NA 1SV4A 2QARA 2B6GA 2QB1A 4NJ8A 2QB0B 2K4PA 4IS7A 3KKAC 1OXJA 2EANA 2KE7A 2E8OA 3SEIA 2KMDA 1V85A 1DXSA 2EAMA 2E8MA 2F44A 1LKYB 1F0MA 2EAPA 2DKZA 5JU5A 1Z1VA 5JTIA 2D8CA 2KSOB 1SGGA 5JRTA 2E8PA 3IDWA 1PK1B 3TADC 4RQMA 2FE9A 4PZOA 5KNIA 2Y9UA 1B0XA 1SXEA 4NL9C 2LPEA 1PK3A 3HILA 2DL0A 1X40A 1LKYA 3BS7A 1SXDA 3BS5B 2F8KA 2LMRA 1KW4A 2JV3A 3KKAA 1WWVA 2GLEA 2KIVA 3SENA 1OW5A 2EAOA 2E8NA 2QB0A 2KG5A 2K60A 2YTUA 3TACB 3TADA 3H8MA 1COKA 2QKQA 2QARB 5F3XB 5J8YC 1SV0C 4MHVA 3K1RB 2ES6A 1JI7A 1RG6A 2L5YA 3BQ7A 2DKXA 2D3DA
chains in the Genus database with same CATH superfamily
1VLBA 2PKEA 3ISDA 4DS5A 5KFWA 1ECWA 2G07A 9ICKA 9ICIA 3HP6A 3F2DA 1X9MA 1X66A 5J2HA 1PVPA 3J81j 2NO5A 3PSPA 2XY5A 1MC8A 1Z00A 2W8LA 4RUCA 2XI9A 5D49A 3H40A 1SB3C 4I2FA 2QB0B 4O3RA 2C2DA 1KL9A 1NKCA 1S76D 3T5LA 3C21A 4DO9A 1KDHA 2G08A 3C28A 3MFHA 9ICOA 5KAIU 2JHDA 2HVIA 2NRXA 4FS2A 9ICBA 3H7IA 5DQHA 5KFSA 3THVA 3D2NA 3ALRA 3RH6A 4LJXA 3F53A 1AQ6A 1BPBA 3MDCA 3C5FA 3C5GA 7ICQA 1IM4A 4Y2SA 1NJWA 1NK7A 2E8PA 2ASJA 4J9QA 4J9KA 1F5SA 2FE9A 1TKDA 3UMCA 4EBCA 1U45A 1SXEA 5EE9A 5KT7A 2DWQA 3ISBA 2IOFA 2F2AB 2RLTA 4FZMA 4QJFB 2W9AA 8ICVA 2H3IA 1L3UA 3HKZC 2EDUA 3TAPA 3ZD9A 1RQLA 2AQ4A 2ZXIA 4PHDA 2BCUA 3SMVA 3BZKA 4ED3A 4DOCA 5HP4A 2YMMA 4RQ2A 2KZZA 3K75D 7ICNA 1T8EA 2G0AA 5DQIA 4KLSA 3NVVA 4DF8A 4C0ZA 4Q43A 1KQQA 4J9PA 1RG6A 4Y2UA 4KLJA 4DQIA 2EQYA 5KFRA 1X6IA 2Y9TA 1XWLA 4C4SA 1WWUA 1ZQYA 5ALUA 4I2CA 3RB4A 3R9KA 4RQ5A 5HMLA 2FPKA 3RRGA 1D8YA 3OHAA 5KFVA 4QWEA 1MQ2A 7ICJA 4YXMA 5BPCA 1SV0A 4OJ5A 3HRDD 4J03A 5IINA 4QWAA 3AMZA 8ICGA 2B6GA 4XA5A 2MAXA 3CW2C 3F2BA 1C20A 3H0MB 5J2AA 4PPXA 2AGPA 4M9GA 4UAYA 1ZQQA 3EZ5A 1ZQVA 3S6JA 4CF5A 3Q8RB 3QEBZ 4ELUA 3WK6A 4KLIA 3TKAA 3WKDA 2HDOA 2KZMA 3OSPA 3GV5B 3H4BA 1L5UA 3G6VA 1TK8A 4P0QA 4Q44A 5DDYA 3LYSA 3C29A 5ALKA 2DPIA 3RJJA 2JEGA 2Y9UA 4UAZA 5L1KA 4FE3A 4OJPA 4Q8EA 2HBJA 3FDSA 3BS5B 4PL2A 4QZHA 2P66A 5AM1A 1B22A 3OHBA 2K60A 5AI6A 4GLXA 4B9NA 2W9MA 3H8MA 4EX6A 2BHNA 3Q8LA 2F77X 2QARB 4OCZA 4YP3A 2YMQA 4XQ8A 4Y2RA 5AKHA 1JI7A 2VA3A 2KZ3A 3M8SA 1S0VA 7ICVA 4KX3A 1YT3A 3PW7A 2KEYA 3FC4A 1VJ5A 2P35A 4ED7A 1JROA 2J6SA 1S5LU 1A77A 4I2IA 4J9RA 2HSZA 3IN5A 1A76A 1O08A 2LYHA 1KFTA 4F93B 3UMGA 3TFRA 1DGSA 4J9NA 3T5JA 4F92B 3T79A 2BCVA 2AXTU 1ZETA 2IOFK 1LKYB 3HJEA 4F5OA 4I28A 1FO4A 2BCRA 2Y1IA 2HHVA 4TUPA 2W04A 2NRWA 5JU5A 2YQEA 4UAWA 2HHUA 3HW8A 4RQ6A 2QLTA 4UB6U 2FI1A 3WK5A 8ICXA 4CDGA 1JMSA 3PX4A 1T3QA 2YN4A 3K1ZA 5ALRA 2HBLA 4IC9A 2MSNA 5EWEA 4M9JA 3ICXA 1KTQA 3IG8A 1SIJA 9ICPA 2WF7A 4M47A 2H3QA 2KJ9A 2WHEA 3V6JA 4C4RA 2WF9A 4DWIA 4QZGA 1COKA 3MR2A 2JGAA 1HUZA 5T14A 2K8BB 2PFNA 1QQ6A 2W7PA 3BQ7A 3IRUA 3MGIA 1QSYA 2XO7A 4JB3A 2W7OA 2KKPA 5J0OA 4C7YA 2JH1A 2RRDA 3M1YA 4O5EA 9ICUA 1X9XA 5DGBA 4HAIA 1UCVA 2HOQA 3NRWA 2KSOA 3MDAA 1KKXA 3IP4B 1A0PA 4DFJA 4MEYA 4EYHB 3PVXA 1PK1A 3HKZF 4NM1A 2K4HA 3NRZA 3QU9A 3AN1A 1OXJA 5ALXA 4JMUA 2E8OA 4BXOA 3SZ2A 4QZ8A 2YX8A 1XSNA 1SKSA 2A1JA 3OGUA 4FO6A 5EWGA 2PI4A 2E1EA 5HMMA 3SI8A 4O3PA 3UMBA 3HWTA 5KFNA 5HNKA 5IIOA 4EYIB 1B43A 9ICQA 2HOIA 1V97A 3VC8A 3QU7A 4YVZA 4EX7A 2AHOB 4QZDA 1DGJA 4EBDA 3ZDCA 5KT6A 3JPTA 2VA2A 5J0SA 3I28A 1HIWA 4MEXA 3QXGA 4GFJA 2JZBB 4PZOA 5KFIA 3H8JA 5J0PA 4C4TA 2O6KA 4FS1A 3KHRA 1X40A 2CRXA 2A1AA 3MC1A 4PH5A 1HUOA 4IQTA 2JV3A 2N1RA 8ICUA 3PSTA 5AM3A 4OD0A 2QKQA 5F3XB 4ELVA 2XIDA 1SV0C 3RTVA 4YMMA 2UVUA 3SAFA 8ICLA 5KFHA 1TK5A 8ICZA 4ECUA 2LHTA 3IM1A 3EUB2 3H8WA 4Q45A 1IV8A 4B9SA 1RM6C 3EWAA 3LWLA 7ICSA 2ZIUA 3U26A 1MA7A 1RZTA 1D9DA 2XY7A 3QE9Y 4Y2TA 1C7YA 7ICGA 3QUQA 3C1YA 4F4XA 1XSLA 1MQ3A 2DQNB 4BX9C 1N56A 4BWMA 1ZQIA 4CGZA 4EEYA 3SEIA 1QQ5A 3RJEA 4QW9A 2VIXA 3RBDA 1N5XA 3CRXA 1K1SA 2GWSA 1ZQHA 1ZD3A 1N60A 4QZBA 4Y2VA 4F4KA 1ZD4A 2KHVA 3FYHA 1ZQGA 4NLCA 5KFGA 2VJ5A 2MU2A 5KFUA 1NOMA 4B9MA 4YQWA 5CWRA 4KLGA 4NXZA 4P4MA 4RQMA 4KLQA 2BQ3A 3JPOA 4DL3A 3Q8KA 5J0WA 3PSIA 1ZQXA 1J97A 5DLFA 1JXEA 5ALTA 2ZJ5A 4RPYA 8ICYA 4RQ1A 2E1FA 2LM4A 5AI9A 4Z6EA 1TV9A 1T3NA 5ALIA 1PUZA 