2D3OR

Structure of ribosome binding domain of the trigger factor on the 50s ribosomal subunit from d. radiodurans
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
93
structure length
93
Chain Sequence
b'SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title The Binding Mode of the Trigger Factor on the Ribosome: Implications for Protein Folding and SRP Interaction
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Ribosome
total genus 7
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2d3oR00
2KFYA 3I56S 2B0GA 2U1AA 2M7SA 5MLCV 2M70A 2MZTA 2XS2A 1JJHA 1WF1A 2YH0A 5LXYA 2DO4A 2F9JA 3MD1A 4WCEQ 2N7CA 5JVGQ 3DXBA 1UW4A 1FO1A 1Q7YT 5HO4A 2M8HA 4C0OC 3V4MA 2J8AA 2AYEA 2NLWA 3I55S 2ZJPQ 2OJ3A 1WHWA 2KXNB 1YJWS 2CPDA 1D9AA 5BJRA 2DISA 3G4SS 1U1KA 3VAMA 2GO9A 3CCUS 1WG4A 1QM9A 3CCSS 3D2WA 1N52B 2GHPA 1PGZA 4ERDA 2M88A 1U1RA 3VAIA 1P1TA 5IFMA 4CQ1A 3P5TL 1U2FA 2N82B 3G71S 3SXLA 5D78A 4TLQA 3VALA 2CQ2A 1WG5A 4IO9Q 2K3KA 3L3CA 1WEYA 2MZSA 2M9KA 4WFNQ 1R8HA 2DHAA 2CQ1A 3MUVP 3CC2S 4F26A 2QA4S 3UCUP 2OTJS 3CCLS 3S7RA 1H6KX 5IQQA 2RRBA 2CPEA 2RS2A 2CQHA 2EK1A 4Z2XA 4TU7A 2DGOA 5DM6Q 5FJ4A 1S79A 1X4FA 3LPYA 3NNCA 2MJNA 2MZQA 5DDPC 3ZZZA 3ZZYA 2MB0B 3UWTA 2BOPA 1YITS 3R27A 2LYVA 4YB1P 1FNXH 2QFJA 2KRRA 5LSOA 1U1QA 1QVFR 3TP2A 2LECA 1B7FA 1DZ5A 1WG1A 2ERRA 2MQLA 2F9DA 5D77A 1P27B 2CQPA 1UFWA 3CCES 2D9OA 2KN4A 1WHYA 4LIRA 5GVQA 1M1KT 2KM8B 2MKHA 2X1FA 3BO4A 2CPXA 2FC8A 2DO0A 3IWNC 3HHNB 3CUNA 2U2FA 2CPHA 2A3JA 4FXWA 3CCQS 3P6YC 4W92B 2DNRA 2DNKA 1VBYA 2MZJA 2FHOB 1X4GA 2DNYA 5DDRC 1VQ6S 1X0FA 3JB9k 3RW6A 2JVRA 1M5KC 2DIVA 3FEYB 2G4BA 2XSFA 1L3KA 1BY9A 1HD0A 2RUGA 3Q2SC 2M8DB 3G96A 1CVJA 2VODA 2DGWA 2MKCA 1X4BA 2AYGA 3NNAA 4YUDA 1N88A 1DRZA 2DK2A 3SDEA 2FC9A 1WI6A 4V19X 1VQ5S 2N3OA 2XS7A 4QPTA 3US5A 2CPJA 2DHXA 2DGTA 2DNMA 2M0GB 3S8SA 2VOOA 2CQBA 1X5OA 3MDFA 1VC5A 2DNLA 1VBZA 1KQSR 5DETA 3CD6S 2LXUA 1VQ7S 3Q2TC 3NMRA 3BO3A 1R8PA 1U1NA 1X5PA 3UD3P 1VQKS 1FHTA 2X1AA 4UQTA 2F3JA 3ULHA 4EGLA 3MI7X 2XNQA 1KC8T 3UE2A 4WF9Q 1VQLS 3VAGA 5IM0B 2AYBA 2HGLA 3MUTP 2KHCA 2M2BA 4CH1A 3CULA 1NU4A 3H2UB 1ZH5A 2ZJQQ 1X4AA 3EX7B 2EVZA 3TYTA 5CYJA 1VQ9S 2D9PA 2KI2A 4IOAQ 5JVHQ 4J5OA 2KM8C 2OSQA 2KYXA 3SDEB 1FJCA 5LXRA 2CQDA 2D3OR 1VC6A 4F25A 3U1MA 2PEHA 3VF0B 1XN9A 2YKAA 1W2BR 2CQGA 4WFAQ 2DGSA 3N9UC 1URNA 2RS8A 4TU9A 4PKDB 2I38A 2CQ0A 3EGNA 1U6BA 4TU8A 3P49B 3SMZA 4W90B 2MKJA 1VBXA 5DDOC 2MJUA 2OTLS 2AYMA 2KT5A 5GADU 1DBDA 2KVIA 3B4MA 2DGXA 5CA5A 2M4MA 1D8ZA 1YI2S 1H2TZ 2MGZB 2NZ4A 2J0QD 2PE8A 1KD1T 2FY1A 3OW2R 1VQNS 1WI8A 1M5OC 4LJMA 3CC7S 2QEXS 1H2VZ 4WKRA 2KRBA 2RRAA 2OIHA 2YTCA 2LEBA 4CH0S 1A9NB 5LSLA 1YJNS 2DIUA 1KOHA 3CCMS 2MMYA 2JVOA 2RT3A 1RKJA 1QVGR 1N54B 2G1DA 3CCVS 3P3DA 1G2EA 2DH9A 4CIOA 2KH9A 1JJ2R 2CQ4A 3LQVA 1PO6A 2RVJA 1VQPS 1Q82T 2KG1A 1OO0B 2LXIA 2E44A 2MKSA 2LQ5A 2DGQA 1X4HA 1WF0A 2MYFA 2XB2D 2HGNA 1U1PA 1IQTA 1HL6A 2CQIA 2KXHA 5GAEU 1RK8A 2E5HA 1FT8A 3S6EA 5LJ5Y 2DNNA 4C4WA 2HGMA 3R1LA 2CQ3A 1F9FA 3CTRA 3G6ES 4RU2A 1FXLA 3MOJB 2VONA 2CJKA 2J0SD 2MSSA 4C7QA 2HYIB 2XS5A 2JX2A 2RQ4A 1X4DA 1VQOS 2CPFA 2MZ1A 4Y00A 2MKKA 1VQ4S 4WIIA 1X4CA 2LKZA 2YH1A 1SJQA 2E5IA 2OSRA 3BS9A 3G8SA 2CPYA 1KOOA 1WEZA 4A8XA 1K9MT 1ZZFA 2ZJRQ 1SJ4P 4FXVA 2O3DA 2DB1A 3CCJS 1WHXA 1M5VC 1VQ8S 3UD4P 1N8RT 4U67Q 3B4DA 2MSTA 1Q86T 2KXFA 1OWXA 3NS5A 4QQBA 2JWNA 2MY7A 2DNGA 3RW7A 2MGZA 1WHVA 1VQMS 2M52A 2MHNA 5HL7Q 2DNOA 4IUFA 4ED5A 3G9CA 3IRWP 1X4EA 3J7ZT 3NS6A 3G8TA 2XNRA 3UCGA 3CXCR 1K8AT 3MURP 3VAKA 2WBRA 1FJEB 2LEAA 4Y0FA 1HD1A 3H2VE 2LMIA 4PRFA 3EGZA 4IOCQ 4OZ1A 3DLLQ 2DGVA 1OPIA 1X5TA 1YWXA 2Q79A 1UAWA 3PIOQ 3CCRS 2MZRA 1YIJS 4M5DB 2DITA 2LA4A 2X1BA 1U1MA 2I2YA 2AD9A 1VC0A 2L9WA 3S01A 2EK6A 1YJ9S 3NNHA 4YOEA 1UP1A 2SXLA 5EN1A 3MUMP 2LCWA 4OZ0A 1A7GE 4UY8T 3CMAS 3MXHP 2L41A 2N3LA 2MQNA 3R1HA 3BEGB 1U1OA 2JRSA 3U1LA 1WEXA 1NJIT 5CXTA 2CPZA 5GAHU 3MD3A 4P6QA 3PIPQ 1WWHA 1JMTA 4QU7A 1K73T 4LMZA 1DHMA 1WF2A 2DNZA 2BZ2A 3K0JA 3CMES 4QU6A 3UCZP 1NO8A 1YHQS 1M5PC 2CQCA 2HZCA 5LJ3Y 2MQPA 2DH7A 2RQCA 2G0CA 2V94A 2MY8A 3THPA 1FJ7A 1YTYA 1H2UX 2RU3A 4ZKAA 1Q81T 1HA1A 5IM0A 2KU7A 1SJRA 4WFBQ 2DH8A 5DDQC 1SJ3P 1U1LA 2MQOA 3VAHA 2MQQA 2MPUA 2MXYA 2DHGA 2LA6A 2L08A 1AUDA 2HVZA 3VAJA 3TO8A 2MKIA 3CC4S 1JJ4A 2E5JA 2ADCA 3J7YU 2KG0A 2DNPA 1WTBA 1WELA 5GMKa 1ZZNA 2YWKA 5DM7Q 3FEXB 3THTA 3BO2A 2E5GA 1O0PA 2X1GA 1SXLA 2DHSA 1M90T 1X5SA 2K8GA 3CF5Q 5H1SV 3CPWR 2CPIA 4F02A 2DGUA 4BS2A 2ADBA 1OIAA 1SJFA 3HI9A 2DNQA 5ITHA 2MQMA 2RNEA 1U6FA 1S72S 4PR6A 2VOPA 2J76E 3VAFA 2DNHA 5GAGU 2FPHX 2UP1A
chains in the Genus database with same CATH superfamily
