2D3O1

Structure of ribosome binding domain of the trigger factor on the 50s ribosomal subunit from d. radiodurans
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
100
structure length
100
Chain Sequence
NKVEFKVSVPAAEVNRAYDQVWAGLARDVRVPGFRPGKAPRKVIENRVGKGYVESQVRDRLLETHYSQGLRELGLNLVDATVDPQDVQSGQAFEFTVKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title The Binding Mode of the Trigger Factor on the Ribosome: Implications for Protein Folding and SRP Interaction
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Ribosome
total genus 13
structure length 100
sequence length 100
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1050 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Trigger factor ribosome-binding domain 2d3o100
2MLXA 2D3O1 3GTYX 2MLZA 1P9YA 2MLYA 1W26A 1T11A 3GU0A 1OMSA
chains in the Genus database with same CATH superfamily
1HHQA 2XZTB 1FK9B 2JEFA 3NEKA 3C66A 1SUQB 1YJ7A 1OS5A 2W01A 1R6YA 4LQ3A 3TEGA 3M8SA 4DR6F 1FTCA 3PR4A 2JLFA 4UF4A 2XO7A 2QE5A 2OSQA 4LF5J 2HVZA 2B4VA 2W2NP 1SV5B 5K8MA 4ECZA 3T19A 3HM9A 1OQ6A 4C48A 1B7FA 4XDDA 1FD8A 1YJTA 4CP5A 2HLUA 4A47A 5GMKa 2G4BA 2BR0A 2J0WA 2VBWA 2XO6A 1XK8A 5EN1A 5IT9U 1TKXB 4NXMF 3WC0A 1TL3A 3P5TL 1VRUB 2IMWP 4WXWA 2M3DA 3DHXA 2Z8QA 1RT1A 2XNRA 3HVAA 2JHEA 4RBVA 1J5EJ 1TK5A 4OYMA 3MMAB 1P6TA 4CLWA 3Q8SB 1OPZA 1SPBP 2P9CA 2HS4A 2VQEJ 1UJ6A 3HJVA 4NLVA 1FFWB 2AEJA 4FBTA 3TARA 3WZ0A 3IA0A 3DFEA 4CLFA 5K8OA 1FWLA 1V3ZA 1XQIA 1AFJA 2ZOGA 4LSLB 3D1QA 3D4JA 3OSNA 4UQTA 3N5BA 2CZVC 4LUBA 1LWEB 3JTPA 2GGPA 1UFLA 1TL1B 1X5PA 4B9SA 1WJ9A 3ITHA 2EFVA 2X51A 1NU4A 1FE4A 1UW4A 4K0KJ 4EI2A 3KKFA 2ZDPA 4MT1A 2DGOA 2ZOFA 2HNYB 2FZKB 1D9AA 1EAYC 3VAIA 4RNFA 1R43A 1UZHA 3NGRA 1KFDA 4DCOB 2LXFA 3OLBA 4DR7F 3FSIA 3G4SS 2AEMA 5A6PA 1VBYA 1MLAA 3NMRA 4WIQA 4USMA 3HHLD 3JXOA 3IC1A 2CFXA 3T6JA 2YH1A 4RO0A 1HBUB 5K8NA 3BQ0A 4R0EA 1T7PA 4ZVFA 2O5DA 3KFWX 4FNHA 5DG7A 3RU0A 4J9PA 3PX4A 4R8UA 4JP8A 1N56A 1BQXA 1V9OA 1YIJS 1VR6A 3EPIA 2I38A 3DLGB 4IG0B 1U0SA 1XMQF 1FNOA 5ETQA 5CYQA 3K7RA 3M7VA 4NLUA 2OIHA 2ZNZA 4E2FB 2BZ2A 3RRGA 2VG5A 4QWBA 1MROA 2RS8A 2CPZA 3UCZP 3R97A 1HYSB 2F65A 5HATA 3QFHA 3TWZA 4DV2F 1IVZA 1RKJA 2H9ZA 2LQ8A 2YKPA 1AFIA 4Q0BB 2H4YB 5IV4A 1LV5A 1EKSA 1WHXA 4DL7A 4LF7J 2NSCA 2K8GA 1S1VB 4KRWA 5L1LA 2EFQA 5HQLA 5AJ3J 3CDEA 1NJIT 2HHVA 3MPWA 3IWLA 4NASA 5F8HA 4I1TA 2IRYA 3NL0A 1U6ZA 1VC5A 1H72C 4TN2A 2D3ZA 5E41A 3AD9C 4CLSA 2OPRB 5IV3A 2IM3A 3QGGA 2DH9A 3GJQB 5J2PB 4DS5A 2Y0SD 1FJCA 1JK9B 1U8SA 1ZS6A 3W2VA 3FKBA 1P8GA 3TA1A 3FCVA 2BJ1A 2IDEA 1F60B 4DOZA 3GWCA 3VF0B 2E7WA 5A2QY 3V4MA 2XNQA 1PJ5A 5F8IA 3Q8YA 4I2PB 4CH1A 4LT6A 3CVKA 1T8EA 5EDWA 4IKAA 3ELHA 5BYRA 2DR5A 2M5YA 3LP1B 2JEJA 3A12A 2HQIA 2VA3A 3T5LA 2XI2A 4U7UK 2FGCA 2CWKA 4ZPVR 2ZH5A 3OFGA 4V1Ak 3N6MA 4ZITA 3NOCA 3EXCX 2GJ2A 2HBZB 4JI0F 1FDBA 1HHTP 5J2MB 3T6BA 4WTYA 1ZAVA 4M1KA 3FEXB 1BC6A 3T3FA 4O0NA 3CUNA 2RE1A 1NJWA 3UQSA 4YN3B 2YWEA 1KQSR 3KLIA 3BZQA 1OIAA 1FRMA 4USWA 3PW5A 4PG5A 2XMVA 3HD1A 1YITS 4M5KA 1WC3A 4UTGA 1FVSA 3V6HA 2XLIA 3ZZUA 3SBMA 5H9FK 1JLFB 3BB5A 4W4MA 3OVSA 2ZE2B 1NHUA 2OAUA 3ILIA 3R5CA 2YQ0A 3LH2S 1XNQJ 2L41A 3UVJB 3MOJB 2CPJA 2LMIA 3QWPA 1HA1A 2KXHA 1RXOB 3EGZA 3G6YA 2C2KB 4GVBB 1I1GA 1RACB 3BKFA 1AUSL 3L95X 1X7VA 1YHQS 2HHPA 2MKIA 5GAHU 3VAMA 4AYBD 4RNOA 1YBAA 3KUEA 3BF4A 2AYMA 1BWVA 1FEHA 3I6PA 3CCJS 2VOOA 1B4SA 2E1RA 5GAGU 1XERA 4ZIVA 1GX5A 1VQLS 2FJAB 2KYXA 1SJQA 1RAOA 2R8HA 2C3MA 4ANCA 2HAFA 3MEDA 2HURA 1U49A 4KR0B 4WYWA 3L3CA 2C2OB 3KLHA 1RHKB 4O3PA 4A4JA 1S59A 4FKXA 1LXNA 5DLGA 4B9VA 4DR3J 1F3VA 1WDTA 4J9SA 1HI0P 3F44A 3F0NA 1JJHA 2VODA 3DRSB 4ATNA 1YZ7A 5CXTA 3HSJA 4IYQA 3TAMA 1U24A 4YR3A 1K8AT 5B0AA 1OY9A 4QQBA 5A0YA 1F9HA 5KG3A 1Q78A 4IH6A 3FFIA 2Z2ZA 1ZM4A 1AXQA 1DQ8A 2RQMA 1HW8A 4DR4F 4O3SA 1MMDA 1Y4ZB 1V3SA 2DKOB 3O8WA 3HHLB 1RAIB 2MJNA 4CZCA 1MW7A 1Q5VA 1J5OB 3CDAA 1HWLA 2E7XA 3MD1A 3MF5A 2J7KA 3PX6A 1SQGA 5KFRA 5DDOC 1QAXA 4MK9A 3EUNA 2GVZA 5HQ8A 4JI7F 2OO4A 4AD6A 3HT0A 4B3TJ 3UFCX 4Y3CA 1WSVA 4ECSA 4DN0A 3A4TA 3UD3P 4Y2IA 5BR8J 4AQYJ 3CCMS 3OXGA 1M5HA 3SCKE 2YNFB 3D6TB 5A8KB 1VBZA 5J1EA 1GAOA 3ZTQA 3BR8A 4DHVA 1HMVB 3FMWA 3HK2A 1RLCL 3HMJG 3MD3A 4YDXA 4P9SA 3MXHP 4C6AA 1HARA 2CPIA 2A18A 1HNZJ 3DHWC 1EHWA 4FYXB 1CJVB 4PWDB 1JXLA 1VCTA 5HBMA 1REVB 2DTJA 2ZH7A 2H5IB 3HHKA 5CZVA 2W9CB 4Q43A 3DOLA 4NLXA 4DV1J 1RGVA 1WF0A 3GFZA 2J6UA 1FNMA 3EGNA 3THVA 2AF6A 2E5JA 2DO4A 5EUHA 2OGUA 4ZPTR 3QSYB 3H5SA 3B6BA 2F4VF 2KZMA 5HVHA 2WOMB 2MKKA 1RABB 1ZM9A 3M2UB 4LF6F 2XSJB 3TUPA 3G82A 5KFTA 1WC1A 1HPZA 1S1XB 4CTAB 2Q6CA 2XMWA 1SH0A 2I8EA 3FGVA 3TA0A 1DBDA 2QRRA 3HPOA 1HI1A 5AXMA 3FSYA 3MEEB 5L1KA 3MECB 3PX0A 2NREA 4C11B 3MPDA 1NEEA 3GG1A 2HHSA 3FK4A 1NB7A 4U7CA 4B02A 1BUXA 3CD6S 1PGZA 4X4OA 2WW4A 4XK8C 1R0AA 1UA1A 3DM2A 2HFNA 4JI8J 1NK4A 2K06A 2V0NA 1TK0A 1XR5A 2VA2A 3HULA 1TVRA 2QMWA 4LRDA 4Y6IA 1XC9A 5ETOA 1NHKL 2VPXB 4LF2A 2GVDB 2EK6A 3X3UA 4FPRA 1U7LA 4ZDNA 2UVVA 4D3HA 1W7WA 4LF9F 2R8IA 1VQ4S 2IBOA 5HQMA 4B9LA 3Q0AA 3O2IA 1XR6A 3MPUB 4BBYA 2R7VA 2CA9A 5KFZA 3HO1A 4ZP6A 1G4CA 3KHRA 1WOSA 1KOHA 1E6VB 1OYDA 4ZCLA 3H20A 4H4OA 4ZVTB 1S1WA 3DDKA 3QGHA 4K8RA 1VK3A 2V8VA 5FLXY 2GHPA 3DI6A 3CDUA 3K5NA 3DDNA 2OD6A 4NLDA 3NCRA 1FJGF 1NK5A 5EX3A 3QLHA 5L1IA 4JI2J 1UL3A 5IM0A 4F0KA 3CNQP 2HQDA 1H98A 1SIZA 3HD2A 5I3UA 4C9DA 3VAKA 4KO0B 5HVGA 4I7FA 1XNRF 5ETLA 4J9RA 2VZ9A 3R3TA 3PHEA 4A8XA 1LK7A 2X1FA 1RISA 4X62F 3KTQA 3MEGA 2RAQA 3BO3A 4TKTA 1CG2A 5F9NA 5LXRA 1MNEA 1JLAA 3HHNB 3CT9A 3OFEA 2NZCA 1KVKA 3CE8A 5JVHQ 3LANA 3MM9A 3T9NA 4F4KA 1FEEA 1W2IA 2RU9A 2KTQA 4WP9A 1QSLA 3KNAA 3M30B 3TVYA 3TR5A 2H1YA 2BJ3A 4DV0F 1Y7PA 3IS9B 1S0OA 5KG7A 5HMXA 1KBRA 1P1TA 4NEZA 2ZBPA 4MJKA 2YKNB 3HSDA 2XWYA 3RBXA 4ZP7A 1EP4B 3M2VA 4OV1A 4OI6A 4OZNA 1QLNA 1JLEB 4FYVB 2M8HA 5HMZA 4X66F 3ICLA 4LBHA 2MQNA 4DFMA 2XMUA 3J7ZT 4C3MA 2VOPA 4PPDA 4OLPA 4B3MJ 4YOEA 2ZH1A 2D1CA 2X1GA 1E6YA 4HEA9 5KFGA 1SL2A 2OPQB 4OYAA 2VBYA 1IKYA 4ICLA 4ECWA 1F9FA 5GVQA 3R1HA 3TA2A 1SI9A 1TFWA 2FJEB 1SKSA 2N7YA 3X1LB 1RTIB 1O5JA 3BYPA 3QMQA 4WKRA 2UXCF 5IQ6A 3PYGA 4YB7A 3JYTA 3IM8A 4A8MP 4DCPB 4ZVQB 4L6V3 2F9DA 2M2BA 4DR1J 3ZNJ1 1KD1T 1DLOB 3J80Y 2VONA 2BACA 3TAQA 3E01A 1DAXA 2HHWA 3Q2SC 2CAJA 1BE4A 3W5ZA 4Z2XA 1D09B 4K4TA 1F6TA 4FXVA 2RUSA 4YY3J 1KP6A 3R6GB 3CMAS 2WHOA 5DQHA 2BEFA 2KFZA 4OX9F 3L7OA 2EKNA 4MTPA 2N3LA 2QLXA 3N5FA 2XS5A 3PRVA 4X4NA 1U1RA 2LECA 2VQFJ 1IR2A 2VL1A 5DM6Q 1FESA 3QT6A 2UXBF 1FXRA 3S01A 3KWMA 3THPA 4IOCQ 2NXCA 1BQNB 1SQFA 2BDPA 2W8LA 2D3OR 1X0FA 1FO1A 2MMYA 2OEKA 2D7SA 3DLLQ 1R8CA 2FJWA 1WELA 1N36J 1IBCB 4F0MA 2Y1JA 3CMQA 4MH8A 1IXKA 3Q8RB 5D3GB 1Q8BA 2Q66A 4I56A 2R7SA 3CWJA 2FQQB 4LSNA 4DPYA 4JI5J 3GFYA 3ENWA 4G1PA 2XYHB 3W60A 2KG0A 2RH3A 1TKZA 3DGPA 4U6PA 4ZP9A 4GKJJ 3I9V9 1VMBA 2A1BA 3QAEA 2IFXA 2FVPA 3PYDA 4OI3A 4TLQA 5F41A 1J2VA 5C5JA 3T5HA 3IRXB 2KXNB 1EZZB 4TY8A 2QX0A 5F0UA 1FX4A 2WB1D 3M8PA 2LVWA 3OR2B 3LP0A 3TVZA 2UUBJ 1UVNA 4FS2A 4OYXA 1KTQA 3THTA 3VVTA 4KAIA 3W9IA 3IG1A 2AIRB 2O66A 2VD3A 4WXOA 2C2NA 3GIJA 5L1JA 3PG9A 4EGLA 3BH6B 2J6SA 3TOQA 4FYDA 2DGSA 1FDDA 3IAS9 1ELOA 1GMVA 1TKTA 2G2OA 6FDRA 1HWUA 2EFPA 1VHIA 3PACA 3CJ4A 1HNWF 3HKWA 4DCJB 2V4RA 2HQFA 1HMVA 1U1QA 5HI7A 2YNIA 2PO4A 2MDAA 3RB4A 4ZJOA 2WB4A 3R6LB 4DG1B 3EMTA 1WUUA 1SH2A 4DPXA 3P45B 1JMTA 3FEYB 4F04B 3KHGA 3Q22A 2LQBA 3T1YF 2M4MA 2OEMA 1S12A 1HLWA 1U1LA 3VTIA 3EDRB 3FRYA 3M6UA 1RWUA 1IR0A 5HROB 2CPHA 5KFIA 3IP0A 4P7VA 1U02A 5KFYA 1B7YB 2MHNA 3KG4A 3TJ8A 1X9SA 1TUGB 3MM6B 3W64A 2ACMA 3G8QA 3NCQA 1L3KA 5B08A 1H2VZ 3OTCA 2RF2B 3QIDA 1OY8A 1S4EA 3R9LA 1N33J 1A6LA 1N5YA 4RU9A 4OQJA 1OJ4A 1J27A 1SB6A 1AB8A 3K5LA 4USVA 4TU9A 1WC0A 2DGVA 4KHPF 3R5AA 3QO9B 3I0RA 2AV5A 4RKUC 3N9UC 4LVNP 3KG0A 3IAM9 1WKLA 3ZZRA 1RT5A 2ZDOA 1JLGA 1VDHA 3DLEB 2CQ3A 2BBEA 4DX6A 1RZMA 1QTMA 2B6AA 3R8YA 2I1RA 3C16A 4A8YA 2GS8A 2AJ2A 1ZOTA 3QSIA 3D68A 4DLGA 1HQUB 3DLKB 3VQTA 4P2SA 1IKXA 2OMOA 3BN7A 1Y5IB 4OZ5A 2DNNA 3RBDA 4YP3A 1Y5NB 2G0JA 4A8SA 4W90B 4D3GA 1RT3B 3H42A 4DPUA 1N52B 1ZBTA 4DS4A 2BQ3A 4QCLA 2DNLA 1CPZA 1OY6A 2OPPB 1Q8LA 2XMAA 3RZAA 1CQNA 4DR5J 2ZM6J 2I0XA 1SQEA 2ZEJA 4OHXA 2VUGA 1HR0J 3MAQA 3AJ1A 5KFVA 4P2MA 4GC6A 2J0SD 2RJZA 1NDCA 4KE5A 1OMSA 2QFIA 4ID8A 2GAHC 2PA8D 4ZCKA 3MR3A 3K8VA 4HHUA 3T1HF 2P9EA 4KH0B 4DF4A 1OSCA 1AZSB 4RW7A 2LKZA 1WHWA 2CQPA 2G9OA 4N47A 3GB0A 1VJWA 3M8QB 2CG8A 3IGVA 4X4SA 3J81U 5LMNF 4C8KA 2EWHA 4ZHRA 3PW0A 2WRMA 1YZ6A 2QIFA 3EDQB 4GO5X 5AE3A 4S0MA 5HN0A 4HHJA 3K5MA 1CJTA 2CUYA 1RLDA 1X0PA 4C3LA 1NSPA 1S1TA 4TQSA 1LWFB 4I64A 2ZH2A 2I6WA 1RT4B 2MSSA 2OI2A 3TAPA 3A1YG 2J9DE 4PYDA 2ZH8A 4G65A 4YB6A 2A6MA 1Q5YA 2JRSA 4EU0A 5A8WA 1NNDA 1DTQA 3ETMA 1KONA 4OJHA 4F3QA 2HMIA 2VFTA 1M1KT 4WIIA 1VRTA 2IVFB 1N6QB 1VI7A 1Q0NA 1K44A 3CC2S 3MAHA 2C42A 3PEHA 3WDOA 2U1AA 3ILJA 2IC3A 2M9KA 4RNMA 2V9WA 3FBEA 2CZ9A 2LQ5A 3GR0A 3RG6A 2NXUA 1FDNA 2IM1A 2EBGA 2K7KA 1FERA 5KFNA 1S77D 5HLFB 4MFBA 2QLJB 2H51B 1RTJB 3RRKA 1RBLA 1HBNA 5C2GA 1FD2A 2HYIB 1HIYA 2O1PA 1TP7A 3DLBA 1IBMF 1C0UB 2KH9A 4ZJQA 1B0TA 5KFCA 3T1AA 1S7HA 2BJ8A 1R27B 1DTTB 1Y3KA 3QT5A 4F3MA 4NZ6A 2CJYB 3RTVA 3JSMB 3ZO7A 4DX5A 3IXQA 1XMOJ 2XZWA 3DU6A 3T41A 1YTYA 3CGIA 4WWSA 3MDFA 1SJ3P 3POTB 1VC0A 3DGVA 2V34A 1BWEA 4UOGA 1B99A 1NKEA 1TMMA 2ZVSA 3MCSA 4IFYA 1U0HB 3DOKA 5B09A 5GMDA 5SUHA 1F1BB 2R2SA 1JLBA 2F7VA 1JB0C 3K57A 1YBTA 4F4XA 2NYHA 1TZ0A 2XYGB 4PG4A 4O3QA 1VYAA 1KSPA 1WEYA 2DCUB 1XR7A 2I5JA 5D0EA 2X3GA 1RUSA 3NBPA 3CJSA 4ES2A 1UJ5A 4USKA 1IKWA 3VCDA 3C14B 1T9XA 5KFOA 3ILOA 1S0VA 4BCAA 2PEBA 3DYAB 1GXLA 1D3WA 1NPPA 1K1QA 5F8GA 4C8ZA 2C28A 2M70A 3S8SA 2GV1A 3NWRA 2WCXA 3KHHA 1FF2A 3Q24A 2DIUA 3ULHA 2C2MB 2WTFA 1YLXA 2XY6A 1I94J 2WSFC 3OW2R 5ETTA 1KS2A 1O6XA 1YJNS 2RQCA 1VIXA 1S6OA 4K4ZA 3M8ZA 3TYTA 3N4WA 5M2RA 1RKIA 3ZZZA 1LWCA 3AH6A 3BR9A 1RWMB 2OTJS 1S7IA 3OTBA 4DV2J 4NLPA 3PW7A 3GFXA 1YRXA 5HL7Q 3LOUA 1RT7A 4HACA 5FDLA 5A8RB 5IZHA 4JI6F 2HS0A 3O44A 5IT9Y 3AD7C 4DUYJ 1UVKA 2HHXA 4X4QA 2O3DA 5D0RA 4JYAJ 2ZWOA 3BYRA 4YR0A 1RWXB 4Q45A 2EFNA 