5BOMA 4R8UA 3TADA 1ZQOA 7ICOA 4RQ4A 3H0LB 4QWBA 4RZRA 4G9BA 2R8JA 1ZQCA 1X9WA 4F2RA 3K1RB 3V7LA 2DUYA 4YXJA 4NV0A 2D3DA 1N62A 2A19A 5KFDA 4IL6U 5L1IA 1ZQWA 2IA6A 5CHGA 4DFDA 3H8SA 2WFAA 3JPQA 5B66U 2G5HB 5GTIU 1NJZA 2FLNA 5J0RA 3NVWA 1PZNA 1RYUA 1N2XA 3RF9A 4UQGA 1CEZA 3G6XA 5AKKA 5ALZA 4US8A 4M6WA 1S8OA 5CJ7A 5AM4A 3FM9A 2J6TA 4UASA 3M6ZA 5KFZA 2EANA 4TQRA 5KG2A 4QIWF 3SAGA 5KFKA 1V85A 4RQ8A 3LDAA 3MR5A 1CUKA 3QUBA 5A0LA 4MF2A 8ICCA 1ZD5A 4USAA 2HHQA 4R64A 5JTIA 4P2HA 3KHGA 3CP8A 4B6JA 2H3FA 9ICJA 2OXOA 5DB8A 5DB7A 2NO4A 5KG6A 5AK3A 1RXWA 3KBBA 1U48A 5TISU 2PXIA 1PK3A 2DF4B 2GOLA 3ORYA 8ICEA 1X9SA 5J2EA 9ICVA 4F2SA 2BDPA 1ZOLA 3DV9A 1WWVA 2GLEA 2FMQA 3UQ2A 2FLPA 3RJGA 2KKVA 5C5JA 4Z6DA 1UA0A 1JXLA 3KTQA 2JH7A 3O0FA 3RB0A 1KN5A 1NJYA 4NLNA 3GV8B 3IHQB 2DBYA 2UVRA 2YMLA 2IHMA 3TARA 4CNQA 2A3VA 2ZJAA 1N48A 3ZI4A 1M6YA 2HCFA 3QZ7A 4QW8A 5ALPA 1J2MA 1YZ6A 1GO3F 3C1ZA 4I2JA 2NRVA 4YD1A 4OJLA 5AICA 3TI0A 1RQNA 8ICMA 3MGHA 3Q8MA 4GXIA 3QNMA 5IIJA 2BCSA 3D6JA 1K1QA 2BKEA 1ED1A 3WKEA 2LKYA 5AKIA 4UATA 4DQQA 1UA1A 8ICSA 2GO7A 1IG6A 2E5SA 1SL0A 4C8OA 2Y1JA 3N28A 1FFUA 4EELA 5L1LA 4FBTA 4MFCA 2LM1A 4ECYA 1L7NA 2G09A 5AKXA 2BPGA 4US9A 3UXNA 5J2CA 2M9NA 4M9LA 1Q8KA 2KSOB 8ICQA 1ZQAA 2ZIXA 5EE1A 1H38A 2IOHA 1PK1B 5KFLA 1DRGA 3C2KA 4ECVA 1ZQ1C 1ZQUA 3BZCA 1L8LA 4QNLA 2DL0A 2W55A 4BXOB 4JWNA 5L1JA 4K4GA 2G06A 2A1JB 5J29A 4P0PA 5KFTA 5AKGA 3KZXA 2EAOA 3PW0A 5AM2A 3GIMA 3GILA 2NRZA 4ED6A 2OYYA 7ICHA 3PO5A 5HR6A 4NLZA 3PR4A 3NVZA 3A0BU 1NK0A 2ATLA 3UPQA 4AP9A 4ED8A 1V9PA 5ALFA 2L5YA 1Z3EB 5AK5A 4KLDA 3AM9A 3WKBA 2J6UA 4EEKA 4DQRA 3RJHA 4DEZA 4ED0A 3SAHA 1ZYQA 1SKRA 4NWIA 3C23A 1N63A 2XY6A 2WF8A 4OJOA 2W9BA 2Q0ZX 2F76X 2RP5A 1BPXA 4KITB 2JR5A 4JWMA 2QB1A 2FPLA 4NJ8A 4O3NA 2K4PA 3UXOA 4RQ3A 2YB4A 1S0NA 1NK8A 2K4EA 3UM9A 4O5CA 4KX5A 5CA7A 5KFYA 3OJUA 8ICAA 4P4PA 2HW3A 1P7DA 3NS1A 4I2GA 3B0YA 7ICPA 4DL7A 1WCLA 3Q8QB 1ZQSA 9ICEA 1ZQRA 9ICMA 1L3SA 4RQ0A 3L4PA 2ZUDA 4GC7A 4PJ0U 5F9NA 2KNJA 2K4IA 4UB4A 1CI4A 1Z1VA 1ZQLA 3ISCA 3MABA 4B9UA 4YCXA 4BJQA 2ZIUB 1XC9A 1L3VA 4O3MA 5KTQA 1VDVA 4F91B 1ZJNA 3SR6A 9ICCA 4Y2YA 5JRTA 5AIAA 4UB2A 2MUTB 1QTMA 3TADC 5KG0A 3NASA 3RR8A 8ICJA 4QZEA 4MF8A 4OJ6A 2ODGA 2ZTEA 2BCQA 2W3SA 1UT8A 2XCAA 3IV6A 4Y2XA 2EZZA 4IRKA 3SD7A 2JMGA 3N97B 1NZPA 1S97A 5DBBA 4I2AA 5KAFU 9ICFA 2HHSA 3MFIA 4KLUA 4R63A 7ICTA 1F44A 5DG9A 2KVSA 3T3FA 5KFBA 4JV0A 5DG8A 3D2SA 3AQEA 8ICKA 4O3QA 1ZQZA 2HBMA 5DLGA 3HT3A 4EZ6A 4FZLA 3MR3A 1JN3A 4JUZA 3RH5A 2ZTCA 5L1MA 2FMPA 2C28A 4I27A 4QIWC 5L9XA 1ZRNA 8ICFA 2WTFA 4DSIA 1XSPA 3EPGA 3MBYA 5J0XA 2ZUBA 1YZ7A 5ALVA 5CRXA 4R8UB 8ICOA 1JRPA 4B9VA 2H3VA 3HX0A 2BQRA 4P4OA 1XO1A 2ZG6A 3N4MB 5AK6A 2KN7A 3V72A 3TANA 4PHEA 3PMNA 4QZ9A 3KHLA 4RQ7A 4KTQA 2ZUCA 4DLGA 4J9OA 2K8AA 5IIKA 3BJYA 3RR7A 1Q3UA 1J2NA 1U4BA 3AEVA 4PGQA 3T5KA 2ZIWA 2OWOA 1OUQA 1SGGA 3RBEA 4DOBA 1KEJA 3JPNA 7ICEA 3RH4A 2P6UA 5KFCA 4M6WB 3FAHA 5J2IA 1B0XA 9ICGA 5AIBA 2AGOA 4M9NA 2RHFA 8ICRA 3BQTA 4DSFA 2Y0SC 2IMWP 3VCBA 1PVQA 2F1HA 3RAQA 1Y88A 1TK0A 4F4ZA 1QLNA 4F72A 2KICA 9ICLA 1Z00B 2BDUA 4UBBA 4F3OA 2V4RA 4DSLA 5KT2A 2PFPA 1D8LA 3JPRA 3N7PD 5J0YA 3GIKA 1KFDA 3PW4A 4F5PA 2YMPA 1ZQTA 4YN4A 1X2IA 2KFZA 4R65A 3GV7B 2H3ZA 4YFKA 4UAVA 2W54A 2ZIVA 2ESEA 3BS5A 1O03A 2VA8A 4DSKA 5ALYA 4Y2PA 4DL6A 4CF3A 1SL1A 4IR1A 5J8YA 4YR0A 4EZ9A 2QARA 4QZCA 2OM6A 4IQWA 1WUDA 4KLTA 2EZYA 4GC6A 1T7PA 4NLGA 1COOA 8ICWA 3SYZA 2ASLA 4DSJA 5KL8B 1KRPA 3PV8A 5KG4A 5B5EU 1F0MA 5ALHA 1S77D 5G5HA 1RYRA 2UVVA 2DKZA 4O3SA 2V9WA 3ZDBA 2KK0A 2OCEA 4ECTA 1RDFA 3Q8PB 1L7PA 2KTQA 3N7SC 1QQ7A 2PFOA 2P6RA 3BQ0A 4ECQA 4ECWA 4YG2A 2RDJA 1LKYA 5KFFA 2C2EA 3WK7A 1RYSA 3RRHA 2B21A 2KIVA 3SENA 2DPJA 3PNCA 2E8NA 3AUOA 2R18A 2HBKA 1UHUA 2W3RA 5KFEA 1NK9A 4F8RA 2MRLA 2Z7JA 5ALEA 3LVVA 2HHXA 2DFLA 2ZIXB 1KBUA 1L3TA 3C2MA 9ICHA 3M9NB 2XCPA 3B9JA 1SKWA 3F5EA 2W11A 4PGYA 2ISOA 4UB3A 2ZTDA 1S0OA 1BGXT 4UB5A 4DF4A 4F5QA 1IXRA 1U9LA 3QU5A 3I76A 4RQNA 2R8HA 9ICRA 4YD2A 1A6SA 4P0PB 4RNNA 1Q3VA 