5KFWA 3I56S 2UVVA 3KMSA 5I3UB 3O8WA 3GILA 3W60A 4WCEQ 5JVGQ 2GA7A 3DXBA 1T3OA 1Q7YT 3JTPA 4ZJQA 8ATCB 2G2YA 3VR1A 2NPFA 3BQ1A 4RW9B 4MKBA 3I55S 1EETA 2BANB 2Z0GA 4R8UB 5BJRA 4KPYA 4IFVB 1C0UA 3BR9A 3M8ZA 2BYCA 5ETQA 3VHQA 2M88A 3G6VA 1S48A 2C1EB 4HHHA 4HDGA 4EYIB 3T1AA 3LWLA 3J80Y 3IMQJ 1KN6A 2ZE2A 3QPIA 3GV8B 1NJZA 3GYNA 1R8HA 3MPYA 3NGTA 4FYVB 2F7VA 5I42A 2WVFA 4Q44A 5M2RA 2CPEA 4DCJB 4MYUA 2DGOA 1QTMA 3P45B 1CJUB 3CO9A 3W5ZA 1RDRA 3LOUA 3IRXB 2MB0B 3ZTQA 2UVRA 3O1LA 3BKTA 2ERRA 3D28A 4B3RJ 5CQGA 3MM7A 1FK9B 2QV6A 1DFDA 1JWWA 2KM8B 2WZ1A 1R6VA 3IM9A 2X1FA 4UOHA 3IWNC 3U1NA 2LQ8A 1IBKF 3MECA 4RX6A 3TVKA 3MTKA 4X84A 4BWJA 5C7PA 1EKSA 2NXJA 8AT1B 4QWBA 3VGTA 1VQ5S 4F3QA 4F4AA 4EU0A 4DUTA 2OEMA 4J91A 1KQSR 1UW9A 4F4XA 4FS2A 1MU2A 3HMJG 2WOMB 1RYRA 2OO4A 2EEYA 3QSIA 1D9DA 3KNGA 1FESA 3M6XA 1Y5LB 2NSBA 3MM9B 2YWWA 3BDPA 3TYTA 1KVKA 5CYJA 4KR0B 4ZVGA 2HQDA 1HR0F 3IP0A 2MEWA 1CS4A 2V67A 3AY0A 1W2BR 5D0RA 4ILRA 4TU8A 3PR4A 1IUJA 4H4KA 1RT5B 2FJDB 2R4FA 3WBZA 3KG1A 2CDQA 4RWXA 3FEZA 1HMVB 2HK3A 1YI2S 3QLHB 4Y2AA 2HQ3A 1H7WA 1RLCL 2FY1A 3MPVA 4DV7J 4JBCA 5DQGA 2V8VA 1Q8KA 1MLAA 2LEBA 1HNZF 4NZ6A 3LANA 1TKTA 2IRUA 4ZPCA 1IKYB 2RVJA 4RO0A 4QZVB 2BV3A 4QIFA 1F6TA 2BQUA 2HNZB 4ID5B 5IZHA 3WQPA 1IQTA 2CQIA 3UR3C 2IBKA 3H5YA 1FT8A 3TJ8A 1YRTA 4K7QA 3DHWC 5JJBA 2HS4A 1MN7A 3JSYA 4Y00A 3MAAA 5KG6A 1PBAA 5C5JA 4DCPB 4P75A 3DGVA 1RCOB 2Z2LA 2DB1A 3KLIA 4DX7A 2M3DA 2QC3A 5HQLA 3BKFA 5HL7Q 2PA3A 3NCPA 2R2RA 4USJC 1UVLA 2I5JB 2EW9A 3CD0A 1S1WB 3DRRB 2BRKA 4Y0FA 1PJ6A 4ECRA 2WVEA 2GV1A 5KFDA 4ZVTB 5A6WA 3OTCA 2NZCA 3EPIA 2YNGA 4UTGA 1W25A 4DPUA 4LFBF 4E8UA 3NNHA 2OH2A 1XEZA 2FVQA 4IKAA 4LF7J 3Q22A 3NGSA 3MXHP 3BDEA 2FLLA 1UVJA 5LOQA 4DLEA 3IWXA 2UXCJ 4USHA 3A1YG 4QWCA 3CMES 1CULA 2AW0A 2HVHA 4X4UA 1RWVB 1E6VB 1SV5B 4B3MF 3V6DB 1LKZA 4JI4J 3FKBA 3M6UA 3BGLA 4F0HA 2FJXA 1R6YA 3M2VB 5ETNA 4UUWA 5DDQC 4KGKA 2PD1A 1K47A 2MPUA 3GB0A 4JI7J 4NXNJ 3HSZA 2QL7B 2CNLB 4NLOA 2L3MA 1S6QB 7AT1B 4OZLA 4N8OA 4J9NA 5EWFA 1M90T 4Q2MA 3MHYA 4NEZA 5J2MB 1PILA 3N4WA 4C8KA 2GS8A 3MM5B 2Y0SD 5A8RA 4JI1J 1DQ8A 2MHEA 5HLFA 1TVRB 2UP1A 4USWA 3SCLE 4AQYF 1RZMA 3Q8QB 1CQNA 3POTB 2X3DA 2DO4A 2N7CA 2HHVA 5IXUA 4CLFA 5AXLA 3KNAA 2X3GA 3HO1A 2YKMA 2N7YA 4JOUA 1Y5NB 3DXSX 3CEDA 4WE1B 2R42A 2Z30B 2N4CA 2IVMA 3OQ2A 4K2XA 2XI3A 1JLBA 3O44A 3FBBA 5KFTA 3J7A1 3LTOA 3CVKA 4ZOSA 1EJ7L 2WTFA 1TK8A 4B9MA 2IMOA 2FJEB 2R8IA 2EK1A 2D69A 3JSMA 2R3VA 1ROFA 3FSYA 5T7LA 1NKCA 2K1RB 3TAMB 2QSWA 2FVRA 4N47A 4I6WA 1JXLA 1VRQC 1FEEA 1BQNB 1HLWA 2C2MB 1D1UA 1EZZB 2CPXA 1HBNA 2YNIB 3EVWA 2XMWA 2PDAA 2CJBA 1SQEA 4RBTA 5CYQB 2WVBA 2DNYA 1M5KC 2VJUA 3T19A 2QX0A 1XNQF 3Q2SC 5SUHA 4Y34A 4QYZK 2GGPB 4QIWD 5F8NA 3FBFA 1SKWA 2KYZA 3K5OA 2O01C 4ETZA 1CEZA 4FF3A 1GXUA 4NLTA 4GVBA 3MCMA 3GFYA 4Q0BA 1MWZA 4JI2J 1CC7A 3PKYA 3QGIA 2DR8A 3L7OA 4K50A 3D54A 1X7VA 1WC3A 4OYZA 2CQDA 3CGIA 4FYYB 4DSIA 3I6PA 1RQ0A 3I96A 1LWFA 5GAGI 1J27A 1LQ9A 2XLJA 1NHVA 1RHRB 1KD1T 3ZZ0A 3J81Y 1HKAA 4OYWA 4FKXA 2KRBA 3X3UA 3BBFA 2E5LF 1YZ7A 5LSLA 3F56A 5A0YA 4AT1B 3QZ8A 4OX9F 4B9NA 3CCVS 4KV8A 2GVZB 3R5JB 1JJ2R 1Y10A 3ILLA 4OLPA 4LQ3A 3DLKB 4DG1B 1HNWF 3AD8C 3HVWA 4I0WA 1OS5A 2V34A 4QIVA 4C8MA 3ZXWA 3N6NA 1CJKA 4WJBA 2V8HA 1FDNA 3OL8A 1ZTWA 2Z8QA 2IIHA 3T1HJ 3BS9A 1HNIB 4DR3F 1DAXA 4B9LA 2FHJD 3BH7B 3MZIA 1N8RT 1T9UA 2MSTA 2KXFA 3C14A 2MY7A 3RW7A 1S59A 4KAIA 1X8DA 2Q66A 2K7JA 2KL8A 4K4XA 1XBWA 4KHRA 2E1RA 3ILOA 5B0BA 2G0IA 3AJDA 3MEDA 1NZ8A 5I3QA 5DG9A 3H2VE 4LF9F 4OI2A 3LGHA 3QRRA 4M5IA 4IR1A 2D74B 4DR2J 1S1TA 4DF4A 1DARA 2ILZA 4DUYJ 2I2YA 2AD9A 1B0VA 5DJBA 2EXUA 2B4VA 4O44B 1LXJA 3U27A 3BQ0A 1U1OA 3E51A 5CAAA 5CXTA 1VRTB 4RLEA 2QZ8A 2DNZA 4H54A 3A8JA 3KK2B 3SZ2A 3T3FA 3QJPA 1NO8A 2JL9A 1HQUB 3HFVA 1FWLA 3UNYA 2VHGA 4OV6A 4NZ7A 4OZJA 2Z4PA 1FI4A 1T11A 2OPPA 1WD6A 1RTZA 2MQOA 5DQHA 2L08A 1DQ9A 3TO8A 4ZVFA 1EARA 4DUZF 1C0TA 3QWPA 1U24A 2ADCA 5GMKa 2YWKA 4Z7YA 5KFLA 1SXLA 1NPRA 1UFKA 2C28A 3HHLA 4DZ6A 2YKQA 3K58A 4C9DA 5AJ3J 4KT0C 5KT2A 3BZQA 1UA0A 5KT7A 5KTQA 4DQSA 3PFEA 2RB7A 2B0GA 2M7SA 1XIQA 1RT4B 1JB0C 4C98A 5GAEI 1FO1A 3AD9C 1MG7A 3CD7A 3OXGA 1QUVA 3ISNC 3CCUS 3CMQA 2F4VJ 4ZP9A 2W9CB 3DM2A 2ZOGA 1GTHA 2JOQA 2V69A 1K1SA 1R3NA 1T02A 2CQ1A 1W7WA 1Z2ZA 3PRVA 1BQXA 1H6KX 3GONA 1RHQB 4PEOA 3K89A 1JLCB 2BJ8A 4ED8A 1JLFB 4CM0A 1ZA2B 1VMBA 3ENQA 3R27A 4P73A 4JI8J 5LSOA 1QVFR 1NK7A 1DZ5A 3EE3A 3M6VA 4R0JA 3IBWA 4W98A 2ZZNA 3ZZRA 4DSLA 5HJYA 3IN5A 2MDAA 3SCKE 3CCQS 2BX6A 1N5QA 1RA7A 1JKHB 4BDPA 3FEYB 5JXSA 2B4OA 1N5YA 1BY9A 3R8YA 3TZXA 2CJYB 1NDCA 2P6TA 3DLGA 2DK2A 1WI6A 2DHXA 1X5OA 4U95A 4EBDA 1YJRA 2VC0A 4F3MA 1VQ7S 2ZKTA 2COLA 4ALZA 2ZKUA 4CT8A 3RTVA 3HHKA 2BOAA 5E3AA 3TX8A 4ZCIA 3WX8A 1X4AA 3SSSA 5JVHQ 1NH8A 1YLXA 3DOLA 3ET6B 5KFOA 4K4YA 3KG0A 3FK4A 1XN9A 2LQBA 1URNA 5L1JA 5HQ8A 4PKDB 2CQ0A 4X64F 3SMZA 1JQGA 4KYZA 4P2XA 4RW4B 2WCXA 1TKZA 1T9YA 2KT5A 3QWUA 2QMUB 1S1XA 2FJAB 5KOXA 3GFHA 3IR7B 4IO1A 2QGFB 5LT5A 4AFFA 1ACMB 5F8GA 1YJNS 1KOHA 2ZHAA 4DR5F 2XMTA 3F44A 1JLGA 4OI3A 3TWZA 3C16B 3IR6B 5EUHA 4CIOA 3H5SA 3MPWA 3LQVA 1NXIA 1YKWA 2P9CA 3LALA 1X4HA 3PEJA 5F8MA 2XG8A 1QTNB 5DQIA 1UEUA 4YR0A 2P6SA 4OJ1A 2VD3A 1S9EA 4C4WA 1Z1ZA 1VLYA 3QATA 4DL0C 1Q8BA 4B3TJ 2BE7D 1VQ4S 3CCWA 3W65A 4OHWA 2BBEA 3BYRA 2QIFA 4QIGA 1JLEA 4LSLA 3PG9A 4OZ5A 1WHXA 1VOMA 5J1PA 4R5PB 2DR5A 2YPZA 2VQFJ 2EI5A 2AV5A 3PW0A 1WHVA 1TL7A 1VQMS 3EJMA 2DNOA 5DLGA 3GIJA 4D3HA 4CLLA 3NMAA 1J5EF 4W4MA 1F3FA 3R6GB 1MW7A 1RT2A 4I2PA 5KFKA 2DXDA 4FF1A 5B0FA 3V81B 4CLKA 1P1LA 3AFGA 4ECSA 1RGVA 2UVWA 1OQ6A 2BACA 4ZDNA 5D4OA 3CE8A 