2HZAA 2Y1LB 4Q5VA 3UPFA 2LP4A 3KK3B 3CC4S 2AJ4A 3J7AN 4LMZA 5ETRA 3IBCB 2GQQA 3HCXA 2UVWA 2HK3A 3H0PA 3I0SB 4RWXA 1RCXB 3CCVS 2YX7A 2HVHA 4NXNF 5B0FA 4NCBA 2HIYA 2LLZA 2VDHA 2VPZB 4YDDB 4OYPA 5G0RB 1H74A 4CLTA 3E8OA 2QLBB 1NJXA 1LW0B 1K9MT 4KJIA 2CYYA 1WC6A 5F9LA 1S6PB 3D5MA 4RW6A 2KB2A 4KGZB 3NCPA 3P4UB 1N88A 2MLXA 3A8IA 3DOMB 3KK2A 3GIKA 3WBZA 4EYIB 2YKAA 5K5MA 1NRKA 2IA6A 1C1BB 2BM1A 4JI0J 5J1PA 2MY7A 4Y34A 2QMUB 2QT7A 4V19J 4TYAA 2LA4A 3VAHA 2RMLA 1VOMA 2C3OA 2MKSA 3UDEA 2HFUA 5L9NA 1S72S 5D4OA 4L3NA 5HK4A 1XMBA 1MMNA 4O44B 3QRPA 5DQGA 2RF2A 3U1MA 1KDNA 2AU0A 2HRUA 4G1IA 3W5YA 1YJRA 3MCOA 3EE3A 5LSOA 4PR6A 1VISA 3A3NB 5KOXA 1EIYB 3EGVA 3HVTA 5B0CA 1GK8A 3CB4A 3J7YU 2RB7A 4IQXA 4ZVSB 4IR1A 5KG6A 1RTHA 2BE7D 2IYGA 4WE1B 2XHCA 3RYLA 2FHMA 1Z2ZA 5I3QA 4KKOA 2YKMB 2JVOA 3OQ2A 1M0SA 4F3OA 1BGXT 4M63A 5E3PA 5JJBA 5DG9A 2HHHJ 2HHQA 3SQGA 1PBUA 2KN4A 3JSBA 2C2RA 3PZPA 4A8QA 2QG9B 2CKWA 1CVJA 4N41A 2WONA 4M5HA 1XIQA 4B3RJ 2APOA 3OTOF 5D0HA 3ZFVA 1CJUA 5KG5A 1RT2B 3GJSB 3D6HB 1VQ8S 1NKBA 1RA7A 3G2XA 2V2ZA 3RAQA 1M5OC 4J37A 1RI7A 3M9OB 3CJ0A 5GAEU 4DL2A 3CJTA 4KQZA 5U47A 3HZGA 2UV8A 3VZIA 5KT3A 3JTOA 1RBOB 1GTHA 2HGLA 3M6WA 3D66A 2RDIA 3CCUS 3BGRB 2GMHA 2JNJA 4CRJA 4WK3A 1TV6A 3DRRB 2PFFB 1SKWA 1IQTA 3D9BA 3BDPA 4PQUA 3UCUP 5MAOA 3PCOB 1WHYA 4PYAA 3TEHB 2B0GA 1APSA 4I2QB 3D28A 1C0TB 3MAAA 2OPSB 1OPIA 2SXLA 2ZHOA 1K1SA 2RKIA 2J8AA 3GYGA 3N0VA 2W25A 3G6VA 4PKDB 3CJKA 4U95A 1VFJA 4P6QA 5H9FJ 2GX8A 5DETA 1RAFB 4DZ6A 2QO3A 3OL7A 1N5VA 3LALA 2MQLA 1BQMA 4DV6F 2C3UA 3UDVA 4M5NA 1H2TZ 4Z37A 3M8QA 3ZTOA 2AZ3A 4WJBA 3M2RB 4LF4J 5DZ7A 3BPDA 2KJWA 5GADI 1KOOA 2DHXA 2R2UA 2DHSA 2DXEA 1M5PC 2CJKA 2GIQA 4FVMA 1TQLA 2DH7A 5DJBA 2M88A 2Y8YA 1CSJA 1RJJA 3MUVP 4N56A 2F8MA 1U2RA 4ILRA 3U7JA 3C6UA 1D9FA 3EGWB 5B7WA 4H4MA 3R7SB 3N79A 4E8UA 3VHQA 3MURP 3TANA 2OFHX 5IC6B 2FC9A 2PMWA 2UUAJ 3VGSA 4MK8A 2R7OA 5HP1B 3BV8A 5MLCV 3MR7A 4F02A 2AGPA 1MN9A 1M5SA 3F41A 5KFUA 2F8EX 3R2DJ 5C24A 1MU2B 3KDNA 3AD8C 3W2WA 4KGKA 3EYZA 3PR5B 3OPKA 1Q7LB 4DEZA 4K59A 4LF5F 1X9WA 3I31A 2DRBA 3A13A 4PG7A 1FRXA 1CULA 2LXIA 4GMKA 3VGUA 4KB7A 2YX1A 5KAKA 5KFJA 4R5PA 2DRAA 2EXUA 4DUZF 2V63A 3SV4A 4NCGA 2V4JA 1OSDA 3VV2B 4MK7A 4DQPA 2KI2A 2FHJD 4LF6J 4DPWA 2MGZA 2J6TA 4HH0A 1T03B 3TJAA 3I96A 3IWXA 3N6NA 3VZHA 3KJQB 3LUYA 2AZ1A 3GSDA 3QIPB 1PYOB 2ATLA 1HW9A 5L46A 5D6GA 4F2SA 5H9EK 2WVDA 4CNYA 1RB0A 1J5EF 3SDEB 3CJ3A 2CNOB 4CO2A 5IFMA 1S1UB 3KLGA 4L76A 1RYRA 1Y9OA 1SC6A 1ZPWX 3M05A 4U9RA 5AE1A 2AKWB 1LFWA 2CQ4A 4HT7A 4NZ0A 4CYUB 3MCNA 3HXMA 3QT8A 2YPZA 4NLSA 2Y0BB 4UOHA 5RUBA 1FXLA 1CJKB 3DMJA 2XY7A 2HQCA 2RQKA 4LR8A 2OHDA 2E5GA 6FD1A 3IR7B 2Y3YA 4I6WA 2K1RB 2ZBIA 4XO0A 4OZ2A 2BE2A 1X9MA 1KKHA 1HBOA 2QA1A 2KHCA 1S48A 5KT4A 2ZD1A 3EZUA 1RADB 2MZJA 3D0IE 2FB0A 2HVEA 2QA4G 3NRBA 4ES3A 5GMEA 4QR0A 3V6DA 1ULRA 1RTDB 4DSKA 2B5JB 5JUMA 1KLMA 1HWIA 4UZCA 4UZBA 2BJDA 4I6AA 1NUEA 3NGDA 4ILLA 1FWPA 1NK0A 1D8YA 4Q44A 4JI1J 3AQPA 1M1HA 4NLQA 2HBQB 2CQ1A 2R7TA 1T05B 3E2EA 2KVQE 4M95A 2WVCA 3CPWR 4X4RA 2UVUA 3Q83A 3LQVA 1X8DA 3TRGA 1QD1A 2R7WA 1JLCA 1VQ9S 1RQ0A 4O4GB 3H5YA 2W9BA 4C3KA 2VFSA 3MFIA 2VU5A 4YHHF 4FVCA 1KTVA 1PC5A 4OI2A 4RU2A 2HG4A 2DXFA 3VAFA 4ZVPB 2AJFE 3G86A 4LFBJ 1QAYA 2FUG9 4B3OB 2CXEA 3LP2B 4DV5J 4ZLNA 2G0IA 4URSA 3LWMA 3QFWA 4OYOA 1PKUA 3I0SA 4JBCA 3QT7A 5K20B 2FVCA 1YWXA 4WFYA 2E5IA 3KMSA 3L7PA 5C2CA 4M5DB 2HSEB 4LF7F 4ETXA 1IUJA 1RWNB 2ASDA 3GIIA 1C1CA 3NG8A 4NLTA 4QR2A 1S9EA 3TQEA 1TELA 1U25A 2P9GA 2HKEA 2AYEA 3JQJA 1F9EB 1WI8A 1QE1B 2ILYA 1ZETA 3HT3A 3G8TA 2GJFA 3TJ9A 3BO4A 4L3KA 4WZMA 4PCQA 2BYCA 2DR7A 4A8FA 2J7UA 4F67A 1LKZA 1SC3B 4F4WA 4FF2A 3HI9A 4JV5J 4HLBA 4X4VA 2NUHA 3KLEA 1O51A 2X3DA 3IMQJ 1T3NA 3VALA 1B64A 4UUXA 4IR9A 2B51A 2OUGA 1X60A 3JS9A 2IJRA 4K4UA 1VQOS 2J9EA 3DRPB 2DPIA 2CPXA 4Q2MA 2M0GB 2HNDB 2MKCA 2ZITA 5IC4B 3ETOA 4HYKA 3M4XA 2LU2A 3DXSX 2DEJA 2MKJA 1TU0B 1FE0A 3MUTP 1FKOA 4IDKA 3MM7B 2K2PA 1LNQA 5B0EA 4E98A 1CBKA 2EFGA 3E3XA 3MMBA 1X4BA 2PE8A 4OX9J 1AYEA 1DZ5A 2HWHA 3BSNA 1RT2A 3CD0A 3OL6A 4P72A 3MM8B 1FX2A 3WHIA 1N54B 1R3NA 4A46A 4F26A 4RPFA 2E9TA 4RW4A 2Y1IA 4USHA 1LW2A 2Q6BA 1JKHB 4DXLA 1XNQF 2XGPA 2VICA 4OI0A 5C25A 4PUOB 4TVAB 1UWBB 3CULA 1SXLA 2HGNA 5J2NB 1T9YA 3BH7B 3DC2A 5KFEA 2VPWB 1UFWA 1VJQA 4ZK7M 1PBAA 4B17A 2MXYA 3OUYB 1G7CB 3Q89A 2W1BA 4ZJLA 4ECYA 1CS4B 2W2OP 4M5IA 4CO0A 5T7LA 1CC7A 1Z4UA 4EMDA 2WVFA 3MMCA 3R7BB 5KT7A 2XLJA 5LMUJ 3CCQS 3O5TB 2QLWA 3H4DA 1PYSB 1MSWD 2RDDA 1VQ6S 2Z2YB 3UR0A 3Q8VA 2RS2A 5KFKA 2A10A 3ZZYA 4ZKAA 1HBMB 1REGX 3HSGA 3AJ2A 4KV8A 4QYRA 2B9EA 3N6LA 3M32B 5HAOA 1HQEB 1M5VC 1RA6A 3QJLA 4DR3F 1SC4B 1U6FA 1FA0A 1EQ0A 4DJBA 2QJ3A 2F3JA 5KFLA 5IT0A 2AD9A 2DGUA 1BXNA 3BSAA 4MIWA 1JJ4A 4P73A 5KT5A 3QBCA 1Q81T 2BRKA 2BANB 3JQMA 4URQU 3FRZA 4NYOA 1UZDA 1TL7B 4IO9Q 4KPCA 2LEAA 1HNWJ 3MM5B 4EZ9A 3C15B 2DD8S 5K14A 4RUHA 2QN6B 2YWFA 2ASJA 2Y9HA 1VHFA 4K5SA 3QNWB 2J7WA 4C8OA 5ETMA 1HNVB 3W7BA 3BBFA 3QGPA 1R8HA 1YJUA 5BR8F 4AQYF 2MQPA 3AODA 2ADCA 3PJ9A 5AE2A 5JVGQ 1S6QA 1QVGR 3BSCA 2FYXA 2ZZTA 2ZHAA 3I4HX 2AEFA 4OJ1A 2HNZA 2GAGC 5DRKA 2EC0A 4G1QB 3ZC4A 2VG6A 1H7XA 4FYWB 3V81A 2W7PA 4J9NA 3HSZA 1HNZF 1SIWB 3M1VB 4ZN3A 3I82A 4KHPJ 1FXDA 2IAJB 3OR1B 4O3NA 3V2UC 2LU1A 2XB2D 3AY0A 4NI2A 1ZZNA 4KHMA 5KFQA 4C8MA 1KHWA 4ID5A 3CJRA 4CH7A 5IWAF 4DV1F 4NA3A 3H98A 2VB6A 2Y8WA 5C42A 4RW9A 2NLWA 4CCHA 2UXDJ 2DNOA 5FD1A 2YWKA 4GO7X 1Q1KA 1AUDA 2BQRA 1X5OA 3W61A 2BJ7A 3GR1A 4X84A 5CD4A 5FJ4A 5ETSA 1EETB 2MTLA 4UT4A 2DNKA 1N5SA 2V5HG 4WP8A 3NS5A 3KLFA 3U1NA 2C2EA 1OWXA 4IFVB 1Y3JA 3EZ5A 2XS2A 3IFEA 5F8LA 2VFRA 4JV1A 5EWFA 3HF5A 1WDDA 4HH1A 4ZVRB 3C6TB 4N77A 4PRFA 5IT4A 5B0GA 3ADAC 4ZCIA 2YPYA 2EBEA 3GU0A 2CJ9A 4I69A 1GXTA 3QAUA 3AOBA 1S79A 3DRXA 2XGQA 1S6UA 2OLWA 1NJYA 3HFVA 4AFFA 3KK1B 2P2CB 2RIJA 4I6YA 4Q7AA 3T1HJ 4P74A 2V6AA 4IG3B 1HNXJ 1JLQB 2ZH4A 2QEXS 3UCGA 2MSTA 3IGNA 3CDWA 1SCJB 3V4IA 2HBYB 1V5VA 4DQSA 2YNHA 3RAXA 2CQBA 3NS7B 5LMNJ 2DCLA 2UV8G 1IKVB 2RRAA 5IXUA 2V2QA 2CADA 4F25A 2F40A 3WX4A 2IY5B 4L74A 2N7CA 1EJ7L 3ET6B 4KY3A 2VDIA 1ZAXA 2DB1A 2P5VA 2XSFA 4JI2F 2IJNA 3PEJA 9ATCB 2YVSA 1R7IA 4CLUA 4MAKA 1YGYA 2EG1A 3ENVA 5F8JA 1B70B 3QQCD 3E51A 5J2QA 2XY5A 3FCHA 1NB2A 1SC1B 4PAAA 1UAWA 5I42B 4FYYB 3I9ZA 1W25A 5FIIA 2YNGA 4OX7A 2KHDA 4M5GA 2CJQA 4ZVUB 2B7CB 5DO2A 1FNXH 4ZPWR 1WF2A 4O23A 2UZAA 2DY9A 1S9GA 3I56S 4LBPA 1U2FA 2BKNA 2MQOA 2ZHBA 4QR1A 1PILA 5CYMA 3BS9A 1H38A 3KJVA 2JDJA 2OP5A 4QYZK 3SIPB 1VIOA 2ROEA 4RW8A 4USTA 4O3RA 3ZTPA 1WNEA 4P2XA 3EVWA 3UNYA 4WCEQ 2RSQA 2ACYA 3ZZOA 1Q82T 3VAJA 3M9NB 4U8YA 1P9YA 2HVIA 4H54A 3OHBA 4F7VA 1OQ3A 3OXFA 2Z56B 4B3MF 2HPUA 1JNZB 5F8NA 3FBCA 3SXLA 3WIUA 1IBMJ 1W2BR 2VC0A 3HJFA 4OV6A 3PXGa 4ER8A 4WFBQ 1TL3B 2VG7A 2GIRA 4BC7A 2JEGA 4G3IA 3AJDA 2KXFA 2VFUA 1B3TA 2ERRA 4K4XA 1FKPA 1RT1B 3UI3A 5KFSA 4Y0FA 4A8KA 3GLJA 4JV2A 2EG2A 1DQAA 3IBWA 4PXCA 2XWXA 3NP5A 3Q8QB 2D3UA 5EWGA 4F2RA 3UNGC 4OZ0A 4B9NA 2MY8A 3OL9A 4F4ZA 3IRWP 3LGNA 2UU9J 2IYIA 2DHGA 4RL1A 5EGYA 3NS6A 4XAKA 2DK2A 4USUA 4KGVB 3DLHA 5M2UA 1F3FA 3LWLA 4DR1F 1AW0A 4OHYA 3VWSA 3TVKA 4NMLA 2GMLA 2NXNA 2GGPB 1TTHB 2W24A 2GZOA 3UDLA 3ITHB 1GTEA 1RCOB 3J81Y 4LRFA 1MMLA 4YY3F 3AT1B 2KT5A 1FK9A 3T5JA 1DRZA 1N34J 2HWIA 3S1TA 2WSCC 1SUQA 1N32F 3QZ8A 4Y28C 2VQFF 2PGCA 5KG0A 2XMTA 3EVMA 4ED3A 3KJFB 3N28A 4K50A 4KHRA 1SV5A 3QJPA 4I0WA 4OI1A 5E3RA 3W66A 2ZWPA 4DMZA 4ED8A 3DRYA 3Q86A 4KYZA 3FNNA 1N36F 2ZVIA 2UUCJ 3D0GE 3TZYA 3M32A 4B9MA 2EEYA 3U1LA 4R8UB 2X7IA 1TKXA 2MQQA 2V8PA 3GIMA 2FVQA 2YQ1A 2BUNA 1VRUA 1SJFA 4JI5F 8RUCA 4L72B 4MKBA 2ZJQQ 4ED1A 1NLKL 3P96A 5CYQB 2MLYA 4IRCA 2DITA 4GKJF 3SZ2A 3CJ2A 1RWWB 2UVRA 3GZ7A 3MMAA 2VG5B 1MROB 1ZTWA 4J9MA 4OX8A 3UR3C 2Q43A 5KG1A 2GHWA 2AMCB 2AJ0A 3MZIA 1YJ9S 4NXNJ 2J5AA 1Q95G 5AXLA 2UUBF 8AT1B 4LSLA 4C8YA 4CM0A 2J0XA 2Z2LA 3BM7A 1BY9A 2BM0A 1LWEA 2V8HA 2IA0A 2VPYB 2GMJA 3RR7A 5KT6A 3MR5A 1TL1A 1WG1A 4R0JA 3GQCA 3K89A 2RD5C 3TX0A 2MQMA 4B3SJ 4OIXA 3CCRS 4DV7J 1FWKA 1X4GA 3K2YA 1T9TA 5ETPA 4J90A 2AQ4A 1T0TV 4E0DA 2HNYA 3GYXB 1KNZA 3KG1A 3BGUA 2RT3A 2CPDA 3CJQA 3R5DA 2QZ8A 4DPOA 1K0VA 3D3BJ 4HDGA 3W2VB 2DVIA 1LQ9A 4LR7A 4NZ7A 1JX4A 3UD4P 4FP9A 4UW2A 1HQ2A 4AL5A 2DNMA 1NCLA 2HFZA 3JTNA 4H4KC 3RAMA 3K58A 3CCTA 4B9UA 1NZAA 5E3QA 4J9QA 4KPYA 3FVYA 3H90A 1HBUA 2XHWA 2BXJA 3A8KA 2ZC3A 2HQ3A 1VLYA 2CPEA 2BX6A 1SKRA 1FHTA 2N4CA 1YG0A 1LWXA 3K59A 3D1OA 2JH3A 4DU7A 3C2PA 3ENQA 1QJHA 3CTRA 2ZJRQ 3DLGA 4IG0A 4MIBA 5LJ5Y 3H2VE 2GNKA 2VJUA 4C8NA 4JI3F 5KG2A 3GONA 2AT1B 4K7QA 4PABA 3KLIB 2FY1A 2M8DB 3OVBA 1PCAA 3S7RA 3AOAA 1DARA 4ED4A 3O1LA 2M52A 1RYSA 2OMLA 1HYSA 3JSYA 3K0JA 3V5RA 3QRQA 3P8BB 1KVJA 3OL8A 5IQQA 2W2QP 4RX6A 4Q0BA 2IVYA 4DPTA 3FUYA 1S1VA 5L39A 1IWGA 3CJ8A 3HHLC 1YDLA 4K4VA 4WTOB 3ISZA 3O6QA 2AX0A 4ZVEA 4MKAA 2B4UA 3M9MB 1SVDA 1PYTA 1WACA 4W98A 2IRUA 1IJEB 2OPRA 2DPJA 3C19A 1NBEB 4GKKJ 3BGOP 5J2PA 3CCSS 3M8RA 4DR5F 2RILA 2ZM6F 4BC9A 1U26A 3MEDB 2GHVC 1S76D 2H54B 3GSIA 3N01A 3BO2A 3D54A 3KLHB 3MTJA 1FRLA 1NAQA 5DDRC 3KNGA 4I2PA 1RU1A 4NYZA 2VKRA 2B9WA 3FZBA 4OL8A 3D1HA 3IR6B 3LP1A 4P75A 3NAHA 3K17A 3HHEA 3NLCA 2VASA 8ATCB 1Q8KA 3VQSA 4YQWA 5CH7B 1WG4A 5J2MA 4DR2F 1VQKS 2COLA 4KBIA 3DDIA 3TAMB 4O4RA 1EQMA 1UJ4A 4WF9Q 5A0YB 4DF8A 1WD6A 2IHR1 3FFIB 2QYGA 2HK2A 2GO9A 3I5AA 1JWWA 2FC8A 3BQ1A 2OFGX 3HKZD 2J8SA 2G1HA 4ECUA 2FLNA 4DSFA 4CLZA 4LQ9A 3HFZB 4V19X 2FLOA 2YQ3A 5JMNA 1JLFA 1I3OB 2GVZB 2U2FA 2Z57B 2ZE2A 1OYEA 1UEKA 4C7QA 4IRKA 2C22A 2HFOA 4LFCJ 3FZ2A 4DQIA 2AWZA 4ZP8A 2FLLA 3UVJA 4MYTA 5DQIA 4QPXA 2LFVA 3H40A 4GVBA 1UEVA 2BVZA 2HRYA 3CW2C 2CJBA 5J1EB 2XTJP 4ZVOB 4DBQA 5JXSA 3H59A 3Q8PB 4H4KA 4ALZA 4U8VA 2J9DA 2ZKTA 3I5BA 3J7Z5 2GA7A 2ZH9A 4FF4A 4DUZJ 5CA5A 3R5JB 3NNCA 2MHEA 4ECXA 3G87A 2V2KA 5HBMB 4OX6A 2R2RA 4WFNQ 4HKQA 1WOPA 1V5IB 2PMZD 4F4AA 2R8KA 3DOLB 4OZ1A 4HL9A 1TUWA 1ZYQA 3OJUA 4QIEA 3T9ZA 3SI8A 2J0QD 2LEPA 1S5ZA 1U47A 1WHVA 4X65J 3RJMB 3EVOA 4CI0B 4ZLJA 4ERDA 2AW0A 4TYBA 4NWBA 2LDYA 3C8YA 3DRSA 3G82B 3KUHA 2KDOA 1HPZB 1DJ0A 2AYGA 4MKYA 5BXIA 3H2UB 3JAMU 9RUBA 3UN5A 