2D3DA

Crystal structure of the rna binding sam domain of saccharomyces cerevisiae vts1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
83
structure length
83
Chain Sequence
SMNPKSLTDPKLLKNIPMWLKSLRLHKYSDALSGTPWIELIYLDDETLEKKGVLALGARRKLLKAFGIVIDYKERDLIDRSAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The NMR and X-ray Structures of the Saccharomyces cerevisiae Vts1 SAM Domain Define a Surface for the Recognition of RNA Hairpins
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords Vts1 protein
total genus 32
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2005-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2d3dA00
3IDWA 2DL0A 1COKA 3SENA 3HILA 1PK1B 2Y9TA 4NJ8A 2JV3A 2EAPA 1PK1A 2QARB 3H8MA 1RG6A 2KMDA 2KSOA 1Z1VA 3TADC 2FE9A 5JU5A 3BQ7A 1PK3A 1WWVA 1WWUA 3KKAC 1SV4A 2DKXA 3KKAA 5J8YC 1X9XA 3K1RB 1B4FA 2EANA 2EAMA 1KW4A 2QARA 5JTIA 1SV0A 1X66A 1V38A 2E8NA 4MHVA 1OXJA 4PZNA 5L1MA 2QKQA 2ESEA 2KIVA 3BS5B 3SEIA 1UQVA 1LKYB 2K4PA 4RQNA 2F8KA 5JRTA 4NL9A 2QB0B 1OW5A 5J8YA 2E8OA 4NL9C 2YTUA 4RQMA 1F0MA 2E8MA 3BS7A 5KNIA 2ES6A 2Y9UA 2GLEA 1LKYA 1X40A 2KE7A 1SXDA 2EAOA 1DXSA 2KSOB 1UCVA 2D8CA 1B0XA 1SV0C 3TACB 4IS7A 2F3NA 2F44A 2QB0A 4PZOA 5F3XB 3BS5A 2K60A 2D3DA 2LMRA 2DKZA 2E8PA 2L5YA 1V85A 2QB1A 2B6GA 2LPEA 1JI7A 2KG5A 1SXEA 3TADA 1SGGA
chains in the Genus database with same CATH superfamily
5KFXA 3MDAA 2YB4A 1U4BA 3JPNA 3RB3A 4M04A 4DSJA 1JXEA 1CUKA 4C80A 1MSWD 2NO4A 4ED2A 3KD3A 3ISCA 3MR6A 5D46A 2EANA 4KLTA 2HHQA 4ECWA 1DK2A 2ZUDA 4LVSA 5F9NA 2RHFA 5DGBA 3JPPA 3QXGA 1ZQIA 4MHVA 3AUOA 5L1MA 3H40A 1L6NA 9ICBA 3M6KA 4FBTA 8ICQA 5AKGA 5DG8A 3NVWA 5DLGA 4UAYA 2DGZA 1DRGA 2JEFA 2HBJA 4RT2A 4NL9C 4M9HA 9ICWA 1NNLA 3RF9A 2G06A 1HJPA 2ES6A 4OJPA 3AQFA 2PKEA 2G07A 9ICKA 4IR9A 2AH5A 7ICPA 2XC9A 2HOIA 4EZ9A 3IM1A 1PVQA 4O5KA 2F2AB 5ALLA 3T5HA 4F91B 1NK8A 3RR8A 2IMWP 1LV5A 2ATLA 4PHEA 2D6FC 4I2EA 8ICXA 2MA1A 1SB3C 8ICLA 1QTMA 1TV9A 5T14A 3K1ZA 1N61A 5J2HA 3TFRA 4ELTA 3ONNA 1CI4A 4DFKA 5CP2A 1L7MA 4US9A 2VA2A 4UB1A 2KFNA 1VJ5A 9ICVA 4DQQA 1V9PA 2I1QA 5KFTA 5C0YA 4C7ZA 4FS1A 2FJ6A 3N7SC 5H2FU 2ZIWA 1RYSA 1V97A 4NLCA 4DWIA 5KFJA 4Z6EA 3TAQA 5DB8A 4KMOB 5AK3A 2BGWA 1ZD3A 2ASJA 3OGUA 4UAUA 3PSPA 3A0BU 4RZRA 5KG3A 1ZQTA 2HHVA 2FE9A 3L5KA 3HRDD 5JU5A 1KTQA 5J0PA 2BQUA 3GFKB 1NOMA 4NM1A 4KLHA 5KFYA 1QSSA 3QE9Y 4PPXA 1S8OA 5ALUA 3LYSA 3RAQA 1IV8A 1JALA 3UQ2A 2JRZA 4PZNA 5ALHA 4B9NA 5AKHA 2OXOA 2ESEA 5AM0A 2ZUBA 4M47A 5KFUA 1QLNA 1UT8A 3S6JA 3V6HA 3RJHA 2IHNA 1D9DA 5A0LA 1Z4OA 4YD2A 5JRTA 4X5VA 3NS1A 4ECTA 3EW9A 4I2AA 2QB0B 3NTUA 4QZGA 3C5GA 1MQ2A 3TANA 1KBUA 3TFSA 1RXWA 3EYZA 2XGQA 3WKEA 7ICTA 3Q8MA 1ZQ1C 4CRXA 4GFJA 3QNMA 4TQSA 4DFDA 4IS7A 9ICGA 4EX6A 3KZXA 5KT4A 1C20A 3SV4A 1ZQKA 3AMZA 3GIMA 4F4YA 8ICNA 5ALQA 2W9BA 1HIWA 4J03A 2BHNA 4I2GA 2DKZA 2G5HB 5J2JA 4NM2A 2AQ4A 2FLPA 4ED8A 4JUZA 5AKLA 2KJ8A 2VA8A 3QUBA 5AM4A 2R8JA 1TK0A 1SGGA 2MUTB 1S0VA 2W11A 3SI8A 2KD1A 4XUSA 4I2JA 4DF4A 1J97A 2K4EA 3H8MA 3ISDA 3IN5A 2KMDA 3PO5A 3OTQA 3TADC 1L7OA 5F9LA 2PI5A 2HMXA 4QWEA 1RYRA 5IIMA 4YR2A 3KKAA 2B21A 1SWVA 1N56A 4ED6A 4NLKA 3MDCA 3BQTA 3HT3A 1ZQGA 1TK5A 3O0FA 1KEJA 5J0YA 4KLEA 2DPJA 4Z6CA 2YMQA 5CB1A 1JUDA 3QEAZ 4EZ6A 1IIPA 1ZQDA 3ZD9A 2A1AA 1B43A 2W9BB 1UT5A 4QZHA 3BQ2A 4KMUA 3PSFA 2OH2A 1VDVA 4RNMA 2VANA 4R66A 4CCHA 4C8LA 2ZTDA 1NK7A 3F2CA 3I1YA 2FLLA 4ZOHC 1D8LA 2KOBA 3G6YA 2KZMA 4IR1A 1XSLA 4ELUA 2JZBB 4BDPA 5J2GA 8ICBA 2QB0A 3RRGA 3RJIA 1SIJA 4JV0A 4EBCA 1ZQHA 4Q43A 4DF8A 2LBOA 1VLBA 5D4BA 1SL0A 4U6PA 3D2SA 2B0CA 2C2EA 2Q0ZX 1BPZA 2QB1A 3RJGA 2I5HA 3M8SA 2JMGA 5J2AA 9ICHA 1SKRA 7ICVA 4UBBA 1ZQNA 5EWEA 3PR5B 4TUQA 2BCVA 3VCBA 2HCFA 1DK3A 4QZ8A 1XO1A 2KVSA 2AXTU 1PK3A 3WK8A 4QZDA 5ALDA 4QZBA 2G08A 2KV2A 2DKXA 4XRHA 1IM4A 4QNLA 1B4FA 2KFZA 4CE6A 2HHUA 1NJZA 3D2QA 3PZPA 4DLEA 5J2DA 4UB2A 4PL2A 5J29A 3N7PD 2K89A 4YQWA 4XQ8A 5L1JA 1T7PA 3I28A 5AHXA 3HJEA 1KDHA 4DL5A 1RQLA 3HKZF 3NRWA 4EBEA 5KFNA 2W9CA 4ELVA 5AIBA 1P7DA 4BUGA 4RPYA 4AP9A 4Y2PA 1H38A 4JV2A 1KN5A 2W9AA 2XY6A 5CHGA 1KRPA 3H0MB 1ZRMA 4OJLA 5AM3A 7ICHA 