3GWCA 2B9YA 3HDSA 4GKKJ 3VQTA 3B82A 4NLWA 2PI4A 3V4IB 4WFYA 5E3CA 1UKUA 2RMLA 1HI0P 3BN7A 5D3GB 1XK8A 1DTTA 2EFNA 5LJ3Y 1NK0A 2ZZTA 1RAJA 4MTPA 3TVZA 4DFPA 2ZHBA 4X62J 4EUVA 1T9XA 2KU7A 2QRRA 4WFBQ 1KHWA 3N6MA 2I8EA 1LW2A 3BKUA 3BGRA 4BWMA 3AXMA 4RW6B 1WTBA 4DLGA 3LAKA 1TKXB 3N01A 3H59A 4LRDA 2BE2B 2OPQB 4XDCA 2OHDA 2FDNA 3D3CJ 1X5SA 2HHTA 3J81j 4WP9A 3SV4A 1HNXJ 4P2MA 3HZEA 4IRCA 1DLOB 3KUHA 1RB0A 2HIYA 1IKWB 3GFZA 2J76E 4IYQA 5KFRA 3QAUA 1IKXB 4CWBA 2M70A 2CWKA 2YH0A 4A8OA 2VUGA 2CAJA 4OI4A 1EIYB 4RW8A 5KT4A 4YR2A 1KQGB 3AOCA 4PQUA 5HATA 2GJFA 1QJHA 2HFUA 3UO0A 3PR5B 3NXZA 1SUQB 2G2ZA 3KLGB 2IFXA 4X4OA 4DV3F 3DCAA 1Y5IB 1NAQA 1WEYA 2P2CB 2MLZA 3D6HB 2QA4S 1J2VA 2OTJS 2YX1A 5IT9U 5M2PA 3I4HX 3D6TB 2ZH1A 4ZP6A 4EWTA 3M8QA 3EUNA 1VRUA 3CJ0A 2CNOB 1EETB 3OXFA 4G1QA 4Q5VA 3TP2A 1C0UB 2F9DA 2GAGC 2D9OA 4LF6J 1LK7A 4TVAB 2V5HG 4E98A 2EKNA 3LO3A 4U8VA 2ZE2B 2PSZA 2A3JA 3NGRA 5KFVA 4W92B 2WSFC 5I42B 1GNKA 1X0FA 3H8YA 5D4NA 2QMWA 4NASA 2DGWA 1IBKJ 1DRZA 4V19X 2FJVA 2XS7A 3M7VA 4A8KA 1REGX 4IR9A 2YX4A 3MM7B 1VQKS 4URGA 5C2CA 4UQGA 1Q4RA 4NA1A 2VBWA 5F3TA 4J9PA 1LW0A 1RBAA 3MECB 4PXDA 2HVEA 3LA0A 1B4SA 1YG0A 4ED3A 1NB2A 3NOGA 2XQCA 2AGOA 2L48A 3SFGA 2G1HA 3TJAA 2FJBB 3OD2A 1U25A 2CZ9A 2F4FA 4L76A 4YB7A 3KJVA 2YPYA 4QR1A 4KQZA 4TU9A 2ASJA 4ZLJA 4DSKA 1TV6A 4J9OA 2PN6A 3KLEA 2XM3A 5GADU 4EYHB 2EWHA 4ILLA 2MGZB 2W2PP 2V9KA 4I69A 2HSEB 3Q8RB 5IT4A 1IJFB 2DIUA 4G3IA 4N41A 2FY8A 1N54B 3ADAC 2QJ3A 1TL3A 3FRYA 1CS4B 4QBUA 4GC6A 3MMAA 4YB6A 1HNZJ 2C3PA 4L72B 4F7VA 4KHPF 2KFNA 1N0UA 4DMZA 3PO5A 3G8QA 1V3ZA 3HKWA 3AB2B 2HGMA 3CIMA 3GQCA 1F9FA 1SCJB 3H5UA 4OJ3A 4K2JA 1RWKB 3N5FA 2LKZA 2UUAF 2EG1A 2J6SA 4M5DA 2ZJRQ 1TKTB 1TKDA 2GIFA 2ZITA 4I67A 3EVMA 1Q86T 4EMDA 3VGUA 2JWNA 4BCAA 2R7RA 5JUMA 4J9UE 2ACYA 5D0HA 3LP0A 4ES3A 2NXUA 3G9CA 4JUZA 1BXNA 1XWLA 4ECTA 2WVCA 3FNNA 5THWA 2GIQA 3V5RA 1N0VC 1IR1A 3OVAA 3HK2A 3D66A 3MAAB 2VKRA 4K4SA 5EDWA 5HAOA 5KOWA 2X1BA 3AD7C 2HFZA 3KLIB 1S49A 4OI6A 2D41A 3HF5A 3NG8A 1HBUA 4UY8T 5BXIA 5K8NA 5EX3A 1FXRA 5DG8A 4FF4A 3M2RA 4LFBJ 1OPZA 3M30A 4OHZA 5ADZA 4O3NA 4PXBA 1A6LA 4L75A 2HHHF 4HHJA 5HQMA 4J7CA 1Q8LA 2V6AA 2WONA 3J80U 2EC0A 4M5MA 3NKYA 4ED7A 3W1YC 2YNGB 5J1EA 1KTVA 3FJ2A 2BM0A 4O23A 2QLJB 4HHUA 4B3MJ 3R2DJ 2GW8A 1WTFA 2FIUA 5K8OA 1JJ4A 2EBEA 3J7YU 4C11A 1F9HA 2F8EX 1NUEA 3Q8UA 2QTWA 3BH6B 4MMOA 2L9NA 1VK3A 1CULB 3GG1A 3CF5Q 2LU1A 3W66A 4BS2A 4DQPA 3RJMB 3H20A 4IG3A 4DQIA 1FFWB 2H9ZA 1SC3B 1RI7A 1TMJA 2GAHC 4RPFA 1Q16B 2J9EA 2CZVC 4OYBA 4ED2A 4FBUA 1LNQA 1LWXA 4I7FA 4AQYJ 3OL6A 2VB6A 2CDRB 3ZTSA 2C3MA 4PWDA 2CUYA 4PUOA 5SZTA 4OIXA 3HSDA 1QM9A 2GHPA 2V8GA 5D0EA 1SI9A 1KVIA 4CQ1A 2B6AA 3MR2A 1TFWA 4NI2A 3AHPA 3O2IA 2C2OB 2XY7A 3BR8A 5A8RB 5HLFB 3VZHA 3CC2S 1IN0A 1F9EB 4QIEA 3UCUP 2YQ0A 1TR0A 3OJUA 2DT9A 1CBKA 1RWXB 1Z2LA 1EQMA 2C3YA 1AB8A 6FDRA 4DQQA 4O3SA 4KO0A 5FD1A 4C8LA 2QFJA 2YKMB 3AT1B 1U1QA 3RAMA 1B7FA 5E5NA 3U02A 1U8WA 3FBEA 5GVQA 2OGUA 1YBAA 1JLBB 1M0SA 2KO1A 3MMJA 3WX4A 4O4GA 4O3OA 4ZPAA 3HHLC 4DSFA 3JSMB 1CVJA 3KJQB 3MFHA 2AYGA 5CYMA 3SDEA 2XYGB 4OHVA 2OFHX 3WZ0A 5T7LB 4M5GA 1VBZA 1XNQJ 1U6ZA 3ULHA 1HBNB 1YBTA 1YJ7A 3ZTRA 2MLXA 4J5OA 2AJ2A 2UUCF 1AROP 3E3XA 3PW7A 1IR0A 4NA3A 2XCAA 2YKAA 2CQGA 2RHQB 3OFEA 1WJ9A 3FSIA 4MIBA 2GJ2A 1JNRB 5J2QA 2J9CA 2HHSA 4IDKA 2RDIA 2KZZA 4GVBB 1UJ6A 3W2WB 1L3SA 3L95X 3UDCA 4Q0BB 2C22A 4JI4F 3LAMA 3KHRA 4K59A 4B9VA 2PT0A 4USMA 1WC1A 2WRMA 1L3VA 4F04B 2W25A 1VQPS 1S7HA 2XHCA 3H4DA 4JI7F 2E5LJ 1VJQA 2AJFE 5HVGA 4OX9J 2VC1A 5GMEA 4P72A 1LWFB 5MAOA 1B7YB 1S0MA 4CO0A 2X7IA 4O3PA 1HNWJ 4O0NA 5M2UA 1RCXB 3VGSA 4ED6A 4IG0A 2A2DA 3D6FB 2YH1A 2E5IA 4ZVOB 4DFMA 2CPYA 1CG2A 4MT1A 4EBEA 4KV8B 1W2IA 3O5TB 4QQBA 2NREA 3E01A 2M52A 2MHNA 2QA1A 4YDDB 4FYXB 3PRBA 2VL1A 4UUXA 2KDOA 4RBUA 1CJKB 2ILYA 1FJEB 3ZTPA 4NWBA 1PAUB 4ZLLA 1RT3A 1HNVA 3ELHA 4YMEA 2UVUA 3RR7A 4LF1A 3PCOB 5AE1A 2HURA 2XTJP 3NEKA 4LSNA 4LF9J 5IS2A 2NPIA 3HD1A 2K7KA 3C14B 3MUMP 1TAQA 1T9TA 3N79A 1WWHA 3TUJC 1DHMA 1WF2A 1B70B 5C25B 3MEDB 2AHOB 3K0JA 1UCNA 2GMHA 5B0AA 4GMKA 5E0OA 4WXWA 4KFBA 1S1TB 1RTIA 5ETVA 4FPIA 1WSVA 2EFGA 1UZHA 2DH8A 4KGVB 3V2UC 4ZCKA 3TAQA 1I6JA 4NCAA 4AL6A 4RW7A 2E5JA 2RD5C 3QFHA 4AYBD 2R2TA 3OLAA 2HBZB 4DUZJ 1OY6A 3MMBA 2BABA 5F41A 2ZH9A 1RT6A 4N8NA 1QSLA 5KG2A 1S72S 3KUEA 2VOPA 2OPPB 3KKFA 2U1AA 4IQMA 3PY8A 2BKOA 2YWGA 4JI2F 1R0BG 3CJSA 1C0TB 4TXSA 3M05A 2BE9B 2AYEA 4DDFA 2ZJPQ 3K8VA 1RACB 1WHWA 3OPKA 4CO5A 4GVLA 2CPDA 4EZ9A 2B4PA 1BE4A 2CXEA 3KHLA 2GO9A 1S77D 3H40A 3HHLB 4ZP7A 1NK9A 4X66F 3NCRA 2V68A 2XY5A 4LFAF 2DD8S 3H0PA 3SCJE 4LF8F 2M9KA 2BA9A 1I94F 4OX8A 1XR7A 2DPJA 4MK9A 2DHHA 3CCLS 1OY8A 1RBLA 2IHR1 2PEBA 3AOBA 2GQCA 3UWTA 5KFAA 1IJEB 3D0IE 2KRRA 1U48A 3TUIC 1M1KT 3DM2B 4RBVA 1BWEA 5L8RC 3UN2A 3BN4A 1ZM4A 2CPHA 3HSJA 4FXWA 2C3UA 4HLBA 1FKPB 2DNKA 4O3QA 3I0SA 1F5BA 3JQKA 2ZEJA 5BYRA 2W8KA 1NCLA 4Y2MA 3G96A 1XC9A 5HVFA 1V3RA 1N88A 2ASDA 3BM7A 4G1IA 2RQKA 1HBOA 3US5A 4A8QA 5KFSA 4C8NA 3ZNUA 2A18A 1U1NA 4ED4A 2F3JA 3MI7X 2EFVA 3G6YA 3Q89A 4CO3A 3I5AA 2EBGA 1TL4A 3H2UB 1D0EA 1Z4UA 3DNCA 3EX7B 1FX2A 2VZ9A 