3QRRA 3LGHA 1ZPVA 1XMOF 2PI4A 1SJRA 2CQHA 3C46A 4J9OA 2JWNA 3HHLA 2H5EA 3W8GA 2DNPA 3MI7X 1PAEX 1J5OA 1R0AB 3DM2B 3K5OA 5CCMA 3A3PB 3J7A1 4EBEA 1TVRB 4CLPA 2PEHA 3ISNC 1IM4A 2DHHA 4KC5A 3PYEA 4LRAA 2HBRB 4A48A 5ITHA 2ZH3A 3KJNB 4EEYA 2YNFA 4WFXA 4EFAC 1NO8A 5A8KA 2CDQA 3GTYX 1IBKF 5H9EJ 2GQCA 4OFZA 1QVFR 3D0HE 4CQ1A 1XWLA 2CIMA 3H8YA 4H4OB 1S1WB 4N76A 1FCAA 1CJVA 4PWDA 4OZJA 4B08A 1REVA 5E2QA 1DURA 4OHVA 3DI6B 4DV4J 4LFAJ 2HAIA 4HTIA 1VQPS 1I94F 4YHHJ 1H0HB 2JVRA 3ENAA 2W9CA 2YX4A 3QLHB 5IM0B 3IN5A 4KTQA 4QIGA 5I3UB 2FZGB 2ZUAA 1DHMA 2W2MP 3Q23A 4DI6A 1UEUA 4I7FB 4ELVA 4EUVA 3I5CA 4PXDA 3MEGB 3L4BC 4OYBA 2HVDA 1RU2A 2CNNB 1YJVA 1ICEB 2WOMA 3OT9A 2PFDA 3M2UA 2XSJA 2KM8C 1JLAB 1G2EA 1S1XA 4CTAA 1NPRA 4IUFA 3MM9B 1PAUB 4DUYF 3MEEA 3MECA 2R8GA 1L3TA 4JYAF 3LAMA 5DGAA 4DQRA 4C11A 4DZDA 7FD1A 2QV6A 5CD4H 5HANA 2G13A 1KWMA 1IBLJ 3CIMA 5T14A 2W7AA 3PTWA 4WK1A 3F56A 4DV3J 3W8PA 2BMBA 2DH8A 1VQ7S 2E5LF 3K8WA 4X4TA 3M2VB 2E1PA 2GVDA 5CCLA 2V67A 3OSPA 1TAQA 1X31C 5IS2A 4RBUA 1JJCB 3VGTA 2DBBA 4ED2A 1UCNA 2BJEA 2I9SA 1E6YB 2MKYA 4L73A 4UY85 2B8QA 1TR0A 2EVZA 4QBUA 1N0VC 1PC4A 3PY8A 1P9QC 3W9JA 4KIAA 2DR6A 1IKYB 4ICLB 4C2MA 1T9VA 1E6VA 1QUVA 1KLNA 4LIRA 4RUAA 4GRSA 5ETNA 4F50A 2E9ZA 5KOWA 2JZ5A 4FPIA 4NEYA 2KT2A 2CRLA 2YH0A 4Q2LA 2HS3A 1U4BA 3SMZA 3JYTB 5D8HB 4WU3A 2WW8A 5LSRA 1GFWB 2PC6A 4KO0A 4QU6A 3NGKA 3DN9A 1QTNB 4Y2AA 3E01B 1K73T 2VC1A 2DO0A 1GQEA 3BDEA 2VHGA 2QL5B 2ILZA 1TKDA 1EX8A 2HHHF 4A8OA 3D67A 2GJIA 1KRPA 4K4WA 3SCLE 3CCLS 5HMYA 2CQ0A 2RRBA 3B8HA 4NLOA 1VQMS 2Z58B 4B3RF 5F3TA 2MZRA 4C0OC 4WKYA 5ETKA 4ELUA 2J9CA 1D0EA 1WG5A 3U27A 3MUMP 2AX1A 4DR6J 3M30A 2DNGA 5GAHI 3IS9A 3GG0A 2XMMA 2XMJA 2QSWA 1ROFA 5HMWA 3PRBA 2BOPA 5GAGI 2YKNA 2PD1A 1MG7A 2CPYA 1EP4A 3ISND 3G9CA 1JLEA 1T3OA 1ZTTA 3VAGA 4ELTA 4FBUA 1PJ6A 1BLUA 1H2UX 1ZH5A 1KQGB 3R27A 3EZOA 3B4DA 1QM9A 1R8AA 1KR4A 3KDOA 4NXMJ 2W4DA 4DN9A 2OPQA 3GMGA 1XEZA 4LSNB 5M2PA 2IM2A 1TK8A 4JI4F 1SH3A 4BWMA 4Z7CA 2N4DA 4X4PA 1TKZB 4ECVA 3QPIA 3DGPB 2YY3A 4MYUA 1IN0A 3M6VA 2WZ1A 1RTIA 2CQCA 4LF1A 2B3TB 2MPUA 1H7WA 2JFDA 3L09A 1WORA 4LF4F 4TY8B 2BV3A 5G4DA 2CJXB 3M8PB 2ZJPQ 3LP0B 3MR6A 5DS7A 2DISA 1GEHA 3DKDA 3HHDA 3K5PA 1DLOA 3IG1B 1ZA2B 4X64F 1O0PA 4OZLA 2YKQA 3PW2A 5L38A 2XG8A 2P6SA 1UA0A 4HHHA 1LFPA 3GILA 4QZVB 3WX8A 3PIOQ 1TKTB 2KG1A 2RDJA 2IDLA 3PFOA 2BA9A 5CAAA 2UUAF 1RAJA 5KFBA 3R1LA 4Y2KA 1IR1A 2EW9A 1JJ2R 3I4PA 2YNIB 1U2CA 4DFKA 1KN6A 2L08A 1S9FA 2L3MA 3TUZC 1AA1B 1RHJB 5D4LA 2OEJA 4M5LA 2VKZG 4DR7J 1BQNA 4HR2A 1Q16B 1U1NA 3G71S 1HD1A 1T11A 3CCZA 3ONQA 4EWTA 2R8JA 4FKYA 5IWAJ 5ETVA 1Q4RA 3GV7B 5L8RC 2QC3A 3CEDA 5D3GA 1PSDA 2ZZMA 3OFFA 4OJ3A 2CQIA 1S97A 5F0WA 2W9AA 3OV7A 3AQOA 3FBBA 1N5YB 4A8WA 1XMQJ 1Q7YT 1KQFB 2G2YA 5CABA 1DFDA 1UWAA 2YWHA 2DGXA 3NXZA 3I0RB 1X4CA 1Y11A 3WIVA 2KL8A 1RT5B 1JLGB 4PPZA 4U7UD 3IRXA 4JOUA 2FHOB 2B6AB 1JXVA 3BBBA 3C16B 3PDNA 3OR2A 2E44A 2DGTA 2X1BA 1X4EA 4JUZA 2R7UA 4BHQA 1IKXB 3HLUA 2AJQA 3TUIC 3CXCR 3SYZA 4LRCA 1H3DA 2OH2A 2GFFA 4Z7YA 3HFKA 3LPEA 1R8BA 1TL4A 4WFAQ 5H1SV 3R5BA 5DGBA 4ZPCA 1YKWA 5SZTA 2DJWA 4DFJA 2PDAA 5EHHA 3NNAA 4NOHA 2EC2A 4OYIA 2ASLA 2LQJA 2C2DA 3DU5A 2A6OA 5KFDA 3LTOA 4OHWA 4DG1A 4RZRA 1VQ5S 5DLFA 5KFMA 1GMUA 1JNRB 3IR5B 3L9ZA 4ES1A 4ILMA 4XPEA 2KRBA 2XM3A 3FBFA 1RHQB 3HVWA 1U45A 5KFPA 3NWGA 5B0BA 1F2GA 5B0DA 1WOOA 2KFYA 2JJ4D 3TZXA 5DDQC 5HROA 4LR9A 4JI1F 4DL3A 2ZH6A 4RW7B 3FQLA 3MM6A 3OLAA 1S10A 1NK6A 4OMFG 1V6HA 3EM1A 1IWAA 3P6YC 5DZ6A 3GJTB 4R25A 5AT1B 3CCWA 3I87A 4M5MA 4RBTA 1QUPA 1UETA 2ROPA 4TU7A 3GV8B 2V9KA 4ZHRB 4DL4A 3QO9A 1HWJA 4YR2A 4I68A 4WYLA 1VS3A 1CJTB 4USJC 4OLOA 1R31A 2QYCA 3DLEA 3S6EA 2CNLB 1S1TB 5CQGA 4LFBF 3QGIA 1FI4A 1Q79A 3SSQA 3PHTA 4Q8FA 2ZBQA 5ADZA 1ZA1B 2VFVA 4DV5F 2DIVA 1WF1A 5A76A 3PFEA 3V6JA 4EZ6A 1D8ZA 3M8WA 2JEIA 1HQUA 1URNA 4QOTA 3DLKA 2B56A 1QDUB 2CQ2A 2H4WB 1L5UA 1WTBA 2BKPA 4AT1B 4OHZA 1NKCA 5EWEA 5A8WB 4CIOA 1RT3A 2FJBB 4J91A 4LREA 2PIIA 1DTQB 4PEOA 2OPPA 2HMIB 4ZOSA 3GJRB 5E3AA 2QMXA 2FY8A 4RNHA 4DX7A 1VRTB 4ENOA 3G8SA 2HHTA 3GP9A 1JIHA 3W3SA 2ALZA 1FJ7A 4C8LA 1VK8A 4DX8H 2IC3B 3UE2A 4PQAA 4F4YA 3KOAA 2PMHA 1W26A 2NS1B 2E5HA 2PN6A 2DNZA 3BSOA 4FDFA 1AROP 4MFBB 4NLGA 3NMAA 2KM8B 1R0CB 4JV5F 3BGFA 2GC8A 1D1UA 5D78A 3W65A 1HBNB 1I5OB 4UOCA 3AB4B 2KRRA 1AZSA 1IJFB 1VLOA 2QGFB 1N8RT 2LA6A 3I55S 4PXBA 4EO8A 2JSXA 4QYZJ 5GADU 1A9NB 3NGSA 4DR4J 1R8PA 1VBKA 4PWUA 4YB5A 5HJXA 2LCWA 7FDRA 1KQKA 2HIQA 3JQKA 2VF3A 1B0VA 2R3VA 3SFGA 1NK9A 1N32J 1LWFA 2ZUGA 4IFYB 1QSSA 4JI7J 3DOKB 4ECQA 3KYLA 3KHLA 1X4FA 1FRHA 4N8NA 1JLBB 1RT6B 3H2LA 3BQ2A 1HWKA 2XCPA 3UN3A 4AE5A 1RT4A 2G1DA 4K4SA 1SL0A 3M6XA 4LF8F 1X4HA 1CLFA 4Y65A 5AXNA 3TI0A 2A3JA 3Q2TC 3SSSA 3EXYA 1FDAA 1UW9A 3L7UA 3QZ7A 2OELA 1NHVA 2R9LA 3RRHA 1HHSA 2I5JB 3GFHA 3NBPB 2E1MC 4DSEA 3SSRA 1IKWB 2NR0A 3Q8UA 2DHAA 2F4FA 4CO1A 1VQSA 4CO5A 1N6QA 4NLWA 4KSEB 3T5KA 3BPSP 3LO3A 2BW7A 1F5CA 1WWHA 4L75A 3QJJA 1IQZA 4P71A 3SFUA 2PSZA 3MPYA 1RAAB 1T02A 2HRTA 2OJ3A 2E1CA 5LMUF 1B0PA 2L9WA 4YFUA 1BD6A 1ZM2A 3FSXA 3DLJA 5HLFA 1LWCB 1RTJA 2FVRA 3EX7B 1C4CA 4ETZA 1WEXA 3LW5C 2F4VJ 3MCMA 1U6BA 2Q1LA 2MQ8A 1RT7B 4HACB 5FDLB 1X4DA 3CDBA 5D4PA 1C0UA 4LBIA 2FJDB 1NSKL 3NY0A 5LXYA 4F8RA 4J9UE 1YX2A 1DTTA 1C2PA 1S49A 2KFNA 3CD7A 4PG8A 3CF5Q 4NA1A 1UVIA 2V4QA 1WI6A 3BKUA 2K3IA 3JSMA 2J76E 4LRBA 4O3OA 2DNHA 3POTA 4PWWA 2VQEF 3MOZA 3V6KA 3H4BA 3A8JA 1RSCA 5A2QU 2D41A 2C3PA 3CMES 1S0NA 3NGTA 1YVFA 3PYFA 3RBZA 1U0HA 4ED6A 2IM0A 1WC5A 4RLEA 5D0GA 3OVAA 2HEKA 1QSYA 1VRQC 3H7HB 3CC7S 1WSRA 3SQOP 1TUVA 1T9UA 4FN5A 4RW6B 2NSBA 4LF9J 2CG4A 3QWUA 2BABA 3MTKA 3KK2B 2KT3A 3ZZ0A 4UY8T 4K0KF 3UDCA 3CSKA 3GPAA 1RWPB 2CWXA 3SEOA 1K0TA 3CCES 3OHAA 3C14A 3DYAA 5CYJA 2FVSA 2CQDA 1HFEL 2YBVA 4WU2A 2F63A 1UVLA 3JB9k 2BQUA 2W8KA 1U1KA 1FJGJ 3D6FB 4NE9C 4JI3J 2OD4A 1H6KX 3OXLA 2ATCB 3HVTB 1FFGB 2EK1A 3CD5A 2ADBA 3PO4A 4AXIA 4IQMA 5HJYA 5KFXA 1XNRJ 1K47A 3VVUA 1RTHB 4K4YA 1R89A 1UPPA 3PVXA 4X62J 2HQGA 4DWIA 3G6XA 2FPHX 4KKOB 3G96A 4IH7A 5A8RA 1WEZA 2UXDF 2KVIA 1NSAA 3SQGB 2DR9A 4NRTA 2CPFA 2Z0GA 1NDLA 4YS2A 2FHKA 4ZA1A 5KFWA 1YQHA 3KLVA 1KC8T 2MB0B 5F3ZA 2WONB 1MWZA 2QLFB 1NM2A 1RBAA 1CJUB 4CT8A 4RUCA 2XYPB 3SV3A 3KK3A 4P7TA 2BE9B 4J9VA 2W7OA 4DV0J 4NA2A 1UKUA 1N5QA 3CO0P 4ZS6A 1Q8IA 2B9YA 2DT9A 1M1GA 5G0RA 4EBDA 1C4AA 1HD0A 1TV6B 4CH0S 4JB8B 1FT8A 1RP5A 1BHNA 1LW0A 4X66J 4PQUB 3TQ1A 4C0BA 1GXUA 1S6PA 5AJ3F 1X5SA 3B78A 3RB3A 4FXWA 3O3LA 4QIWD 3MAAB 2MKHA 2QSFA 3RBEA 5I3PA 1FKAF 1TMJA 3DOMA 2XS7A 2R7RA 2RKIB 2B4OA 3CJKB 1C1BA 1F2HA 1HI8A 5D77A 3UD5A 5HO4A 1N0UA 4DR2J 3SCIE 4KT0C 1HNXF 1HNIB 4FZVA 3AB2B 2AHOB 1F5AA 1BQMB 2D9PA 1YSJA 2NUUG 1BMQB 3W5XA 1LOUA 2NCKL 4O44A 2GW8A 4M8LA 1URRA 3GCWP 1X5TA 1UFKA 2UXCJ 1Y0HA 3RUBL 4IH5A 4M5JA 3RW7A 2VV5A 1ZZFA 4ZN1A 1NXIA 4WZQA 2ALYB 2POKA 2VJVA 3NAIA 1VGYA 2AJ1A 2V8GA 4WE1A 2EKYA 4QWDA 2K3KA 2QA2A 1NH7A 2YKMA 1NH8A 1RE1B 2GCFA 3C6UB 3AFGA 3WC2A 4H4MB 1EB0A 1NSQA 1PG5B 4DLEA 3H25A 3PW4A 4IO1A 4FS1A 2D9OA 1S4FA 1RWOB 2UUWA 2ZOMA 5LL6d 4HI1A 3LGMA 4TU8A 2CNKB 4XDCA 3TZWA 1Q53A 2UXBJ 5C24B 4HTJA 3W2WB 1YI2S 5D15A 2MZSA 4LIWA 4M94A 5HSPA 1U1MA 3BGRA 1PIEA 1FFSB 2HZCA 1Q86T 3DRRA 1KEKA 4DL5A 1U48A 1CQMA 1A7GE 2B43A 3R5GA 2DGQA 3P5BP 3BEGB 1CULB 3R2CJ 2MZ1A 4I2QA 1C0TA 2P8IA 3MWBA 2OPSA 3ZNUA 5LJ3Y 2W4PA 4R5PB 2N3OA 5E7OB 4CO3A 4FNIA 2O01C 4NCGB 2V4JB 4WPAA 2HGMA 2ZNYA 1QAIA 2MGZB 2PA3A 4QU7A 4ECRA 4QIVA 3BN4A 5E33A 1YBUA 1RTZA 2MYFA 3BJYA 4ANDA 3M2RA 4CT9A 1MWYA 1OO0B 4CDIA 1LXJA 3OD2A 4DSJA 3VGVA 2FLPA 4NYPA 3KLGB 7AT1B 4CLYA 2UU9F 2DYAA 4ZVGA 4AUKA 4FF3A 4LVOP 3PNIA 4WP3A 5BYQA 4KFBB 3FQKA 1RT6A 3F73A 2HFSA 3ZZPA 4O0IA 3AOCA 3DMJB 2V94A 1V3RA 2D74B 4J9KA 4CO4A 2JC1A 5CZXA 4EBCA 2FZCB 3NGUA 4QW9A 5HP1A 1IBKJ 2DNYA 2DR8A 3B54A 1DY3A 2BE2B 5KG4A 4BWJA 4UUWA 2HWTA 1HBOB 5LOQA 1S99A 2RHQB 5FLXU 4I4BA 2ZD1B 1N4LA 1GH8A 1MU2A 1N34F 2B4PA 4QWCA 2YWGA 4Y2CA 3WQPA 2B9XA 5F8MA 4B3TF 3V6DB 3T1YJ 3TNVA 1KLMB 3GE9A 4DL0C 2UUTA 2FTRA 3DNCA 3H5UA 2Q79A 3JSRA 3FCWA 2YKOA 4P10A 4KH1B 5A6WA 1MN7A 4GVLA 1KHVA 2L9NA 2BKOA 2UUCF 2BOAA 1M90T 2H5JB 1JLCB 4YMEA 2NXEA 2ZKUA 3EPGA 1WKJA 3SCJE 4RNNA 3US5A 1T03A 2V68A 2W9BB 3DXBA 3W63A 1RAEB 2XEXA 1Y00A 2D69A 2W4CA 3QYYA 4DUTA 3QIPA 3PO5A 3P3DA 2Z2MA 1FRIA 2E9RX 2YTCA 4OI4A 5LM7E 1T94A 4NRUA 4DSIA 2CDRB 3TW0A 4PG6A 3SDEA 3AAWB 3FEZA 2KZZA 4NL5A 1S1UA 4ED5A 1XJWB 3PKYA 1QY7A 4NX9A 4F0HA 2WSEC 2DXDA 4RJVA 6AT1B 2E5LJ 4BLGA 5DM7Q 4CYUA 2E1AA 2OSRA 1O8BA 2XQCA 2VBZA 1CJKA 1C1CB 1YJWS 2G2ZA 2FGOA 2A2DA 2KYZA 4UOFA 2LQ9A 1S9EB 3MR2A 2JFKA 4LJMA 4ED7A 2K1RA 3JAMY 2PI5A 4B3SF 2V50A 3D6MB 2LDIA 1YK9A 3TUJC 4DV7F 1NPKA 2PT0A 2XBPA 4JI8F 3UWTA 1G6BA 4RUBA 3PJWA 4J7CA 1RAGB 4I67A 2ABYA 2FJVA 2CVIA 2Z30B 2HHUA 4CLLA 2Y1RI 3FJ2A 1RTDA 2CZ4A 4KGMA 2ZBCA 2B5JA 5HVFA 3TZZA 3D7SB 3D3CJ 5D4NA 1CEZA 1N5TA 3KLEB 5EX0A 1NZ8A 4XTTA 1U8WA 1R0BG 2AP6A 1Z1ZA 3J80U 3KMQA 1UP1A 2KJVA 2RHSB 1T05A 3D2WA 1KFSA 3J7YI 2WAQD 3U02A 1G3OA 4IRDA 1S57A 5KTQA 3IO1A 3W9HA 2V69A 4O4GA 3GCXP 1FKOB 2F8HA 4IDKB 5J1NA 1SKUB 3MMBB 2F5GA 1XN9A 3BGLA 4EO6A 2HW3A 4NLRA 1NK7A 2FJXA 3NKYA 4HT5A 4B3OA 2H65B 2WBMA 3LP2A 3LPYA 2FIUA 4ECTA 1ZAWA 2NPFA 3CJ5A 3HVRA 1L3VA 4RW4B 3UN2A 1XBWA 2LEBA 5GAEI 1NK8A 1LW2B 2AGOA 2ZBRA 3RB0A 2DRDA 4MKVA 2GQ2A 4M5DA 5BJRA 5C25B 3RW6A 1VBXA 2A2CA 2C3YA 1PJ7A 2I2YA 1I6JA 2EPIA 1RHMB 4KGXB 4FF1A 2NQPA 4TLRA 1TL5A 1QE1A 2KU7A 1Y10A 3C3LA 1H73A 2KO1A 5T7LB 4C0HA 4JI4J 3NNHA 4GKKF 5LT5A 3MMCB 4U67Q 3TX8A 2OTLS 4JV0A 2RVJA 2DY1A 1HNIA 4OYZA 3ZTRA 3MHYA 1RAHB 2HZVA 4ZPDA 2C2ZB 1ACMB 1NDPA 2IPOB 3AA8A 4X4UA 2EFOA 3UO0A 4QWEA 4KV8B 4CLKA 4ZVHA 3LAKA 1VQNS 1CC8A 2HFVA 1PO6A 1YRTA 1T95A 2XZDB 3DRPA 2M7SA 1TAUA 4AXJA 2HNDA 5DG8A 2BRLA 4DFPA 3KUGA 1GT8A 2EI5A 4X64J 3UW1A 3BBCA 4QPTA 4QWAA 5E5NA 2JLEA 2ZZNA 1DQ9A 2W2PP 1U09A 3A3OB 1UPMB 3MM7A 2IMOA 1P27B 1RDRA 2ZFHA 4F36A 2B8PA 3ZXWA 4K2JA 2KKHA 4YB1P 2E29A 4OJGA 4CWBA 1RK8A 4YEAA 2XULA 5THWA 1IM6A 4NPOA 1EKRA 3MM8A 4QIFA 2K7JA 1TFYA 2MLZA 2B7BB 5K14B 1NJZA 2IBKA 1JQGA 4ZPAA 2FDNA 