2D3DA

Crystal structure of the rna binding sam domain of saccharomyces cerevisiae vts1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
83
structure length
83
Chain Sequence
b'SMNPKSLTDPKLLKNIPMWLKSLRLHKYSDALSGTPWIELIYLDDETLEKKGVLALGARRKLLKAFGIVIDYKERDLIDRSAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vts1 protein
publication title The NMR and X-ray Structures of the Saccharomyces cerevisiae Vts1 SAM Domain Define a Surface for the Recognition of RNA Hairpins
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 32
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2005-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2d3dA00
3K1RB 5J8YA 2F3NA 4NL9C 2K60A 3SENA 1SV0A 2KIVA 3H8MA 3TACB 5KNIA 1SV0C 1UCVA 2LMRA 4NL9A 4RQMA 1OXJA 2KE7A 1X9XA 2EAMA 1PK1B 2L5YA 2FE9A 1B0XA 2KG5A 1LKYB 2D8CA 4RQNA 1PK3A 1COKA 5JTIA 1OW5A 2D3DA 2EAPA 2Y9TA 2ES6A 2KSOA 5L1MA 2B6GA 2ESEA 1F0MA 3KKAC 1RG6A 1V38A 2QB1A 2EANA 3BS5A 3BQ7A 2QARA 3SEIA 2YTUA 1SV4A 1JI7A 5JRTA 1SXDA 2E8NA 1KW4A 2EAOA 2KSOB 5F3XB 1SXEA 3KKAA 2DKZA 2E8OA 4PZNA 1UQVA 3BS5B 2QB0B 2QARB 2F44A 4MHVA 3HILA 2QB0A 3TADA 3BS7A 1WWUA 2K4PA 1SGGA 3TADC 2F8KA 2GLEA 1DXSA 2KMDA 2DL0A 2E8MA 2Y9UA 1X66A 5J8YC 2E8PA 4NJ8A 1V85A 5JU5A 4PZOA 1Z1VA 3IDWA 4IS7A 1X40A 1WWVA 2JV3A 2DKXA 2LPEA 1PK1A 1B4FA 2QKQA 1LKYA
chains in the Genus database with same CATH superfamily
4US9A 1ZQQA 1WUDA 5AKJA 2HVIA 2YB1A 4F4YA 3C2LA 3IM1A 3SI8A 4UB2A 3BQ0A 4B9SA 4RNNA 2ZUDA 4UB5A 2KG5A 1COKA 1ZQNA 2BGWA 4C8OA 5DDMA 3FM9A 4I2EA 3UQ2A 1X9MA 4I2AA 3V72A 3N7SC 1FFUA 5AKEA 2ATLA 5KFRA 4RUAA 3QNMA 1NK4A 3IN5A 2ASJA 8ICTA 1SWWA 4O0IA 5DQHA 2BCVA 4R63A 3PW2A 3RJKA 3SV4A 1KFSA 5J2AA 5L1JA 3SAFA 2VANA 2XC9A 5KG1A 1WCNA 1FIQA 1ZQ1C 1V9PA 1TAMA 7ICSA 1WG8A 2GLEA 4O5CA 2W7OA 4RPZA 2DL0A 1Z19A 3F5AA 3RR8A 2WF5A 4F50A 4U6PA 4M6WB 5KFKA 2K8AA 4PL2A 8ICRA 8ICWA 5JU5A 1NJZA 3RJJA 2W9CB 2DBYA 3ISDA 5J2EA 2JH7A 1XSLA 1D9DA 5KFIA 5KFGA 5AK3A 5KT5A 2YX8A 4DOBA 3RJGA 4DOCA 4YXMA 3RAXA 5KG3A 2F1IA 2UVUA 5AKZA 1ZQMA 5IIMA 1BNOA 3M6ZA 3QUQA 3OJUA 5KNIA 2CPRA 4I2IA 5J2HA 2LMRA 4BXOA 4Q43A 4EYIB 4EELA 1OXJA 4UASA 1Q3VA 5KFXA 3ETLA 1LKYB 2H3IA 3UXNA 3HW8A 2DWQA 4GXJA 4DL6A 1P7DA 3HWTA 2KSOA 3K1ZA 3SV3A 5G5GA 1F0MA 4F5QA 1S97A 4DEZA 5KFNA 2BZFA 3HX0A 5F9LA 4JUZA 4Y2YA 5DKWA 1SV4A 3HKZC 4CF5A 1MA7A 2W7PA 4Y2RA 2C2RA 7ICPA 3ZDCA 3RH5A 2JRZA 1N60A 5AM2A 4Z6FA 4NLNA 1V97A 1BPBA 5DG7A 7ICQA 4C80A 2YMMA 4DLGA 3BJYA 3GIKA 4BDPA 3UMBA 4B9MA 1TV9A 4F3OA 3PO4A 1IG6A 4K4IA 3M9MB 5CJ7A 4RPXA 4FZLA 1JROA 2RQ5A 1ZQGA 5J8YC 9ICIA 4QZHA 4IQUA 2NRWA 5ALKA 5DBCA 2XO7A 2WF7A 3C28A 3NUQA 4IRDA 1H38A 2ZIWA 1S77D 4NL9C 5J2KA 1NKEA 2D6FC 1TAQA 4RQMA 5AHXA 3C1YA 3PW5A 3DV9A 4IQTA 2YMPA 8ICUA 4G3IA 3WK5A 3BDPA 5AKIA 3C23A 4DCCA 2JEFA 2ES6A 1J97A 3H4BA 3Q8SB 2B6GA 1NNLA 5AI4A 3LVWA 9ICBA 3PY8A 3PX6A 3ZDBA 3D2SA 4Y2QA 2F76X 2KN7A 3V7KA 2YTUA 5AKLA 1X42A 4KLQA 2YB4A 3C5FA 2XY6A 1JMSA 3RH6A 4PH5A 4C7YA 5ALOA 2Q0ZX 4PL1A 4TQSA 4RUCA 5ALSA 2WF9A 3RJIA 8ICSA 1UT8A 4E0DA 1ZQZA 4NJ8A 1L3VA 3RJHA 4ECTA 1O03A 2LYBA 2W54A 1DGSA 2IHMA 2MRLA 1QH9A 2A3VA 3OHAA 9ICAA 2ZG6A 2DKXA 4Y2UA 2N1RA 1KL9A 4NM2A 1HUZA 1C7YA 1NKBA 1Z00A 3MGHA 2G5IB 4DSIA 2KJ5A 3CRXA 3TAQA 3AEVA 4DL4A 3OSNA 1SV0C 9ICXA 1RYSA 2Y1JA 2L5YA 4IL6U 5HR7A 4M9NA 1ZQYA 2E5SA 4RQNA 3TFRA 5ALTA 3MR2A 1ZRNA 2C2EA 2HOQA 4KLIA 3M8RA 1BPDA 3MABA 4JV2A 2D3DA 4EENA 1QSLA 2FPLA 3F5EA 2BR0A 4BXOB 1XWLA 8ICJA 4UB6U 3H0LB 4Y2JA 4UB1A 4I2FA 1V38A 2KZMA 5KFYA 3PSTA 2W04A 5EWFA 2QARA 3WK7A 8ICIA 4RQ1A 3UMCA 4MEYA 4IRKA 5GTIU 1XSPA 3Q8RB 4ED6A 4EZ9A 4BX9C 3I28A 1NK9A 9ICJA 2KSOB 4DQSA 2E1EA 4PPXA 2MSNA 4JB3A 2JXJA 2NRZA 5G5HA 2G08A 5IILA 5AM0A 5ALMA 1CRXA 7ICKA 1S0NA 3H8JA 1UPHA 2H3VA 5CP2A 4K4GA 2W3SA 2W03A 1A0PA 4Y2TA 1ZQEA 1L3TA 2I5HA 2LM4A 4C8NA 1RYUA 4YP3A 2G06A 1BPXA 1XU4A 3ISBA 1N56A 3M6KA 2PXIA 2WAQF 5KFAA 3K4GA 5HP4A 3HRDD 4M6WA 1BVSA 4JV1A 1RDFA 2K8BB 2R8IA 2W9AA 4XQ8A 2LPEA 4FFDA 4KLUA 4B9TA 5AM4A 2I6XA 4YMMA 2KOBA 2W3RA 3NS1A 3UMGA 5KT2A 2DUYA 1S76D 2K60A 5GTHU 1NOMA 5TISU 4Y2XA 2KEYA 3B0YA 