2D3DA

Crystal structure of the rna binding sam domain of saccharomyces cerevisiae vts1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
83
structure length
83
Chain Sequence
SMNPKSLTDPKLLKNIPMWLKSLRLHKYSDALSGTPWIELIYLDDETLEKKGVLALGARRKLLKAFGIVIDYKERDLIDRSAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The NMR and X-ray Structures of the Saccharomyces cerevisiae Vts1 SAM Domain Define a Surface for the Recognition of RNA Hairpins
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords Vts1 protein
total genus 32
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2005-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2d3dA00
1B4FA 2E8PA 2FE9A 2B6GA 1SXDA 1RG6A 1OXJA 2DKZA 1V85A 3BQ7A 4PZOA 2E8NA 2LPEA 3BS5B 5L1MA 3BS5A 2ES6A 4RQMA 1B0XA 2K4PA 2QARB 2K60A 1LKYB 1SGGA 2QARA 1SV0C 2LMRA 1PK1A 4MHVA 1X40A 3BS7A 1SV4A 1UQVA 2EAPA 2KMDA 3TACB 3KKAA 2QB1A 3H8MA 1COKA 1F0MA 5JTIA 1PK3A 2E8OA 2QB0A 2EAMA 2KE7A 4NL9C 4NJ8A 2F44A 5KNIA 1WWUA 5J8YC 4PZNA 3K1RB 4RQNA 2GLEA 1WWVA 3SEIA 2EANA 2F8KA 2QB0B 1DXSA 1LKYA 1UCVA 5JRTA 1KW4A 1OW5A 2DL0A 1PK1B 3TADC 5J8YA 1X9XA 2Y9UA 2KG5A 5F3XB 2KIVA 2L5YA 4IS7A 4NL9A 3IDWA 2KSOA 1SV0A 1V38A 2EAOA 2Y9TA 2E8MA 1Z1VA 2D3DA 2F3NA 2QKQA 1X66A 3SENA 1JI7A 3TADA 2YTUA 2ESEA 5JU5A 3KKAC 1SXEA 2DKXA 3HILA 2JV3A 2KSOB 2D8CA
chains in the Genus database with same CATH superfamily
2KZ3A 3UXOA 2R8IA 4C0ZA 2MUTA 2B6GA 3C29A 5KFSA 3H0LB 3RAXA 3C2LA 3AN1A 4Y2UA 5FP0A 5J2EA 1X9SA 1WYGA 4RQ4A 1KQQA 4ECWA 2JR5A 2W54A 1UPHA 8ICPA 2G5HB 4PL1A 3QX7A 3H0MB 5AIAA 5EWGA 1ZQGA 4R64A 4PHPA 1COKA 4FZMA 3SV4A 9ICGA 2IOHA 3T5JA 1S0MA 4Y2QA 4RQ8A 1LV5A 2XICA 2UVVA 4O3NA 2XC9A 4PZNA 2G09A 4FZNA 2ZJ5A 4F50A 3V6HA 1DXSA 5GTHU 5JRTA 3MDAA 3I1YA 4O5KA 2FMSA 1A76A 1L3TA 3PW0A 2F77X 4IQVA 1IV8A 2AHOB 5KG6A 5KFOA 4F5QA 4F3OA 1BNPA 4UB8U 4PJ0U 3ED5A 4DSKA 5ALOA 4P0QA 4ED2A 4QZEA 5KFNA 5KT2A 2AU0A 5G5GA 2H3VA 2D3DA 2KVCA 4B9LA 2KJ8A 3OTQA 2ESEA 5L1LA 4KLIA 1QSYA 3T5HA 3PO4A 2EDUA 3BQ7A 2E8NA 5J2KA 3SI8A 3C21A 3DDHA 4I2AA 3ZD9A 4JMUA 5L1MA 4KLHA 3CNHA 3UXNA 4QZ8A 4YCXA 3T5KA 2YN4A 2M0NA 1S76D 1XO1A 5J2HA 1L8OA 2KOBA 5J2JA 2BGWA 3H4DA 1L3SA 9ICQA 1U48A 2K4EA 4Y2XA 3RTVA 1JRPA 5F9NA 4PGYA 3RJEA 9ICXA 3T3FA 2BQRA 4Y2RA 1F0MA 1UA1A 9ICCA 2IOFK 9ICNA 1N5WA 4NL9C 1NJZA 4B9NA 4KLFA 2KEYA 4B9VA 2A3VA 5HMMA 3BQ1A 4EBEA 3T79A 4OJOA 5KFGA 3OHAA 2RHFA 2FMPA 3QUCA 4UAVA 2P66A 5CB1A 4J9QA 2ZTCA 2KICA 1CUKA 2ZJAA 4LZDA 2ODGA 2Q0ZX 2GOLA 5ALXA 2HMXA 5AM1A 3ZDCA 1ZXIA 5KT4A 4Q43A 5EE9A 5J0TA 4ELUA 3KOOA 1T94A 1QSLA 2XIDA 3K1ZA 4RQ7A 5AKEA 3PW4A 3FDSA 2ZG6A 3D6JA 3H40A 3GIJA 4F91B 4PHEA 1IIPA 2HBMA 5JU5A 1Z19A 3KKAC 5GTIU 1BPYA 3IHQB 2KSOB 4DLEA 3LVVA 1B4FA 1QH9A 5KG3A 1NK9A 2WAQF 2CXYA 4F5RA 4R66A 3IG8A 4UAUA 4BXOA 3N7SC 4I2HA 3I28A 4BUGA 4KLJA 3Q8QB 4NLGA 5KFKA 2JEFA 4P4MA 3AMZA 4DSEA 1Z1BA 3HWTA 2XCAA 2RDJA 3CW2C 1VLBA 1BGXT 3NS1A 4EZ6A 4C4TA 1BPXA 3RB3A 4DQIA 1B22A 4DL4A 4ECUA 4NJ8A 3QYPA 2F44A 5J8YC 5DLGA 3M8SA 3UM9A 3PMNA 4CNQA 2ZJ8A 4Q45A 2F8LA 5KT7A 9ICAA 2WTFA 3UMGA 4O3OA 2HHWA 1U9LA 7ICJA 2G08A 5ALGA 4FS2A 3WK8A 5KFXA 8ICHA 3ALRA 3Q8LA 5J29A 3GV8B 1KN5A 3QU4A 3NVVA 4YR0A 4CRXA 1ZQRA 3DEEA 2VJ4A 3M1YA 2I9GA 1TFRA 3H8SA 1S77D 4EELA 4JV2A 3QZ8A 3BZKA 4JUZA 2JRZA 2E8MA 3M6KA 2H3IA 3WK7A 5D46A 2F3NA 5AKZA 3SENA 3RJGA 4NLBA 4RPXA 1SXEA 3MGHA 2KV2A 2W11A 1IXRA 3AQFA 4ICAA 4YP3A 1RZTA 2FLNA 4TQSA 1NJXA 3V7JA 4RU9A 4J9PA 3F2CA 7ICMA 2PFOA 3C5FA 4KLQA 4C4RA 1MA7A 3RR8A 4PGXA 2OM6A 3C2KA 5AKHA 4TUSA 5CP2A 1NJWA 4TUQA 8ICEA 1RM6C 3GV7B 4YMMA 4GXJA 4RQ0A 5KT3A 4DF8A 4XA5A 3FAHA 1YT3A 2KIWA 2GH1A 2W9CB 3RJHA 4C8KA 2J6SA 2KMDA 1KL9A 3UMBA 4YN4A 2XY7A 4QWCA 3QUTA 1ZQPA 5C0YA 2H3QA 4P0PA 7ICVA 1KRPA 4YG2A 8ICTA 5HR6A 2JZBB 3QNMA 1RYSA 3UQ0A 4EBCA 1N48A 8ICBA 1P7DA 7ICEA 5DLFA 4RPYA 1D8LA 3B0XA 3NRZA 4UBBA 9ICRA 3Q8MA 2EH9A 5AM3A 2BKEA 4XRHA 5L1JA 1PVQA 2KP7A 1X9XA 2H3FA 3SYZA 4DOBA 1ZQVA 2OCEA 1X42A 1XC9A 3KHRA 4B9UA 3IM1A 4DQRA 3ZI4A 5HHIA 1Q3VA 1S8OA 5EE0A 2BDUA 2ZIUA 8ICIA 5AKLA 4J9MA 1HUZA 7ICHA 1S0NA 2AJQA 2HVIA 4Z6EA 4RZRA 