4ZIWA 3QGPA 3DDKA 1N5YB 2GQQA 1TL5A 4M8LA 3DLGB 3QYYA 1OJ4A 1GQEA 2V8PA 4YR3A 4M1KA 5CA5A 1D9FA 3GJQB 3I31A 4X64J 1RAIB 2FZKB 2V4JB 3HPOA 1FE4A 1JX4A 2HMIA 1XMBA 2FUG9 2DR7A 4NLSA 3DMJA 2V2ZA 4BLGA 2HW3A 2G1DA 3DOLB 4LR8A 3K7RA 1PO6A 5DZ7A 3JSBA 2MKSA 4EEYA 2LQ5A 3J7Z5 1Y9OA 1S0NA 1HL6A 2KXHA 1U47A 1FVQA 5KFNA 2FVPA 5A8WA 2KJVA 3S6EA 1TKZB 5L9NA 3R1LA 1S1XB 2FGCA 4FDFA 1KHVA 2LXFA 3M8WA 4KC5A 2XBPA 2VH7A 3JS9A 4PCQA 2CPFA 4WIIA 2NUUG 3MR6A 4FS1A 4B17A 1PSDA 3M2UA 3C6UA 3QNWB 2O3DA 2CG4A 2W7OA 3UR0A 3CCJS 1M5VC 1IWAA 4ZJLA 1EAYC 5U47A 2W4DA 1SH0A 3MPUB 1S9EB 1NSQA 1VI7A 2XMJA 4YHHF 3OV7A 2LEAA 2ZH3A 4CNZA 2F4VF 1CC8A 1N33F 1J5EJ 5HP1B 1ZM3A 1YWXA 5KFPA 4PWWA 4P74A 3DRPA 2V2QA 4ELTA 1JLEB 1H3DA 4ELVA 5HVHA 2LU2A 3S01A 2EK6A 4CTAA 1BQMA 2PMZD 3AXKA 1HI8A 4KE5A 4I56A 2LCWA 1F3VA 1TL7B 3BEGB 1IBMF 1MNEA 2HHWA 1JMTA 4QU7A 1RT2B 2Q43A 4I2PB 2O66A 3PXGa 2MQPA 2DH7A 2G0CA 2V94A 1VK8A 1NSPA 3NBPA 4USKA 2NXEA 4ZVPB 4U8YA 5L39A 1IVZA 4WTYA 1R8BA 2EFPA 3IFEA 3ZFVA 4LR7A 1FERA 3HCXA 3JYTB 2RDJA 4KB7A 1SJ3P 2YNHB 4DV2F 3CDEA 3K59A 1ZBTA 5F8HA 2ZH2A 1LWCA 1RHUB 2H1YA 1B3TA 4OV1A 3CB4A 3OFFA 3GMGA 3TR5A 1NPPA 3BPSP 2YKNA 1DTTB 4LF2A 3UD5A 4F02A 2CPIA 1JLAA 1WUUA 4A46A 1NSKL 1TFYA 2I1RA 1U6FA 5AE3A 4Q7AA 4B08A 2DRBA 2JEGA 3C3LA 5GAGU 3O6QA 4M95A 5ETRA 1RU1A 1LW2B 3BGRB 2M8HA 2B9WA 2HFSA 2MLYA 3N6LA 5KG3A 4PQAA 2IVYA 1IM4A 2RIJA 2DISA 1R43A 3QGHA 2CJ9A 4ERDA 2JEJA 1P1TA 3IBCB 3Q83A 1NJXA 1RT1A 2W4PA 3AH6A 1WOOA 2H51B 3QBCA 1NKBA 4DV3J 3S1TA 2DYAA 3DKDA 2IAJA 5KFYA 3ZZZA 4K0KF 1KTQA 4RW8B 1SIWB 4PQUB 4YB1P 5G0RB 1FWPA 3Q8SB 3TNVA 2CKWA 2R7QA 1VIXA 3UVJA 3NOCA 1MMLA 4NLVA 5EWEA 4OYAA 1NRKA 1VJWA 2RH3A 2R2SA 1G6BA 4RW9A 3MFIA 4R8UA 2AGPA 1L3KA 1HD0A 2BM1A 2WAQD 3M8QB 3JTNA 4LQ9A 4USTA 1P9YA 4G1QB 2EKYA 2DNLA 2R8JA 3CJ2A 4X65F 1FRHA 2VBZA 1FHTA 3OVBA 5IWAF 2KT3A 1HPZA 4LBIA 1HWLA 3CULA 3NAHA 3FBCA 1UEVA 4JYAF 2J0XA 1EP4A 3RUBL 2CIMA 3M9NB 1FK9A 3RRGA 4KH1B 3TRGA 4GKKF 4GKJF 4PWUA 1NM2A 3N9UC 2HNDA 3C2PA 2OEKA 3H42A 1TMMA 1APSA 2IY5B 1NDKA 3BQ2A 3B4MA 1LXNA 1QLNA 2M4MA 4QR2A 4Y2IA 1I5OB 1LW0B 2J6UA 2CWXA 3IC1A 3DC2A 1R0CB 5LM7E 2QEXS 4LFCF 2MTLA 4ZVQB 3BREA 4X62F 2ZH4A 1RKJA 1MROA 1NEEA 2PMHA 1ZOTA 3GIKA 3JQJA 2KH9A 5KT6A 3WC0A 4PYDA 2OKQA 3KJVB 2BJDA 2QA2A 1WF0A 5CD4H 1IKVA 2QO3A 1TV6B 3NY0A 5GAEU 3KLEB 1IXKA 1N56A 2IRXA 4OZ3A 4R0EA 2CQ3A 4EK2A 2V2KA 3TUPA 2HYIB 3GU0A 2RQ4A 4KHPJ 1HBMA 3TVYA 4NX9A 5KFGA 4OFZA 1WACA 2IM2A 1SKUB 4CO4A 5E3QA 4NYZA 4A8XA 1ZZFA 2RU9A 4FXVA 2RHSB 1UMJA 3T5JA 1TL3B 2ZH6A 3DI6A 1VIOA 2VDHA 3CSKA 3RB4A 2ZDOA 3NRBA 3QFWA 3GIRA 2FYXA 2UUAJ 4CZCA 3CDBA 4NYPA 1X4EA 4QOTA 3UPFA 3UCGA 2VKZG 4ZPTR 2WBRA 2BDPA 1OMSA 4RNNA 3CD5A 3MMCA 1IKYA 2VICA 1XR6A 4JV1A 4ZLNA 2C2KB 4B3OB 1PC4A 5DZ6A 4M5DB 4HH0A 3MEEA 1YSJA 3HT3A 3HLUA 3LP0B 1U02A 3NWGA 2APOA 5KG7A 4J90A 2Z58B 2DCLA 2BZ2A 1SJ1A 3SSRA 1S4EA 4LF6F 3HP6A 2IJRA 3KLFA 3CWJA 2RU3A 4TQSA 3GTYX 5HROA 2VG7A 2W2NP 2HHHJ 5AE2A 3T5HA 4HR2A 1FEHA 2I5JA 1Y0HA 1HBUB 1N5TA 1UL3A 2KG0A 1Q95G 1N5SA 1K1QA 1GX5A 2AJ0A 2PI5A 3M2RB 1Y00A 4DL5A 3C66A 4DU7A 3ZC4A 3ZZPA 1FDBA 2X1GA 3I87A 3HULA 2V9WA 3CPWR 3OR1A 2IM3A 2GCFA 2F65A 3KLVA 3DOKA 2IA6A 3PZPA 2MQMA 3I32A 1Q8IA 3OXLA 2WONB 5J1EB 2ALYB 2FHKA 1TELA 3MM6A 3X1LB 5LXYA 1UW4A 2EPIA 1IQZA 1T05A 2XZWA 2F8HA 1FRMA 4C11B 4PPZA 2ZFHA 4TLRA 1NZAA 2XMVA 3M2VA 3D1OA 2OD6A 4ECUA 2QSFA 3QT7A 4IG3B 3VALA 3SEOA 2UXBF 4U7CA 1M5HA 5L1KA 2XULA 4CP5A 2IBOA 1S6QA 2VPZB 1E6YB 1KDNA 3M32A 2RS2A 2CQHA 3A3OB 4TU7A 1X4FA 4I7FB 1AA1B 3CJQA 4DV1F 5KG5A 2ABYA 2LYVA 1SKRA 1V5VA 4PWDB 2YBVA 4PUOB 2HHUA 1QSYA 1X9MA 2ROPA 1UFWA 2FGOA 3JXOA 2B6AB 2D1CA 3QRPA 3A3NB 4GO7X 1QUPA 3K17A 1VGYA 4L3KA 2AT1B 3P6YC 3QMQA 2CVIA 3R2CJ 3C19A 2CYYA 3M1VA 1NH7A 2JVRA 3Q8YA 2G4BA 1T3NA 2M8DB 1F5AA 1KKHA 4YUDA 2N3OA 4QPTA 1SC6A 1U0HA 2HWTA 1OYEA 5HI7A 1RA6A 2XZTB 1RTDA 2J9DA 2NYHA 3VV2B 3VAGA 1S57A 1LFPA 1S0VA 3LP1A 4O4GB 1RLDA 3PO4A 2DRDA 2VG5B 4CLUA 4R25A 1S1UA 4MKYA 5CYMB 1S10A 2KYXA 3SDEB 2DXEA 4OQJA 5D4PA 3KHGA 3QGGA 2G0JA 3DRSA 2I38A 2UUCJ 1UFLA 1IBLF 5CYQA 2UV8A 2HNYA 4J9RA 5DDOC 4CCHA 3DOMB 1WKLA 2AYMA 4I4BA 3OT9A 2LVWA 5FLXU 1H2TZ 2QG9B 1WI8A 1GH8A 5J2NA 4CH0S 5KFXA 3CCMS 4KTQA 3W7BA 3KJNB 3P3DA 1S99A 2CQ4A 2MYFA 2BJEA 4YDXA 3R97A 5F0UA 1QE1B 2GJIA 5J2QB 5HJXA 1N4LA 2PGCA 5LJ5Y 4IDKB 3OTBA 2DEIA 2QL5B 2AWZA 1ZETA 2CJKA 2J0SD 2AIRB 4ANCA 5KFJA 1PKUA 1R0AA 3IAS9 3FRZA 2XY6A 4CRJA 2E1AA 1KOOA 1VQ8S 1XQIA 4DR6F 4H4OA 4DF8A 4JI6F 3L7UA 1ITPA 4C3LA 4NRTA 2XNRA 4PG7A 4UOFA 1RABB 1NBEB 2AP6A 4IG0B 1C1CA 3BGUA 1RWWB 2BJ1A 2GMLA 1VYAA 4ED1A 3G82B 3DRYA 3E01B 4WKYA 1T9VA 4QW8A 4PG8A 3MD3A 2E7VA 5KFBA 3GYXB 2HLTA 2NR0A 3W3SA 1SH3A 5BR8F 3QJJA 1RT3B 5A76A 3KJFB 4HKQA 4ZKAA 4X4RA 2E9TA 1Q53A 1KEKA 1U4BA 6FD1A 4RKUC 1XTZA 2DHGA 5F9NA 2ZH8A 2NXCA 4LREA 4QYRA 2P9EA 3QIPB 1JLQB 2QE5A 4L74A 3OTEA 2AMCB 2KVQE 3SQGA 4K4WA 2V0NA 2E7XA 1SIZA 5D4LA 5ITHA 4KFBB 3PKMA 1RTIB 1CPZA 5ETMA 3CW2C 2XCPA 3D1HA 5MLCV 1ULRA 5D0GA 2XS2A 4OX7A 3RAQA 2XYHB 1DQAA 5HO4A 1KWMA 3CNQP 4DV5F 2KXNB 2W9BA 4FKYA 1REVA 2B3TB 2BQ3A 2HHXA 3D2WA 