3MEKA 2FHJA 1JKHA 4LFCF 5K9FA 3RB6A 3B4MA 4PUOA 4PZVA 1UWBA 5J2NA 1S0MA 4PXEA 2A0FB 2MZTA 3AXKA 1S6QB 1UTAA 1SBRA 4BDPA 2MZQA 1A0OB 4NCAA 2R42A 3OUYA 3MPVA 2HNZB 4Y2MA 1CS4A 4XPCA 4EK2A 2VG6B 2QL7B 3EICA 1HL6A 1RHUB 3ILLA 3V81B 3HDSA 2LXUA 2H3EB 5E3CA 4DU8A 2IIHA 3R7NB 3IBFB 2R7XA 3AA9A 4WBFA 4NI2B 5I4MA 2LYVA 1WTFA 3H5XA 4TY9A 1ITPA 2NZ4A 3EJMA 2RU3A 1MWQA 2E66A 4ID5B 4OZ3A 3J81j 1RWKB 2GIFA 1Y5LB 3GYNA 3LA0A 3KXDA 1HBMA 1I51B 2JL9A 4C97A 2QTWA 4U96A 2F9JA 4Q8EA 1HQEA 5C42B 4RW9B 1UVJA 1T9WA 4JI6J 2RQ4A 4C98A 4X65F 1VC6A 2X1AA 3FMBA 4C4WA 1XTZA 5DDPC 4P2FA 2VBXA 2QFJA 4MIAA 3MFHA 4KFBA 3PV8A 4HDHA 2XMKA 4OYWA 2N82B 4GC7A 3KLFB 2DNQA 3TP2A 2OKQA 5C7PA 2BANA 2L9DA 1SL1A 1TL7A 2MJUA 2L48A 3MM5A 2ASYA 1L3SA 2P6TA 3C15A 3I32A 4RWWA 2JLGA 4BS2A 3OBIA 2XI3A 4TXSA 2VIHA 1GNKA 4HVZA 2F1FA 2ROGA 5T41A 1EARA 2H48B 1QAJA 2RUGA 3OTEA 1KVIA 4QJVA 2D3O1 3P49B 1LEOA 1HNVA 1WC4A 4CNZA 3PJXA 2VH7A 1G1XA 4N7TA 3AXMA 2WK4A 1SJ4P 1F5BA 2AGQA 1WKKA 1GX6A 3PIPQ 3IWNC 1YRUA 3V4IB 4AL6A 2R4FA 2YNHB 4LSZB 4G1QA 5L9XA 4WFZA 4DDFA 3W62A 2QA4S 4IOBA 1NDKA 4ANEA 5KT2A 3M1VA 1HKAA 3HP6A 1NMEB 2RRNA 1U1PA 2BW2A 3BKTA 2IAJA 3GV5B 4DV4F 3MMJA 2XLKA 3OR1A 4LFAF 2YWWA 2CVEA 4TNOA 1P1LA 4ZCMA 4P52A 2QL9B 3GIRA 4RR5A 2E7VA 2HLTA 2XC9A 3AHPA 2AYBA 3G6ES 5J2QB 4URGA 4N5SA 4IOAQ 5KFHA 4Y00A 2Z4PA 4J9LA 4DQQA 1N33F 2UP1A 2DGWA 3ZZTA 2WVBA 3OTOJ 3TO8A 2IJFA 1EETA 2BJ9A 1LK5A 4ZMMA 2YNGB 1VQYA 2V8DA 4ZLPA 2JC0A 4HI2A 1M5KC 4ZLLA 3NOGA 1UMJA 4IFVA 3RGIA 1RHRB 2G0CA 5E0OA 5AXKA 3CIZA 1S9GB 3VR1A 4TQRA 3C6TA 5CYMB 1IBLF 1U1OA 3KJVB 1JXEA 4NLYA 2JOQA 3B82A 3EWGA 4DV3F 3IM9A 3FC9A 2YXLA 3RR8A 4RW8B 2NYIA 4MMOA 4ZIWA 3HX9A 1N48A 2JX2A 4X2BA 5KFAA 4YUDA 3KK1A 1F0XA 4ED0A 2C1EB 2DEIA 3LF0A 3W1YC 3PKMA 2V2VA 2ZC4A 4N8OA 4IG3A 4G6VB 3CO9A 4ZPBA 1RWVB 2CQGA 4FXDA 2WVEA 4UQGA 1JLQA 4DL6A 1ZM3A 2O67A 2RNEA 4DV6J 1GMWA 2VG7B 3DCAA 2FD2A 1HR0F 1FTRA 1L3UA 2R7QA 2CJAA 3BREA 3OFHA 1FKPB 3FDSA 2R2TA 3MGJA 1IKVA 4ITSA 1Z2LA 4DSLA 1D9DA 3OJSA 4K2XA 4K5RA 5K8PA 2IVMA 1R6VA 3ET6A 2DNRA 3PM9A 1SJ1A 1FJEB 1UVMA 4W92B 2GO8A 4NMXA 3A8EA 4QW8A 1FRJA 4EYHB 1FRKA 2Q3PA 1GMWD 5LSLA 1FVQA 3PRDA 5BYSA 1X4AA 2NXJA 4LF8J 1AT1B 3HZEA 5IOLA 4B9TA 3M8YA 2XCAA 2IRXA 4AL7A 3OTDA 5KFFA 5I42A 2MEWA 5CHCB 2NPIA 4USIA 2WBRA 4CM2A 4J5OA 3QATA 3ZTSA 4XIUA
chains in the Genus database with same CATH topology
2MLXA 2D3O1 3GTYX 2MLZA 1P9YA 2MLYA 1W26A 1T11A 3GU0A 1OMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLX A;  2D3O 1;  3GTY X;  2MLZ A;  1P9Y A;  2MLY A;  1W26 A;  1T11 A;  3GU0 A;  1OMS A; 
#chains in the Genus database with same CATH topology
 1HHQ A;  2XZT B;  1FK9 B;  2JEF A;  3NEK A;  3C66 A;  1SUQ B;  1YJ7 A;  1OS5 A;  2W01 A;  1R6Y A;  4LQ3 A;  3TEG A;  3M8S A;  4DR6 F;  1FTC A;  3PR4 A;  2JLF A;  4UF4 A;  2XO7 A;  2QE5 A;  2OSQ A;  4LF5 J;  2HVZ A;  2B4V A;  2W2N P;  1SV5 B;  5K8M A;  4ECZ A;  3T19 A;  3HM9 A;  1OQ6 A;  4C48 A;  1B7F A;  4XDD A;  1FD8 A;  1YJT A;  4CP5 A;  2HLU A;  4A47 A;  5GMK a;  2G4B A;  2BR0 A;  2J0W A;  2VBW A;  2XO6 A;  1XK8 A;  5EN1 A;  5IT9 U;  1TKX B;  4NXM F;  3WC0 A;  1TL3 A;  3P5T L;  1VRU B;  2IMW P;  4WXW A;  2M3D A;  3DHX A;  2Z8Q A;  1RT1 A;  2XNR A;  3HVA A;  2JHE A;  4RBV A;  1J5E J;  1TK5 A;  4OYM A;  3MMA B;  1P6T A;  4CLW A;  3Q8S B;  1OPZ A;  1SPB P;  2P9C A;  2HS4 A;  2VQE J;  1UJ6 A;  3HJV A;  4NLV A;  1FFW B;  2AEJ A;  4FBT A;  3TAR A;  3WZ0 A;  3IA0 A;  3DFE A;  4CLF A;  5K8O A;  1FWL A;  1V3Z A;  1XQI A;  1AFJ A;  2ZOG A;  4LSL B;  3D1Q A;  3D4J A;  3OSN A;  4UQT A;  3N5B A;  2CZV C;  4LUB A;  1LWE B;  3JTP A;  2GGP A;  1UFL A;  1TL1 B;  1X5P A;  4B9S A;  1WJ9 A;  3ITH A;  2EFV A;  2X51 A;  1NU4 A;  1FE4 A;  1UW4 A;  4K0K J;  4EI2 A;  3KKF A;  2ZDP A;  4MT1 A;  2DGO A;  2ZOF A;  2HNY B;  2FZK B;  1D9A A;  1EAY C;  3VAI A;  4RNF A;  1R43 A;  1UZH A;  3NGR A;  1KFD A;  4DCO B;  2LXF A;  3OLB A;  4DR7 F;  3FSI A;  3G4S S;  2AEM A;  5A6P A;  1VBY A;  1MLA A;  3NMR A;  4WIQ A;  4USM A;  3HHL D;  3JXO A;  3IC1 A;  2CFX A;  3T6J A;  2YH1 A;  4RO0 A;  1HBU B;  5K8N A;  3BQ0 A;  4R0E A;  1T7P A;  4ZVF A;  2O5D A;  3KFW X;  4FNH A;  5DG7 A;  3RU0 A;  4J9P A;  3PX4 A;  4R8U A;  4JP8 A;  1N56 A;  1BQX A;  1V9O A;  1YIJ S;  1VR6 A;  3EPI A;  2I38 A;  3DLG B;  4IG0 B;  1U0S A;  1XMQ F;  1FNO A;  5ETQ A;  5CYQ A;  3K7R A;  3M7V A;  4NLU A;  2OIH A;  2ZNZ A;  4E2F B;  2BZ2 A;  3RRG A;  2VG5 A;  4QWB A;  1MRO A;  2RS8 A;  2CPZ A;  3UCZ P;  3R97 A;  1HYS B;  2F65 A;  5HAT A;  3QFH A;  3TWZ A;  4DV2 F;  1IVZ A;  1RKJ A;  2H9Z A;  2LQ8 A;  2YKP A;  1AFI A;  4Q0B B;  2H4Y B;  5IV4 A;  1LV5 A;  1EKS A;  1WHX A;  4DL7 A;  4LF7 J;  2NSC A;  2K8G A;  1S1V B;  4KRW A;  5L1L A;  2EFQ A;  5HQL A;  5AJ3 J;  3CDE A;  1NJI T;  2HHV A;  3MPW A;  3IWL A;  4NAS A;  5F8H A;  4I1T A;  2IRY A;  3NL0 A;  1U6Z A;  1VC5 A;  1H72 C;  4TN2 A;  2D3Z A;  5E41 A;  3AD9 C;  4CLS A;  2OPR B;  5IV3 A;  2IM3 A;  3QGG A;  2DH9 A;  3GJQ B;  5J2P B;  4DS5 A;  2Y0S D;  1FJC A;  1JK9 B;  1U8S A;  1ZS6 A;  3W2V A;  3FKB A;  1P8G A;  3TA1 A;  3FCV A;  2BJ1 A;  2IDE A;  1F60 B;  4DOZ A;  3GWC A;  3VF0 B;  2E7W A;  5A2Q Y;  3V4M A;  2XNQ A;  1PJ5 A;  5F8I A;  3Q8Y A;  4I2P B;  4CH1 A;  4LT6 A;  3CVK A;  1T8E A;  5EDW A;  4IKA A;  3ELH A;  5BYR A;  2DR5 A;  2M5Y A;  3LP1 B;  2JEJ A;  3A12 A;  2HQI A;  2VA3 A;  3T5L A;  2XI2 A;  4U7U K;  2FGC A;  2CWK A;  4ZPV R;  2ZH5 A;  3OFG A;  4V1A k;  3N6M A;  4ZIT A;  3NOC A;  3EXC X;  2GJ2 A;  2HBZ B;  4JI0 F;  1FDB A;  1HHT P;  5J2M B;  3T6B A;  4WTY A;  1ZAV A;  4M1K A;  3FEX B;  1BC6 A;  3T3F A;  4O0N A;  3CUN A;  2RE1 A;  1NJW A;  3UQS A;  4YN3 B;  2YWE A;  1KQS R;  3KLI A;  3BZQ A;  1OIA A;  1FRM A;  4USW A;  3PW5 A;  4PG5 A;  2XMV A;  3HD1 A;  1YIT S;  4M5K A;  1WC3 A;  4UTG A;  1FVS A;  3V6H A;  2XLI A;  3ZZU A;  3SBM A;  5H9F K;  1JLF B;  3BB5 A;  4W4M A;  3OVS A;  2ZE2 B;  1NHU A;  2OAU A;  3ILI A;  3R5C A;  2YQ0 A;  3LH2 S;  1XNQ J;  2L41 A;  3UVJ B;  3MOJ B;  2CPJ A;  2LMI A;  3QWP A;  1HA1 A;  2KXH A;  1RXO B;  3EGZ A;  3G6Y A;  2C2K B;  4GVB B;  1I1G A;  1RAC B;  3BKF A;  1AUS L;  3L95 X;  1X7V A;  1YHQ S;  2HHP A;  2MKI A;  5GAH U;  3VAM A;  4AYB D;  4RNO A;  1YBA A;  3KUE A;  3BF4 A;  2AYM A;  1BWV A;  1FEH A;  3I6P A;  3CCJ S;  2VOO A;  1B4S A;  2E1R A;  5GAG U;  1XER A;  4ZIV A;  1GX5 A;  1VQL S;  2FJA B;  2KYX A;  1SJQ A;  1RAO A;  2R8H A;  2C3M A;  4ANC A;  2HAF A;  3MED A;  2HUR A;  1U49 A;  4KR0 B;  4WYW A;  3L3C A;  2C2O B;  3KLH A;  1RHK B;  4O3P A;  4A4J A;  1S59 A;  4FKX A;  1LXN A;  5DLG A;  4B9V A;  4DR3 J;  1F3V A;  1WDT A;  4J9S A;  1HI0 P;  3F44 A;  3F0N A;  1JJH A;  2VOD A;  3DRS B;  4ATN A;  1YZ7 A;  5CXT A;  3HSJ A;  4IYQ A;  3TAM A;  1U24 A;  4YR3 A;  1K8A T;  5B0A A;  1OY9 A;  4QQB A;  5A0Y A;  1F9H A;  5KG3 A;  1Q78 A;  4IH6 A;  3FFI A;  2Z2Z A;  1ZM4 A;  1AXQ A;  1DQ8 A;  2RQM A;  1HW8 A;  4DR4 F;  4O3S A;  1MMD A;  1Y4Z B;  1V3S A;  2DKO B;  3O8W A;  3HHL B;  1RAI B;  2MJN A;  4CZC A;  1MW7 A;  1Q5V A;  1J5O B;  3CDA A;  1HWL A;  2E7X A;  3MD1 A;  3MF5 A;  2J7K A;  3PX6 A;  1SQG A;  5KFR A;  5DDO C;  1QAX A;  4MK9 A;  3EUN A;  2GVZ A;  5HQ8 A;  4JI7 F;  2OO4 A;  4AD6 A;  3HT0 A;  4B3T J;  3UFC X;  4Y3C A;  1WSV A;  4ECS A;  4DN0 A;  3A4T A;  3UD3 P;  4Y2I A;  5BR8 J;  4AQY J;  3CCM S;  3OXG A;  1M5H A;  3SCK E;  2YNF B;  3D6T B;  5A8K B;  1VBZ A;  5J1E A;  1GAO A;  3ZTQ A;  3BR8 A;  4DHV A;  1HMV B;  3FMW A;  3HK2 A;  1RLC L;  3HMJ G;  3MD3 A;  4YDX A;  4P9S A;  3MXH P;  4C6A A;  1HAR A;  2CPI A;  2A18 A;  1HNZ J;  3DHW C;  1EHW A;  4FYX B;  1CJV B;  4PWD B;  1JXL A;  1VCT A;  5HBM A;  1REV B;  2DTJ A;  2ZH7 A;  2H5I B;  3HHK A;  5CZV A;  2W9C B;  4Q43 A;  3DOL A;  4NLX A;  4DV1 J;  1RGV A;  1WF0 A;  3GFZ A;  2J6U A;  1FNM A;  3EGN A;  3THV A;  2AF6 A;  2E5J A;  2DO4 A;  5EUH A;  2OGU A;  4ZPT R;  3QSY B;  3H5S A;  3B6B A;  2F4V F;  2KZM A;  5HVH A;  2WOM B;  2MKK A;  1RAB B;  1ZM9 A;  3M2U B;  4LF6 F;  2XSJ B;  3TUP A;  3G82 A;  5KFT A;  1WC1 A;  1HPZ A;  1S1X B;  4CTA B;  2Q6C A;  2XMW A;  1SH0 A;  2I8E A;  3FGV A;  3TA0 A;  1DBD A;  2QRR A;  3HPO A;  1HI1 A;  5AXM A;  3FSY A;  3MEE B;  5L1K A;  3MEC B;  3PX0 A;  2NRE A;  4C11 B;  3MPD A;  1NEE A;  3GG1 A;  2HHS A;  3FK4 A;  1NB7 A;  4U7C A;  4B02 A;  1BUX A;  3CD6 S;  1PGZ A;  4X4O A;  2WW4 A;  4XK8 C;  1R0A A;  1UA1 A;  3DM2 A;  2HFN A;  4JI8 J;  1NK4 A;  2K06 A;  2V0N A;  1TK0 A;  1XR5 A;  2VA2 A;  3HUL A;  1TVR A;  2QMW A;  4LRD A;  4Y6I A;  1XC9 A;  5ETO A;  1NHK L;  2VPX B;  4LF2 A;  2GVD B;  2EK6 A;  3X3U A;  4FPR A;  1U7L A;  4ZDN A;  2UVV A;  4D3H A;  1W7W A;  4LF9 F;  2R8I A;  1VQ4 S;  2IBO A;  5HQM A;  4B9L A;  3Q0A A;  3O2I A;  1XR6 A;  3MPU B;  4BBY A;  2R7V A;  2CA9 A;  5KFZ A;  3HO1 A;  4ZP6 A;  1G4C A;  3KHR A;  1WOS A;  1KOH A;  1E6V B;  1OYD A;  4ZCL A;  3H20 A;  4H4O A;  4ZVT B;  1S1W A;  3DDK A;  3QGH A;  4K8R A;  1VK3 A;  2V8V A;  5FLX Y;  2GHP A;  3DI6 A;  3CDU A;  3K5N A;  3DDN A;  2OD6 A;  4NLD A;  3NCR A;  1FJG F;  1NK5 A;  5EX3 A;  3QLH A;  5L1I A;  4JI2 J;  1UL3 A;  5IM0 A;  4F0K A;  3CNQ P;  2HQD A;  1H98 A;  1SIZ A;  3HD2 A;  5I3U A;  4C9D A;  3VAK A;  4KO0 B;  5HVG A;  4I7F A;  1XNR F;  5ETL A;  4J9R A;  2VZ9 A;  3R3T A;  3PHE A;  4A8X A;  1LK7 A;  2X1F A;  1RIS A;  4X62 F;  3KTQ A;  3MEG A;  2RAQ A;  3BO3 A;  4TKT A;  1CG2 A;  5F9N A;  5LXR A;  1MNE A;  1JLA A;  3HHN B;  3CT9 A;  3OFE A;  2NZC A;  1KVK A;  3CE8 A;  5JVH Q;  3LAN A;  3MM9 A;  3T9N A;  4F4K A;  1FEE A;  1W2I A;  2RU9 A;  2KTQ A;  4WP9 A;  1QSL A;  3KNA A;  3M30 B;  3TVY A;  3TR5 A;  2H1Y A;  2BJ3 A;  4DV0 F;  1Y7P A;  3IS9 B;  1S0O A;  5KG7 A;  5HMX A;  1KBR A;  1P1T A;  4NEZ A;  2ZBP A;  4MJK A;  2YKN B;  3HSD A;  2XWY A;  3RBX A;  4ZP7 A;  1EP4 B;  3M2V A;  4OV1 A;  4OI6 A;  4OZN A;  1QLN A;  1JLE B;  4FYV B;  2M8H A;  5HMZ A;  4X66 F;  3ICL A;  4LBH A;  2MQN A;  4DFM A;  2XMU A;  3J7Z T;  4C3M A;  2VOP A;  4PPD A;  4OLP A;  4B3M J;  4YOE A;  2ZH1 A;  2D1C A;  2X1G A;  1E6Y A;  4HEA 9;  5KFG A;  1SL2 A;  2OPQ B;  4OYA A;  2VBY A;  1IKY A;  4ICL A;  4ECW A;  1F9F A;  5GVQ A;  3R1H A;  3TA2 A;  1SI9 A;  1TFW A;  2FJE B;  1SKS A;  2N7Y A;  3X1L B;  1RTI B;  1O5J A;  3BYP A;  3QMQ A;  4WKR A;  2UXC F;  5IQ6 A;  3PYG A;  4YB7 A;  3JYT A;  3IM8 A;  4A8M P;  4DCP B;  4ZVQ B;  4L6V 3;  2F9D A;  2M2B A;  4DR1 J;  3ZNJ 1;  1KD1 T;  1DLO B;  3J80 Y;  2VON A;  2BAC A;  3TAQ A;  3E01 A;  1DAX A;  2HHW A;  3Q2S C;  2CAJ A;  1BE4 A;  3W5Z A;  4Z2X A;  1D09 B;  4K4T A;  1F6T A;  4FXV A;  2RUS A;  4YY3 J;  1KP6 A;  3R6G B;  3CMA S;  2WHO A;  5DQH A;  2BEF A;  2KFZ A;  4OX9 F;  3L7O A;  2EKN A;  4MTP A;  2N3L A;  2QLX A;  3N5F A;  2XS5 A;  3PRV A;  4X4N A;  1U1R A;  2LEC A;  2VQF J;  1IR2 A;  2VL1 A;  5DM6 Q;  1FES A;  3QT6 A;  2UXB F;  1FXR A;  3S01 A;  3KWM A;  3THP A;  4IOC Q;  2NXC A;  1BQN B;  1SQF A;  2BDP A;  2W8L A;  2D3O R;  1X0F A;  1FO1 A;  2MMY A;  2OEK A;  2D7S A;  3DLL Q;  1R8C A;  2FJW A;  1WEL A;  1N36 J;  1IBC B;  4F0M A;  2Y1J A;  3CMQ A;  4MH8 A;  1IXK A;  3Q8R B;  5D3G B;  1Q8B A;  2Q66 A;  4I56 A;  2R7S A;  3CWJ A;  2FQQ B;  4LSN A;  4DPY A;  4JI5 J;  3GFY A;  3ENW A;  4G1P A;  2XYH B;  3W60 A;  2KG0 A;  2RH3 A;  1TKZ A;  3DGP A;  4U6P A;  4ZP9 A;  4GKJ J;  3I9V 9;  1VMB A;  2A1B A;  3QAE A;  2IFX A;  2FVP A;  3PYD A;  4OI3 A;  4TLQ A;  5F41 A;  1J2V A;  5C5J A;  3T5H A;  3IRX B;  2KXN B;  1EZZ B;  4TY8 A;  2QX0 A;  5F0U A;  1FX4 A;  2WB1 D;  3M8P A;  2LVW A;  3OR2 B;  3LP0 A;  3TVZ A;  2UUB J;  1UVN A;  4FS2 A;  4OYX A;  1KTQ A;  3THT A;  3VVT A;  4KAI A;  3W9I A;  3IG1 A;  2AIR B;  2O66 A;  2VD3 A;  4WXO A;  2C2N A;  3GIJ A;  5L1J A;  3PG9 A;  4EGL A;  3BH6 B;  2J6S A;  3TOQ A;  4FYD A;  2DGS A;  1FDD A;  3IAS 9;  1ELO A;  1GMV A;  1TKT A;  2G2O A;  6FDR A;  1HWU A;  2EFP A;  1VHI A;  3PAC A;  3CJ4 A;  1HNW F;  3HKW A;  4DCJ B;  2V4R A;  2HQF A;  1HMV A;  1U1Q A;  5HI7 A;  2YNI A;  2PO4 A;  2MDA A;  3RB4 A;  4ZJO A;  2WB4 A;  3R6L B;  4DG1 B;  3EMT A;  1WUU A;  1SH2 A;  4DPX A;  3P45 B;  1JMT A;  3FEY B;  4F04 B;  3KHG A;  3Q22 A;  2LQB A;  3T1Y F;  2M4M A;  2OEM A;  1S12 A;  1HLW A;  1U1L A;  3VTI A;  3EDR B;  3FRY A;  3M6U A;  1RWU A;  1IR0 A;  5HRO B;  2CPH A;  5KFI A;  3IP0 A;  4P7V A;  1U02 A;  5KFY A;  1B7Y B;  2MHN A;  3KG4 A;  3TJ8 A;  1X9S A;  1TUG B;  3MM6 B;  3W64 A;  2ACM A;  3G8Q A;  3NCQ A;  1L3K A;  5B08 A;  1H2V Z;  3OTC A;  2RF2 B;  3QID A;  1OY8 A;  1S4E A;  3R9L A;  1N33 J;  1A6L A;  1N5Y A;  4RU9 A;  4OQJ A;  1OJ4 A;  1J27 A;  1SB6 A;  1AB8 A;  3K5L A;  4USV A;  4TU9 A;  1WC0 A;  2DGV A;  4KHP F;  3R5A A;  3QO9 B;  3I0R A;  2AV5 A;  4RKU C;  3N9U C;  4LVN P;  3KG0 A;  3IAM 9;  1WKL A;  3ZZR A;  1RT5 A;  2ZDO A;  1JLG A;  1VDH A;  3DLE B;  2CQ3 A;  2BBE A;  4DX6 A;  1RZM A;  1QTM A;  2B6A A;  3R8Y A;  2I1R A;  3C16 A;  4A8Y A;  2GS8 A;  2AJ2 A;  1ZOT A;  3QSI A;  3D68 A;  4DLG A;  1HQU B;  3DLK B;  3VQT A;  4P2S A;  1IKX A;  2OMO A;  3BN7 A;  1Y5I B;  4OZ5 A;  2DNN A;  3RBD A;  4YP3 A;  1Y5N B;  2G0J A;  4A8S A;  4W90 B;  4D3G A;  1RT3 B;  3H42 A;  4DPU A;  1N52 B;  1ZBT A;  4DS4 A;  2BQ3 A;  4QCL A;  2DNL A;  1CPZ A;  1OY6 A;  2OPP B;  1Q8L A;  2XMA A;  3RZA A;  1CQN A;  4DR5 J;  2ZM6 J;  2I0X A;  1SQE A;  2ZEJ A;  4OHX A;  2VUG A;  1HR0 J;  3MAQ A;  3AJ1 A;  5KFV A;  4P2M A;  4GC6 A;  2J0S D;  2RJZ A;  1NDC A;  4KE5 A;  1OMS A;  2QFI A;  4ID8 A;  2GAH C;  2PA8 D;  4ZCK A;  3MR3 A;  3K8V A;  4HHU A;  3T1H F;  2P9E A;  4KH0 B;  4DF4 A;  1OSC A;  1AZS B;  4RW7 A;  2LKZ A;  1WHW A;  2CQP A;  2G9O A;  4N47 A;  3GB0 A;  1VJW A;  3M8Q B;  2CG8 A;  3IGV A;  4X4S A;  3J81 U;  5LMN F;  4C8K A;  2EWH A;  4ZHR A;  3PW0 A;  2WRM A;  1YZ6 A;  2QIF A;  3EDQ B;  4GO5 X;  5AE3 A;  4S0M A;  5HN0 A;  4HHJ A;  3K5M A;  1CJT A;  2CUY A;  1RLD A;  1X0P A;  4C3L A;  1NSP A;  1S1T A;  4TQS A;  1LWF B;  4I64 A;  2ZH2 A;  2I6W A;  1RT4 B;  2MSS A;  2OI2 A;  3TAP A;  3A1Y G;  2J9D E;  4PYD A;  2ZH8 A;  4G65 A;  4YB6 A;  2A6M A;  1Q5Y A;  2JRS A;  4EU0 A;  5A8W A;  1NND A;  1DTQ A;  3ETM A;  1KON A;  4OJH A;  4F3Q A;  2HMI A;  2VFT A;  1M1K T;  4WII A;  1VRT A;  2IVF B;  1N6Q B;  1VI7 A;  1Q0N A;  1K44 A;  3CC2 S;  3MAH A;  2C42 A;  3PEH A;  3WDO A;  2U1A A;  3ILJ A;  2IC3 A;  2M9K A;  4RNM A;  2V9W A;  3FBE A;  2CZ9 A;  2LQ5 A;  3GR0 A;  3RG6 A;  2NXU A;  1FDN A;  2IM1 A;  2EBG A;  2K7K A;  1FER A;  5KFN A;  1S77 D;  5HLF B;  4MFB A;  2QLJ B;  2H51 B;  1RTJ B;  3RRK A;  1RBL A;  1HBN A;  5C2G A;  1FD2 A;  2HYI B;  1HIY A;  2O1P A;  1TP7 A;  3DLB A;  1IBM F;  1C0U B;  2KH9 A;  4ZJQ A;  1B0T A;  5KFC A;  3T1A A;  1S7H A;  2BJ8 A;  1R27 B;  1DTT B;  1Y3K A;  3QT5 A;  4F3M A;  4NZ6 A;  2CJY B;  3RTV A;  3JSM B;  3ZO7 A;  4DX5 A;  3IXQ A;  1XMO J;  2XZW A;  3DU6 A;  3T41 A;  1YTY A;  3CGI A;  4WWS A;  3MDF A;  1SJ3 P;  3POT B;  1VC0 A;  3DGV A;  2V34 A;  1BWE A;  4UOG A;  1B99 A;  1NKE A;  1TMM A;  2ZVS A;  3MCS A;  4IFY A;  1U0H B;  3DOK A;  5B09 A;  5GMD A;  5SUH A;  1F1B B;  2R2S A;  1JLB A;  2F7V A;  1JB0 C;  3K57 A;  1YBT A;  4F4X A;  2NYH A;  1TZ0 A;  2XYG B;  4PG4 A;  4O3Q A;  1VYA A;  1KSP A;  1WEY A;  2DCU B;  1XR7 A;  2I5J A;  5D0E A;  2X3G A;  1RUS A;  3NBP A;  3CJS A;  4ES2 A;  1UJ5 A;  4USK A;  1IKW A;  3VCD A;  3C14 B;  1T9X A;  5KFO A;  3ILO A;  1S0V A;  4BCA A;  2PEB A;  3DYA B;  1GXL A;  1D3W A;  1NPP A;  1K1Q A;  5F8G A;  4C8Z A;  2C28 A;  2M70 A;  3S8S A;  2GV1 A;  3NWR A;  2WCX A;  3KHH A;  1FF2 A;  3Q24 A;  2DIU A;  3ULH A;  2C2M B;  2WTF A;  1YLX A;  2XY6 A;  1I94 J;  2WSF C;  3OW2 R;  5ETT A;  1KS2 A;  1O6X A;  1YJN S;  2RQC A;  1VIX A;  1S6O A;  4K4Z A;  3M8Z A;  3TYT A;  3N4W A;  5M2R A;  1RKI A;  3ZZZ A;  1LWC A;  3AH6 A;  3BR9 A;  1RWM B;  2OTJ S;  1S7I A;  3OTB A;  4DV2 J;  4NLP A;  3PW7 A;  3GFX A;  1YRX A;  5HL7 Q;  3LOU A;  1RT7 A;  4HAC A;  5FDL A;  5A8R B;  5IZH A;  4JI6 F;  2HS0 A;  3O44 A;  5IT9 Y;  3AD7 C;  4DUY J;  1UVK A;  2HHX A;  4X4Q A;  2O3D A;  5D0R A;  4JYA J;  2ZWO A;  3BYR A;  4YR0 A;  1RWX B;  4Q45 A;  2EFN A;  2HZA A;  2Y1L B;  4Q5V A;  3UPF A;  2LP4 A;  3KK3 B;  3CC4 S;  2AJ4 A;  3J7A N;  4LMZ A;  5ETR A;  3IBC B;  2GQQ A;  3HCX A;  2UVW A;  2HK3 A;  3H0P A;  3I0S B;  4RWX A;  1RCX B;  3CCV S;  2YX7 A;  2HVH A;  4NXN F;  5B0F A;  4NCB A;  2HIY A;  2LLZ A;  2VDH A;  2VPZ B;  4YDD B;  4OYP A;  5G0R B;  1H74 A;  4CLT A;  3E8O A;  2QLB B;  1NJX A;  1LW0 B;  1K9M T;  4KJI A;  2CYY A;  1WC6 A;  5F9L A;  1S6P B;  3D5M A;  4RW6 A;  2KB2 A;  4KGZ B;  3NCP A;  3P4U B;  1N88 A;  2MLX A;  3A8I A;  3DOM B;  3KK2 A;  3GIK A;  3WBZ A;  4EYI B;  2YKA A;  5K5M A;  1NRK A;  2IA6 A;  1C1B B;  2BM1 A;  4JI0 J;  5J1P A;  2MY7 A;  4Y34 A;  2QMU B;  2QT7 A;  4V19 J;  4TYA A;  2LA4 A;  3VAH A;  2RML A;  1VOM A;  2C3O A;  2MKS A;  3UDE A;  2HFU A;  5L9N A;  1S72 S;  5D4O A;  4L3N A;  5HK4 A;  1XMB A;  1MMN A;  4O44 B;  3QRP A;  5DQG A;  2RF2 A;  3U1M A;  1KDN A;  2AU0 A;  2HRU A;  4G1I A;  3W5Y A;  1YJR A;  3MCO A;  3EE3 A;  5LSO A;  4PR6 A;  1VIS A;  3A3N B;  5KOX A;  1EIY B;  3EGV A;  3HVT A;  5B0C A;  1GK8 A;  3CB4 A;  3J7Y U;  2RB7 A;  4IQX A;  4ZVS B;  4IR1 A;  5KG6 A;  1RTH A;  2BE7 D;  2IYG A;  4WE1 B;  2XHC A;  3RYL A;  2FHM A;  1Z2Z A;  5I3Q A;  4KKO A;  2YKM B;  2JVO A;  3OQ2 A;  1M0S A;  4F3O A;  1BGX T;  4M63 A;  5E3P A;  5JJB A;  5DG9 A;  2HHH J;  2HHQ A;  3SQG A;  1PBU A;  2KN4 A;  3JSB A;  2C2R A;  3PZP A;  4A8Q A;  2QG9 B;  2CKW A;  1CVJ A;  4N41 A;  2WON A;  4M5H A;  1XIQ A;  4B3R J;  2APO A;  3OTO F;  5D0H A;  3ZFV A;  1CJU A;  5KG5 A;  1RT2 B;  3GJS B;  3D6H B;  1VQ8 S;  1NKB A;  1RA7 A;  3G2X A;  2V2Z A;  3RAQ A;  1M5O C;  4J37 A;  1RI7 A;  3M9O B;  3CJ0 A;  5GAE U;  4DL2 A;  3CJT A;  4KQZ A;  5U47 A;  3HZG A;  2UV8 A;  3VZI A;  5KT3 A;  3JTO A;  1RBO B;  1GTH A;  2HGL A;  3M6W A;  3D66 A;  2RDI A;  3CCU S;  3BGR B;  2GMH A;  2JNJ A;  4CRJ A;  4WK3 A;  1TV6 A;  3DRR B;  2PFF B;  1SKW A;  1IQT A;  3D9B A;  3BDP A;  4PQU A;  3UCU P;  5MAO A;  3PCO B;  1WHY A;  4PYA A;  3TEH B;  2B0G A;  1APS A;  4I2Q B;  3D28 A;  1C0T B;  3MAA A;  2OPS B;  1OPI A;  2SXL A;  2ZHO A;  1K1S A;  2RKI A;  2J8A A;  3GYG A;  3N0V A;  2W25 A;  3G6V A;  4PKD B;  3CJK A;  4U95 A;  1VFJ A;  4P6Q A;  5H9F J;  2GX8 A;  5DET A;  1RAF B;  4DZ6 A;  2QO3 A;  3OL7 A;  1N5V A;  3LAL A;  2MQL A;  1BQM A;  4DV6 F;  2C3U A;  3UDV A;  4M5N A;  1H2T Z;  4Z37 A;  3M8Q A;  3ZTO A;  2AZ3 A;  4WJB A;  3M2R B;  4LF4 J;  5DZ7 A;  3BPD A;  2KJW A;  5GAD I;  1KOO A;  2DHX A;  2R2U A;  2DHS A;  2DXE A;  1M5P C;  2CJK A;  2GIQ A;  4FVM A;  1TQL A;  2DH7 A;  5DJB A;  2M88 A;  2Y8Y A;  1CSJ A;  1RJJ A;  3MUV P;  4N56 A;  2F8M A;  1U2R A;  4ILR A;  3U7J A;  3C6U A;  1D9F A;  3EGW B;  5B7W A;  4H4M A;  3R7S B;  3N79 A;  4E8U A;  3VHQ A;  3MUR P;  3TAN A;  2OFH X;  5IC6 B;  2FC9 A;  2PMW A;  2UUA J;  3VGS A;  4MK8 A;  2R7O A;  5HP1 B;  3BV8 A;  5MLC V;  3MR7 A;  4F02 A;  2AGP A;  1MN9 A;  1M5S A;  3F41 A;  5KFU A;  2F8E X;  3R2D J;  5C24 A;  1MU2 B;  3KDN A;  3AD8 C;  3W2W A;  4KGK A;  3EYZ A;  3PR5 B;  3OPK A;  1Q7L B;  4DEZ A;  4K59 A;  4LF5 F;  1X9W A;  3I31 A;  2DRB A;  3A13 A;  4PG7 A;  1FRX A;  1CUL A;  2LXI A;  4GMK A;  3VGU A;  4KB7 A;  2YX1 A;  5KAK A;  5KFJ A;  4R5P A;  2DRA A;  2EXU A;  4DUZ F;  2V63 A;  3SV4 A;  4NCG A;  2V4J A;  1OSD A;  3VV2 B;  4MK7 A;  4DQP A;  2KI2 A;  2FHJ D;  4LF6 J;  4DPW A;  2MGZ A;  2J6T A;  4HH0 A;  1T03 B;  3TJA A;  3I96 A;  3IWX A;  3N6N A;  3VZH A;  3KJQ B;  3LUY A;  2AZ1 A;  3GSD A;  3QIP B;  1PYO B;  2ATL A;  1HW9 A;  5L46 A;  5D6G A;  4F2S A;  5H9E K;  2WVD A;  4CNY A;  1RB0 A;  1J5E F;  3SDE B;  3CJ3 A;  2CNO B;  4CO2 A;  5IFM A;  1S1U B;  3KLG A;  4L76 A;  1RYR A;  