2D3O1

Structure of ribosome binding domain of the trigger factor on the 50s ribosomal subunit from d. radiodurans
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
100
structure length
100
Chain Sequence
b'NKVEFKVSVPAAEVNRAYDQVWAGLARDVRVPGFRPGKAPRKVIENRVGKGYVESQVRDRLLETHYSQGLRELGLNLVDATVDPQDVQSGQAFEFTVKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title The Binding Mode of the Trigger Factor on the Ribosome: Implications for Protein Folding and SRP Interaction
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Ribosome
total genus 13
structure length 100
sequence length 100
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1050 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Trigger factor ribosome-binding domain 2d3o100
3GU0A 1P9YA 2MLYA 1T11A 2D3O1 3GTYX 2MLXA 2MLZA 1OMSA 1W26A
chains in the Genus database with same CATH superfamily
1U1LA 3HULA 2CYYA 3PO4A 3LP1A 2WVEA 2BE2B 5KFKA 4K4SA 4OYZA 1N34F 4O4RA 2OPSB 3UWTA 4N8OA 2HFUA 2QV6A 3NRBA 1HW8A 2YKNA 3UN2A 4ZMMA 4Q2MA 5I3PA 3MTJA 2M3DA 3Q89A 3KG1A 4DV5F 4Y6IA 2YKQA 2K7JA 3ZC4A 2KU7A 2HHHJ 3QAUA 1N5SA 2ZHBA 4A46A 3KHHA 3CXCR 1LQ9A 4CNYA 3PFOA 3KDNA 3WX8A 3CJTA 1WEZA 3MPWA 4JYAF 4JV0A 4Q0BA 4F7VA 2VODA 1VBZA 2LKZA 1U1OA 4E2FB 2O66A 1O0PA 3TAQA 2BMBA 4ETZA 3IS9B 3T6BA 4G6VB 3ENAA 2CQIA 2QL9B 2VQEJ 4MKYA 3ZZPA 5I42A 5GMEA 4ZJOA 2JLFA 3UDLA 3VTIA 2E1CA 1NAQA 3LGMA 1SIWB 2GNKA 1RT3B 5KFIA 2QL7B 3BGOP 1VCTA 2OPRA 4JI6F 5LSLA 1AA1B 3TP2A 2LXUA 3LQVA 3IXQA 4PWWA 3AT1B 5LOQA 1S0NA 1IBLJ 4C9DA 3HHLA 1XTZA 3SXLA 3LWLA 5KT7A 2H5EA 1X9WA 1GXTA 2C2OB 3RB4A 1TL7B 4EO8A 1CEZA 4J9SA 3TYTA 4FBTA 2K8GA 3OL8A 2C3OA 3LOUA 4CLWA 4DBQA 4DUZF 1Y5LB 5D77A 3BJYA 3M2RB 2DJWA 2VDIA 3DOLB 4OLPA 4DQIA 3QGGA 1C0UA 5HO4A 3QWPA 2RH3A 2FLOA 1WC6A 4TLRA 2M2BA 1WWHA 2W8LA 1S6PB 4DV3F 2FHMA 3CD0A 3KK1A 4WTYA 9ATCB 1HQEA 5DLFA 2MQOA 3DXBA 3L7OA 5C2CA 3AD8C 3TEGA 4HT7A 2DRDA 5JVHQ 5FD1A 1EJ7L 2XMMA 5ETRA 1OJ4A 4L72B 1A9NB 1TU0B 3BREA 1DLOA 5A8KB 5B0BA 1TUGB 3BSCA 2A0FB 3DLKA 4OYIA 5EWEA 1HBNB 1MWZA 3VGTA 5DO2A 3UE2A 2GIRA 3OL7A 1FX4A 1TELA 2RDJA 3CD6S 2YWKA 2QC3A 4XPEA 3RB6A 2Z8QA 1NJYA 2DXFA 4ED1A 2R7UA 4JI0F 1RAGB 3DDIA 5M2UA 2MZJA 4C6AA 1U49A 4FVMA 1HWUA 2NUUG 4P75A 2E7WA 1SH2A 4O23A 4LFCF 1BC6A 1LFWA 1QE1A 2P5VA 1HR0F 1TMMA 5KFZA 4RBUA 3M8ZA 4AQYJ 4Y3CA 2Y1RI 4DL6A 3EICA 2CPIA 5HQMA 3JTPA 1SQFA 4DR6F 2V2VA 5L8RC 1FRIA 1NM2A 2G13A 1VQLS 3A4TA 1MNEA 3D28A 4ECZA 3DOMB 5G0RA 3K5OA 4GO7X 4QIVA 4C8MA 3OLBA 2UUAJ 4WE1B 2IFXA 4JI4F 5EHHA 3MEDB 1OY8A 4GC7A 4FNHA 2MKKA 2KRRA 4M94A 4IG0B 1MSWD 1URRA 1R0BG 3DRXA 2LU2A 3IBFB 3PEJA 4DCPB 1NXIA 2W25A 4Y00A 2HNZB 5B7WA 2WBMA 3BKUA 3MUTP 1V9OA 3QMQA 4IDKA 2DR5A 4UOCA 3ZTOA 4CI0B 2OTJS 3CIMA 1H3DA 3MCMA 5HLFA 1UL3A 2M52A 3D6TB 3RW7A 3CULA 2YQ3A 3LP1B 3T1YJ 1MN7A 3M2VA 2DITA 4J91A 5DETA 1REVA 2XHWA 3OJUA 4J90A 2JC0A 4X66F 3ENVA 3Q8PB 2IJNA 5C25A 4I7FA 1DURA 1N5VA 2BX6A 2OHDA 4E98A 1R0CB 4EGLA 5JVGQ 3OVSA 3UR0A 2MYFA 4EBCA 2BQUA 4LBIA 3OPKA 2GA7A 3MPYA 1I94F 1SJ4P 4C4WA 1IJFB 2HHTA 3W64A 3TJ9A 4ZJQA 4J9KA 5J1NA 3MFIA 4PYDA 4CTAA 2DNGA 4K59A 2ZM6F 1KBRA 2Z2YB 1VRUA 3DM2B 1RWUA 1WF2A 4P71A 3Q8SB 4NLXA 2V8HA 1BQNA 1U1NA 1NHKL 1Q8IA 4RWWA 2I8EA 3CW2C 2RU3A 1UA0A 1D3WA 4LF5J 5E5NA 4OHVA 1V6HA 2DD8S 4OI4A 2RQMA 3N6LA 2ZVIA 3P6YC 4URQU 4WP3A 2JLGA 2GJFA 5I42B 4RNOA 5F8GA 1TFWA 1KTQA 2APOA 2CQDA 1NK4A 3NGSA 5IT9U 3UCZP 2RNEA 3IWNC 2HEKA 4QW9A 1RT1A 8AT1B 2VFSA 3P49B 3NMAA 2CPYA 2B4UA 4KJIA 3ISND 1M5SA 4K0KJ 4RW8A 3I31A 1JNZB 1RTIA 4UZCA 4OX6A 1B7FA 4WFZA 3DC2A 3AFGA 2I6WA 2YWFA 5KG1A 1TL1A 3TZWA 1Y5IB 4G1PA 4HTJA 1QTNB 1OPZA 5HATA 4LF7J 2FJDB 3EVMA 1C4AA 1WC1A 5HP1A 3D6MB 2J76E 2IDEA 4P73A 2GVDA 3V4MA 4RW4A 1C0UB 4P6QA 3CMES 4MKVA 4N5SA 2CIMA 3HHLD 1K47A 3IO1A 2R7SA 2DHGA 2PMHA 2X7IA 3CCWA 1RDRA 1LW2A 3C3LA 2DPJA 1CJUA 3RBZA 2E1MC 4OJGA 1NSPA 1X4BA 3OBIA 3VV2B 4KGXB 1DLOB 2WTFA 4ZP7A 2AX0A 1RADB 4F36A 2DEJA 4EFAC 3I5AA 2QSWA 5CCMA 4NZ0A 4M5LA 4LUBA 1RTDA 2FZGB 3B4MA 2HHHF 2MY8A 3HLUA 3EGNA 3WDOA 3PW5A 4U6PA 2DY9A 5H9EJ 4NEZA 5ETOA 3B82A 2JEIA 3BSNA 4F04B 3ISZA 4DPOA 3R5BA 2GHPA 5KFNA 2OMLA 4ZVQB 3SBMA 2ZJPQ 4CM2A 5T41A 1HNVA 5F8IA 2XLIA 4F2RA 1R31A 2EFQA 3M6WA 2N7YA 4IO1A 2R4FA 3EXCX 2BOAA 5G0RB 2VQEF 2IVFB 5HN0A 1L3KA 3OR2B 2QFJA 2JHEA 2AKWB 3I4PA 1H38A 3BSAA 1I6JA 3D5MA 3ZZZA 3RB0A 3W5YA 2A1BA 2ZUGA 1J27A 4UT4A 5CXTA 4O3RA 1YJUA 2WHOA 3L7PA 3MMJA 5AJ3J 3CJ3A 4GVLA 4QPXA 4B9TA 1R0AA 1IBLF 1WACA 1DFDA 2XY7A 3IMQJ 1T9UA 4IDKB 1VK3A 1XNQJ 5LJ5Y 2LMIA 3K5MA 5HLFB 4FN5A 5CYMA 3R6LB 1KQFB 1YI2S 4FF1A 3A13A 4ZPAA 4PAAA 1PO6A 1J2VA 3M2VB 2IA6A 1H2TZ 4GO5X 4R0EA 1F3FA 1REVB 1Y5NB 4A47A 2JEGA 3S1TA 3KNAA 4ZVTB 3QT6A 1V5IB 3RB3A 2RUGA 1F5CA 3GE9A 2W9CA 5C25B 4I7FB 3EGZA 2A6MA 2C3MA 1VJWA 2B5JA 1VRTA 2KM8B 3IFEA 3AJ1A 4LIWA 3TARA 1LNQA 2YNGA 1S0VA 4CTAB 4GC6A 2VFUA 4C0HA 1VRUB 3I82A 4B9MA 2CNLB 4DCJB 2HWHA 4ILMA 5CZVA 2AYBA 2FZKB 1CJTA 3QGHA 3OL9A 2VDHA 1GK8A 1BQNB 2XSFA 3Q86A 3C6TA 1OWXA 4BS2A 2IM2A 2V9WA 3BM7A 1EKRA 5KFYA 4B02A 4F4ZA 3G86A 4PWDA 1EP4A 2FVRA 3OT9A 5LMUJ 4QPTA 3KFWX 2QLWA 3AQPA 3M6UA 5E3AA 4K5RA 4OHWA 4KB7A 3UCGA 2GJ2A 3BBCA 2J7WA 4DZDA 4ELUA 5KOWA 1K1SA 1IUJA 3KNGA 1N88A 3NLCA 4AQYF 3I4HX 2RS2A 3G87A 2J9CA 4M5KA 2DGUA 3A8EA 1RT1B 2XCPA 3M30A 2N7CA 2VD3A 2YTCA 4PG7A 4RW8B 1LWCA 4PPZA 2UUAF 3R1LA 3CC7S 1RTIB 4IQXA 4IRDA 2XSJA 4YS2A 5KFAA 2RD5C 2ZZMA 1TL1B 4FS2A 4WK3A 2BJ3A 3KHGA 1LV5A 5HP1B 4ZPBA 1Q5YA 3GV5B 2GVDB 3D3CJ 2AHOB 4RW4B 3GG0A 4Q5VA 3NGKA 2VBZA 3BV8A 1EB0A 3F56A 1ZTWA 3EYZA 4DDFA 1TKDA 1NPPA 1MG7A 2GX8A 1UJ4A 4L74A 4EZ6A 5DG8A 4XTTA 1LW2B 3BPDA 2NYHA 1ZZFA 1NZ8A 1TKTA 1CJUB 3C2PA 3T1YF 1VQ4S 2XWXA 1AT1B 1U6FA 3UCUP 4DL5A 4CLKA 1GQEA 4KFBA 5ETTA 3DMJA 1U4BA 3KLGA 1PAUB 5KFPA 3MF5A 4DR7J 1WKLA 2HQIA 4C3MA 2PI4A 1LFPA 1Q8LA 2CNOB 1RKIA 2QYGA 1RTDB 1N33J 5KAKA 2M4MA 5CD4A 2ILYA 5C24B 2NSCA 1YJNS 1WDTA 4DR2J 5GAEU 2BE9B 4FYDA 4BC9A 3OFHA 3NCPA 3VGUA 4KGKA 4EUVA 5L1KA 3J7YU 1F60B 2WCXA 1RKJA 1KFDA 4NE9C 4LSLA 3GFXA 4QIWD 3OTCA 3Q2TC 1B0TA 1HNVB 4LF5F 4U9RA 2HK3A 3GJSB 3BB5A 2XHCA 2VG5B 3T41A 1ITPA 2DB1A 4KGZB 3TA2A 1EAYC 3J81U 2GCFA 3QAEA 2YX4A 4CIOA 3MMAA 1HL6A 2IM3A 4NRTA 2PIIA 4DL2A 4NLVA 1HQ2A 3H40A 3FMBA 2QE5A 3HKWA 3H5UA 3D0GE 3JSRA 1AROP 3MD1A 2B9YA 4DJBA 2V50A 3CNQP 1SJRA 3CCES 3CD7A 3D6FB 4JUZA 1UCNA 2NXCA 5IS2A 3QFHA 2ZH1A 4I67A 4OZNA 4M8LA 1CPZA 2QA4G 1CJKA 4K0KF 5CYMB 3IM8A 2XMUA 1M5HA 2AIRB 2FZCB 4ES2A 3F0NA 4F4YA 4LQ9A 2CG8A 5G4DA 2RAQA 4LF7F 2VC0A 2N4DA 2O3DA 4BHQA 4PWUA 2BANA 4G65A 2V68A 4HDHA 2W9CB 1D0EA 2OH2A 1YDLA 1T7PA 1BLUA 4ILLA 3V81A 3KOAA 2LXIA 2B5JB 4AE5A 2OPQA 4ZVPB 1VRTB 2IRUA 3S8SA 1FERA 4C8OA 4DI6A 2CPHA 2MTLA 3PO5A 3IRXB 2YNGB 3M6VA 2CQHA 3QRRA 1C4CA 2N82B 2Z2ZA 2RMLA 4IRKA 5A6PA 2EBEA 1KFSA 2DRBA 1XEZA 3CO9A 1CJTB 1JLAA 2VKZG 2JOQA 2QA4S 4K4ZA 2XZDB 1SI9A 3Q8QB 4CLLA 2PFDA 3GU0A 3F44A 4LMZA 3C6TB 1RABB 3W61A 1FDBA 1FKPA 4GVBA 1KQKA 1SKRA 1XMQJ 5L46A 2LEAA 3R2DJ 3PX6A 3EJMA 4F4XA 1UW4A 3A8JA 5F9LA 4MIAA 3HVTB 4YB5A 4RU9A 4WFAQ 3G6XA 4F25A 5BYSA 3J80Y 3G9CA 4QYZK 2V8GA 1FVQA 2GMLA 1X31C 3FZ2A 1VQNS 1T95A 4B08A 2YY3A 4R5PA 1RI7A 3NS6A 2BA9A 1PJ5A 3SIPB 2DNQA 1KVJA 2XCAA 3MPUB 3TAPA 2CVEA 4QIEA 2RQKA 3PCOB 2ZUAA 1Y0HA 2RRBA 3MGJA 4CLZA 4E8UA 2P9GA 1FRKA 1NUEA 1GH8A 1LWCB 4ECRA 2XSJB 2HNDB 1M5OC 4DU8A 2GHWA 2MHNA 2KG0A 5E3RA 1AZSA 5HQLA 3D0HE 2EC2A 1RT7A 4ED8A 3F73A 3FSYA 5AJ3F 4OZ5A 2NXEA 4DV7J 1HI0P 1TQLA 5LT5A 3G71S 2ZHAA 3G96A 2QLBB 4LSNB 1XNQF 3AXKA 3H25A 5CA5A 3KUHA 1LW0A 3PKMA 1MROA 4H4OA 3FZBA 2I38A 1SKSA 4N8NA 2BJ9A 3W5XA 1FKAF 1VBKA 3JTNA 5KFBA 5KFOA 5E3QA 4KFBB 2FHJA 3HJVA 3KLGB 3MM8B 1L3UA 3GSDA 4Q7AA 1F5BA 4ZK7M 2GIQA 1L3SA 2ZH4A 2U2FA 2BEFA 4P52A 2IRYA 2WVBA 2Y8WA 3V6DA 4OMFG 4XO0A 2AF6A 4FXVA 2PA8D 2VHGA 1RU1A 4NLSA 1IKWA 5HL7Q 2ZBCA 2XMKA 2J6SA 2DTJA 1B7YB 3KG0A 1AUDA 3U1MA 3VAKA 1S0OA 2AYMA 5BYRA 5E7OB 5LMUF 1H0HB 4XK8C 2AGOA 5HROA 2CQ3A 4IOCQ 4I0WA 1N56A 4M5DB 5KG3A 1U2CA 4J9LA 2MKYA 2Y3YA 1VC6A 3LA0A 1NH8A 3ILLA 2UUBJ 4QWAA 5D0HA 4MKAA 2FVCA 1SJQA 4A8XA 3BYPA 3H5SA 2IBOA 4LBPA 2LDYA 3H98A 3W8GA 2W9AA 1NSKL 2ZH7A 3H5YA 1SJFA 3KKFA 5DQIA 3Q24A 1YX2A 5LM7E 1S1XA 3PY8A 3VAHA 4ZLPA 1HMVA 3BF4A 3AHPA 2V8VA 3KDOA 1CJKB 4QZVB 4NLQA 3KLIB 2E1AA 1H7WA 3HD2A 3MCSA 1U25A 1X5SA 4B3TJ 3C15A 2OMOA 2KJWA 2ZBIA 1H74A 2OPPA 4TY8A 4JI1J 4ECUA 2B0GA 2BANB 1JLEB 3G8SA 4ED6A 3RTVA 2MJUA 1JKHB 2HAFA 3A3OB 4J9UE 1FT8A 1Q53A 2CJAA 1LXNA 2PFFB 3M8PB 3DLLQ 1GMUA 4YP3A 3MM7A 2GVZA 2OPQB 1HPZA 4Y65A 4XAKA 2M70A 2BOPA 1KONA 4FXWA 3O44A 2OGUA 4MJKA 2VBWA 4DSEA 5KFHA 4ED0A 4FYVB 5KFUA 1T9TA 4F50A 1LK7A 4HHHA 2CQ1A 1Q79A 2WSFC 5KG6A 1U2FA 4USUA 1JLAB 5GAGU 4MK8A 3HP6A 3K5PA 1QAJA 4YQWA 3G6VA 3TJ8A 4DR7F 2RUSA 1FKPB 2HYIB 1RAEB 3US5A 4KH0B 2JJ4D 1N33F 2D3ZA 4YY3J 2AJ2A 4F3QA 5HJXA 2I2YA 2R7QA 5M2RA 4DR2F 3GYNA 2RSQA 4C7QA 3N9UC 2F3JA 1HBMB 3CCZA 2BJEA 4R5PB 3CMQA 1HWJA 3GWCA 4UZBA 4EBDA 1KQSR 4FBUA 3DRPA 3MM9A 4YB7A 4PG4A 1S1WA 4ZCKA 3DGVA 4UY8T 1B99A 4Y2IA 5CHCB 4YN3B 5L9XA 3WZ0A 1G1XA 1CJVB 3C66A 3CCLS 2O01C 4ED7A 2Z30B 2RHQB 1Y4ZB 1QSSA 3M1VA 3CVKA 2CKWA 4FYYB 3SEOA 3VALA 1UVNA 1RT7B 2AWZA 2K7KA 3FFIA 5F8LA 2ZNYA 3W9IA 5IXUA 1XNRJ 1PJ6A 2OEJA 5IQ6A 1K8AT 3I0SB 3N01A 2HWIA 1NU4A 2UUTA 3PRDA 4K4XA 4PXBA 2J8AA 4OFZA 1JLGA 1HHTP 4S0MA 1GX6A 3QWUA 3UI3A 3M8SA 1LW0B 5KFQA 4H4OB 3D3BJ 5BJRA 4KYZA 2E44A 3GONA 2I5JA 3THPA 1YJ9S 3D67A 3PRBA 3QZ7A 3QJLA 4WFBQ 4DSJA 4QR1A 2BR0A 1U1RA 1RBAA 2OEKA 1PG5B 2QGFB 4LF2A 4USKA 3VAIA 4LQ3A 4JV5J 3N6MA 2B43A 3F41A 2HURA 4FF4A 4PYAA 2PO4A 4LRFA 2R2TA 4WBFA 2EFPA 2E7VA 4TN2A 5KFEA 2A2DA 1E6VA 3NMRA 3JYTB 3IAS9 2IMWP 2OFHX 4LT6A 3V6DB 2CPZA 3MWBA 1F2HA 1Q7LB 3I96A 1DJ0A 3FC9A 1ZH5A 5KFSA 3QNWB 4DV2J 2N3OA 2ROPA 4WXWA 4KT0C 1PAEX 4FPIA 1VYAA 3GSIA 2MQQA 2OO4A 1IKVA 4JOUA 2FHJD 2K1RA 3I9V9 4QWBA 3KMQA 5DDQC 4NLTA 1XMQF 2R3VA 4QW8A 3EGVA 3OR1B 3TQ1A 4X4PA 4Y2CA 2HRUA 1QVGR 1N5YA 5HROB 1DRZA 1SC6A 1FNXH 4DV1J 5K8NA 4KH1B 3CDAA 1U0SA 4D3GA 5J2MA 2B7CB 1YJWS 5J2QA 2MKCA 