2D3OR

Structure of ribosome binding domain of the trigger factor on the 50s ribosomal subunit from d. radiodurans
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title The Binding Mode of the Trigger Factor on the Ribosome: Implications for Protein Folding and SRP Interaction
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Ribosome
total genus 7
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2d3oR00
2N3LA 4YUDA 5IM0B 1SJFA 4U67Q 5DDOC 2KG0A 3PIPQ 2M8DB 2EK6A 3UCZP 3UD3P 4BS2A 1IQTA 1U6FA 4A8XA 4ZKAA 4UY8T 1SJQA 4IUFA 5JVHQ 2CQ3A 3ULHA 2ADBA 4CH1A 1X5OA 1ZH5A 1FO1A 1URNA 2CPXA 1R8HA 4IO9Q 1DRZA 4FXWA 3CCLS 5HL7Q 3VAIA 1WELA 2RU3A 1Q7YT 2QFJA 3BO2A 2I38A 2KYXA 1DBDA 3VAKA 3H2VE 1VBZA 3VF0B 2E5JA 2M9KA 5DM6Q 4TU7A 1VQ9S 2DISA 1A9NB 1X5TA 3I56S 2DIVA 2MJUA 1PGZA 2LKZA 2YWKA 2XS5A 1BY9A 2RRAA 2M4MA 1WI8A 1HD0A 2CPYA 4Y00A 1DZ5A 3ZZYA 2CQIA 3LPYA 2GO9A 3CMAS 5D77A 2QA4S 5CA5A 2Q79A 2FY1A 3HHNB 2MKHA 2RS8A 2BOPA 2DNLA 1KD1T 3UWTA 1FXLA 1KQSR 2YTCA 2DGSA 5HO4A 2LXIA 2XSFA 2QEXS 2VONA 3NNAA 1D8ZA 2YH0A 3MUTP 1YTYA 3UE2A 1NO8A 3S01A 2PEHA 2MXYA 1K9MT 2XS7A 3DXBA 2XNQA 1Q82T 1YI2S 4QU7A 2M52A 2J8AA 2MZSA 5IFMA 3J7ZT 4F02A 1K8AT 1U1QA 1AUDA 2M8HA 3BO4A 3N9UC 2LQ5A 1WWHA 2DNMA 1P1TA 3DLLQ 3EGZA 3Q2TC 2XS2A 2RRBA 2CQCA 3CF5Q 2LXUA 1H6KX 1U1NA 2LA6A 1U1LA 2HGMA 3MUMP 2KI2A 1HD1A 1FHTA 2MZRA 1VC0A 1SJ4P 1WG5A 1YIJS 3CULA 2CPIA 4F25A 1VQ6S 2D3OR 4OZ1A 2RT3A 1WHYA 4P6QA 2M70A 1YJNS 2MZ1A 2U1AA 5GADU 4RU2A 1CVJA 1WI6A 1X5SA 3CC4S 2OIHA 2RQ4A 5FJ4A 1VQ4S 2OJ3A 4QQBA 4WF9Q 5LSLA 2K8GA 2MHNA 2CPDA 3NNHA 1X4CA 2DNQA 2D9OA 1S79A 2AYGA 4EGLA 1FT8A 1R8PA 3MD1A 2VOOA 3R1LA 3I55S 1WEZA 2X1BA 1VQNS 2DNYA 2MQNA 2KXHA 2CJKA 2DITA 5DM7Q 1DHMA 4C7QA 5GMKa 2L08A 2DNGA 2KRBA 1JJ2R 1VQ5S 4W92B 1HL6A 1X4DA 3VAHA 3NMRA 2N7CA 1X4BA 2AD9A 4WCEQ 2LEBA 3RW6A 2HGLA 5GAHU 2E5IA 2JVOA 3CD6S 1QVGR 3MD3A 3MUVP 3BO3A 2DGUA 3G6ES 2MMYA 1KOOA 2MGZB 2AYEA 2DHSA 4YOEA 3CTRA 3EGNA 3JB9k 2CQDA 1X4GA 2LCWA 