1QQ6A 5AI8A 7ICJA 1ZJMA 3C28A 1RPLA 4JK1A 4IRDA 8ICWA 2ZIVA 2UVRA 4GIBA 3SZ2A 4ACOA 3HW8A 5DB6A 9ICRA 5G5HA 2VKQA 4KX5A 1ZJNA 9ICEA 2PFQA 4M9LA 2E5SA 3C2MA 4KITB 1D8YA 3WKAA 4DFMA 2KK0A 2ZTCA 4O5EA 3MFIA 2I6XA 1WG8A 4PGXA 3ALRA 3SAHA 3IDWA 3IV6A 1UPHA 8ICEA 1ZQRA 2OEHA 2JV3A 3GV8B 4R8UA 3KHHA 3C2LA 5KG6A 5KFOA 3M7DA 2PMZF 5DBAA 2G5IB 2ZUCA 2BKEA 2RRDA 3PSTA 3WKCA 1Q3VA 3QUCA 4M9GA 2W9MA 1JROA 5AI6A 4YN4A 2Y1JA 4YR3A 2AHOB 1B22A 3Q8KA 1KSPA 1S77D 3TAPA 5ALNA 2K4PA 4DSKA 3CYMA 5DG7A 3ZI4A 2HOQA 2BPCA 2GWSA 3V7LA 3OSNA 5KFBA 5EE3A 4F92B 4HYKA 1XO0A 5D49A 4CDGA 8ICAA 3WK9A 4ED7A 3GIKA 2Z7JA 1Q3UA 3OJUA 2O6KA 3T5JA 5KFCA 1Q8KA 4BXOA 5BPCA 2KJ5A 2OCEA 2XO7A 4YFKA 4O3PA 2HSZA 1JN3A 4JB3A 3OHBA 1ZOLA 3F5EA 5ALRA 1A0PA 2ASLA 2ODGA 3BDPA 3Q8QB 3GV5B 4US8A 2FDRA 3J81j 1CEZA 2FI1A 1URJA 9ICTA 3QZ8A 4DSIA 4DFJA 7ICSA 1S97A 4J9OA 9ICFA 3F2DA 3H8JA 1NKBA 5KT5A 5KG7A 3H4BA 1SV4A 2WHEA 4ZH4A 3MGIA 4C8OA 3MR2A 4Y2RA 1ZYQA 3V7KA 1WUDA 1UHUA 2QARA 1S76D 3BZKA 2BDUA 4LZDA 4M0AA 2W03A 3CP8A 4J9KA 2J6UA 2YMPA 3SMVA 3QU2A 3QUTA 5IIKA 4DL6A 3H8SA 1LKYB 3KOOA 7ICMA 4IQTA 4Y2TA 5KG2A 4Z6DA 1DOQA 2NV3A 4NL9A 5ALOA 2HBLA 2W3RA 3RAXA 2Y9UA 2ZIVB 2RQ5A 1L3SA 1FIQA 5ALGA 3LVWA 2R8IA 9ICSA 2EH9A 5AK5A 5KFGA 4YVZA 4EEKA 5EE9A 3KBBA 4BXOB 4TQRA 2K8AA 4QZ9A 8ICTA 4KLDA 2V9WA 3TI0A 3UXOA 4O3OA 5KFFA 2XI9A 2KKVA 2W7PA 4B6JA 4B9LA 3T5LA 1L3TA 3NRZA 4BWMA 1M6YA 4I2IA 1ZQCA 5C5JA 1ZQYA 5AM5A 3GU3A 2DFLA 2MU2A 5KFHA 2AGQA 4RQ2A 7ICLA 4O3RA 4PHDA 5KFVA 2LI6A 2WAQC 2Y9TA 4DEZA 2WF7A 3QEBZ 2EAPA 4KLJA 3NASA 5J0TA 2YQEA 1XS9D 1Z1VA 3H4DA 3SD7A 5AI5A 8ICSA 4MFFA 2EZXA 2R18A 4CNQA 4B9TA 3G6XA 2LYAA 7ICEA 5HMMA 1U47A 5ALXA 9ICLA 3ZD8A 2LKYA 1SZHA 1T4GA 3DEEA 3MFHA 2YB1A 1QCKA 5ALPA 3M9MB 1NJXA 2VJ5A 3PMNA 4IQUA 3RRHA 3D2NA 3QU9A 4A8EA 3BQ0A 3E2EA 4RT3A 5IILA 4B9VA 3AM9A 2KP7A 4YG2A 1L3UA 4RQMA 2JH1A 3C21A 2I9GA 4RPXA 4F8RA 3PY8A 3MABA 1L5UA 3HX0A 5KG4A 4RNOA 4K4GA 2NRVA 4GC7A 8ICFA 3RJFA 2KSOB 2VA3A 2DBYA 3ISBA 1ZETA 4O3QA 5KFAA 3SR6A 1IXRA 1KQQA 5EWGA 1NI3A 4AYBC 4YCXA 5AM2A 4F4XA 1Z4NA 4J9LA 4YMMA 1BPXA 3OPXA 4IQVA 2KN7A 3WK7A 4YMOA 4PH5A 4F93B 1XSNA 3EUB2 3KHGA 4PHPA 5DDMA 4DL4A 4NXZA 1ZQUA 3RBDA 3IRUA 4R65A 1X9WA 7ICGA 2JEGA 1ZQVA 1SXEA 1C7YA 4DOAA 2EDUA 1HUOA 3T79A 1COKA 5AI0A 3C1ZA 5J2EA 2V4QA 4RQ8A 2QARB 5EE0A 2HBMA 2H3IA 3BQ7A 4EEYA 5KT2A 3KKAC 2GH1A 3UMGA 3JPRA 1NKEA 4P2HA 1ZD4A 3V6JA 3N4MB 3C5FA 2CXYA 4C8NA 2K4HA 2M0NA 4NLZA 4O5CA 2BQ3A 5JTIA 1SV0A 1SZPA 4RQ0A 3Q8RB 5TISU 1ED1A 4F2SA 9ICNA 5B5EU 4M6WA 5DLFA 4PHAA 4DQSA 4Y2XA 8ICJA 2PFPA 1Y88A 5TZVA 9ICPA 5L9XA 2WFAA 5ALMA 2BCSA 3BS7A 3F53A 2XCAA 2FMQA 5KFDA 4I2FA 3M1YA 4C7YA 5ALIA 2BPGA 1COOA 4F71A 5KFWA 3GILA 1SKWA 4P0PB 1SXDA 4OO1J 2BZFA 4ECQA 4RQ5A 2KTQA 1SV0C 1D8BA 1YZ6A 4QIWC 5J0WA 1Z00A 3H7IA 3UMCA 2JH7A 3GIIA 4ECYA 5KL8B 4K4HA 2K60A 4UB5A 1Z19A 2W8LA 1ZQLA 4Y2SA 5IIOA 2FPLA 1JRPA 1TAQA 3LVVA 5DQIA 2L5YA 4DS4A 1AQ6A 3ZDDA 4O9MA 1NK6A 1A77A 4I2CA 3QYPA 4BGDA 3PMLA 4J9MA 1BNOA 3C2KA 3GIJA 1RYUA 3L4PA 1A76A 9ICQA 3PX0A 2ZG6A 2V4RA 5ALEA 4ECVA 7ICFA 2WF9A 5DB9A 5HMLA 2ZIXB 2F77X 4M2YA 4IL6U 4PGYA 3L3FX 4GLXA 2YY6A 5HHIA 4TUPA 4C4TA 2RLTA 3H0RB 1WYGA 4P0PA 3B9JA 5EE1A 5KG5A 9ICCA 1TK8A 9ICJA 1NKCA 1OXJA 3GQCA 4ED1A 4JWNA 2ZXIA 3V72A 4F5PA 8ICPA 3M6ZA 1IG6A 2ZIUA 3WU2U 2ALZA 2F8KA 2E1FA 5HNKA 2E8OA 3F2BA 4NLNA 4QWBA 3AU2A 2K4IA 5DQHA 1XNSA 4F4WA 4ED0A 4DSLA 3EPGA 1XSPA 3ED5A 5AKZA 1N5XA 3HP6A 1NJWA 5J2BA 3CW2C 3RJKA 1ZQWA 2PMZC 2EZZA 2MSNA 1U48A 4QW8A 2JEJA 3FAHA 2FPKA 3C23A 2E8PA 4M9JA 5AK6A 4FFDA 3PR4A 3PV8A 4PGQA 4DS5A 8ICKA 2NRTA 5J2KA 3SAGA 2WB1C 2LYHA 2K8CB 2IBKA 3DDHA 4MFCA 4DQRA 4RUAA 2XICA 1T8EA 2W55A 3ZDEA 3HILA 4YD1A 4LZGA 4NJ8A 1U9LA 1CRXA 3RTVA 1S5LU 2P6UA 3UXNA 5KFPA 8ICRA 1GO3F 5K4LA 8ICYA 2XGPA 2R8HA 1WWUA 1WCLA 1T94A 5AI4A 5AICA 2Y1IA 4KLFA 5HR6A 5J8YC 4OJ6A 2KEYA 4KLSA 3OSPA 3SV3A 2DPIA 2C2RA 1ZQXA 2WF8A 2E8NA 1RM6C 2KZ3A 1XC9A 3MGHA 2MAXA 4EENA 3WKDA 4I28A 3ZDBA 2OWOA 1UQVA 1K5OA 1YT3A 2EZYA 2G0AA 3Q8PB 1BPEA 2RP5A 4P0QA 5DQGA 1ZQEA 3PSIA 4LJXA 5KNIA 2RDIA 5GTHU 4F3OA 3H8WA 1RQNA 