1RP5A 3MMBB 3VAIA 4JV5J 3NGDA 1RT6B 4X4VA 1N6QA 3TA2A 3G71S 3D1QA 3HD2A 2OUGA 4NLXA 2K3KA 3L3CA 1WNEA 2ACMA 4WFNQ 3AOAA 3PEHA 4X66J 1SH2A 4H4MA 4HT5A 4LFAJ 5DM6Q 1GMVA 5A8KA 2ZVSA 3MOZA 4LF8J 4M5KA 2RDDA 4ER8A 1I94J 3EXCX 2Y1IA 3RB6A 2LECA 3CCTA 2HFOA 3MAQA 5KFEA 2IM1A 3AQPA 2XSJA 2ZBQA 4WFXA 1VBYA 2MZJA 1FA0A 3RB0A 4ICLA 2B8QA 2R7WA 4TY8A 5F0WA 2HWIA 3OJSA 3NL0A 3ENVA 5EGYA 3UDLA 1FDAA 4PXEA 1X5PA 2QN6B 4C48A 4Y2KA 4G6VB 4TNOA 2KT2A 3UE2A 4TN2A 3C6TA 1JLFA 4ZK7M 5KG4A 4F4KA 2Y1RI 3R5DA 4DI6A 1NU4A 1HQ2A 1CQMA 3I0SB 4DS5A 3CJTA 2XHWA 2D9PA 3QAEA 4FNIA 1XERA 3EZUA 4KKOA 3BV8A 2Z2ZA 1BC6A 3KXDA 4DCOB 1HBOB 2DGSA 2KZMA 3EGNA 3P49B 1B99A 4W90B 1UEKA 4KBIA 4U7UK 2OPSB 1JKHA 3R6LB 2OFGX 1DBDA 2RKIA 5A2QY 3RR8A 4TYAA 3FCVA 1D8ZA 4NA2A 4I68A 1M5OC 1PJ7A 2FVCA 5AXMA 3CC7S 1FRKA 3HFKA 4A8WA 1EHWA 1SC4B 2C2ZB 1NK6A 4MFBB 1S6PA 1QVGR 4OZNA 1RTHA 2FLPA 3AJ2A 3CDWA 2KG1A 2HVIA 4X4SA 2KFZA 2DGQA 1SQFA 5D6GA 2QYGA 5DO2A 4U9RA 1GMWA 1YZ6A 3R9LA 4A8FA 3H5XA 1TUGB 1OY9A 3ITHA 3CTRA 3D67A 1N32F 1R31A 4KSEB 3DMJB 4I64A 1HHSA 3NLCA 2M5YA 3JAMU 3K2YA 3MR7A 2VPXB 3A8KA 5CABA 3NAIA 3VZIA 1KNZA 3OTDA 5A8WB 2WBMA 3G8TA 5B08A 1K8AT 1NDLA 3OR2A 2Q6CA 3AJ1A 5C24A 2J9DE 4DPYA 4PG5A 5ETLA 5JMNA 1X5TA 2AX0A 4NEYA 4RZRA 2HEKA 2AZ3A 4YHHJ 2FZGB 1YIJS 3ISZA 3M2UB 3C6UB 4DJBA 1JXEA 3PX4A 1N33J 4Z7CA 1K44A 1TL1A 3QRQA 1JK9B 4P6QA 3HVAA 4OYXA 2IPOB 3ZNJ1 4Q8EA 1N34J 2W8LA 4QU6A 2CQCA 2IJFA 1IBMJ 4CNYA 5K14A 2OAUA 4ZCMA 2R8GA 2YQ1A 1TAUA 4F50A 1Q81T 3DRPB 5IM0A 1TK0A 2ZBRA 1SJRA 3IG1A 2YNFA 1EB0A 1L3TA 4CTAB 1BQMB 1AUDA 1RISA 2DY9A 2YVSA 5T41A 3CC4S 2NYIA 3OUYA 1KONA 4DV2J 1ZPVA 2LLZA 4EO8A 1WDTA 2ADBA 3NBPB 2C2DA 5RUBA 1WC4A 1FWKA 1QDUB 1MWQA 4JB8B 1NK4A 5D3GA 4JV2A 4ANDA 1GMUA 4RL1A 1FRJA 2GFFA 1LWCB 4CLYA 4MIWA 3G4SS 4YQWA 2YKNB 2HG4A 3VAMA 1PC5A 3K8WA 1U1RA 1JLAB 1KFDA 1U2FA 3W9HA 2ZNZA 1NKEA 4DN9A 2MZSA 2J8SA 2YWFA 3Q8VA 4ANEA 1PIEA 3DU5A 4RNMA 3PNIA 3I9ZA 3Q23A 3NGKA 3KK1A 1QAYA 3IAM9 5DDPC 3I5BA 3ZZYA 1UVIA 2HQFA 3P96A 2BOPA 1O5JA 4OI1A 1DLOA 2VG6A 1WG1A 3TQEA 4C0BA 4JP8A 2E9RX 1P27B 2CQPA 3CCES 2W01A 4K0KJ 2OPRB 1GXLA 4ZP8A 3BO4A 4QWDA 4B3SF 2XI2A 2WHOA 1EKRA 2E1CA 2AGQA 1IR2A 5F8IA 4LRBA 5DDRC 4K4TA 2RE1A 1WSRA 1RWMB 5GAHI 1C2PA 5BYSA 3CJKB 3VVUA 1FRIA 3KLGA 3LPEA 2DGTA 3KDNA 2M0GB 2B4UA 1VC5A 4AXJA 5FDLA 3R3TA 1NPKA 3UVJB 3EYZA 2C2NA 4F3OA 4EGLA 4MIAA 4MKAA 1KC8T 2HHPA 2AYBA 4U96A 2HGLA 4F4YA 4X65J 1Y3KA 3A13A 4DV0F 5IWAJ 3MM8A 3FMBA 2ZUGA 2CZ4A 1VBKA 3FQLA 1G4CA 1U49A 1UWBA 4DL3A 3TX0A 4Y3CA 1VQYA 2VBYA 3GSIA 4JYAJ 5HMZA 2PEHA 5GMDA 4QJVA 2IVFB 3H90A 1T03A 1R89A 3LWMA 5KAKA 5HN0A 3CDUA 1HPZB 4GKJJ 4NCGA 5CCLA 4RNOA 4DX6A 2ZOMA 1XMQJ 4DX5A 2H4WB 3OBIA 2OMLA 3D0HE 1EP4B 4V19J 2YTCA 1NSAA 3R7BB 2NUHA 1R7IA 4NLYA 3LW5C 5B0CA 4LFCJ 2HNDB 3DLJA 4FF2A 4WK3A 2JFDA 2DTJA 2LEPA 4K8RA 4CDIA 2VONA 1C4CA 1VLOA 1X4DA 4X2BA 2JNJA 3RRKA 3SYZA 4LF4F 3T6BA 1MROB 1NDPA 3TW0A 2AKWB 2Y8YA 1VFJA 3FFIA 3B4DA 3IA0A 2R8HA 2MGZA 3FGVA 1IKVB 3LUYA 3IRWP 3A4TA 3K5LA 3QT6A 2GC8A 2E9ZA 3QO9A 2GMJA 4BC7A 1KQKA 2IDLA 1HBMB 3EGZA 2FZCB 3OTOF 2XMUA 5AXKA 1UAWA 5H9EJ 1SC1B 3IXQA 2VFTA 1MMNA 5DGBA 1RJJA 4LBHA 4N77A 3DI6B 2YY3A 2SXLA 3A8EA 1UJ4A 3IS9A 4EZ6A 2DR6A 1DY3A 2VPYB 1U45A 1HIYA 4P2SA 2R7TA 5F8JA 2XO6A 1H0HB 3DGPA 2BJ7A 5DLFA 4LMZA 3PFOA 3TAPA 1YX2A 5ETKA 3MMCB 2AF6A 5EHHA 1PYSB 3KUGA 1YTYA 3R5CA 5LMUF 1FRLA 2FJWA 3I0RA 1FE0A 2ZBPA 4TYBA 4B9TA 1YJVA 4ED0A 3GR1A 1U1LA 2AU0A 3VAHA 2MXYA 4CLZA 1PAEX 3MEEB 2HVZA 1FNOA 3QSYB 5C42A 3FEXB 1OQ3A 2J7WA 2DHSA 3SQOP 4K5SA 2XYPB 1G1XA 1SJFA 5HMWA 2UUBF 3CJ8A 3KLFB 1MMDA 4PR6A 4ES1A 5HROB 2VG7B 3T5LA 4ZVSB 3LH2S 3GV7B 4KJIA 4KIAA 4L6V3 3MD1A 4B02A 3M8SA 3TI0A 2D7SA 4NPOA 4C0OC 2GHWA 3HXMA 3B6BA 2QLXA 1YJWS 1FCAA 3T1YF 1QY7A 4X4PA 1KRPA 4FVMA 2XC9A 4ZITA 4UW2A 3OR1B 2PO4A 1S4FA 3DOKB 2R7VA 1ELOA 4N7TA 2ASYA 4HEA9 2BKPA 2RUSA 4G1PA 4UOGA 2DKOB 3MPDA 1MU2B 2FLNA 5IQQA 3MM6B 5IV3A 2UXBJ 5DS7A 1I1GA 5KT5A 2HQGA 1T05B 4OI0A 3N28A 2HZVA 3BSNA 4IH6A 1F1BB 1YITS 1NHUA 4K4VA 5D77A 4DV1J 2CG8A 1UPMB 3HHNB 1HWUA 1AZSA 2QLBB 2HWHA 3FQKA 2UV8G 3UN3A 2ATCB 3RW6A 4ZVEA 2ZUAA 3M32B 2XSFA 2JJ4D 2DBBA 3I82A 1FKOA 1X4BA 4B9SA 2EFOA 2NCKL 4DHVA 4KGMA 3MDFA 1WKJA 2Y1JA 4DN0A 3A12A 4LRAA 1RU2A 5E41A 4F0KA 3Q2TC 3HM9A 4V1Ak 2ZC4A 1CLFA 5G4DA 4URSA 4UQTA 1LV5A 2PC6A 4DWIA 5H9FJ 4NCBA 4XO0A 2M2BA 1WOSA 5L46A 1S1VA 5B09A 3GR0A 4DOZA 3M1VB 1Q5YA 1FRXA 1U2RA 3BGOP 4IOAQ 1SBRA 5FLXY 2NSCA 4NXMF 4DR7J 2HIQA 3MR3A 2R9LA 1FNMA 1VC6A 2FTRA 1WKKA 2CJAA 1U0HB 3BJYA 4WFAQ 1RTDB 1AUSL 2I9SA 1DTQA 3FCHA 2P5VA 2CJQA 3WIUA 1IBLJ 3LP1B 2QMXA 3G87A 2WW4A 4MYTA 4LRCA 2B9XA 2ALZA 5LL6d 1S76D 2BW7A 3EMTA 4ZHRA 1S1UB 2OELA 4KHMA 4F8RA 1U2CA 4LF5F 4CO1A 1RHMB 3DRSB 3KG4A 2CA9A 1K0VA 2HGNA 3A8IA 3HSGA 2HNYB 4P7VA 3LF0A 4J9SA 3W9IA 2VA2A 2IDEA 3EWGA 4NZ0A 2AEFA 5J2NB 3UFCX 3QT5A 2IYGA 1X4CA 3UI3A 3ZZUA 1YJTA 2ZD1A 1Q79A 4YY3J 1S6OA 2HBQB 4AL5A 4DX8H 5DGAA 3L09A 3W2WA 4ZJOA 1H7XA 3UN5A 3GIMA 4DR6J 4JI6J 3D4JA 1KFSA 2K3IA 2VU5A 4Z37A 2W4CA 1R0AB 3ETMA 1T9WA 4N76A 3W5XA 2E29A 2UZAA 1ZAXA 2LA4A 4YOEA 