5BJRA 2EVZA 5JVGQ 4CH0S 2HYIB 2N3OA 5GAEU 3G9CA 2DGXA 4WFBQ 2RQCA 1HA1A 1H2TZ 2DO0A 2RVJA 2CQ1A 1L3KA 2M7SA 1WTBA 3MI7X 1N8RT 3THPA 3CC2S 2MY8A 1M5VC 3VAGA 3HI9A 1ZZNA 2DIUA 4PKDB 2ZJQQ 2ERRA 2CPJA 3G4SS 2F3JA 2PE8A 3CCUS 2MPUA 2RNEA 4LJMA 2CQBA 2MKCA 3SMZA 2CQ0A 3CCSS 3S6EA 3CCJS 1X4FA 3CCQS 4QPTA 2BZ2A 2KXNB 2B0GA 3VAMA 3VAFA 2M0GB 4M5DB 1YHQS 1OWXA 1M5KC 2DO4A 3UCUP 1FJ7A 3FEYB 2DNRA 3G96A 1WEXA 2KH9A 5GVQA 2DGTA 1U1RA 1FJCA 2F9JA 1W2BR 3P49B 4OZ0A 3MURP 3MXHP 2UP1A 2L9WA 2MYFA 4WFAQ 2CQPA 3EX7B 2AYBA 1XN9A 1WG4A 2M2BA 2RS2A 2MQLA 4CQ1A 2JRSA 2OTJS 4WFNQ 3TYTA 4TU8A 1Q86T 1O0PA 1OIAA 1SXLA 1UP1A 2CQGA 1WF0A 1D9AA 2MZQA 1WG1A 3R1HA 3CPWR 2GHPA 2X1GA 1VQ8S 3MDFA 2E5HA 1UFWA 1U1PA 2XB2D 2AYMA 2DNNA 1U1KA 1M90T 3K0JA 1OO0B 3SDEA 1VBXA 2ZJRQ 1P27B 1WHWA 1SJ3P 1M5OC 3FEXB 3P6YC 1KC8T 2CPEA 2ZJPQ 3VAJA 2NZ4A 1RKJA 4W90B 2DNZA 3U1MA 2E44A 2FPHX 3V4MA 1UW4A 5IQQA 5IM0A 1WEYA 2DGQA 2DHAA 1UAWA 2MJNA 2OSQA 2LEAA 2EK1A 5LXYA 1VQPS 1KOHA 2DH7A 1S72S 1NU4A 5LJ5Y 1YJWS 3MOJB 2DNHA 2LA4A 2LECA 4PRFA 2HZCA 2DNPA 3B4MA 2MKJA 2DGOA 5H1SV 1VQMS 2DK2A 2MKSA 3S8SA 1M5PC 4QU6A 2DGVA 3G71S 2E5GA 2JWNA 2X1AA 2MSTA 2FHOB 3P5TL 1X0FA 4PR6A 4LMZA 1WHVA 3OW2R 2MB0B 2KM8B 3CC7S 2MQPA 1A7GE 2JVRA 3SXLA 2FC8A 2CQHA 1QM9A 5MLCV 1SJRA 5LXRA 1VQ7S 2DNOA 2J0QD 1FNXH 2RUGA 2L41A 1JJHA 4FXVA 5DETA 1QVFR 2YH1A 1VQLS 1JMTA 3NNCA 5DDPC 4WIIA 1G2EA 5GAGU 1N54B 4TLQA 5LJ3Y 4ERDA 3G8SA 3UD4P 3G8TA 1H2VZ 2XNRA 3BS9A 2F9DA 1N52B 1OPIA 3VALA 5EN1A 1WF1A 3S7RA 2O3DA 2DH8A 2VODA 2NLWA 1RK8A 2J76E 3B4DA 2G0CA 1WF2A 1FJEB 3TP2A 1U1OA 2YKAA 5DDRC 1X4HA 5D78A 4ED5A 2WBRA 3US5A 2M88A 2DB1A 1U6BA 1PO6A 3U1LA 1JJ4A 2HGNA 4IOAQ 5ITHA 2U2FA 1K73T 1Q81T 1VBYA 4F26A 1X4AA 1H2UX 3L3CA 1X5PA 2MQQA 1VQOS 3NS6A 1YJ9S 3UCGA 2G4BA 2DHXA 1YITS 2D9PA 1U2FA 2JX2A 2CPHA 2G1DA 3RW7A 1VC5A 3THTA 2MKKA 2MQOA 4WKRA 4UQTA 2LYVA 1U1MA 2ADCA 4C4WA 3CCES 1ZZFA 2OSRA 3D2WA 3CCRS 1B7FA 2KRRA 2SXLA 2OTLS 4TU9A 4CIOA 2KN4A 3IRWP 3CMES 3BEGB 