5KAIU 4YR2A 3ORYA 5KT5A 1ZJNA 2HHSA 1QCKA 2CPRA 4ECVA 4RQ1A 1XSPA 1NKCA 3PR4A 1DK2A 5ALEA 3EPIA 4US9A 3MFIA 4DOCA 5J0OA 2Y1JA 4YR3A 3KHGA 4J9SA 4F71A 4KLEA 4BXOB 3RAQA 1FFVA 5ALYA 3AUOA 2B0CA 2HHVA 4USAA 1J97A 2P6RA 8ICSA 2PFQA 3D2QA 4QZCA 2KVSA 5ALKA 1Y88A 2ZIXB 4F93B 4EEKA 1TAMA 3MABA 4J9RA 1SV4A 1L7NA 5KFMA 1NJYA 2FJ6A 9ICJA 1SKSA 3PSPA 2MU2A 4B9MA 2W7OA 2XI9A 3EPGA 3MC1A 3K75D 5ALQA 5DBBA 4Y2YA 4Q8FA 4QNLA 5KG5A 2QB0A 2XY5A 4BDPA 1K1QA 5DG7A 1URJA 4J9OA 9ICSA 5KL8B 5CA7A 2I5HA 3QU9A 1WWVA 3BQTA 3SEIA 2EANA 1C7YA 2QB0B 3NVYA 3HX0A 4KLSA 4M2YA 4M9JA 1FFUA 1L8LA 5KG7A 4ECYA 4O5CA 9ICFA 1DGSA 3TADC 1WUDA 3M9NB 4KLUA 8ICWA 1TV9A 4NM1A 2FPKA 4QZDA 1ZJMA 2KZMA 9ICUA 3UMCA 3WK9A 4ACOA 4P0QB 4CGZA 4MF2A 3KBBA 4Y2PA 1LVHA 4ELTA 4C7YA 1RPLA 4WJ3B 1V38A 1T7PA 2IMWP 2HVHA 4YD1A 3H7IA 1NZBA 1JI7A 4KITB 2FDRA 1JMSA 1NZPA 1UT8A 2W9AA 9ICHA 4QJFB 4F2RA 4UB4A 4C8NA 1NK8A 4ECRA 1ZRNA 2EZYA 3QZ7A 2VJ5A 3N7RC 3OGUA 3EZ5A 3PNCA 2JMGA 4G3IA 4M04A 2PI4A 3BS5A 2BCSA 4AYBC 4I29A 3BQ0A 5DDMA 1BPEA 1KDHA 4GIBA 2W7PA 9ICVA 3TFSA 4EEYA 5AM2A 4I28A 2KD1A 5AM5A 4O3QA 4NXZA 4BGDA 2DQNB 7ICGA 2PFNA 2HDOA 5AM0A 2ZIWA 1N5XA 4Z6FA 4MFAA 3MBYA 3PY8A 5ALPA 5KFQA 4UB2A 4MFFA 4OJ6A 2BCQA 2EAMA 4Q8EA 1VDVA 3QEBZ 3M9MB 2W8KA 3WK6A 7ICUA 1NI3A 3FC4A 4Z6CA 5KNIA 3HT3A 2RP5A 1SWWA 2G07A 1RYUA 1UCVA 2BCUA 3SAHA 2YY6A 1K1SA 5AI0A 8ICNA 3OJSA 1RQLA 4GFJA 5J8YA 3Q8RB 4HYKA 3SQIA 8ICKA 2W03A 3S6JA 2HSZA 1FO4A 2C28A 3AQEA 5KFYA 1A77A 2W04A 4RNOA 1RXVA 1XS9D 3BQ2A 4O3MA 1N63A 1WG8A 5D49A 5KFFA 5KTQA 4DL5A 1V97A 3PV8A 2YTUA 3IG5A 1EXNA 5IILA 3MGIA 4F4XA 1H38A 3SAGA 4OJ5A 2EQYA 2E8PA 1QQ7A 4DF4A 3WKBA 3PSFA 5B66U 3M8RA 4IRDA 5AM4A 4O3RA 3CRXA 1ECWA 1XNSA 2KJ9A 5J2GA 4EENA 2WAQC 1CEZA 1ZQBA 2R18A 1N2XA 1SGGA 3MR5A 3QE9Y 2RDIA 4ED6A 4MFCA 4RQ3A 3IP4B 1QQ6A 1X40A 2A1JB 2JGAA 3DV9A 1SL1A 3MR6A 4UATA 3JPNA 3Q8KA 2JH1A 3N4MB 2HHTA 3MDCA 4FBUA 5CR0A 3IRUA 2C2EA 4KX5A 1U49A 1PVPA 2DUYA 5AKIA 2RLTA 2JEJA 3D2SA 5AK5A 1ZQUA 2PI5A 2BZFA 4F5NA 5DG9A 5EWEA 3JPOA 3GIKA 3F5EA 2DL0A 2BQ3A 4Y2SA 3SZ2A 4QZ9A 4CCHA 5ALSA 4FS1A 4P4OA 4YMOA 1N56A 4IQUA 1ZQHA 2AQ0A 2WF8A 5IIOA 7ICFA 4I2DA 4M9NA 3N28A 1JXLA 3GILA 4P4PA 3MR2A 3EYZA 9ICBA 5AK4A 4C4SA 1TAUA 4ED8A 3MGVA 1UT5A 2N1RA 1NOMA 2AQ4A 1XO0A 9ICLA 4HAIA 4QWDA 4JB3A 2IHNA 2UVWA 1NK5A 3RFAA 4DS4A 5KFTA 2HOIA 5AI4A 1JX4A 1XSNA 3SAFA 1L7OA 5CEHA 5J0PA 2MSNA 1WCLA 4PZOA 5DBAA 5EWFA 5KFIA 5AHXA 9ICPA 1KBUA 2LKYA 5AIBA 4I2GA 2K4PA 2K60A 2DPIA 4DSFA 4M9HA 2KZZA 1MQ3A 1ZQTA 2JXJA 5CHGA 2OXOA 3M9OB 3BS7A 2WB1C 4LVSA 3LVWA 4IC9A 1NKBA 3H8MA 3T5LA 2NRZA 1ZD4A 5J0QA 4F8RA 2R8GA 2IBKA 3Q8SB 1M6YA 3PZPA 4NLZA 5DG8A 3CP8A 4KLDA 8ICLA 1S0VA 4KX3A 3LYSA 2BPCA 1DGJA 2PMZF 2ASDA 2XY6A 5KFCA 4DQPA 3TAQA 3AM9A 5DB6A 2NV3A 4B9TA 4Y2TA 1NKEA 4UASA 2W9BB 4DL3A 4F4WA 3PX4A 4GXIA 4NWIA 4XQ8A 4KN4A 3KD3A 4IRCA 5KFVA 5BPCA 4RNNA 4UW9A 2L5YA 3G6VA 1MN8A 2EZXA 2I6XA 3OSNA 2FMQA 1BNOA 5DQHA 3RJIA 1SV0A 3GV5B 3KZIU 4AYBF 4UAZA 1RYRA 4NV0A 2B21A 2FPLA 2VA3A 3EW9A 1PZNA 4Y2VA 4UB3A 4PHAA 2IHMA 1WCNA 3RH4A 4DL2A 4QZAA 4DFMA 5T14A 2AXTU 7ICQA 4GXKA 1U4BA 4P0PB 5HP4A 2BCRA 2RRDA 4ELVA 4M6WA 1RG6A 5ALZA 2PXIA 2NYVA 3SR6A 3HRDD 5HR7A 8ICFA 4M9GA 1SKWA 2LYAA 1HIWA 1KFTA 4GLXA 3V7KA 2EZZA 4AP9A 1X2IA 1ZQYA 2NRXA 5AKKA 1GO3F 4LJXA 5L1IA 2YMMA 4QIWC 2G5IB 2EAPA 2HW3A 2FPMA 4IR1A 4R65A 2QB1A 4G9BA 4JV0A 2KKVA 5JTIA 3VCBA 1U47A 3JPSA 1AQ6A 9ICIA 4KLLA 1N60A 2FLPA 4K4GA 1ZQCA 3C23A 9ICMA 4RQNA 1SL0A 5KL1B 2KTQA 2E1FA 2F8KA 1LKYA 3TI0A 2Z7JA 2JEIA 3QXGA 5KFWA 1OW5A 1F5SA 3ZDEA 2IA6A 4PGQA 4RQ2A 4M0AA 2A1AA 1T4GA 4DFDA 2W43A 2Q4TA 2K8BB 4CE6A 2AH5A 4IS7A 1OUQA 2WF5A 4KLOA 4Y2JA 2WFAA 4FFDA 3SD7A 5KFDA 2UVUA 1Z1VA 4R63A 3NVZA 4OCZA 4YQWA 3ISBA 4DS5A 3EUB2 1NK0A 3H0RB 5KFZA 4F92B 4CF5A 3PW7A 5KFUA 2HOQA 1JXEA 4K4IA 3RB4A 3TQ1A 1Q3UA 2YQEA 3PR5B 3F2BA 1ZQKA 1D9DA 4I27A 3VC8A 5HHHA 1ZQZA 3C1YA 1V85A 3J81j 1L5UA 3BS5B 4O5EA 1BPZA 3ZDBA 1ZQMA 2ASJA 1ZQJA 1Z00B 1ZYQA 2ZUBA 5DBCA 3OHBA 4MHVA 4DWIA 4EX6A 1LB2B 1UQVA 1A6SA 3AU2A 1RQNA 4ZH4A 4CDGA 2H3ZA 5K4LA 4KLMA 4RUCA 1N62A 3WKAA 4DSIA 