2HBLA 4YR0A 4CGZA 5AI6A 4OJPA 2H3QA 4YFKA 2HOFA 3ALRA 4KMOB 1ZQAA 3WK9A 4DOAA 4KITB 5HHIA 2IOFK 1KDHA 1GO3F 4O3NA 4LVSA 1RXWA 3UXPA 2Q4TA 3MR5A 2MA1A 1OW5A 5J2GA 3Q8MA 3RJEA 2EQYA 4UQGA 5KAFU 3WKBA 3PZPA 1C20A 1L7NA 4P2HA 3H0MB 3UQ0A 4DL7A 2FMSA 1TK0A 2A19A 4WJ3B 3VC8A 2KVCA 1U4BA 2HVHA 1T94A 4EBCA 3NRZA 2AGQA 5KFZA 1L7PA 1M6YA 2KKPA 4M2YA 8ICKA 1Y88A 2PFPA 4BUGA 3BQ1A 2M0NA 2WB1F 1J2NA 2E8OA 5BPCA 4U7CA 1L7MA 2QB0B 2ISOA 8ICAA 1SKSA 4UAVA 4FZMA 3C5GA 4TURA 1D8LA 4TUQA 1ZRMA 9ICEA 2H3ZA 9ICMA 2W8KA 2GH1A 5ALXA 1JN3A 1RPLA 3TKAA 8ICYA 2OEHA 1XO0A 4OJ5A 4PHAA 3D2QA 1NI3A 1QQ7A 2JZBB 2XICA 4ECXA 5DG8A 4R64A 1TVAA 1XO1A 3MFIA 4F91B 4O5KA 4ED3A 1B4FA 1Q3UA 2FLNA 2A1JB 2XGPA 2HHSA 4NL9A 1KRPA 5IIKA 4M04A 4KLEA 1UHUA 7ICFA 4RU9A 3RBEA 5AIBA 8ICNA 5KFBA 1F44A 3UPQA 3MC1A 1UA1A 1B0XA 5T14A 3C29A 1U49A 5AKYA 3ZDAA 2MU2A 5IIOA 5AICA 3L3FX 2Y9TA 1U45A 2RDJA 4UATA 4F5OA 1ZQJA 3KKAC 3WKEA 3AM9A 9ICFA 1ZQPA 4F4XA 3A0BU 2XIDA 3SEIA 3B9JA 2ZJ8A 1S10A 3G6XA 2AXTU 1L8OA 4QZBA 4YMNA 4KX3A 2P6RA 1LVHA 1KLNA 1PVPA 2E1FA 5ALZA 4C4TA 1KSPA 3M9OB 4ED7A 2QARB 1OUQA 1EXNA 3GV8B 2EH9A 8ICEA 3GILA 1NK6A 4KLFA 4QWDA 2ZTEA 2K4EA 3AU6A 3C1ZA 1MSWD 1KBUA 2HCFA 3WK4A 1O08A 4QWBA 3QEBZ 4O3PA 2ALZA 4DQRA 1S0MA 2KZ3A 3HP6A 2FDRA 5J2CA 4ECRA 2HHXA 3C2MA 3QU2A 3GIIA 2NRXA 4QZAA 3KD3A 1SL2A 4MF2A 5ALGA 2FMQA 3GV7B 7ICUA 4RNMA 1SV0A 4F71A 5IINA 4P0PA 5KL1B 1BNPA 3AMZA 2KJ8A 5KG6A 1CI4A 5ALRA 1K1SA 1QQ6A 3D6JA 3KZXA 2XGQA 5KG4A 4JK1A 1TE2A 4C0ZA 3PSIA 3Q8PB 4F5NA 1RQLA 4QW9A 1JXLA 2LI6A 2NO4A 4YN4A 2BDUA 9ICPA 4BWMA 2W9BB 4F5PA 2ESEA 1CUKA 2G0AA 3KFUF 2EANA 4Q8FA 5J0RA 3OJSA 4O5EA 1J2MA 1AQ6A 3C21A 4JWNA 1KEJA 4QIWF 1HEKA 2NRTA 4OO1J 1PZNA 4DFKA 1T8EA 3LDAA 2OWOA 1FO4A 2MUTA 2E8NA 4RQ7A 3SR6A 5KL8B 4J9NA 2J6SA 4PZNA 1UQVA 1LB2B 5KFPA 4DL5A 1K5OA 2DQNB 8ICQA 5ALJA 2LBOA 2ASDA 3V6KA 1SL1A 4P0QA 5B66U 1L5UA 3C2KA 1WWUA 1L3UA 1ZYQA 2P66A 4JWMA 5AM3A 4I28A 4PHEA 1ZJMA 2WTFA 1V85A 3KHGA 1S5LU 9ICGA 5J29A 9ICTA 4MFAA 5EE0A 3CW2C 1RXVA 5C0YA 1KFTA 4FBUA 4NLKA 1X40A 4ACOA 1HIWA 2VIXA 2G5HB 3K75D 4DS4A 2KHVA 4GC6A 4F2RA 1YZ7A 3GU3A 4GFJA 5HMLA 5BOLA 3K1RB 5DG9A 4NV0A 4PGQA 3PMNA 2F2AB 1ZQCA 2CN1A 2P6UA 4PJ0U 4DLEA 4CCHA 4ZOHC 3GZFA 2BPFA 3HPOA 1NJYA 1S9FA 3ZDEA 5HNKA 3AQFA 2GWSA 2AGPA 4CNQA 4MEXA 1URJA 4RT3A 5DQIA 3V6JA 4OJOA 4KLHA 4ECUA 2XCPA 4OD0A 1SWVA 2ZJAA 5KFQA 2EZYA 4RQ5A 1JALA 4KLMA 2NRVA 4G9BA 5F9NA 2CRXA 3QYPA 4M9GA 2B0CA 1JIHA 2R8HA 5DQGA 3DEEA 2KFNA 2Y1IA 2KK0A 2UVVA 2G09A 3PNCA 4B6JA 3ONNA 1FEZA 3GDXA 2R8GA 4ELTA 3EZ5A 1XNSA 5L1KA 2F44A 1B43A 2PFQA 2HHVA 2QB0A 4QWCA 4KX5A 3AL0B 3TI0A 3DDHA 5KG0A 3BS7A 3F2CA 4J9KA 3TADC 1JX4A 3EPIA 3QZ8A 5KFTA 5AKGA 4DO9A 1L7OA 2XI9A 5AK6A 5KFOA 4ED8A 1SB3C 4I29A 1K1QA 4R65A 4CF3A 5J2DA 9ICWA 2H5XA 3TQ1A 4C4SA 2AU0A 8ICXA 2JEGA 1D8BA 3KBBA 4GLXA 3FAHA 2JZBA 3M1YA 5KFFA 2IBKA 1PK1A 4DFMA 5JUMA 4YQWA 5HHHA 9ICSA 2A1JA 4OCZA 3PV8A 5EOZA 2V4RA 1KTQA 2BPCA 3OSPA 2KIVA 2F8LA 3LK9A 2K8CB 2GOLA 2EAMA 4DS5A 3TARA 1U47A 4DL2A 3ETRA 2KICA 2BCUA 1S0OA 2HW3A 1JRPA 2F1JA 3MR3A 4EX6A 1ZQBA 4F93B 4CRXA 1UT5A 4P0PB 4QJFB 4GIBA 3NGDA 4F4WA 5ALHA 1YZ6A 1Z1BA 4UB8U 2PFOA 4I27A 4OJLA 1VJ5A 3MGIA 1RG6A 1KKXA 4PGXA 4ECVA 4QIWC 1FFVA 3H40A 2LM1A 2I1QA 2MAXA 1X2IA 3PSPA 3FDSA 5H2FU 4AYBF 2EZXA 3H4DA 4LZDA 2E3TA 4DF4A 1U48A 3G6VA 4C8MA 8ICCA 4ECYA 2MUTB 1ZJNA 3KZIU 2R8KA 5TZVA 2DF4B 2VKQA 2BDPA 3FYHA 4IQWA 3OHBA 3IP4B 2BCRA 1VLBA 2RHFA 3RB3A 5DBBA 2OHFA 3IV6A 3BQ2A 5J0SA 2ASLA 3WKCA 4P0QB 3T5KA 2ZUCA 2ZXIA 5CR0A 8ICVA 5EE9A 2M9NA 1N62A 5KG5A 4RQ6A 1D9FA 2HBMA 4FZNA 5ALUA 3NVWA 5K4LA 4B9NA 3D2NA 5EWEA 3PX4A 1B22A 4B9VA 4C7ZA 5DB8A 5D46A 4QZIA 4NLCA 4RNOA 4O9MA 3NVYA 4XRHA 4ED0A 4PHPA 5AIAA 5D49A 4TUSA 4I2BA 3H7IA 3F2BA 5IIJA 5KFUA 4ELVA 4QW8A 5L1MA 2C28A 1MQ3A 3R9KA 3E0FA 4XA5A 4TQRA 1IV8A 3QU5A 5A0LA 2W43A 2W9BA 3BQ7A 2W8LA 3KOOA 4Q8EA 5HMMA 2XY7A 3SZ2A 2OM6A 2NO5A 4O3OA 2VJ5A 1JI7A 3BZCA 2IOHA 2RLTA 4RPYA 4UBCA 2EAOA 5CHGA 4Z6CA 2PI5A 9ICLA 2DKZA 4Q45A 2B21A 4USAA 1A77A 1Z4OA 4F5RA 4RQ4A 3LVVA 1HJPA 1X9WA 4GXKA 4M0AA 3RB0A 1UA0A 3PW4A 