5CXTA 2HVZA 1X4EA 1WHXA 2KG1A 1F9FA 2KM8C 2X1FA 2DH9A 2MQMA 3PIOQ 2DGWA 2CQ2A 2N82B 3J7YU 3IWNC 4Z2XA 2MGZA 5CYJA 2KU7A 3CUNA 2DHGA 2K3KA 4V19X 3CCVS 4J5OA 2FC9A 2DNKA 2CPZA 2KFYA 1VQKS 2MZJA 5LSOA 4IOCQ 1VC6A 2I2YA 1NJIT 1M1KT 5DDQC 2MKIA 2MSSA 1YWXA 2KVIA 2VOPA 2KXFA 2KHCA 3Q2SC 4YB1P 2CPFA 2J0SD 3LQVA 3H2UB 3SDEB 2CQ4A 2MZTA 4C0OC 3ZZZA 2V94A 1N88A 2KT5A 3CCMS 2A3JA 2LMIA 3R27A 4LIRA 4Y0FA 2MY7A 3TO8A 3CXCR 3NS5A 3P3DA
chains in the Genus database with same CATH superfamily
4KC5A 2H9ZA 3PACA 3TUPA 4RJVA 1U6FA 3KJNB 4Q2LA 1RBLA 2UVVA 3PNIA 2UUAJ 3CCLS 8ATCB 1NPPA 4F4ZA 5CZVA 2HNZA 2NZCA 3V6DB 1HIYA 1X5TA 3W60A 3OUYB 3I56S 2YWKA 4M1KA 3E8OA 1UTAA 1B7YB 1RXOB 5DQHA 5BYQA 1GEHA 1CJUA 3DU5A 2FZKB 1FA0A 4AFFA 3HFZB 3G82A 2V34A 1VHIA 1S9FA 1Q82T 3I4PA 3FK4A 3QO9B 1K8AT 3C46A 2HMIA 4HT5A 4EYIB 2HGMA 4DN9A 4YB5A 3V81A 4F3OA 5IV3A 3CULA 5D0GA 1T3NA 3RRHA 2DT9A 1ZPWX 4F25A 2D3OR 4MYTA 2NR0A 4DWIA 3MR6A 3V6JA 2K1RB 3CC4S 1S99A 3PEJA 4C8ZA 1YRTA 4YY3J 1L3VA 4DPWA 3DDKA 2ZE2B 3LP1B 2ACMA 3QPIA 2VFVA 3PW0A 3CJ3A 3KJVB 3U27A 1TL5A 4V1Ak 5EHHA 2QA2A 3TEGA 1S7HA 3PKYA 1SJ1A 3IP0A 2YX7A 1DAXA 4YR2A 3G6ES 2EFQA 3V6DA 4DV3F 4OX9F 3EGNA 2LCWA 4X65F 2EVZA 4C0HA 4Q8EA 2M7SA 4B3RF 5FIIA 2VC1A 1TKDA 1M5VC 4XAKA 4OYWA 4ID8A 2F3JA 3QJJA 2V5HG 2HFUA 4PWUA 1C1CB 1PC5A 3S6EA 1S9GA 2WRMA 3I87A 2AMCB 1H98A 2B3TB 1GXTA 3K5LA 4KIAA 1RT4B 5L8RC 1I51B 2FTRA 3HDSA 1Q86T 1RTDB 2J9CA 1YRUA 2YPYA 4DUZF 5L9NA 4P7TA 2K1RA 1D1UA 3A3OB 3G6YA 1WORA 1PSDA 1PYTA 2OPRB 3HHLC 3KJVA 2FHJD 4RNHA 3D67A 2NZ4A 4CT8A 3FUYA 5F8IA 5HQMA 1U6ZA 3MM7A 5IQQA 1CULB 5HMWA 2CKWA 1YJRA 4DS4A 3WHIA 5KFYA 1S72S 3HT0A 3PO4A 2R7QA 2MHEA 1PILA 2DNHA 2LECA 3D28A 4F4KA 2DNPA 4X66F 1IKYB 2DGOA 1FDDA 2RD5C 1UZHA 3WBZA 4KHMA 2VG5B 3N5FA 1TMMA 5DGBA 2DR6A 2JC1A 1C1CA 3IGNA 4DL6A 2CQHA 2ZHBA 1FRIA 4FXVA 1ZM9A 4RW6B 4LFAJ 5D15A 1WOSA 4LRBA 2V4RA 2XNRA 3R5JB 2NLWA 2OMLA 1WF2A 2BJEA 5KFIA 4M5KA 3JXOA 1CBKA 2XMMA 1JJ4A 2R7RA 4NOHA 1TFWA 2OPRA 3TVYA 