2DBYA 1SIJA 2F1JA 1KEJA 2A1JA 8ICMA 5ALDA 5DB7A 2GLEA 4QW9A 1C20A 4E0DA 4F4KA 4OD0A 2HOFA 3KZXA 5IIIA 5ALHA 3GU3A 1NK6A 1L6NA 9ICEA 1Z00A 4Z6DA 1MQ2A 2WF9A 4DCCA 4UBCA 4UQGA 1TAQA 4ECSA 4DFKA 5KG0A 2MAXA 4DFPA 1D8BA 3AL0B 3FM9A 2VA2A 5AI9A 2JH7A 2G06A 2HHXA 1HEKA 2WHEA 3ETLA 3SMVA 3RF9A 5B5EU 4QWBA 1QQ5A 2DF4B 2NRTA 3L4PA 3E58A 1K5OA 2LBOA 5KFHA 2Y0SF 4TUPA 1SZPA 3GIMA 4RQMA 3ISCA 1JN3A 4CF3A 4PL2A 3RRGA 3LWLA 1T3QA 2YMLA 5J2FA 4O9MA 3QU5A 3A0HU 3NASA 5DDYA 2LMRA 4IRKA 2YB4A 1RXWA 5F9LA 2PKEA 2VKQA 4FZLA 2ZUDA 4U7CA 1F44A 5KG4A 4FE3A 4DSJA 1JALA 4MEYA 2KE7A 3PX0A 4QWEA 2WB1F 4OO1J 8ICUA 2ZIVB 3GDXA 4UB1A 2ZIUB 5KFRA 4O0IA 2YMQA 2DFLA 8ICYA 8ICJA 3G6YA 1Q46A 5CWRA 2OYYA 4IL6U 2J6TA 4NM2A 4ED0A 5IINA 4I2IA 4J9KA 1ZQAA 2AGOA 2V4RA 2ISPA 2AGQA 4C8LA 4F4YA 2E1EA 2BPGA 4OJPA 2V4QA 2VANA 4XUSA 5E79U 2RQ5A 1UHUA 2F76X 2K8CB 2KG5A 2O6KA 1HUOA 3AEVA 1S5LU 1KSPA 3SV3A 4UARA 1NNLA 2XO7A 2H5XA 5F3XB 2DPJA 3RH5A 5KG2A 4DL6A 5J2CA 1SL2A 1SB3C 2HBKA 1COOA 2R8HA 1CRXA 3WKEA 2ZIVA 1A0PA 5KFAA 2JV3A 2GWSA 2Y0SC 2BPFA 1T8EA 4UAWA 5AKGA 3PO5A 4RT3A 4M47A 1O03A 5J0UA 2KJ5A 3UXPA 4ED1A 2YB1A 4RPZA 1ZQDA 4BWMA 2DWQA 2DGZA 1JROA 5L9XA 3ZD8A 1BPDA 5ALIA 2J6UA 5AI5A 1Z4OA 2QARB 2XGPA 4DOAA 5A0LA 1ZD5A 1SV0C 3GZFA 1TE2A 2NO4A 7ICTA 3JPPA 4JWMA 5AICA 5ALTA 2XCPA 3E2EA 1KKXA 4J9NA 3MFHA 4LZGA 8ICRA 2ALZA 5H2FU 3RJFA 2LYHA 4QIWF 4U6PA 3NUQA 3PSIA 4IR9A 4RNMA 2NRWA 3K1RB 2LM4A 3FYHA 4ED7A 1ED1A 1ZD3A 3PX6A 1TK5A 3V72A 4J9LA 1KW4A 2R8JA 4BWJA 1QLNA 1T3NA 2W55A 1Z4NA 3LWMA 1PK1B 4YMNA 2BQUA 1D9FA 1J2MA 2Y9UA 1S0OA 4EBDA 2KK0A 5AK3A 5HMLA 4EYHB 1XSLA 5BOMA 1SWVA 2ZTEA 1Z3EB 3RH6A 2HCFA 3ETRA 3HP6A 2P35A 5KFJA 1HJPA 2AGPA 4C8OA 1XWLA 3NGDA 3V6KA 2ZIWB 1ZQIA 3WKCA 3NRWA 3QUBA 2ZTDA 4QZBA 2OH2A 1ZQ1C 4UB6U 1B43A 3QU7A 1OXJA 4DO9A 4KN7A 2W8LA 2V9WA 5ALUA 5JUMA 5IIKA 2ZXIA 4I2JA 4M9LA 1SKRA 2PFPA 2HBJA 4NY8A 1ZETA 4C7ZA 5KT6A 4ZOHC 3N97B 4DEZA 3JPRA 3TACB 1X6IA 4QWAA 2HHUA 3H8JA 1UA0A 2W3RA 1DRGA 8ICXA 2LM1A 5AK6A 3C2MA 4IQTA 5J2BA 3HKZF 9ICOA 3KFUF 2FLLA 1PUZA 4UAYA 1FEZA 1V9PA 2XGQA 3HKZC 3THVA 3RB6A 5ALVA 3IV6A 4I2EA 1ZQEA 4F5PA 1L3VA 4B6JA 3HPOA 2OEHA 2F1IA 2CRXA 4ECXA 4DQQA 4YXJA 5DGBA 3UPQA 3IDWA 4DFJA 8ICCA 4M6WB 2JZBA 3RR7A 5KFEA 3QU2A 2C2DA 4KLTA 1N61A 4QZHA 3TADA 4MF8A 4YD2A 2K4IA 4RQ6A 2MA1A 5J0RA 8ICQA 5J2IA 2UVRA 2I1QA 1FIQA 2A19A 1CI4A 9ICWA 4DL7A 3RBDA 2P6UA 2ZIXA 1TK0A 3N7PD 3TANA 3GQCA 2LYBA 4FBTA 8ICAA 3IN5A 5AKJA 5ALNA 2LPEA 1KFDA 2W9CA 3TARA 1BPBA 2HHQA 3WKDA 1L3UA 1ZQOA 2ISOA 1B0XA 1YZ6A 3GIIA 5TISU 2KFZA 3A0BU 2QARA 4A8EA 8ICZA 4YFKA 2M9NA 4I2CA 2FI1A 4GC7A 5DB8A 3L3FX 1ZQSA 1NK4A 2E3TA 3B0YA 4ECZA 4TQRA 3TKAA 1NK7A 3C1ZA 3LDAA 1ZQXA 5G5HA 9ICKA 4EX7A 4RUAA 2F1HA 3V7LA 3TFRA 4QZGA 5DQIA 5DB9A 1JUDA 2K4HA 7ICOA 1ZOLA 3OSPA 5ALMA 5KAFU 3KHLA 1L7MA 3PVXA 3PSTA 1ZRMA 2F2AB 4RT2A 1AROP 5ALFA 2C2RA 5J0WA 3QUQA 2KFNA 3RBEA 2BCVA 2W3SA 4NL9A 4JV1A 2ATLA 2KSOA 2OHFA 5KG1A 3ZDAA 4ECTA 1J2NA 5IIMA 2QKQA 3RB0A 1S10A 4C8MA 4F72A 2LI6A 2KHVA 4NLCA 1D8YA 4O3SA 4O3PA 1BVSA 5CJ7A 4EZ9A 7ICIA 2D8CA 4IQWA 4F2SA 4YXMA 1ZQQA 3GFKB 2VIXA 2ZUCA 3RJJA 4DQSA 3NVWA 1X9MA 2DKZA 2CN1A 4ECQA 1KLNA 1PVRA 1ZD2P 5ALRA 4GC6A 2LHTA 3H8WA 2KKPA 3ICXA 5L1KA 7ICRA 4BJQA 3C5GA 4NLKA 5D4BA 3F5AA 4Q44A 4C80A 3ONNA 4K4HA 1PK1A 3U26A 4F5OA 2GO7A 4UB5A 1X9WA 5TZVA 3KKAA 5J0YA 3B9JA 4KLGA 4R8UB 4DSLA 3WU2U 1TVAA 5IIJA 4DLGA 2E8OA 5AI8A 2JHDA 4F4ZA 3H4BA 2OWOA 2KHQA 1ZQNA 3G6XA 1DOQA 3I76A 3MR3A 2C22A 1WWUA 1YZ7A 2HBLA 5KFBA 5J2DA 4PPXA 2HI0A 3UQ2A 5J0SA 2IOFA 5KFPA 1QTMA 5ALJA 4PH5A 3M7DA 3JPTA 2NO5A 1QSSA 1O08A 4KMOB 2KNJA 2PMZC 7ICKA 1VJ5A 1S9FA 5EOZA 3KHHA 3ISDA 4YVZA 4QW8A 2WF7A 1DK3A 3WK4A 4MEXA 2NRVA 2VA8A 3O0FA 1U45A 5ALWA 5HNKA 2W9BA 7ICPA 4CF4A 5C5JA 2R8KA 3EWAA 4US8A 1ZQFA 3D2NA 4P2HA 4JK1A 2YX8A 4PHDA 4KMUA 4ED3A 3JPQA 3Q8PB 5J2AA 4EYIB 3E0FA 5DGAA 4FO6A 4OJLA 3WK5A 4R8UA 3V6JA 5DKWA 8ICOA 3QEAZ 1IM4A 2FE9A 3K4GA 1X6JA 3RRHA 4I2FA 1SXDA 2XVTA 4B9SA 1TKDA 3KTQA 7ICNA 1IG6A 1XU4A 3HJEA 2QLTA 1L7PA 7ICLA 3BZCA 1SZHA 2ES6A 3OJUA 2BHNA 1JIHA 4I2BA 1LKYB 2E5SA 1KTQA 3ZDDA 3L5KA 3PMLA 3RJKA 3F2DA 1MSWD 3BDPA 5BOLA 2K89A 3F53A 1Q8KA 1PK3A 1RDFA 2MUTB 2ZXHA 2YMPA 4JWNA 2JEGA 4NLNA 3PW2A 2Y1IA 4QZIA 2ASLA 2WF6A 3BJYA 3OPXA 2MRLA 5CRXA 8ICVA 2D6FC 2BR0A 3PW5A 5AI6A 1ZQWA 3CYMA 5ALLA 1TK8A 4KTQA 8ICGA 1S97A 2W9MA 4TURA 2BDPA 3M6ZA 1KFSA 2KIVA 3HW8A 3C28A 9ICTA 4QZFA 5EE3A 3LK9A 5AKXA 3R9KA 4BX9C 2EAOA 4J03A 2Y9TA 5KFLA 7ICSA 3AU6A 5J0XA 2KN7A 5DQGA 1ZQLA 1MC8A 1X66A 4X5VA 3NTUA 3TAPA 2DKXA 2K8AA 3HILA 5EE1A 4RQ5A 2G0AA 5AKYA