4Q8EA 1NZPA 1FFVA 1N60A 1ZRNA 2KE7A 4F72A 4FS2A 4KLLA 1JXLA 3D6JA 4GC6A 2D8CA 2H3FA 2AU0A 4R64A 2JXJA 1ZQMA 4GXIA 3EZ5A 5ALFA 3EWAA 4NY8A 1XWLA 1L7PA 1L3VA 1ZD5A 1TAMA 7ICRA 4G9BA 1N63A 4RQ1A 1MN8A 4I2BA 2HI0A 4RQ4A 2RDJA 4C0ZA 4UAVA 2D3DA 4BWJA 4IC9A 4QWDA 3AL0B 1K1SA 5J2CA 2A1JA 2YX8A 4OD0A 1BPYA 5KAFU 3Q8SB 2PFOA 5IIJA 3JPTA 1MQ3A 2DL0A 5CA7A 3IG8A 2IOFA 2W54A 1PK1A 4Z6FA 5DKWA 3M9OB 4FZNA 4DSEA 2ZIWB 2M9NA 2HW3A 4DO9A 3BJYA 3AQEA 4FBUA 2N1RA 4UARA 5AKJA 4O3SA 3RB0A 5AKEA 1BNPA 3RFAA 2H3QA 3ZDCA 1N5WA 4PL1A 2QKQA 2BCQA 3NGDA 2KIVA 1T3NA 1ZQPA 3SEIA 3SAFA 2BDPA 9ICIA 3EPIA 1BPBA 2CN1A 4UB3A 1FEZA 4KLMA 5KFMA 1X6IA 1FFUA 4KN4A 2LHTA 2YTUA 2DUYA 2E8MA 3RJJA 4UAWA 4Y2YA 3HKZC 3SYZA 3K4GA 2KJ9A 5CWRA 1SKSA 3MC1A 2YMLA 2ZXHA 2IHMA 2KHQA 1DGJA 1JMSA 1TAUA 4O3NA 2Y0SC 4R8UB 1QSYA 4I27A 1SL1A 3ETRA 2OM6A 4PZOA 5DG9A 3OHAA 3BS5A 4ECXA 4G3IA 5AKIA 4DQPA 4Y2VA 3PW2A 3U26A 1X42A 2UVVA 2NO5A 1ZQBA 1F44A 3C1YA 2KZZA 4KX3A 1J2MA 1ZQOA 5AI9A 7ICUA 3V6KA 2YN4A 4RQ3A 2EQYA 1JI7A 5KG0A 1RXVA 5J0QA 1ZQFA 5HR7A 2C28A 1N62A 1RG6A 2KSOA 3SQIA 4WJ3B 8ICZA 1QSLA 1BVSA 1SWWA 3QX7A 3TARA 2J6SA 2W43A 2W7OA 3K1RB 2EAMA 1NZBA 2R8KA 1NK5A 3VC8A 3NVYA 3AEVA 4GXJA 2NRZA 2W9CB 4J9SA 4Q44A 3PX6A 4C4RA 3NUQA 3BS5B 5CR0A 1SL2A 2E1EA 4EELA 5BOLA 1PVPA 4RQNA 1MA7A 2R8GA 1S0OA 4QZIA 4MF2A 4UAZA 5J0RA 2IA6A 3RR7A 7ICQA 3R9KA 3OJSA 4MEXA 5ALWA 2IOHA 3UQ0A 1X40A 1BPDA 1S9FA 8ICHA 3PW4A 1T3QA 3RH4A 3GZFA 4KTQA 3HWTA 2ZJ8A 4YR0A 4DSFA 3KFUF 1RZTA 2AGPA 1Z3EB 3T5KA 4NLBA 4IQWA 4F4ZA 4UASA 2LYBA 2F1HA 1TE2A 2HHXA 3NVVA 5DB7A 3ETLA 2P6RA 7ICIA 2F1JA 4JWMA 4CGZA 1PVRA 3CRXA 4KLUA 4RQ7A 5J0OA 5KG1A 4KLOA 3IP4B 3QU4A 3QU5A 4F5NA 8ICGA 5KFEA 1X2IA 2WF6A 3DV9A 2AQ0A 4K4IA 3TADA 4QZAA 3NVZA 5KFQA 1PUZA 2JZBA 4EYHB 3SENA 1PK1B 4QZCA 8ICMA 3H0LB 1ZD2P 2K8BB 4C4SA 4R63A 3WKBA 8ICIA 3RB4A 2Q4TA 3MR5A 4J9QA 1U45A 3LDAA 1LVHA 4EYIB 5ALVA 3AN1A 4Q45A 2XIDA 2HHTA 5CEHA 3KTQA 8ICUA 5DGAA 1Z1BA 4C8MA 5ALJA 5J0XA 4Y2JA 4CF4A 4OJOA 5KT6A 2YMMA 2HHSA 2Y0SF 1V38A 1YZ7A 4I2HA 2E3TA 1F5SA 3IHQB 2JGAA 1S10A 1S0NA 2HBKA 3JPOA 9ICAA 4P4MA 1NJYA 3RJEA 1WCNA 5HP4A 3UMBA 4DL7A 4MEYA 1J2NA 3N7RC 3WK6A 4ECRA 3QZ7A 3N28A 5B66U 1F0MA 4ECZA 3PW0A 1L8OA 3V7JA 4Q8FA 2ZJ5A 3RH5A 1JX4A 2DF4B 1ECWA 2WTFA 2A3VA 2KICA 3BZCA 4JMUA 5J0UA 4UBCA 1L8LA 3AU6A 3M8RA 3TKAA 3MBYA 3LK9A 4FZMA 5ALSA 3PX4A 4P0QB 2P35A 4NLGA 5DBBA 4B9MA 4DL2A 4KLGA 3F5AA 3BQ1A 1NK4A 5ALYA 5F3XB 2UVWA 3LWLA 3PVXA 2ISOA 5BOMA 1K1QA 9ICXA 4IRCA 4KN7A 5L1IA 5AM1A 5J2IA 4B9UA 1V85A 3PW7A 3KHLA 4XA5A 1N48A 5KFKA 1HUZA 3FM9A 4NWIA 5KL1B 1U49A 4TUSA 2BPFA 5EOZA 3MGVA 2XY7A 2W8KA 3FDSA 4ECUA 2CPRA 4UW9A 3PNCA 1UA0A 2ASDA 2XVTA 4E0DA 4IRKA 4FE3A 2IOFK 1Z00B 4RUCA 5E79U 3JPQA 2C22A 1KW4A 3QU7A 4AYBF 2BQRA 1PZNA 1XU4A 2ZIXA 3UM9A 4QIWF 1N2XA 4UB8U 2ISPA 4QZFA 5KFIA 3RBEA 4DL3A 2NYVA 2KIWA 4DFPA 2XY5A 5IIIA 4QW9A 1A6SA 4KLIA 1Q46A 3JPSA 2KHVA 1EXNA 2W3SA 5KT7A 3B0YA 3KZIU 1LKYA 8ICOA 2LM4A 3T3FA 3UPQA 5CJ7A 4BX9C 5KFZA 4O3MA 1ZXIA 2ZIUB 1QQ5A 4NV0A 2F44A 1L7NA 5AK4A 3A0HU 1ZQQA 4QWCA 4BJQA 4YXJA 4M9NA 5KTQA 1KLNA 4F4KA 3UXPA 4F5OA 5AKKA 4YXMA 4DOBA 1ZQSA 2OHFA 3PO4A 2LMRA 2A19A 2NRWA 1KFDA 5KFSA 2VJ4A 4UB6U 3C29A 1S0MA 2HDOA 5ALTA 4PJ0U 2JR5A 5G5GA 9ICOA 4GXKA 2WB1F 4U7CA 9ICUA 2H3ZA 1UA1A 4EX7A 4QZEA 5HHHA 1KKXA 1KL9A 4F5QA 2CRXA 3B0XA 5DDYA 2PFNA 2AJQA 4CF5A 4QWAA 1TKDA 1X9XA 4F50A 3GV7B 4DCCA 2C2DA 4UB4A 1X9SA 2H5XA 1X66A 2J6TA 5FP0A 2KNJA 4QJFB 2HOFA 4MF8A 4DQIA 1MC8A 2FLNA 5L1LA 1O03A 4DLGA 4I2DA 2FMSA 5L1KA 2WAQF 1OW5A 3MR3A 5J8YA 2PXIA 2HVHA 5AKXA 2GO7A 2HVIA 1TFRA 2NRXA 3E58A 3QUQA 5CRXA 3FC4A 4P4OA 4OJ5A 2F1IA 4TURA 3TQ1A 2PI4A 3IG5A 1NK9A 1DXSA 1KFSA 1UCVA 4KLQA 1B0XA 4JV1A 1QH9A 2JEIA 2ZJAA 3K75D 4MFAA 4C8KA 5JUMA 2DQNB 1D9FA 1AROP 2F76X 2W04A 5AKYA 4RU9A 3ORYA 2HHWA 3PW5A 4ECSA 8ICCA 4EBDA 1QQ7A 1DGSA 4ED3A 3WK5A 3Q8LA 2UVUA 1OUQA 2G09A 5GTIU 2BCRA 4Y2UA 2VIXA 7ICKA 3I76A 4O0IA 5AIAA 3FYHA 4B9SA 4OCZA 2KVCA 4Y2QA 3M9NB 2ZTEA 5J2FA 2QLTA 3G6VA 3RH6A 4FO6A 5DBCA 1BGXT 3HPOA 4J9NA 1WWVA 5J0SA 4RNNA 2JHDA 4RQ6A 4UQGA 4P4PA 4UATA 2BR0A 2MUTA 4FZLA 2WF5A 2FMPA 2H3VA 1KFTA 3ZDAA 2F8LA 2BCUA 2A1JB 2MRLA 5ALKA 3CNHA 5KAIU 5IINA 4ICAA 5EWFA 4M6WB 1HEKA 1FO4A 3GDXA 4I29A 2XCPA 5ALZA 2GOLA 4RPZA 4DOCA 1ZQZA 1O08A 3ICXA 1X9MA 2OYYA 1TVAA 4USAA 2GLEA 1NK0A 2DWQA 2KKPA 4J9RA 1JIHA 3KHRA 2EAOA 4YP3A 5KT3A 2AGOA 3TACB 1LB2B 3THVA 1ZQJA 2F3NA 1RDFA 2FPMA 9ICMA 4HAIA 7ICOA 4F5RA 4CF3A 3WK4A 3LWMA 3RB6A 5KFRA 7ICNA 5KFLA 3N97B 4F2RA 2B6GA 4J9PA 2P66A 2LPEA 4YMNA 8ICVA 2KG5A 1ZQAA 2LM1A 1X6JA 3E0FA