3SBMA 1XMOF 2FHMA 4ELTA 3NAIA 3KHRA 3D3CJ 3PM9A 4OZ3A 2H5IB 5IV4A 4CO3A 4GC6A 3DLGB 1CULA 2B7BB 4MKAA 1Q5YA 1IKWA 2ZC4A 5T7LA 3TEHB 2DTJA 3GFYA 1IKYA 2KN4A 2GCFA 1P9QC 1RWUA 2PI5A 2HVZA 2KG1A 3PIOQ 1IUJA 1TELA 2VG5A 4U96A 3DRRB 2CRLA 3TA1A 1HQUA 4I1TA 3ET6B 3SDEB 3AHPA 4LIRA 2E1PA 2EI5A 4QYZJ 3HHLD 1VRUA 2ROGA 4UY8T 1SJQA 1HMVB 2C2OB 1HNVB 3OHAA 4NL5A 2N4CA 4K50A 2V6AA 1QE1B 3OJSA 1RHKB 1WC0A 2WW8A 2JEGA 2XZDB 1RA7A 2WVFA 4Y00A 2YWWA 3Q83A 2CQIA 3C19A 3KK3B 4JI5J 3DLGA 3PY8A 2GFFA 1KQFB 1T03A 4MIAA 5F9NA 2OPQB 4DV3J 3Q86A 4OX9J 4QU7A 2I8EA 2V0NA 4Q0BB 3I5BA 4B3RJ 5K5MA 3DLLQ 3OVAA 4N76A 1Z2LA 4RUCA 5LSRA 1WG5A 3RU0A 3DRRA 3W1YC 2YNGB 4JB8B 2G2YA 4JV5F 2RQ4A 3GQCA 3CDEA 4WF9Q 2GA7A 5KOWA 1TVRA 3NNHA 1X4CA 2DNQA 3H5YA 2IIHA 1CPZA 2X1BA 2JEIA 2KXHA 2WVEA 3RAXA 5K20B 3OFHA 4DFPA 4LSNB 4M95A 4DUZJ 4LSLB 4DMZA 1ZA1B 3OXLA 3L7PA 2MMYA 3NY0A 1NSAA 3RBEA 3BH7B 1BXNA 5ETTA 3CW2C 4P2MA 2HRUA 3QJPA 4DV6F 3G9CA 3ENQA 4WFBQ 4J7CA 1DFDA 4CLSA 4TN2A 3HFVA 4B08A 3KK3A 3FQKA 1BWEA 5HQ8A 2OPSB 3RZAA 4QR2A 3EMTA 1WOOA 2MKCA 3G2XA 2EWHA 1Q16B 1N5VA 1BQMB 4C6AA 3ISZA 4OLOA 2OD6A 2PDAA 3KYLA 1UWBA 3QGGA 2HRYA 1OWXA 1ZM4A 3IMQJ 1FJ7A 3GLJA 2DNRA 5IXUA 3MM9B 2MYFA 4WFAQ 2D3ZA 1SKWA 2AYBA 2DXFA 4AUKA 4H54A 4CDIA 2OMOA 2EKNA 1JLBB 3BSCA 1RWNB 3OLBA 2W9CB 1RKIA 4KFBA 1HBOB 4OZLA 2EFNA 2RDIA 3TANA 2F65A 3KLFB 2GHPA 1F60B 3M2VB 4J91A 4CLFA 2KVQE 3UNGC 5KFBA 3ZTOA 3Q23A 1P27B 4Y2IA 4DR3F 4WIQA 1RWKB 4LSNA 3M32B 1FE4A 2DNZA 4LSLA 4ZS6A 2E44A 5CHCB 4CLLA 3H5UA 2M5YA 4ZLLA 4ANDA 3I96A 1XMOJ 2LDIA 3W62A 3PX0A 3GV7B 2MKSA 2Z2YB 4QU6A 2ALYB 3E01B 1FKOB 1Q4RA 3BM7A 1LFWA 4YN3B 5K8PA 1GTHA 2MB0B 2BE7D 5I3QA 2MQPA 4FF2A 1LWEB 4I69A 1XJWB 4CLKA 2DR9A 1BQMA 3V5RA 4KO0A 3QNWB 3KJFB 2ZNZA 3UVJA 2OFGX 2GGPB 4C3KA 1U2CA 1NEEA 2FZCB 1VQLS 1REGX 3DRSB 1SQFA 1OMSA 3AOCA 4OHZA 2QFIA 5E5NA 1WF1A 3RR7A 3DC2A 4EI2A 3AXMA 2NPFA 4CLTA 2W9CA 2HFVA 2HEKA 3AB4B 3GYXB 1M1HA 2AGQA 1FJGF 1ZAWA 1TKTB 1UA1A 3PTWA 3DXSX 5J1NA 