chains in the Genus database with same CATH topology
1B4FA 2E8PA 2FE9A 2B6GA 1SXDA 1RG6A 1OXJA 2DKZA 1V85A 3BQ7A 4PZOA 2E8NA 2LPEA 3BS5B 5L1MA 3BS5A 2ES6A 4RQMA 1B0XA 2K4PA 2QARB 2K60A 1LKYB 1SGGA 2QARA 1SV0C 2LMRA 1PK1A 4MHVA 1X40A 3BS7A 1SV4A 1UQVA 2EAPA 2KMDA 3TACB 3KKAA 2QB1A 3H8MA 1COKA 1F0MA 5JTIA 1PK3A 2E8OA 2QB0A 2EAMA 2KE7A 4NL9C 4NJ8A 2F44A 5KNIA 1WWUA 5J8YC 4PZNA 3K1RB 4RQNA 2GLEA 1WWVA 3SEIA 2EANA 2F8KA 2QB0B 1DXSA 1LKYA 1UCVA 5JRTA 1KW4A 1OW5A 2DL0A 1PK1B 3TADC 5J8YA 1X9XA 2Y9UA 2KG5A 5F3XB 2KIVA 2L5YA 4IS7A 4NL9A 3IDWA 2KSOA 1SV0A 1V38A 2EAOA 2Y9TA 2E8MA 1Z1VA 2D3DA 2F3NA 2QKQA 1X66A 3SENA 1JI7A 3TADA 2YTUA 2ESEA 5JU5A 3KKAC 1SXEA 2DKXA 3HILA 2JV3A 2KSOB 2D8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B4F A;  2E8P A;  2FE9 A;  2B6G A;  1SXD A;  1RG6 A;  1OXJ A;  2DKZ A;  1V85 A;  3BQ7 A;  4PZO A;  2E8N A;  2LPE A;  3BS5 B;  5L1M A;  3BS5 A;  2ES6 A;  4RQM A;  1B0X A;  2K4P A;  2QAR B;  2K60 A;  1LKY B;  1SGG A;  2QAR A;  1SV0 C;  2LMR A;  1PK1 A;  4MHV A;  1X40 A;  3BS7 A;  1SV4 A;  1UQV A;  2EAP A;  2KMD A;  3TAC B;  3KKA A;  2QB1 A;  3H8M A;  1COK A;  1F0M A;  5JTI A;  1PK3 A;  2E8O A;  2QB0 A;  2EAM A;  2KE7 A;  4NL9 C;  4NJ8 A;  2F44 A;  5KNI A;  1WWU A;  5J8Y C;  4PZN A;  3K1R B;  4RQN A;  2GLE A;  1WWV A;  3SEI A;  2EAN A;  2F8K A;  2QB0 B;  1DXS A;  1LKY A;  1UCV A;  5JRT A;  1KW4 A;  1OW5 A;  2DL0 A;  1PK1 B;  3TAD C;  5J8Y A;  1X9X A;  2Y9U A;  2KG5 A;  5F3X B;  2KIV A;  2L5Y A;  4IS7 A;  4NL9 A;  3IDW A;  2KSO A;  1SV0 A;  1V38 A;  2EAO A;  2Y9T A;  2E8M A;  1Z1V A;  2D3D A;  2F3N A;  2QKQ A;  1X66 A;  3SEN A;  1JI7 A;  3TAD A;  2YTU A;  2ESE A;  5JU5 A;  3KKA C;  1SXE A;  2DKX A;  3HIL A;  2JV3 A;  2KSO B;  2D8C A; 
#chains in the Genus database with same CATH topology
 2KZ3 A;  3UXO A;  2R8I A;  4C0Z A;  2MUT A;  2B6G A;  3C29 A;  5KFS A;  3H0L B;  3RAX A;  3C2L A;  3AN1 A;  4Y2U A;  5FP0 A;  5J2E A;  1X9S A;  1WYG A;  4RQ4 A;  1KQQ A;  4ECW A;  2JR5 A;  2W54 A;  1UPH A;  8ICP A;  2G5H B;  4PL1 A;  3QX7 A;  3H0M B;  5AIA A;  5EWG A;  1ZQG A;  4R64 A;  4PHP A;  1COK A;  4FZM A;  3SV4 A;  9ICG A;  2IOH A;  3T5J A;  1S0M A;  4Y2Q A;  4RQ8 A;  1LV5 A;  2XIC A;  2UVV A;  4O3N A;  2XC9 A;  4PZN A;  2G09 A;  4FZN A;  2ZJ5 A;  4F50 A;  3V6H A;  1DXS A;  5GTH U;  5JRT A;  3MDA A;  3I1Y A;  4O5K A;  2FMS A;  1A76 A;  1L3T A;  3PW0 A;  2F77 X;  4IQV A;  1IV8 A;  2AHO B;  5KG6 A;  5KFO A;  4F5Q A;  4F3O A;  1BNP A;  4UB8 U;  4PJ0 U;  3ED5 A;  4DSK A;  5ALO A;  4P0Q A;  4ED2 A;  4QZE A;  5KFN A;  5KT2 A;  2AU0 A;  5G5G A;  2H3V A;  2D3D A;  2KVC A;  4B9L A;  2KJ8 A;  3OTQ A;  2ESE A;  5L1L A;  4KLI A;  1QSY A;  3T5H A;  3PO4 A;  2EDU A;  3BQ7 A;  2E8N A;  5J2K A;  3SI8 A;  3C21 A;  3DDH A;  4I2A A;  3ZD9 A;  4JMU A;  5L1M A;  4KLH A;  3CNH A;  3UXN A;  4QZ8 A;  4YCX A;  3T5K A;  2YN4 A;  2M0N A;  1S76 D;  1XO1 A;  5J2H A;  1L8O A;  2KOB A;  5J2J A;  2BGW A;  3H4D A;  1L3S A;  9ICQ A;  1U48 A;  2K4E A;  4Y2X A;  3RTV A;  1JRP A;  5F9N A;  4PGY A;  3RJE A;  9ICX A;  3T3F A;  2BQR A;  4Y2R A;  1F0M A;  1UA1 A;  9ICC A;  2IOF K;  9ICN A;  1N5W A;  4NL9 C;  1NJZ A;  4B9N A;  4KLF A;  2KEY A;  4B9V A;  2A3V A;  5HMM A;  3BQ1 A;  4EBE A;  3T79 A;  4OJO A;  5KFG A;  3OHA A;  2RHF A;  2FMP A;  3QUC A;  4UAV A;  2P66 A;  5CB1 A;  4J9Q A;  2ZTC A;  2KIC A;  1CUK A;  2ZJA A;  4LZD A;  2ODG A;  2Q0Z X;  2GOL A;  5ALX A;  2HMX A;  5AM1 A;  3ZDC A;  1ZXI A;  5KT4 A;  4Q43 A;  5EE9 A;  5J0T A;  4ELU A;  3KOO A;  1T94 A;  1QSL A;  2XID A;  3K1Z A;  