4ZP9A 3J7ZT 4ES3A 3NXZA 2OSRA 5BXIA 4WYWA 2F8HA 2FIUA 5DGAA 4C11A 4K2XA 3ZFVA 1UZDA 2DHHA 1S5ZA 5ITHA 1PSDA 3LUYA 2E5IA 2HBZB 5KFFA 2O67A 1NSAA 2W4CA 4I69A 1F1BB 1Y10A 1S1XB 1YJ7A 1HMVB 2HGMA 3TR5A 1VI7A 1BGXT 4IFYA 3C14A 3U1LA 2BJ7A 1EARA 3W63A 1U6ZA 3C15B 1FFGB 4C8YA 3MR2A 2V4QA 1OS5A 4Q43A 2OPPB 4TY8B 4W98A 3QPIA 1NJXA 3JQJA 3VAMA 3VZHA 4KY3A 1P9QC 4GKKJ 2OSQA 2ALZA 2IBKA 4DV7F 2YWEA 2VFVA 3R9LA 3DLGB 3W2WA 3QT7A 3ENQA 1ROFA 3MM7B 2GVZB 3KLHA 3H8YA 1AXQA 4PR6A 4L73A 4RW7A 3HFVA 1MMLA 4ZCMA 4A8SA 3OD2A 2RDDA 2NSBA 3IG1A 1WHVA 1JWWA 1CLFA 3A3NB 3VHQA 1WELA 4X62J 2XC9A 2L3MA 1IKXA 1RSCA 1Q86T 4FPRA 2J7UA 1M1GA 2MLYA 1ZOTA 2CJQA 3CC2S 3ZTPA 3N79A 3MAHA 1TAUA 5CAAA 1OQ6A 1F5AA 2GS8A 4A8QA 3I87A 1QAYA 4TU7A 4X4SA 2ZH5A 2GIFA 1SB6A 1T3OA 1X9SA 2LYVA 3DRPB 3MM9B 3OUYA 2F4FA 1RCOB 3P96A 3NOGA 1S1WB 2QLXA 4PG5A 2UP1A 4QU7A 4OZ1A 3T9ZA 5K8OA 2HBRB 3SV3A 3UW1A 5HMWA 3VZIA 4PXDA 2W2QP 1RTHA 1W26A 5KG4A 4X65J 3K57A 2UUBF 1HFEL 1O8BA 4NCGA 1WKKA 2DGWA 2CZ4A 3S6EA 1K44A 3M1VB 4J5OA 2D1CA 3ZZRA 3KLFB 2NQPA 1NK0A 2ZBRA 3GJQB 4ZPWR 1NKBA 1IM4A 3FFIB 2IJRA 2PD1A 3LALA 4BC7A 4FKYA 3CCMS 2DR9A 3RRKA 5IFMA 2CRLA 1LWXA 3ZZOA 1JLGB 1S12A 4RBTA 2E9ZA 3U7JA 2MZSA 4TU8A 2HLTA 5A2QY 4NXMJ 4TYAA 4OX9J 5GADI 5THWA 5C2GA 3HT3A 2I5JB 3ITHA 4B3TF 3LF0A 5IC4B 4IH7A 1NB7A 2XBPA 3QIPB 5D4NA 1DHMA 5KT4A 3ONQA 3W5ZA 1FXDA 3J7AN 3OXFA 4BBYA 2HVEA 4NLDA 2GV1A 2BKOA 3EE3A 5C7PA 3I5CA 4H4MA 5KFDA 2UUCJ 1WSVA 1FTRA 3LGNA 3O1LA 2X51A 2ADCA 1CQMA 3FBBA 2OD4A 1E6VB 2HFNA 1EETA 2CXEA 3KK2B 4BCAA 3TUJC 1FXLA 3CE8A 3RZAA 4K8RA 2ASLA 4I64A 5F0WA 2LCWA 1LWEA 1D9DA 1WEYA 2U1AA 4O3QA 3G2XA 2UV8A 3TAMB 1RHJB 3SQOP 4WFXA 1IKVB 1T8EA 2F63A 4I4BA 1SL1A 2K1RB 4RW9B 4ECWA 1KQGB 3CJ5A 3W9HA 1TK0A 2HHSA 2NR0A 1N5YB 2I0XA 1WC0A 5FDLA 4YY3F 2V34A 2XYPB 4P9SA 3CJKA 1P8GA 5J2MB 5J2QB 2V63A 4C8LA 3RUBL 1FRLA 4QYRA 3WHIA 3FEYB 4NLOA 2H1YA 1TV6B 1U7LA 2L41A 1TKXA 3H90A 2EBGA 5SZTA 2W4DA 2GGPA 2KH9A 2ILZA 4NXNJ 4DFKA 3VQTA 4IKAA 2AD9A 4ZCIA 1ZAVA 3T3FA 1WORA 1QAIA 3KMSA 2EK1A 2XMAA 2EXUA 4IFYB 3C14B 1KTVA 4UOGA 3MHYA 2DCLA 4WPAA 3WX4A 4ZP6A 3B4DA 5D0GA 2KZZA 1R6VA 4DCOB 1S7HA 1U6BA 1VJQA 5RUBA 3CO0P 4OJ1A 1O51A 1DZ5A 3VAJA 1XNRF 1S7IA 1FJ7A 2J6UA 1ZA1B 3NOCA 1AFJA 4ZVOB 5MLCV 3SCKE 2X1FA 1PKUA 2EFGA 3KLHB 2H5IB 2ZEJA 4AFFA 1B4SA 1IR1A 1UJ6A 2W2NP 3TRGA 3NGDA 3C19A 4RW7B 1JK9B 2Z4PA 2HQFA 4TXSA 2L9DA 1NJIT 4Q8FA 2WONB 3CD5A 3TA0A 3IG1B 1VQMS 1Q5VA 3RGIA 2WB4A 4XIUA 5FLXY 2VZ9A 2AYEA 5B08A 3IS9A 4JV5F 4NASA 1SH3A 1IKXB 1SH0A 2HGNA 2W7PA 1SC1B 3SSRA 1VISA 2EG1A 4ZVFA 1TTHB 5DDRC 5K8MA 1GAOA 1OSCA 5EDWA 3M9NB 1PC4A 3UDEA 1MW7A 2GC8A 4B9LA 2MJNA 3MOZA 2P6TA 1S76D 3RBXA 3ULHA 1YQHA 1RT3A 3NEKA 1IKYA 1N32J 4DR4J 4RBVA 1RQ0A 2EK6A 4DEZA 3WC2A 1B64A 1REGX 4JV1A 4DR1F 2V94A 4NL5A 1TL3A 5IM0A 3TZXA 4DV2F 3QFWA 2G2OA 4X4QA 1H72C 1F6TA 2KT5A 1YRXA 4FS1A 2QYCA 5LSRA 5KT6A 3OUYB 3JQMA 3LWMA 1IWGA 1TMJA 1FCAA 1RWKB 3MXHP 2VKRA 2VA2A 2D74B 3T5JA 4X4NA 1F9EB 2F1FA 4DV1F 1U24A 3K8WA 3LGHA 1RTHB 4O44A 3TANA 3PM9A 1RAAB 1WI8A 2J0XA 3M2RA 3I9ZA 4TLQA 3DOLA 1TVRA 3AA9A 4CYUB 2Z2MA 4HLBA 2D7SA 1P9YA 3GILA 3TVYA 3M4XA 1SKWA 3SSQA 1D8ZA 2X1BA 2M5YA 1TK5A 3CIZA 3DLHA 1G4CA 1HNZJ 3T6JA 3BYRA 3VR1A 2YH1A 2FVQA 3G4SS 3K17A 1UVLA 2OIHA 4Y28C 4OLOA 4ENOA 1X5PA 1S79A 3NAIA 3OTOJ 3RRGA 4OYPA 1SL2A 4GKKF 4HACA 1S9FA 1I51B 1GMVA 3ILOA 1U02A 3MR3A 1GFWB 3HF5A 4HH1A 2ZBPA 4N41A 4IQMA 4H4MB 2R42A 3I6PA 1P6TA 2QMXA 1RWNB 1FE4A 3EM1A 2XGQA 1NDPA 3D6HB 3GFZA 2VJVA 3HSZA 4C97A 1FDAA 1UWAA 2W2OP 1FO1A 2ACMA 2KHDA 2MKSA 2YNFA 2DXDA 1WSRA 3CCJS 1LWEB 1PC5A 2EFNA 4X62F 2FB0A 4PQUA 4DS4A 3CJQA 4DXLA 2HS3A 2JNJA 3W65A 1JJ4A 2RQ4A 4I6AA 2HIQA 4IR1A 2DXEA 4WE1A 1FJCA 2E1PA 2VL1A 1YRTA 1RHRB 2IYGA 2WOMB 4QU6A 4AL7A 2E5HA 5JJBA 2KFZA 4KQZA 1UAWA 1IVZA 2BKNA 4FYWB 2UZAA 3DFEA 3MAQA 1U47A 3KTQA 5F8NA 2RE1A 1RT6A 2EG2A 2CJ9A 4DUTA 4X64J 2KB2A 1TKXB 4RJVA 3JSBA 2GGPB 3LH2S 1X60A 2PT0A 5ETMA 4USVA 2QA1A 1UPMB 1GT8A 1AFIA 4DSKA 2HFOA 4X65F 1XR7A 4OX8A 2FUG9 4LRCA 1RWOB 4G1QA 1NNDA 2AYGA 4ZVEA 2DHAA 3TW0A 4NEYA 4CT9A 3MTKA 2YBVA 5HMXA 3K5LA 3Q83A 4I2PA 5B0AA 1S0MA 4C0BA 3HZEA 3CDBA 2W1BA 4ZN1A 2CDRB 2H51B 2LQJA 5AXLA 3UPFA 1ACMB 3Q22A 1HWLA 3GTYX 4NXMF 1Y9OA 3DM2A 5KFXA 4OX9F 1JNRB 3NS5A 2J9DE 2YPYA 5MAOA 5E0OA 5DM7Q 1XIQA 5D4OA 5JXSA 2R7VA 4EMDA 2XMVA 1YVFA 4IO9Q 4RU2A 1FRHA 5HMZA 2YKPA 4KKOA 4KGMA 2IJFA 3BKFA 4DPUA 2BV3A 1UTAA 5ETPA 1M5PC 4U8YA 3ZXWA 2ROEA 3LPYA 3KHRA 4DN9A 3PIOQ 2B3TB 2XYGB 2BJDA 2UUCF 4ZLJA 1B70B 1NPRA 2IM1A 1IKYB 1V5VA 2WSCC 4DL4A 4MMOA 4ED4A 2NCKL 4K7QA 2LQBA 1PBAA 1CULA 3MOJB 3H2VE 4LREA 1TL3B 5IM0B 4KTQA 2H3EB 2G2ZA 2WZ1A 1ZM3A 2HFVA 5LMNJ 2FJEB 4DFPA 3J80U 4R25A 4JI3J 1OMSA 1WKJA 2RKIA 3MCNA 3LP2B 5CYQB 3IN5A 2R7XA 1QJHA 3W1YC 1NDCA 4LF8J 2CWKA 4LFBJ 5SUHA 1NKCA 5A76A 5KFGA 4RNMA 3CT9A 3RAQA 1CBKA 4ECQA 1BWVA 1NHUA 3NAHA 3SCLE 4O44B 5LJ3Y 4J7CA 1VC0A 4FF2A 1Z2LA 4MH8A 5CYJA 2QFIA 2IPOB 4U7CA 1CSJA 2DR6A 2VQFJ 1TVRB 2KFYA 4P74A 2C22A 3DKDA 1M90T 4DFJA 1X8DA 3HO1A 4C8NA 1FWPA 1G2EA 4OJHA 2K3KA 3OHAA 3PYFA 2ATCB 4WTOB 5J1PA 4NXNF 2VBXA 1E6YA 3HCXA 2IHR1 1XMOJ 3A8KA 2ADBA 4W90B 2GQ2A 5D4LA 2FPHX 1T94A 2KJVA 4CM0A 3MAAB 2KRBA 4ZHRA 3BGFA 3TUIC 2HS4A 1FHTA 2H4WB 5GMDA 2QL5B 5L1LA 1YZ6A 1HYSA 3GLJA 1RISA 1HNWJ 2AT1B 2DHSA 3E51A 3A8IA 3UN3A 4F3MA 3AQOA 3QRQA 4HACB 4OZJA 1M1HA 2L48A 2LVWA 1RZMA 4RL1A 2DNLA 2BXJA 3BH7B 1OPIA 1RK8A 3WBZA 1IR0A 2Z58B 3GV8B 4OYMA 5F8JA 3HFKA 4ID8A 1VOMA 2ZOGA 2MKHA 4OYWA 2YNFB 2ZH8A 4K4YA 1UA1A 2V2QA 2A3JA 3KWMA 4PXCA 3BQ0A 3GIIA 2NPFA 2DIUA 4PQUB 2CZVC 1QUPA 3N5BA 1KWMA 1FE0A 3BO4A 3PDNA 3OR2A 1Y11A 5AE2A 2NYIA 1R3NA 1RWVB 2QT7A 2CFXA 2ZWPA 4B3RJ 3WC0A 4KV8B 1S1TA 3GG1A 4EBEA 1ELOA 5F8MA 1ZPWX 5IV4A 5K8PA 1J5EJ 1N32F 2BE7D 2FD2A 4DR4F 4XDCA 1MMNA 4U8VA 4MKBA 2LA4A 1JQGA 5HMYA 4XDDA 3H7HB 1TKZA 2OKQA 1MMDA 4BWMA 4B9SA 2V0NA 4HI1A 3PV8A 1RT6B 4IH5A 1WC4A 3I55S 2AZ3A 3FCWA 4ZLLA 4QR2A 3R97A 3CDEA 2CZ9A 4NCBA 4M5IA 4DQQA 5HBMB 3D1QA 2AEJA 1TP7A 3SI8A 3ADAC 2MQNA 2MKIA 1BQXA 3AAWB 2A10A 4OI3A 3L7UA 3PZPA 1FWLA 2NXUA 2W01A 3E8OA 4G1QB 1VBXA 1UZHA 2WVFA 2Y8YA 1SV5B 3LAKA 3PTWA 1NK9A 1U8SA 4NRUA 2WW8A 3T5KA 2KVIA 4YDXA 4I2PB 1FA0A 2GO8A 3CGIA 3MM5B 2G2YA 3SCJE 3OXGA 3IAM9 3VQSA 1A6LA 3SDEA 1HNZF 2HHPA 2UVUA 5FJ4A 4DUYJ 2DNOA 4J9PA 4ES1A 3V6HA 3GJTB 3OFGA 4LF9J 4MK9A 5T7LA 2FVPA 2MQMA 2E9TA 2MSTA 1RTZA 1LK5A 4ITSA 3OTOF 3CB4A 1RT2A 3UFCX 5KT3A 2VH7A 3HXMA 4KKOB 4I2QB 4YDDB 4NI2B 4L76A 4U7UK 1RHKB 1JB0C 3K58A 6FD1A 1ZTTA 4X4UA 3ZZYA 1UETA 4KC5A 4CH7A 5B0EA 2BRLA 1PBUA 2UVWA 1ZM4A 2OEMA 2Z56B 2HLUA 3IA0A 4OHXA 2XNQA 2R2RA 2DBBA 3DGPB 4Z7YA 1CULB 1NKEA 4IUFA 2EFVA 3TVZA 3CCRS 3PACA 2CPFA 1NSQA 1VIXA 1FEHA 1C1BA 2RKIB 2DIVA 4B3MJ 1RLDA 4AL6A 2E5GA 1UFKA 1VQ9S 4OZ3A 1RHQB 4A8MP 1O5JA 1DARA 4IOBA 3FCVA 1FRMA 2KHCA 1EQ0A 5L1IA 4G1IA 4M1KA 4CLYA 1XQIA 1QVFR 4X4TA 3DI6A 4HL9A 3AB4B 3FBEA 4DMZA 4DF8A 4OI1A 1VHFA 1S6UA 3CDUA 1U1PA 3J81Y 3JAMY 1Q78A 3IBCB 4X64F 3M2UA 5GVQA 3BBFA 3PHEA 3DRRA 3DOKA 2PE8A 2POKA 2XULA 1HD0A 1E6YB 1UFLA 1Q7YT 4DX6A 2DH7A 5CABA 1T03A 3EXYA 2OUGA 1WUUA 2R7RA 3JQKA 5D8HB 4NA2A 2Q66A 5DS7A 4ALZA 4F4KA 3VCDA 3TO8A 3CCQS 2R8IA 4M5JA 3AJDA 4M5NA 4ZHRB 7FDRA 2MQ8A 2DRAA 3OTEA 5EX3A 2HG4A 3IGNA 3D4JA 1HYSB 4CRJA 4K5SA 3U27A 1RGVA 5L38A 1OYEA 4LFAF 1DQ9A 1YG0A 1UWBA 4IH6A 2BVZA 2AGQA 2B6AA 2BQRA 4EI2A 5C24A 4K4UA 4UW2A 4X84A 1V3SA 1DTTA 3BEGB 3D2WA 3V5RA 1YTYA 4ZVRB 1UEUA 2QA2A 3KLVA 1KVIA 5FIIA 2NZ4A 3IRWP 1UVJA 3R7BB 2B9EA 5D15A 4PG6A 2JH3A 2XMTA 3K2YA 4EYIB 1EQMA 4ZA1A 3QO9B 4DR5J 2AZ1A 2VG5A 5D78A 3EWGA 1AYEA 3FQKA 3HSDA 3QT5A 4NCAA 5F41A 4UOFA 3UD4P 1FX2A 5E3CA 3PW4A 3N4WA 1N6QB 2F9JA 1KVKA 1S1TB 1RAFB 4CWBA 3VVTA 1FFWB 1XJWB 2EKNA 3K89A 3SQGB 1S72S 3OVBA 4RWXA 1XBWA 2R7WA 3HFZB 1JXLA 2FHKA 2XO6A 1UJ5A 1TKZB 4YR3A 1VQKS 1YWXA 2VUGA 1H7XA 3KJQB 4M63A 4CO0A 4DL7A 1IWAA 2XMWA 3EUNA 5LMNF 4DLEA 5L39A 2ABYA 4A4JA 4JI3F 3HSJA 1K1QA 1WG4A 3QGIA 2H4YB 2O1PA 1S49A 2CADA 4RNNA 2M7SA 2XG8A 2HBQB 4LF8F 4LFBF 2B7BB 1HIYA 3MEGA 5KTQA 1SXLA 1VLYA 1FJEB 3HM9A 3EDRB 4ETXA 2P9CA 1FRJA 2PDAA 1YBTA 2VQFF 2GQQA 3N6NA 2FY1A 2VONA 3PW2A 1HHSA 1VGYA 3GYGA 2HVZA 2YWGA 2VOOA 2PN6A 4MFBA 2G4BA 2VICA 2QIFA 1KLMA 3TQEA 4CH1A 1Z2ZA 5DDPC 3RG6A 4PPDA 1FFSB 3IRXA 1BMQB 2HHWA 3H2LA 3SDEB 4O3NA 1VQOS 1OSDA 1XMOF 3PXGa 1APSA 4P10A 2F40A 2MLXA 5KOXA 1N36J 3GIMA 2BZ2A 3AODA 4KSEB 3AD9C 2FJXA 3M9MB 3QSIA 4UUXA 5T7LB 2WK4A 3ET6A 2Y1IA 1N0UA 2DNRA 2YWWA 1HNWF 2BJ1A 1RT2B 4HHUA 4LF6J 1Q4RA 1K73T 4JV2A 2ZKUA 3VF0B 2VPWB 3AJ2A 4KAIA 4UQTA 3FK4A 4OYOA 2UXDJ 3HVTA 2XZTB 1H98A 2GAHC 2D3O1 4ECSA 3R5JB 4CCHA 4C8ZA 2IM0A 3FQLA 5LXRA 1VC5A 2VB6A 2AW0A 4LBHA 1Q0NA 2FHOB 4A8WA 2JDJA 4FXDA 3OXLA 4F4WA 3DYAA 2VFTA 2DGOA 3BKTA 1C1BB 2DO0A 1KEKA 3P5TL 2COLA 3A3PB 4RKUC 4B3RF 2HNDA 2CUYA 4B3OA 4NX9A 1N5TA 1VIOA 4ECYA 4EU0A 1NK7A 2GAGC 1J5EF 2P8IA 4OZ0A 1YJRA 3DI6B 1P1TA 3OJSA 3UVJA 1WJ9A 4CNZA 4EZ9A 1IBCB 3M2UB 4LSNA 2LA6A 3DRRB 3DOKB 4A8OA 5KT2A 2KTQA 2M88A 1VQ5S 2DNZA 3W9JA 4ED3A 1A7GE 4ICLB 2JEFA 1MN9A 1T03B 3MPVA 1CG2A 5KFRA 4ZVSB 3P8BB 3R27A 1UVKA 3VGVA 3RR8A 1QSYA 4DV6J 2QMWA 2Y0SD 3ZTQA 4OI0A 4QBUA 4HT5A 1UEVA 3MM8A 2C3YA 2BKPA 4H54A 4X4VA 2BQ3A 2UUWA 2YNIA 2DO4A 2YPZA 3FJ2A 1UWBB 2FVSA 4O0IA 2B6AB 4WU3A 2FJAB 2JFDA 1R8AA 1JJHA 5KFLA 3NS7B 3RAXA 1S1UA 5DLGA 1DTTB 4P2XA 2Q6BA 3PEHA 2VU5A 2AJ0A 4LR8A 1HBUA 2C2RA 4X2BA 4DUYF 2M0GB 1X9MA 4IR9A 4ECVA 4YEAA 1TFYA 3UNGC 1U2RA 4F3OA 4LF9F 1UEKA 1N54B 1H6KX 2EKYA 4EEYA 1K0VA 3UQSA 2DEIA 3C8YA 1QUVA 4RUCA 4QWEA 4M5DA 1X4AA 2HK2A 3PJWA 2Y0BB 4DPXA 3FVYA 3LP0A 2FTRA 4IFVB 4I1TA 2XI3A 2AMCB 2HIYA 3W3SA 2MB0B 4PABA 2C3UA 1Q95G 2ZD1A 2DH9A 4QYZJ 1WC3A 2HRYA 2E7XA 1GEHA 2PMZD 1NEEA 1WOSA 4ID5A 1KHVA 4CT8A 3FEZA 1IQZA 4B3MF 3KLIA 2HW3A 1FTCA 1JLFB 3K0JA 4B9UA 5DM6Q 3KJVA 3TJAA 5ETNA 2V67A 1RUSA 5D0RA 1NJWA 2E5JA 4OV1A 3MEGB 4LVOP 1HD1A 1SBRA 2FGOA 2VPYB 1JLEA 3ZZTA 4P2SA 5GADU 4Q45A 4C98A 1XN9A 1JKHA 2Q79A 5AXNA 1S59A 3M8PA 2RRNA 2YKOA 2V5HG 3GB0A 5J1EB 2ZH3A 