1I6JA 3C6UB 3FFIA 1UPPA 2E66A 3PR4A 3BPDA 1X31C 3C14B 3DDIA 2DBBA 5F8GA 1F2HA 2V67A 3Q8QB 3M32A 2V8PA 2G0IA 1YITS 4O3OA 4U8VA 3PKMA 1RYRA 1PAUB 2CVIA 2CWKA 3AOBA 1TL7B 2ZUGA 3LAMA 2OPPA 3VTIA 4C4WA 1CSJA 3CCRS 3MMCB 1NB2A 2F8MA 3M6VA 3IRWP 1ZTWA 2Y0SD 1NDPA 5EWEA 5JMNA 1UVMA 2AJFE 4JI6F 3W61A 1FKOA 2BR0A 2KU7A 2XTJP 2FC9A 4FBUA 2FDNA 1RT1B 4G1QA 4ILRA 4HHUA 2DCUB 4XPCA 2XZWA 3GP9A 3NGSA 1Q8KA 4K59A 2GGPA 3M9OB 5KFLA 4F2RA 5LMNJ 3DRSA 4ICLB 3BKTA 2EC2A 1RAHB 1WC5A 2KG0A 2BUNA 4B9MA 1Q53A 1MN9A 1WDDA 1F0XA 3T19A 2KDOA 3FNNA 1KVJA 2AEFA 4CLPA 4L75A 4CH1A 4JV5J 3D3BJ 5A8KB 1DRZA 5HL7Q 4Q7AA 2I38A 2E9RX 5IC6B 1S6PB 1TKTA 4FN5A 2R2SA 1RI7A 4TU7A 3BYRA 3C6UA 5IC4B 3GJTB 3DYAB 2M4MA 5KFPA 2GO9A 3CMAS 5D77A 4RUBA 3HHNB 2YKQA 1XR5A 3UWTA 4DV4F 2VONA 3SZ2A 3KLEA 5CH7B 1FFSB 2CJAA 2PI4A 3CE8A 3CJ2A 3N6NA 3MMCA 1RB0A 3FCHA 4DV6J 3CB4A 2ZH8A 4N41A 4O0NA 1YDLA 2YKMB 1HBNB 1SPBP 4ZPCA 3FDSA 2QA4G 1Y9OA 1U7LA 1H6KX 1U1LA 3FRYA 4Y2KA 2FVPA 3ZFVA 4R5PA 4WU2A 3ZC4A 2WB4A 4LF9F 1VQ6S 1N5YA 2GJ2A 3QQCD 3W9HA 1YJNS 4Z37A 3RR8A 4NZ6A 4LF5F 3VZIA 3TAMB 4ICLA 2BV3A 4A46A 3PHEA 4EGLA 2KO1A 2QO3A 3TJ9A 2AJ0A 3I0RB 5EWGA 2HAFA 1S49A 1XNRJ 4AQYF 4J9SA 2BKOA 4FDFA 1HI1A 4RWXA 4ILMA 5GAHU 4RO0A 2B8PA 3ZTRA 2AYEA 2PGCA 3GB0A 1X4GA 4B9UA 3DYAA 3LGHA 4DR3J 1H7XA 3DLHA 2DGXA 4X4OA 3DRYA 2XCPA 3TUJC 4RWWA 1KEKA 5HMYA 3MPUB 2RNEA 1IR0A 3QAEA 3DOMB 1JWWA 3I82A 4KY3A 2W4CA 4ZOSA 2B0GA 2WW4A 3EZOA 3CDWA 3ICLA 3MPYA 4K7QA 2DGTA 2IMOA 5EGYA 1DQ9A 3PO5A 4KSEB 3PYFA 2IFXA 2ZDOA 3EX7B 3M2UA 1IR1A 4JI4F 3OVBA 1YZ7A 4Y65A 3GJQB 2E1AA 3ZZRA 4C9DA 3IS9A 5C42A 2CQGA 2FGOA 2Z8QA 3A13A 2OH2A 2H4WB 3J80Y 5B0GA 4JYAF 4IG0B 4LR9A 2ZJRQ 1TP7A 4B9NA 4ENOA 1M5OC 1KC8T 2EBGA 2ROEA 1S1TB 4F8RA 3PR5B 1JLAB 2W7PA 1FJGJ 2EK1A 2IVMA 4ILLA 2BVZA 3CJ0A 2XGPA 5HJXA 1R8AA 4K4WA 2VL1A 3CCZA 3OTCA 4LRAA 1LW2A 2OI2A 2FY8A 1HBUB 1QAYA 4DXLA 3P5TL 4PR6A 4LMZA 1U09A 2V50A 1Y7PA 1RHUB 2R7VA 1SKUB 2CVEA 4JI6J 2AX0A 1U45A 3R3TA 4MTPA 5EDWA 2BMBA 