4H4OB 5DRKA 3RBXA 1YDLA 2N3LA 4NRUA 3GSDA 4FVCA 4ZN3A 4K4UA 3IGNA 3U1LA 1NJIT 4I2QA 4DR4F 1J5OA 3THVA 2YWEA 3PRDA 1OYDA 2PA8D 1KSPA 4F36A 4AD6A 2MQ8A 4RNFA 3K57A 3ICLA 1RT7A 2XWXA 4JI0F 1QAXA 1C1CB 4RNHA 3WC2A 5BR8J 1SL0A 3VGVA 1YRXA 3C46A 1HWKA 1ZZNA 5DM7Q 1RAHB 2P9GA 2FB0A 3DYAA 2K8GA 2Z57B 2DGUA 3PJ9A 2Y1LB 2J0WA 4C3MA 4USUA 4ELUA 3ENWA 1XMOF 3DRXA 2B5JA 3R5GA 1D3WA 4Y65A 1SKSA 5FIIA 4KGZB 4J37A 2Q6BA 5E33A 2KFYA 2GHVC 1FKAF 1T0TV 5C25A 4HI2A 1JJHA 3PJWA 3IR5B 4RUAA 3TANA 3V4MA 1ZAWA 4ZIVA 4KH0B 3ZO7A 4DEZA 4DPTA 3SQGB 1WG4A 1C1BA 2J7UA 2ZM6F 3DN9A 1BD6A 2VFUA 2QA4G 4QPXA 5IFMA 3TZWA 1FD2A 1JXVA 4DV5J 1CJTA 2N82B 5IC6B 1WOPA 4RUHA 3TJ9A 3GE9A 1HWJA 4DQRA 1B0TA 1BUXA 4F26A 3EDRB 4PABA 4PYAA 4CLSA 2RRBA 1S12A 1I51B 2HBRB 5K8PA 2R2UA 1T8EA 4I6YA 4E0DA 2VQEF 2O67A 2C2RA 1FNXH 2XO7A 2W9BB 3AA9A 2O5DA 1REVB 5CCMA 1OSCA 2HHQA 2LDYA 2J7KA 2OEJA 3BSCA 1N6QB 4KPCA 5ETSA 3OSPA 4LVOP 2XZDB 1H38A 3TEHB 2DJWA 1FD8A 3SI8A 3W2VA 1VQ6S 3JB9k 1AW0A 4H4MB 2DIVA 3VCDA 4DR1F 4NLUA 4WP8A 2VODA 5K20B 5A8KB 4GC7A 4LUBA 3PW2A 4NMXA 2J6TA 2DNMA 3PHTA 5K9FA 1O51A 3D68A 3RYLA 1FFGB 1R8AA 1H72C 5KG0A 3FUYA 2A2CA 5A0YB 1R27B 2LQJA 3CD6S 3HVTA 2X1AA 2HFVA 1GTEA 4PAAA 1MN9A 4DZDA 1RAFB 3RBZA 1RKIA 3MUTP 5EX0A 2XSJB 1U7LA 4NLDA 2C2EA 3BGFA 4YFUA 1HI1A 4ICLB 3EVOA 1FJCA 4TY8B 3EXYA 3U1MA 3VF0B 3GV5B 2RS8A 1YRUA 4HTJA 1FKPA 1HYSA 3DFEA 4ZN1A 2MJUA 4C3KA 2UU9F 3F41A 3M9OB 3GCWP 4DSEA 1HQEA 2E7WA 3C6TB 2ZNYA 1FFSB 1G3OA 2NZ4A 4ECZA 1KP6A 3B8HA 4S0MA 1NMEB 1FJGJ 4AL7A 1IM6A 2JC1A 5KFQA 2UUWA 2I6WA 2RT3A 4WWSA 1G2EA 3ISND 4KKOB 2DY1A 3P4UB 1Q82T 3LP2A 3DU6A 3JAMY 1YK9A 1RSCA 3A3PB 1A0OB 4C8ZA 2E5HA 3TEGA 4CT9A 4HTIA 4UF4A 2RKIB 3Q0AA 3DLEA 1S7IA 4ECQA 3PVXA 2XS5A 2JX2A 4NLGA 4NOHA 4YS2A 2JHEA 3G8SA 3LGNA 1S6PB 1TQLA 2LFVA 4BC9A 3KLHA 1N32J 1SJ4P 1BMQB 5KFHA 3UW1A 1RTHB 5AT1B 2AZ1A 3CJ3A 4DFKA 3UD4P 4U67Q 5A6PA 2V63A 3NS5A 2LDIA 2WK4A 2B51A 2V4JA 3KDOA 3G86A 3J7ZT 1UTAA 4DV4J 3M8YA 5IQ6A 2HRTA 4NMLA 1UVKA 1NHKL 3ITHB 2IA0A 3C8YA 4JI5F 4PRFA 4JV5F 5HBMA 3DLLQ 4XIUA 2Q79A 3P5BP 2MZRA 1LEOA 1RWNB 3FSXA 1U1MA 3PHEA 3J7AN 1Q7LB 4WYWA 2F5GA 3T9NA 3B78A 4HI1A 2DXFA 2ZWOA 3R7SB 2RRNA 3OR2B 3U7JA 4ZMMA 4OYPA 1CSJA 1UVNA 5C24B 2VASA 4OYIA 4DV6F 1X9WA 3GG0A 3MTJA 4KRWA 4J9QA 3GFXA 1HA1A 1UPPA 7FD1A 2G13A 5H9EK 3MCOA 4DL2A 1TL1B 1T7PA 1N36F 2BJ3A 2K06A 1MWYA 5HP1A 3THTA 3OHBA 4DPOA 1SL1A 4O0IA 1RADB 2UXDF 4CLTA 1NLKL 1OIAA 3AA8A 5K14B 2XLKA 2DNQA 4K5RA 4D3GA 1EX8A 1GT8A 3VAFA 5IM0B 2YXLA 3ZTOA 2GVDA 5D15A 1K0TA 2D3UA 3IG1B 2YNFB 3QIDA 1XR5A 4URQU 5KFCA 4P7TA 3OUYB 4F4WA 3ZZTA 3GJRB 1I3OB 4WZQA 1AXQA 4OYMA 2NLWA 2JLGA 5B7WA 3N5BA 4H4KC 1PGZA 3JYTA 2YNHA 2W2QP 3TA1A 1LK5A 5L9XA 3SXLA 5D78A 2D3O1 2K2PA 2W1BA 4MK7A 1RAOA 2YX7A 2ZH5A 2VFRA 3MEGA 2NXNA 4HH1A 3MUVP 1WC5A 4OX6A 2V2VA 5ETTA 1FF2A 4ECYA 2CJXB 2JLFA 4Z2XA 5FJ4A 1S79A 4RR5A 3NCQA 1QSSA 3HHDA 2A6MA 3M9MB 1FX4A 4C0HA 4WZMA 4NYOA 3ILIA 1F2GA 4WP3A 1IWGA 4PG4A 3BBCA 3GJTB 1U26A 2DO0A 5T14A 1HHTP 3AB4B 3M4XA 4ZPWR 5A2QU 2XLIA 5AXNA 4XTTA 2AQ4A 4ID8A 1YQHA 3FCWA 3H25A 4CYUA 4B3SJ 2RUGA 4DXLA 3KK1B 2RAQA 1HFEL 3D9BA 3BF4A 3NNAA 3L4BC 3C15A 2JZ5A 3EM1A 2VG6B 1NJYA 5DETA 1RTJA 1VHIA 2L9DA 1R8PA 3BO3A 3UD3P 1JLGB 4QCLA 2WVDA 3MWBA 3OSNA 2P8IA 2XNQA 1QD1A 1KLMA 2OD4A 4OZ2A 1KS2A 4CH1A 4ES2A 3CJ4A 5LMNF 5G0RA 1P9QC 1VQ9S 4Y2CA 3TA0A 1D09B 1UETA 1PG5B 4ZPVR 1ZYQA 1ZTTA 4DV0J 1TP7A 5J1NA 1FVSA 4FYWB 1GK8A 1U8SA 4O4RA 4F25A 4J9MA 2HS3A 2FVSA 5FDLB 3IGVA 2VV5A 1EQ0A 2MKJA 4LSLB 1H98A 1GXTA 2A10A 4NLQA 2W9AA 2RF2A 2KVIA 1RYSA 1N34F 1TUWA 2J0QD 3KMQA 5CZXA 5H9FK 1VQNS 3MCNA 1VS3A 3MM8B 2E66A 4Q8FA 1Q0NA 1A9NB 1UWBB 1VQSA 1WORA 2MMYA 1CJVA 2DH9A 2BQRA 1RHKB 2LXIA 4X4QA 2XB2D 3M8RA 2HKEA 1TUVA 3RBEA 1T03B 3DDNA 2FHJA 2HZAA 1HW9A 4FXDA 2W7PA 4NCGB 2BVZA 2DNNA 4WFZA 4RU9A 3G6ES 3WHIA 1S9GA 4A47A 4RU2A 1FXLA 3Q24A 3V6HA 4DL7A 3TZYA 2Z2MA 4JI3F 2EFQA 5J2PA 2ROEA 1WEZA 4IFYA 1URRA 3EGWB 1KLNA 4U7UD 5CH7B 5IV4A 2BXJA 4HYKA 5KFZA 4ILMA 4LF4J 1QAIA 1SL2A 4DBQA 3HFZB 3VAKA 1V3SA 3TOQA 2ZOFA 2IC3A 1LWEA 3FVYA 4OZ1A 3KK3A 3IBFB 3PYFA 3UDEA 1HR0J 3W5YA 4HACA 2DITA 3RGIA 3FFIB 3OTOJ 2QYCA 3PACA 1N5VA 2BJ9A 4ITSA 1A7GE 2XGPA 3CMAS 2L41A 3QZ7A 2A1BA 3M8PA 5HMXA 3D3BJ 3EPGA 4DFJA 1K73T 1NB7A 1XNRF 8RUCA 4NLRA 3D5MA 3QO9B 4PXCA 4M63A 3THPA 3PYGA 2IRYA 3PW4A 4A4JA 1SQGA 3MF5A 1JJCB 3F0NA 3QQCD 3PX6A 5I3UA 2A0FB 5E7OB 5LMUJ 3IS9B 3I9V9 5K8MA 5HANA 2ZZMA 2W2OP 1PCAA 2DPIA 4B3OA 2BANA 4E2FB 4AXIA 3BO2A 3DGPB 1O0PA 4IFVA 3ENAA 3CO0P 3KYLA 1VISA 1VRUB 2V8DA 5B0GA 9ATCB 3VVTA 1FTRA 2RSQA 3I0RB 3RBDA 3OLBA 1RHJB 4Q45A 3R7NB 3BPDA 3QT8A 2UUBJ 1WF1A 3BSOA 2IJNA 2PFDA 1CJUA 5HMYA 5B0DA 4DL4A 4EO6A 4FZVA 3IRXA 1AFIA 5C42B 4YB5A 1D9AA 1U1KA 1AT1B 4OL8A 3CCSS 2Z2YB 1VR6A 3P5TL 3PM9A 2D3ZA 4I6AA 3T1YJ 2PIIA 1XMQF 4Q43A 2QL9B 2DHAA 3SSQA 4IRDA 3S7RA 1GFWB 5KFMA 2R7XA 4B3RF 4GO5X 1VHFA 3LPYA 4TKTA 1BHNA 4EFAC 3TQ1A 4UZBA 2OI2A 1BLUA 1R8CA 4MAKA 2MQLA 2R7SA 1UJ5A 1DJ0A 1SVDA 2KN4A 4LIRA 2WOMA 2MKHA 4IQXA 2GIRA 3CUNA 1NJWA 3PX0A 2VFVA 2DNRA 3ONQA 2F40A 3MM9A 4OYOA 3NGUA 2FHOB 4HVZA 