4CH0S 4NYZA 4MFBB 3KHLA 3V6KA 4YHHJ 3CCTA 2NREA 2AJ4A 1KLMB 3BQ1A 5DZ7A 4OJ3A 1OY9A 4WP9A 2R8GA 2PMWA 3AY0A 3FCHA 3AB2B 2XYHB 4ATNA 1JX4A 3KG4A 2J0QD 3NNCA 4ZIWA 1PYTA 2X3GA 1FK9A 3CTRA 4B3SJ 3M7VA 3ET6B 2DNKA 5HVHA 4KRWA 3M32A 4JI5J 2LEPA 5ETQA 4J9OA 5KFJA 4X4OA 4DV4J 3RAMA 2EEYA 3LAMA 1RBOB 4URGA 3AOCA 4ZLNA 1T05A 4KPYA 4QOTA 4J9QA 2AGPA 2KXNB 4PG8A 3CJ2A 1KNZA 4ECXA 3ILJA 2ZOMA 5KFTA 5IT0A 3FRZA 5FLXU 2HVDA 5CQGA 1HBMA 3TUPA 5EN1A 2DNYA 2EPIA 1TL5A 4CLUA 2OI2A 4RR5A 1LKZA 5H1SV 3UDVA 4Q2LA 2R7OA 4F26A 4K4TA 4DR5F 5A8WA 2QX0A 5F0UA 3DYAB 1C2PA 4HVZA 4F4AA 2KG1A 2HVIA 1U1QA 1CJVA 3H4BA 2J6TA 3GFYA 2HNYA 3KXDA 3PX0A 4B3OB 3QSYB 3G82A 3X3UA 4L3KA 1RTJA 4KR0B 2IMOA 2RILA 5ETLA 2F7VA 2EFOA 5E3PA 3UVJB 1X4CA 2IC3A 2R9LA 5LL6d 3I0SA 4I56A 1O6XA 4W4MA 3RBDA 3U02A 2AX1A 2DISA 4ZIVA 4ELTA 1RAJA 4CLPA 1RT5A 1U0HA 1WD6A 4A8YA 2HAIA 5IV3A 5K20B 3EZOA 1GX5A 1I1GA 2ERRA 1FD2A 4AXJA 4WJBA 2YWHA 2WVCA 3FEXB 5I3QA 3GJRB 4P2FA 2XNRA 4ZITA 2Q3PA 2J9EA 2JRSA 5E2QA 4OHZA 5AXKA 2YNIB 2KYZA 4V19X 1TUWA 2G1HA 3R5CA 4J37A 4KO0B 2W7AA 2XY5A 2EVZA 2KKHA 1S1UB 3JYTA 3CJSA 2MSSA 1HBUB 2E29A 5EWFA 2A18A 3D54A 3MI7X 2LQ9A 4ZPDA 1N36F 4LF4J 3KJNB 1RJJA 4Y2KA 4NLGA 3T19A 4RUHA 3BGUA 2UXBJ 2JFKA 5C5JA 1WF0A 1M1KT 4TQRA 2DGVA 2V8PA 2YKNB 4U96A 5JMNA 4LF6F 3OR1A 4ED2A 1JXEA 3P4UB 2ALYB 1SC3B 2FJBB 3PVXA 1HWIA 2UXDF 2YNHA 2GO9A 2FLLA 4KHPJ 5K14A 4DL3A 3IC1A 3D66A 3DNCA 3POTA 4A48A 1UMJA 3LP0B 1RXOB 1BUXA 2VOPA 2HGLA 5DZ6A 1LOUA 4Q0BB 2ZD1B 3H59A 3AA8A 3OL6A 2R2SA 1HI1A 1QAXA 3V2UC 4B9VA 4ELVA 2OTLS 4ID5B 3P5BP 1F3VA 4USTA 1QY7A 1IXKA 1DBDA 5DQGA 3BBBA 3H42A 3SFUA 3DDNA 5JUMA 4Y2MA 3IGVA 3KJVB 2LEBA 2R8JA 3ZNUA 3JTOA 2DR8A 2H54B 3QT8A 4H4KC 2N4CA 2C42A 2CQPA 3CJ8A 1KS2A 2HHXA 2OPRB 1U45A 3OSNA 5KT5A 1L3TA 3W60A 1NDKA 2CG4A 2XI2A 3DLGA 2Y9HA 2LQ8A 1VHIA 5M2PA 1TK8A 2DNPA 2CAJA 2QZ8A 5I3UA 3HHLB 3WIUA 2J8SA 2J0WA 2LLZA 3TZZA 4OL8A 5HAOA 3GCXP 1UKUA 3PKYA 2EW9A 4OV6A 3IP0A 2BM0A 1GTHA 4DV6F 4P2MA 2LXFA 1VQ6S 3BGRA 4C2MA 4Y0FA 1FK9B 3M32B 4DU7A 1NO8A 1N48A 3K59A 4Q8EA 5J2NA 3ILIA 2PA3A 1S77D 3OQ2A 1T05B 2BM1A 2D3UA 1QLNA 2SXLA 4DF4A 3O6QA 3KK1B 4CO1A 1HQEB 2YQ0A 1ZBTA 1L5UA 3DRYA 3NGRA 4DPYA 3GQCA 1VFJA 2HVHA 3OLAA 2DGXA 2F4VJ 2P2CB 1IR2A 4OZ2A 4DV0J 3DLKB 3K7RA 3I0RA 1XERA 2C1EB 2AEMA 1OY6A 5A8WB 3VWSA 1SQGA 2FY8A 4ZDNA 3BS9A 1IQTA 3EGWB 1NJZA 1R8BA 4HTIA 2HNYB 3R3TA 2PEHA 4ZOSA 5KFWA 2MMYA 1CC8A 3G82B 5LXYA 2B9XA 1F0XA 1RTJB 4NPOA 2MXYA 2CJKA 3EMTA 3KLFA 4DQSA 3CC4S 1QE1B 3NCQA 4JI7J 3RR7A 2JSXA 2O5DA 1HA1A 4ANDA 2DNMA 4WYLA 2IC3B 1EZZB 5GAHI 3PW0A 2JEJA 3M05A 1H73A 1RT5B 1B0VA 1U0HB 2KT2A 1T11A 1RWMB 3MCOA 1YJTA 3HHNB 3HMJG 3GZ7A 2AJ1A 1RYSA 4GMKA 4NMLA 3QIPA 5KG2A 1C1CA 3IR7B 2HS0A 3Q8UA 4WU2A 2V6AA 3RJMB 1WNEA 3OTDA 1WF1A 1LXJA 5B0CA 3JSMA 1KLNA 2MHEA 4I6YA 1WHWA 3JSYA 1CS4A 4YHHF 4UOHA 5F3ZA 2E5LJ 1V3ZA 5B0FA 1NRKA 3KK2A 1BHNA 1U1MA 1M0SA 4DR1J 2E66A 4JP8A 1CVJA 3R6GB 2ZZTA 3QBCA 2GZOA 4WK1A 1NPKA 2KO1A 3TX8A 4NLYA 1F2GA 3FNNA 2C3PA 3TAMA 4F0HA 4B3SF 2OD6A 1ZAWA 4YFUA 1YJVA 4ED5A 4EYHB 4JI5F 4RW9A 2GMJA 3FSXA 3FBFA 4NLWA 1W25A 2ZDPA 1NHVA 1Z4UA 3GMGA 4DV4F 5H9EK 1TR0A 3NGUA 2BW7A 4DPTA 1S1VA 2YNHB 2VG6A 2MLZA 1C0TA 5K14B 3QLHA 2RVJA 1SUQA 2L08A 3POTB 3HD1A 1MWQA 3GIJA 1TZ0A 3SYZA 5F8HA 2V2ZA 1S4EA 2FLNA 1TV6A 3C6UA 4JBCA 4USWA 3HDSA 4WXOA 1Y7PA 2DNNA 2Z57B 2H9ZA 1RB0A 5CCLA 1JJCB 3NWGA 3B54A 2KXHA 3RW6A 1HBOA 3HHDA 4WIIA 3BQ2A 1RWPB 4FKXA 2VASA 1U26A 2CPEA 1V3RA 3ETMA 5HSPA 3R5AA 4YMEA 3TI0A 5EUHA 2P6SA 5ETVA 1FDNA 2PGCA 2MQLA 2GW8A 5A0YA 4FNIA 2ZH6A 3SSSA 3FRYA 2JWNA 3BPSP 4B9NA 1JIHA 1YGYA 2XO7A 3MEEA 2KXFA 2F8EX 5I3UB 3HT0A 3OHBA 2MEWA 1D8YA 1FDDA 3L3CA 2MZTA 4M5GA 4CDIA 3EZ5A 5BYQA 1WHYA 4LIRA 1VR6A 2CJYB 3M8RA 3B78A 2J0SD 3BR9A 4QWDA 3GYXB 2DGQA 2WONA 4ANEA 1R8CA 1TAQA 5H9FJ 3MR6A 3ZO7A 5B09A 1S9EA 5L1JA 1Q8KA 1HWKA 1IM6A 2HZCA 3BGRB 3N5FA 2I9SA 3CSKA 2HMIA 2C2NA 2JLEA 3PR5B 2XWYA 1WI6A 3BDEA 2HKEA 4O4GA 5J2NB 2QO3A 3G8QA 2VIHA 4CO3A 3LTOA 5DJBA 3PYGA 1DQAA 1ZA2B 1NCLA 4ZVGA 1N5QA 2GMHA 3QIDA 2IRXA 6AT1B 1EIYB 2HHQA 4LF4F 2BACA 4PQAA 3W8PA 4BDPA 4DSLA 4DZ6A 3LO3A 1NZAA 1URNA 2HHVA 4HKQA 2UXBF 1T9YA 3MURP 3Q0AA 2UU9J 3I0RB 3VGSA 3FKBA 3M8WA 1QSLA 5L9NA 3KLEA 1JLBA 2H48B 5KG5A 1KD1T 2BW2A 1SC4B 4F02A 4Y34A 4KHPF 3ISNC 4RX6A 5ETSA 4P7TA 4O3SA 2OLWA 2YKAA 1ZYQA 4FP9A 2LFVA 2DY1A 3EX7B 4CYUA 1DAXA 1T02A 2GQCA 2VC1A 4U7UD 2BABA 1VQ8S 1X4EA 2WW4A 1YHQS 1NDLA 5E33A 1BQMA 1BE4A 3FBCA 3CUNA 2YKMA 4JI8J 2W2MP 4ERDA 1S9GA 4KGVB 3GIKA 5IC6B 1WDDA 3HHLC 4WZQA 3CCSS 1Z1ZA 1R8PA 3NWRA 3JAMU 3MR7A 3BZQA 1C1CB 2B8PA 3M6XA 4ILRA 3MMCA 2K3IA 1ULRA 2ZJRQ 1QM9A 2ZKTA 3JSMB 4NLUA 2DVIA 1FEEA 1ZAXA 1R0AB 5KFVA 3T5HA 3KYLA 2ZHOA 5HQ8A 1CS4B 2ZE2A 3H20A 2CQGA 3THTA 4C3LA 4NZ7A 2HZAA 3V4IA 2V4JA 4TQSA 1ZS6A 1P27B 3HKZD 3PW7A 3TZYA 4ZVUB 2CQ2A 4ZPCA 2ZVSA 1N0VC 1MLAA 1Q8BA 2KFNA 3ZTRA 4WWSA 5AE1A 1FD8A 3IM9A 5DGBA 4ZS6A 2WRMA 4V19J 4CLTA 2QMUB 2XM3A 1IBMJ 4KPCA 4P7VA 4YR2A 2B4PA 1NB2A 2Z2LA 3GR0A 1WOOA 4CLFA 4KE5A 3CCVS 2WOMA 1X0PA 4R8UA 5AE3A 1T9XA 2B4VA 1VK8A 3NBPA 2PC6A 2HPUA 1S1VB 4J9MA 2MKJA 2VG6B 4QIFA 2W9BA 1C0TB 3GR1A 3QLHB 4CQ1A 2R7TA 1SUQB 3H4DA 3R7SB 1IN0A 2HFZA 3RYLA 1U48A 4CLSA 2G9OA 3W2VA 3AD7C 1FVSA 2D41A 3E3XA 3DU5A 3C6UB 2FYXA 2F4VF 1JLCA 4I68A 3TVKA 4DV0F 1RLCL 3L95X 1D09B 3V6JA 1NH7A 1HBOB 1EP4B 4PWDB 2UXCJ 1YK9A 3T1AA 4AT1B 5LSOA 3CJ0A 3WQPA 5B0DA 1U1KA 3L4BC 5KFMA 3ZNJ1 1K0TA 2J9DA 4PCQA 3G8TA 1JMTA 2QRRA 5IT4A 3D1OA 4TYBA 2ZDOA 1L3VA 2Q1LA 5A0YB 4MT1A 4JI7F 1RP5A 2ROGA 3P3DA 1MWYA 3ELHA 4KBIA 4NMXA 2G1DA 3BN4A 3RU0A 3HZGA 3BSOA 3MEEB 2OFGX 1T9WA 1SIZA 1S57A 3PNIA 4NWBA 3UO0A 3M30B 4Z2XA 5DG9A 3L9ZA 4TVAB 1J5OA 1RAHB 2DGSA 4YR0A 4RNHA 4GKJJ 1S9EB 8RUCA 1UW9A 1HLWA 2NUHA 2MZ1A 2HMIB 3P45B 3HI9A 3MDFA 1KR4A 3EVWA 4OZLA 1S99A 1BXNA 1RCXB 4DWIA 3E01A 4O4GB 3CF5Q 1SPBP 2QN6B 2P9EA 2GJIA 4ZPTR 4C48A 2E5LF 1T9VA 4R0JA 5KG7A 4M5HA 2ZOFA 2KM8C 3D1HA 3UN5A 1RWWB 1OO0B 1TKTB 4UQGA 1XC9A 3JB9k 2K2PA 3D9BA 4XPCA 4Q44A 1NK5A 3NNHA 4WP8A 4DHVA 3GCWP 1GTEA 3SMZA 2MPUA 3DLJA 1R89A 3C46A 3DMJB 2BYCA 3LP2A 5CYQA 4DSFA 1YIJS 4NA1A 1P1LA 2XEXA 1YBUA 4DFMA 4Y2AA 2B9WA 3KLEB 3AXMA 1JLBB 5U47A 1NK8A 1LWFA 1RAOA 3KUEA 2XY6A 3UD3P 1PILA 2J7KA 2ATLA 5F3TA 4HI2A 3HHKA 2WAQD 7FD1A 2HQCA 1NBEB 2V9KA 3TEHB 2IAJA 2GHVC 1XR6A 1U8WA 3W7BA 3R8YA 2C2KB 5DQHA 2LQ5A 1N4LA 4FVCA 1PCAA 4HR2A 1VRQC 3R5GA 1RHUB 1BQMB 3J7A1 2FJWA 4PEOA 4M5MA 2VA3A 5D3GA 1GMWA 4LSLB 2YKMB 3FSIA 2WBRA 1S9GB 3OFFA 4C8KA 1FWKA 3AOBA 1W7WA 4K4VA 2LU1A 5C42A 3MAAA 3H0PA 2FDNA 2JZ5A 4JI2J 3DRSA 2HSEB 4F67A 3MMAB 2A6OA 2W24A 1GXLA 3FUYA 2I1RA 5CZXA 2YQ1A 2IDLA 1KRPA 1WG5A 3MMCB 3PFEA 3BN7A 5DDOC 2Q6CA 4DX7A 2CDQA 4HH0A 4IRCA 2XS2A 3W66A 2KVQE 2ZE2B 1X0FA 2F8MA 3V4IB 3T5LA 2V4JB 2F5GA 1CQNA 4L75A 4OYBA 4OX7A 1FNOA 1FESA 3T1HJ 3FGVA 1S6QA 3KK3A 2QG9B 2QTWA 5HJYA 2M8DB 2NZCA 1Q1KA 2JC1A 4KV8A 1GXUA 1OYDA 4R8UB 4NLPA 1U09A 3NBPB 3K8VA 1VQ7S 3C16A 3V81B 3NCRA 3M8YA 2CQBA 2XLJA 1HW9A 3H5XA 2W9BB 4W92B 3MPDA 4G3IA 3BGLA 1HI8A 3IR6B 4A8KA 1EKSA 4K2JA 2RDIA 2IIHA 4FYXB 3W2VB 2V4RA 4DQRA 1S6OA 2RS8A 2X1AA 1XK8A 4L6V3 2E1RA 1JLCB 2DKOB 4F2SA 1R43A 2UU9F 2MY7A 3QATA 3IWLA 4LR7A 1X4GA 3MECA 3WIVA 5HVFA 4URSA 5HBMA 5IT9Y 4GVBB 3BO2A 1Q81T 2B56A 3U1NA 2AU0A 1RU2A 5I4MA 2G0IA 5AT1B 1I3OB 4NA3A 1SV5A 1SL0A 2HQDA 4RUAA 2GFFA 2C2DA 4LFAJ 3LPEA 1D9AA 3AH6A 1LEOA 3IWXA 2W4PA 3ICLA 3MM5A 3Q8VA 5D4PA 4JI8F 4O3PA 4ZKAA 1VMBA 5A8RA 4WF9Q 4JB8B 1DQ8A 1VS3A 7AT1B 4EO6A 1D9FA 1J5OB 3TA1A 2JX2A 2NXNA 2AJQA 4DN0A 3FDSA 1EX8A 2DPIA 4U95A 2J5AA 1RA6A 1HHQA 2N3LA 4PKDB 1AZSB 4I2QA 4NI2A 3D0IE 1T3NA 1KOHA 1X4HA 1VQSA 3E01B 4WKRA 2ASDA 3TUZC 3DCAA 4PZVA 2XZWA 4P72A 2HHUA 2DGTA 4LRBA 5ETKA 1MROB 4F0MA 1QDUB 3DGPA 3PHTA 4KHMA 4UTGA 3D68A 4N7TA 9RUBA 4PXEA 4YB6A 4QJVA 1RA7A 2LP4A 2CQCA 3TWZA 2CNKB 2PI5A 4RW6A 3OW2R 1KN6A 3IBWA 1IBMF 2IVMA 3X1LB 2NLWA 4DX8H 2D3OR 4YOEA 2FC8A 1HQUA 3R1HA 1LWFB 2ZC3A 4OYAA 5BR8J 4QWCA 1T0TV 2XS7A 5EWGA 1PIEA 2H5JB 4FF3A 2IAJB 2G0CA 3CEDA 2ZWOA 2Y1LB 4UY85 1Y00A 2HQGA 4Z7CA 2AP6A 1RYRA 2XS5A 1X5OA 4D3HA 1KHWA 1IKWB 3EDQB 3A12A 1RWXB 3I56S 3G6YA 1B0PA 4MAKA 5D3GB 2YVSA 2D9OA 2QJ3A 4FDFA 5EGYA 3MEKA 1Q82T 3R5DA 2CPDA 4ECTA 3OV7A 4C3KA 3GPAA 2UXCF 3NL0A 2Y1JA 2D9PA 3HVRA 3SZ2A 1FRXA 5C42B 2D69A 3S01A 3DRSB 4J9NA 4AD6A 3ZZUA 1I5OB 2ZJQQ 1FKOA 1NLKL 4NOHA 2DYAA 2DR7A 2W2PP 2AJFE 2B8QA 2YXLA 3MFHA 4M95A 3BO3A 4RZRA 1A0OB 2F9DA 5E41A 2ZBQA 4TU9A 1HKAA 3EVOA 3MM6A 4LRAA 3PG9A 2RF2A 1GMWD 2RQCA 1EHWA 5IWAJ 2KN4A 1ZZNA 2JL9A 4WFYA 3Q8YA 1B3TA 4LSZB 4YB1P 4DR3J 1ICEB 4LF1A 4USMA 2V2KA 3ENWA 1YZ7A 2Q43A 1XMBA 2OJ3A 2HWTA 4GKJF 2IVYA 3QO9A 4WIQA 1OQ3A 3LW5C 4DS5A 2FC9A 1S6QB 2M8HA 3KK3B 3J81j 5KFCA 3DU6A 2MGZA 3N28A 1IBKJ 1FJGJ 1N52B 1N6QA 1X4FA 3MR5A 4HDGA 4DG1A 3BR8A 2BUNA 2EI5A 5HK4A 1SKUB 2L9NA 3SQGA 1H2UX 1PJ7A 3C16B 4ZJLA 5KG0A 2EC0A 3NNAA 1HPZB 3Q2SC 2PSZA 1X7VA 4CZCA 2DH8A 3QJJA 4UUWA 4PUOA 4DQPA 3SCIE 2VG7A 3R7NB 2C28A 3OTBA 3QQCD 1WTFA 3HK2A 4IOAQ 1KKHA 2UV8G 2XTJP 2VV5A 3HJFA 1R27B 3VVUA 2QLJB 2VBYA 3OFEA 3UD5A 3MECB 1HNXJ 1KSPA 5GAEI 1YKWA 4MYUA 2KYXA 4CP5A 2DK2A 2ACYA 3J7Z5 2DCUB 4DSIA 2CJBA 4TKTA 3J7YI 1OIAA 4YUDA 2QEXS 1MU2A 1M5KC 4IG3A 1HNIA 3EPGA 5HI7A 2UVVA 3KUGA 3DN9A 4RUBA 2RHSB 2XQCA 3W62A 4RNFA 5J2PA 4MTPA 2NS1B 1G7CB 3NY0A 1FNMA 3ZTSA 1PYOB 1QD1A 2CQ4A 1KDNA 1DTQA 6FDRA 3NP5A 2HRTA 2NXJA 8ATCB 3G6ES 2YH0A 5T14A 4WFNQ 2CQ0A 3O3LA 1DY3A 4TY9A 5A8RB 2RU9A 1S10A 2AV5A 2VPXB 3N0VA 2DT9A 4AL5A 2FQQB 2K06A 1N34J 1PYSB 3M8QA 4JI2F 2OAUA 4ER8A 2CA9A 2ZITA 4USHA 2BJ8A 3CDWA 4MYTA 5D0EA 1AB8A 5CH7B 2F65A 1RAIB 1YRUA 1ZPVA 2FJVA 1YLXA 4MIBA 3EPIA 1WG1A 2QLFB 3S7RA 1XWLA 3MD3A 1Q16B 2KT3A 3AOAA 4DV5J 2R8HA 1WOPA 3B6BA 2WB1D 3DHWC 2ZZNA 2MQPA 4DOZA 1RT4A 3O8WA 4USJC 5H9FK 4JYAJ 4AYBD 3TX0A 4ANCA 3DLEA 3DHXA 4NYOA 2X3DA 1S97A 3D7SB 2RRAA 2CPXA 3QJPA 1ZM9A 3T1HF 2C2EA 1CC7A 3QGPA 1FF2A 3OVAA 4JI1F 3HX9A 4RW6B 3UR3C 3OSPA 3RRHA 1K9MT 1KP6A 2DNHA 1HQUB 4KIAA 3MMBA 4USIA 4GRSA 5D6GA 2ASYA 4JI6J 