5EN1A 3ENAA 2LQJA 4I6AA 1V6HA 4TQSA 5KG6A 4M5GA 2KB2A 1RAFB 3US5A 1FDBA 2M88A 3NWRA 4F4XA 4ZN1A 4IOAQ 2BW7A 4IG0A 5A8WB 1OY9A 2VPXB 5L1LA 4PPDA 1NJYA 1NK9A 1P9YA 1S1TA 1TAQA 4DSLA 2UXBF 2LYVA 1FRXA 3R5CA 3OTEA 3I0SB 3AXKA 4USJC 4RZRA 1R6VA 2OTLS 5IT9Y 3PJ9A 2OEMA 4DQQA 3FBCA 1BQXA 4BWMA 1F9FA 4DV4J 5LT5A 3ONQA 5I3UA 2VBXA 3H2LA 1LK7A 1VQKS 1UWAA 2CJBA 2QX0A 2KXFA 1S5ZA 2CQ4A 3ZZZA 4BC9A 4J9MA 4QJVA 1HNIA 4YS2A 2RIJA 3WZ0A 3NS5A 3RBXA 2IVYA 4Q8FA 4YEAA 4QPXA 3EDRB 2G9OA 1Z2ZA 4H4MB 1T11A 4NLYA 4LF9J 2NS1B 1L3SA 2R8HA 1UJ5A 3EUNA 4IRKA 3UO0A 3AB2B 1C0TB 4EUVA 4PCQA 4KPYA 2VFRA 1TAUA 2M9KA 5LM7E 5A8WA 4IH6A 2DISA 4PWDB 3QRPA 5KFHA 4EBCA 1RCOB 2V8VA 5ETRA 2CJ9A 1FRMA 1VGYA 3TARA 2YTCA 3FC9A 3MAAB 4I6WA 3OXFA 5K8NA 3OTOF 3LO3A 1GK8A 2HFOA 3VGTA 4HVZA 1U1NA 4X4SA 3MUMP 1FK9B 2KI2A 1HQEB 3K8WA 3FMBA 1RADB 4OLPA 4TQRA 5J2MB 2ZBCA 3CDUA 4CWBA 2MZ1A 2UUWA 4ZK7M 5E3AA 3EGWB 1UCNA 2OJ3A 3BGOP 3KHGA 2VOOA 2UUBJ 4DOZA 3BKFA 4JI4J 2IM3A 2Y0BB 4NLXA 4H4MA 3MMBB 2D3UA 4LREA 2QV6A 2DNGA 3J7A1 1GT8A 2RU9A 4Q43A 3KMSA 3M8WA 2E5IA 4DSKA 4ZHRB 2AHOB 4LF6F 2MGZB 2DCLA 4XPEA 3E3XA 4PWDA 3R7SB 1H0HB 5HMZA 2HPUA 1Y5NB 3PHTA 3RB6A 2Z58B 2RQCA 4IFYB 3THPA 4NX9A 3HI9A 3JTOA 1ZZNA 2WK4A 3G86A 4IG3B 3MAAA 4ED6A 2HAIA 1RACB 3RAQA 2DEJA 3JQMA 1NSKL 5F0WA 4DQSA 4DL3A 2FHJA 4OV1A 1C1BB 4O3NA 1RWPB 4XO0A 3G96A 4MT1A 5GMDA 2J7UA 4OYZA 3DGVA 2B51A 4IRCA 2XMJA 1HQEA 4OHVA 5J2MA 2F4VF 3MOZA 3SIPB 3DOLA 1EHWA 4LRFA 2QGFB 1TKXB 4JBCA 3Q8SB 1NK7A 4BBYA 3OL7A 1RHMB 5C2GA 1VCTA 1MROB 4G6VB 1C0UB 2DNNA 5D8HB 2C2KB 4DL5A 1M90T 5H9FJ 4ZCIA 2CPEA 4O23A 4DG1A 2XMAA 3QIPA 4KGVB 2FPHX 3EXYA 3QT6A 3HPOA 5HJYA 1LW0B 4ZHRA 2VFTA 4B9TA 3IR5B 2DH7A 3DU6A 4DR4F 3TJ8A 3I5CA 1RT7B 2JSXA 1WTFA 4IFYA 3CJ5A 4JI8J 4F0MA 2CADA 4WU3A 2UXBJ 3CEDA 2VA3A 3SXLA 3OFGA 5A8RB 1T8EA 3M8PB 2R2UA 3IG1A 2DNOA 4KT0C 1C1BA 3HSJA 2W2QP 3A4TA 3T5LA 1N54B 4C48A 3EPIA 1JB0C 2F7VA 3UD4P 4I0WA 4CO4A 4ECRA 1KFDA 2HIYA 1IXKA 5D78A 1QTNB 5HATA 2VBWA 2HWHA 