4ECXA 2AJQA 2DR9A 1ZA1B 1U0SA 4P52A 2MKCA 2FC9A 3JQMA 2AEJA 4FBTA 1VCTA 2CPJA 3TZZA 3S8SA 2VOOA 2Q3PA 3R5AA 4EBCA 2JEFA 1WDDA 1LOUA 1E6YA 2JLEA 4CLWA 1RT5A 4AE5A 2BMBA 5KG1A 2HLUA 2WSCC 3BYPA 4WF9Q 3MMAB 1HMVA 1P8GA 3QLHA 4A8YA 1AZSB 4Q2LA 2ZJQQ 1C4AA 3W8GA 4ETXA 2H3EB 1RE1B 1F60B 3P8BB 3KTQA 5IOLA 2WSEC 1FKOB 2NS1B 1KBRA 2RJZA 2VF3A 2N4DA 3K5MA 5LXRA 2D3OR 2ZBCA 4OHXA 1GEHA 1HARA 2PFFB 1O8BA 2HS0A 2HNZA 4ID5A 4NXMJ 4HT7A 1S9FA 5F3ZA 4DV7F 5CHCB 3G2XA 4WYLA 2OTLS 2YQ3A 3EGVA 2X51A 2NQPA 1Q5VA 1ZPWX 2XGQA 1S1VB 3OW2R 2XMAA 1MSWD 4A8SA 2W2MP 2UUTA 2Q1LA 3EDQB 2JVOA 4CI0B 3NWRA 1V9OA 3V6JA 4ZLPA 2ZWPA 1OO0B 1RAAB 5CD4A 1V5IB 9RUBA 3E8OA 1UA1A 3KWMA 1FTCA 1DTQB 1S1WA 4LF5J 2B7CB 2VG5A 3DRRA 4USIA 4MK8A 4OJHA 2KJWA 4WTOB 2FD2A 1VQOS 3M30B 2C42A 3UNGC 3KFWX 2KKHA 2OSRA 1NK8A 4ZHRB 3GPAA 4M5JA 3E2EA 4M5NA 3HHEA 3DOMA 4UY85 1GX6A 1GMWD 2VA3A 3CCZA 3CDAA 1M5SA 1U09A 5KFFA 3D6MB 3RRHA 1RBOB 1IBCB 4MH8A 3CXCR 4XK8C 2ZVIA 2KTQA 2BRLA 1F2HA 2I0XA 1HD1A 2WB1D 3HHLD 2HRUA 1E6VA 1SV5A 3H4BA 3V6DA 2GO8A 3RU0A 4XPEA 3GZ7A 1S6UA 4LF7F 5KFIA 2FLOA 3PIOQ 4WK1A 3W62A 1QE1A 1WC6A 2ZD1B 4ZCLA 4C6AA 1P6TA 2H5JB 4OHYA 2UXCF 1UP1A 3GYGA 2HQIA 5EN1A 4OZ0A 2MQNA 3R1HA 2YKPA 4M94A 3FZ2A 5ETOA 5GAHU 1TZ0A 4WPAA 2Y8WA 2J5AA 1H74A 4YN3B 4P71A 5J2MA 2HK2A 1Q1KA 1NK5A 3UCZP 2HZCA 2XEXA 3EZ5A 2RQCA 3L9ZA 4OMFG 4DR4J 3TARA 2ROGA 2HQCA 3MM5A 3WDOA 4NXNF 1RUSA 1HWIA 3SV3A 1TVRA 1B64A 4EI2A 2GNKA 4QW9A 3W61A 4JI0J 2LA6A 1RWUA 1ZM2A 3POTA 4NL5A 4NI2B 2G2OA 3SBMA 4KY3A 3MCSA 3F73A 4I2QB 1Y3JA 4N5SA 4TQRA 4RJVA 1J5OB 4JI1F 4WE1A 3LGMA 5H1SV 3G82A 1RT7B 4U6PA 3HI9A 4KO0B 1X0PA 2R7OA 2FPHX 2F63A 4DR3J 1VDHA 2MZTA 4PG6A 3AODA 1PBUA 3W8PA 2F9JA 1XMOJ 4WU2A 4DR7F 3WIVA 5D8HB 2J8AA 4DU8A 2IMWP 3B54A 2K1RA 3TAMA 3DYAB 3Q86A 1BQNA 4IOBA 2DCUB 2YNIA 4QR0A 2CQ2A 4IO9Q 5HSPA 2B5JB 3FMWA 4ZVUB 3QIPA 2ZBIA 1JLQA 2ZM6J 3VTIA 2H48B 2VFSA 3CJRA 2Y0BB 3NP5A 2ATLA 3FZBA 5F9LA 1HHQA 3NNCA 1TU0B 2MJNA 2MZQA 2GGPA 2XWYA 3IO1A 4UT4A 2JC0A 2XMKA 1RAEB 1C1BB 1FDDA 3GIIA 1CJTB 2VQEJ 4IH7A 2H54B 1JNZB 2FC8A 2U2FA 2HFNA 3D0GE 2VBXA 1RWPB 4F0MA 3VQSA 1YJUA 4F67A 3UDVA 3I5CA 4KGXB 1D8YA 2CFXA 2VPWB 1ICEB 4YY3F 1L3UA 1KQFB 4DR1J 2CRLA 1NNDA 2LXUA 3NMRA 3T5KA 2E1PA 3CT9A 1DURA 4USVA 4C8OA 3T9ZA 2IYIA 3AAWB 1VQLS 2KHCA 4MKVA 1HW8A 4ZS6A 3W2VB 2BW2A 5CZVA 2KI2A 4PPDA 3MAHA 4WXOA 2GVZA 2HAIA 3HT0A 3DLKA 4BHQA 4LT6A 4DG1A 2V4RA 1U6BA 2Y9HA 3HVTB 1VBXA 5BYQA 2DGXA 4P9SA 2PE8A 2QLWA 2BEFA 2RRAA 1N48A 2OIHA 2UU9J 2WW8A 1T94A 1H73A 3ZZOA 4C8YA 1HNIA 2ZH7A 2GX8A 3KHHA 1HNVB 1ZAVA 2E44A 4MJKA 4ZPDA 1PJ5A 4C97A 4HL9A 1HYSB 3SFUA 3J81U 4LSNB 3T1HF 3R5BA 1HQEB 3PTWA 1OSDA 5IT0A 3MOJB 2B8PA 2MSSA 3T41A 1V6HA 1F5CA 2MZ1A 2MKKA 5HK4A 3T6JA 2ZHOA 5F8LA 4CO2A 2AEMA 4YP3A 2JEIA 1K9MT 2OPSA 2H5IB 2EG2A 4L73A 4BBYA 1OWXA 4GRSA 4O44A 3K5NA 3FC9A 4P2FA 2JFKA 4FYDA 3LP2B 4WU3A 4LRFA 4IUFA 1VRTA 4ATNA 4LSZB 4Y6IA 4I1TA 1B0PA 3MURP 4DR2F 4ZA1A 4OLOA 3KK2A 4X4TA 4MFBA 3DLEB 4RW7B 4DUYF 1HQUA 3MR5A 2HAFA 3FDSA 2LMIA 3UQSA 4IOCQ 2DGVA 3OL7A 4XPCA 4DL6A 2ASLA 4JI5J 3KLHB 2OMOA 3BSAA 4LBPA 3HZGA 2HVDA 3OFGA 3JTOA 5E2QA 3H98A 1RWOB 2XMMA 4ZPBA 2VDIA 3PIPQ 2EC2A 1W26A 1XJWB 5HBMB 4WIQA 1Y4ZB 2MY8A 1H2UX 4DR5J 2W24A 1JIHA 4B9UA 5E3RA 2DRAA 2LQ9A 1FXDA 4O3RA 2MQQA 1RT4A 4DV6J 5LSRA 1KR4A 2MKIA 1Y7PA 2R8KA 5AJ3F 1X9SA 5GADI 4J9KA 4ZVHA 2E5GA 3EICA 1BGXT 1N36J 3PJXA 2W9CA 4RUBA 5B0EA 1Y11A 4NE9C 2UXDJ 4X4NA 1WC0A 6AT1B 2WB4A 2QFIA 1S5ZA 1JLCA 3HVRA 2FQQB 3HJVA 3K5PA 1Q78A 3ILJA 2OJ3A 1PYOB 3OVSA 4L3NA 2H5EA 4UZCA 4ECWA 2B7BB 1SPBP 1N52B 3KOAA 3NS7B 4PZVA 2GZOA 4OJGA 2PMWA 3O3LA 5K5MA 4F4ZA 4TLQA 1WG5A 1O6XA 3H2LA 3I4PA 2GVDB 2CNNB 1FJGF 3DHXA 4C2MA 4JI8F 1PYTA 2AJ4A 3L7PA 5I3PA 4QYZJ 3W63A 3PV8A 2YKOA 3HKZD 2F1FA 1X60A 2ZDPA 3PW5A 4J9LA 1WHYA 1SB6A 2OP5A 3BBBA 1UZDA 2CADA 4XAKA 2KHDA 3MEGB 2JDJA 2AX1A 1AFJA 3GLJA 1X4GA 3HJFA 4Y28C 2FHMA 2AJ1A 2MKYA 4J9VA 2W7AA 4FN5A 3ET6A 3RG6A 3JSRA 1YVFA 5L38A 2HMIB 3IM8A 2CQBA 1AYEA 1BWVA 4AUKA 2V4QA 3RAXA 4ZVRB 4UOCA 2B9EA 4DV4F 4RW4A 2F8MA 4FP9A 4WBFA 4NLPA 3BB5A 1ZM9A 3VWSA 2HRYA 1ZH5A 5IT9Y 4TY9A 2EVZA 1RAGB 3J7YI 5IC4B 2Z56B 4CYUB 1M1HA 4CH7A 2KM8C 2OPRA 2OSQA 4K4ZA 5LMNJ 3C16A 3C15B 4RWWA 3GCXP 1TK5A 1S97A 4DPWA 4XDDA 3SCIE 4LIWA 1RTJB 5L1LA 1KLMB 4A48A 1GAOA 3CJKA 3V6KA 3M6WA 4LJMA 4IRKA 3ETOA 1H2VZ 4WKRA 2V50A 3RB3A 2BUNA 1KVJA 4JV0A 2Y3YA 3OL9A 4LVNP 1T95A 3W64A 2E1MC 4DS4A 4R5PA 3PYDA 2JH3A 4YEAA 4ENOA 3H7HB 3GP9A 2DEJA 1U1PA 3RZAA 4B3TF 1RK8A 3N0VA 2JSXA 2YWHA 4LR9A 2RF2B 4ECVA 3AQOA 3DDIA 2VJVA 3V81A 5EWGA 2A6OA 5KFUA 4C7QA 2DVIA 4QWAA 2VQFF 1SJQA 2IM0A 3G6XA 3Q8PB 1CJVB 5DG7A 3OHAA 5I4MA 5ETPA 2RILA 2DNGA 3V4IA 4JI3J 3DLHA 3PDNA 1L5UA 4ED5A 2G9OA 4CM2A 3NS6A 2HBYB 4M5HA 2R7UA 1S9GB 1LFWA 2C3OA 2H4YB 1OPIA 3CCRS 1RXOB 5J2PB 4IFYB 4M5LA 1VC0A 2B43A 2L9WA 1UVMA 1YJ9S 7FDRA 2RQMA 4IH5A 2BKNA 4RW6A 2B56A 2JRSA 1WEXA 2CPZA 4CLPA 1TKXA 4F2SA 4QWEA 2BE2A 2OPQA 3HX9A 3IWLA 3CJ5A 1YGYA 3MGJA 4FNHA 1YHQS 3OFHA 1M5PC 4P10A 2IC3B 1LWEB 3D7SB 3QJLA 3MEKA 3SIPB 1FJ7A 1TTHB 2CVEA 1UWAA 2KB2A 3KK3B 1XNRJ 3TUZC 1IKWA 1G7CB 1IKXA 4RUCA 4HACB 4N56A 2QLFB 4DPXA 1ZS6A 1RT1B 3CIZA 5L1IA 3VAJA 2ZC3A 5KT3A 5C2GA 2OLWA 1YBUA 4A8MP 2DNPA 3GJSB 1X31C 1WELA 3M8PB 4HDHA 4DSJA 3PYEA 4FPRA 3DLBA 1HNXF 2O1PA 4F2RA 2HPUA 3EZOA 2LP4A 2H65B 4G65A 2GQ2A 2POKA 2IAJB 2VIHA 1F0XA 5E3PA 1SUQA 3W9JA 1QAJA 2QT7A 1S0OA 2BR0A 2CNKB 2RNEA 1M1GA 2DNHA