3QYYA 4RPFA 4J9VA 5K9FA 4B17A 1S48A 2FLPA 2Z0GA 3DDKA 3UNYA 3B8HA 3MUMP 1XR5A 2ZH9A 2HZVA 4OQJA 4KHRA 2KL8A 4A8FA 1IJEB 3BH6B 5CD4H 1VLOA 4ZVHA 1BWEA 1SJ1A 4ICLA 4ZPVR 4ZP8A 4EWTA 4ZCLA 1H2VZ 3HPOA 2UVRA 4H4KA 2PEBA 3UDCA 4DUZJ 4CO4A 1WTBA 4DX5A 3CPWR 2ASJA 1FXRA 4AUKA 2H65B 1FKOB 2FGCA 2VFRA 4O3OA 2OELA 1RACB 4OHYA 2IA0A 2C2MB 3EZUA 3MUVP 5HVGA 1YSJA 2L9WA 4IYQA 4C11B 3PIPQ 4DV3J 5F9NA 3MM6B 1F9HA 3SFGA 3E2EA 5GMKa 2RF2B 4RLEA 1JLQA 2CJXB 2MZRA 3TOQA 4WKYA 2BE2A 3PYDA 5IZHA 2LDIA 2OPSA 1R7IA 2DHXA 1W2IA 3SV4A 4RO0A 1VBYA 3BDPA 2E9RX 2MGZB 1NMEB 1SVDA 3QRPA 3RBEA 4JI0J 2CVIA 4TNOA 1JXVA 2QSFA 3PRVA 1M5VC 4NLRA 4N77A 4DG1B 2ZNZA 4F0KA 4WCEQ 3W2WB 1SJ3P 4IFVA 2JVRA 3R2CJ 4LFCJ 1X4DA 1GNKA 3PYEA 1HR0J 2XMJA 1ZM2A 4N47A 3Q23A 3CJRA 3CMAS 2BBEA 5EX0A 3H2UB 4PUOB 4K4WA 4UF4A 4QIGA 2VG7B 4Z37A 1BD6A 3CCUS 4DR6J 1QTMA 2HFSA 4HHJA 1Y3JA 2W8KA 4N56A 3GP9A 4E0DA 3LANA 1JLFA 3TNVA 1NK6A 1HARA 2ZC4A 4AXIA 1TUVA 5GAHU 2V8DA 4MIWA 4JI4J 4DL0C 2WSEC 2X1GA 5BR8F 3ETOA 1R6YA 4MK7A 1G3OA 1D1UA 3HVWA 1MU2B 4IG3B 3K5NA 2BRKA 3ZZ0A 1HNIB 4CO2A 3CJ4A 2RB7A 2W7OA 1RHMB 1SCJB 5J2PB 2XGPA 4FZVA 1UVIA 5J1EA 2B51A 5HANA 1YITS 3KJFB 1DTQB 5K5MA 3O5TB 2RJZA 3JXOA 2CPJA 1KC8T 3NKYA 2RIJA 3GIRA 1WEXA 1TL7A 5IQQA 5IOLA 4BLGA 4LVNP 4NYPA 4N76A 1X5TA 3HHEA 2A2CA 3M8QB 3T9NA 2VPZB 4K50A 4OI2A 3JS9A 4NZ6A 1AW0A 3I5BA 4X66J 1S4FA 3NG8A 3PR4A 4U67Q 1ZETA 4NCGB 1WHXA 3PJXA 1N8RT 1R8HA 3GV7B 3VAFA 5DG7A 3MZIA 3GFHA 1RE1B 1S6PA 5A6WA 2MZQA 2VF3A 1WC5A 1I94J 4OI6A 1F9FA 2RT3A 5IWAF 1UP1A 3Q8RB 1TL4A 1RT4B 3FMWA 2AEFA 4O0NA 2ZH2A 2ZM6J 3A1YG 4DR3F 2YX7A 3NGTA 4DPWA 3O2IA 4QR0A 2YX1A 4ZN3A 5A8KA 2OP5A 3ITHB 5DRKA 3DLEB 4X4RA 4WZMA 1HBNA 1RBLA 2C2ZB 2IYIA 4OYXA 1FI4A 1IBKF 2R8KA 1FJGF 4F8RA 2VJUA 2EWHA 1UPPA 4DLGA 4PRFA 2IY5B 2CWXA 2MDAA 1BY9A 3MMBB 1KOOA 2NPIA 5B0GA 2WVDA 2ZFHA 5GAGI 4LJMA 4QQBA 2KI2A 2V69A 5AXMA 2HBYB 3PX4A 2AQ4A 1EETB 1G6BA 3HSGA 1UVMA 2KDOA 3CWJA 4J9RA 2B4OA 2XLKA 2JVOA 4QCLA 3DOMA 1YBAA 1HNXF 2KZMA 4I6WA 2G0JA 1UFWA 2LECA 3MEDA 3M9OB 1SQEA 3PJ9A 1Y3KA 4C0OC 5ADZA 2M9KA 5FDLB 1AUSL 4IG0A 3DXSX 3THVA 2R2UA 1PGZA 1JJ2R 2CNNB 3CJKB 1VDHA 3DLBA 5A2QU 1W2BR 2BDPA 2HQ3A 4L3NA 1VQYA 4LRDA 3QZ8A 3VAGA 1VQPS 2HNZA 4BWJA 3IR5B 4HEA9 4V1Ak 4KO0A 4CO5A 4OIXA 3I32A 4EK2A 4HYKA 3HVAA 4LR9A 2XB2D 1JLQB 3L09A
chains in the Genus database with same CATH topology
3GU0A 1P9YA 2MLYA 1T11A 2D3O1 3GTYX 2MLXA 2MLZA 1OMSA 1W26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GU0 A;  1P9Y A;  2MLY A;  1T11 A;  2D3O 1;  3GTY X;  2MLX A;  2MLZ A;  1OMS A;  1W26 A; 
#chains in the Genus database with same CATH topology
 1U1L A;  3HUL A;  2CYY A;  3PO4 A;  3LP1 A;  2WVE A;  2BE2 B;  5KFK A;  4K4S A;  4OYZ A;  1N34 F;  4O4R A;  2OPS B;  3UWT A;  4N8O A;  2HFU A;  2QV6 A;  3NRB A;  1HW8 A;  2YKN A;  3UN2 A;  4ZMM A;  4Q2M A;  5I3P A;  3MTJ A;  2M3D A;  3Q89 A;  3KG1 A;  4DV5 F;  4Y6I A;  2YKQ A;  2K7J A;  3ZC4 A;  2KU7 A;  2HHH J;  3QAU A;  1N5S A;  2ZHB A;  4A46 A;  3KHH A;  3CXC R;  1LQ9 A;  4CNY A;  3PFO A;  3KDN A;  3WX8 A;  3CJT A;  1WEZ A;  3MPW A;  4JYA F;  4JV0 A;  4Q0B A;  4F7V A;  2VOD A;  1VBZ A;  2LKZ A;  1U1O A;  4E2F B;  2O66 A;  1O0P A;  3TAQ A;  2BMB A;  4ETZ A;  3IS9 B;  3T6B A;  4G6V B;  3ENA A;  2CQI A;  2QL9 B;  2VQE J;  4MKY A;  3ZZP A;  5I42 A;  5GME A;  4ZJO A;  2JLF A;  3UDL A;  3VTI A;  2E1C A;  1NAQ A;  3LGM A;  1SIW B;  2GNK A;  1RT3 B;  5KFI A;  2QL7 B;  3BGO P;  1VCT A;  2OPR A;  4JI6 F;  5LSL A;  1AA1 B;  3TP2 A;  2LXU A;  3LQV A;  3IXQ A;  4PWW A;  3AT1 B;  5LOQ A;  1S0N A;  1IBL J;  4C9D A;  3HHL A;  1XTZ A;  3SXL A;  3LWL A;  5KT7 A;  2H5E A;  1X9W A;  1GXT A;  2C2O B;  3RB4 A;  1TL7 B;  4EO8 A;  1CEZ A;  4J9S A;  3TYT A;  4FBT A;  2K8G A;  3OL8 A;  2C3O A;  3LOU A;  4CLW A;  4DBQ A;  4DUZ F;  1Y5L B;  5D77 A;  3BJY A;  3M2R B;  2DJW A;  2VDI A;  3DOL B;  4OLP A;  4DQI A;  3QGG A;  1C0U A;  5HO4 A;  3QWP A;  2RH3 A;  2FLO A;  1WC6 A;  4TLR A;  2M2B A;  1WWH A;  2W8L A;  1S6P B;  4DV3 F;  2FHM A;  3CD0 A;  3KK1 A;  4WTY A;  9ATC B;  1HQE A;  5DLF A;  2MQO A;  3DXB A;  3L7O A;  5C2C A;  3AD8 C;  3TEG A;  4HT7 A;  2DRD A;  5JVH Q;  5FD1 A;  1EJ7 L;  2XMM A;  5ETR A;  1OJ4 A;  4L72 B;  1A9N B;  1TU0 B;  3BRE A;  1DLO A;  5A8K B;  5B0B A;  1TUG B;  3BSC A;  2A0F B;  3DLK A;  4OYI A;  5EWE A;  1HBN B;  1MWZ A;  3VGT A;  5DO2 A;  3UE2 A;  2GIR A;  3OL7 A;  1FX4 A;  1TEL A;  2RDJ A;  3CD6 S;  2YWK A;  2QC3 A;  4XPE A;  3RB6 A;  2Z8Q A;  1NJY A;  2DXF A;  4ED1 A;  2R7U A;  4JI0 F;  1RAG B;  3DDI A;  5M2U A;  2MZJ A;  4C6A A;  1U49 A;  4FVM A;  1HWU A;  2NUU G;  4P75 A;  2E7W A;  1SH2 A;  4O23 A;  4LFC F;  1BC6 A;  1LFW A;  1QE1 A;  2P5V A;  1HR0 F;  1TMM A;  5KFZ A;  4RBU A;  3M8Z A;  4AQY J;  4Y3C A;  2Y1R I;  4DL6 A;  3EIC A;  2CPI A;  5HQM A;  3JTP A;  1SQF A;  4DR6 F;  2V2V A;  5L8R C;  1FRI A;  1NM2 A;  2G13 A;  1VQL S;  3A4T A;  1MNE A;  3D28 A;  4ECZ A;  3DOM B;  5G0R A;  3K5O A;  4GO7 X;  4QIV A;  4C8M A;  3OLB A;  2UUA J;  4WE1 B;  2IFX A;  4JI4 F;  5EHH A;  3MED B;  1OY8 A;  4GC7 A;  4FNH A;  2MKK A;  2KRR A;  4M94 A;  4IG0 B;  1MSW D;  1URR A;  1R0B G;  3DRX A;  2LU2 A;  3IBF B;  3PEJ A;  4DCP B;  1NXI A;  2W25 A;  4Y00 A;  2HNZ B;  5B7W A;  2WBM A;  3BKU A;  3MUT P;  1V9O A;  3QMQ A;  4IDK A;  2DR5 A;  4UOC A;  3ZTO A;  4CI0 B;  2OTJ S;  3CIM A;  1H3D A;  3MCM A;  5HLF A;  1UL3 A;  2M52 A;  3D6T B;  3RW7 A;  3CUL A;  2YQ3 A;  3LP1 B;  3T1Y J;  1MN7 A;  3M2V A;  2DIT A;  4J91 A;  5DET A;  1REV A;  2XHW A;  3OJU A;  4J90 A;  2JC0 A;  4X66 F;  3ENV A;  3Q8P B;  2IJN A;  5C25 A;  4I7F A;  1DUR A;  1N5V A;  2BX6 A;  2OHD A;  4E98 A;  1R0C B;  4EGL A;  5JVG Q;  3OVS A;  3UR0 A;  2MYF A;  4EBC A;  2BQU A;  4LBI A;  3OPK A;  2GA7 A;  3MPY A;  1I94 F;  1SJ4 P;  4C4W A;  1IJF B;  2HHT A;  3W64 A;  3TJ9 A;  4ZJQ A;  4J9K A;  5J1N A;  3MFI A;  4PYD A;  4CTA A;  2DNG A;  4K59 A;  2ZM6 F;  1KBR A;  2Z2Y B;  1VRU A;  3DM2 B;  1RWU A;  1WF2 A;  4P71 A;  3Q8S B;  4NLX A;  2V8H A;  1BQN A;  1U1N A;  1NHK L;  1Q8I A;  4RWW A;  2I8E A;  3CW2 C;  2RU3 A;  1UA0 A;  1D3W A;  4LF5 J;  5E5N A;  4OHV A;  1V6H A;  2DD8 S;  4OI4 A;  2RQM A;  3N6L A;  2ZVI A;  3P6Y C;  4URQ U;  4WP3 A;  2JLG A;  2GJF A;  5I42 B;  4RNO A;  5F8G A;  1TFW A;  1KTQ A;  2APO A;  2CQD A;  1NK4 A;  3NGS A;  5IT9 U;  3UCZ P;  2RNE A;  3IWN C;  2HEK A;  4QW9 A;  1RT1 A;  8AT1 B;  2VFS A;  3P49 B;  3NMA A;  2CPY A;  2B4U A;  4KJI A;  3ISN D;  1M5S A;  4K0K J;  4RW8 A;  3I31 A;  1JNZ B;  1RTI A;  4UZC A;  4OX6 A;  1B7F A;  4WFZ A;  3DC2 A;  3AFG A;  2I6W A;  2YWF A;  5KG1 A;  1TL1 A;  3TZW A;  1Y5I B;  4G1P A;  4HTJ A;  1QTN B;  1OPZ A;  5HAT A;  4LF7 J;  2FJD B;  3EVM A;  1C4A A;  1WC1 A;  5HP1 A;  3D6M B;  2J76 E;  2IDE A;  4P73 A;  2GVD A;  3V4M A;  4RW4 A;  1C0U B;  4P6Q A;  3CME S;  4MKV A;  4N5S A;  2CIM A;  3HHL D;  1K47 A;  3IO1 A;  2R7S A;  2DHG A;  2PMH A;  2X7I A;  3CCW A;  1RDR A;  1LW2 A;  3C3L A;  2DPJ A;  1CJU A;  3RBZ A;  2E1M C;  4OJG A;  1NSP A;  1X4B A;  3OBI A;  3VV2 B;  4KGX B;  1DLO B;  2WTF A;  4ZP7 A;  2AX0 A;  1RAD B;  4F36 A;  2DEJ A;  4EFA C;  3I5A A;  2QSW A;  5CCM A;  4NZ0 A;  4M5L A;  4LUB A;  1RTD A;  2FZG B;  3B4M A;  2HHH F;  2MY8 A;  3HLU A;  3EGN A;  3WDO A;  3PW5 A;  4U6P A;  2DY9 A;  5H9E J;  4NEZ A;  5ETO A;  3B82 A;  2JEI A;  3BSN A;  4F04 B;  3ISZ A;  4DPO A;  3R5B A;  2GHP A;  5KFN A;  2OML A;  4ZVQ B;  3SBM A;  2ZJP Q;  4CM2 A;  5T41 A;  1HNV A;  5F8I A;  2XLI A;  4F2R A;  1R31 A;  2EFQ A;  3M6W A;  2N7Y A;  4IO1 A;  2R4F A;  3EXC X;  2BOA A;  5G0R B;  2VQE F;  2IVF B;  5HN0 A;  1L3K A;  3OR2 B;  2QFJ A;  2JHE A;  2AKW B;  3I4P A;  1H38 A;  3BSA A;  1I6J A;  3D5M A;  3ZZZ A;  3RB0 A;  3W5Y A;  2A1B A;  2ZUG A;  1J27 A;  4UT4 A;  5CXT A;  4O3R A;  1YJU A;  2WHO A;  3L7P A;  3MMJ A;  5AJ3 J;  3CJ3 A;  4GVL A;  4QPX A;  4B9T A;  1R0A A;  1IBL F;  1WAC A;  1DFD A;  2XY7 A;  3IMQ J;  1T9U A;  4IDK B;  1VK3 A;  1XNQ J;  5LJ5 Y;  2LMI A;  3K5M A;  5HLF B;  4FN5 A;  5CYM A;  3R6L B;  1KQF B;  1YI2 S;  4FF1 A;  3A13 A;  4ZPA A;  4PAA A;  1PO6 A;  1J2V A;  3M2V B;  2IA6 A;  1H2T Z;  4GO5 X;  4R0E A;  1F3F A;  1REV B;  1Y5N B;  4A47 A;  2JEG A;  3S1T A;  3KNA A;  4ZVT B;  3QT6 A;  1V5I B;  3RB3 A;  2RUG A;  1F5C A;  3GE9 A;  2W9C A;  5C25 B;  4I7F B;  3EGZ A;  2A6M A;  2C3M A;  1VJW A;  2B5J A;  1VRT A;  2KM8 B;  3IFE A;  3AJ1 A;  4LIW A;  3TAR A;  1LNQ A;  2YNG A;  1S0V A;  4CTA B;  4GC6 A;  2VFU A;  4C0H A;  1VRU B;  3I82 A;  4B9M A;  2CNL B;  4DCJ B;  2HWH A;  4ILM A;  5CZV A;  2AYB A;  2FZK B;  1CJT A;  3QGH A;  3OL9 A;  2VDH A;  1GK8 A;  1BQN B;  2XSF A;  3Q86 A;  3C6T A;  1OWX A;  4BS2 A;  2IM2 A;  2V9W A;  3BM7 A;  1EKR A;  5KFY A;  4B02 A;  4F4Z A;  3G86 A;  4PWD A;  1EP4 A;  2FVR A;  3OT9 A;  5LMU J;  4QPT A;  3KFW X;  2QLW A;  3AQP A;  3M6U A;  5E3A A;  4K5R A;  4OHW A;  4KB7 A;  3UCG A;  2GJ2 A;  3BBC A;  2J7W A;  4DZD A;  4ELU A;  5KOW A;  1K1S A;  1IUJ A;  3KNG A;  1N88 A;  3NLC A;  4AQY F;  3I4H X;  2RS2 A;  3G87 A;  2J9C A;  4M5K A;  2DGU A;  3A8E A;  1RT1 B;  2XCP A;  3M30 A;  2N7C A;  2VD3 A;  2YTC A;  4PG7 A;  4RW8 B;  1LWC A;  4PPZ A;  2UUA F;  3R1L A;  3CC7 S;  1RTI B;  4IQX A;  4IRD A;  2XSJ A;  4YS2 A;  5KFA A;  2RD5 C;  2ZZM A;  1TL1 B;  4FS2 A;  4WK3 A;  2BJ3 A;  3KHG A;  1LV5 A;  5HP1 B;  4ZPB A;  1Q5Y A;  3GV5 B;  2GVD B;  3D3C J;  2AHO B;  4RW4 B;  3GG0 A;  4Q5V A;  3NGK A;  2VBZ A;  3BV8 A;  1EB0 A;  3F56 A;  1ZTW A;  3EYZ A;  4DDF A;  1TKD A;  1NPP A;  1MG7 A;  2GX8 A;  1UJ4 A;  4L74 A;  4EZ6 A;  5DG8 A;  4XTT A;  1LW2 B;  3BPD A;  2NYH A;  1ZZF A;  1NZ8 A;  1TKT A;  1CJU B;  3C2P A;  3T1Y F;  1VQ4 S;  2XWX A;  1AT1 B;  1U6F A;  3UCU P;  4DL5 A;  4CLK A;  1GQE A;  4KFB A;  5ETT A;  3DMJ A;  1U4B A;  3KLG A;  1PAU B;  5KFP A;  3MF5 A;  4DR7 J;  1WKL A;  2HQI A;  4C3M A;  2PI4 A;  1LFP A;  1Q8L A;  2CNO B;  1RKI A;  2QYG A;  1RTD B;  1N33 J;  5KAK A;  2M4M A;  5CD4 A;  2ILY A;  5C24 B;  2NSC A;  1YJN S;  1WDT A;  4DR2 J;  5GAE U;  2BE9 B;  4FYD A;  4BC9 A;  3OFH A;  3NCP A;  3VGU A;  4KGK A;  4EUV A;  5L1K A;  3J7Y U;  1F60 B;  2WCX A;  1RKJ A;  1KFD A;  4NE9 C;  4LSL A;  3GFX A;  4QIW D;  3OTC A;  3Q2T C;  1B0T A;  1HNV B;  4LF5 F;  4U9R A;  2HK3 A;  3GJS B;  3BB5 A;  2XHC A;  2VG5 B;  3T41 A;  1ITP A;  2DB1 A;  4KGZ B;  3TA2 A;  1EAY C;  3J81 U;  2GCF A;  3QAE A;  2YX4 A;  4CIO A;  3MMA A;  1HL6 A;  2IM3 A;  4NRT A;  2PII A;  4DL2 A;  4NLV A;  1HQ2 A;  3H40 A;  3FMB A;  2QE5 A;  3HKW A;  3H5U A;  3D0G E;  3JSR A;  1ARO P;  3MD1 A;  2B9Y A;  4DJB A;  2V50 A;  3CNQ P;  1SJR A;  3CCE S;  3CD7 A;  3D6F B;  4JUZ A;  1UCN A;  2NXC A;  5IS2 A;  3QFH A;  2ZH1 A;  4I67 A;  4OZN A;  4M8L A;  1CPZ A;  2QA4 G;  1CJK A;  4K0K F;  5CYM B;  3IM8 A;  2XMU A;  1M5H A;  2AIR B;  2FZC B;  4ES2 A;  3F0N A;  4F4Y A;  4LQ9 A;  2CG8 A;  5G4D A;  2RAQ A;  4LF7 F;  2VC0 A;  2N4D A;  2O3D A;  4BHQ A;  4PWU A;  2BAN A;  4G65 A;  2V68 A;  4HDH A;  2W9C B;  1D0E A;  2OH2 A;  1YDL A;  1T7P A;  1BLU A;  4ILL A;  3V81 A;  3KOA A;  2LXI A;  2B5J B;  4AE5 A;  2OPQ A;  4ZVP B;  1VRT B;  2IRU A;  3S8S A;  1FER A;  4C8O A;  4DI6 A;  2CPH A;  2MTL A;  3PO5 A;  3IRX B;  2YNG B;  3M6V A;  2CQH A;  3QRR A;  1C4C A;  2N82 B;  2Z2Z A;  2RML A;  4IRK A;  5A6P A;  2EBE A;  1KFS A;  2DRB A;  1XEZ A;  3CO9 A;  1CJT B;  1JLA A;  2VKZ G;  2JOQ A;  2QA4 S;  4K4Z A;  2XZD B;  1SI9 A;  3Q8Q B;  4CLL A;  2PFD A;  3GU0 A;  3F44 A;  4LMZ A;  3C6T B;  1RAB B;  3W61 A;  1FDB A;  1FKP A;  4GVB A;  1KQK A;  1SKR A;  1XMQ J;  5L46 A;  2LEA A;  3R2D J;  3PX6 A;  3EJM A;  4F4X A;  1UW4 A;  3A8J A;  5F9L A;  4MIA A;  3HVT B;  4YB5 A;  4RU9 A;  4WFA Q;  3G6X A;  4F25 A;  5BYS A;  3J80 Y;  3G9C A;  4QYZ K;  2V8G A;  1FVQ A;  2GML A;  1X31 C;  3FZ2 A;  1VQN S;  1T95 A;  4B08 A;  2YY3 A;  4R5P A;  1RI7 A;  3NS6 A;  2BA9 A;  1PJ5 A;  3SIP B;  2DNQ A;  1KVJ A;  2XCA A;  3MPU B;  3TAP A;  2CVE A;  4QIE A;  2RQK A;  3PCO B;  2ZUA A;  1Y0H A;  2RRB A;  3MGJ A;  4CLZ A;  4E8U A;  2P9G A;  1FRK A;  1NUE A;  1GH8 A;  1LWC B;  4ECR A;  2XSJ B;  2HND B;  1M5O C;  4DU8 A;  2GHW A;  2MHN A;  2KG0 A;  5E3R A;  1AZS A;  5HQL A;  3D0H E;  2EC2 A;  1RT7 A;  4ED8 A;  3F73 A;  3FSY A;  5AJ3 F;  4OZ5 A;  2NXE A;  4DV7 J;  1HI0 P;  1TQL A;  5LT5 A;  3G71 S;  2ZHA A;  3G96 A;  2QLB B;  4LSN B;  1XNQ F;  3AXK A;  3H25 A;  5CA5 A;  3KUH A;  1LW0 A;  3PKM A;  1MRO A;  4H4O A;  3FZB A;  2I38 A;  1SKS A;  4N8N A;  2BJ9 A;  3W5X A;  1FKA F;  1VBK A;  3JTN A;  5KFB A;  5KFO A;  5E3Q A;  4KFB B;  2FHJ A;  3HJV A;  3KLG B;  3MM8 B;  1L3U A;  3GSD A;  4Q7A A;  1F5B A;  4ZK7 M;  2GIQ A;  1L3S A;  2ZH4 A;  2U2F A;  2BEF A;  4P52 A;  2IRY A;  2WVB A;  2Y8W A;  3V6D A;  4OMF G;  4XO0 A;  2AF6 A;  4FXV A;  2PA8 D;  2VHG A;  1RU1 A;  4NLS A;  1IKW A;  5HL7 Q;  2ZBC A;  2XMK A;  2J6S A;  2DTJ A;  1B7Y B;  3KG0 A;  1AUD A;  3U1M A;  3VAK A;  1S0O A;  2AYM A;  5BYR A;  5E7O B;  5LMU F;  1H0H B;  4XK8 C;  2AGO A;  5HRO A;  2CQ3 A;  4IOC Q;  4I0W A;  1N56 A;  4M5D B;  5KG3 A;  1U2C A;  4J9L A;  2MKY A;  2Y3Y A;  1VC6 A;  3LA0 A;  1NH8 A;  3ILL A;  2UUB J;  4QWA A;  5D0H A;  4MKA A;  2FVC A;  1SJQ A;  4A8X A;  3BYP A;  3H5S A;  2IBO A;  4LBP A;  2LDY A;  3H98 A;  3W8G A;  2W9A A;  1NSK L;  2ZH7 A;  3H5Y A;  1SJF A;  3KKF A;  5DQI A;  3Q24 A;  1YX2 A;  5LM7 E;  1S1X A;  3PY8 A;  3VAH A;  4ZLP A;  1HMV A;  3BF4 A;  3AHP A;  2V8V A;  3KDO A;  1CJK B;  4QZV B;  4NLQ A;  3KLI B;  2E1A A;  1H7W A;  3HD2 A;  3MCS A;  1U25 A;  1X5S A;  4B3T J;  3C15 A;  2OMO A;  2KJW A;  2ZBI A;  1H74 A;  2OPP A;  4TY8 A;  4JI1 J;  4ECU A;  2B0G A;  2BAN B;  1JLE B;  3G8S A;  4ED6 A;  3RTV A;  2MJU A;  1JKH B;  2HAF A;  3A3O B;  4J9U E;  1FT8 A;  1Q53 A;  2CJA A;  1LXN A;  2PFF B;  3M8P B;  3DLL Q;  1GMU A;  4YP3 A;  3MM7 A;  2GVZ A;  2OPQ B;  1HPZ A;  4Y65 A;  4XAK A;  2M70 A;  2BOP A;  1KON A;  4FXW A;  3O44 A;  2OGU A;  4MJK A;  2VBW A;  4DSE A;  5KFH A;  4ED0 A;  4FYV B;  5KFU A;  1T9T A;  4F50 A;  1LK7 A;  4HHH A;  2CQ1 A;  1Q79 A;  2WSF C;  5KG6 A;  1U2F A;  4USU A;  1JLA B;  5GAG U;  4MK8 A;  3HP6 A;  3K5P A;  1QAJ A;  4YQW A;  3G6V A;  3TJ8 A;  4DR7 F;  2RUS A;  1FKP B;  2HYI B;  1RAE B;  3US5 A;  4KH0 B;  2JJ4 D;  1N33 F;  2D3Z A;  4YY3 J;  2AJ2 A;  4F3Q A;  5HJX A;  2I2Y A;  2R7Q A;  5M2R A;  4DR2 F;  3GYN A;  2RSQ A;  4C7Q A;  3N9U C;  2F3J A;  1HBM B;  3CCZ A;  2BJE A;  4R5P B;  3CMQ A;  1HWJ A;  3GWC A;  4UZB A;  4EBD A;  1KQS R;  4FBU A;  3DRP A;  3MM9 A;  4YB7 A;  4PG4 A;  1S1W A;  4ZCK A;  3DGV A;  4UY8 T;  1B99 A;  4Y2I A;  5CHC B;  4YN3 B;  5L9X A;  3WZ0 A;  1G1X A;  1CJV B;  3C66 A;  3CCL S;  2O01 C;  4ED7 A;  2Z30 B;  2RHQ B;  1Y4Z B;  1QSS A;  3M1V A;  3CVK A;  2CKW A;  4FYY B;  3SEO A;  3VAL A;  1UVN A;  1RT7 B;  2AWZ A;  2K7K A;  3FFI A;  5F8L A;  2ZNY A;  3W9I A;  5IXU A;  1XNR J;  1PJ6 A;  2OEJ A;  5IQ6 A;  1K8A T;  3I0S B;  3N01 A;  2HWI A;  1NU4 A;  2UUT A;  3PRD A;  4K4X A;  4PXB A;  2J8A A;  4OFZ A;  1JLG A;  1HHT P;  4S0M A;  1GX6 A;  3QWU A;  3UI3 A;  3M8S A;  1LW0 B;  5KFQ A;  4H4O B;  3D3B J;  5BJR A;  4KYZ A;  2E44 A;  3GON A;  2I5J A;  3THP A;  1YJ9 S;  3D67 A;  3PRB A;  3QZ7 A;  3QJL A;  4WFB Q;  4DSJ A;  4QR1 A;  2BR0 A;  1U1R A;  1RBA A;  2OEK A;  1PG5 B;  2QGF B;  4LF2 A;  4USK A;  3VAI A;  4LQ3 A;  4JV5 J;  3N6M A;  2B43 A;  3F41 A;  2HUR A;  4FF4 A;  4PYA A;  2PO4 A;  4LRF A;  2R2T A;  4WBF A;  2EFP A;  2E7V A;  4TN2 A;  5KFE A;  2A2D A;  1E6V A;  3NMR A;  3JYT B;  3IAS 9;  2IMW P;  2OFH X;  4LT6 A;  3V6D B;  2CPZ A;  3MWB A;  1F2H A;  1Q7L B;  3I96 A;  1DJ0 A;  3FC9 A;  1ZH5 A;  5KFS A;  3QNW B;  4DV2 J;  2N3O A;  2ROP A;  4WXW A;  4KT0 C;  1PAE X;  4FPI A;  1VYA A;  3GSI A;  2MQQ A;  2OO4 A;  1IKV A;  4JOU A;  2FHJ D;  2K1R A;  3I9V 9;  4QWB A;  3KMQ A;  5DDQ C;  4NLT A;  1XMQ F;  2R3V A;  4QW8 A;  3EGV A;  3OR1 B;  3TQ1 A;  4X4P A;  4Y2C A;  2HRU A;  1QVG R;  1N5Y A;  5HRO B;  1DRZ A;  1SC6 A;  1FNX H;  4DV1 J;  5K8N A;  4KH1 B;  3CDA A;  1U0S A;  4D3G A;  5J2M A;  2B7C B;  1YJW S;  5J2Q A;  2MKC A;  4ZP9 A;  3J7Z T;  4ES3 A;  3NXZ A;  2OSR A;  5BXI A;  4WYW A;  2F8H A;  2FIU A;  5DGA A;  4C11 A;  4K2X A;  3ZFV A;  1UZD A;  2DHH A;  1S5Z A;  5ITH A;  1PSD A;  3LUY A;  2E5I A;  2HBZ B;  5KFF A;  2O67 A;  1NSA A;  2W4C A;  4I69 A;  1F1B B;  1Y10 A;  1S1X B;  1YJ7 A;  1HMV B;  2HGM A;  3TR5 A;  1VI7 A;  1BGX T;  4IFY A;  3C14 A;  3U1L A;  2BJ7 A;  1EAR A;  3W63 A;  1U6Z A;  3C15 B;  1FFG B;  4C8Y A;  3MR2 A;  2V4Q A;  1OS5 A;  4Q43 A;  2OPP B;  4TY8 B;  4W98 A;  3QPI A;  1NJX A;  3JQJ A;  3VAM A;  3VZH A;  4KY3 A;  1P9Q C;  4GKK J;  2OSQ A;  2ALZ A;  2IBK A;  4DV7 F;  2YWE A;  2VFV A;  3R9L A;  3DLG B;  3W2W A;  3QT7 A;  3ENQ A;  1ROF A;  3MM7 B;  2GVZ B;  3KLH A;  3H8Y A;  1AXQ A;  4PR6 A;  4L73 A;  4RW7 A;  3HFV A;  1MML A;  4ZCM A;  4A8S A;  3OD2 A;  2RDD A;  2NSB A;  3IG1 A;  1WHV A;  1JWW A;  1CLF A;  3A3N B;  3VHQ A;  1WEL A;  4X62 J;  2XC9 A;  2L3M A;  1IKX A;  1RSC A;  1Q86 T;  4FPR A;  2J7U A;  1M1G A;  2MLY A;  1ZOT A;  2CJQ A;  3CC2 S;  3ZTP A;  3N79 A;  3MAH A;  1TAU A;  5CAA A;  1OQ6 A;  1F5A A;  2GS8 A;  4A8Q A;  3I87 A;  1QAY A;  4TU7 A;  4X4S A;  2ZH5 A;  2GIF A;  1SB6 A;  1T3O A;  1X9S A;  2LYV A;  3DRP B;  3MM9 B;  3OUY A;  2F4F A;  1RCO B;  3P96 A;  3NOG A;  1S1W B;  2QLX A;  4PG5 A;  2UP1 A;  4QU7 A;  4OZ1 A;  3T9Z A;  5K8O A;  2HBR B;  3SV3 A;  3UW1 A;  5HMW A;  3VZI A;  4PXD A;  2W2Q P;  1RTH A;  1W26 A;  5KG4 A;  4X65 J;  3K57 A;  2UUB F;  1HFE L;  1O8B A;  4NCG A;  1WKK A;  2DGW A;  2CZ4 A;  3S6E A;  1K44 A;  3M1V B;  4J5O A;  2D1C A;  3ZZR A;  3KLF B;  2NQP A;  1NK0 A;  2ZBR A;  3GJQ B;  4ZPW R;  1NKB A;  1IM4 A;  3FFI B;  2IJR A;  2PD1 A;  3LAL A;  4BC7 A;  4FKY A;  3CCM S;  2DR9 A;  3RRK A;  5IFM A;  2CRL A;  1LWX A;  3ZZO A;  1JLG B;  1S12 A;  4RBT A;  2E9Z A;  3U7J A;  2MZS A;  4TU8 A;  2HLT A;  5A2Q Y;  4NXM J;  4TYA A;  4OX9 J;  5GAD I;  5THW A;  5C2G A;  3HT3 A;  2I5J B;  3ITH A;  4B3T F;  3LF0 A;  5IC4 B;  4IH7 A;  1NB7 A;  2XBP A;  3QIP B;  5D4N A;  1DHM A;  5KT4 A;  3ONQ A;  3W5Z A;  1FXD A;  3J7A N;  3OXF A;  4BBY A;  2HVE A;  4NLD A;  2GV1 A;  2BKO A;  3EE3 A;  5C7P A;  3I5C A;  4H4M A;  5KFD A;  2UUC J;  1WSV A;  1FTR A;  3LGN A;  3O1L A;  2X51 A;  2ADC A;  1CQM A;  3FBB A;  2OD4 A;  1E6V B;  2HFN A;  1EET A;  2CXE A;  3KK2 B;  4BCA A;  3TUJ C;  1FXL A;  3CE8 A;  3RZA A;  4K8R A;  2ASL A;  4I64 A;  5F0W A;  2LCW A;  1LWE A;  1D9D A;  1WEY A;  2U1A A;  4O3Q A;  3G2X A;  2UV8 A;  3TAM B;  1RHJ B;  3SQO P;  4WFX A;  1IKV B;  1T8E A;  2F63 A;  4I4B A;  1SL1 A;  2K1R B;  4RW9 B;  4ECW A;  1KQG B;  3CJ5 A;  3W9H A;  1TK0 A;  2HHS A;  2NR0 A;  1N5Y B;  2I0X A;  1WC0 A;  5FDL A;  4YY3 F;  2V34 A;  2XYP B;  4P9S A;  3CJK A;  1P8G A;  5J2M B;  5J2Q B;  2V63 A;  4C8L A;  3RUB L;  1FRL A;  4QYR A;  3WHI A;  3FEY B;  4NLO A;  2H1Y A;  1TV6 B;  1U7L A;  2L41 A;  1TKX A;  3H90 A;  2EBG A;  5SZT A;  2W4D A;  2GGP A;  2KH9 A;  2ILZ A;  4NXN J;  4DFK A;  3VQT A;  4IKA A;  2AD9 A;  4ZCI A;  1ZAV A;  3T3F A;  1WOR A;  1QAI A;  3KMS A;  2EK1 A;  2XMA A;  2EXU A;  4IFY B;  3C14 B;  1KTV A;  4UOG A;  3MHY A;  2DCL A;  4WPA A;  3WX4 A;  4ZP6 A;  3B4D A;  5D0G A;  2KZZ A;  1R6V A;  4DCO B;  1S7H A;  1U6B A;  1VJQ A;  5RUB A;  3CO0 P;  4OJ1 A;  1O51 A;  1DZ5 A;  3VAJ A;  1XNR F;  1S7I A;  1FJ7 A;  2J6U A;  1ZA1 B;  3NOC A;  1AFJ A;  4ZVO B;  5MLC V;  3SCK E;  2X1F A;  1PKU A;  2EFG A;  3KLH B;  2H5I B;  2ZEJ A;  4AFF A;  1B4S A;  1IR1 A;  1UJ6 A;  2W2N P;  3TRG A;  3NGD A;  3C19 A;  4RW7 B;  1JK9 B;  2Z4P A;  2HQF A;  4TXS A;  2L9D A;  1NJI T;  4Q8F A;  2WON B;  3CD5 A;  3TA0 A;  3IG1 B;  1VQM S;  1Q5V A;  3RGI A;  2WB4 A;  4XIU A;  