3EYZA 4PHAA 4P0QB 4IS7A 2KV2A 4ICAA 3KZIU 4F4YA 5KFPA 3UQ0A 1BPDA 4YMNA 3ED5A 1DXSA 3PY8A 1X42A 3A0HU 5EOZA 3M9MB 1L7MA 1JUDA 5J2GA 4FBUA 2FDRA 2R8IA 4JV2A 4ECRA 3OSNA 3BQ1A 3ZD8A 1Q46A 3NUQA 1SZPA 3L3FX 5AKYA 1Z4NA 2V4QA 4Z6CA 4RPZA 2W9BB 3WK4A 3IDWA 1NK4A 4NLKA 5DKWA 3NVYA 5KNIA 5C0YA 1ZQJA 5AHXA 3JPPA 2WF5A 4MFAA 2YB1A 3H4DA 2LPEA 2W43A 3HILA 1X6JA 2K89A 3QYPA 3SV4A 5KG5A 2JXJA 2R8KA 5J2JA 2BQUA 2LMRA 1JIHA 3M8RA 2LBOA 5ALLA 3E0FA 3TAQA 3MGVA 1ZQNA 3GDXA 3WKAA 2W9CA 4GIBA 4ED2A 1S0MA 2XC9A 2JZBA 5KT3A 4DLEA 9ICXA 2PMZC 2OEHA 5J2BA 5DB9A 1D8BA 3LWMA 4PHPA 4F50A 1WCNA 1KSPA 2Y0SF 3QUCA 3RFAA 2CPRA 3RJKA 3ZDDA 4DS4A 2CXYA 2KP7A 4KLFA 3QUTA 7ICMA 4Q8FA 1NZBA 4IQUA 4M0AA 3KOOA 2KMDA 5D46A 1T94A 4E0DA 5J2DA 4FFDA 4YMOA 3ETLA 2ZJ8A 4IQVA 5H2FU 3BDPA 7ICKA 3EPIA 4I29A 2H5XA 2R8GA 4MFFA 3BQ2A 3QZ8A 4RNOA 1ZRMA 4IRCA 4ECZA 4WJ3B 3H0RB 1CRXA 4F5RA 1RPLA 4JK1A 5KFOA 4DL5A 2VJ4A 3AL0B 5EE3A 2WAQF 3RJIA 3AU2A 2I1QA 2KJ8A 4AYBF 1L7OA 2FJ6A 3WKCA 5HHHA 2DGZA 3N7RC 4I2BA 1AROP 5KG3A 2UVWA 4Y2QA 1ZQEA 1OW5A 4QWDA 1TAUA 2BZFA 4GXJA 4M9HA 3TACB 4I2HA 4F4WA 2W8KA 3KD3A 5J8YC 5DBAA 4RPXA 2ZIWB 2NYVA 2KJ5A 5HR7A 2XICA 5GTHU 1U47A 1UQVA 3OTQA 5KG7A 3AQFA 1T4GA 1XO0A 4PZNA 5DQGA 2MA1A 2OHFA 1SZHA 1QH9A 1V38A 2VANA 1ZJMA 2F3NA 4NY8A 7ICIA 5AKJA 4EBEA 4C8NA 1DK2A 3T5HA 8ICHA 4U7CA 3KKAC 4YR3A 1N5WA 4KN7A 1LVHA 4UW9A 1S9FA 3DEEA 1KFSA 4DOAA 3RJFA 5EWFA 4FZNA 1Z1BA 4IRDA 4BDPA 2KD1A 1UPHA 3LVWA 2ZIVB 4TUSA 2PI5A 1QSLA 3TFSA 5CR0A 3PMLA 3QU2A 3WU2U 4J9MA 2BR0A 1ZQBA 2JEJA 3WK8A 9ICSA 4B9TA 4EENA 1NKBA 1SWWA 2ISPA 4NL9C 2AJQA 5BOLA 5F9LA 3JPSA 2F8KA 5DGAA 4QZFA 7ICUA 3QEAZ 1LV5A 4GXKA 5ALDA 4UBCA 3OPXA 5AI0A 4LZDA 2QB0A 4M04A 3MR6A 4KLEA 3PX6A 2KG5A 2HOFA 7ICRA 2IBKA 4RNMA 5EE0A 1BPEA 4B9LA 2KVCA 4ZOHC 1FFVA 3HPOA 4CF4A 5DG7A 4DCCA 2BPFA 3Q8SB 3CNHA 2BGWA 3F5AA 4CE6A 4DFPA 3PX0A 1TAMA 5ALJA 4O9MA 4NLBA 2KIWA 2WB1C 2W03A 2WF6A 2FPMA 2M0NA 4X5VA 1Z19A 4KN4A 4C8MA 1ZQPA 2IHNA 3KFUF 1HJPA 8ICPA 4K4IA 4RT3A 4C8KA 4DFMA 3D2QA 3K4GA 2I6XA 5DDMA 3PW5A 2NRTA 5CEHA 5D4BA 2XVTA 1QSSA 1BNOA 4ELTA 2D6FC 1NNLA 3RB6A 2EZXA 2AH5A 3PO4A 2AQ0A 2F44A 4LZGA 1DK3A 5DB6A 2EAPA 4DFKA 2Q4TA 4J9LA 4OO1J 2PMZF 4C7ZA 3PR5B 3QU4A 3OJSA 1XU4A 1L8OA 2NV3A 5AI4A 3SQIA 3M6KA 3QX7A 3TQ1A 4C80A 3NTUA 3PW2A 8ICIA 5KFJA 9ICNA 1NK6A 4XRHA 4CRXA 3IG5A 5J0QA 4G3IA 1JALA 1TE2A 2ALZA 5IIIA 3PSFA 4BWJA 2KFNA 3BS7A 4TURA 4O0IA 1Z4OA 3ZDAA 1U49A 5IILA 4KMUA 1DOQA 5JUMA 5K4LA 4K4HA 2F8LA 2YTUA 1NJXA 2PFQA 2HMXA 1ZQFA 3LK9A 3WK9A 3V7JA 1N61A 2ES6A 4ECSA 1UT5A 4U6PA 1HEKA 2BPCA 2DKXA 1QCKA 4QWCA 1BPYA 4IR9A 1NKEA 5ALWA 5KT4A 2I9GA 1NI3A 8ICBA 1KLNA 2KOBA 2G5IB 2HHTA 3GZFA 5AK4A 3EW9A 3AU6A 1MSWD 2JRZA 5TZVA 4CCHA 1XS9D 5ALQA 5KT5A 4I2DA 1IIPA 2HI0A 2LYBA 1BNPA 1NK5A 1ZD2P 2F1IA 4KLHA 2HVHA 5ALNA 4PL1A 3DDHA 5KFXA 1SWVA 2W9CB 2ASDA 2RDIA 3NGDA 2XGPA 3UXPA 3I1YA 4ZH4A 5FP0A 5KFAA 3ETRA 2JEFA 5ALOA 3V7KA 1ZQKA 4RUAA 8ICTA 1EXNA 7ICFA 1FEZA 2D8CA 1LB2B 2WAQC 3L5KA 3RB3A 4AYBC 2KHQA 3B0XA 4PGXA 4ECXA 2E3TA 4DSEA 1WYGA 4YR2A 2FLLA 4TQSA 2AGQA 2LI6A 1TVAA 2XGQA 4KLLA 4UARA 3ONNA 3GU3A 5HHIA 5AI8A 1XNSA 5J0TA 5KFMA 4J9SA 3KKAA 1SL2A 3RAXA 5J0UA 4BGDA 9ICAA 1RXVA 4HYKA 2GH1A 4I2EA 4O3OA 3CYMA 3M7DA 4MHVA 2MUTA 5J2FA 1WG8A 4XUSA 4O5KA 3GIJA 4JV1A 1TAQA 4UB8U 3C2LA 4Y2JA 5AKLA 1B4FA 5IIMA 7ICLA 4DQSA 4KMOB 2K8CB 4KLMA 4DL2A 4RU9A 4NM2A 2VKQA 1K5OA 2B0CA 1BPZA 5AI5A 3G6YA 4NL9A 3E2EA 1SV4A 5CB1A 9ICTA 1BVSA 2KE7A 5AKEA 4DL4A 2ZXHA 4F71A 5AM5A 2OH2A 4M2YA 1ZXIA 2EAMA 1MN8A 1S10A 3E58A 4R66A 2E8MA 1JX4A 4KLOA 3F2CA 2EH9A 4QZAA 3PZPA 1L6NA 2FMSA 3V6HA 4A8EA 3GFKB 4Z6FA 1FIQA 4C8LA 2F1JA 1ZQMA 4UAUA 2AU0A 5J2KA 2C2RA 5E79U 3SV3A 3M9OB 2WB1F 5KL1B 5KFQA 4ACOA 2YY6A 1ZQDA 4LVSA 5AM0A 2LYAA 8ICNA 2CN1A 9ICWA 5ALSA 5DBCA 5KG1A 3GIIA 1D9FA 1PVRA 1SXDA 5ALMA 3GQCA 5CP2A 1KW4A 4QZIA 5G5GA 3V6KA 5ALGA 2I5HA 2RQ5A 4TUQA 3KHHA 4F5NA 2C22A 4DQPA 4BUGA 2HHWA 2JEIA 3ZDEA 1URJA 4RT2A 1TFRA 4UB1A 5AKZA 4ED1A