1PO6A 3FVYA 4XDDA 1HWIA 2QTWA 3R5AA 3CJTA 3VWSA 2QLBB 3DRXA 3D5MA 2XG8A 5I4MA 3CSKA 4USKA 4HTJA 1PKUA 4CI0B 4KTQA 4FNHA 1LW0A 1FKAF 2VG6A 4DR2J 4IH7A 2HBRB 3HHLA 2SXLA 4ZP9A 3V4IB 3C6TB 5KFCA 5F9LA 1WHXA 1HFEL 2KL8A 3OTOJ 3M6UA 2CNOB 5D3GB 3A3NB 5LSOA 2G0JA 5A8RA 4OYOA 1FFWB 3M8PA 4ZPAA 2ZWPA 4M5HA 2AU0A 4OI3A 1JLFB 5F8JA 4YUDA 5KFGA 2EK6A 3B78A 3H59A 4IUFA 4Q44A 3M30A 1I5OB 4YR0A 1S1WB 3ITHA 4FXWA 4AL6A 1WKKA 5KG5A 4RW4A 1E6VB 1JLQB 4YHHF 1RUSA 2F8EX 1Y11A 2CPYA 1DARA 3LPYA 4FZVA 3KLGB 5ETLA 4L74A 3UQSA 4BHQA 1DLOA 5SZTA 3KK2B 3OR1A 2YKPA 2HQDA 3EWGA 4LF6J 4P7VA 4QIEA 1X60A 2UZAA 3DXBA 4QBUA 1N6QA 3AOAA 3V4IA 2J8AA 3C6TA 5A76A 1OS5A 2M8HA 3BO4A 1VRQC 4P9SA 5GAHI 3GSIA 3WDOA 3F56A 1RTJB 3DHXA 4DPYA 4OI4A 2IJNA 2CPIA 2H65B 3SSRA 3FJ2A 3BGLA 2XMWA 4BCAA 4QIVA 4S0MA 2LVWA 5KFXA 2I1RA 4LBIA 1LFPA 4Z7YA 4X4RA 3FRZA 2HVDA 2DNYA 2BJ3A 2V8DA 5ETVA 5J1EA 3NCQA 4J9KA 3L4BC 2F4VJ 1QJHA 2HHPA 1S1WA 1X4DA 2ZH4A 4JI3F 5HVHA 5LMUF 3VV2B 1E6VA 3CD6S 2FQQB 4FS2A 2EC0A 3BO3A 5HBMA 3QT7A 4NEYA 4ALZA 3LTOA 2UVWA 1IR2A 4WTYA 4K5SA 2YBVA 3NGDA 3KLGA 2VPZB 2MY8A 4WYWA 3CD7A 4DV7F 3P4UB 3M1VA 5KFZA 3LWMA 3F0NA 2FVRA 2KJWA 2FVCA 9ATCB 4N7TA 4P74A 3UDCA 1S77D 5KFOA 4DR4J 3M9MB 1YJVA 4DL0C 4U6PA 3J81U 2M0GB 4M5DB 1N0UA 5HI7A 4LF8F 4QWBA 4V19J 2R8JA 2KH9A 4EEYA 3RYLA 1JXEA 4DV1F 4WXWA 4CZCA 1K1QA 3KMQA 1NBEB 3SI8A 1KWMA 1FVQA 1P6TA 4B02A 1YBTA 4MK7A 5D4OA 2ZBQA 4LVOP 4L6V3 3V6HA 2H5EA 2GZOA 4O4GB 5KFFA 1XWLA 2KT2A 1HWKA 2AGPA 2BKPA 4G1IA 3CJRA 2MJNA 1S7IA 2LEAA 1SUQB 5LXYA 4NPOA 3KHHA 1OYEA 4A4JA 5LJ5Y 4JI7F 1UW9A 4FKXA 2ASLA 4DCPB 1APSA 4TKTA 2RAQA 5CCMA 1EJ7L 3IRXA 3W5ZA 1U02A 4UUXA 3H98A 3DLKB 1EP4B 3CO9A 4ZVGA 3MTJA 4KRWA 1MMDA 1N34F 4ZLNA 2J0QD 2HURA 3O3LA 3CCWA 4QWEA 4MYUA 2BA9A 2VKRA 2IA0A 2PA8D 2VH7A 2BKNA 3ZTSA 4CLZA 2GIFA 2F9DA 5KFAA 3ZNJ1 1OPIA 1AZSB 3MAQA 3HHDA 3ILOA 1X4HA 1YK9A 2DB1A 4J90A 4K4UA 1S9EA 4UZCA 4O4GA 4USIA 5KFJA 2W2PP 5K14A 1FX2A 3KLIB 7AT1B 1IN0A 1E6YB 4N8OA 3RW7A 