5FLX Y;  2VZ9 A;  2AYE A;  5B08 A;  3IS9 A;  4JV5 F;  4NAS A;  1SH3 A;  1IKX B;  1SH0 A;  2HGN A;  2W7P A;  1SC1 B;  3SSR A;  1VIS A;  2EG1 A;  4ZVF A;  1TTH B;  5DDR C;  5K8M A;  1GAO A;  1OSC A;  5EDW A;  3M9N B;  1PC4 A;  3UDE A;  1MW7 A;  2GC8 A;  4B9L A;  2MJN A;  3MOZ A;  2P6T A;  1S76 D;  3RBX A;  3ULH A;  1YQH A;  1RT3 A;  3NEK A;  1IKY A;  1N32 J;  4DR4 J;  4RBV A;  1RQ0 A;  2EK6 A;  4DEZ A;  3WC2 A;  1B64 A;  1REG X;  4JV1 A;  4DR1 F;  2V94 A;  4NL5 A;  1TL3 A;  5IM0 A;  3TZX A;  4DV2 F;  3QFW A;  2G2O A;  4X4Q A;  1H72 C;  1F6T A;  2KT5 A;  1YRX A;  4FS1 A;  2QYC A;  5LSR A;  5KT6 A;  3OUY B;  3JQM A;  3LWM A;  1IWG A;  1TMJ A;  1FCA A;  1RWK B;  3MXH P;  2VKR A;  2VA2 A;  2D74 B;  3T5J A;  4X4N A;  1F9E B;  2F1F A;  4DV1 F;  1U24 A;  3K8W A;  3LGH A;  1RTH B;  4O44 A;  3TAN A;  3PM9 A;  1RAA B;  1WI8 A;  2J0X A;  3M2R A;  3I9Z A;  4TLQ A;  3DOL A;  1TVR A;  3AA9 A;  4CYU B;  2Z2M A;  4HLB A;  2D7S A;  1P9Y A;  3GIL A;  3TVY A;  3M4X A;  1SKW A;  3SSQ A;  1D8Z A;  2X1B A;  2M5Y A;  1TK5 A;  3CIZ A;  3DLH A;  1G4C A;  1HNZ J;  3T6J A;  3BYR A;  3VR1 A;  2YH1 A;  2FVQ A;  3G4S S;  3K17 A;  1UVL A;  2OIH A;  4Y28 C;  4OLO A;  4ENO A;  1X5P A;  1S79 A;  3NAI A;  3OTO J;  3RRG A;  4OYP A;  1SL2 A;  4GKK F;  4HAC A;  1S9F A;  1I51 B;  1GMV A;  3ILO A;  1U02 A;  3MR3 A;  1GFW B;  3HF5 A;  4HH1 A;  2ZBP A;  4N41 A;  4IQM A;  4H4M B;  2R42 A;  3I6P A;  1P6T A;  2QMX A;  1RWN B;  1FE4 A;  3EM1 A;  2XGQ A;  1NDP A;  3D6H B;  3GFZ A;  2VJV A;  3HSZ A;  4C97 A;  1FDA A;  1UWA A;  2W2O P;  1FO1 A;  2ACM A;  2KHD A;  2MKS A;  2YNF A;  2DXD A;  1WSR A;  3CCJ S;  1LWE B;  1PC5 A;  2EFN A;  4X62 F;  2FB0 A;  4PQU A;  4DS4 A;  3CJQ A;  4DXL A;  2HS3 A;  2JNJ A;  3W65 A;  1JJ4 A;  2RQ4 A;  4I6A A;  2HIQ A;  4IR1 A;  2DXE A;  4WE1 A;  1FJC A;  2E1P A;  2VL1 A;  1YRT A;  1RHR B;  2IYG A;  2WOM B;  4QU6 A;  4AL7 A;  2E5H A;  5JJB A;  2KFZ A;  4KQZ A;  1UAW A;  1IVZ A;  2BKN A;  4FYW B;  2UZA A;  3DFE A;  3MAQ A;  1U47 A;  3KTQ A;  5F8N A;  2RE1 A;  1RT6 A;  2EG2 A;  2CJ9 A;  4DUT A;  4X64 J;  2KB2 A;  1TKX B;  4RJV A;  3JSB A;  2GGP B;  3LH2 S;  1X60 A;  2PT0 A;  5ETM A;  4USV A;  2QA1 A;  1UPM B;  1GT8 A;  1AFI A;  4DSK A;  2HFO A;  4X65 F;  1XR7 A;  4OX8 A;  2FUG 9;  4LRC A;  1RWO B;  4G1Q A;  1NND A;  2AYG A;  4ZVE A;  2DHA A;  3TW0 A;  4NEY A;  4CT9 A;  3MTK A;  2YBV A;  5HMX A;  3K5L A;  3Q83 A;  4I2P A;  5B0A A;  1S0M A;  4C0B A;  3HZE A;  3CDB A;  2W1B A;  4ZN1 A;  2CDR B;  2H51 B;  2LQJ A;  5AXL A;  3UPF A;  1ACM B;  3Q22 A;  1HWL A;  3GTY X;  4NXM F;  1Y9O A;  3DM2 A;  5KFX A;  4OX9 F;  1JNR B;  3NS5 A;  2J9D E;  2YPY A;  5MAO A;  5E0O A;  5DM7 Q;  1XIQ A;  5D4O A;  5JXS A;  2R7V A;  4EMD A;  2XMV A;  1YVF A;  4IO9 Q;  4RU2 A;  1FRH A;  5HMZ A;  2YKP A;  4KKO A;  4KGM A;  2IJF A;  3BKF A;  4DPU A;  2BV3 A;  1UTA A;  5ETP A;  1M5P C;  4U8Y A;  3ZXW A;  2ROE A;  3LPY A;  3KHR A;  4DN9 A;  3PIO Q;  2B3T B;  2XYG B;  2BJD A;  2UUC F;  4ZLJ A;  1B70 B;  1NPR A;  2IM1 A;  1IKY B;  1V5V A;  2WSC C;  4DL4 A;  4MMO A;  4ED4 A;  2NCK L;  4K7Q A;  2LQB A;  1PBA A;  1CUL A;  3MOJ B;  3H2V E;  4LRE A;  1TL3 B;  5IM0 B;  4KTQ A;  2H3E B;  2G2Z A;  2WZ1 A;  1ZM3 A;  2HFV A;  5LMN J;  2FJE B;  4DFP A;  3J80 U;  4R25 A;  4JI3 J;  1OMS A;  1WKJ A;  2RKI A;  3MCN A;  3LP2 B;  5CYQ B;  3IN5 A;  2R7X A;  1QJH A;  3W1Y C;  1NDC A;  4LF8 J;  2CWK A;  4LFB J;  5SUH A;  1NKC A;  5A76 A;  5KFG A;  4RNM A;  3CT9 A;  3RAQ A;  1CBK A;  4ECQ A;  1BWV A;  1NHU A;  3NAH A;  3SCL E;  4O44 B;  5LJ3 Y;  4J7C A;  1VC0 A;  4FF2 A;  1Z2L A;  4MH8 A;  5CYJ A;  2QFI A;  2IPO B;  4U7C A;  1CSJ A;  2DR6 A;  2VQF J;  1TVR B;  2KFY A;  4P74 A;  2C22 A;  3DKD A;  1M90 T;  4DFJ A;  1X8D A;  3HO1 A;  4C8N A;  1FWP A;  1G2E A;  4OJH A;  2K3K A;  3OHA A;  3PYF A;  2ATC B;  4WTO B;  5J1P A;  4NXN F;  2VBX A;  1E6Y A;  3HCX A;  2IHR 1;  1XMO J;  3A8K A;  2ADB A;  4W90 B;  2GQ2 A;  5D4L A;  2FPH X;  1T94 A;  2KJV A;  4CM0 A;  3MAA B;  2KRB A;  4ZHR A;  3BGF A;  3TUI C;  2HS4 A;  1FHT A;  2H4W B;  5GMD A;  2QL5 B;  5L1L A;  1YZ6 A;  1HYS A;  3GLJ A;  1RIS A;  1HNW J;  2AT1 B;  2DHS A;  3E51 A;  3A8I A;  3UN3 A;  4F3M A;  3AQO A;  3QRQ A;  4HAC B;  4OZJ A;  1M1H A;  2L48 A;  2LVW A;  1RZM A;  4RL1 A;  2DNL A;  2BXJ A;  3BH7 B;  1OPI A;  1RK8 A;  3WBZ A;  1IR0 A;  2Z58 B;  3GV8 B;  4OYM A;  5F8J A;  3HFK A;  4ID8 A;  1VOM A;  2ZOG A;  2MKH A;  4OYW A;  2YNF B;  2ZH8 A;  4K4Y A;  1UA1 A;  2V2Q A;  2A3J A;  3KWM A;  4PXC A;  3BQ0 A;  3GII A;  2NPF A;  2DIU A;  4PQU B;  2CZV C;  1QUP A;  3N5B A;  1KWM A;  1FE0 A;  3BO4 A;  3PDN A;  3OR2 A;  1Y11 A;  5AE2 A;  2NYI A;  1R3N A;  1RWV B;  2QT7 A;  2CFX A;  2ZWP A;  4B3R J;  3WC0 A;  4KV8 B;  1S1T A;  3GG1 A;  4EBE A;  1ELO A;  5F8M A;  1ZPW X;  5IV4 A;  5K8P A;  1J5E J;  1N32 F;  2BE7 D;  2FD2 A;  4DR4 F;  4XDC A;  1MMN A;  4U8V A;  4MKB A;  2LA4 A;  1JQG A;  5HMY A;  4XDD A;  3H7H B;  1TKZ A;  2OKQ A;  1MMD A;  4BWM A;  4B9S A;  2V0N A;  4HI1 A;  3PV8 A;  1RT6 B;  4IH5 A;  1WC4 A;  3I55 S;  2AZ3 A;  3FCW A;  4ZLL A;  4QR2 A;  3R97 A;  3CDE A;  2CZ9 A;  4NCB A;  4M5I A;  4DQQ A;  5HBM B;  3D1Q A;  2AEJ A;  1TP7 A;  3SI8 A;  3ADA C;  2MQN A;  2MKI A;  1BQX A;  3AAW B;  2A10 A;  4OI3 A;  3L7U A;  3PZP A;  1FWL A;  2NXU A;  2W01 A;  3E8O A;  4G1Q B;  1VBX A;  1UZH A;  2WVF A;  2Y8Y A;  1SV5 B;  3LAK A;  3PTW A;  1NK9 A;  1U8S A;  4NRU A;  2WW8 A;  3T5K A;  2KVI A;  4YDX A;  4I2P B;  1FA0 A;  2GO8 A;  3CGI A;  3MM5 B;  2G2Y A;  3SCJ E;  3OXG A;  3IAM 9;  3VQS A;  1A6L A;  3SDE A;  1HNZ F;  2HHP A;  2UVU A;  5FJ4 A;  4DUY J;  2DNO A;  4J9P A;  4ES1 A;  3V6H A;  3GJT B;  3OFG A;  4LF9 J;  4MK9 A;  5T7L A;  2FVP A;  2MQM A;  2E9T A;  2MST A;  1RTZ A;  1LK5 A;  4ITS A;  3OTO F;  3CB4 A;  1RT2 A;  3UFC X;  5KT3 A;  2VH7 A;  3HXM A;  4KKO B;  4I2Q B;  4YDD B;  4NI2 B;  4L76 A;  4U7U K;  1RHK B;  1JB0 C;  3K58 A;  6FD1 A;  1ZTT A;  4X4U A;  3ZZY A;  1UET A;  4KC5 A;  4CH7 A;  5B0E A;  2BRL A;  1PBU A;  2UVW A;  1ZM4 A;  2OEM A;  2Z56 B;  2HLU A;  3IA0 A;  4OHX A;  2XNQ A;  2R2R A;  2DBB A;  3DGP B;  4Z7Y A;  1CUL B;  1NKE A;  4IUF A;  2EFV A;  3TVZ A;  3CCR S;  3PAC A;  2CPF A;  1NSQ A;  1VIX A;  1FEH A;  1C1B A;  2RKI B;  2DIV A;  4B3M J;  1RLD A;  4AL6 A;  2E5G A;  1UFK A;  1VQ9 S;  4OZ3 A;  1RHQ B;  4A8M P;  1O5J A;  1DAR A;  4IOB A;  3FCV A;  1FRM A;  2KHC A;  1EQ0 A;  5L1I A;  4G1I A;  4M1K A;  4CLY A;  1XQI A;  1QVF R;  4X4T A;  3DI6 A;  4HL9 A;  3AB4 B;  3FBE A;  4DMZ A;  4DF8 A;  4OI1 A;  1VHF A;  1S6U A;  3CDU A;  1U1P A;  3J81 Y;  3JAM Y;  1Q78 A;  3IBC B;  4X64 F;  3M2U A;  5GVQ A;  3BBF A;  3PHE A;  3DRR A;  3DOK A;  2PE8 A;  2POK A;  2XUL A;  1HD0 A;  1E6Y B;  1UFL A;  1Q7Y T;  4DX6 A;  2DH7 A;  5CAB A;  1T03 A;  3EXY A;  2OUG A;  1WUU A;  2R7R A;  3JQK A;  5D8H B;  4NA2 A;  2Q66 A;  5DS7 A;  4ALZ A;  4F4K A;  3VCD A;  3TO8 A;  3CCQ S;  2R8I A;  4M5J A;  3AJD A;  4M5N A;  4ZHR B;  7FDR A;  2MQ8 A;  2DRA A;  3OTE A;  5EX3 A;  2HG4 A;  3IGN A;  3D4J A;  1HYS B;  4CRJ A;  4K5S A;  3U27 A;  1RGV A;  5L38 A;  1OYE A;  4LFA F;  1DQ9 A;  1YG0 A;  1UWB A;  4IH6 A;  2BVZ A;  2AGQ A;  2B6A A;  2BQR A;  4EI2 A;  5C24 A;  4K4U A;  4UW2 A;  4X84 A;  1V3S A;  1DTT A;  3BEG B;  3D2W A;  3V5R A;  1YTY A;  4ZVR B;  1UEU A;  2QA2 A;  3KLV A;  1KVI A;  5FII A;  2NZ4 A;  3IRW P;  1UVJ A;  3R7B B;  2B9E A;  5D15 A;  4PG6 A;  2JH3 A;  2XMT A;  3K2Y A;  4EYI B;  1EQM A;  4ZA1 A;  3QO9 B;  4DR5 J;  2AZ1 A;  2VG5 A;  5D78 A;  3EWG A;  1AYE A;  3FQK A;  3HSD A;  3QT5 A;  4NCA A;  5F41 A;  4UOF A;  3UD4 P;  1FX2 A;  5E3C A;  3PW4 A;  3N4W A;  1N6Q B;  2F9J A;  1KVK A;  1S1T B;  1RAF B;  4CWB A;  3VVT A;  1FFW B;  1XJW B;  2EKN A;  3K89 A;  3SQG B;  1S72 S;  3OVB A;  4RWX A;  1XBW A;  2R7W A;  3HFZ B;  1JXL A;  2FHK A;  2XO6 A;  1UJ5 A;  1TKZ B;  4YR3 A;  1VQK S;  1YWX A;  2VUG A;  1H7X A;  3KJQ B;  4M63 A;  4CO0 A;  4DL7 A;  1IWA A;  2XMW A;  3EUN A;  5LMN F;  4DLE A;  5L39 A;  2ABY A;  4A4J A;  4JI3 F;  3HSJ A;  1K1Q A;  1WG4 A;  3QGI A;  2H4Y B;  2O1P A;  1S49 A;  2CAD A;  4RNN A;  2M7S A;  2XG8 A;  2HBQ B;  4LF8 F;  4LFB F;  2B7B B;  1HIY A;  3MEG A;  5KTQ A;  1SXL A;  1VLY A;  1FJE B;  3HM9 A;  3EDR B;  4ETX A;  2P9C A;  1FRJ A;  2PDA A;  1YBT A;  2VQF F;  2GQQ A;  3N6N A;  2FY1 A;  2VON A;  3PW2 A;  1HHS A;  1VGY A;  3GYG A;  2HVZ A;  2YWG A;  2VOO A;  2PN6 A;  4MFB A;  2G4B A;  2VIC A;  2QIF A;  1KLM A;  3TQE A;  4CH1 A;  1Z2Z A;  5DDP C;  3RG6 A;  4PPD A;  1FFS B;  3IRX A;  1BMQ B;  2HHW A;  3H2L A;  3SDE B;  4O3N A;  1VQO S;  1OSD A;  1XMO F;  3PXG a;  1APS A;  4P10 A;  2F40 A;  2MLX A;  5KOX A;  1N36 J;  3GIM A;  2BZ2 A;  3AOD A;  4KSE B;  3AD9 C;  2FJX A;  3M9M B;  3QSI A;  4UUX A;  5T7L B;  2WK4 A;  3ET6 A;  2Y1I A;  1N0U A;  2DNR A;  2YWW A;  1HNW F;  2BJ1 A;  1RT2 B;  4HHU A;  4LF6 J;  1Q4R A;  1K73 T;  4JV2 A;  2ZKU A;  3VF0 B;  2VPW B;  3AJ2 A;  4KAI A;  4UQT A;  3FK4 A;  4OYO A;  2UXD J;  3HVT A;  2XZT B;  1H98 A;  2GAH C;  2D3O 1;  4ECS A;  3R5J B;  4CCH A;  4C8Z A;  2IM0 A;  3FQL A;  5LXR A;  1VC5 A;  2VB6 A;  2AW0 A;  4LBH A;  1Q0N A;  2FHO B;  4A8W A;  2JDJ A;  4FXD A;  3OXL A;  4F4W A;  3DYA A;  2VFT A;  2DGO A;  3BKT A;  1C1B B;  2DO0 A;  1KEK A;  3P5T L;  2COL A;  3A3P B;  4RKU C;  4B3R F;  2HND A;  2CUY A;  4B3O A;  4NX9 A;  1N5T A;  1VIO A;  4ECY A;  4EU0 A;  1NK7 A;  2GAG C;  1J5E F;  2P8I A;  4OZ0 A;  1YJR A;  3DI6 B;  1P1T A;  3OJS A;  3UVJ A;  1WJ9 A;  4CNZ A;  4EZ9 A;  1IBC B;  3M2U B;  4LSN A;  2LA6 A;  3DRR B;  3DOK B;  4A8O A;  5KT2 A;  2KTQ A;  2M88 A;  1VQ5 S;  2DNZ A;  3W9J A;  4ED3 A;  1A7G E;  4ICL B;  2JEF A;  1MN9 A;  1T03 B;  3MPV A;  1CG2 A;  5KFR A;  4ZVS B;  3P8B B;  3R27 A;  1UVK A;  3VGV A;  3RR8 A;  1QSY A;  4DV6 J;  2QMW A;  2Y0S D;  3ZTQ A;  4OI0 A;  4QBU A;  