chains in the Genus database with same CATH topology
3IDWA 2DL0A 1COKA 3SENA 3HILA 1PK1B 2Y9TA 4NJ8A 2JV3A 2EAPA 1PK1A 2QARB 3H8MA 1RG6A 2KMDA 2KSOA 1Z1VA 3TADC 2FE9A 5JU5A 3BQ7A 1PK3A 1WWVA 1WWUA 3KKAC 1SV4A 2DKXA 3KKAA 5J8YC 1X9XA 3K1RB 1B4FA 2EANA 2EAMA 1KW4A 2QARA 5JTIA 1SV0A 1X66A 1V38A 2E8NA 4MHVA 1OXJA 4PZNA 5L1MA 2QKQA 2ESEA 2KIVA 3BS5B 3SEIA 1UQVA 1LKYB 2K4PA 4RQNA 2F8KA 5JRTA 4NL9A 2QB0B 1OW5A 5J8YA 2E8OA 4NL9C 2YTUA 4RQMA 1F0MA 2E8MA 3BS7A 5KNIA 2ES6A 2Y9UA 2GLEA 1LKYA 1X40A 2KE7A 1SXDA 2EAOA 1DXSA 2KSOB 1UCVA 2D8CA 1B0XA 1SV0C 3TACB 4IS7A 2F3NA 2F44A 2QB0A 4PZOA 5F3XB 3BS5A 2K60A 2D3DA 2LMRA 2DKZA 2E8PA 2L5YA 1V85A 2QB1A 2B6GA 2LPEA 1JI7A 2KG5A 1SXEA 3TADA 1SGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IDW A;  2DL0 A;  1COK A;  3SEN A;  3HIL A;  1PK1 B;  2Y9T A;  4NJ8 A;  2JV3 A;  2EAP A;  1PK1 A;  2QAR B;  3H8M A;  1RG6 A;  2KMD A;  2KSO A;  1Z1V A;  3TAD C;  2FE9 A;  5JU5 A;  3BQ7 A;  1PK3 A;  1WWV A;  1WWU A;  3KKA C;  1SV4 A;  2DKX A;  3KKA A;  5J8Y C;  1X9X A;  3K1R B;  1B4F A;  2EAN A;  2EAM A;  1KW4 A;  2QAR A;  5JTI A;  1SV0 A;  1X66 A;  1V38 A;  2E8N A;  4MHV A;  1OXJ A;  4PZN A;  5L1M A;  2QKQ A;  2ESE A;  2KIV A;  3BS5 B;  3SEI A;  1UQV A;  1LKY B;  2K4P A;  4RQN A;  2F8K A;  5JRT A;  4NL9 A;  2QB0 B;  1OW5 A;  5J8Y A;  2E8O A;  4NL9 C;  2YTU A;  4RQM A;  1F0M A;  2E8M A;  3BS7 A;  5KNI A;  2ES6 A;  2Y9U A;  2GLE A;  1LKY A;  1X40 A;  2KE7 A;  1SXD A;  2EAO A;  1DXS A;  2KSO B;  1UCV A;  2D8C A;  1B0X A;  1SV0 C;  3TAC B;  4IS7 A;  2F3N A;  2F44 A;  2QB0 A;  4PZO A;  5F3X B;  3BS5 A;  2K60 A;  2D3D A;  2LMR A;  2DKZ A;  2E8P A;  2L5Y A;  1V85 A;  2QB1 A;  2B6G A;  2LPE A;  1JI7 A;  2KG5 A;  1SXE A;  3TAD A;  1SGG A; 
#chains in the Genus database with same CATH topology
 5KFX A;  3MDA A;  2YB4 A;  1U4B A;  3JPN A;  3RB3 A;  4M04 A;  4DSJ A;  1JXE A;  1CUK A;  4C80 A;  1MSW D;  2NO4 A;  4ED2 A;  3KD3 A;  3ISC A;  3MR6 A;  5D46 A;  2EAN A;  4KLT A;  2HHQ A;  4ECW A;  1DK2 A;  2ZUD A;  4LVS A;  5F9N A;  2RHF A;  5DGB A;  3JPP A;  3QXG A;  1ZQI A;  4MHV A;  3AUO A;  5L1M A;  3H40 A;  1L6N A;  9ICB A;  3M6K A;  4FBT A;  8ICQ A;  5AKG A;  5DG8 A;  3NVW A;  5DLG A;  4UAY A;  2DGZ A;  1DRG A;  2JEF A;  2HBJ A;  4RT2 A;  4NL9 C;  4M9H A;  9ICW A;  1NNL A;  3RF9 A;  2G06 A;  1HJP A;  2ES6 A;  4OJP A;  3AQF A;  2PKE A;  2G07 A;  9ICK A;  4IR9 A;  2AH5 A;  7ICP A;  2XC9 A;  2HOI A;  4EZ9 A;  3IM1 A;  1PVQ A;  4O5K A;  2F2A B;  5ALL A;  3T5H A;  4F91 B;  1NK8 A;  3RR8 A;  2IMW P;  1LV5 A;  2ATL A;  4PHE A;  2D6F C;  4I2E A;  8ICX A;  2MA1 A;  1SB3 C;  8ICL A;  1QTM A;  1TV9 A;  5T14 A;  3K1Z A;  1N61 A;  5J2H A;  3TFR A;  4ELT A;  3ONN A;  1CI4 A;  4DFK A;  5CP2 A;  1L7M A;  4US9 A;  2VA2 A;  4UB1 A;  2KFN A;  1VJ5 A;  9ICV A;  4DQQ A;  1V9P A;  2I1Q A;  5KFT A;  5C0Y A;  4C7Z A;  4FS1 A;  2FJ6 A;  3N7S C;  5H2F U;  2ZIW A;  1RYS A;  1V97 A;  4NLC A;  4DWI A;  5KFJ A;  4Z6E A;  3TAQ A;  5DB8 A;  4KMO B;  5AK3 A;  2BGW A;  1ZD3 A;  2ASJ A;  3OGU A;  4UAU A;  3PSP A;  3A0B U;  4RZR A;  5KG3 A;  1ZQT A;  2HHV A;  2FE9 A;  3L5K A;  3HRD D;  5JU5 A;  1KTQ A;  5J0P A;  2BQU A;  3GFK B;  1NOM A;  4NM1 A;  4KLH A;  5KFY A;  1QSS A;  3QE9 Y;  4PPX A;  1S8O A;  5ALU A;  3LYS A;  3RAQ A;  1IV8 A;  1JAL A;  3UQ2 A;  2JRZ A;  4PZN A;  5ALH A;  4B9N A;  5AKH A;  2OXO A;  2ESE A;  5AM0 A;  2ZUB A;  4M47 A;  5KFU A;  1QLN A;  1UT8 A;  3S6J A;  3V6H A;  3RJH A;  2IHN A;  1D9D A;  5A0L A;  1Z4O A;  4YD2 A;  5JRT A;  4X5V A;  3NS1 A;  4ECT A;  3EW9 A;  