2EZZA 3T5HA 3WK6A 1X6JA 2BQ3A 3BZKA 9ICOA 3ZD8A 7ICRA 2BQUA 5AI9A 3L5KA 3HJEA 4PZOA 5ALPA 4FO6A 1WWVA 5ALLA 1KQQA 2ZUBA 4BGDA 2XCAA 3N7PD 5JTIA 5J8YA 4F92B 3T79A 4QZFA 9ICVA 2YY6A 3F53A 2LYAA 2IA6A 1DK3A 3V7LA 4EX7A 3RB6A 3SAHA 5KFEA 2JHDA 1DK2A 4CE6A 4J9SA 1PK1B 3GFKB 4NLZA 4RT2A 2HBKA 5KFVA 4IR9A 3HKZF 2OYYA 2AH5A 4DFJA 2DPIA 4I2HA 4R66A 3MDAA 3JPNA 1SIJA 2ZIXA 2Y0SF 4Q44A 8ICMA 3SYZA 5CEHA 1VDVA 3JPOA 3I1YA 4TUPA 4M47A 3QUTA 1KFDA 4XUSA 5CA7A 3RB4A 5E79U 3NASA 2K4IA 3QE9Y 1BGXT 2DFLA 5EWGA 3QU7A 4DQIA 4AYBC 2IMWP 2ZIVA 2CXYA 3OGUA 5DLGA 2BCSA 4IQVA 3T5JA 3V6HA 8ICBA 3M9NB 2IHNA 5ALVA 4F2SA 3QX7A 3TADA 1WCLA 2NYVA 4DL3A 2F8KA 1DRGA 1SL0A 2BQRA 3PR5B 5KFMA 3A0HU 1Z4NA 1ZQKA 1WYGA 5KFWA 2FLLA 2H3FA 4J9QA 4A8EA 4FS1A 3B0XA 3FC4A 9ICNA 4KLDA 4ECQA 4IS7A 2JV3A 1YT3A 1SKWA 5HR6A 3MDCA 4QZDA 4IRCA 1COOA 4FBTA 3NVZA 3ZDDA 2KVSA 7ICJA 3S6JA 2WAQC 2PKEA 4RQ2A 2ZTCA 2BHNA 3EW9A 2P35A 3RRGA 5J0PA 1LV5A 7ICOA 4B9LA 5AI8A 1PUZA 4F8RA 3SD7A 1ZQUA 2W11A 4EBDA 3KHHA 1IXRA 2HSZA 4NLBA 5IIIA 1ZQVA 3JPSA 2HMXA 3Q8LA 7ICHA 4KLJA 3N28A 4DWIA 2VA8A 5D4BA 3RH4A 5EE1A 3T3FA 1QSYA 8ICGA 1X6IA 3RR7A 1X9SA 4RQ3A 1XSNA 2J6UA 4ECSA 4US8A 1QQ5A 4LZGA 5CRXA 4J9PA 1KW4A 1S8OA 1SZPA 5AM1A 2KZZA 3MR6A 3WK8A 2LYHA 1RZTA 3ISCA 5KFDA 4YVZA 5KT7A 2QLTA 3RFAA 5J0XA 3HILA 4I2GA 4KMUA 4YCXA 4M9LA 5DB6A 5KT4A 4KLLA 4GC7A 3TANA 3M7DA 4FS2A 3H8SA 2RDIA 3LWMA 1DXSA 2KMDA 7ICMA 3JPRA 5J0TA 4YXJA 4YMOA 2WB1C 8ICHA 1TK8A 2E8PA 1SKRA 9ICHA 3UXOA 2KJ9A 4HAIA 2YQEA 3Q8QB 4QZ8A 5J0QA 8ICZA 5J2BA 4QZGA 4KTQA 1ZQRA 1N5WA 2FI1A 3L4PA 5ALEA 3NTUA 1ZD4A 1F5SA 5DB9A 4LJXA 4J03A 4Y2PA 2NV3A 2K89A 2ZIUB 2ZJ5A 2R8JA 3QUBA 2W55A 1PVQA 2YN4A 5AI5A 4F4ZA 2GO7A 4QWAA 3PW7A 1A6SA 3QU9A 2DGZA 4ZH4A 1T4GA 2D8CA 4Z6DA 3LWLA 3Q8KA 3PSFA 4P4PA 2ODGA 2ZXHA 1XC9A 4FE3A 5ALIA 3UM9A 3BQTA 1CEZA 2HHUA 3GQCA 2Y0SC 3PW0A 4P4OA 5C5JA 2JMGA 5KFCA 8ICFA 3QXGA 3EYZA 1N5XA 5J2FA 1XS9D 1KN5A 1QTMA 2KV2A 1NJXA 3BS5A 5CWRA 5DGAA 8ICOA 2LKYA 1NK5A 3M8SA 2K4HA 5KFHA 4RZRA 3TFSA 2WFAA 5JRTA 4C4RA 4M9JA 2ZIXB 7ICLA 4DQQA 2OCEA 4EYHB 4KN7A 3QUCA 4UW9A 2WHEA 4JMUA 5ALYA 3JPTA 2AQ4A 3RRHA 2AGOA 1ZQSA 3NRWA 1U9LA 3WU2U 4MHVA 4I2JA 4OJ6A 2PFNA 4QWEA 5ALFA 2K4PA 3ORYA 2HOIA 7ICVA 4J9LA 2E8MA 3O0FA 1NZPA 2ZIVB 4UARA 3ZI4A 4Y2VA 4O3RA 2OXOA 1T3NA 1L3SA 4ELUA 4QZCA 1N2XA 4PHDA 9ICKA 3N7RC 5KG2A 9ICQA 5DDYA 4YG2A 7ICNA 3IDWA 2KKVA 4UAWA 5BOMA 4DF8A 3CP8A 2KNJA 3N4MB 3QEAZ 2O6KA 3ZD9A 2F3NA 2KP7A 2PMZF 1ZETA 4Y2SA 4I2DA 4R8UA 4GXIA 3PO5A 2KHQA 4KLOA 1UCVA 1ZQFA 1D8YA 2BKEA 5AK5A 5DBAA 1TKDA 3CNHA 3EUB2 4O3QA 2XY5A 5L1LA 3HT3A 2JEIA 1MQ2A 4NXZA 2C22A 4NWIA 1NK8A 1HUOA 2AJQA 5ALNA 1PK3A 3F2DA 1ZD3A 9ICUA 3V7JA 2JGAA 8ICLA 4EEYA 1L8LA 3EWAA 2FLPA 3G6YA 2DPJA 2LHTA 4F72A 2G07A 2PI4A 3EPGA 3PVXA 2C2DA 4DSFA 3KHLA 3IRUA 5J0UA 3KTQA 5ALDA 2KTQA 3QU4A 3RAQA 4EEKA 1PVRA 3PX0A 3T5LA 5F3XB 2FPMA 3KKAA 2JEJA 4J9OA 4JV0A 2Z7JA 1Z3EB 4Z6EA 3SMVA 4AP9A 3H8WA 2IOFA 1DOQA 4DFPA 2KFZA 1SGGA 1Q8KA 1NJWA 4M9HA 7ICGA 3MFHA 4BJQA 1TK5A 2YMLA 4IC9A 2VA3A 4O3SA 2WF8A 2KD1A 1MC8A 9ICCA 5KG7A 2OH2A 3WKAA 3RJFA 2RP5A 3THVA 1ZOLA 4KLGA 2HHQA 2R18A 3ED5A 4CF4A 4ED2A 4K4HA 3U26A 5FP0A 2HI0A 4UBBA 4O3MA 3AQEA 1N63A 2VJ4A 1RM6C 3TACB 2W9MA 3GV5B 4YD1A 5ALQA 3RF9A 2KE7A 2J6TA 2I9GA 4QNLA 2FE9A 2WF6A 3OPXA 3WKDA 1ZQLA 4ED1A 1NK7A 4QZ9A 4C8KA 3ICXA 5B5EU 1QLNA 1JXEA 1ZQTA 3N97B 5J0WA 3CYMA 4RQ8A 1S0VA 4KN4A 5J2JA 2JR5A 2QB1A 1T7PA 1ZD5A 1ED1A 4ECWA 4DQPA 5AKXA 1ZXIA 1ZQIA 1SXDA 5KFSA 4UAUA 3JPPA 4MFCA 1NK0A 1BPEA 4KLSA 4QZEA 1IIPA 3BS5B 3AU2A 3GIMA 3I76A 9ICRA 3GIJA 5KT3A 4UAYA 2W9CA 4CDGA 4F4KA 5DLFA 4P4MA 1DGJA 1TFRA 5AKKA 5AM5A 2XVTA 4YD2A 4DSEA 1X66A 4B9UA 3PMLA 1AROP 2FPKA 5DB7A 5KAIU 3H0RB 3OTQA 5J2IA 2JH1A 1NKCA 2V9WA 1Z1VA 4J9MA 5ALWA 3TAPA 4UB4A 4DSKA 2BPGA 3MBYA 2EDUA 2QKQA 2ZIWB 2FMPA 4NM1A 1LKYA 5L9XA 2UVWA 2PMZC 2BCQA 3LYSA 5AKHA 3SENA 2ZIUA 2HHTA 3H8MA 4RQ0A 3AUOA 5AK4A 3VCBA 4DSJA 1TAUA 1N48A 1X9XA 1BPZA 2YMQA 3IG5A 4EBEA 4DSLA 2VA2A 3SAGA 5KFJA 5CB1A 2F1HA 3IHQB 4R8UB 1A76A 5L1IA 2EAPA 3PR4A 4NLGA 1MN8A 1BPYA 5KT6A 3SQIA 2AQ0A 2RRDA 1SZHA 5KFLA 4DFDA 4YR3A 1RQNA 5J0YA 1ZQDA 4C8LA 1T3QA 4NY8A 4HYKA 1RYRA 3RBDA 2KIWA 4MF8A 2F77X 4X5VA 3J81j 7ICTA 1Q46A 3JPQA 2AHOB 1JUDA 2V4QA 1NZBA 3RTVA 4YR2A 2A1AA 2FJ6A 1SXEA 3AN1A 3IG8A 7ICEA 5KTQA 2HDOA 3E58A 2ISPA 2ZTDA 1ECWA 4UB3A 1IM4A 4ICAA 1QCKA 5J0OA 1ZQWA 4ECZA 5EE3A 1L6NA 1ZQOA 1QSSA 5DGBA 2Y9UA 4J9RA 7ICIA 3E2EA 2UVRA 1ZD2P 8ICPA 4EZ6A 4UAZA 1N61A 5AI0A 3KHRA 4IR1A 1ZQXA 2HBJA 4BWJA 4MFFA 4PGYA 1ZQHA 1Z00B 4KLTA 3MGVA 2HHWA 3NVVA 3QZ7A 4I2CA