4HT5 A;  1UEV A;  3MM8 A;  2C3Y A;  2BKP A;  4H54 A;  4X4V A;  2BQ3 A;  2UUW A;  2YNI A;  2DO4 A;  2YPZ A;  3FJ2 A;  1UWB B;  2FVS A;  4O0I A;  2B6A B;  4WU3 A;  2FJA B;  2JFD A;  1R8A A;  1JJH A;  5KFL A;  3NS7 B;  3RAX A;  1S1U A;  5DLG A;  1DTT B;  4P2X A;  2Q6B A;  3PEH A;  2VU5 A;  2AJ0 A;  4LR8 A;  1HBU A;  2C2R A;  4X2B A;  4DUY F;  2M0G B;  1X9M A;  4IR9 A;  4ECV A;  4YEA A;  1TFY A;  3UNG C;  1U2R A;  4F3O A;  4LF9 F;  1UEK A;  1N54 B;  1H6K X;  2EKY A;  4EEY A;  1K0V A;  3UQS A;  2DEI A;  3C8Y A;  1QUV A;  4RUC A;  4QWE A;  4M5D A;  1X4A A;  2HK2 A;  3PJW A;  2Y0B B;  4DPX A;  3FVY A;  3LP0 A;  2FTR A;  4IFV B;  4I1T A;  2XI3 A;  2AMC B;  2HIY A;  3W3S A;  2MB0 B;  4PAB A;  2C3U A;  1Q95 G;  2ZD1 A;  2DH9 A;  4QYZ J;  1WC3 A;  2HRY A;  2E7X A;  1GEH A;  2PMZ D;  1NEE A;  1WOS A;  4ID5 A;  1KHV A;  4CT8 A;  3FEZ A;  1IQZ A;  4B3M F;  3KLI A;  2HW3 A;  1FTC A;  1JLF B;  3K0J A;  4B9U A;  5DM6 Q;  3KJV A;  3TJA A;  5ETN A;  2V67 A;  1RUS A;  5D0R A;  1NJW A;  2E5J A;  4OV1 A;  3MEG B;  4LVO P;  1HD1 A;  1SBR A;  2FGO A;  2VPY B;  1JLE A;  3ZZT A;  4P2S A;  5GAD U;  4Q45 A;  4C98 A;  1XN9 A;  1JKH A;  2Q79 A;  5AXN A;  1S59 A;  3M8P A;  2RRN A;  2YKO A;  2V5H G;  3GB0 A;  5J1E B;  2ZH3 A;  4CH0 S;  4NYZ A;  4MFB B;  3KHL A;  3V6K A;  4YHH J;  3CCT A;  2NRE A;  2AJ4 A;  1KLM B;  3BQ1 A;  5DZ7 A;  4OJ3 A;  1OY9 A;  4WP9 A;  2R8G A;  2PMW A;  3AY0 A;  3FCH A;  3AB2 B;  2XYH B;  4ATN A;  1JX4 A;  3KG4 A;  2J0Q D;  3NNC A;  4ZIW A;  1PYT A;  2X3G A;  1FK9 A;  3CTR A;  4B3S J;  3M7V A;  3ET6 B;  2DNK A;  5HVH A;  4KRW A;  3M32 A;  4JI5 J;  2LEP A;  5ETQ A;  4J9O A;  5KFJ A;  4X4O A;  4DV4 J;  3RAM A;  2EEY A;  3LAM A;  1RBO B;  4URG A;  3AOC A;  4ZLN A;  1T05 A;  4KPY A;  4QOT A;  4J9Q A;  2AGP A;  2KXN B;  4PG8 A;  3CJ2 A;  1KNZ A;  4ECX A;  3ILJ A;  2ZOM A;  5KFT A;  5IT0 A;  3FRZ A;  5FLX U;  2HVD A;  5CQG A;  1HBM A;  3TUP A;  5EN1 A;  2DNY A;  2EPI A;  1TL5 A;  4CLU A;  2OI2 A;  4RR5 A;  1LKZ A;  5H1S V;  3UDV A;  4Q2L A;  2R7O A;  4F26 A;  4K4T A;  4DR5 F;  5A8W A;  2QX0 A;  5F0U A;  3DYA B;  1C2P A;  4HVZ A;  4F4A A;  2KG1 A;  2HVI A;  1U1Q A;  1CJV A;  3H4B A;  2J6T A;  3GFY A;  2HNY A;  3KXD A;  3PX0 A;  4B3O B;  3QSY B;  3G82 A;  3X3U A;  4L3K A;  1RTJ A;  4KR0 B;  2IMO A;  2RIL A;  5ETL A;  2F7V A;  2EFO A;  5E3P A;  3UVJ B;  1X4C A;  2IC3 A;  2R9L A;  5LL6 d;  3I0S A;  4I56 A;  1O6X A;  4W4M A;  3RBD A;  3U02 A;  2AX1 A;  2DIS A;  4ZIV A;  4ELT A;  1RAJ A;  4CLP A;  1RT5 A;  1U0H A;  1WD6 A;  4A8Y A;  2HAI A;  5IV3 A;  5K20 B;  3EZO A;  1GX5 A;  1I1G A;  2ERR A;  1FD2 A;  4AXJ A;  4WJB A;  2YWH A;  2WVC A;  3FEX B;  5I3Q A;  3GJR B;  4P2F A;  2XNR A;  4ZIT A;  2Q3P A;  2J9E A;  2JRS A;  5E2Q A;  4OHZ A;  5AXK A;  2YNI B;  2KYZ A;  4V19 X;  1TUW A;  2G1H A;  3R5C A;  4J37 A;  4KO0 B;  2W7A A;  2XY5 A;  2EVZ A;  2KKH A;  1S1U B;  3JYT A;  3CJS A;  2MSS A;  1HBU B;  2E29 A;  5EWF A;  2A18 A;  3D54 A;  3MI7 X;  2LQ9 A;  4ZPD A;  1N36 F;  4LF4 J;  3KJN B;  1RJJ A;  4Y2K A;  4NLG A;  3T19 A;  4RUH A;  3BGU A;  2UXB J;  2JFK A;  5C5J A;  1WF0 A;  1M1K T;  4TQR A;  2DGV A;  2V8P A;  2YKN B;  4U96 A;  5JMN A;  4LF6 F;  3OR1 A;  4ED2 A;  1JXE A;  3P4U B;  2ALY B;  1SC3 B;  2FJB B;  3PVX A;  1HWI A;  2UXD F;  2YNH A;  2GO9 A;  2FLL A;  4KHP J;  5K14 A;  4DL3 A;  3IC1 A;  3D66 A;  3DNC A;  3POT A;  4A48 A;  1UMJ A;  3LP0 B;  1RXO B;  1BUX A;  2VOP A;  2HGL A;  5DZ6 A;  1LOU A;  4Q0B B;  2ZD1 B;  3H59 A;  3AA8 A;  3OL6 A;  2R2S A;  1HI1 A;  1QAX A;  3V2U C;  4B9V A;  4ELV A;  2OTL S;  4ID5 B;  3P5B P;  1F3V A;  4UST A;  1QY7 A;  1IXK A;  1DBD A;  5DQG A;  3BBB A;  3H42 A;  3SFU A;  3DDN A;  5JUM A;  4Y2M A;  3IGV A;  3KJV B;  2LEB A;  2R8J A;  3ZNU A;  3JTO A;  2DR8 A;  2H54 B;  3QT8 A;  4H4K C;  2N4C A;  2C42 A;  2CQP A;  3CJ8 A;  1KS2 A;  2HHX A;  2OPR B;  1U45 A;  3OSN A;  5KT5 A;  1L3T A;  3W60 A;  1NDK A;  2CG4 A;  2XI2 A;  3DLG A;  2Y9H A;  2LQ8 A;  1VHI A;  5M2P A;  1TK8 A;  2DNP A;  2CAJ A;  2QZ8 A;  5I3U A;  3HHL B;  3WIU A;  2J8S A;  2J0W A;  2LLZ A;  3TZZ A;  4OL8 A;  5HAO A;  3GCX P;  1UKU A;  3PKY A;  2EW9 A;  4OV6 A;  3IP0 A;  2BM0 A;  1GTH A;  4DV6 F;  4P2M A;  2LXF A;  1VQ6 S;  3BGR A;  4C2M A;  4Y0F A;  1FK9 B;  3M32 B;  4DU7 A;  1NO8 A;  1N48 A;  3K59 A;  4Q8E A;  5J2N A;  3ILI A;  2PA3 A;  1S77 D;  3OQ2 A;  1T05 B;  2BM1 A;  2D3U A;  1QLN A;  2SXL A;  4DF4 A;  3O6Q A;  3KK1 B;  4CO1 A;  1HQE B;  2YQ0 A;  1ZBT A;  1L5U A;  3DRY A;  3NGR A;  4DPY A;  3GQC A;  1VFJ A;  2HVH A;  3OLA A;  2DGX A;  2F4V J;  2P2C B;  1IR2 A;  4OZ2 A;  4DV0 J;  3DLK B;  3K7R A;  3I0R A;  1XER A;  2C1E B;  2AEM A;  1OY6 A;  5A8W B;  3VWS A;  1SQG A;  2FY8 A;  4ZDN A;  3BS9 A;  1IQT A;  3EGW B;  1NJZ A;  1R8B A;  4HTI A;  2HNY B;  3R3T A;  2PEH A;  4ZOS A;  5KFW A;  2MMY A;  1CC8 A;  3G82 B;  5LXY A;  2B9X A;  1F0X A;  1RTJ B;  4NPO A;  2MXY A;  2CJK A;  3EMT A;  3KLF A;  4DQS A;  3CC4 S;  1QE1 B;  3NCQ A;  4JI7 J;  3RR7 A;  2JSX A;  2O5D A;  1HA1 A;  4AND A;  2DNM A;  4WYL A;  2IC3 B;  1EZZ B;  5GAH I;  3PW0 A;  2JEJ A;  3M05 A;  1H73 A;  1RT5 B;  1B0V A;  1U0H B;  2KT2 A;  1T11 A;  1RWM B;  3MCO A;  1YJT A;  3HHN B;  3HMJ G;  3GZ7 A;  2AJ1 A;  1RYS A;  4GMK A;  4NML A;  3QIP A;  5KG2 A;  1C1C A;  3IR7 B;  2HS0 A;  3Q8U A;  4WU2 A;  2V6A A;  3RJM B;  1WNE A;  3OTD A;  1WF1 A;  1LXJ A;  5B0C A;  3JSM A;  1KLN A;  2MHE A;  4I6Y A;  1WHW A;  3JSY A;  1CS4 A;  4YHH F;  4UOH A;  5F3Z A;  2E5L J;  1V3Z A;  5B0F A;  1NRK A;  3KK2 A;  1BHN A;  1U1M A;  1M0S A;  4DR1 J;  2E66 A;  4JP8 A;  1CVJ A;  3R6G B;  2ZZT A;  3QBC A;  2GZO A;  4WK1 A;  1NPK A;  2KO1 A;  3TX8 A;  4NLY A;  1F2G A;  3FNN A;  2C3P A;  3TAM A;  4F0H A;  4B3S F;  2OD6 A;  1ZAW A;  4YFU A;  1YJV A;  4ED5 A;  4EYH B;  4JI5 F;  4RW9 A;  2GMJ A;  3FSX A;  3FBF A;  4NLW A;  1W25 A;  2ZDP A;  1NHV A;  1Z4U A;  3GMG A;  4DV4 F;  5H9E K;  1TR0 A;  3NGU A;  2BW7 A;  4DPT A;  1S1V A;  2YNH B;  2VG6 A;  2MLZ A;  1C0T A;  5K14 B;  3QLH A;  2RVJ A;  1SUQ A;  2L08 A;  3POT B;  3HD1 A;  1MWQ A;  3GIJ A;  1TZ0 A;  3SYZ A;  5F8H A;  2V2Z A;  1S4E A;  2FLN A;  1TV6 A;  3C6U A;  4JBC A;  4USW A;  3HDS A;  4WXO A;  1Y7P A;  2DNN A;  2Z57 B;  2H9Z A;  1RB0 A;  5CCL A;  1JJC B;  3NWG A;  3B54 A;  2KXH A;  3RW6 A;  1HBO A;  3HHD A;  4WII A;  3BQ2 A;  1RWP B;  4FKX A;  2VAS A;  1U26 A;  2CPE A;  1V3R A;  3ETM A;  5HSP A;  3R5A A;  4YME A;  3TI0 A;  5EUH A;  2P6S A;  5ETV A;  1FDN A;  2PGC A;  2MQL A;  2GW8 A;  5A0Y A;  4FNI A;  2ZH6 A;  3SSS A;  3FRY A;  2JWN A;  3BPS P;  4B9N A;  1JIH A;  1YGY A;  2XO7 A;  3MEE A;  2KXF A;  2F8E X;  5I3U B;  3HT0 A;  3OHB A;  2MEW A;  1D8Y A;  1FDD A;  3L3C A;  2MZT A;  4M5G A;  4CDI A;  3EZ5 A;  5BYQ A;  1WHY A;  4LIR A;  1VR6 A;  2CJY B;  3M8R A;  3B78 A;  2J0S D;  3BR9 A;  4QWD A;  3GYX B;  2DGQ A;  2WON A;  4ANE A;  1R8C A;  1TAQ A;  5H9F J;  3MR6 A;  3ZO7 A;  5B09 A;  1S9E A;  5L1J A;  1Q8K A;  1HWK A;  1IM6 A;  2HZC A;  3BGR B;  3N5F A;  2I9S A;  3CSK A;  2HMI A;  2C2N A;  2JLE A;  3PR5 B;  2XWY A;  1WI6 A;  3BDE A;  2HKE A;  4O4G A;  5J2N B;  2QO3 A;  3G8Q A;  2VIH A;  4CO3 A;  3LTO A;  5DJB A;  3PYG A;  1DQA A;  1ZA2 B;  1NCL A;  4ZVG A;  1N5Q A;  2GMH A;  3QID A;  2IRX A;  6AT1 B;  1EIY B;  2HHQ A;  4LF4 F;  2BAC A;  4PQA A;  3W8P A;  4BDP A;  4DSL A;  4DZ6 A;  3LO3 A;  1NZA A;  1URN A;  2HHV A;  4HKQ A;  2UXB F;  1T9Y A;  3MUR P;  3Q0A A;  2UU9 J;  3I0R B;  3VGS A;  3FKB A;  3M8W A;  1QSL A;  5L9N A;  3KLE A;  1JLB A;  2H48 B;  5KG5 A;  1KD1 T;  2BW2 A;  1SC4 B;  4F02 A;  4Y34 A;  4KHP F;  3ISN C;  4RX6 A;  5ETS A;  4P7T A;  4O3S A;  2OLW A;  2YKA A;  1ZYQ A;  4FP9 A;  2LFV A;  2DY1 A;  3EX7 B;  4CYU A;  1DAX A;  1T02 A;  2GQC A;  2VC1 A;  4U7U D;  2BAB A;  1VQ8 S;  1X4E A;  2WW4 A;  1YHQ S;  1NDL A;  5E33 A;  1BQM A;  1BE4 A;  3FBC A;  3CUN A;  2YKM A;  4JI8 J;  2W2M P;  4ERD A;  1S9G A;  4KGV B;  3GIK A;  5IC6 B;  1WDD A;  3HHL C;  4WZQ A;  3CCS S;  1Z1Z A;  1R8P A;  3NWR A;  3JAM U;  3MR7 A;  3BZQ A;  1C1C B;  2B8P A;  3M6X A;  4ILR A;  3MMC A;  2K3I A;  1ULR A;  2ZJR Q;  1QM9 A;  2ZKT A;  3JSM B;  4NLU A;  2DVI A;  1FEE A;  1ZAX A;  1R0A B;  5KFV A;  3T5H A;  3KYL A;  2ZHO A;  5HQ8 A;  1CS4 B;  2ZE2 A;  3H20 A;  2CQG A;  3THT A;  4C3L A;  4NZ7 A;  2HZA A;  3V4I A;  2V4J A;  4TQS A;  1ZS6 A;  1P27 B;  3HKZ D;  3PW7 A;  3TZY A;  4ZVU B;  2CQ2 A;  4ZPC A;  2ZVS A;  1N0V C;  1MLA A;  1Q8B A;  2KFN A;  3ZTR A;  4WWS A;  5AE1 A;  1FD8 A;  3IM9 A;  5DGB A;  4ZS6 A;  2WRM A;  4V19 J;  4CLT A;  2QMU B;  2XM3 A;  1IBM J;  4KPC A;  4P7V A;  4YR2 A;  2B4P A;  1NB2 A;  2Z2L A;  3GR0 A;  1WOO A;  4CLF A;  4KE5 A;  3CCV S;  2WOM A;  1X0P A;  4R8U A;  5AE3 A;  1T9X A;  2B4V A;  1VK8 A;  3NBP A;  2PC6 A;  2HPU A;  1S1V B;  4J9M A;  2MKJ A;  2VG6 B;  4QIF A;  2W9B A;  1C0T B;  3GR1 A;  3QLH B;  4CQ1 A;  2R7T A;  1SUQ B;  3H4D A;  3R7S B;  1IN0 A;  2HFZ A;  3RYL A;  1U48 A;  4CLS A;  2G9O A;  3W2V A;  3AD7 C;  1FVS A;  2D41 A;  3E3X A;  3DU5 A;  3C6U B;  2FYX A;  2F4V F;  1JLC A;  4I68 A;  3TVK A;  4DV0 F;  1RLC L;  3L95 X;  1D09 B;  3V6J A;  1NH7 A;  1HBO B;  1EP4 B;  4PWD B;  2UXC J;  1YK9 A;  3T1A A;  4AT1 B;  5LSO A;  3CJ0 A;  3WQP A;  5B0D A;  1U1K A;  3L4B C;  5KFM A;  3ZNJ 1;  1K0T A;  2J9D A;  4PCQ A;  3G8T A;  1JMT A;  2QRR A;  5IT4 A;  3D1O A;  4TYB A;  2ZDO A;  1L3V A;  2Q1L A;  5A0Y B;  4MT1 A;  4JI7 F;  1RP5 A;  2ROG A;  3P3D A;  1MWY A;  3ELH A;  4KBI A;  4NMX A;  2G1D A;  3BN4 A;  3RU0 A;  3HZG A;  3BSO A;  3MEE B;  2OFG X;  1T9W A;  1SIZ A;  1S57 A;  3PNI A;  4NWB A;  3UO0 A;  3M30 B;  4Z2X A;  5DG9 A;  3L9Z A;  4TVA B;  1J5O A;  1RAH B;  2DGS A;  4YR0 A;  4RNH A;  4GKJ J;  1S9E B;  8RUC A;  1UW9 A;  1HLW A;  2NUH A;  2MZ1 A;  2HMI B;  3P45 B;  3HI9 A;  3MDF A;  1KR4 A;  3EVW A;  4OZL A;  1S99 A;  1BXN