1Y9O A;  1SC6 A;  1ZPW X;  3M05 A;  4U9R A;  5AE1 A;  2AKW B;  1LFW A;  2CQ4 A;  4HT7 A;  4NZ0 A;  4CYU B;  3MCN A;  3HXM A;  3QT8 A;  2YPZ A;  4NLS A;  2Y0B B;  4UOH A;  5RUB A;  1FXL A;  1CJK B;  3DMJ A;  2XY7 A;  2HQC A;  2RQK A;  4LR8 A;  2OHD A;  2E5G A;  6FD1 A;  3IR7 B;  2Y3Y A;  4I6W A;  2K1R B;  2ZBI A;  4XO0 A;  4OZ2 A;  2BE2 A;  1X9M A;  1KKH A;  1HBO A;  2QA1 A;  2KHC A;  1S48 A;  5KT4 A;  2ZD1 A;  3EZU A;  1RAD B;  2MZJ A;  3D0I E;  2FB0 A;  2HVE A;  2QA4 G;  3NRB A;  4ES3 A;  5GME A;  4QR0 A;  3V6D A;  1ULR A;  1RTD B;  4DSK A;  2B5J B;  5JUM A;  1KLM A;  1HWI A;  4UZC A;  4UZB A;  2BJD A;  4I6A A;  1NUE A;  3NGD A;  4ILL A;  1FWP A;  1NK0 A;  1D8Y A;  4Q44 A;  4JI1 J;  3AQP A;  1M1H A;  4NLQ A;  2HBQ B;  2CQ1 A;  2R7T A;  1T05 B;  3E2E A;  2KVQ E;  4M95 A;  2WVC A;  3CPW R;  4X4R A;  2UVU A;  3Q83 A;  3LQV A;  1X8D A;  3TRG A;  1QD1 A;  2R7W A;  1JLC A;  1VQ9 S;  1RQ0 A;  4O4G B;  3H5Y A;  2W9B A;  4C3K A;  2VFS A;  3MFI A;  2VU5 A;  4YHH F;  4FVC A;  1KTV A;  1PC5 A;  4OI2 A;  4RU2 A;  2HG4 A;  2DXF A;  3VAF A;  4ZVP B;  2AJF E;  3G86 A;  4LFB J;  1QAY A;  2FUG 9;  4B3O B;  2CXE A;  3LP2 B;  4DV5 J;  4ZLN A;  2G0I A;  4URS A;  3LWM A;  3QFW A;  4OYO A;  1PKU A;  3I0S A;  4JBC A;  3QT7 A;  5K20 B;  2FVC A;  1YWX A;  4WFY A;  2E5I A;  3KMS A;  3L7P A;  5C2C A;  4M5D B;  2HSE B;  4LF7 F;  4ETX A;  1IUJ A;  1RWN B;  2ASD A;  3GII A;  1C1C A;  3NG8 A;  4NLT A;  4QR2 A;  1S9E A;  3TQE A;  1TEL A;  1U25 A;  2P9G A;  2HKE A;  2AYE A;  3JQJ A;  1F9E B;  1WI8 A;  1QE1 B;  2ILY A;  1ZET A;  3HT3 A;  3G8T A;  2GJF A;  3TJ9 A;  3BO4 A;  4L3K A;  4WZM A;  4PCQ A;  2BYC A;  2DR7 A;  4A8F A;  2J7U A;  4F67 A;  1LKZ A;  1SC3 B;  4F4W A;  4FF2 A;  3HI9 A;  4JV5 J;  4HLB A;  4X4V A;  2NUH A;  3KLE A;  1O51 A;  2X3D A;  3IMQ J;  1T3N A;  3VAL A;  1B64 A;  4UUX A;  4IR9 A;  2B51 A;  2OUG A;  1X60 A;  3JS9 A;  2IJR A;  4K4U A;  1VQO S;  2J9E A;  3DRP B;  2DPI A;  2CPX A;  4Q2M A;  2M0G B;  2HND B;  2MKC A;  2ZIT A;  5IC4 B;  3ETO A;  4HYK A;  3M4X A;  2LU2 A;  3DXS X;  2DEJ A;  2MKJ A;  1TU0 B;  1FE0 A;  3MUT P;  1FKO A;  4IDK A;  3MM7 B;  2K2P A;  1LNQ A;  5B0E A;  4E98 A;  1CBK A;  2EFG A;  3E3X A;  3MMB A;  1X4B A;  2PE8 A;  4OX9 J;  1AYE A;  1DZ5 A;  2HWH A;  3BSN A;  1RT2 A;  3CD0 A;  3OL6 A;  4P72 A;  3MM8 B;  1FX2 A;  3WHI A;  1N54 B;  1R3N A;  4A46 A;  4F26 A;  4RPF A;  2E9T A;  4RW4 A;  2Y1I A;  4USH A;  1LW2 A;  2Q6B A;  1JKH B;  4DXL A;  1XNQ F;  2XGP A;  2VIC A;  4OI0 A;  5C25 A;  4PUO B;  4TVA B;  1UWB B;  3CUL A;  1SXL A;  2HGN A;  5J2N B;  1T9Y A;  3BH7 B;  3DC2 A;  5KFE A;  2VPW B;  1UFW A;  1VJQ A;  4ZK7 M;  1PBA A;  4B17 A;  2MXY A;  3OUY B;  1G7C B;  3Q89 A;  2W1B A;  4ZJL A;  4ECY A;  1CS4 B;  2W2O P;  4M5I A;  4CO0 A;  5T7L A;  1CC7 A;  1Z4U A;  4EMD A;  2WVF A;  3MMC A;  3R7B B;  5KT7 A;  2XLJ A;  5LMU J;  3CCQ S;  3O5T B;  2QLW A;  3H4D A;  1PYS B;  1MSW D;  2RDD A;  1VQ6 S;  2Z2Y B;  3UR0 A;  3Q8V A;  2RS2 A;  5KFK A;  2A10 A;  3ZZY A;  4ZKA A;  1HBM B;  1REG X;  3HSG A;  3AJ2 A;  4KV8 A;  4QYR A;  2B9E A;  3N6L A;  3M32 B;  5HAO A;  1HQE B;  1M5V C;  1RA6 A;  3QJL A;  4DR3 F;  1SC4 B;  1U6F A;  1FA0 A;  1EQ0 A;  4DJB A;  2QJ3 A;  2F3J A;  5KFL A;  5IT0 A;  2AD9 A;  2DGU A;  1BXN A;  3BSA A;  4MIW A;  1JJ4 A;  4P73 A;  5KT5 A;  3QBC A;  1Q81 T;  2BRK A;  2BAN B;  3JQM A;  4URQ U;  3FRZ A;  4NYO A;  1UZD A;  1TL7 B;  4IO9 Q;  4KPC A;  2LEA A;  1HNW J;  3MM5 B;  4EZ9 A;  3C15 B;  2DD8 S;  5K14 A;  4RUH A;  2QN6 B;  2YWF A;  2ASJ A;  2Y9H A;  1VHF A;  4K5S A;  3QNW B;  2J7W A;  4C8O A;  5ETM A;  1HNV B;  3W7B A;  3BBF A;  3QGP A;  1R8H A;  1YJU A;  5BR8 F;  4AQY F;  2MQP A;  3AOD A;  2ADC A;  3PJ9 A;  5AE2 A;  5JVG Q;  1S6Q A;  1QVG R;  3BSC A;  2FYX A;  2ZZT A;  2ZHA A;  3I4H X;  2AEF A;  4OJ1 A;  2HNZ A;  2GAG C;  5DRK A;  2EC0 A;  4G1Q B;  3ZC4 A;  2VG6 A;  1H7X A;  4FYW B;  3V81 A;  2W7P A;  4J9N A;  3HSZ A;  1HNZ F;  1SIW B;  3M1V B;  4ZN3 A;  3I82 A;  4KHP J;  1FXD A;  2IAJ B;  3OR1 B;  4O3N A;  3V2U C;  2LU1 A;  2XB2 D;  3AY0 A;  4NI2 A;  1ZZN A;  4KHM A;  5KFQ A;  4C8M A;  1KHW A;  4ID5 A;  3CJR A;  4CH7 A;  5IWA F;  4DV1 F;  4NA3 A;  3H98 A;  2VB6 A;  2Y8W A;  5C42 A;  4RW9 A;  2NLW A;  4CCH A;  2UXD J;  2DNO A;  5FD1 A;  2YWK A;  4GO7 X;  1Q1K A;  1AUD A;  2BQR A;  1X5O A;  3W61 A;  2BJ7 A;  3GR1 A;  4X84 A;  5CD4 A;  5FJ4 A;  5ETS A;  1EET B;  2MTL A;  4UT4 A;  2DNK A;  1N5S A;  2V5H G;  4WP8 A;  3NS5 A;  3KLF A;  3U1N A;  2C2E A;  1OWX A;  4IFV B;  1Y3J A;  3EZ5 A;  2XS2 A;  3IFE A;  5F8L A;  2VFR A;  4JV1 A;  5EWF A;  3HF5 A;  1WDD A;  4HH1 A;  4ZVR B;  3C6T B;  4N77 A;  4PRF A;  5IT4 A;  5B0G A;  3ADA C;  4ZCI A;  2YPY A;  2EBE A;  3GU0 A;  2CJ9 A;  4I69 A;  1GXT A;  3QAU A;  3AOB A;  1S79 A;  3DRX A;  2XGQ A;  1S6U A;  2OLW A;  1NJY A;  3HFV A;  4AFF A;  3KK1 B;  2P2C B;  2RIJ A;  4I6Y A;  4Q7A A;  3T1H J;  4P74 A;  2V6A A;  4IG3 B;  1HNX J;  1JLQ B;  2ZH4 A;  2QEX S;  3UCG A;  2MST A;  3IGN A;  3CDW A;  1SCJ B;  3V4I A;  2HBY B;  1V5V A;  4DQS A;  2YNH A;  3RAX A;  2CQB A;  3NS7 B;  5LMN J;  2DCL A;  2UV8 G;  1IKV B;  2RRA A;  5IXU A;  2V2Q A;  2CAD A;  4F25 A;  2F40 A;  3WX4 A;  2IY5 B;  4L74 A;  2N7C A;  1EJ7 L;  3ET6 B;  4KY3 A;  2VDI A;  1ZAX A;  2DB1 A;  2P5V A;  2XSF A;  4JI2 F;  2IJN A;  3PEJ A;  9ATC B;  2YVS A;  1R7I A;  4CLU A;  4MAK A;  1YGY A;  2EG1 A;  3ENV A;  5F8J A;  1B70 B;  3QQC D;  3E51 A;  5J2Q A;  2XY5 A;  3FCH A;  1NB2 A;  1SC1 B;  4PAA A;  1UAW A;  5I42 B;  4FYY B;  3I9Z A;  1W25 A;  5FII A;  2YNG A;  4OX7 A;  2KHD A;  4M5G A;  2CJQ A;  4ZVU B;  2B7C B;  5DO2 A;  1FNX H;  4ZPW R;  1WF2 A;  4O23 A;  2UZA A;  2DY9 A;  1S9G A;  3I56 S;  4LBP A;  1U2F A;  2BKN A;  2MQO A;  2ZHB A;  4QR1 A;  1PIL A;  5CYM A;  3BS9 A;  1H38 A;  3KJV A;  2JDJ A;  2OP5 A;  4QYZ K;  3SIP B;  1VIO A;  2ROE A;  4RW8 A;  4UST A;  4O3R A;  3ZTP A;  1WNE A;  4P2X A;  3EVW A;  3UNY A;  4WCE Q;  2RSQ A;  2ACY A;  3ZZO A;  1Q82 T;  3VAJ A;  3M9N B;  4U8Y A;  1P9Y A;  2HVI A;  4H54 A;  3OHB A;  4F7V A;  1OQ3 A;  3OXF A;  2Z56 B;  4B3M F;  2HPU A;  1JNZ B;  5F8N A;  3FBC A;  3SXL A;  3WIU A;  1IBM J;  1W2B R;  2VC0 A;  3HJF A;  4OV6 A;  3PXG a;  4ER8 A;  4WFB Q;  1TL3 B;  2VG7 A;  2GIR A;  4BC7 A;  2JEG A;  4G3I A;  3AJD A;  2KXF A;  2VFU A;  1B3T A;  2ERR A;  4K4X A;  1FKP A;  1RT1 B;  3UI3 A;  5KFS A;  4Y0F A;  4A8K A;  3GLJ A;  4JV2 A;  2EG2 A;  1DQA A;  3IBW A;  4PXC A;  2XWX A;  3NP5 A;  3Q8Q B;  2D3U A;  5EWG A;  4F2R A;  3UNG C;  4OZ0 A;  4B9N A;  2MY8 A;  3OL9 A;  4F4Z A;  3IRW P;  3LGN A;  2UU9 J;  2IYI A;  2DHG A;  4RL1 A;  5EGY A;  3NS6 A;  4XAK A;  2DK2 A;  4USU A;  4KGV B;  3DLH A;  5M2U A;  1F3F A;  3LWL A;  4DR1 F;  1AW0 A;  4OHY A;  3VWS A;  3TVK A;  4NML A;  2GML A;  2NXN A;  2GGP B;  1TTH B;  2W24 A;  2GZO A;  3UDL A;  3ITH B;  1GTE A;  1RCO B;  3J81 Y;  4LRF A;  1MML A;  4YY3 F;  3AT1 B;  2KT5 A;  1FK9 A;  3T5J A;  1DRZ A;  1N34 J;  2HWI A;  3S1T A;  2WSC C;  1SUQ A;  1N32 F;  3QZ8 A;  4Y28 C;  2VQF F;  2PGC A;  5KG0 A;  2XMT A;  3EVM A;  4ED3 A;  3KJF B;  3N28 A;  4K50 A;  4KHR A;  1SV5 A;  3QJP A;  4I0W A;  4OI1 A;  5E3R A;  3W66 A;  2ZWP A;  4DMZ A;  4ED8 A;  3DRY A;  3Q86 A;  4KYZ A;  3FNN A;  1N36 F;  2ZVI A;  2UUC J;  3D0G E;  3TZY A;  3M32 A;  4B9M A;  2EEY A;  3U1L A;  4R8U B;  2X7I A;  1TKX A;  2MQQ A;  2V8P A;  3GIM A;  2FVQ A;  2YQ1 A;  2BUN A;  1VRU A;  1SJF A;  4JI5 F;  8RUC A;  4L72 B;  4MKB A;  2ZJQ Q;  4ED1 A;  1NLK L;  3P96 A;  5CYQ B;  2MLY A;  4IRC A;  2DIT A;  4GKJ F;  3SZ2 A;  3CJ2 A;  1RWW B;  2UVR A;  3GZ7 A;  3MMA A;  2VG5 B;  1MRO B;  1ZTW A;  4J9M A;  4OX8 A;  3UR3 C;  2Q43 A;  5KG1 A;  2GHW A;  2AMC B;  2AJ0 A;  3MZI A;  1YJ9 S;  4NXN J;  2J5A A;  1Q95 G;  5AXL A;  2UUB F;  8AT1 B;  4LSL A;  4C8Y A;  4CM0 A;  2J0X A;  2Z2L A;  3BM7 A;  1BY9 A;  2BM0 A;  1LWE A;  2V8H A;  2IA0 A;  2VPY B;  2GMJ A;  3RR7 A;  5KT6 A;  3MR5 A;  1TL1 A;  1WG1 A;  4R0J A;  3GQC A;  3K89 A;  2RD5 C;  3TX0 A;  2MQM A;  4B3S J;  4OIX A;  3CCR S;  4DV7 J;  1FWK A;  1X4G A;  3K2Y A;  1T9T A;  5ETP A;  4J90 A;  2AQ4 A;  1T0T V;  4E0D A;  2HNY A;  3GYX B;  1KNZ A;  3KG1 A;  3BGU A;  2RT3 A;  2CPD A;  3CJQ A;  3R5D A;  2QZ8 A;  4DPO A;  1K0V A;  3D3B J;  4HDG A;  3W2V B;  2DVI A;  1LQ9 A;  4LR7 A;  4NZ7 A;  1JX4 A;  3UD4 P;  4FP9 A;  4UW2 A;  1HQ2 A;  4AL5 A;  2DNM A;  1NCL A;  2HFZ A;  3JTN A;  4H4K C;  3RAM A;  3K58 A;  3CCT A;  4B9U A;  1NZA A;  5E3Q A;  4J9Q A;  4KPY A;  3FVY A;  3H90 A;  1HBU A;  2XHW A;  2BXJ A;  3A8K A;  2ZC3 A;  2HQ3 A;  1VLY A;  2CPE A;  2BX6 A;  1SKR A;  1FHT A;  2N4C A;  1YG0 A;  1LWX A;  3K59 A;  3D1O A;  2JH3 A;  4DU7 A;  3C2P A;  3ENQ A;  1QJH A;  3CTR A;  2ZJR Q;  3DLG A;  4IG0 A;  4MIB A;  5LJ5 Y;  3H2V E;  2GNK A;  2VJU A;  4C8N A;  4JI3 F;  5KG2 A;  3GON A;  2AT1 B;  4K7Q A;  4PAB A;  3KLI B;  2FY1 A;  2M8D B;  3OVB A;  1PCA A;  3S7R A;  3AOA A;  1DAR A;  4ED4 A;  3O1L A;  2M52 A;  1RYS A;  2OML A;  1HYS A;  3JSY A;  3K0J A;  3V5R A;  3QRQ A;  3P8B B;  1KVJ A;  3OL8 A;  5IQQ A;  2W2Q P;  4RX6 A;  4Q0B A;  2IVY A;  4DPT A;  3FUY A;  1S1V A;  5L39 A;  1IWG A;  3CJ8 A;  3HHL C;  1YDL A;  4K4V A;  4WTO B;  3ISZ A;  3O6Q A;  2AX0 A;  4ZVE A;  4MKA A;  2B4U A;  3M9M B;  1SVD A;  1PYT A;  1WAC A;  4W98 A;  2IRU A;  1IJE B;  2OPR A;  2DPJ A;  3C19 A;  1NBE B;  4GKK J;  3BGO P;  5J2P A;  3CCS S;  3M8R A;  4DR5 F;  2RIL A;  2ZM6 F;  4BC9 A;  1U26 A;  3MED B;  2GHV C;  1S76 D;  2H54 B;  3GSI A;  3N01 A;  3BO2 A;  3D54 A;  3KLH B;  3MTJ A;  1FRL A;  1NAQ A;  5DDR C;  3KNG A;  4I2P A;  1RU1 A;  4NYZ A;  2VKR A;  2B9W A;  3FZB A;  4OL8 A;  3D1H A;  3IR6 B;  3LP1 A;  4P75 A;  3NAH A;  3K17 A;  3HHE A;  3NLC A;  2VAS A;  8ATC B;  1Q8K A;  3VQS A;  4YQW A;  5CH7 B;  1WG4 A;  5J2M A;  4DR2 F;  1VQK S;  2COL A;  4KBI A;  