chains in the Genus database with same CATH topology
3K1RB 5J8YA 2F3NA 4NL9C 2K60A 3SENA 1SV0A 2KIVA 3H8MA 3TACB 5KNIA 1SV0C 1UCVA 2LMRA 4NL9A 4RQMA 1OXJA 2KE7A 1X9XA 2EAMA 1PK1B 2L5YA 2FE9A 1B0XA 2KG5A 1LKYB 2D8CA 4RQNA 1PK3A 1COKA 5JTIA 1OW5A 2D3DA 2EAPA 2Y9TA 2ES6A 2KSOA 5L1MA 2B6GA 2ESEA 1F0MA 3KKAC 1RG6A 1V38A 2QB1A 2EANA 3BS5A 3BQ7A 2QARA 3SEIA 2YTUA 1SV4A 1JI7A 5JRTA 1SXDA 2E8NA 1KW4A 2EAOA 2KSOB 5F3XB 1SXEA 3KKAA 2DKZA 2E8OA 4PZNA 1UQVA 3BS5B 2QB0B 2QARB 2F44A 4MHVA 3HILA 2QB0A 3TADA 3BS7A 1WWUA 2K4PA 1SGGA 3TADC 2F8KA 2GLEA 1DXSA 2KMDA 2DL0A 2E8MA 2Y9UA 1X66A 5J8YC 2E8PA 4NJ8A 1V85A 5JU5A 4PZOA 1Z1VA 3IDWA 4IS7A 1X40A 1WWVA 2JV3A 2DKXA 2LPEA 1PK1A 1B4FA 2QKQA 1LKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1R B;  5J8Y A;  2F3N A;  4NL9 C;  2K60 A;  3SEN A;  1SV0 A;  2KIV A;  3H8M A;  3TAC B;  5KNI A;  1SV0 C;  1UCV A;  2LMR A;  4NL9 A;  4RQM A;  1OXJ A;  2KE7 A;  1X9X A;  2EAM A;  1PK1 B;  2L5Y A;  2FE9 A;  1B0X A;  2KG5 A;  1LKY B;  2D8C A;  4RQN A;  1PK3 A;  1COK A;  5JTI A;  1OW5 A;  2D3D A;  2EAP A;  2Y9T A;  2ES6 A;  2KSO A;  5L1M A;  2B6G A;  2ESE A;  1F0M A;  3KKA C;  1RG6 A;  1V38 A;  2QB1 A;  2EAN A;  3BS5 A;  3BQ7 A;  2QAR A;  3SEI A;  2YTU A;  1SV4 A;  1JI7 A;  5JRT A;  1SXD A;  2E8N A;  1KW4 A;  2EAO A;  2KSO B;  5F3X B;  1SXE A;  3KKA A;  2DKZ A;  2E8O A;  4PZN A;  1UQV A;  3BS5 B;  2QB0 B;  2QAR B;  2F44 A;  4MHV A;  3HIL A;  2QB0 A;  3TAD A;  3BS7 A;  1WWU A;  2K4P A;  1SGG A;  3TAD C;  2F8K A;  2GLE A;  1DXS A;  2KMD A;  2DL0 A;  2E8M A;  2Y9U A;  1X66 A;  5J8Y C;  2E8P A;  4NJ8 A;  1V85 A;  5JU5 A;  4PZO A;  1Z1V A;  3IDW A;  4IS7 A;  1X40 A;  1WWV A;  2JV3 A;  2DKX A;  2LPE A;  1PK1 A;  1B4F A;  2QKQ A;  1LKY A; 
#chains in the Genus database with same CATH topology
 4US9 A;  1ZQQ A;  1WUD A;  5AKJ A;  2HVI A;  2YB1 A;  4F4Y A;  3C2L A;  3IM1 A;  3SI8 A;  4UB2 A;  3BQ0 A;  4B9S A;  4RNN A;  2ZUD A;  4UB5 A;  2KG5 A;  1COK A;  1ZQN A;  2BGW A;  4C8O A;  5DDM A;  3FM9 A;  4I2E A;  3UQ2 A;  1X9M A;  4I2A A;  3V72 A;  3N7S C;  1FFU A;  5AKE A;  2ATL A;  5KFR A;  4RUA A;  3QNM A;  1NK4 A;  3IN5 A;  2ASJ A;  8ICT A;  1SWW A;  4O0I A;  5DQH A;  2BCV A;  4R63 A;  3PW2 A;  3RJK A;  3SV4 A;  1KFS A;  5J2A A;  5L1J A;  3SAF A;  2VAN A;  2XC9 A;  5KG1 A;  1WCN A;  1FIQ A;  1ZQ1 C;  1V9P A;  1TAM A;  7ICS A;  1WG8 A;  2GLE A;  4O5C A;  2W7O A;  4RPZ A;  2DL0 A;  1Z19 A;  3F5A A;  3RR8 A;  2WF5 A;  4F50 A;  4U6P A;  4M6W B;  5KFK A;  2K8A A;  4PL2 A;  8ICR A;  8ICW A;  5JU5 A;  1NJZ A;  3RJJ A;  2W9C B;  2DBY A;  3ISD A;  5J2E A;  2JH7 A;  1XSL A;  1D9D A;  5KFI A;  5KFG A;  5AK3 A;  5KT5 A;  2YX8 A;  4DOB A;  3RJG A;  4DOC A;  4YXM A;  3RAX A;  5KG3 A;  2F1I A;  2UVU A;  5AKZ A;  1ZQM A;  5IIM A;  1BNO A;  3M6Z A;  3QUQ A;  3OJU A;  5KNI A;  2CPR A;  4I2I A;  5J2H A;  2LMR A;  4BXO A;  4Q43 A;  4EYI B;  4EEL A;  1OXJ A;  4UAS A;  1Q3V A;  5KFX A;  3ETL A;  1LKY B;  2H3I A;  3UXN A;  3HW8 A;  2DWQ A;  4GXJ A;  4DL6 A;  1P7D A;  3HWT A;  2KSO A;  3K1Z A;  3SV3 A;  5G5G A;  1F0M A;  4F5Q A;  1S97 A;  4DEZ A;  5KFN A;  2BZF A;  3HX0 A;  5F9L A;  4JUZ A;  4Y2Y A;  5DKW A;  1SV4 A;  3HKZ C;  4CF5 A;  1MA7 A;  2W7P A;  4Y2R A;  2C2R A;  7ICP A;  3ZDC A;  3RH5 A;  2JRZ A;  1N60 A;  5AM2 A;  4Z6F A;  4NLN A;  1V97 A;  1BPB A;  5DG7 A;  7ICQ A;  4C80 A;  2YMM A;  4DLG A;  3BJY A;  3GIK A;  4BDP A;  3UMB A;  4B9M A;  1TV9 A;  4F3O A;  3PO4 A;  1IG6 A;  4K4I A;  3M9M B;  5CJ7 A;  4RPX A;  4FZL A;  1JRO A;  2RQ5 A;  1ZQG A;  5J8Y C;  9ICI A;  