4RQ7 A;  5AKE A;  3PW4 A;  3FDS A;  2ZG6 A;  3D6J A;  3H40 A;  3GIJ A;  4F91 B;  4PHE A;  1IIP A;  2HBM A;  5JU5 A;  1Z19 A;  3KKA C;  5GTI U;  1BPY A;  3IHQ B;  2KSO B;  4DLE A;  3LVV A;  1B4F A;  1QH9 A;  5KG3 A;  1NK9 A;  2WAQ F;  2CXY A;  4F5R A;  4R66 A;  3IG8 A;  4UAU A;  4BXO A;  3N7S C;  4I2H A;  3I28 A;  4BUG A;  4KLJ A;  3Q8Q B;  4NLG A;  5KFK A;  2JEF A;  4P4M A;  3AMZ A;  4DSE A;  1Z1B A;  3HWT A;  2XCA A;  2RDJ A;  3CW2 C;  1VLB A;  1BGX T;  3NS1 A;  4EZ6 A;  4C4T A;  1BPX A;  3RB3 A;  4DQI A;  1B22 A;  4DL4 A;  4ECU A;  4NJ8 A;  3QYP A;  2F44 A;  5J8Y C;  5DLG A;  3M8S A;  3UM9 A;  3PMN A;  4CNQ A;  2ZJ8 A;  4Q45 A;  2F8L A;  5KT7 A;  9ICA A;  2WTF A;  3UMG A;  4O3O A;  2HHW A;  1U9L A;  7ICJ A;  2G08 A;  5ALG A;  4FS2 A;  3WK8 A;  5KFX A;  8ICH A;  3ALR A;  3Q8L A;  5J29 A;  3GV8 B;  1KN5 A;  3QU4 A;  3NVV A;  4YR0 A;  4CRX A;  1ZQR A;  3DEE A;  2VJ4 A;  3M1Y A;  2I9G A;  1TFR A;  3H8S A;  1S77 D;  4EEL A;  4JV2 A;  3QZ8 A;  3BZK A;  4JUZ A;  2JRZ A;  2E8M A;  3M6K A;  2H3I A;  3WK7 A;  5D46 A;  2F3N A;  5AKZ A;  3SEN A;  3RJG A;  4NLB A;  4RPX A;  1SXE A;  3MGH A;  2KV2 A;  2W11 A;  1IXR A;  3AQF A;  4ICA A;  4YP3 A;  1RZT A;  2FLN A;  4TQS A;  1NJX A;  3V7J A;  4RU9 A;  4J9P A;  3F2C A;  7ICM A;  2PFO A;  3C5F A;  4KLQ A;  4C4R A;  1MA7 A;  3RR8 A;  4PGX A;  2OM6 A;  3C2K A;  5AKH A;  4TUS A;  5CP2 A;  1NJW A;  4TUQ A;  8ICE A;  1RM6 C;  3GV7 B;  4YMM A;  4GXJ A;  4RQ0 A;  5KT3 A;  4DF8 A;  4XA5 A;  3FAH A;  1YT3 A;  2KIW A;  2GH1 A;  2W9C B;  3RJH A;  4C8K A;  2J6S A;  2KMD A;  1KL9 A;  3UMB A;  4YN4 A;  2XY7 A;  4QWC A;  3QUT A;  1ZQP A;  5C0Y A;  2H3Q A;  4P0P A;  7ICV A;  1KRP A;  4YG2 A;  8ICT A;  5HR6 A;  2JZB B;  3QNM A;  1RYS A;  3UQ0 A;  4EBC A;  1N48 A;  8ICB A;  1P7D A;  7ICE A;  5DLF A;  4RPY A;  1D8L A;  3B0X A;  3NRZ A;  4UBB A;  9ICR A;  3Q8M A;  2EH9 A;  5AM3 A;  2BKE A;  4XRH A;  5L1J A;  1PVQ A;  2KP7 A;  1X9X A;  2H3F A;  3SYZ A;  4DOB A;  1ZQV A;  2OCE A;  1X42 A;  1XC9 A;  3KHR A;  4B9U A;  3IM1 A;  4DQR A;  3ZI4 A;  5HHI A;  1Q3V A;  1S8O A;  5EE0 A;  2BDU A;  2ZIU A;  8ICI A;  5AKL A;  4J9M A;  1HUZ A;  7ICH A;  1S0N A;  2AJQ A;  2HVI A;  4Z6E A;  4RZR A;  5KAI U;  4YR2 A;  3ORY A;  5KT5 A;  1ZJN A;  2HHS A;  1QCK A;  2CPR A;  4ECV A;  4RQ1 A;  1XSP A;  1NKC A;  3PR4 A;  1DK2 A;  5ALE A;  3EPI A;  4US9 A;  3MFI A;  4DOC A;  5J0O A;  2Y1J A;  4YR3 A;  3KHG A;  4J9S A;  4F71 A;  4KLE A;  4BXO B;  3RAQ A;  1FFV A;  5ALY A;  3AUO A;  2B0C A;  2HHV A;  4USA A;  1J97 A;  2P6R A;  8ICS A;  2PFQ A;  3D2Q A;  4QZC A;  2KVS A;  5ALK A;  1Y88 A;  2ZIX B;  4F93 B;  4EEK A;  1TAM A;  3MAB A;  4J9R A;  1SV4 A;  1L7N A;  5KFM A;  1NJY A;  2FJ6 A;  9ICJ A;  1SKS A;  3PSP A;  2MU2 A;  4B9M A;  2W7O A;  2XI9 A;  3EPG A;  3MC1 A;  3K75 D;  5ALQ A;  5DBB A;  4Y2Y A;  4Q8F A;  4QNL A;  5KG5 A;  2QB0 A;  2XY5 A;  4BDP A;  1K1Q A;  5DG7 A;  1URJ A;  4J9O A;  9ICS A;  5KL8 B;  5CA7 A;  2I5H A;  3QU9 A;  1WWV A;  3BQT A;  3SEI A;  2EAN A;  1C7Y A;  2QB0 B;  3NVY A;  3HX0 A;  4KLS A;  4M2Y A;  4M9J A;  1FFU A;  1L8L A;  5KG7 A;  4ECY A;  4O5C A;  9ICF A;  1DGS A;  3TAD C;  1WUD A;  3M9N B;  4KLU A;  8ICW A;  1TV9 A;  4NM1 A;  2FPK A;  4QZD A;  1ZJM A;  2KZM A;  9ICU A;  3UMC A;  3WK9 A;  4ACO A;  4P0Q B;  4CGZ A;  4MF2 A;  3KBB A;  4Y2P A;  1LVH A;  4ELT A;  4C7Y A;  1RPL A;  4WJ3 B;  1V38 A;  1T7P A;  2IMW P;  2HVH A;  4YD1 A;  3H7I A;  1NZB A;  1JI7 A;  4KIT B;  2FDR A;  1JMS A;  1NZP A;  1UT8 A;  2W9A A;  9ICH A;  4QJF B;  4F2R A;  4UB4 A;  4C8N A;  1NK8 A;  4ECR A;  1ZRN A;  2EZY A;  3QZ7 A;  2VJ5 A;  3N7R C;  3OGU A;  3EZ5 A;  3PNC A;  2JMG A;  4G3I A;  4M04 A;  2PI4 A;  3BS5 A;  2BCS A;  4AYB C;  4I29 A;  3BQ0 A;  5DDM A;  1BPE A;  1KDH A;  4GIB A;  2W7P A;  9ICV A;  3TFS A;  4EEY A;  5AM2 A;  4I28 A;  2KD1 A;  5AM5 A;  4O3Q A;  4NXZ A;  4BGD A;  2DQN B;  7ICG A;  2PFN A;  2HDO A;  5AM0 A;  2ZIW A;  1N5X A;  4Z6F A;  4MFA A;  3MBY A;  3PY8 A;  5ALP A;  5KFQ A;  4UB2 A;  4MFF A;  4OJ6 A;  