3DDI A;  3TAM B;  4O4R A;  1EQM A;  1UJ4 A;  4WF9 Q;  5A0Y B;  4DF8 A;  1WD6 A;  2IHR 1;  3FFI B;  2QYG A;  2HK2 A;  2GO9 A;  3I5A A;  1JWW A;  2FC8 A;  3BQ1 A;  2OFG X;  3HKZ D;  2J8S A;  2G1H A;  4ECU A;  2FLN A;  4DSF A;  4CLZ A;  4LQ9 A;  3HFZ B;  4V19 X;  2FLO A;  2YQ3 A;  5JMN A;  1JLF A;  1I3O B;  2GVZ B;  2U2F A;  2Z57 B;  2ZE2 A;  1OYE A;  1UEK A;  4C7Q A;  4IRK A;  2C22 A;  2HFO A;  4LFC J;  3FZ2 A;  4DQI A;  2AWZ A;  4ZP8 A;  2FLL A;  3UVJ A;  4MYT A;  5DQI A;  4QPX A;  2LFV A;  3H40 A;  4GVB A;  1UEV A;  2BVZ A;  2HRY A;  3CW2 C;  2CJB A;  5J1E B;  2XTJ P;  4ZVO B;  4DBQ A;  5JXS A;  3H59 A;  3Q8P B;  4H4K A;  4ALZ A;  4U8V A;  2J9D A;  2ZKT A;  3I5B A;  3J7Z 5;  2GA7 A;  2ZH9 A;  4FF4 A;  4DUZ J;  5CA5 A;  3R5J B;  3NNC A;  2MHE A;  4ECX A;  3G87 A;  2V2K A;  5HBM B;  4OX6 A;  2R2R A;  4WFN Q;  4HKQ A;  1WOP A;  1V5I B;  2PMZ D;  4F4A A;  2R8K A;  3DOL B;  4OZ1 A;  4HL9 A;  1TUW A;  1ZYQ A;  3OJU A;  4QIE A;  3T9Z A;  3SI8 A;  2J0Q D;  2LEP A;  1S5Z A;  1U47 A;  1WHV A;  4X65 J;  3RJM B;  3EVO A;  4CI0 B;  4ZLJ A;  4ERD A;  2AW0 A;  4TYB A;  4NWB A;  2LDY A;  3C8Y A;  3DRS A;  3G82 B;  3KUH A;  2KDO A;  1HPZ B;  1DJ0 A;  2AYG A;  4MKY A;  5BXI A;  3H2U B;  3JAM U;  9RUB A;  3UN5 A;  3QRR A;  3LGH A;  1ZPV A;  1XMO F;  2PI4 A;  1SJR A;  2CQH A;  3C46 A;  4J9O A;  2JWN A;  3HHL A;  2H5E A;  3W8G A;  2DNP A;  3MI7 X;  1PAE X;  1J5O A;  1R0A B;  3DM2 B;  3K5O A;  5CCM A;  3A3P B;  3J7A 1;  4EBE A;  1TVR B;  4CLP A;  2PEH A;  3ISN C;  1IM4 A;  2DHH A;  4KC5 A;  3PYE A;  4LRA A;  2HBR B;  4A48 A;  5ITH A;  2ZH3 A;  3KJN B;  4EEY A;  2YNF A;  4WFX A;  4EFA C;  1NO8 A;  5A8K A;  2CDQ A;  3GTY X;  1IBK F;  5H9E J;  2GQC A;  4OFZ A;  1QVF R;  3D0H E;  4CQ1 A;  1XWL A;  2CIM A;  3H8Y A;  4H4O B;  1S1W B;  4N76 A;  1FCA A;  1CJV A;  4PWD A;  4OZJ A;  4B08 A;  1REV A;  5E2Q A;  1DUR A;  4OHV A;  3DI6 B;  4DV4 J;  4LFA J;  2HAI A;  4HTI A;  1VQP S;  1I94 F;  4YHH J;  1H0H B;  2JVR A;  3ENA A;  2W9C A;  2YX4 A;  3QLH B;  5IM0 B;  3IN5 A;  4KTQ A;  4QIG A;  5I3U B;  2FZG B;  2ZUA A;  1DHM A;  2W2M P;  3Q23 A;  4DI6 A;  1UEU A;  4I7F B;  4ELV A;  4EUV A;  3I5C A;  4PXD A;  3MEG B;  3L4B C;  4OYB A;  2HVD A;  1RU2 A;  2CNN B;  1YJV A;  1ICE B;  2WOM A;  3OT9 A;  2PFD A;  3M2U A;  2XSJ A;  2KM8 C;  1JLA B;  1G2E A;  1S1X A;  4CTA A;  1NPR A;  4IUF A;  3MM9 B;  1PAU B;  4DUY F;  3MEE A;  3MEC A;  2R8G A;  1L3T A;  4JYA F;  3LAM A;  5DGA A;  4DQR A;  4C11 A;  4DZD A;  7FD1 A;  2QV6 A;  5CD4 H;  5HAN A;  2G13 A;  1KWM A;  1IBL J;  3CIM A;  5T14 A;  2W7A A;  3PTW A;  4WK1 A;  3F56 A;  4DV3 J;  3W8P A;  2BMB A;  2DH8 A;  1VQ7 S;  2E5L F;  3K8W A;  4X4T A;  3M2V B;  2E1P A;  2GVD A;  5CCL A;  2V67 A;  3OSP A;  1TAQ A;  1X31 C;  5IS2 A;  4RBU A;  1JJC B;  3VGT A;  2DBB A;  4ED2 A;  1UCN A;  2BJE A;  2I9S A;  1E6Y B;  2MKY A;  4L73 A;  4UY8 5;  2B8Q A;  1TR0 A;  2EVZ A;  4QBU A;  1N0V C;  1PC4 A;  3PY8 A;  1P9Q C;  3W9J A;  4KIA A;  2DR6 A;  1IKY B;  4ICL B;  4C2M A;  1T9V A;  1E6V A;  1QUV A;  1KLN A;  4LIR A;  4RUA A;  4GRS A;  5ETN A;  4F50 A;  2E9Z A;  5KOW A;  2JZ5 A;  4FPI A;  4NEY A;  2KT2 A;  2CRL A;  2YH0 A;  4Q2L A;  2HS3 A;  1U4B A;  3SMZ A;  3JYT B;  5D8H B;  4WU3 A;  2WW8 A;  5LSR A;  1GFW B;  2PC6 A;  4KO0 A;  4QU6 A;  3NGK A;  3DN9 A;  1QTN B;  4Y2A A;  3E01 B;  1K73 T;  2VC1 A;  2DO0 A;  1GQE A;  3BDE A;  2VHG A;  2QL5 B;  2ILZ A;  1TKD A;  1EX8 A;  2HHH F;  4A8O A;  3D67 A;  2GJI A;  1KRP A;  4K4W A;  3SCL E;  3CCL S;  5HMY A;  2CQ0 A;  2RRB A;  3B8H A;  4NLO A;  1VQM S;  2Z58 B;  4B3R F;  5F3T A;  2MZR A;  4C0O C;  4WKY A;  5ETK A;  4ELU A;  2J9C A;  1D0E A;  1WG5 A;  3U27 A;  3MUM P;  2AX1 A;  4DR6 J;  3M30 A;  2DNG A;  5GAH I;  3IS9 A;  3GG0 A;  2XMM A;  2XMJ A;  2QSW A;  1ROF A;  5HMW A;  3PRB A;  2BOP A;  5GAG I;  2YKN A;  2PD1 A;  1MG7 A;  2CPY A;  1EP4 A;  3ISN D;  3G9C A;  1JLE A;  1T3O A;  1ZTT A;  3VAG A;  4ELT A;  4FBU A;  1PJ6 A;  1BLU A;  1H2U X;  1ZH5 A;  1KQG B;  3R27 A;  3EZO A;  3B4D A;  1QM9 A;  1R8A A;  1KR4 A;  3KDO A;  4NXM J;  2W4D A;  4DN9 A;  2OPQ A;  3GMG A;  1XEZ A;  4LSN B;  5M2P A;  2IM2 A;  1TK8 A;  4JI4 F;  1SH3 A;  4BWM A;  4Z7C A;  2N4D A;  4X4P A;  1TKZ B;  4ECV A;  3QPI A;  3DGP B;  2YY3 A;  4MYU A;  1IN0 A;  3M6V A;  2WZ1 A;  1RTI A;  2CQC A;  4LF1 A;  2B3T B;  2MPU A;  1H7W A;  2JFD A;  3L09 A;  1WOR A;  4LF4 F;  4TY8 B;  2BV3 A;  5G4D A;  2CJX B;  3M8P B;  2ZJP Q;  3LP0 B;  3MR6 A;  5DS7 A;  2DIS A;  1GEH A;  3DKD A;  3HHD A;  3K5P A;  1DLO A;  3IG1 B;  1ZA2 B;  4X64 F;  1O0P A;  4OZL A;  2YKQ A;  3PW2 A;  5L38 A;  2XG8 A;  2P6S A;  1UA0 A;  4HHH A;  1LFP A;  3GIL A;  4QZV B;  3WX8 A;  3PIO Q;  1TKT B;  2KG1 A;  2RDJ A;  2IDL A;  3PFO A;  2BA9 A;  5CAA A;  2UUA F;  1RAJ A;  5KFB A;  3R1L A;  4Y2K A;  1IR1 A;  2EW9 A;  1JJ2 R;  3I4P A;  2YNI B;  1U2C A;  4DFK A;  1KN6 A;  2L08 A;  1S9F A;  2L3M A;  3TUZ C;  1AA1 B;  1RHJ B;  5D4L A;  2OEJ A;  4M5L A;  2VKZ G;  4DR7 J;  1BQN A;  4HR2 A;  1Q16 B;  1U1N A;  3G71 S;  1HD1 A;  1T11 A;  3CCZ A;  3ONQ A;  4EWT A;  2R8J A;  4FKY A;  5IWA J;  5ETV A;  1Q4R A;  3GV7 B;  5L8R C;  2QC3 A;  3CED A;  5D3G A;  1PSD A;  2ZZM A;  3OFF A;  4OJ3 A;  2CQI A;  1S97 A;  5F0W A;  2W9A A;  3OV7 A;  3AQO A;  3FBB A;  1N5Y B;  4A8W A;  1XMQ J;  1Q7Y T;  1KQF B;  2G2Y A;  5CAB A;  1DFD A;  1UWA A;  2YWH A;  2DGX A;  3NXZ A;  3I0R B;  1X4C A;  1Y11 A;  3WIV A;  2KL8 A;  1RT5 B;  1JLG B;  4PPZ A;  4U7U D;  3IRX A;  4JOU A;  2FHO B;  2B6A B;  1JXV A;  3BBB A;  3C16 B;  3PDN A;  3OR2 A;  2E44 A;  2DGT A;  2X1B A;  1X4E A;  4JUZ A;  2R7U A;  4BHQ A;  1IKX B;  3HLU A;  2AJQ A;  3TUI C;  3CXC R;  3SYZ A;  4LRC A;  1H3D A;  2OH2 A;  2GFF A;  4Z7Y A;  3HFK A;  3LPE A;  1R8B A;  1TL4 A;  4WFA Q;  5H1S V;  3R5B A;  5DGB A;  4ZPC A;  1YKW A;  5SZT A;  2DJW A;  4DFJ A;  2PDA A;  5EHH A;  3NNA A;  4NOH A;  2EC2 A;  4OYI A;  2ASL A;  2LQJ A;  2C2D A;  3DU5 A;  2A6O A;  5KFD A;  3LTO A;  4OHW A;  4DG1 A;  4RZR A;  1VQ5 S;  5DLF A;  5KFM A;  1GMU A;  1JNR B;  3IR5 B;  3L9Z A;  4ES1 A;  4ILM A;  4XPE A;  2KRB A;  2XM3 A;  3FBF A;  1RHQ B;  3HVW A;  1U45 A;  5KFP A;  3NWG A;  5B0B A;  1F2G A;  5B0D A;  1WOO A;  2KFY A;  2JJ4 D;  3TZX A;  5DDQ C;  5HRO A;  4LR9 A;  4JI1 F;  4DL3 A;  2ZH6 A;  4RW7 B;  3FQL A;  3MM6 A;  3OLA A;  1S10 A;  1NK6 A;  4OMF G;  1V6H A;  3EM1 A;  1IWA A;  3P6Y C;  5DZ6 A;  3GJT B;  4R25 A;  5AT1 B;  3CCW A;  3I87 A;  4M5M A;  4RBT A;  1QUP A;  1UET A;  2ROP A;  4TU7 A;  3GV8 B;  2V9K A;  4ZHR B;  4DL4 A;  3QO9 A;  1HWJ A;  4YR2 A;  4I68 A;  4WYL A;  1VS3 A;  1CJT B;  4USJ C;  4OLO A;  1R31 A;  2QYC A;  3DLE A;  3S6E A;  2CNL B;  1S1T B;  5CQG A;  4LFB F;  3QGI A;  1FI4 A;  1Q79 A;  3SSQ A;  3PHT A;  4Q8F A;  2ZBQ A;  5ADZ A;  1ZA1 B;  2VFV A;  4DV5 F;  2DIV A;  1WF1 A;  5A76 A;  3PFE A;  3V6J A;  4EZ6 A;  1D8Z A;  3M8W A;  2JEI A;  1HQU A;  1URN A;  4QOT A;  3DLK A;  2B56 A;  1QDU B;  2CQ2 A;  2H4W B;  1L5U A;  1WTB A;  2BKP A;  4AT1 B;  4OHZ A;  1NKC A;  5EWE A;  5A8W B;  4CIO A;  1RT3 A;  2FJB B;  4J91 A;  4LRE A;  2PII A;  1DTQ B;  4PEO A;  2OPP A;  2HMI B;  4ZOS A;  3GJR B;  5E3A A;  2QMX A;  2FY8 A;  4RNH A;  4DX7 A;  1VRT B;  4ENO A;  3G8S A;  2HHT A;  3GP9 A;  1JIH A;  3W3S A;  2ALZ A;  1FJ7 A;  4C8L A;  1VK8 A;  4DX8 H;  2IC3 B;  3UE2 A;  4PQA A;  4F4Y A;  3KOA A;  2PMH A;  1W26 A;  2NS1 B;  2E5H A;  2PN6 A;  2DNZ A;  3BSO A;  4FDF A;  1ARO P;  4MFB B;  4NLG A;  3NMA A;  2KM8 B;  1R0C B;  4JV5 F;  3BGF A;  2GC8 A;  1D1U A;  5D78 A;  3W65 A;  1HBN B;  1I5O B;  4UOC A;  3AB4 B;  2KRR A;  1AZS A;  1IJF B;  1VLO A;  2QGF B;  1N8R T;  2LA6 A;  3I55 S;  4PXB A;  4EO8 A;  2JSX A;  4QYZ J;  5GAD U;  1A9N B;  3NGS A;  4DR4 J;  1R8P A;  1VBK A;  4PWU A;  4YB5 A;  5HJX A;  2LCW A;  7FDR A;  1KQK A;  2HIQ A;  3JQK A;  2VF3 A;  1B0V A;  2R3V A;  3SFG A;  1NK9 A;  1N32 J;  1LWF A;  2ZUG A;  4IFY B;  1QSS A;  4JI7 J;  3DOK B;  4ECQ A;  3KYL A;  3KHL A;  1X4F A;  1FRH A;  4N8N A;  1JLB B;  1RT6 B;  3H2L A;  3BQ2 A;  1HWK A;  2XCP A;  3UN3 A;  4AE5 A;  1RT4 A;  2G1D A;  4K4S A;  1SL0 A;  3M6X A;  4LF8 F;  1X4H A;  1CLF A;  4Y65 A;  5AXN A;  3TI0 A;  2A3J A;  3Q2T C;  3SSS A;  3EXY A;  1FDA A;  1UW9 A;  3L7U A;  3QZ7 A;  2OEL A;  1NHV A;  2R9L A;  3RRH A;  1HHS A;  2I5J B;  3GFH A;  3NBP B;  2E1M C;  4DSE A;  3SSR A;  1IKW B;  2NR0 A;  3Q8U A;  2DHA A;  2F4F A;  4CO1 A;  1VQS A;  4CO5 A;  1N6Q A;  4NLW A;  4KSE B;  3T5K A;  3BPS P;  3LO3 A;  2BW7 A;  1F5C A;  1WWH A;  4L75 A;  3QJJ A;  1IQZ A;  4P71 A;  3SFU A;  2PSZ A;  3MPY A;  1RAA B;  1T02 A;  2HRT A;  2OJ3 A;  2E1C A;  5LMU F;  1B0P A;  2L9W A;  4YFU A;  1BD6 A;  1ZM2 A;  3FSX A;  3DLJ A;  5HLF A;  1LWC B;  1RTJ A;  2FVR A;  3EX7 B;  1C4C A;  4ETZ A;  1WEX A;  3LW5 C;  2F4V J;  3MCM A;  1U6B A;  2Q1L A;  2MQ8 A;  1RT7 B;  4HAC B;  5FDL B;  1X4D A;  3CDB A;  5D4P A;  1C0U A;  4LBI A;  2FJD B;  1NSK L;  3NY0 A;  5LXY A;  4F8R A;  4J9U E;  1YX2 A;  1DTT A;  1C2P A;  1S49 A;  2KFN A;  3CD7 A;  4PG8 A;  3CF5 Q;  4NA1 A;  1UVI A;  2V4Q A;  1WI6 A;  3BKU A;  2K3I A;  3JSM A;  2J76 E;  4LRB A;  4O3O A;  2DNH A;  3POT A;  4PWW A;  2VQE F;  3MOZ A;  3V6K A;  3H4B A;  3A8J A;  1RSC A;  5A2Q U;  2D41 A;  2C3P A;  3CME S;  1S0N A;  3NGT A;  1YVF A;  3PYF A;  3RBZ A;  1U0H A;  4ED6 A;  2IM0 A;  1WC5 A;  4RLE A;  5D0G A;  3OVA A;  2HEK A;  1QSY A;  1VRQ C;  3H7H B;  3CC7 S;  1WSR A;  3SQO P;  1TUV A;  1T9U A;  4FN5 A;  4RW6 B;  2NSB A;  4LF9 J;  2CG4 A;  3QWU A;  2BAB A;  3MTK A;  3KK2 B;  2KT3 A;  3ZZ0 A;  4UY8 T;  4K0K F;  3UDC A;  3CSK A;  3GPA A;  1RWP B;  2CWX A;  3SEO A;  1K0T A;  3CCE S;  3OHA A;  3C14 A;  3DYA A;  5CYJ A;  2FVS A;  2CQD A;  1HFE L;  2YBV A;  4WU2 A;  2F63 A;  1UVL A;  3JB9 k;  2BQU A;  2W8K A;  1U1K A;  1FJG J;  3D6F B;  4NE9 C;  4JI3 J;  2OD4 A;  1H6K