chains in the Genus database with same CATH topology
1B4FA 2Y9TA 2ESEA 3BS5A 1WWUA 1X9XA 1UQVA 1X66A 1UCVA 4PZNA 2KSOA 5L1MA 4RQNA 5J8YA 1SV0A 1V38A 1PK1A 4NL9A 2F3NA 1SV4A 2QARA 2B6GA 2QB1A 4NJ8A 2QB0B 2K4PA 4IS7A 3KKAC 1OXJA 2EANA 2KE7A 2E8OA 3SEIA 2KMDA 1V85A 1DXSA 2EAMA 2E8MA 2F44A 1LKYB 1F0MA 2EAPA 2DKZA 5JU5A 1Z1VA 5JTIA 2D8CA 2KSOB 1SGGA 5JRTA 2E8PA 3IDWA 1PK1B 3TADC 4RQMA 2FE9A 4PZOA 5KNIA 2Y9UA 1B0XA 1SXEA 4NL9C 2LPEA 1PK3A 3HILA 2DL0A 1X40A 1LKYA 3BS7A 1SXDA 3BS5B 2F8KA 2LMRA 1KW4A 2JV3A 3KKAA 1WWVA 2GLEA 2KIVA 3SENA 1OW5A 2EAOA 2E8NA 2QB0A 2KG5A 2K60A 2YTUA 3TACB 3TADA 3H8MA 1COKA 2QKQA 2QARB 5F3XB 5J8YC 1SV0C 4MHVA 3K1RB 2ES6A 1JI7A 1RG6A 2L5YA 3BQ7A 2DKXA 2D3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B4F A;  2Y9T A;  2ESE A;  3BS5 A;  1WWU A;  1X9X A;  1UQV A;  1X66 A;  1UCV A;  4PZN A;  2KSO A;  5L1M A;  4RQN A;  5J8Y A;  1SV0 A;  1V38 A;  1PK1 A;  4NL9 A;  2F3N A;  1SV4 A;  2QAR A;  2B6G A;  2QB1 A;  4NJ8 A;  2QB0 B;  2K4P A;  4IS7 A;  3KKA C;  1OXJ A;  2EAN A;  2KE7 A;  2E8O A;  3SEI A;  2KMD A;  1V85 A;  1DXS A;  2EAM A;  2E8M A;  2F44 A;  1LKY B;  1F0M A;  2EAP A;  2DKZ A;  5JU5 A;  1Z1V A;  5JTI A;  2D8C A;  2KSO B;  1SGG A;  5JRT A;  2E8P A;  3IDW A;  1PK1 B;  3TAD C;  4RQM A;  2FE9 A;  4PZO A;  5KNI A;  2Y9U A;  1B0X A;  1SXE A;  4NL9 C;  2LPE A;  1PK3 A;  3HIL A;  2DL0 A;  1X40 A;  1LKY A;  3BS7 A;  1SXD A;  3BS5 B;  2F8K A;  2LMR A;  1KW4 A;  2JV3 A;  3KKA A;  1WWV A;  2GLE A;  2KIV A;  3SEN A;  1OW5 A;  2EAO A;  2E8N A;  2QB0 A;  2KG5 A;  2K60 A;  2YTU A;  3TAC B;  3TAD A;  3H8M A;  1COK A;  2QKQ A;  2QAR B;  5F3X B;  5J8Y C;  1SV0 C;  4MHV A;  3K1R B;  2ES6 A;  1JI7 A;  1RG6 A;  2L5Y A;  3BQ7 A;  2DKX A;  2D3D A; 
#chains in the Genus database with same CATH topology
 1VLB A;  2PKE A;  3ISD A;  4DS5 A;  5KFW A;  1ECW A;  2G07 A;  9ICK A;  9ICI A;  3HP6 A;  3F2D A;  1X9M A;  1X66 A;  5J2H A;  1PVP A;  3J81 j;  2NO5 A;  3PSP A;  2XY5 A;  1MC8 A;  1Z00 A;  2W8L A;  4RUC A;  2XI9 A;  5D49 A;  3H40 A;  1SB3 C;  4I2F A;  2QB0 B;  4O3R A;  2C2D A;  1KL9 A;  1NKC A;  1S76 D;  3T5L A;  3C21 A;  4DO9 A;  1KDH A;  2G08 A;  3C28 A;  3MFH A;  9ICO A;  5KAI U;  2JHD A;  2HVI A;  2NRX A;  4FS2 A;  9ICB A;  3H7I A;  5DQH A;  5KFS A;  3THV A;  3D2N A;  3ALR A;  3RH6 A;  4LJX A;  3F53 A;  1AQ6 A;  1BPB A;  3MDC A;  3C5F A;  3C5G A;  7ICQ A;  1IM4 A;  4Y2S A;  1NJW A;  1NK7 A;  2E8P A;  2ASJ A;  4J9Q A;  4J9K A;  1F5S A;  2FE9 A;  1TKD A;  3UMC A;  4EBC A;  1U45 A;  1SXE A;  5EE9 A;  5KT7 A;  2DWQ A;  3ISB A;  2IOF A;  2F2A B;  2RLT A;  4FZM A;  4QJF B;  2W9A A;  8ICV A;  2H3I A;  1L3U A;  3HKZ C;  2EDU A;  3TAP A;  3ZD9 A;  1RQL A;  2AQ4 A;  2ZXI A;  4PHD A;  2BCU A;  3SMV A;  3BZK A;  4ED3 A;  4DOC A;  5HP4 A;  2YMM A;  4RQ2 A;  2KZZ A;  3K75 D;  7ICN A;  1T8E A;  2G0A A;  5DQI A;  4KLS A;  3NVV A;  4DF8 A;  4C0Z A;  4Q43 A;  1KQQ A;  4J9P A;  1RG6 A;  4Y2U A;  4KLJ A;  4DQI A;  2EQY A;  5KFR A;  1X6I A;  2Y9T A;  1XWL A;  4C4S A;  1WWU A;  1ZQY A;  5ALU A;  4I2C A;  3RB4 A;  3R9K A;  4RQ5 A;  5HML A;  2FPK A;  3RRG A;  1D8Y A;  3OHA A;  5KFV A;  4QWE A;  1MQ2 A;  7ICJ A;  4YXM A;  5BPC A;  1SV0 A;  4OJ5 A;  3HRD D;  4J03 A;  5IIN A;  4QWA A;  3AMZ A;  8ICG A;  2B6G A;  4XA5 A;  2MAX A;  3CW2 C;  3F2B A;  1C20 A;  3H0M B;  5J2A A;  4PPX A;  2AGP A;  4M9G A;  4UAY A;  1ZQQ A;  3EZ5 A;  1ZQV A;  3S6J A;  4CF5 A;  3Q8R B;  3QEB Z;  4ELU A;  3WK6 A;  4KLI A;  3TKA A;  3WKD A;  2HDO A;  2KZM A;  3OSP A;  3GV5 B;  3H4B A;  1L5U A;  3G6V A;  1TK8 A;  4P0Q A;  4Q44 A;  5DDY A;  3LYS A;  3C29 A;  5ALK A;  2DPI A;  3RJJ A;  2JEG A;  2Y9U A;  4UAZ A;  5L1K A;  4FE3 A;  4OJP A;  4Q8E A;  2HBJ A;  3FDS A;  3BS5 B;  4PL2 A;  4QZH A;  2P66 A;  5AM1 A;  1B22 A;  3OHB A;  2K60 A;  5AI6 A;  4GLX A;  4B9N A;  2W9M A;  3H8M A;  4EX6 A;  2BHN A;  3Q8L A;  2F77 X;  2QAR B;  4OCZ A;  4YP3 A;  2YMQ A;  4XQ8 A;  4Y2R A;  5AKH A;  1JI7 