2BCQ A;  2EAM A;  4Q8E A;  1VDV A;  3QEB Z;  3M9M B;  2W8K A;  3WK6 A;  7ICU A;  1NI3 A;  3FC4 A;  4Z6C A;  5KNI A;  3HT3 A;  2RP5 A;  1SWW A;  2G07 A;  1RYU A;  1UCV A;  2BCU A;  3SAH A;  2YY6 A;  1K1S A;  5AI0 A;  8ICN A;  3OJS A;  1RQL A;  4GFJ A;  5J8Y A;  3Q8R B;  4HYK A;  3SQI A;  8ICK A;  2W03 A;  3S6J A;  2HSZ A;  1FO4 A;  2C28 A;  3AQE A;  5KFY A;  1A77 A;  2W04 A;  4RNO A;  1RXV A;  1XS9 D;  3BQ2 A;  4O3M A;  1N63 A;  1WG8 A;  5D49 A;  5KFF A;  5KTQ A;  4DL5 A;  1V97 A;  3PV8 A;  2YTU A;  3IG5 A;  1EXN A;  5IIL A;  3MGI A;  4F4X A;  1H38 A;  3SAG A;  4OJ5 A;  2EQY A;  2E8P A;  1QQ7 A;  4DF4 A;  3WKB A;  3PSF A;  5B66 U;  3M8R A;  4IRD A;  5AM4 A;  4O3R A;  3CRX A;  1ECW A;  1XNS A;  2KJ9 A;  5J2G A;  4EEN A;  2WAQ C;  1CEZ A;  1ZQB A;  2R18 A;  1N2X A;  1SGG A;  3MR5 A;  3QE9 Y;  2RDI A;  4ED6 A;  4MFC A;  4RQ3 A;  3IP4 B;  1QQ6 A;  1X40 A;  2A1J B;  2JGA A;  3DV9 A;  1SL1 A;  3MR6 A;  4UAT A;  3JPN A;  3Q8K A;  2JH1 A;  3N4M B;  2HHT A;  3MDC A;  4FBU A;  5CR0 A;  3IRU A;  2C2E A;  4KX5 A;  1U49 A;  1PVP A;  2DUY A;  5AKI A;  2RLT A;  2JEJ A;  3D2S A;  5AK5 A;  1ZQU A;  2PI5 A;  2BZF A;  4F5N A;  5DG9 A;  5EWE A;  3JPO A;  3GIK A;  3F5E A;  2DL0 A;  2BQ3 A;  4Y2S A;  3SZ2 A;  4QZ9 A;  4CCH A;  5ALS A;  4FS1 A;  4P4O A;  4YMO A;  1N56 A;  4IQU A;  1ZQH A;  2AQ0 A;  2WF8 A;  5IIO A;  7ICF A;  4I2D A;  4M9N A;  3N28 A;  1JXL A;  3GIL A;  4P4P A;  3MR2 A;  3EYZ A;  9ICB A;  5AK4 A;  4C4S A;  1TAU A;  4ED8 A;  3MGV A;  1UT5 A;  2N1R A;  1NOM A;  2AQ4 A;  1XO0 A;  9ICL A;  4HAI A;  4QWD A;  4JB3 A;  2IHN A;  2UVW A;  1NK5 A;  3RFA A;  4DS4 A;  5KFT A;  2HOI A;  5AI4 A;  1JX4 A;  1XSN A;  3SAF A;  1L7O A;  5CEH A;  5J0P A;  2MSN A;  1WCL A;  4PZO A;  5DBA A;  5EWF A;  5KFI A;  5AHX A;  9ICP A;  1KBU A;  2LKY A;  5AIB A;  4I2G A;  2K4P A;  2K60 A;  2DPI A;  4DSF A;  4M9H A;  2KZZ A;  1MQ3 A;  1ZQT A;  2JXJ A;  5CHG A;  2OXO A;  3M9O B;  3BS7 A;  2WB1 C;  4LVS A;  3LVW A;  4IC9 A;  1NKB A;  3H8M A;  3T5L A;  2NRZ A;  1ZD4 A;  5J0Q A;  4F8R A;  2R8G A;  2IBK A;  3Q8S B;  1M6Y A;  3PZP A;  4NLZ A;  5DG8 A;  3CP8 A;  4KLD A;  8ICL A;  1S0V A;  4KX3 A;  3LYS A;  2BPC A;  1DGJ A;  2PMZ F;  2ASD A;  2XY6 A;  5KFC A;  4DQP A;  3TAQ A;  3AM9 A;  5DB6 A;  2NV3 A;  4B9T A;  4Y2T A;  1NKE A;  4UAS A;  2W9B B;  4DL3 A;  4F4W A;  3PX4 A;  4GXI A;  4NWI A;  4XQ8 A;  4KN4 A;  3KD3 A;  4IRC A;  5KFV A;  5BPC A;  4RNN A;  4UW9 A;  2L5Y A;  3G6V A;  1MN8 A;  2EZX A;  2I6X A;  3OSN A;  2FMQ A;  1BNO A;  5DQH A;  3RJI A;  1SV0 A;  3GV5 B;  3KZI U;  4AYB F;  4UAZ A;  1RYR A;  4NV0 A;  2B21 A;  2FPL A;  2VA3 A;  3EW9 A;  1PZN A;  4Y2V A;  4UB3 A;  4PHA A;  2IHM A;  1WCN A;  3RH4 A;  4DL2 A;  4QZA A;  4DFM A;  5T14 A;  2AXT U;  7ICQ A;  4GXK A;  1U4B A;  4P0P B;  5HP4 A;  2BCR A;  2RRD A;  4ELV A;  4M6W A;  1RG6 A;  5ALZ A;  2PXI A;  2NYV A;  3SR6 A;  3HRD D;  5HR7 A;  8ICF A;  4M9G A;  1SKW A;  2LYA A;  1HIW A;  1KFT A;  4GLX A;  3V7K A;  2EZZ A;  4AP9 A;  1X2I A;  1ZQY A;  2NRX A;  5AKK A;  1GO3 F;  4LJX A;  5L1I A;  2YMM A;  4QIW C;  2G5I B;  2EAP A;  2HW3 A;  2FPM A;  4IR1 A;  4R65 A;  2QB1 A;  4G9B A;  4JV0 A;  2KKV A;  5JTI A;  3VCB A;  1U47 A;  3JPS A;  1AQ6 A;  9ICI A;  4KLL A;  1N60 A;  2FLP A;  4K4G A;  1ZQC A;  3C23 A;  9ICM A;  4RQN A;  1SL0 A;  5KL1 B;  2KTQ A;  2E1F A;  2F8K A;  1LKY A;  3TI0 A;  2Z7J A;  2JEI A;  3QXG A;  5KFW A;  1OW5 A;  1F5S A;  3ZDE A;  2IA6 A;  4PGQ A;  4RQ2 A;  4M0A A;  2A1A A;  1T4G A;  4DFD A;  2W43 A;  2Q4T A;  2K8B B;  4CE6 A;  2AH5 A;  4IS7 A;  1OUQ A;  2WF5 A;  4KLO A;  4Y2J A;  2WFA A;  4FFD A;  3SD7 A;  5KFD A;  2UVU A;  1Z1V A;  4R63 A;  3NVZ A;  4OCZ A;  4YQW A;  3ISB A;  4DS5 A;  3EUB 2;  1NK0 A;  3H0R B;  5KFZ A;  4F92 B;  4CF5 A;  3PW7 A;  5KFU A;  2HOQ A;  1JXE A;  4K4I A;  3RB4 A;  3TQ1 A;  1Q3U A;  2YQE A;  3PR5 B;  3F2B A;  1ZQK A;  1D9D A;  4I27 A;  3VC8 A;  5HHH A;  1ZQZ A;  3C1Y A;  1V85 A;  3J81 j;  1L5U A;  3BS5 B;  4O5E A;  1BPZ A;  3ZDB A;  1ZQM A;  2ASJ A;  1ZQJ A;  1Z00 