chains in the Genus database with same CATH topology
5KFWA 1K0TA 2D3UA 3IG1B 3I56S 2UVVA 3KMSA 2XCPA 1Q16B 2YNFB 3D1HA 2J9EA 5MLCV 3QIDA 1ULRA 2CZVC 2XS2A 4OX7A 5I3UB 3O8WA 3GILA 1XR5A 3RAQA 4URQU 5KFCA 4WCEQ 4ED2A 5JVGQ 4P7TA 4FBUA 2GA7A 3DXBA 1T3OA 3OUYB 3JTPA 1Q7YT 1DQAA 5HO4A 4F4WA 3ZZTA 4I7FA 3VR1A 2NPFA 4WZQA 1AXQA 3BQ1A 2NLWA 4RW9B 4MKBA 3I55S 2JLGA 1EETA 2BANB 5B7WA 2KXNB 4DV5F 2Z0GA 3OL6A 2VB6A 4R8UB 2C3MA 5BJRA 2W9BA 4PWDA 3N5BA 4KPYA 4PUOA 5SZTA 4IFVB 4OIXA 1C0UA 1REVA 2B3TB 3BR9A 4H4KC 2BQ3A 2HHXA 1QM9A 2BYCA 3D2WA 2GHPA 1PGZA 1RP5A 3MMBB 3JYTA 2M88A 2V8GA 3G6VA 3VAIA 2YNHA 1SI9A 1KVIA 1S48A 4HDGA 3TA1A 4CQ1A 4EYIB 1LK5A 3NGDA 1RT6B 2B6AA 3T1AA 3MR2A 3LWLA 1TFWA 3AHPA 5L9XA 4X4VA 3O2IA 2XY7A 1N6QA 3TA2A 3J80Y 3G71S 3BR8A 3SXLA 5D78A 2K2PA 3D1QA 5A8RB 1KN6A 2ZE2A 4MK7A 4NLXA 2K3KA 3L3CA 2YX7A 2ZH5A 2VFRA 3MEGA 3QPIA 1WNEA 5HLFB 3GV8B 4HH1A 1NJZA 3VZHA 3GYNA 4WFNQ 3CC2S 1R8HA 3MPYA 3MUVP 1IN0A 3PEHA 4OX6A 4QIEA 3UCUP 2F7VA 5I42A 1TR0A 1FF2A 3OJUA 1SH2A 4H4MA 4ECYA 2DT9A 4Q44A 5M2RA 4HT5A 2CPEA 4MYUA 2JLFA 4Z2XA 1Z2LA 2DGOA 5DM6Q 1QTMA 5FJ4A 1S79A 2C3YA 5A8KA 2ZVSA 3NCQA 3MOZA 6FDRA 3CO9A 4DQQA 1RDRA 1QSSA 3LOUA 3IRXB 2MB0B 2UVRA 4O3SA 3EXCX 3HHDA 2Y1IA 4KO0A 3M9MB 5FD1A 3O1LA 4C8LA 2QFJA 2YKMB 3RB6A 1U1QA 3RAMA 2LECA 1B7FA 5E5NA 2ERRA 3D28A 3CCTA 3U02A 4C0HA 5CQGA 4WZMA 3MM7A 1FK9B 2QV6A 4NYOA 5GVQA 1DFDA 1F2GA 1JWWA 2KM8B 4PG4A 2X1FA 2HFOA 3MAQA 1YBAA 1JLBB 5KFEA 1U26A 2DO0A 3IWNC 2IM1A 3U1NA 5T14A 1HHTP 1M0SA 3AB4B 3AQPA 3M4XA 4ZPWR 2KO1A 1IBKF 2XLIA 2XSJA 4WFXA 3MECA 3MMJA 3WX4A 4O4GA 4O3OA 1VBYA 2MZJA 5AXNA 4RX6A 3TVKA 3MTKA 2AQ4A 4ID8A 1YQHA 4X84A 4ZPAA 1FA0A 3HHLC 3H25A 2RUGA 4BWJA 4DSFA 3RB0A 3KK1B 3JSMB 4ICLA 1CVJA 1HFEL 3BF4A 3MFHA 2AYGA 5CYMA 3NNAA 2R7WA 3SDEA 4QWBA 4TY8A 1VQ5S 4OHVA 5F0WA 4F3QA 2JZ5A 2OFHX 2HWIA 4EU0A 3WZ0A 3OJSA 5T7LB 3NL0A 2VG6B 3ENVA 1VBZA 1KQSR 5EGYA 1NJYA 5DETA 1RTJA 3UDLA 1U6ZA 4F4XA 1FDAA 4FS2A 2L9DA 1R8PA 4PXEA 1X5PA 3BO3A 3UD3P 1JLGB 1MU2A 4QCLA 3HMJG 2WOMB 4Y2KA 3MWBA 4G6VB 4TNOA 3ULHA 3OSNA 1RYRA 2XNQA 1HBNB 2KT2A 2OO4A 3UE2A 4TN2A 1KLMA 3C6TA 1JLFA 4ZK7M 2OD4A 5KG4A 4F4KA 1D9DA 1KS2A 2Y1RI 3KNGA 3R5DA 4CH1A 1FESA 3M6XA 4ES2A 1NU4A 3CJ4A 1Y5LB 2NSBA 5LMNF 3MM9B 1CQMA 3I0SB 4DS5A 3BDPA 5G0RA 1P9QC 3TYTA 5CYJA 4KR0B 4ZVGA 1VQ9S 2XHWA 4Y2CA 2D9PA 3QAEA 4FNIA 3TA0A 1UETA 4J5OA 2UUCF 1HR0F 1XERA 1AROP 4ZPVR 3EZUA 4KKOA 1ZTTA 1ZYQA 1TP7A 5J1NA 1FVSA 3E3XA 3PW7A 1BC6A 1IR0A 1U8SA 4NA3A 4O4RA 1HBOB 4F25A 3AY0A 2XCAA 1W2BR 2YKAA 2CQGA 4J9MA 2DGSA 2HS3A 2FVSA 3OFEA 5FDLB 3IGVA 3FSIA 2VV5A 2KZMA 3EGNA 4ILRA 4MIBA 4TU8A 3P49B 4W90B 3PR4A 1IUJA 2MKJA 4H4KA 4KBIA 2GJ2A 4U7UK 2OPSB 1RT5B 1JNRB 4LSLB 2FJDB 1H98A 2R4FA 3WBZA 5J2QA 1GXTA 1JKHA 2A10A 3KG1A 2J9CA 4NLQA 2HHSA 2W9AA 2OFGX 1DBDA 2CDQA 2RF2A 4IDKA 2KVIA 2RKIA 4RWXA 1RYSA 5A2QY 3FEZA 3RR8A 4TYAA 1N34F 1HMVB 1D8ZA 2RDIA 1YI2S 2KZZA 3QLHB 4Y2AA 2J0QD 2HQ3A 1UJ6A 3W2WB 1H7WA 1L3SA 3KMQA 3L95X 5CZXA 3UDCA 4NA2A 3MPVA 4I68A 2FY1A 1M5OC 1VQNS 4JBCA 2FVCA 2C22A 5DQGA 4Q0BB 2V8VA 5AXMA 1VS3A 3MM8B 3CC7S 1FRKA 3HFKA 4A8WA 2E66A 4Q8FA 2LEBA 4JI4F 3LAMA 1A9NB 3KHRA 1HNZF 4K59A 1UWBB 1NK6A 1VQSA 2MMYA 4MFBB 1S6PA 4B9VA 4NZ6A 4OZNA 2PT0A 1QVGR 3LANA 1TKTA 2DH9A 1RTHA 2IRUA 4ZPCA 2FLPA 2WRMA 1IKYB 1L3VA 2BQRA 2W25A 3AJ2A 2RVJA 3CDWA 4QZVB 1S7HA 2BV3A 2KG1A 3H4DA 1VQPS 2HVIA 2LXIA 4JI7F 4QIFA 4X4QA 4X4SA 2KFZA 2DGQA 2AJFE 2BQUA 2HNZB 4ID5B 5IZHA 2XB2D 1IQTA 3M8RA 1TUVA 3RBEA 2CQIA 5D6GA 3UR3C 5DO2A 2VC1A 3DDNA 2FHJA 5MAOA 1LWFB 4U9RA 1T03B 2IBKA 3H5YA 1HW9A 1S0MA 1FT8A 4CO0A 4FXDA 4A8FA 2W7PA 4NCGB 3H5XA 4O3PA 1YRTA 2BVZA 2DNNA 4WFZA 3ITHA 4RU9A 3DHWC 3CTRA 3G6ES 5M2UA 4RU2A 1S9GA 4A47A 5JJBA 1FXLA 1N32F 1R31A 3Q24A 2HS4A 3V6HA 4DL7A 4ED6A 4IG0A 3JSYA 2A2DA 4Y00A 2Z2MA 4KSEB 5KG6A 5C5JA 2YH1A 4JI3F 2E5IA 3DMJB 4I64A 2EFQA 1HHSA 3NLCA 5J2PA 2ROEA 2M5YA 2CPYA 1WEZA 4DFMA 4IFYA 1URRA 3K2YA 2Z2LA 1CG2A 2DB1A 3EGWB 4EBEA 1KLNA 4KV8B 3KLIA 2BXJA 5CH7B 1W2IA 3O5TB 2M3DA 4HYKA 4QQBA 5KFZA 2NREA 2VPXB 3E01A 4ILMA 3NAIA 2M52A 2MHNA 2QA1A 5HL7Q 4YDDB 2PA3A 3PRBA 3VZIA 1QAIA 3NCPA 1SL2A 4DBQA 2R2RA 2VL1A 4USJC 1KNZA 3OTDA 5A8WB 4UUXA 1UVLA 2WBMA 2KDOA 2I5JB 3G8TA 2EW9A 5B08A 3CD0A 1K8AT 1S1WB 3OR2A 2Q6CA 3AJ1A 3DRRB 3VAKA 2BRKA 4RBUA 1V3SA 3TOQA 2ZOFA 2ILYA 1FJEB 2IC3A 4Y0FA 1LWEA 4NWBA 5C24A 2J9DE 4ECRA 3FVYA 4PG5A 2GV1A 1RT3A 5KFDA 1HNVA 4YMEA 4OZ1A 2UVUA 3RR7A 1X5TA 3KK3A 2AX0A 5AE1A 4RZRA 5A6WA 3OTCA 1YIJS 3EPIA 2YNGA 3ISZA 1W25A 2DITA 3M2UB 3C6UB 4DJBA 4LSNA 1JXEA 4LFBF 5IS2A 3PX4A 4E8UA 2NPIA 3NNHA 2OH2A 3FFIB 2QYCA 1XEZA 2K7KA 2FVQA 1TL1A 3PACA 3MUMP 4IKAA 1N5VA 1TAQA 4ITSA 1A7GE 2XGPA 3CMAS 3Q22A 2L41A 3MXHP 3BDEA 2FLLA 1JK9B 3N79A 3QZ7A 1UVJA 2A1BA