4I2A A;  2QB0 B;  3NTU A;  4QZG A;  3C5G A;  1MQ2 A;  3TAN A;  1KBU A;  3TFS A;  1RXW A;  3EYZ A;  2XGQ A;  3WKE A;  7ICT A;  3Q8M A;  1ZQ1 C;  4CRX A;  4GFJ A;  3QNM A;  4TQS A;  4DFD A;  4IS7 A;  9ICG A;  4EX6 A;  3KZX A;  5KT4 A;  1C20 A;  3SV4 A;  1ZQK A;  3AMZ A;  3GIM A;  4F4Y A;  8ICN A;  5ALQ A;  2W9B A;  1HIW A;  4J03 A;  2BHN A;  4I2G A;  2DKZ A;  2G5H B;  5J2J A;  4NM2 A;  2AQ4 A;  2FLP A;  4ED8 A;  4JUZ A;  5AKL A;  2KJ8 A;  2VA8 A;  3QUB A;  5AM4 A;  2R8J A;  1TK0 A;  1SGG A;  2MUT B;  1S0V A;  2W11 A;  3SI8 A;  2KD1 A;  4XUS A;  4I2J A;  4DF4 A;  1J97 A;  2K4E A;  3H8M A;  3ISD A;  3IN5 A;  2KMD A;  3PO5 A;  3OTQ A;  3TAD C;  1L7O A;  5F9L A;  2PI5 A;  2HMX A;  4QWE A;  1RYR A;  5IIM A;  4YR2 A;  3KKA A;  2B21 A;  1SWV A;  1N56 A;  4ED6 A;  4NLK A;  3MDC A;  3BQT A;  3HT3 A;  1ZQG A;  1TK5 A;  3O0F A;  1KEJ A;  5J0Y A;  4KLE A;  2DPJ A;  4Z6C A;  2YMQ A;  5CB1 A;  1JUD A;  3QEA Z;  4EZ6 A;  1IIP A;  1ZQD A;  3ZD9 A;  2A1A A;  1B43 A;  2W9B B;  1UT5 A;  4QZH A;  3BQ2 A;  4KMU A;  3PSF A;  2OH2 A;  1VDV A;  4RNM A;  2VAN A;  4R66 A;  4CCH A;  4C8L A;  2ZTD A;  1NK7 A;  3F2C A;  3I1Y A;  2FLL A;  4ZOH C;  1D8L A;  2KOB A;  3G6Y A;  2KZM A;  4IR1 A;  1XSL A;  4ELU A;  2JZB B;  4BDP A;  5J2G A;  8ICB A;  2QB0 A;  3RRG A;  3RJI A;  1SIJ A;  4JV0 A;  4EBC A;  1ZQH A;  4Q43 A;  4DF8 A;  2LBO A;  1VLB A;  5D4B A;  1SL0 A;  4U6P A;  3D2S A;  2B0C A;  2C2E A;  2Q0Z X;  1BPZ A;  2QB1 A;  3RJG A;  2I5H A;  3M8S A;  2JMG A;  5J2A A;  9ICH A;  1SKR A;  7ICV A;  4UBB A;  1ZQN A;  5EWE A;  3PR5 B;  4TUQ A;  2BCV A;  3VCB A;  2HCF A;  1DK3 A;  4QZ8 A;  1XO1 A;  2KVS A;  2AXT U;  1PK3 A;  3WK8 A;  4QZD A;  5ALD A;  4QZB A;  2G08 A;  2KV2 A;  2DKX A;  4XRH A;  1IM4 A;  4QNL A;  1B4F A;  2KFZ A;  4CE6 A;  2HHU A;  1NJZ A;  3D2Q A;  3PZP A;  4DLE A;  5J2D A;  4UB2 A;  4PL2 A;  5J29 A;  3N7P D;  2K89 A;  4YQW A;  4XQ8 A;  5L1J A;  1T7P A;  3I28 A;  5AHX A;  3HJE A;  1KDH A;  4DL5 A;  1RQL A;  3HKZ F;  3NRW A;  4EBE A;  5KFN A;  2W9C A;  4ELV A;  5AIB A;  1P7D A;  4BUG A;  4RPY A;  4AP9 A;  4Y2P A;  1H38 A;  4JV2 A;  1KN5 A;  2W9A A;  2XY6 A;  5CHG A;  1KRP A;  3H0M B;  1ZRM A;  4OJL A;  5AM3 A;  7ICH A;  1QQ6 A;  5AI8 A;  7ICJ A;  1ZJM A;  3C28 A;  1RPL A;  4JK1 A;  4IRD A;  8ICW A;  2ZIV A;  2UVR A;  4GIB A;  3SZ2 A;  4ACO A;  3HW8 A;  5DB6 A;  9ICR A;  5G5H A;  2VKQ A;  4KX5 A;  1ZJN A;  9ICE A;  2PFQ A;  4M9L A;  2E5S A;  3C2M A;  4KIT B;  1D8Y A;  3WKA A;  4DFM A;  2KK0 A;  2ZTC A;  4O5E A;  3MFI A;  2I6X A;  1WG8 A;  4PGX A;  3ALR A;  3SAH A;  3IDW A;  3IV6 A;  1UPH A;  8ICE A;  1ZQR A;  2OEH A;  2JV3 A;  3GV8 B;  4R8U A;  3KHH A;  3C2L A;  5KG6 A;  5KFO A;  3M7D A;  2PMZ F;  5DBA A;  2G5I B;  2ZUC A;  2BKE A;  2RRD A;  3PST A;  3WKC A;  1Q3V A;  3QUC A;  4M9G A;  2W9M A;  1JRO A;  5AI6 A;  4YN4 A;  2Y1J A;  4YR3 A;  2AHO B;  1B22 A;  3Q8K A;  1KSP A;  1S77 D;  3TAP A;  5ALN A;  2K4P A;  4DSK A;  3CYM A;  5DG7 A;  3ZI4 A;  2HOQ A;  2BPC A;  2GWS A;  3V7L A;  3OSN A;  5KFB A;  5EE3 A;  4F92 B;  4HYK A;  1XO0 A;  5D49 A;  4CDG A;  8ICA A;  3WK9 A;  4ED7 A;  3GIK A;  2Z7J A;  1Q3U A;  3OJU A;  2O6K A;  3T5J A;  5KFC A;  1Q8K A;  4BXO A;  5BPC A;  2KJ5 A;  2OCE A;  2XO7 A;  4YFK A;  4O3P A;  2HSZ A;  1JN3 A;  4JB3 A;  3OHB A;  1ZOL A;  3F5E A;  5ALR A;  1A0P A;  2ASL A;  2ODG A;  3BDP A;  3Q8Q B;  3GV5 B;  4US8 A;  2FDR A;  3J81 j;  1CEZ A;  2FI1 A;  1URJ A;  9ICT A;  3QZ8 A;  4DSI A;  4DFJ A;  7ICS A;  1S97 A;  4J9O A;  9ICF A;  3F2D A;  3H8J A;  1NKB A;  5KT5 A;  5KG7 A;  3H4B A;  1SV4 A;  2WHE A;  4ZH4 A;  3MGI A;  4C8O A;  3MR2 A;  4Y2R A;  1ZYQ A;  3V7K A;  1WUD A;  1UHU A;  2QAR A;  1S76 D;  3BZK A;  2BDU A;  4LZD A;  4M0A A;  2W03 A;  3CP8 A;  4J9K A;  2J6U A;  2YMP A;  3SMV A;  3QU2 A;  3QUT A;  5IIK A;  4DL6 A;  3H8S A;  1LKY B;  3KOO A;  7ICM A;  4IQT A;  4Y2T A;  5KG2 A;  4Z6D A;  1DOQ A;  2NV3 A;  4NL9 A;  5ALO A;  2HBL A;  2W3R A;  3RAX A;  2Y9U A;  2ZIV B;  2RQ5 A;  1L3S A;  1FIQ A;  5ALG A;  3LVW A;  