A;  2VA3 A;  2KZ3 A;  3M8S A;  1S0V A;  7ICV A;  4KX3 A;  1YT3 A;  3PW7 A;  2KEY A;  3FC4 A;  1VJ5 A;  2P35 A;  4ED7 A;  1JRO A;  2J6S A;  1S5L U;  1A77 A;  4I2I A;  4J9R A;  2HSZ A;  3IN5 A;  1A76 A;  1O08 A;  2LYH A;  1KFT A;  4F93 B;  3UMG A;  3TFR A;  1DGS A;  4J9N A;  3T5J A;  4F92 B;  3T79 A;  2BCV A;  2AXT U;  1ZET A;  2IOF K;  1LKY B;  3HJE A;  4F5O A;  4I28 A;  1FO4 A;  2BCR A;  2Y1I A;  2HHV A;  4TUP A;  2W04 A;  2NRW A;  5JU5 A;  2YQE A;  4UAW A;  2HHU A;  3HW8 A;  4RQ6 A;  2QLT A;  4UB6 U;  2FI1 A;  3WK5 A;  8ICX A;  4CDG A;  1JMS A;  3PX4 A;  1T3Q A;  2YN4 A;  3K1Z A;  5ALR A;  2HBL A;  4IC9 A;  2MSN A;  5EWE A;  4M9J A;  3ICX A;  1KTQ A;  3IG8 A;  1SIJ A;  9ICP A;  2WF7 A;  4M47 A;  2H3Q A;  2KJ9 A;  2WHE A;  3V6J A;  4C4R A;  2WF9 A;  4DWI A;  4QZG A;  1COK A;  3MR2 A;  2JGA A;  1HUZ A;  5T14 A;  2K8B B;  2PFN A;  1QQ6 A;  2W7P A;  3BQ7 A;  3IRU A;  3MGI A;  1QSY A;  2XO7 A;  4JB3 A;  2W7O A;  2KKP A;  5J0O A;  4C7Y A;  2JH1 A;  2RRD A;  3M1Y A;  4O5E A;  9ICU A;  1X9X A;  5DGB A;  4HAI A;  1UCV A;  2HOQ A;  3NRW A;  2KSO A;  3MDA A;  1KKX A;  3IP4 B;  1A0P A;  4DFJ A;  4MEY A;  4EYH B;  3PVX A;  1PK1 A;  3HKZ F;  4NM1 A;  2K4H A;  3NRZ A;  3QU9 A;  3AN1 A;  1OXJ A;  5ALX A;  4JMU A;  2E8O A;  4BXO A;  3SZ2 A;  4QZ8 A;  2YX8 A;  1XSN A;  1SKS A;  2A1J A;  3OGU A;  4FO6 A;  5EWG A;  2PI4 A;  2E1E A;  5HMM A;  3SI8 A;  4O3P A;  3UMB A;  3HWT A;  5KFN A;  5HNK A;  5IIO A;  4EYI B;  1B43 A;  9ICQ A;  2HOI A;  1V97 A;  3VC8 A;  3QU7 A;  4YVZ A;  4EX7 A;  2AHO B;  4QZD A;  1DGJ A;  4EBD A;  3ZDC A;  5KT6 A;  3JPT A;  2VA2 A;  5J0S A;  3I28 A;  1HIW A;  4MEX A;  3QXG A;  4GFJ A;  2JZB B;  4PZO A;  5KFI A;  3H8J A;  5J0P A;  4C4T A;  2O6K A;  4FS1 A;  3KHR A;  1X40 A;  2CRX A;  2A1A A;  3MC1 A;  4PH5 A;  1HUO A;  4IQT A;  2JV3 A;  2N1R A;  8ICU A;  3PST A;  5AM3 A;  4OD0 A;  2QKQ A;  5F3X B;  4ELV A;  2XID A;  1SV0 C;  3RTV A;  4YMM A;  2UVU A;  3SAF A;  8ICL A;  5KFH A;  1TK5 A;  8ICZ A;  4ECU A;  2LHT A;  3IM1 A;  3EUB 2;  3H8W A;  4Q45 A;  1IV8 A;  4B9S A;  1RM6 C;  3EWA A;  3LWL A;  7ICS A;  2ZIU A;  3U26 A;  1MA7 A;  1RZT A;  1D9D A;  2XY7 A;  3QE9 Y;  4Y2T A;  1C7Y A;  7ICG A;  3QUQ A;  3C1Y A;  4F4X A;  1XSL A;  1MQ3 A;  2DQN B;  4BX9 C;  1N56 A;  4BWM A;  1ZQI A;  4CGZ A;  4EEY A;  3SEI A;  1QQ5 A;  3RJE A;  4QW9 A;  2VIX A;  3RBD A;  1N5X A;  3CRX A;  1K1S A;  2GWS A;  1ZQH A;  1ZD3 A;  1N60 A;  4QZB A;  4Y2V A;  4F4K A;  1ZD4 A;  2KHV A;  3FYH A;  1ZQG A;  4NLC A;  5KFG A;  2VJ5 A;  2MU2 A;  5KFU A;  1NOM A;  4B9M A;  4YQW A;  5CWR A;  4KLG A;  4NXZ A;  4P4M A;  4RQM A;  4KLQ A;  2BQ3 A;  3JPO A;  4DL3 A;  3Q8K A;  5J0W A;  3PSI A;  1ZQX A;  1J97 A;  5DLF A;  1JXE A;  5ALT A;  2ZJ5 A;  4RPY A;  8ICY A;  4RQ1 A;  2E1F A;  2LM4 A;  5AI9 A;  4Z6E A;  1TV9 A;  1T3N A;  5ALI A;  1PUZ A;  5BOM A;  4R8U A;  3TAD A;  1ZQO A;  7ICO A;  4RQ4 A;  3H0L B;  4QWB A;  4RZR A;  4G9B A;  2R8J A;  1ZQC A;  1X9W A;  4F2R A;  3K1R B;  3V7L A;  2DUY A;  4YXJ A;  4NV0 A;  2D3D A;  1N62 A;  2A19 A;  5KFD A;  4IL6 U;  5L1I A;  1ZQW A;  2IA6 A;  5CHG A;  4DFD A;  3H8S A;  2WFA A;  3JPQ A;  5B66 U;  2G5H B;  5GTI U;  1NJZ A;  2FLN A;  5J0R A;  3NVW A;  1PZN A;  1RYU A;  1N2X A;  3RF9 A;  4UQG A;  1CEZ A;  3G6X A;  5AKK A;  5ALZ A;  4US8 A;  4M6W A;  1S8O A;  5CJ7 A;  5AM4 A;  3FM9 A;  2J6T A;  4UAS A;  3M6Z A;  5KFZ A;  2EAN A;  4TQR A;  5KG2 A;  4QIW F;  3SAG A;  5KFK A;  1V85 A;  4RQ8 A;  3LDA A;  3MR5 A;  1CUK A;  3QUB A;  5A0L A;  4MF2 A;  8ICC A;  1ZD5 A;  4USA A;  2HHQ A;  4R64 A;  5JTI A;  4P2H A;  3KHG A;  3CP8 A;  4B6J A;  2H3F A;  9ICJ A;  2OXO A;  5DB8 A;  5DB7 A;  2NO4 A;  5KG6 A;  5AK3 A;  1RXW A;  3KBB A;  1U48 A;  5TIS U;  2PXI A;  1PK3 A;  2DF4 B;  2GOL A;  3ORY A;  8ICE A;  1X9S A;  5J2E A;  9ICV A;  4F2S A;  2BDP A;  1ZOL A;  3DV9 A;  1WWV A;  2GLE A;  2FMQ A;  3UQ2 A;  2FLP A;  3RJG A;  2KKV A;  5C5J A;  