A;  1RCX B;  4DWI A;  3E01 A;  4O4G B;  3CF5 Q;  1SPB P;  2QN6 B;  2P9E A;  2GJI A;  4ZPT R;  4C48 A;  2E5L F;  1T9V A;  4R0J A;  5KG7 A;  4M5H A;  2ZOF A;  2KM8 C;  3D1H A;  3UN5 A;  1RWW B;  1OO0 B;  1TKT B;  4UQG A;  1XC9 A;  3JB9 k;  2K2P A;  3D9B A;  4XPC A;  4Q44 A;  1NK5 A;  3NNH A;  4WP8 A;  4DHV A;  3GCW P;  1GTE A;  3SMZ A;  2MPU A;  3DLJ A;  1R89 A;  3C46 A;  3DMJ B;  2BYC A;  3LP2 A;  5CYQ A;  4DSF A;  1YIJ S;  4NA1 A;  1P1L A;  2XEX A;  1YBU A;  4DFM A;  4Y2A A;  2B9W A;  3KLE B;  3AXM A;  1JLB B;  5U47 A;  1NK8 A;  1LWF A;  1RAO A;  3KUE A;  2XY6 A;  3UD3 P;  1PIL A;  2J7K A;  2ATL A;  5F3T A;  4HI2 A;  3HHK A;  2WAQ D;  7FD1 A;  2HQC A;  1NBE B;  2V9K A;  3TEH B;  2IAJ A;  2GHV C;  1XR6 A;  1U8W A;  3W7B A;  3R8Y A;  2C2K B;  5DQH A;  2LQ5 A;  1N4L A;  4FVC A;  1PCA A;  4HR2 A;  1VRQ C;  3R5G A;  1RHU B;  1BQM B;  3J7A 1;  2FJW A;  4PEO A;  4M5M A;  2VA3 A;  5D3G A;  1GMW A;  4LSL B;  2YKM B;  3FSI A;  2WBR A;  1S9G B;  3OFF A;  4C8K A;  1FWK A;  3AOB A;  1W7W A;  4K4V A;  2LU1 A;  5C42 A;  3MAA A;  3H0P A;  2FDN A;  2JZ5 A;  4JI2 J;  3DRS A;  2HSE B;  4F67 A;  3MMA B;  2A6O A;  2W24 A;  1GXL A;  3FUY A;  2I1R A;  5CZX A;  2YQ1 A;  2IDL A;  1KRP A;  1WG5 A;  3MMC B;  3PFE A;  3BN7 A;  5DDO C;  2Q6C A;  4DX7 A;  2CDQ A;  4HH0 A;  4IRC A;  2XS2 A;  3W66 A;  2KVQ E;  2ZE2 B;  1X0F A;  2F8M A;  3V4I B;  3T5L A;  2V4J B;  2F5G A;  1CQN A;  4L75 A;  4OYB A;  4OX7 A;  1FNO A;  1FES A;  3T1H J;  3FGV A;  1S6Q A;  3KK3 A;  2QG9 B;  2QTW A;  5HJY A;  2M8D B;  2NZC A;  1Q1K A;  2JC1 A;  4KV8 A;  1GXU A;  1OYD A;  4R8U B;  4NLP A;  1U09 A;  3NBP B;  3K8V A;  1VQ7 S;  3C16 A;  3V81 B;  3NCR A;  3M8Y A;  2CQB A;  2XLJ A;  1HW9 A;  3H5X A;  2W9B B;  4W92 B;  3MPD A;  4G3I A;  3BGL A;  1HI8 A;  3IR6 B;  4A8K A;  1EKS A;  4K2J A;  2RDI A;  2IIH A;  4FYX B;  3W2V B;  2V4R A;  4DQR A;  1S6O A;  2RS8 A;  2X1A A;  1XK8 A;  4L6V 3;  2E1R A;  1JLC B;  2DKO B;  4F2S A;  1R43 A;  2UU9 F;  2MY7 A;  3QAT A;  3IWL A;  4LR7 A;  1X4G A;  3MEC A;  3WIV A;  5HVF A;  4URS A;  5HBM A;  5IT9 Y;  4GVB B;  3BO2 A;  1Q81 T;  2B56 A;  3U1N A;  2AU0 A;  1RU2 A;  5I4M A;  2G0I A;  5AT1 B;  1I3O B;  4NA3 A;  1SV5 A;  1SL0 A;  2HQD A;  4RUA A;  2GFF A;  2C2D A;  4LFA J;  3LPE A;  1D9A A;  3AH6 A;  1LEO A;  3IWX A;  2W4P A;  3ICL A;  3MM5 A;  3Q8V A;  5D4P A;  4JI8 F;  4O3P A;  4ZKA A;  1VMB A;  5A8R A;  4WF9 Q;  4JB8 B;  1DQ8 A;  1VS3 A;  7AT1 B;  4EO6 A;  1D9F A;  1J5O B;  3TA1 A;  2JX2 A;  2NXN A;  2AJQ A;  4DN0 A;  3FDS A;  1EX8 A;  2DPI A;  4U95 A;  2J5A A;  1RA6 A;  1HHQ A;  2N3L A;  4PKD B;  1AZS B;  4I2Q A;  4NI2 A;  3D0I E;  1T3N A;  1KOH A;  1X4H A;  1VQS A;  3E01 B;  4WKR A;  2ASD A;  3TUZ C;  3DCA A;  4PZV A;  2XZW A;  4P72 A;  2HHU A;  2DGT A;  4LRB A;  5ETK A;  1MRO B;  4F0M A;  1QDU B;  3DGP A;  3PHT A;  4KHM A;  4UTG A;  3D68 A;  4N7T A;  9RUB A;  4PXE A;  4YB6 A;  4QJV A;  1RA7 A;  2LP4 A;  2CQC A;  3TWZ A;  2CNK B;  2PI5 A;  4RW6 A;  3OW2 R;  1KN6 A;  3IBW A;  1IBM F;  2IVM A;  3X1L B;  2NLW A;  4DX8 H;  2D3O R;  4YOE A;  2FC8 A;  1HQU A;  3R1H A;  1LWF B;  2ZC3 A;  4OYA A;  5BR8 J;  4QWC A;  1T0T V;  2XS7 A;  5EWG A;  1PIE A;  2H5J B;  4FF3 A;  2IAJ B;  2G0C A;  3CED A;  2ZWO A;  2Y1L B;  4UY8 5;  1Y00 A;  2HQG A;  4Z7C A;  2AP6 A;  1RYR A;  2XS5 A;  1X5O A;  4D3H A;  1KHW A;  1IKW B;  3EDQ B;  3A12 A;  1RWX B;  3I56 S;  3G6Y A;  1B0P A;  4MAK A;  5D3G B;  2YVS A;  2D9O A;  2QJ3 A;  4FDF A;  5EGY A;  3MEK A;  1Q82 T;  3R5D A;  2CPD A;  4ECT A;  3OV7 A;  4C3K A;  3GPA A;  2UXC F;  3NL0 A;  2Y1J A;  2D9P A;  3HVR A;  3SZ2 A;  1FRX A;  5C42 B;  2D69 A;  3S01 A;  3DRS B;  4J9N A;  4AD6 A;  3ZZU A;  1I5O B;  2ZJQ Q;  1FKO A;  1NLK L;  4NOH A;  2DYA A;  2DR7 A;  2W2P P;  2AJF E;  2B8Q A;  2YXL A;  3MFH A;  4M95 A;  3BO3 A;  4RZR A;  1A0O B;  2F9D A;  5E41 A;  2ZBQ A;  4TU9 A;  1HKA A;  3EVO A;  3MM6 A;  4LRA A;  3PG9 A;  2RF2 A;  1GMW D;  2RQC A;  1EHW A;  5IWA J;  2KN4 A;  1ZZN A;  2JL9 A;  4WFY A;  3Q8Y A;  1B3T A;  4LSZ B;  4YB1 P;  4DR3 J;  1ICE B;  4LF1 A;  4USM A;  2V2K A;  3ENW A;  1YZ7 A;  2Q43 A;  1XMB A;  2OJ3 A;  2HWT A;  4GKJ F;  2IVY A;  3QO9 A;  4WIQ A;  1OQ3 A;  3LW5 C;  4DS5 A;  2FC9 A;  1S6Q B;  2M8H A;  3KK3 B;  3J81 j;  5KFC A;  3DU6 A;  2MGZ A;  3N28 A;  1IBK J;  1FJG J;  1N52 B;  1N6Q A;  1X4F A;  3MR5 A;  4HDG A;  4DG1 A;  3BR8 A;  2BUN A;  2EI5 A;  5HK4 A;  1SKU B;  2L9N A;  3SQG A;  1H2U X;  1PJ7 A;  3C16 B;  4ZJL A;  5KG0 A;  2EC0 A;  3NNA A;  1HPZ B;  3Q2S C;  2PSZ A;  1X7V A;  4CZC A;  2DH8 A;  3QJJ A;  4UUW A;  4PUO A;  4DQP A;  3SCI E;  2VG7 A;  3R7N B;  2C28 A;  3OTB A;  3QQC D;  1WTF A;  3HK2 A;  4IOA Q;  1KKH A;  2UV8 G;  2XTJ P;  2VV5 A;  3HJF A;  1R27 B;  3VVU A;  2QLJ B;  2VBY A;  3OFE A;  3UD5 A;  3MEC B;  1HNX J;  1KSP A;  5GAE I;  1YKW A;  4MYU A;  2KYX A;  4CP5 A;  2DK2 A;  2ACY A;  3J7Z 5;  2DCU B;  4DSI A;  2CJB A;  4TKT A;  3J7Y I;  1OIA A;  4YUD A;  2QEX S;  1MU2 A;  1M5K C;  4IG3 A;  1HNI A;  3EPG A;  5HI7 A;  2UVV A;  3KUG A;  3DN9 A;  4RUB A;  2RHS B;  2XQC A;  3W62 A;  4RNF A;  5J2P A;  4MTP A;  2NS1 B;  1G7C B;  3NY0 A;  1FNM A;  3ZTS A;  1PYO B;  1QD1 A;  2CQ4 A;  1KDN A;  1DTQ A;  6FDR A;  3NP5 A;  2HRT A;  2NXJ A;  8ATC B;  3G6E S;  2YH0 A;  5T14 A;  4WFN Q;  2CQ0 A;  3O3L A;  1DY3 A;  4TY9 A;  5A8R B;  2RU9 A;  1S10 A;  2AV5 A;  2VPX B;  3N0V A;  2DT9 A;  4AL5 A;  2FQQ B;  2K06 A;  1N34 J;  1PYS B;  3M8Q A;  4JI2 F;  2OAU A;  4ER8 A;  2CA9 A;  2ZIT A;  4USH A;  2BJ8 A;  3CDW A;  4MYT A;  5D0E A;  1AB8 A;  5CH7 B;  2F65 A;  1RAI B;  1YRU A;  1ZPV A;  2FJV A;  1YLX A;  4MIB A;  3EPI A;  1WG1 A;  2QLF B;  3S7R A;  1XWL A;  3MD3 A;  1Q16 B;  2KT3 A;  3AOA A;  4DV5 J;  2R8H A;  1WOP A;  3B6B A;  2WB1 D;  3DHW C;  2ZZN A;  2MQP A;  4DOZ A;  1RT4 A;  3O8W A;  4USJ C;  5H9F K;  4JYA J;  4AYB D;  3TX0 A;  4ANC A;  3DLE A;  3DHX A;  4NYO A;  2X3D A;  1S97 A;  3D7S B;  2RRA A;  2CPX A;  3QJP A;  1ZM9 A;  3T1H F;  2C2E A;  1CC7 A;  3QGP A;  1FF2 A;  3OVA A;  4JI1 F;  3HX9 A;  4RW6 B;  3UR3 C;  3OSP A;  3RRH A;  1K9M T;  1KP6 A;  2DNH A;  1HQU B;  4KIA A;  3MMB A;  4USI A;  4GRS A;  5D6G A;  2ASY A;  4JI6 J;  3QYY A;  4RPF A;  4J9V A;  5K9F A;  4B17 A;  1S48 A;  2FLP A;  2Z0G A;  3DDK A;  3UNY A;  3B8H A;  3MUM P;  1XR5 A;  2ZH9 A;  2HZV A;  4OQJ A;  4KHR A;  2KL8 A;  4A8F A;  1IJE B;  3BH6 B;  5CD4 H;  1VLO A;  4ZVH A;  1BWE A;  1SJ1 A;  4ICL A;  4ZPV R;  4ZP8 A;  4EWT A;  4ZCL A;  1H2V Z;  3HPO A;  2UVR A;  4H4K A;  2PEB A;  3UDC A;  4DUZ J;  4CO4 A;  1WTB A;  4DX5 A;  3CPW R;  2ASJ A;  1FXR A;  4AUK A;  2H65 B;  1FKO B;  2FGC A;  2VFR A;  4O3O A;  2OEL A;  1RAC B;  4OHY A;  2IA0 A;  2C2M B;  3EZU A;  3MUV P;  5HVG A;  1YSJ A;  2L9W A;  4IYQ A;  4C11 B;  3PIP Q;  4DV3 J;  5F9N A;  3MM6 B;  1F9H A;  3SFG A;  3E2E A;  5GMK a;  2RF2 B;  4RLE A;  1JLQ A;  2CJX B;  2MZR A;  3TOQ A;  4WKY A;  2BE2 A;  3PYD A;  5IZH A;  2LDI A;  2OPS A;  1R7I A;  2DHX A;  1W2I A;  3SV4 A;  4RO0 A;  1VBY A;  3BDP A;  2E9R X;  2MGZ B;  1NME B;  1SVD A;  3QRP A;  3RBE A;  4JI0 J;  2CVI A;  4TNO A;  1JXV A;  2QSF A;  3PRV A;  1M5V C;  4NLR A;  4N77 A;  4DG1 B;  2ZNZ A;  4F0K A;  4WCE Q;  3W2W B;  1SJ3 P;  4IFV A;  2JVR A;  3R2C J;  4LFC J;  1X4D A;  1GNK A;  3PYE A;  1HR0 J;  2XMJ A;  1ZM2 A;  4N47 A;  3Q23 A;  3CJR A;  3CMA S;  2BBE A;  5EX0 A;  3H2U B;  4PUO B;  4K4W A;  4UF4 A;  4QIG A;  2VG7 B;  4Z37 A;  1BD6 A;  3CCU S;  4DR6 J;  1QTM A;  2HFS A;  4HHJ A;  1Y3J A;  2W8K A;  4N56 A;  3GP9 A;  4E0D A;  3LAN A;  1JLF A;  3TNV A;  1NK6 A;  1HAR A;  2ZC4 A;  4AXI A;  1TUV A;  5GAH U;  2V8D A;  4MIW A;  4JI4 J;  4DL0 C;  2WSE C;  2X1G A;  5BR8 F;  3ETO A;  1R6Y A;  4MK7 A;  1G3O A;  1D1U A;  3HVW A;  1MU2 B;  4IG3 B;  3K5N A;  2BRK A;  3ZZ0 A;  1HNI B;  4CO2 A;  3CJ4 A;  2RB7 A;  2W7O A;  1RHM B;  1SCJ B;  5J2P B;  2XGP A;  4FZV A;  1UVI A;  5J1E A;  2B51 A;  5HAN A;  1YIT S;  3KJF B;  1DTQ B;  5K5M A;  3O5T B;  2RJZ A;  3JXO A;  2CPJ A;  1KC8 T;  3NKY A;  2RIJ A;  3GIR A;  1WEX A;  1TL7 A;  5IQQ A;  5IOL A;  4BLG A;  4LVN P;  4NYP A;  4N76 A;  1X5T A;  3HHE A;  2A2C A;  3M8Q B;  3T9N A;  2VPZ B;  4K50 A;  4OI2 A;  3JS9 A;  4NZ6 A;  1AW0 A;  3I5B A;  4X66 J;  1S4F A;  3NG8 A;  3PR4 A;  4U67 Q;  1ZET A;  4NCG B;  1WHX A;  3PJX A;  1N8R T;  1R8H A;  3GV7 B;  3VAF A;  5DG7 A;  3MZI A;  3GFH A;  1RE1 B;  1S6P A;  5A6W A;  2MZQ A;  2VF3 A;  1WC5 A;  1I94 J;  4OI6 A;  1F9F A;  2RT3 A;  5IWA F;  1UP1 A;  3Q8R B;  1TL4 A;  1RT4 B;  3FMW A;  2AEF A;  4O0N A;  2ZH2 A;  2ZM6 J;  3A1Y G;  4DR3 F;  2YX7 A;  3NGT A;  4DPW A;  3O2I A;  4QR0 A;  2YX1 A;  4ZN3 A;  5A8K A;  2OP5 A;  3ITH B;  5DRK A;  3DLE B;  4X4R A;  4WZM A;  1HBN A;  1RBL A;  2C2Z B;  2IYI A;  4OYX A;  1FI4 A;  1IBK F;  2R8K A;  1FJG F;  4F8R A;  2VJU A;  2EWH A;  1UPP A;  4DLG A;  4PRF A;  2IY5 B;  2CWX A;  2MDA A;  1BY9 A;  3MMB B;  1KOO A;  2NPI A;  5B0G A;  2WVD A;  2ZFH A;  5GAG I;  4LJM A;  4QQB A;  2KI2 A;  2V69 A;  5AXM A;  2HBY B;  3PX4 A;  2AQ4 A;  1EET B;  1G6B A;  3HSG A;  1UVM A;  2KDO A;  3CWJ A;  4J9R A;  2B4O A;  2XLK A;  2JVO A;  4QCL A;  3DOM A;  1YBA A;  1HNX F;  2KZM A;  4I6W A;  2G0J A;  1UFW A;  2LEC A;  3MED A;  3M9O B;  1SQE A;  3PJ9 A;  1Y3K A;  4C0O C;  5ADZ A;  2M9K A;  5FDL B;  1AUS L;  4IG0 A;  3DXS X;  3THV A;  2R2U A;  1PGZ A;  1JJ2 R;  2CNN B;  3CJK B;  1VDH A;  3DLB A;  5A2Q U;  1W2B R;  2BDP A;  2HQ3 A;  4L3N A;  1VQY A;  4LRD A;  3QZ8 A;  3VAG A;  1VQP S;  2HNZ A;  4BWJ A;  3IR5 B;  4HEA 9;  4V1A k;  4KO0 A;  4CO5 A;  4OIX A;  3I32 A;  4EK2 A;  4HYK A;  3HVA A;  4LR9 A;  2XB2 D;  1JLQ B;  3L09 A; 
#chains in the Genus database with same CATH homology
 3GU0 A;  1P9Y A;  2MLY A;  1T11 A;  2D3O 1;  3GTY X;  2MLX A;  2MLZ A;  1OMS A;  1W26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...