2R8I A;  9ICS A;  2EH9 A;  5AK5 A;  5KFG A;  4YVZ A;  4EEK A;  5EE9 A;  3KBB A;  4BXO B;  4TQR A;  2K8A A;  4QZ9 A;  8ICT A;  4KLD A;  2V9W A;  3TI0 A;  3UXO A;  4O3O A;  5KFF A;  2XI9 A;  2KKV A;  2W7P A;  4B6J A;  4B9L A;  3T5L A;  1L3T A;  3NRZ A;  4BWM A;  1M6Y A;  4I2I A;  1ZQC A;  5C5J A;  1ZQY A;  5AM5 A;  3GU3 A;  2DFL A;  2MU2 A;  5KFH A;  2AGQ A;  4RQ2 A;  7ICL A;  4O3R A;  4PHD A;  5KFV A;  2LI6 A;  2WAQ C;  2Y9T A;  4DEZ A;  2WF7 A;  3QEB Z;  2EAP A;  4KLJ A;  3NAS A;  5J0T A;  2YQE A;  1XS9 D;  1Z1V A;  3H4D A;  3SD7 A;  5AI5 A;  8ICS A;  4MFF A;  2EZX A;  2R18 A;  4CNQ A;  4B9T A;  3G6X A;  2LYA A;  7ICE A;  5HMM A;  1U47 A;  5ALX A;  9ICL A;  3ZD8 A;  2LKY A;  1SZH A;  1T4G A;  3DEE A;  3MFH A;  2YB1 A;  1QCK A;  5ALP A;  3M9M B;  1NJX A;  2VJ5 A;  3PMN A;  4IQU A;  3RRH A;  3D2N A;  3QU9 A;  4A8E A;  3BQ0 A;  3E2E A;  4RT3 A;  5IIL A;  4B9V A;  3AM9 A;  2KP7 A;  4YG2 A;  1L3U A;  4RQM A;  2JH1 A;  3C21 A;  2I9G A;  4RPX A;  4F8R A;  3PY8 A;  3MAB A;  1L5U A;  3HX0 A;  5KG4 A;  4RNO A;  4K4G A;  2NRV A;  4GC7 A;  8ICF A;  3RJF A;  2KSO B;  2VA3 A;  2DBY A;  3ISB A;  1ZET A;  4O3Q A;  5KFA A;  3SR6 A;  1IXR A;  1KQQ A;  5EWG A;  1NI3 A;  4AYB C;  4YCX A;  5AM2 A;  4F4X A;  1Z4N A;  4J9L A;  4YMM A;  1BPX A;  3OPX A;  4IQV A;  2KN7 A;  3WK7 A;  4YMO A;  4PH5 A;  4F93 B;  1XSN A;  3EUB 2;  3KHG A;  4PHP A;  5DDM A;  4DL4 A;  4NXZ A;  1ZQU A;  3RBD A;  3IRU A;  4R65 A;  1X9W A;  7ICG A;  2JEG A;  1ZQV A;  1SXE A;  1C7Y A;  4DOA A;  2EDU A;  1HUO A;  3T79 A;  1COK A;  5AI0 A;  3C1Z A;  5J2E A;  2V4Q A;  4RQ8 A;  2QAR B;  5EE0 A;  2HBM A;  2H3I A;  3BQ7 A;  4EEY A;  5KT2 A;  3KKA C;  2GH1 A;  3UMG A;  3JPR A;  1NKE A;  4P2H A;  1ZD4 A;  3V6J A;  3N4M B;  3C5F A;  2CXY A;  4C8N A;  2K4H A;  2M0N A;  4NLZ A;  4O5C A;  2BQ3 A;  5JTI A;  1SV0 A;  1SZP A;  4RQ0 A;  3Q8R B;  5TIS U;  1ED1 A;  4F2S A;  9ICN A;  5B5E U;  4M6W A;  5DLF A;  4PHA A;  4DQS A;  4Y2X A;  8ICJ A;  2PFP A;  1Y88 A;  5TZV A;  9ICP A;  5L9X A;  2WFA A;  5ALM A;  2BCS A;  3BS7 A;  3F53 A;  2XCA A;  2FMQ A;  5KFD A;  4I2F A;  3M1Y A;  4C7Y A;  5ALI A;  2BPG A;  1COO A;  4F71 A;  5KFW A;  3GIL A;  1SKW A;  4P0P B;  1SXD A;  4OO1 J;  2BZF A;  4ECQ A;  4RQ5 A;  2KTQ A;  1SV0 C;  1D8B A;  1YZ6 A;  4QIW C;  5J0W A;  1Z00 A;  3H7I A;  3UMC A;  2JH7 A;  3GII A;  4ECY A;  5KL8 B;  4K4H A;  2K60 A;  4UB5 A;  1Z19 A;  2W8L A;  1ZQL A;  4Y2S A;  5IIO A;  2FPL A;  1JRP A;  1TAQ A;  3LVV A;  5DQI A;  2L5Y A;  4DS4 A;  1AQ6 A;  3ZDD A;  4O9M A;  1NK6 A;  1A77 A;  4I2C A;  3QYP A;  4BGD A;  3PML A;  4J9M A;  1BNO A;  3C2K A;  3GIJ A;  1RYU A;  3L4P A;  1A76 A;  9ICQ A;  3PX0 A;  2ZG6 A;  2V4R A;  5ALE A;  4ECV A;  7ICF A;  2WF9 A;  5DB9 A;  5HML A;  2ZIX B;  2F77 X;  4M2Y A;  4IL6 U;  4PGY A;  3L3F X;  4GLX A;  2YY6 A;  5HHI A;  4TUP A;  4C4T A;  2RLT A;  3H0R B;  1WYG A;  4P0P A;  3B9J A;  5EE1 A;  5KG5 A;  9ICC A;  1TK8 A;  9ICJ A;  1NKC A;  1OXJ A;  3GQC A;  4ED1 A;  4JWN A;  2ZXI A;  3V72 A;  4F5P A;  8ICP A;  3M6Z A;  1IG6 A;  2ZIU A;  3WU2 U;  2ALZ A;  2F8K A;  2E1F A;  5HNK A;  2E8O A;  3F2B A;  4NLN A;  4QWB A;  3AU2 A;  2K4I A;  5DQH A;  1XNS A;  4F4W A;  4ED0 A;  4DSL A;  3EPG A;  1XSP A;  3ED5 A;  5AKZ A;  1N5X A;  3HP6 A;  1NJW A;  5J2B A;  3CW2 C;  3RJK A;  1ZQW A;  2PMZ C;  2EZZ A;  2MSN A;  1U48 A;  4QW8 A;  2JEJ A;  3FAH A;  2FPK A;  3C23 A;  2E8P A;  4M9J A;  5AK6 A;  4FFD A;  3PR4 A;  3PV8 A;  4PGQ A;  4DS5 A;  8ICK A;  2NRT A;  5J2K A;  3SAG A;  2WB1 C;  2LYH A;  2K8C B;  2IBK A;  3DDH A;  4MFC A;  4DQR A;  4RUA A;  2XIC A;  1T8E A;  2W55 A;  3ZDE A;  3HIL A;  4YD1 A;  4LZG A;  4NJ8 A;  1U9L A;  1CRX A;  3RTV A;  1S5L U;  2P6U A;  3UXN A;  5KFP A;  8ICR A;  1GO3 F;  5K4L A;  8ICY A;  2XGP A;  2R8H A;  1WWU A;  1WCL A;  1T94 A;  5AI4 A;  5AIC A;  2Y1I A;  4KLF A;  5HR6 A;  5J8Y C;  4OJ6 A;  2KEY A;  4KLS A;  3OSP A;  3SV3 A;  2DPI A;  2C2R A;  1ZQX A;  2WF8 A;  2E8N A;  1RM6 C;  2KZ3 A;  1XC9 A;  3MGH A;  2MAX A;  4EEN A;  3WKD A;  4I28 