B;  1ZYQ A;  2ZUB A;  5DBC A;  3OHB A;  4MHV A;  4DWI A;  4EX6 A;  1LB2 B;  1UQV A;  1A6S A;  3AU2 A;  1RQN A;  4ZH4 A;  4CDG A;  2H3Z A;  5K4L A;  4KLM A;  4RUC A;  1N62 A;  3WKA A;  4DSI A;  2DBY A;  1SIJ A;  2F1J A;  1KEJ A;  2A1J A;  8ICM A;  5ALD A;  5DB7 A;  2GLE A;  4QW9 A;  1C20 A;  4E0D A;  4F4K A;  4OD0 A;  2HOF A;  3KZX A;  5III A;  5ALH A;  3GU3 A;  1NK6 A;  1L6N A;  9ICE A;  1Z00 A;  4Z6D A;  1MQ2 A;  2WF9 A;  4DCC A;  4UBC A;  4UQG A;  1TAQ A;  4ECS A;  4DFK A;  5KG0 A;  2MAX A;  4DFP A;  1D8B A;  3AL0 B;  3FM9 A;  2VA2 A;  5AI9 A;  2JH7 A;  2G06 A;  2HHX A;  1HEK A;  2WHE A;  3ETL A;  3SMV A;  3RF9 A;  5B5E U;  4QWB A;  1QQ5 A;  2DF4 B;  2NRT A;  3L4P A;  3E58 A;  1K5O A;  2LBO A;  5KFH A;  2Y0S F;  4TUP A;  1SZP A;  3GIM A;  4RQM A;  3ISC A;  1JN3 A;  4CF3 A;  4PL2 A;  3RRG A;  3LWL A;  1T3Q A;  2YML A;  5J2F A;  4O9M A;  3QU5 A;  3A0H U;  3NAS A;  5DDY A;  2LMR A;  4IRK A;  2YB4 A;  1RXW A;  5F9L A;  2PKE A;  2VKQ A;  4FZL A;  2ZUD A;  4U7C A;  1F44 A;  5KG4 A;  4FE3 A;  4DSJ A;  1JAL A;  4MEY A;  2KE7 A;  3PX0 A;  4QWE A;  2WB1 F;  4OO1 J;  8ICU A;  2ZIV B;  3GDX A;  4UB1 A;  2ZIU B;  5KFR A;  4O0I A;  2YMQ A;  2DFL A;  8ICY A;  8ICJ A;  3G6Y A;  1Q46 A;  5CWR A;  2OYY A;  4IL6 U;  2J6T A;  4NM2 A;  4ED0 A;  5IIN A;  4I2I A;  4J9K A;  1ZQA A;  2AGO A;  2V4R A;  2ISP A;  2AGQ A;  4C8L A;  4F4Y A;  2E1E A;  2BPG A;  4OJP A;  2V4Q A;  2VAN A;  4XUS A;  5E79 U;  2RQ5 A;  1UHU A;  2F76 X;  2K8C B;  2KG5 A;  2O6K A;  1HUO A;  3AEV A;  1S5L U;  1KSP A;  3SV3 A;  4UAR A;  1NNL A;  2XO7 A;  2H5X A;  5F3X B;  2DPJ A;  3RH5 A;  5KG2 A;  4DL6 A;  5J2C A;  1SL2 A;  1SB3 C;  2HBK A;  1COO A;  2R8H A;  1CRX A;  3WKE A;  2ZIV A;  1A0P A;  5KFA A;  2JV3 A;  2GWS A;  2Y0S C;  2BPF A;  1T8E A;  4UAW A;  5AKG A;  3PO5 A;  4RT3 A;  4M47 A;  1O03 A;  5J0U A;  2KJ5 A;  3UXP A;  4ED1 A;  2YB1 A;  4RPZ A;  1ZQD A;  4BWM A;  2DWQ A;  2DGZ A;  1JRO A;  5L9X A;  3ZD8 A;  1BPD A;  5ALI A;  2J6U A;  5AI5 A;  1Z4O A;  2QAR B;  2XGP A;  4DOA A;  5A0L A;  1ZD5 A;  1SV0 C;  3GZF A;  1TE2 A;  2NO4 A;  7ICT A;  3JPP A;  4JWM A;  5AIC A;  5ALT A;  2XCP A;  3E2E A;  1KKX A;  4J9N A;  3MFH A;  4LZG A;  8ICR A;  2ALZ A;  5H2F U;  3RJF A;  2LYH A;  4QIW F;  4U6P A;  3NUQ A;  3PSI A;  4IR9 A;  4RNM A;  2NRW A;  3K1R B;  2LM4 A;  3FYH A;  4ED7 A;  1ED1 A;  1ZD3 A;  3PX6 A;  1TK5 A;  3V72 A;  4J9L A;  1KW4 A;  2R8J A;  4BWJ A;  1QLN A;  1T3N A;  2W55 A;  1Z4N A;  3LWM A;  1PK1 B;  4YMN A;  2BQU A;  1D9F A;  1J2M A;  2Y9U A;  1S0O A;  4EBD A;  2KK0 A;  5AK3 A;  5HML A;  4EYH B;  1XSL A;  5BOM A;  1SWV A;  2ZTE A;  1Z3E B;  3RH6 A;  2HCF A;  3ETR A;  3HP6 A;  2P35 A;  5KFJ A;  1HJP A;  2AGP A;  4C8O A;  1XWL A;  3NGD A;  3V6K A;  2ZIW B;  1ZQI A;  3WKC A;  3NRW A;  3QUB A;  2ZTD A;  4QZB A;  2OH2 A;  1ZQ1 C;  4UB6 U;  1B43 A;  3QU7 A;  1OXJ A;  4DO9 A;  4KN7 A;  2W8L A;  2V9W A;  5ALU A;  5JUM A;  5IIK A;  2ZXI A;  4I2J A;  4M9L A;  1SKR A;  2PFP A;  2HBJ A;  4NY8 A;  1ZET A;  4C7Z A;  5KT6 A;  4ZOH C;  3N97 B;  4DEZ A;  3JPR A;  3TAC B;  1X6I A;  4QWA A;  2HHU A;  3H8J A;  1UA0 A;  2W3R A;  1DRG A;  8ICX A;  2LM1 A;  5AK6 A;  3C2M A;  4IQT A;  5J2B A;  3HKZ F;  9ICO A;  3KFU F;  2FLL A;  1PUZ A;  4UAY A;  1FEZ A;  1V9P A;  2XGQ A;  3HKZ C;  3THV A;  3RB6 A;  5ALV A;  3IV6 A;  4I2E A;  1ZQE A;  4F5P A;  1L3V A;  4B6J A;  3HPO A;  2OEH A;  2F1I A;  2CRX A;  4ECX A;  4DQQ A;  4YXJ A;  5DGB A;  3UPQ A;  3IDW A;  4DFJ A;  8ICC A;  4M6W B;  2JZB A;  3RR7 A;  5KFE A;  3QU2 A;  2C2D A;  4KLT A;  1N61 A;  4QZH A;  3TAD A;  4MF8 A;  4YD2 A;  2K4I A;  4RQ6 A;  2MA1 A;  5J0R A;  8ICQ A;  5J2I A;  2UVR A;  2I1Q A;  1FIQ A;  2A19 A;  1CI4 A;  9ICW A;  4DL7 A;  3RBD A;  2P6U A;  2ZIX A;  1TK0 A;  3N7P D;  3TAN A;  3GQC A;  2LYB A;  4FBT A;  8ICA A;  3IN5 A;  5AKJ A;  5ALN A;  2LPE A;  1KFD A;  2W9C A;  3TAR A;  1BPB A;  2HHQ A;  3WKD A;  1L3U A;  1ZQO A;  2ISO A;  1B0X A;  1YZ6 A;  3GII A;  5TIS U;  2KFZ A;  3A0B U;  2QAR A;  4A8E A;  8ICZ A;  4YFK