4QZH A;  4IQU A;  2NRW A;  5ALK A;  5DBC A;  2XO7 A;  2WF7 A;  3C28 A;  3NUQ A;  4IRD A;  1H38 A;  2ZIW A;  1S77 D;  4NL9 C;  5J2K A;  1NKE A;  2D6F C;  1TAQ A;  4RQM A;  5AHX A;  3C1Y A;  3PW5 A;  3DV9 A;  4IQT A;  2YMP A;  8ICU A;  4G3I A;  3WK5 A;  3BDP A;  5AKI A;  3C23 A;  4DCC A;  2JEF A;  2ES6 A;  1J97 A;  3H4B A;  3Q8S B;  2B6G A;  1NNL A;  5AI4 A;  3LVW A;  9ICB A;  3PY8 A;  3PX6 A;  3ZDB A;  3D2S A;  4Y2Q A;  2F76 X;  2KN7 A;  3V7K A;  2YTU A;  5AKL A;  1X42 A;  4KLQ A;  2YB4 A;  3C5F A;  2XY6 A;  1JMS A;  3RH6 A;  4PH5 A;  4C7Y A;  5ALO A;  2Q0Z X;  4PL1 A;  4TQS A;  4RUC A;  5ALS A;  2WF9 A;  3RJI A;  8ICS A;  1UT8 A;  4E0D A;  1ZQZ A;  4NJ8 A;  1L3V A;  3RJH A;  4ECT A;  1O03 A;  2LYB A;  2W54 A;  1DGS A;  2IHM A;  2MRL A;  1QH9 A;  2A3V A;  3OHA A;  9ICA A;  2ZG6 A;  2DKX A;  4Y2U A;  2N1R A;  1KL9 A;  4NM2 A;  1HUZ A;  1C7Y A;  1NKB A;  1Z00 A;  3MGH A;  2G5I B;  4DSI A;  2KJ5 A;  3CRX A;  3TAQ A;  3AEV A;  4DL4 A;  3OSN A;  1SV0 C;  9ICX A;  1RYS A;  2Y1J A;  2L5Y A;  4IL6 U;  5HR7 A;  4M9N A;  1ZQY A;  2E5S A;  4RQN A;  3TFR A;  5ALT A;  3MR2 A;  1ZRN A;  2C2E A;  2HOQ A;  4KLI A;  3M8R A;  1BPD A;  3MAB A;  4JV2 A;  2D3D A;  4EEN A;  1QSL A;  2FPL A;  3F5E A;  2BR0 A;  4BXO B;  1XWL A;  8ICJ A;  4UB6 U;  3H0L B;  4Y2J A;  4UB1 A;  4I2F A;  1V38 A;  2KZM A;  5KFY A;  3PST A;  2W04 A;  5EWF A;  2QAR A;  3WK7 A;  8ICI A;  4RQ1 A;  3UMC A;  4MEY A;  4IRK A;  5GTI U;  1XSP A;  3Q8R B;  4ED6 A;  4EZ9 A;  4BX9 C;  3I28 A;  1NK9 A;  9ICJ A;  2KSO B;  4DQS A;  2E1E A;  4PPX A;  2MSN A;  4JB3 A;  2JXJ A;  2NRZ A;  5G5H A;  2G08 A;  5IIL A;  5AM0 A;  5ALM A;  1CRX A;  7ICK A;  1S0N A;  3H8J A;  1UPH A;  2H3V A;  5CP2 A;  4K4G A;  2W3S A;  2W03 A;  1A0P A;  4Y2T A;  1ZQE A;  1L3T A;  2I5H A;  2LM4 A;  4C8N A;  1RYU A;  4YP3 A;  2G06 A;  1BPX A;  1XU4 A;  3ISB A;  1N56 A;  3M6K A;  2PXI A;  2WAQ F;  5KFA A;  3K4G A;  5HP4 A;  3HRD D;  4M6W A;  1BVS A;  4JV1 A;  1RDF A;  2K8B B;  2R8I A;  2W9A A;  4XQ8 A;  2LPE A;  4FFD A;  4KLU A;  4B9T A;  5AM4 A;  2I6X A;  4YMM A;  2KOB A;  2W3R A;  3NS1 A;  3UMG A;  5KT2 A;  2DUY A;  1S76 D;  2K60 A;  5GTH U;  1NOM A;  5TIS U;  4Y2X A;  2KEY A;  3B0Y A;  2HBL A;  4YR0 A;  4CGZ A;  5AI6 A;  4OJP A;  2H3Q A;  4YFK A;  2HOF A;  3ALR A;  4KMO B;  1ZQA A;  3WK9 A;  4DOA A;  4KIT B;  5HHI A;  2IOF K;  1KDH A;  1GO3 F;  4O3N A;  4LVS A;  1RXW A;  3UXP A;  2Q4T A;  3MR5 A;  2MA1 A;  1OW5 A;  5J2G A;  3Q8M A;  3RJE A;  2EQY A;  4UQG A;  5KAF U;  3WKB A;  3PZP A;  1C20 A;  1L7N A;  4P2H A;  3H0M B;  3UQ0 A;  4DL7 A;  2FMS A;  1TK0 A;  2A19 A;  4WJ3 B;  3VC8 A;  2KVC A;  1U4B A;  2HVH A;  1T94 A;  4EBC A;  3NRZ A;  2AGQ A;  5KFZ A;  1L7P A;  1M6Y A;  2KKP A;  4M2Y A;  8ICK A;  1Y88 A;  2PFP A;  4BUG A;  3BQ1 A;  2M0N A;  2WB1 F;  1J2N A;  2E8O A;  5BPC A;  4U7C A;  1L7M A;  2QB0 B;  2ISO A;  8ICA A;  1SKS A;  4UAV A;  4FZM A;  3C5G A;  4TUR A;  1D8L A;  4TUQ A;  1ZRM A;  9ICE A;  2H3Z A;  9ICM A;  2W8K A;  2GH1 A;  5ALX A;  1JN3 A;  1RPL A;  3TKA A;  8ICY A;  2OEH A;  1XO0 A;  4OJ5 A;  4PHA A;  3D2Q A;  1NI3 A;  1QQ7 A;  2JZB B;  2XIC A;  4ECX A;  5DG8 A;  4R64 A;  1TVA A;  1XO1 A;  3MFI A;  4F91 B;  4O5K A;  4ED3 A;  1B4F A;  1Q3U A;  2FLN A;  2A1J B;  2XGP A;  2HHS A;  4NL9 A;  1KRP A;  5IIK A;  4M04 A;  4KLE A;  1UHU A;  7ICF A;  4RU9 A;  3RBE A;  5AIB A;  8ICN A;  5KFB A;  1F44 A;  3UPQ A;  3MC1 A;  1UA1 A;  1B0X A;  5T14 A;  3C29 A;  1U49 A;  5AKY A;  3ZDA A;  2MU2 A;  5IIO A;  5AIC A;  3L3F X;  2Y9T A;  1U45 A;  2RDJ A;  4UAT A;  4F5O A;  1ZQJ A;  3KKA C;  3WKE A;  3AM9 A;  9ICF A;  1ZQP A;  4F4X A;  3A0B U;  2XID A;  3SEI A;  3B9J A;  2ZJ8 A;  1S10 A;  3G6X A;  2AXT U;  1L8O A;  4QZB A;  4YMN A;  4KX3 A;  2P6R A;  1LVH A;  1KLN A;  1PVP A;  2E1F A;  5ALZ A;  4C4T A;  1KSP A;  3M9O B;  4ED7 A;  2QAR B;  1OUQ A;  1EXN A;  3GV8 B;  2EH9 A;  8ICE A;  3GIL A;  1NK6 A;  4KLF A;  4QWD A;  2ZTE A;  2K4E A;  3AU6 A;  3C1Z A;  1MSW D;  1KBU A;  2HCF A;  3WK4 A;  1O08 A;  4QWB A;  