A;  3ZDB A;  2OWO A;  1UQV A;  1K5O A;  1YT3 A;  2EZY A;  2G0A A;  3Q8P B;  1BPE A;  2RP5 A;  4P0Q A;  5DQG A;  1ZQE A;  3PSI A;  4LJX A;  5KNI A;  2RDI A;  5GTH U;  4F3O A;  3H8W A;  1RQN A;  4Q8E A;  1NZP A;  1FFV A;  1N60 A;  1ZRN A;  2KE7 A;  4F72 A;  4FS2 A;  4KLL A;  1JXL A;  3D6J A;  4GC6 A;  2D8C A;  2H3F A;  2AU0 A;  4R64 A;  2JXJ A;  1ZQM A;  4GXI A;  3EZ5 A;  5ALF A;  3EWA A;  4NY8 A;  1XWL A;  1L7P A;  1L3V A;  1ZD5 A;  1TAM A;  7ICR A;  4G9B A;  1N63 A;  4RQ1 A;  1MN8 A;  4I2B A;  2HI0 A;  4RQ4 A;  2RDJ A;  4C0Z A;  4UAV A;  2D3D A;  4BWJ A;  4IC9 A;  4QWD A;  3AL0 B;  1K1S A;  5J2C A;  2A1J A;  2YX8 A;  4OD0 A;  1BPY A;  5KAF U;  3Q8S B;  2PFO A;  5IIJ A;  3JPT A;  1MQ3 A;  2DL0 A;  5CA7 A;  3IG8 A;  2IOF A;  2W54 A;  1PK1 A;  4Z6F A;  5DKW A;  3M9O B;  4FZN A;  4DSE A;  2ZIW B;  2M9N A;  2HW3 A;  4DO9 A;  3BJY A;  3AQE A;  4FBU A;  2N1R A;  4UAR A;  5AKJ A;  4O3S A;  3RB0 A;  5AKE A;  1BNP A;  3RFA A;  2H3Q A;  3ZDC A;  1N5W A;  4PL1 A;  2QKQ A;  2BCQ A;  3NGD A;  2KIV A;  1T3N A;  1ZQP A;  3SEI A;  3SAF A;  2BDP A;  9ICI A;  3EPI A;  1BPB A;  2CN1 A;  4UB3 A;  1FEZ A;  4KLM A;  5KFM A;  1X6I A;  1FFU A;  4KN4 A;  2LHT A;  2YTU A;  2DUY A;  2E8M A;  3RJJ A;  4UAW A;  4Y2Y A;  3HKZ C;  3SYZ A;  3K4G A;  2KJ9 A;  5CWR A;  1SKS A;  3MC1 A;  2YML A;  2ZXH A;  2IHM A;  2KHQ A;  1DGJ A;  1JMS A;  1TAU A;  4O3N A;  2Y0S C;  4R8U B;  1QSY A;  4I27 A;  1SL1 A;  3ETR A;  2OM6 A;  4PZO A;  5DG9 A;  3OHA A;  3BS5 A;  4ECX A;  4G3I A;  5AKI A;  4DQP A;  4Y2V A;  3PW2 A;  3U26 A;  1X42 A;  2UVV A;  2NO5 A;  1ZQB A;  1F44 A;  3C1Y A;  2KZZ A;  4KX3 A;  1J2M A;  1ZQO A;  5AI9 A;  7ICU A;  3V6K A;  2YN4 A;  4RQ3 A;  2EQY A;  1JI7 A;  5KG0 A;  1RXV A;  5J0Q A;  1ZQF A;  5HR7 A;  2C28 A;  1N62 A;  1RG6 A;  2KSO A;  3SQI A;  4WJ3 B;  8ICZ A;  1QSL A;  1BVS A;  1SWW A;  3QX7 A;  3TAR A;  2J6S A;  2W43 A;  2W7O A;  3K1R B;  2EAM A;  1NZB A;  2R8K A;  1NK5 A;  3VC8 A;  3NVY A;  3AEV A;  4GXJ A;  2NRZ A;  2W9C B;  4J9S A;  4Q44 A;  3PX6 A;  4C4R A;  3NUQ A;  3BS5 B;  5CR0 A;  1SL2 A;  2E1E A;  4EEL A;  5BOL A;  1PVP A;  4RQN A;  1MA7 A;  2R8G A;  1S0O A;  4QZI A;  4MF2 A;  4UAZ A;  5J0R A;  2IA6 A;  3RR7 A;  7ICQ A;  3R9K A;  3OJS A;  4MEX A;  5ALW A;  2IOH A;  3UQ0 A;  1X40 A;  1BPD A;  1S9F A;  8ICH A;  3PW4 A;  1T3Q A;  3RH4 A;  3GZF A;  4KTQ A;  3HWT A;  2ZJ8 A;  4YR0 A;  4DSF A;  3KFU F;  1RZT A;  2AGP A;  1Z3E B;  3T5K A;  4NLB A;  4IQW A;  4F4Z A;  4UAS A;  2LYB A;  2F1H A;  1TE2 A;  2HHX A;  3NVV A;  5DB7 A;  3ETL A;  2P6R A;  7ICI A;  2F1J A;  4JWM A;  4CGZ A;  1PVR A;  3CRX A;  4KLU A;  4RQ7 A;  5J0O A;  5KG1 A;  4KLO A;  3IP4 B;  3QU4 A;  3QU5 A;  4F5N A;  8ICG A;  5KFE A;  1X2I A;  2WF6 A;  3DV9 A;  2AQ0 A;  4K4I A;  3TAD A;  4QZA A;  3NVZ A;  5KFQ A;  1PUZ A;  2JZB A;  4EYH B;  3SEN A;  1PK1 B;  4QZC A;  8ICM A;  3H0L B;  1ZD2 P;  2K8B B;  4C4S A;  4R63 A;  3WKB A;  8ICI A;  3RB4 A;  2Q4T A;  3MR5 A;  4J9Q A;  1U45 A;  3LDA A;  1LVH A;  4EYI B;  5ALV A;  3AN1 A;  4Q45 A;  2XID A;  2HHT A;  5CEH A;  3KTQ A;  8ICU A;  5DGA A;  1Z1B A;  4C8M A;  5ALJ A;  5J0X A;  4Y2J A;  4CF4 A;  4OJO A;  5KT6 A;  2YMM A;  2HHS A;  2Y0S F;  1V38 A;  1YZ7 A;  4I2H A;  2E3T A;  1F5S A;  3IHQ B;  2JGA A;  1S10 A;  1S0N A;  2HBK A;  3JPO A;  9ICA A;  4P4M A;  1NJY A;  3RJE A;  1WCN A;  5HP4 A;  3UMB A;  4DL7 A;  4MEY A;  1J2N A;  3N7R C;  3WK6 A;  4ECR A;  3QZ7 A;  3N28 A;  5B66 U;  1F0M A;  4ECZ A;  3PW0 A;  1L8O A;  3V7J A;  4Q8F A;  2ZJ5 A;  3RH5 A;  1JX4 A;  2DF4 B;  1ECW A;  2WTF A;  2A3V A;  2KIC A;  3BZC A;  4JMU A;  5J0U A;  4UBC A;  1L8L A;  3AU6 A;  3M8R A;  3TKA A;  3MBY A;  3LK9 A;  4FZM A;  5ALS A;  3PX4 A;  4P0Q B;  2P35 A;  4NLG A;  5DBB A;  4B9M A;  4DL2 A;  4KLG A;  3F5A A;  3BQ1 A;  1NK4 A;  5ALY A;  5F3X B;  2UVW A;  3LWL A;  3PVX A;  2ISO A;  5BOM A;  1K1Q A;  9ICX A;  4IRC A;  4KN7 A;  5L1I A;  5AM1 A;  5J2I A;  4B9U A;  1V85 A;  3PW7 A;  3KHL A;  4XA5 A;  1N48 A;  5KFK A;  1HUZ A;  3FM9 A;  4NWI A;  5KL1 