4Z6D A;  1UA0 A;  1JXL A;  3KTQ A;  2JH7 A;  3O0F A;  3RB0 A;  1KN5 A;  1NJY A;  4NLN A;  3GV8 B;  3IHQ B;  2DBY A;  2UVR A;  2YML A;  2IHM A;  3TAR A;  4CNQ A;  2A3V A;  2ZJA A;  1N48 A;  3ZI4 A;  1M6Y A;  2HCF A;  3QZ7 A;  4QW8 A;  5ALP A;  1J2M A;  1YZ6 A;  1GO3 F;  3C1Z A;  4I2J A;  2NRV A;  4YD1 A;  4OJL A;  5AIC A;  3TI0 A;  1RQN A;  8ICM A;  3MGH A;  3Q8M A;  4GXI A;  3QNM A;  5IIJ A;  2BCS A;  3D6J A;  1K1Q A;  2BKE A;  1ED1 A;  3WKE A;  2LKY A;  5AKI A;  4UAT A;  4DQQ A;  1UA1 A;  8ICS A;  2GO7 A;  1IG6 A;  2E5S A;  1SL0 A;  4C8O A;  2Y1J A;  3N28 A;  1FFU A;  4EEL A;  5L1L A;  4FBT A;  4MFC A;  2LM1 A;  4ECY A;  1L7N A;  2G09 A;  5AKX A;  2BPG A;  4US9 A;  3UXN A;  5J2C A;  2M9N A;  4M9L A;  1Q8K A;  2KSO B;  8ICQ A;  1ZQA A;  2ZIX A;  5EE1 A;  1H38 A;  2IOH A;  1PK1 B;  5KFL A;  1DRG A;  3C2K A;  4ECV A;  1ZQ1 C;  1ZQU A;  3BZC A;  1L8L A;  4QNL A;  2DL0 A;  2W55 A;  4BXO B;  4JWN A;  5L1J A;  4K4G A;  2G06 A;  2A1J B;  5J29 A;  4P0P A;  5KFT A;  5AKG A;  3KZX A;  2EAO A;  3PW0 A;  5AM2 A;  3GIM A;  3GIL A;  2NRZ A;  4ED6 A;  2OYY A;  7ICH A;  3PO5 A;  5HR6 A;  4NLZ A;  3PR4 A;  3NVZ A;  3A0B U;  1NK0 A;  2ATL A;  3UPQ A;  4AP9 A;  4ED8 A;  1V9P A;  5ALF A;  2L5Y A;  1Z3E B;  5AK5 A;  4KLD A;  3AM9 A;  3WKB A;  2J6U A;  4EEK A;  4DQR A;  3RJH A;  4DEZ A;  4ED0 A;  3SAH A;  1ZYQ A;  1SKR A;  4NWI A;  3C23 A;  1N63 A;  2XY6 A;  2WF8 A;  4OJO A;  2W9B A;  2Q0Z X;  2F76 X;  2RP5 A;  1BPX A;  4KIT B;  2JR5 A;  4JWM A;  2QB1 A;  2FPL A;  4NJ8 A;  4O3N A;  2K4P A;  3UXO A;  4RQ3 A;  2YB4 A;  1S0N A;  1NK8 A;  2K4E A;  3UM9 A;  4O5C A;  4KX5 A;  5CA7 A;  5KFY A;  3OJU A;  8ICA A;  4P4P A;  2HW3 A;  1P7D A;  3NS1 A;  4I2G A;  3B0Y A;  7ICP A;  4DL7 A;  1WCL A;  3Q8Q B;  1ZQS A;  9ICE A;  1ZQR A;  9ICM A;  1L3S A;  4RQ0 A;  3L4P A;  2ZUD A;  4GC7 A;  4PJ0 U;  5F9N A;  2KNJ A;  2K4I A;  4UB4 A;  1CI4 A;  1Z1V A;  1ZQL A;  3ISC A;  3MAB A;  4B9U A;  4YCX A;  4BJQ A;  2ZIU B;  1XC9 A;  1L3V A;  4O3M A;  5KTQ A;  1VDV A;  4F91 B;  1ZJN A;  3SR6 A;  9ICC A;  4Y2Y A;  5JRT A;  5AIA A;  4UB2 A;  2MUT B;  1QTM A;  3TAD C;  5KG0 A;  3NAS A;  3RR8 A;  8ICJ A;  4QZE A;  4MF8 A;  4OJ6 A;  2ODG A;  2ZTE A;  2BCQ A;  2W3S A;  1UT8 A;  2XCA A;  3IV6 A;  4Y2X A;  2EZZ A;  4IRK A;  3SD7 A;  2JMG A;  3N97 B;  1NZP A;  1S97 A;  5DBB A;  4I2A A;  5KAF U;  9ICF A;  2HHS A;  3MFI A;  4KLU A;  4R63 A;  7ICT A;  1F44 A;  5DG9 A;  2KVS A;  3T3F A;  5KFB A;  4JV0 A;  5DG8 A;  3D2S A;  3AQE A;  8ICK A;  4O3Q A;  1ZQZ A;  2HBM A;  5DLG A;  3HT3 A;  4EZ6 A;  4FZL A;  3MR3 A;  1JN3 A;  4JUZ A;  3RH5 A;  2ZTC A;  5L1M A;  2FMP A;  2C28 A;  4I27 A;  4QIW C;  5L9X A;  1ZRN A;  8ICF A;  2WTF A;  4DSI A;  1XSP A;  3EPG A;  3MBY A;  5J0X A;  2ZUB A;  1YZ7 A;  5ALV A;  5CRX A;  4R8U B;  8ICO A;  1JRP A;  4B9V A;  2H3V A;  3HX0 A;  2BQR A;  4P4O A;  1XO1 A;  2ZG6 A;  3N4M B;  5AK6 A;  2KN7 A;  3V72 A;  3TAN A;  4PHE A;  3PMN A;  4QZ9 A;  3KHL A;  4RQ7 A;  4KTQ A;  2ZUC A;  4DLG A;  4J9O A;  2K8A A;  5IIK A;  3BJY A;  3RR7 A;  1Q3U A;  1J2N A;  1U4B A;  3AEV A;  4PGQ A;  3T5K A;  2ZIW A;  2OWO A;  1OUQ A;  1SGG A;  3RBE A;  4DOB A;  1KEJ A;  3JPN A;  7ICE A;  3RH4 A;  2P6U A;  5KFC A;  4M6W B;  3FAH A;  5J2I A;  1B0X A;  9ICG A;  5AIB A;  2AGO A;  4M9N A;  2RHF A;  8ICR A;  3BQT A;  4DSF A;  2Y0S C;  2IMW P;  3VCB A;  1PVQ A;  2F1H A;  3RAQ A;  1Y88 A;  1TK0 A;  4F4Z A;  1QLN A;  4F72 A;  2KIC A;  9ICL A;  1Z00 B;  2BDU A;  4UBB A;  4F3O A;  2V4R A;  4DSL A;  5KT2 A;  2PFP A;  1D8L A;  3JPR A;  3N7P D;  5J0Y A;  3GIK A;  1KFD A;  3PW4 A;  4F5P A;  2YMP A;  1ZQT A;  4YN4 A;  1X2I A;  2KFZ A;  4R65 A;  3GV7 B;  2H3Z A;  4YFK A;  4UAV A;  2W54 A;  2ZIV A;  2ESE A;  3BS5 A;  1O03 A;  2VA8 A;  4DSK A;  5ALY A;  4Y2P A;  4DL6 A;  4CF3 A;  1SL1 A;  4IR1 A;  5J8Y A;  4YR0 A;  4EZ9 A;  2QAR A;  4QZC A;  2OM6 A;  4IQW A;  1WUD A;  4KLT A;  2EZY A;  4GC6 A;  1T7P