A;  2M9N A;  4I2C A;  2FI1 A;  4GC7 A;  5DB8 A;  3L3F X;  1ZQS A;  1NK4 A;  2E3T A;  3B0Y A;  4ECZ A;  4TQR A;  3TKA A;  1NK7 A;  3C1Z A;  3LDA A;  1ZQX A;  5G5H A;  9ICK A;  4EX7 A;  4RUA A;  2F1H A;  3V7L A;  3TFR A;  4QZG A;  5DQI A;  5DB9 A;  1JUD A;  2K4H A;  7ICO A;  1ZOL A;  3OSP A;  5ALM A;  5KAF U;  3KHL A;  1L7M A;  3PVX A;  3PST A;  1ZRM A;  2F2A B;  4RT2 A;  1ARO P;  5ALF A;  2C2R A;  5J0W A;  3QUQ A;  2KFN A;  3RBE A;  2BCV A;  2W3S A;  4NL9 A;  4JV1 A;  2ATL A;  2KSO A;  2OHF A;  5KG1 A;  3ZDA A;  4ECT A;  1J2N A;  5IIM A;  2QKQ A;  3RB0 A;  1S10 A;  4C8M A;  4F72 A;  2LI6 A;  2KHV A;  4NLC A;  1D8Y A;  4O3S A;  4O3P A;  1BVS A;  5CJ7 A;  4EZ9 A;  7ICI A;  2D8C A;  4IQW A;  4F2S A;  4YXM A;  1ZQQ A;  3GFK B;  2VIX A;  2ZUC A;  3RJJ A;  4DQS A;  3NVW A;  1X9M A;  2DKZ A;  2CN1 A;  4ECQ A;  1KLN A;  1PVR A;  1ZD2 P;  5ALR A;  4GC6 A;  2LHT A;  3H8W A;  2KKP A;  3ICX A;  5L1K A;  7ICR A;  4BJQ A;  3C5G A;  4NLK A;  5D4B A;  3F5A A;  4Q44 A;  4C80 A;  3ONN A;  4K4H A;  1PK1 A;  3U26 A;  4F5O A;  2GO7 A;  4UB5 A;  1X9W A;  5TZV A;  3KKA A;  5J0Y A;  3B9J A;  4KLG A;  4R8U B;  4DSL A;  3WU2 U;  1TVA A;  5IIJ A;  4DLG A;  2E8O A;  5AI8 A;  2JHD A;  4F4Z A;  3H4B A;  2OWO A;  2KHQ A;  1ZQN A;  3G6X A;  1DOQ A;  3I76 A;  3MR3 A;  2C22 A;  1WWU A;  1YZ7 A;  2HBL A;  5KFB A;  5J2D A;  4PPX A;  2HI0 A;  3UQ2 A;  5J0S A;  2IOF A;  5KFP A;  1QTM A;  5ALJ A;  4PH5 A;  3M7D A;  3JPT A;  2NO5 A;  1QSS A;  1O08 A;  4KMO B;  2KNJ A;  2PMZ C;  7ICK A;  1VJ5 A;  1S9F A;  5EOZ A;  3KHH A;  3ISD A;  4YVZ A;  4QW8 A;  2WF7 A;  1DK3 A;  3WK4 A;  4MEX A;  2NRV A;  2VA8 A;  3O0F A;  1U45 A;  5ALW A;  5HNK A;  2W9B A;  7ICP A;  4CF4 A;  5C5J A;  2R8K A;  3EWA A;  4US8 A;  1ZQF A;  3D2N A;  4P2H A;  4JK1 A;  2YX8 A;  4PHD A;  4KMU A;  4ED3 A;  3JPQ A;  3Q8P B;  5J2A A;  4EYI B;  3E0F A;  5DGA A;  4FO6 A;  4OJL A;  3WK5 A;  4R8U A;  3V6J A;  5DKW A;  8ICO A;  3QEA Z;  1IM4 A;  2FE9 A;  3K4G A;  1X6J A;  3RRH A;  4I2F A;  1SXD A;  2XVT A;  4B9S A;  1TKD A;  3KTQ A;  7ICN A;  1IG6 A;  1XU4 A;  3HJE A;  2QLT A;  1L7P A;  7ICL A;  3BZC A;  1SZH A;  2ES6 A;  3OJU A;  2BHN A;  1JIH A;  4I2B A;  1LKY B;  2E5S A;  1KTQ A;  3ZDD A;  3L5K A;  3PML A;  3RJK A;  3F2D A;  1MSW D;  3BDP A;  5BOL A;  2K89 A;  3F53 A;  1Q8K A;  1PK3 A;  1RDF A;  2MUT B;  2ZXH A;  2YMP A;  4JWN A;  2JEG A;  4NLN A;  3PW2 A;  2Y1I A;  4QZI A;  2ASL A;  2WF6 A;  3BJY A;  3OPX A;  2MRL A;  5CRX A;  8ICV A;  2D6F C;  2BR0 A;  3PW5 A;  5AI6 A;  1ZQW A;  3CYM A;  5ALL A;  1TK8 A;  4KTQ A;  8ICG A;  1S97 A;  2W9M A;  4TUR A;  2BDP A;  3M6Z A;  1KFS A;  2KIV A;  3HW8 A;  3C28 A;  9ICT A;  4QZF A;  5EE3 A;  3LK9 A;  5AKX A;  3R9K A;  4BX9 C;  2EAO A;  4J03 A;  2Y9T A;  5KFL A;  7ICS A;  3AU6 A;  5J0X A;  2KN7 A;  5DQG A;  1ZQL A;  1MC8 A;  1X66 A;  4X5V A;  3NTU A;  3TAP A;  2DKX A;  2K8A A;  3HIL A;  5EE1 A;  4RQ5 A;  2G0A A;  5AKY A; 
#chains in the Genus database with same CATH homology
 1B4F A;  2E8P A;  2FE9 A;  2B6G A;  1SXD A;  1RG6 A;  1OXJ A;  2DKZ A;  1V85 A;  3BQ7 A;  4PZO A;  2E8N A;  2LPE A;  3BS5 B;  5L1M A;  3BS5 A;  2ES6 A;  4RQM A;  1B0X A;  2K4P A;  2QAR B;  2K60 A;  1LKY B;  1SGG A;  2QAR A;  1SV0 C;  2LMR A;  1PK1 A;  4MHV A;  1X40 A;  3BS7 A;  1SV4 A;  1UQV A;  2EAP A;  2KMD A;  3TAC B;  3KKA A;  2QB1 A;  3H8M A;  1COK A;  1F0M A;  5JTI A;  1PK3 A;  2E8O A;  2QB0 A;  2EAM A;  2KE7 A;  4NL9 C;  4NJ8 A;  2F44 A;  5KNI A;  1WWU A;  5J8Y C;  4PZN A;  3K1R B;  4RQN A;  2GLE A;  1WWV A;  3SEI A;  2EAN A;  2F8K A;  2QB0 B;  1DXS A;  1LKY A;  1UCV A;  5JRT A;  1KW4 A;  1OW5 A;  2DL0 A;  1PK1 B;  3TAD C;  5J8Y A;  1X9X A;  2Y9U A;  2KG5 A;  5F3X B;  2KIV A;  2L5Y A;  4IS7 A;  4NL9 A;  3IDW A;  2KSO A;  1SV0 A;  1V38 A;  2EAO A;  2Y9T A;  2E8M A;  1Z1V A;  2D3D A;  2F3N A;  2QKQ A;  1X66 A;  3SEN A;  1JI7 A;  3TAD A;  2YTU A;  2ESE A;  5JU5 A;  3KKA C;  1SXE A;  2DKX A;  3HIL A;  2JV3 A;  2KSO B;  2D8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...