B;  1U49 A;  4TUS A;  2BPF A;  5EOZ A;  3MGV A;  2XY7 A;  2W8K A;  3FDS A;  4ECU A;  2CPR A;  4UW9 A;  3PNC A;  1UA0 A;  2ASD A;  2XVT A;  4E0D A;  4IRK A;  4FE3 A;  2IOF K;  1Z00 B;  4RUC A;  5E79 U;  3JPQ A;  2C22 A;  1KW4 A;  3QU7 A;  4AYB F;  2BQR A;  1PZN A;  1XU4 A;  2ZIX A;  3UM9 A;  4QIW F;  1N2X A;  4UB8 U;  2ISP A;  4QZF A;  5KFI A;  3RBE A;  4DL3 A;  2NYV A;  2KIW A;  4DFP A;  2XY5 A;  5III A;  4QW9 A;  1A6S A;  4KLI A;  1Q46 A;  3JPS A;  2KHV A;  1EXN A;  2W3S A;  5KT7 A;  3B0Y A;  3KZI U;  1LKY A;  8ICO A;  2LM4 A;  3T3F A;  3UPQ A;  5CJ7 A;  4BX9 C;  5KFZ A;  4O3M A;  1ZXI A;  2ZIU B;  1QQ5 A;  4NV0 A;  2F44 A;  1L7N A;  5AK4 A;  3A0H U;  1ZQQ A;  4QWC A;  4BJQ A;  4YXJ A;  4M9N A;  5KTQ A;  1KLN A;  4F4K A;  3UXP A;  4F5O A;  5AKK A;  4YXM A;  4DOB A;  1ZQS A;  2OHF A;  3PO4 A;  2LMR A;  2A19 A;  2NRW A;  1KFD A;  5KFS A;  2VJ4 A;  4UB6 U;  3C29 A;  1S0M A;  2HDO A;  5ALT A;  4PJ0 U;  2JR5 A;  5G5G A;  9ICO A;  4GXK A;  2WB1 F;  4U7C A;  9ICU A;  2H3Z A;  1UA1 A;  4EX7 A;  4QZE A;  5HHH A;  1KKX A;  1KL9 A;  4F5Q A;  2CRX A;  3B0X A;  5DDY A;  2PFN A;  2AJQ A;  4CF5 A;  4QWA A;  1TKD A;  1X9X A;  4F50 A;  3GV7 B;  4DCC A;  2C2D A;  4UB4 A;  1X9S A;  2H5X A;  1X66 A;  2J6T A;  5FP0 A;  2KNJ A;  4QJF B;  2HOF A;  4MF8 A;  4DQI A;  1MC8 A;  2FLN A;  5L1L A;  1O03 A;  4DLG A;  4I2D A;  2FMS A;  5L1K A;  2WAQ F;  1OW5 A;  3MR3 A;  5J8Y A;  2PXI A;  2HVH A;  5AKX A;  2GO7 A;  2HVI A;  1TFR A;  2NRX A;  3E58 A;  3QUQ A;  5CRX A;  3FC4 A;  4P4O A;  4OJ5 A;  2F1I A;  4TUR A;  3TQ1 A;  2PI4 A;  3IG5 A;  1NK9 A;  1DXS A;  1KFS A;  1UCV A;  4KLQ A;  1B0X A;  4JV1 A;  1QH9 A;  2JEI A;  2ZJA A;  3K75 D;  4MFA A;  4C8K A;  5JUM A;  2DQN B;  1D9F A;  1ARO P;  2F76 X;  2W04 A;  5AKY A;  4RU9 A;  3ORY A;  2HHW A;  3PW5 A;  4ECS A;  8ICC A;  4EBD A;  1QQ7 A;  1DGS A;  4ED3 A;  3WK5 A;  3Q8L A;  2UVU A;  1OUQ A;  2G09 A;  5GTI U;  2BCR A;  4Y2U A;  2VIX A;  7ICK A;  3I76 A;  4O0I A;  5AIA A;  3FYH A;  4B9S A;  4OCZ A;  2KVC A;  4Y2Q A;  3M9N B;  2ZTE A;  5J2F A;  2QLT A;  3G6V A;  3RH6 A;  4FO6 A;  5DBC A;  1BGX T;  3HPO A;  4J9N A;  1WWV A;  5J0S A;  4RNN A;  2JHD A;  4RQ6 A;  4UQG A;  4P4P A;  4UAT A;  2BR0 A;  2MUT A;  4FZL A;  2WF5 A;  2FMP A;  2H3V A;  1KFT A;  3ZDA A;  2F8L A;  2BCU A;  2A1J B;  2MRL A;  5ALK A;  3CNH A;  5KAI U;  5IIN A;  4ICA A;  5EWF A;  4M6W B;  1HEK A;  1FO4 A;  3GDX A;  4I29 A;  2XCP A;  5ALZ A;  2GOL A;  4RPZ A;  4DOC A;  1ZQZ A;  1O08 A;  3ICX A;  1X9M A;  2OYY A;  1TVA A;  4USA A;  2GLE A;  1NK0 A;  2DWQ A;  2KKP A;  4J9R A;  1JIH A;  3KHR A;  2EAO A;  4YP3 A;  5KT3 A;  2AGO A;  3TAC B;  1LB2 B;  3THV A;  1ZQJ A;  2F3N A;  1RDF A;  2FPM A;  9ICM A;  4HAI A;  7ICO A;  4F5R A;  4CF3 A;  3WK4 A;  3LWM A;  3RB6 A;  5KFR A;  7ICN A;  5KFL A;  3N97 B;  4F2R A;  2B6G A;  4J9P A;  2P66 A;  2LPE A;  4YMN A;  8ICV A;  2KG5 A;  1ZQA A;  2LM1 A;  1X6J A;  3E0F A; 
#chains in the Genus database with same CATH homology
 3IDW A;  2DL0 A;  1COK A;  3SEN A;  3HIL A;  1PK1 B;  2Y9T A;  4NJ8 A;  2JV3 A;  2EAP A;  1PK1 A;  2QAR B;  3H8M A;  1RG6 A;  2KMD A;  2KSO A;  1Z1V A;  3TAD C;  2FE9 A;  5JU5 A;  3BQ7 A;  1PK3 A;  1WWV A;  1WWU A;  3KKA C;  1SV4 A;  2DKX A;  3KKA A;  5J8Y C;  1X9X A;  3K1R B;  1B4F A;  2EAN A;  2EAM A;  1KW4 A;  2QAR A;  5JTI A;  1SV0 A;  1X66 A;  1V38 A;  2E8N A;  4MHV A;  1OXJ A;  4PZN A;  5L1M A;  2QKQ A;  2ESE A;  2KIV A;  3BS5 B;  3SEI A;  1UQV A;  1LKY B;  2K4P A;  4RQN A;  2F8K A;  5JRT A;  4NL9 A;  2QB0 B;  1OW5 A;  5J8Y A;  2E8O A;  4NL9 C;  2YTU A;  4RQM A;  1F0M A;  2E8M A;  3BS7 A;  5KNI A;  2ES6 A;  2Y9U A;  2GLE A;  1LKY A;  1X40 A;  2KE7 A;  1SXD A;  2EAO A;  1DXS A;  2KSO B;  1UCV A;  2D8C A;  1B0X A;  1SV0 C;  3TAC B;  4IS7 A;  2F3N A;  2F44 A;  2QB0 A;  4PZO A;  5F3X B;  3BS5 A;  2K60 A;  2D3D A;  2LMR A;  2DKZ A;  2E8P A;  2L5Y A;  1V85 A;  2QB1 A;  2B6G A;  2LPE A;  1JI7 A;  2KG5 A;  1SXE A;  3TAD A;  1SGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...