A;  4NLG A;  1COO A;  8ICW A;  3SYZ A;  2ASL A;  4DSJ A;  5KL8 B;  1KRP A;  3PV8 A;  5KG4 A;  5B5E U;  1F0M A;  5ALH A;  1S77 D;  5G5H A;  1RYR A;  2UVV A;  2DKZ A;  4O3S A;  2V9W A;  3ZDB A;  2KK0 A;  2OCE A;  4ECT A;  1RDF A;  3Q8P B;  1L7P A;  2KTQ A;  3N7S C;  1QQ7 A;  2PFO A;  2P6R A;  3BQ0 A;  4ECQ A;  4ECW A;  4YG2 A;  2RDJ A;  1LKY A;  5KFF A;  2C2E A;  3WK7 A;  1RYS A;  3RRH A;  2B21 A;  2KIV A;  3SEN A;  2DPJ A;  3PNC A;  2E8N A;  3AUO A;  2R18 A;  2HBK A;  1UHU A;  2W3R A;  5KFE A;  1NK9 A;  4F8R A;  2MRL A;  2Z7J A;  5ALE A;  3LVV A;  2HHX A;  2DFL A;  2ZIX B;  1KBU A;  1L3T A;  3C2M A;  9ICH A;  3M9N B;  2XCP A;  3B9J A;  1SKW A;  3F5E A;  2W11 A;  4PGY A;  2ISO A;  4UB3 A;  2ZTD A;  1S0O A;  1BGX T;  4UB5 A;  4DF4 A;  4F5Q A;  1IXR A;  1U9L A;  3QU5 A;  3I76 A;  4RQN A;  2R8H A;  9ICR A;  4YD2 A;  1A6S A;  4P0P B;  4RNN A;  1Q3V A;  3EYZ A;  4PHA A;  4P0Q B;  4IS7 A;  2KV2 A;  4ICA A;  3KZI U;  4F4Y A;  5KFP A;  3UQ0 A;  1BPD A;  4YMN A;  3ED5 A;  1DXS A;  3PY8 A;  1X42 A;  3A0H U;  5EOZ A;  3M9M B;  1L7M A;  1JUD A;  5J2G A;  4FBU A;  2FDR A;  2R8I A;  4JV2 A;  4ECR A;  3OSN A;  3BQ1 A;  3ZD8 A;  1Q46 A;  3NUQ A;  1SZP A;  3L3F X;  5AKY A;  1Z4N A;  2V4Q A;  4Z6C A;  4RPZ A;  2W9B B;  3WK4 A;  3IDW A;  1NK4 A;  4NLK A;  5DKW A;  3NVY A;  5KNI A;  5C0Y A;  1ZQJ A;  5AHX A;  3JPP A;  2WF5 A;  4MFA A;  2YB1 A;  3H4D A;  2LPE A;  2W43 A;  3HIL A;  1X6J A;  2K89 A;  3QYP A;  3SV4 A;  5KG5 A;  2JXJ A;  2R8K A;  5J2J A;  2BQU A;  2LMR A;  1JIH A;  3M8R A;  2LBO A;  5ALL A;  3E0F A;  3TAQ A;  3MGV A;  1ZQN A;  3GDX A;  3WKA A;  2W9C A;  4GIB A;  4ED2 A;  1S0M A;  2XC9 A;  2JZB A;  5KT3 A;  4DLE A;  9ICX A;  2PMZ C;  2OEH A;  5J2B A;  5DB9 A;  1D8B A;  3LWM A;  4PHP A;  4F50 A;  1WCN A;  1KSP A;  2Y0S F;  3QUC A;  3RFA A;  2CPR A;  3RJK A;  3ZDD A;  4DS4 A;  2CXY A;  2KP7 A;  4KLF A;  3QUT A;  7ICM A;  4Q8F A;  1NZB A;  4IQU A;  4M0A A;  3KOO A;  2KMD A;  5D46 A;  1T94 A;  4E0D A;  5J2D A;  4FFD A;  4YMO A;  3ETL A;  2ZJ8 A;  4IQV A;  5H2F U;  3BDP A;  7ICK A;  3EPI A;  4I29 A;  2H5X A;  2R8G A;  4MFF A;  3BQ2 A;  3QZ8 A;  4RNO A;  1ZRM A;  4IRC A;  4ECZ A;  4WJ3 B;  3H0R B;  1CRX A;  4F5R A;  1RPL A;  4JK1 A;  5KFO A;  4DL5 A;  2VJ4 A;  3AL0 B;  5EE3 A;  2WAQ F;  3RJI A;  3AU2 A;  2I1Q A;  2KJ8 A;  4AYB F;  1L7O A;  2FJ6 A;  3WKC A;  5HHH A;  2DGZ A;  3N7R C;  4I2B A;  1ARO P;  5KG3 A;  2UVW A;  4Y2Q A;  1ZQE A;  1OW5 A;  4QWD A;  1TAU A;  2BZF A;  4GXJ A;  4M9H A;  3TAC B;  4I2H A;  4F4W A;  2W8K A;  3KD3 A;  5J8Y C;  5DBA A;  4RPX A;  2ZIW B;  2NYV A;  2KJ5 A;  5HR7 A;  2XIC A;  5GTH U;  1U47 A;  1UQV A;  3OTQ A;  5KG7 A;  3AQF A;  1T4G A;  1XO0 A;  4PZN A;  5DQG A;  2MA1 A;  2OHF A;  1SZH A;  1QH9 A;  1V38 A;  2VAN A;  1ZJM A;  2F3N A;  4NY8 A;  7ICI A;  5AKJ A;  4EBE A;  4C8N A;  1DK2 A;  3T5H A;  8ICH A;  4U7C A;  3KKA C;  4YR3 A;  1N5W A;  4KN7 A;  1LVH A;  4UW9 A;  1S9F A;  3DEE A;  1KFS A;  4DOA A;  3RJF A;  5EWF A;  4FZN A;  1Z1B A;  4IRD A;  4BDP A;  2KD1 A;  1UPH A;  3LVW A;  2ZIV B;  4TUS A;  2PI5 A;  1QSL A;  3TFS A;  5CR0 A;  3PML A;  3QU2 A;  3WU2 U;  4J9M A;  2BR0 A;  1ZQB A;  2JEJ A;  3WK8 A;  9ICS A;  4B9T A;  4EEN A;  1NKB A;  1SWW A;  2ISP A;  4NL9 C;  2AJQ A;  5BOL A;  5F9L A;  3JPS A;  2F8K A;  5DGA A;  4QZF A;  7ICU A;  3QEA Z;  1LV5 A;  4GXK A;  5ALD A;  4UBC A;  3OPX A;  5AI0 A;  4LZD A;  2QB0 A;  4M04 A;  3MR6 A;  4KLE A;  3PX6 A;  2KG5 A;  2HOF A;  7ICR A;  2IBK A;  4RNM A;  5EE0 A;  1BPE A;  4B9L A;  2KVC A;  4ZOH C;  1FFV A;  3HPO A;  4CF4 A;  5DG7 A;  4DCC A;  2BPF A;  3Q8S B;  3CNH A;  2BGW A;  3F5A A;  4CE6 A;  4DFP A;  3PX0 A;  1TAM A;  5ALJ A;  4O9M A;  4NLB A;  2KIW A;  2WB1 C;  2W03 A;  2WF6 A;  2FPM A;  2M0N A;  4X5V A;  1Z19 A;  4KN4 A;  4C8M A;  1ZQP A;  2IHN A;  3KFU F;  1HJP A;  8ICP A;  4K4I A;  4RT3 A;  4C8K A;  4DFM A;  3D2Q A;  3K4G A;  2I6X A;  5DDM A;  3PW5 A;  