3QEB Z;  4O3P A;  2ALZ A;  4DQR A;  1S0M A;  2KZ3 A;  3HP6 A;  2FDR A;  5J2C A;  4ECR A;  2HHX A;  3C2M A;  3QU2 A;  3GII A;  2NRX A;  4QZA A;  3KD3 A;  1SL2 A;  4MF2 A;  5ALG A;  2FMQ A;  3GV7 B;  7ICU A;  4RNM A;  1SV0 A;  4F71 A;  5IIN A;  4P0P A;  5KL1 B;  1BNP A;  3AMZ A;  2KJ8 A;  5KG6 A;  1CI4 A;  5ALR A;  1K1S A;  1QQ6 A;  3D6J A;  3KZX A;  2XGQ A;  5KG4 A;  4JK1 A;  1TE2 A;  4C0Z A;  3PSI A;  3Q8P B;  4F5N A;  1RQL A;  4QW9 A;  1JXL A;  2LI6 A;  2NO4 A;  4YN4 A;  2BDU A;  9ICP A;  4BWM A;  2W9B B;  4F5P A;  2ESE A;  1CUK A;  2G0A A;  3KFU F;  2EAN A;  4Q8F A;  5J0R A;  3OJS A;  4O5E A;  1J2M A;  1AQ6 A;  3C21 A;  4JWN A;  1KEJ A;  4QIW F;  1HEK A;  2NRT A;  4OO1 J;  1PZN A;  4DFK A;  1T8E A;  3LDA A;  2OWO A;  1FO4 A;  2MUT A;  2E8N A;  4RQ7 A;  3SR6 A;  5KL8 B;  4J9N A;  2J6S A;  4PZN A;  1UQV A;  1LB2 B;  5KFP A;  4DL5 A;  1K5O A;  2DQN B;  8ICQ A;  5ALJ A;  2LBO A;  2ASD A;  3V6K A;  1SL1 A;  4P0Q A;  5B66 U;  1L5U A;  3C2K A;  1WWU A;  1L3U A;  1ZYQ A;  2P66 A;  4JWM A;  5AM3 A;  4I28 A;  4PHE A;  1ZJM A;  2WTF A;  1V85 A;  3KHG A;  1S5L U;  9ICG A;  5J29 A;  9ICT A;  4MFA A;  5EE0 A;  3CW2 C;  1RXV A;  5C0Y A;  1KFT A;  4FBU A;  4NLK A;  1X40 A;  4ACO A;  1HIW A;  2VIX A;  2G5H B;  3K75 D;  4DS4 A;  2KHV A;  4GC6 A;  4F2R A;  1YZ7 A;  3GU3 A;  4GFJ A;  5HML A;  5BOL A;  3K1R B;  5DG9 A;  4NV0 A;  4PGQ A;  3PMN A;  2F2A B;  1ZQC A;  2CN1 A;  2P6U A;  4PJ0 U;  4DLE A;  4CCH A;  4ZOH C;  3GZF A;  2BPF A;  3HPO A;  1NJY A;  1S9F A;  3ZDE A;  5HNK A;  3AQF A;  2GWS A;  2AGP A;  4CNQ A;  4MEX A;  1URJ A;  4RT3 A;  5DQI A;  3V6J A;  4OJO A;  4KLH A;  4ECU A;  2XCP A;  4OD0 A;  1SWV A;  2ZJA A;  5KFQ A;  2EZY A;  4RQ5 A;  1JAL A;  4KLM A;  2NRV A;  4G9B A;  5F9N A;  2CRX A;  3QYP A;  4M9G A;  2B0C A;  1JIH A;  2R8H A;  5DQG A;  3DEE A;  2KFN A;  2Y1I A;  2KK0 A;  2UVV A;  2G09 A;  3PNC A;  4B6J A;  3ONN A;  1FEZ A;  3GDX A;  2R8G A;  4ELT A;  3EZ5 A;  1XNS A;  5L1K A;  2F44 A;  1B43 A;  2PFQ A;  2HHV A;  2QB0 A;  4QWC A;  4KX5 A;  3AL0 B;  3TI0 A;  3DDH A;  5KG0 A;  3BS7 A;  3F2C A;  4J9K A;  3TAD C;  1JX4 A;  3EPI A;  3QZ8 A;  5KFT A;  5AKG A;  4DO9 A;  1L7O A;  2XI9 A;  5AK6 A;  5KFO A;  4ED8 A;  1SB3 C;  4I29 A;  1K1Q A;  4R65 A;  4CF3 A;  5J2D A;  9ICW A;  2H5X A;  3TQ1 A;  4C4S A;  2AU0 A;  8ICX A;  2JEG A;  1D8B A;  3KBB A;  4GLX A;  3FAH A;  2JZB A;  3M1Y A;  5KFF A;  2IBK A;  1PK1 A;  4DFM A;  5JUM A;  4YQW A;  5HHH A;  9ICS A;  2A1J A;  4OCZ A;  3PV8 A;  5EOZ A;  2V4R A;  1KTQ A;  2BPC A;  3OSP A;  2KIV A;  2F8L A;  3LK9 A;  2K8C B;  2GOL A;  2EAM A;  4DS5 A;  3TAR A;  1U47 A;  4DL2 A;  3ETR A;  2KIC A;  2BCU A;  1S0O A;  2HW3 A;  1JRP A;  2F1J A;  3MR3 A;  4EX6 A;  1ZQB A;  4F93 B;  4CRX A;  1UT5 A;  4P0P B;  4QJF B;  4GIB A;  3NGD A;  4F4W A;  5ALH A;  1YZ6 A;  1Z1B A;  4UB8 U;  2PFO A;  4I27 A;  4OJL A;  1VJ5 A;  3MGI A;  1RG6 A;  1KKX A;  4PGX A;  4ECV A;  4QIW C;  1FFV A;  3H40 A;  2LM1 A;  2I1Q A;  2MAX A;  1X2I A;  3PSP A;  3FDS A;  5H2F U;  4AYB F;  2EZX A;  3H4D A;  4LZD A;  2E3T A;  4DF4 A;  1U48 A;  3G6V A;  4C8M A;  8ICC A;  4ECY A;  2MUT B;  1ZJN A;  3KZI U;  2R8K A;  5TZV A;  2DF4 B;  2VKQ A;  2BDP A;  3FYH A;  4IQW A;  3OHB A;  3IP4 B;  2BCR A;  1VLB A;  2RHF A;  3RB3 A;  5DBB A;  2OHF A;  3IV6 A;  3BQ2 A;  5J0S A;  2ASL A;  3WKC A;  4P0Q B;  3T5K A;  2ZUC A;  2ZXI A;  5CR0 A;  8ICV A;  5EE9 A;  2M9N A;  1N62 A;  5KG5 A;  4RQ6 A;  1D9F A;  2HBM A;  4FZN A;  5ALU A;  3NVW A;  5K4L A;  4B9N A;  3D2N A;  5EWE A;  3PX4 A;  1B22 A;  4B9V A;  4C7Z A;  5DB8 A;  5D46 A;  4QZI A;  4NLC A;  4RNO A;  4O9M A;  3NVY A;  4XRH A;  4ED0 A;  4PHP A;  5AIA A;  5D49 A;  4TUS A;  4I2B A;  3H7I A;  3F2B A;  5IIJ A;  5KFU A;  4ELV A;  4QW8 A;  5L1M A;  2C28 A;  1MQ3 A;  3R9K A;  3E0F A;  4XA5 A;  4TQR A;  1IV8 A;  3QU5 A;  5A0L A;  2W43 A;  2W9B A;  3BQ7 A;  2W8L A;  3KOO A;  4Q8E A;  5HMM A;  2XY7 A;  3SZ2 A;  2OM6 A;  2NO5 A;  4O3O A;  2VJ5 A;  1JI7 A;  3BZC A;  2IOH A;  2RLT A;  4RPY A;  4UBC A;  2EAO