X;  3OXL A;  2ATC B;  3HVT B;  1FFG B;  2EK1 A;  3CD5 A;  2ADB A;  3PO4 A;  4AXI A;  4IQM A;  5HJY A;  5KFX A;  1XNR J;  1K47 A;  3VVU A;  1RTH B;  4K4Y A;  1R89 A;  1UPP A;  3PVX A;  4X62 J;  2HQG A;  4DWI A;  3G6X A;  2FPH X;  4KKO B;  3G96 A;  4IH7 A;  5A8R A;  1WEZ A;  2UXD F;  2KVI A;  1NSA A;  3SQG B;  2DR9 A;  4NRT A;  2CPF A;  2Z0G A;  1NDL A;  4YS2 A;  2FHK A;  4ZA1 A;  5KFW A;  1YQH A;  3KLV A;  1KC8 T;  2MB0 B;  5F3Z A;  2WON B;  1MWZ A;  2QLF B;  1NM2 A;  1RBA A;  1CJU B;  4CT8 A;  4RUC A;  2XYP B;  3SV3 A;  3KK3 A;  4P7T A;  2BE9 B;  4J9V A;  2W7O A;  4DV0 J;  4NA2 A;  1UKU A;  1N5Q A;  3CO0 P;  4ZS6 A;  1Q8I A;  2B9Y A;  2DT9 A;  1M1G A;  5G0R A;  4EBD A;  1C4A A;  1HD0 A;  1TV6 B;  4CH0 S;  4JB8 B;  1FT8 A;  1RP5 A;  1BHN A;  1LW0 A;  4X66 J;  4PQU B;  3TQ1 A;  4C0B A;  1GXU A;  1S6P A;  5AJ3 F;  1X5S A;  3B78 A;  3RB3 A;  4FXW A;  3O3L A;  4QIW D;  3MAA B;  2MKH A;  2QSF A;  3RBE A;  5I3P A;  1FKA F;  1TMJ A;  3DOM A;  2XS7 A;  2R7R A;  2RKI B;  2B4O A;  3CJK B;  1C1B A;  1F2H A;  1HI8 A;  5D77 A;  3UD5 A;  5HO4 A;  1N0U A;  4DR2 J;  3SCI E;  4KT0 C;  1HNX F;  1HNI B;  4FZV A;  3AB2 B;  2AHO B;  1F5A A;  1BQM B;  2D9P A;  1YSJ A;  2NUU G;  1BMQ B;  3W5X A;  1LOU A;  2NCK L;  4O44 A;  2GW8 A;  4M8L A;  1URR A;  3GCW P;  1X5T A;  1UFK A;  2UXC J;  1Y0H A;  3RUB L;  4IH5 A;  4M5J A;  3RW7 A;  2VV5 A;  1ZZF A;  4ZN1 A;  1NXI A;  4WZQ A;  2ALY B;  2POK A;  2VJV A;  3NAI A;  1VGY A;  2AJ1 A;  2V8G A;  4WE1 A;  2EKY A;  4QWD A;  2K3K A;  2QA2 A;  1NH7 A;  2YKM A;  1NH8 A;  1RE1 B;  2GCF A;  3C6U B;  3AFG A;  3WC2 A;  4H4M B;  1EB0 A;  1NSQ A;  1PG5 B;  4DLE A;  3H25 A;  3PW4 A;  4IO1 A;  4FS1 A;  2D9O A;  1S4F A;  1RWO B;  2UUW A;  2ZOM A;  5LL6 d;  4HI1 A;  3LGM A;  4TU8 A;  2CNK B;  4XDC A;  3TZW A;  1Q53 A;  2UXB J;  5C24 B;  4HTJ A;  3W2W B;  1YI2 S;  5D15 A;  2MZS A;  4LIW A;  4M94 A;  5HSP A;  1U1M A;  3BGR A;  1PIE A;  1FFS B;  2HZC A;  1Q86 T;  3DRR A;  1KEK A;  4DL5 A;  1U48 A;  1CQM A;  1A7G E;  2B43 A;  3R5G A;  2DGQ A;  3P5B P;  3BEG B;  1CUL B;  3R2C J;  2MZ1 A;  4I2Q A;  1C0T A;  2P8I A;  3MWB A;  2OPS A;  3ZNU A;  5LJ3 Y;  2W4P A;  4R5P B;  2N3O A;  5E7O B;  4CO3 A;  4FNI A;  2O01 C;  4NCG B;  2V4J B;  4WPA A;  2HGM A;  2ZNY A;  1QAI A;  2MGZ B;  2PA3 A;  4QU7 A;  4ECR A;  4QIV A;  3BN4 A;  5E33 A;  1YBU A;  1RTZ A;  2MYF A;  3BJY A;  4AND A;  3M2R A;  4CT9 A;  1MWY A;  1OO0 B;  4CDI A;  1LXJ A;  3OD2 A;  4DSJ A;  3VGV A;  2FLP A;  4NYP A;  3KLG B;  7AT1 B;  4CLY A;  2UU9 F;  2DYA A;  4ZVG A;  4AUK A;  4FF3 A;  4LVO P;  3PNI A;  4WP3 A;  5BYQ A;  4KFB B;  3FQK A;  1RT6 A;  3F73 A;  2HFS A;  3ZZP A;  4O0I A;  3AOC A;  3DMJ B;  2V94 A;  1V3R A;  2D74 B;  4J9K A;  4CO4 A;  2JC1 A;  5CZX A;  4EBC A;  2FZC B;  3NGU A;  4QW9 A;  5HP1 A;  1IBK J;  2DNY A;  2DR8 A;  3B54 A;  1DY3 A;  2BE2 B;  5KG4 A;  4BWJ A;  4UUW A;  2HWT A;  1HBO B;  5LOQ A;  1S99 A;  2RHQ B;  5FLX U;  4I4B A;  2ZD1 B;  1N4L A;  1GH8 A;  1MU2 A;  1N34 F;  2B4P A;  4QWC A;  2YWG A;  4Y2C A;  3WQP A;  2B9X A;  5F8M A;  4B3T F;  3V6D B;  3T1Y J;  3TNV A;  1KLM B;  3GE9 A;  4DL0 C;  2UUT A;  2FTR A;  3DNC A;  3H5U A;  2Q79 A;  3JSR A;  3FCW A;  2YKO A;  4P10 A;  4KH1 B;  5A6W A;  1MN7 A;  4GVL A;  1KHV A;  2L9N A;  2BKO A;  2UUC F;  2BOA A;  1M90 T;  2H5J B;  1JLC B;  4YME A;  2NXE A;  2ZKU A;  3EPG A;  1WKJ A;  3SCJ E;  4RNN A;  3US5 A;  1T03 A;  2V68 A;  2W9B B;  3DXB A;  3W63 A;  1RAE B;  2XEX A;  1Y00 A;  2D69 A;  2W4C A;  3QYY A;  4DUT A;  3QIP A;  3PO5 A;  3P3D A;  2Z2M A;  1FRI A;  2E9R X;  2YTC A;  4OI4 A;  5LM7 E;  1T94 A;  4NRU A;  4DSI A;  2CDR B;  3TW0 A;  4PG6 A;  3SDE A;  3AAW B;  3FEZ A;  2KZZ A;  4NL5 A;  1S1U A;  4ED5 A;  1XJW B;  3PKY A;  1QY7 A;  4NX9 A;  4F0H A;  2WSE C;  2DXD A;  4RJV A;  6AT1 B;  2E5L J;  4BLG A;  5DM7 Q;  4CYU A;  2E1A A;  2OSR A;  1O8B A;  2XQC A;  2VBZ A;  1CJK A;  1C1C B;  1YJW S;  2G2Z A;  2FGO A;  2A2D A;  2KYZ A;  4UOF A;  2LQ9 A;  1S9E B;  3MR2 A;  2JFK A;  4LJM A;  4ED7 A;  2K1R A;  3JAM Y;  2PI5 A;  4B3S F;  2V50 A;  3D6M B;  2LDI A;  1YK9 A;  3TUJ C;  4DV7 F;  1NPK A;  2PT0 A;  2XBP A;  4JI8 F;  3UWT A;  1G6B A;  4RUB A;  3PJW A;  4J7C A;  1RAG B;  4I67 A;  2ABY A;  2FJV A;  2CVI A;  2Z30 B;  2HHU A;  4CLL A;  2Y1R I;  3FJ2 A;  1RTD A;  2CZ4 A;  4KGM A;  2ZBC A;  2B5J A;  5HVF A;  3TZZ A;  3D7S B;  3D3C J;  5D4N A;  1CEZ A;  1N5T A;  3KLE B;  5EX0 A;  1NZ8 A;  4XTT A;  1U8W A;  1R0B G;  2AP6 A;  1Z1Z A;  3J80 U;  3KMQ A;  1UP1 A;  2KJV A;  2RHS B;  1T05 A;  3D2W A;  1KFS A;  3J7Y I;  2WAQ D;  3U02 A;  1G3O A;  4IRD A;  1S57 A;  5KTQ A;  3IO1 A;  3W9H A;  2V69 A;  4O4G A;  3GCX P;  1FKO B;  2F8H A;  4IDK B;  5J1N A;  1SKU B;  3MMB B;  2F5G A;  1XN9 A;  3BGL A;  4EO6 A;  2HW3 A;  4NLR A;  1NK7 A;  2FJX A;  3NKY A;  4HT5 A;  4B3O A;  2H65 B;  2WBM A;  3LP2 A;  3LPY A;  2FIU A;  4ECT A;  1ZAW A;  2NPF A;  3CJ5 A;  3HVR A;  1L3V A;  4RW4 B;  3UN2 A;  1XBW A;  2LEB A;  5GAE I;  1NK8 A;  1LW2 B;  2AGO A;  2ZBR A;  3RB0 A;  2DRD A;  4MKV A;  2GQ2 A;  4M5D A;  5BJR A;  5C25 B;  3RW6 A;  1VBX A;  2A2C A;  2C3Y A;  1PJ7 A;  2I2Y A;  1I6J A;  2EPI A;  1RHM B;  4KGX B;  4FF1 A;  2NQP A;  4TLR A;  1TL5 A;  1QE1 A;  2KU7 A;  1Y10 A;  3C3L A;  1H73 A;  2KO1 A;  5T7L B;  4C0H A;  4JI4 J;  3NNH A;  4GKK F;  5LT5 A;  3MMC B;  4U67 Q;  3TX8 A;  2OTL S;  4JV0 A;  2RVJ A;  2DY1 A;  1HNI A;  4OYZ A;  3ZTR A;  3MHY A;  1RAH B;  2HZV A;  4ZPD A;  2C2Z B;  1ACM B;  1NDP A;  2IPO B;  3AA8 A;  4X4U A;  2EFO A;  3UO0 A;  4QWE A;  4KV8 B;  4CLK A;  4ZVH A;  3LAK A;  1VQN S;  1CC8 A;  2HFV A;  1PO6 A;  1YRT A;  1T95 A;  2XZD B;  3DRP A;  2M7S A;  1TAU A;  4AXJ A;  2HND A;  5DG8 A;  2BRL A;  4DFP A;  3KUG A;  1GT8 A;  2EI5 A;  4X64 J;  3UW1 A;  3BBC A;  4QPT A;  4QWA A;  5E5N A;  2JLE A;  2ZZN A;  1DQ9 A;  2W2P P;  1U09 A;  3A3O B;  1UPM B;  3MM7 A;  2IMO A;  1P27 B;  1RDR A;  2ZFH A;  4F36 A;  2B8P A;  3ZXW A;  4K2J A;  2KKH A;  4YB1 P;  2E29 A;  4OJG A;  4CWB A;  1RK8 A;  4YEA A;  2XUL A;  5THW A;  1IM6 A;  4NPO A;  1EKR A;  3MM8 A;  4QIF A;  2K7J A;  1TFY A;  2MLZ A;  2B7B B;  5K14 B;  1NJZ A;  2IBK A;  1JQG A;  4ZPA A;  2FDN A;  3MEK A;  2FHJ A;  1JKH A;  4LFC F;  5K9F A;  3RB6 A;  3B4M A;  4PUO A;  4PZV A;  1UWB A;  5J2N A;  1S0M A;  4PXE A;  2A0F B;  2MZT A;  3AXK A;  1S6Q B;  1UTA A;  1SBR A;  4BDP A;  2MZQ A;  1A0O B;  4NCA A;  2R42 A;  3OUY A;  3MPV A;  2HNZ B;  4Y2M A;  1CS4 A;  4XPC A;  4EK2 A;  2VG6 B;  2QL7 B;  3EIC A;  1HL6 A;  1RHU B;  3ILL A;  3V81 B;  3HDS A;  2LXU A;  2H3E B;  5E3C A;  4DU8 A;  2IIH A;  3R7N B;  3IBF B;  2R7X A;  3AA9 A;  4WBF A;  4NI2 B;  5I4M A;  2LYV A;  1WTF A;  3H5X A;  4TY9 A;  1ITP A;  2NZ4 A;  3EJM A;  2RU3 A;  1MWQ A;  2E66 A;  4ID5 B;  4OZ3 A;  3J81 j;  1RWK B;  2GIF A;  1Y5L B;  3GYN A;  3LA0 A;  3KXD A;  1HBM A;  1I51 B;  2JL9 A;  4C97 A;  2QTW A;  4U96 A;  2F9J A;  4Q8E A;  1HQE A;  5C42 B;  4RW9 B;  1UVJ A;  1T9W A;  4JI6 J;  2RQ4 A;  4C98 A;  4X65 F;  1VC6 A;  2X1A A;  3FMB A;  4C4W A;  1XTZ A;  5DDP C;  4P2F A;  2VBX A;  2QFJ A;  4MIA A;  3MFH A;  4KFB A;  3PV8 A;  4HDH A;  2XMK A;  4OYW A;  2N82 B;  4GC7 A;  3KLF B;  2DNQ A;  3TP2 A;  2OKQ A;  5C7P A;  2BAN A;  2L9D A;  1SL1 A;  1TL7 A;  2MJU A;  2L48 A;  3MM5 A;  2ASY A;  1L3S A;  2P6T A;  3C15 A;  3I32 A;  4RWW A;  2JLG A;  4BS2 A;  3OBI A;  2XI3 A;  4TXS A;  2VIH A;  1GNK A;  4HVZ A;  2F1F A;  2ROG A;  5T41 A;  1EAR A;  2H48 B;  1QAJ A;  2RUG A;  3OTE A;  1KVI A;  4QJV A;  2D3O 1;  3P49 B;  1LEO A;  1HNV A;  1WC4 A;  4CNZ A;  3PJX A;  2VH7 A;  1G1X A;  4N7T A;  3AXM A;  2WK4 A;  1SJ4 P;  1F5B A;  2AGQ A;  1WKK A;  1GX6 A;  3PIP Q;  3IWN C;  1YRU A;  3V4I B;  4AL6 A;  2R4F A;  2YNH B;  4LSZ B;  4G1Q A;  5L9X A;  4WFZ A;  4DDF A;  3W62 A;  2QA4 S;  4IOB A;  1NDK A;  4ANE A;  5KT2 A;  3M1V A;  1HKA A;  3HP6 A;  1NME B;  2RRN A;  1U1P A;  2BW2 A;  3BKT A;  2IAJ A;  3GV5 B;  4DV4 F;  3MMJ A;  2XLK A;  3OR1 A;  4LFA F;  2YWW A;  2CVE A;  4TNO A;  1P1L A;  4ZCM A;  4P52 A;  2QL9 B;  3GIR A;  4RR5 A;  2E7V A;  2HLT A;  2XC9 A;  3AHP A;  2AYB A;  3G6E S;  5J2Q B;  4URG A;  4N5S A;  4IOA Q;  5KFH A;  4Y00 A;  2Z4P A;  4J9L A;  4DQQ A;  1N33 F;  2UP1 A;  2DGW A;  3ZZT A;  2WVB A;  3OTO J;  3TO8 A;  2IJF A;  1EET A;  2BJ9 A;  1LK5 A;  4ZMM A;  2YNG B;  1VQY A;  2V8D A;  4ZLP A;  2JC0 A;  4HI2 A;  1M5K C;  4ZLL A;  3NOG A;  1UMJ A;  4IFV A;  3RGI A;  1RHR B;  2G0C A;  5E0O A;  5AXK A;  3CIZ A;  1S9G B;  3VR1 A;  4TQR A;  3C6T A;  5CYM B;  1IBL F;  1U1O A;  3KJV B;  1JXE A;  4NLY A;  2JOQ A;  3B82 A;  3EWG A;  4DV3 F;  3IM9 A;  3FC9 A;  2YXL A;  3RR8 A;  4RW8 B;  2NYI A;  4MMO A;  4ZIW A;  3HX9 A;  1N48 A;  2JX2 A;  4X2B A;  5KFA A;  4YUD A;  3KK1 A;  1F0X A;  4ED0 A;  2C1E B;  2DEI A;  3LF0 A;  3W1Y C;  3PKM A;  2V2V A;  2ZC4 A;  4N8O A;  4IG3 A;  4G6V B;  3CO9 A;  4ZPB A;  1RWV B;  2CQG A;  4FXD A;  2WVE A;  4UQG A;  1JLQ A;  4DL6 A;  1ZM3 A;  2O67 A;  2RNE A;  4DV6 J;  1GMW A;  2VG7 B;  3DCA A;  2FD2 A;  1HR0 F;  1FTR A;  1L3U A;  2R7Q A;  2CJA A;  3BRE A;  3OFH A;  1FKP B;  3FDS A;  2R2T A;  3MGJ A;  1IKV A;  4ITS A;  1Z2L A;  4DSL A;  1D9D A;  3OJS A;  4K2X A;  4K5R A;  5K8P A;  2IVM A;  1R6V A;  3ET6 A;  2DNR A;  3PM9 A;  1SJ1 A;  1FJE B;  1UVM A;  4W92 B;  2GO8 A;  4NMX A;  3A8E A;  4QW8 A;  1FRJ A;  4EYH B;  1FRK A;  2Q3P A;  1GMW D;  5LSL A;  1FVQ A;  3PRD A;  5BYS A;  1X4A A;  2NXJ A;  4LF8 J;  1AT1 B;  3HZE A;  5IOL A;  4B9T A;  3M8Y A;  2XCA A;  2IRX A;  4AL7 A;  3OTD A;  5KFF A;  5I42 A;  2MEW A;  5CHC B;  2NPI A;  4USI A;  2WBR A;  4CM2 A;  4J5O A;  3QAT A;  3ZTS A;  4XIU A; 
#chains in the Genus database with same CATH homology
 2MLX A;  2D3O 1;  3GTY X;  2MLZ A;  1P9Y A;  2MLY A;  1W26 A;  1T11 A;  3GU0 A;  1OMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...