2NRT A;  5CEH A;  5D4B A;  2XVT A;  1QSS A;  1BNO A;  4ELT A;  2D6F C;  1NNL A;  3RB6 A;  2EZX A;  2AH5 A;  3PO4 A;  2AQ0 A;  2F44 A;  4LZG A;  1DK3 A;  5DB6 A;  2EAP A;  4DFK A;  2Q4T A;  4J9L A;  4OO1 J;  2PMZ F;  4C7Z A;  3PR5 B;  3QU4 A;  3OJS A;  1XU4 A;  1L8O A;  2NV3 A;  5AI4 A;  3SQI A;  3M6K A;  3QX7 A;  3TQ1 A;  4C80 A;  3NTU A;  3PW2 A;  8ICI A;  5KFJ A;  9ICN A;  1NK6 A;  4XRH A;  4CRX A;  3IG5 A;  5J0Q A;  4G3I A;  1JAL A;  1TE2 A;  2ALZ A;  5III A;  3PSF A;  4BWJ A;  2KFN A;  3BS7 A;  4TUR A;  4O0I A;  1Z4O A;  3ZDA A;  1U49 A;  5IIL A;  4KMU A;  1DOQ A;  5JUM A;  5K4L A;  4K4H A;  2F8L A;  2YTU A;  1NJX A;  2PFQ A;  2HMX A;  1ZQF A;  3LK9 A;  3WK9 A;  3V7J A;  1N61 A;  2ES6 A;  4ECS A;  1UT5 A;  4U6P A;  1HEK A;  2BPC A;  2DKX A;  1QCK A;  4QWC A;  1BPY A;  4IR9 A;  1NKE A;  5ALW A;  5KT4 A;  2I9G A;  1NI3 A;  8ICB A;  1KLN A;  2KOB A;  2G5I B;  2HHT A;  3GZF A;  5AK4 A;  3EW9 A;  3AU6 A;  1MSW D;  2JRZ A;  5TZV A;  4CCH A;  1XS9 D;  5ALQ A;  5KT5 A;  4I2D A;  1IIP A;  2HI0 A;  2LYB A;  1BNP A;  1NK5 A;  1ZD2 P;  2F1I A;  4KLH A;  2HVH A;  5ALN A;  4PL1 A;  3DDH A;  5KFX A;  1SWV A;  2W9C B;  2ASD A;  2RDI A;  3NGD A;  2XGP A;  3UXP A;  3I1Y A;  4ZH4 A;  5FP0 A;  5KFA A;  3ETR A;  2JEF A;  5ALO A;  3V7K A;  1ZQK A;  4RUA A;  8ICT A;  1EXN A;  7ICF A;  1FEZ A;  2D8C A;  1LB2 B;  2WAQ C;  3L5K A;  3RB3 A;  4AYB C;  2KHQ A;  3B0X A;  4PGX A;  4ECX A;  2E3T A;  4DSE A;  1WYG A;  4YR2 A;  2FLL A;  4TQS A;  2AGQ A;  2LI6 A;  1TVA A;  2XGQ A;  4KLL A;  4UAR A;  3ONN A;  3GU3 A;  5HHI A;  5AI8 A;  1XNS A;  5J0T A;  5KFM A;  4J9S A;  3KKA A;  1SL2 A;  3RAX A;  5J0U A;  4BGD A;  9ICA A;  1RXV A;  4HYK A;  2GH1 A;  4I2E A;  4O3O A;  3CYM A;  3M7D A;  4MHV A;  2MUT A;  5J2F A;  1WG8 A;  4XUS A;  4O5K A;  3GIJ A;  4JV1 A;  1TAQ A;  4UB8 U;  3C2L A;  4Y2J A;  5AKL A;  1B4F A;  5IIM A;  7ICL A;  4DQS A;  4KMO B;  2K8C B;  4KLM A;  4DL2 A;  4RU9 A;  4NM2 A;  2VKQ A;  1K5O A;  2B0C A;  1BPZ A;  5AI5 A;  3G6Y A;  4NL9 A;  3E2E A;  1SV4 A;  5CB1 A;  9ICT A;  1BVS A;  2KE7 A;  5AKE A;  4DL4 A;  2ZXH A;  4F71 A;  5AM5 A;  2OH2 A;  4M2Y A;  1ZXI A;  2EAM A;  1MN8 A;  1S10 A;  3E58 A;  4R66 A;  2E8M A;  1JX4 A;  4KLO A;  3F2C A;  2EH9 A;  4QZA A;  3PZP A;  1L6N A;  2FMS A;  3V6H A;  4A8E A;  3GFK B;  4Z6F A;  1FIQ A;  4C8L A;  2F1J A;  1ZQM A;  4UAU A;  2AU0 A;  5J2K A;  2C2R A;  5E79 U;  3SV3 A;  3M9O B;  2WB1 F;  5KL1 B;  5KFQ A;  4ACO A;  2YY6 A;  1ZQD A;  4LVS A;  5AM0 A;  2LYA A;  8ICN A;  2CN1 A;  9ICW A;  5ALS A;  5DBC A;  5KG1 A;  3GII A;  1D9F A;  1PVR A;  1SXD A;  5ALM A;  3GQC A;  5CP2 A;  1KW4 A;  4QZI A;  5G5G A;  3V6K A;  5ALG A;  2I5H A;  2RQ5 A;  4TUQ A;  3KHH A;  4F5N A;  2C22 A;  4DQP A;  4BUG A;  2HHW A;  2JEI A;  3ZDE A;  1URJ A;  4RT2 A;  1TFR A;  4UB1 A;  5AKZ A;  4ED1 A; 
#chains in the Genus database with same CATH homology
 1B4F A;  2Y9T A;  2ESE A;  3BS5 A;  1WWU A;  1X9X A;  1UQV A;  1X66 A;  1UCV A;  4PZN A;  2KSO A;  5L1M A;  4RQN A;  5J8Y A;  1SV0 A;  1V38 A;  1PK1 A;  4NL9 A;  2F3N A;  1SV4 A;  2QAR A;  2B6G A;  2QB1 A;  4NJ8 A;  2QB0 B;  2K4P A;  4IS7 A;  3KKA C;  1OXJ A;  2EAN A;  2KE7 A;  2E8O A;  3SEI A;  2KMD A;  1V85 A;  1DXS A;  2EAM A;  2E8M A;  2F44 A;  1LKY B;  1F0M A;  2EAP A;  2DKZ A;  5JU5 A;  1Z1V A;  5JTI A;  2D8C A;  2KSO B;  1SGG A;  5JRT A;  2E8P A;  3IDW A;  1PK1 B;  3TAD C;  4RQM A;  2FE9 A;  4PZO A;  5KNI A;  2Y9U A;  1B0X A;  1SXE A;  4NL9 C;  2LPE A;  1PK3 A;  3HIL A;  2DL0 A;  1X40 A;  1LKY A;  3BS7 A;  1SXD A;  3BS5 B;  2F8K A;  2LMR A;  1KW4 A;  2JV3 A;  3KKA A;  1WWV A;  2GLE A;  2KIV A;  3SEN A;  1OW5 A;  2EAO A;  2E8N A;  2QB0 A;  2KG5 A;  2K60 A;  2YTU A;  3TAC B;  3TAD A;  3H8M A;  1COK A;  2QKQ A;  2QAR B;  5F3X B;  5J8Y C;  1SV0 C;  4MHV A;  3K1R B;  2ES6 A;  1JI7 A;  1RG6 A;  2L5Y A;  3BQ7 A;  2DKX A;  2D3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...