A;  5CHG A;  4Z6C A;  2PI5 A;  9ICL A;  2DKZ A;  4Q45 A;  2B21 A;  4USA A;  1A77 A;  1Z4O A;  4F5R A;  4RQ4 A;  3LVV A;  1HJP A;  1X9W A;  4GXK A;  4M0A A;  3RB0 A;  1UA0 A;  3PW4 A;  2EZZ A;  3T5H A;  3WK6 A;  1X6J A;  2BQ3 A;  3BZK A;  9ICO A;  3ZD8 A;  7ICR A;  2BQU A;  5AI9 A;  3L5K A;  3HJE A;  4PZO A;  5ALP A;  4FO6 A;  1WWV A;  5ALL A;  1KQQ A;  2ZUB A;  4BGD A;  2XCA A;  3N7P D;  5JTI A;  5J8Y A;  4F92 B;  3T79 A;  4QZF A;  9ICV A;  2YY6 A;  3F53 A;  2LYA A;  2IA6 A;  1DK3 A;  3V7L A;  4EX7 A;  3RB6 A;  3SAH A;  5KFE A;  2JHD A;  1DK2 A;  4CE6 A;  4J9S A;  1PK1 B;  3GFK B;  4NLZ A;  4RT2 A;  2HBK A;  5KFV A;  4IR9 A;  3HKZ F;  2OYY A;  2AH5 A;  4DFJ A;  2DPI A;  4I2H A;  4R66 A;  3MDA A;  3JPN A;  1SIJ A;  2ZIX A;  2Y0S F;  4Q44 A;  8ICM A;  3SYZ A;  5CEH A;  1VDV A;  3JPO A;  3I1Y A;  4TUP A;  4M47 A;  3QUT A;  1KFD A;  4XUS A;  5CA7 A;  3RB4 A;  5E79 U;  3NAS A;  2K4I A;  3QE9 Y;  1BGX T;  2DFL A;  5EWG A;  3QU7 A;  4DQI A;  4AYB C;  2IMW P;  2ZIV A;  2CXY A;  3OGU A;  5DLG A;  2BCS A;  4IQV A;  3T5J A;  3V6H A;  8ICB A;  3M9N B;  2IHN A;  5ALV A;  4F2S A;  3QX7 A;  3TAD A;  1WCL A;  2NYV A;  4DL3 A;  2F8K A;  1DRG A;  1SL0 A;  2BQR A;  3PR5 B;  5KFM A;  3A0H U;  1Z4N A;  1ZQK A;  1WYG A;  5KFW A;  2FLL A;  2H3F A;  4J9Q A;  4A8E A;  4FS1 A;  3B0X A;  3FC4 A;  9ICN A;  4KLD A;  4ECQ A;  4IS7 A;  2JV3 A;  1YT3 A;  1SKW A;  5HR6 A;  3MDC A;  4QZD A;  4IRC A;  1COO A;  4FBT A;  3NVZ A;  3ZDD A;  2KVS A;  7ICJ A;  3S6J A;  2WAQ C;  2PKE A;  4RQ2 A;  2ZTC A;  2BHN A;  3EW9 A;  2P35 A;  3RRG A;  5J0P A;  1LV5 A;  7ICO A;  4B9L A;  5AI8 A;  1PUZ A;  4F8R A;  3SD7 A;  1ZQU A;  2W11 A;  4EBD A;  3KHH A;  1IXR A;  2HSZ A;  4NLB A;  5III A;  1ZQV A;  3JPS A;  2HMX A;  3Q8L A;  7ICH A;  4KLJ A;  3N28 A;  4DWI A;  2VA8 A;  5D4B A;  3RH4 A;  5EE1 A;  3T3F A;  1QSY A;  8ICG A;  1X6I A;  3RR7 A;  1X9S A;  4RQ3 A;  1XSN A;  2J6U A;  4ECS A;  4US8 A;  1QQ5 A;  4LZG A;  5CRX A;  4J9P A;  1KW4 A;  1S8O A;  1SZP A;  5AM1 A;  2KZZ A;  3MR6 A;  3WK8 A;  2LYH A;  1RZT A;  3ISC A;  5KFD A;  4YVZ A;  5KT7 A;  2QLT A;  3RFA A;  5J0X A;  3HIL A;  4I2G A;  4KMU A;  4YCX A;  4M9L A;  5DB6 A;  5KT4 A;  4KLL A;  4GC7 A;  3TAN A;  3M7D A;  4FS2 A;  3H8S A;  2RDI A;  3LWM A;  1DXS A;  2KMD A;  7ICM A;  3JPR A;  5J0T A;  4YXJ A;  4YMO A;  2WB1 C;  8ICH A;  1TK8 A;  2E8P A;  1SKR A;  9ICH A;  3UXO A;  2KJ9 A;  4HAI A;  2YQE A;  3Q8Q B;  4QZ8 A;  5J0Q A;  8ICZ A;  5J2B A;  4QZG A;  4KTQ A;  1ZQR A;  1N5W A;  2FI1 A;  3L4P A;  5ALE A;  3NTU A;  1ZD4 A;  1F5S A;  5DB9 A;  4LJX A;  4J03 A;  4Y2P A;  2NV3 A;  2K89 A;  2ZIU B;  2ZJ5 A;  2R8J A;  3QUB A;  2W55 A;  1PVQ A;  2YN4 A;  5AI5 A;  4F4Z A;  2GO7 A;  4QWA A;  3PW7 A;  1A6S A;  3QU9 A;  2DGZ A;  4ZH4 A;  1T4G A;  2D8C A;  4Z6D A;  3LWL A;  3Q8K A;  3PSF A;  4P4P A;  2ODG A;  2ZXH A;  1XC9 A;  4FE3 A;  5ALI A;  3UM9 A;  3BQT A;  1CEZ A;  2HHU A;  3GQC A;  2Y0S C;  3PW0 A;  4P4O A;  5C5J A;  2JMG A;  5KFC A;  8ICF A;  3QXG A;  3EYZ A;  1N5X A;  5J2F A;  1XS9 D;  1KN5 A;  1QTM A;  2KV2 A;  1NJX A;  3BS5 A;  5CWR A;  5DGA A;  8ICO A;  2LKY A;  1NK5 A;  3M8S A;  2K4H A;  5KFH A;  4RZR A;  3TFS A;  2WFA A;  5JRT A;  4C4R A;  4M9J A;  2ZIX B;  7ICL A;  4DQQ A;  2OCE A;  4EYH B;  4KN7 A;  3QUC A;  4UW9 A;  2WHE A;  4JMU A;  5ALY A;  3JPT A;  2AQ4 A;  3RRH A;  2AGO A;  1ZQS A;  3NRW A;  1U9L A;  3WU2 U;  4MHV A;  4I2J A;  4OJ6 A;  2PFN A;  4QWE A;  5ALF A;  2K4P A;  3ORY A;  2HOI A;  7ICV A;  4J9L A;  2E8M A;  3O0F A;  1NZP A;  2ZIV B;  4UAR A;  3ZI4 A;  4Y2V A;  4O3R A;  2OXO A;  1T3N A;  1L3S A;  4ELU A;  4QZC A;  1N2X A;  4PHD A;  9ICK A;  3N7R C;  5KG2 A;  9ICQ A;  5DDY A;  4YG2 A;  7ICN A;  3IDW A;  2KKV A;  4UAW A;  5BOM A;  4DF8 A;  3CP8 A;  2KNJ A;  3N4M B;  3QEA Z;  2O6K A;  3ZD9 A;  2F3N A;  2KP7 A;  2PMZ F;  1ZET A;  4Y2S A;  4I2D A;  4R8U A;  4GXI A;  3PO5 A;  2KHQ A;  4KLO A;  1UCV A;  1ZQF A;  1D8Y A;  2BKE A;  5AK5 A;  5DBA A;  1TKD A;  3CNH A;  3EUB 2;  4O3Q A;  2XY5 A;  5L1L A;  3HT3 A;  2JEI A;  1MQ2 A;  4NXZ A;  2C22 A;  4NWI A;  1NK8 A;  1HUO A;  2AJQ A;  5ALN A;  1PK3 A;  3F2D A;  1ZD3 A;  9ICU A;  3V7J A;  2JGA A;  8ICL A;  4EEY A;  1L8L A;  3EWA A;  2FLP A;  3G6Y A;  2DPJ A;  2LHT A;  4F72 A;  2G07 A;  2PI4 A;  3EPG A;  3PVX A;  2C2D A;  4DSF A;  3KHL A;  3IRU A;  5J0U A;  3KTQ A;  5ALD A;  2KTQ A;  3QU4 A;  3RAQ A;  4EEK A;  1PVR A;  3PX0 A;  3T5L A;  5F3X B;  2FPM A;  3KKA A;  2JEJ A;  4J9O A;  4JV0 A;  2Z7J A;  1Z3E B;  4Z6E A;  3SMV A;  4AP9 A;  3H8W A;  2IOF A;  1DOQ A;  4DFP A;  2KFZ A;  1SGG A;  1Q8K A;  1NJW A;  4M9H A;  7ICG A;  3MFH A;  4BJQ A;  1TK5 A;  2YML A;  4IC9 A;  2VA3 A;  4O3S A;  2WF8 A;  2KD1 A;  1MC8 A;  9ICC A;  5KG7 A;  2OH2 A;  3WKA A;  3RJF A;  2RP5 A;  3THV A;  1ZOL A;  4KLG A;  2HHQ A;  2R18 A;  3ED5 A;  4CF4 A;  4ED2 A;  4K4H A;  3U26 A;  5FP0 A;  2HI0 A;  4UBB A;  4O3M A;  3AQE A;  1N63 A;  2VJ4 A;  1RM6 C;  3TAC B;  2W9M A;  3GV5 B;  4YD1 A;  5ALQ A;  3RF9 A;  2KE7 A;  2J6T A;  2I9G A;  4QNL A;  2FE9 A;  2WF6 A;  3OPX A;  3WKD A;  1ZQL A;  4ED1 A;  1NK7 A;  4QZ9 A;  4C8K A;  3ICX A;  5B5E U;  1QLN A;  1JXE A;  1ZQT A;  3N97 B;  5J0W A;  3CYM A;  4RQ8 A;  1S0V A;  4KN4 A;  5J2J A;  2JR5 A;  2QB1 A;  1T7P A;  1ZD5 A;  1ED1 A;  4ECW A;  4DQP A;  5AKX A;  1ZXI A;  1ZQI A;  1SXD A;  5KFS A;  4UAU A;  3JPP A;  4MFC A;  1NK0 A;  1BPE A;  4KLS A;  4QZE A;  1IIP A;  3BS5 B;  3AU2 A;  3GIM A;  3I76 A;  9ICR A;  3GIJ A;  5KT3 A;  4UAY A;  2W9C A;  4CDG A;  4F4K A;  5DLF A;  4P4M A;  1DGJ A;  1TFR A;  5AKK A;  5AM5 A;  2XVT A;  4YD2 A;  4DSE A;  1X66 A;  4B9U A;  3PML A;  1ARO P;  2FPK A;  5DB7 A;  5KAI U;  3H0R B;  3OTQ A;  5J2I A;  2JH1 A;  1NKC A;  2V9W A;  1Z1V A;  4J9M A;  5ALW A;  3TAP A;  4UB4 A;  4DSK A;  2BPG A;  3MBY A;  2EDU A;  2QKQ A;  2ZIW B;  2FMP A;  4NM1 A;  1LKY A;  5L9X A;  2UVW A;  2PMZ C;  2BCQ A;  3LYS A;  5AKH A;  3SEN A;  2ZIU A;  2HHT A;  3H8M A;  4RQ0 A;  3AUO A;  5AK4 A;  3VCB A;  4DSJ A;  1TAU A;  1N48 A;  1X9X A;  1BPZ A;  2YMQ A;  3IG5 A;  4EBE A;  4DSL A;  2VA2 A;  3SAG A;  5KFJ A;  5CB1 A;  2F1H A;  3IHQ B;  4R8U B;  1A76 A;  5L1I A;  2EAP A;  3PR4 A;  4NLG A;  1MN8 A;  1BPY A;  5KT6 A;  3SQI A;  2AQ0 A;  2RRD A;  1SZH A;  5KFL A;  4DFD A;  4YR3 A;  1RQN A;  5J0Y A;  1ZQD A;  4C8L A;  1T3Q A;  4NY8 A;  4HYK A;  1RYR A;  3RBD A;  2KIW A;  4MF8 A;  2F77 X;  4X5V A;  3J81 j;  7ICT A;  1Q46 A;  3JPQ A;  2AHO B;  1JUD A;  2V4Q A;  1NZB A;  3RTV A;  4YR2 A;  2A1A A;  2FJ6 A;  1SXE A;  3AN1 A;  3IG8 A;  7ICE A;  5KTQ A;  2HDO A;  3E58 A;  2ISP A;  2ZTD A;  1ECW A;  4UB3 A;  1IM4 A;  4ICA A;  1QCK A;  5J0O A;  1ZQW A;  4ECZ A;  5EE3 A;  1L6N A;  1ZQO A;  1QSS A;  5DGB A;  2Y9U A;  4J9R A;  7ICI A;  3E2E A;  2UVR A;  1ZD2 P;  8ICP A;  4EZ6 A;  4UAZ A;  1N61 A;  5AI0 A;  3KHR A;  4IR1 A;  1ZQX A;  2HBJ A;  4BWJ A;  4MFF A;  4PGY A;  1ZQH A;  1Z00 B;  4KLT A;  3MGV A;  2HHW A;  3NVV A;  3QZ7 A;  4I2C A; 
#chains in the Genus database with same CATH homology
 3K1R B;  5J8Y A;  2F3N A;  4NL9 C;  2K60 A;  3SEN A;  1SV0 A;  2KIV A;  3H8M A;  3TAC B;  5KNI A;  1SV0 C;  1UCV A;  2LMR A;  4NL9 A;  4RQM A;  1OXJ A;  2KE7 A;  1X9X A;  2EAM A;  1PK1 B;  2L5Y A;  2FE9 A;  1B0X A;  2KG5 A;  1LKY B;  2D8C A;  4RQN A;  1PK3 A;  1COK A;  5JTI A;  1OW5 A;  2D3D A;  2EAP A;  2Y9T A;  2ES6 A;  2KSO A;  5L1M A;  2B6G A;  2ESE A;  1F0M A;  3KKA C;  1RG6 A;  1V38 A;  2QB1 A;  2EAN A;  3BS5 A;  3BQ7 A;  2QAR A;  3SEI A;  2YTU A;  1SV4 A;  1JI7 A;  5JRT A;  1SXD A;  2E8N A;  1KW4 A;  2EAO A;  2KSO B;  5F3X B;  1SXE A;  3KKA A;  2DKZ A;  2E8O A;  4PZN A;  1UQV A;  3BS5 B;  2QB0 B;  2QAR B;  2F44 A;  4MHV A;  3HIL A;  2QB0 A;  3TAD A;  3BS7 A;  1WWU A;  2K4P A;  1SGG A;  3TAD C;  2F8K A;  2GLE A;  1DXS A;  2KMD A;  2DL0 A;  2E8M A;  2Y9U A;  1X66 A;  5J8Y C;  2E8P A;  4NJ8 A;  1V85 A;  5JU5 A;  4PZO A;  1Z1V A;  3IDW A;  4IS7 A;  1X40 A;  1WWV A;  2JV3 A;  2DKX A;  2LPE A;  1PK1 A;  1B4F A;  2QKQ A;  1LKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...