5DO2A 1T9XA 2UV8A 4HKQA 1SUQA 3IA0A 5CYQA 2ASDA 2XEXA 4YHHJ 1ZZFA 3IC1A 3TNVA 1B7FA 2NSCA 1PJ5A 2V9WA 4G3IA 2P6SA 4MKYA 3I9V9 2RB7A 3MM6B 2KM8C 2MQMA 2QL9B 3PJWA 2B4OA 2DGWA 4RW9B 3FGVA 5HROB 1ZAVA 4GKJF 2DHGA 2K3KA 4C8MA 2DKOB 4IOCQ 3K5MA 3C15B 2F63A 2HBYB 3VGSA 3J80U 2WONB 2OHDA 1M5SA 3M8RA 3KK1A 4KV8B 1IBLF 2RUSA 1J5EF 1NAQA 1H72C 1KDNA 2N3LA 2YX4A 4HI2A 2AKWB 5A6WA 4JI1F 1HYSB 1AZSA 2NXNA 4Q5VA 3I6PA 2PIIA 1SI9A 3MPVA 4X4NA 4N8NA 4EFAC 3VAKA 5ETKA 4RX6A 1A9NB 1NZ8A 4J9VA 2A2CA 3G6VA 2WOMB 2XS5A 3TVKA 4O3PA 1D09B 3KLIA 2D74B 2BJ9A 1E6YA 4F04B 4PG8A 4F4AA 4JI3J 5E2QA 5LMUJ 1RTZA 1KTVA 3HZEA 3JQJA 4DFKA 2RMLA 2PEHA 5EX3A 2OLWA 2XS7A 3NP5A 3TUIC 1Y3KA 4U95A 1Z4UA 4L3KA 2P8IA 2ZEJA 1JLEA 3VQTA 4DV7J 2R7WA 2YNHB 3IAM9 2ASYA 4G1PA 5HROA 2DVIA 1SQEA 2YNFA 4KHRA 1NM2A 4K4TA 2IYGA 2OD4A 2HHUA 3KDNA 3C15A 2MLZA 4LF8J 4USWA 3PRDA 4KV8A 1BC6A 4P75A 2ZNYA 5A2QU 2PT0A 4EYHB 4DV1J 4KH1B 2MQNA 4RR5A 4YQWA 4F0KA 2XULA 3PX4A 5DG9A 2L08A 2J6TA 1L3TA 1VQ5S 4HHJA 4FVMA 5IT4A 3NMRA 1QSYA 4ECWA 1GQEA 3RW6A 4NLPA 5IT9U 2CYYA 2DHSA 2K7JA 3SCIE 4DR7F 2IBKA 1XQIA 2RDDA 2HYIB 4M63A 2NUUG 1NK8A 1M1GA 2BJDA 1RISA 1Y5LB 4PKDB 2J6UA 1KLMB 5BYRA 2GMHA 3CCUS 4ZITA 1PJ6A 1S6QB 4WWSA 3H5SA 3VGUA 2HIQA 3MEEA 3CCSS 3BF4A 6AT1B 4X4QA 1HHSA 2CFXA 2ZHAA 1FXRA 2YNHA 3FEYB 5ETNA 1U1RA 2HNDB 5KFRA 2CQPA 2NXCA 2ZH2A 1CJKB 2R9LA 3ENVA 3CJKB 4OJ1A 1EIYB 2KTQA 1N36F 1ZM3A 5FLXY 4FKYA 2GVDB 3QZ8A 4XK8C 3T1HF 3MWBA 1EX8A 3CPWR 2VUGA 3MDFA 2N4DA 4O44B 2XB2D 7FDRA 4AXIA 5B08A 4A8SA 4NCAA 1VBXA 3G6XA 1NSPA 2YXLA 3V4MA 4DPUA 2DGQA 2OSQA 3OTBA 4UTGA 2HVIA 2DXDA 1D9FA 1FWKA 3M05A 1EZZB 4P73A 2P9EA 5H1SV 3ELHA 3S8SA 1QAXA 2RKIA 4F50A 1KHWA 2ACYA 3GJSB 4OHYA 2HLUA 3AFGA 4RW7B 2XLJA 1WNEA 1Q78A 5KAKA 3PCOB 5DQIA 1B0PA 1VDHA 1W7WA 4Q45A 5LXRA 4GC7A 1F3VA 5DETA 1RSCA 5AXKA 4F3QA 2JFDA 4IH5A 1VQSA 2Z2ZA 5LJ3Y 4DR6J 3G8SA 1VISA 1F5CA 1LWCB 1N52B 4LR7A 1CJKA 3CJKA 4WJBA 2XY6A 1HPZB 4IQMA 2J76E 3B4DA 1SKRA 4OJ3A 5BR8J 2IYIA 2HHWA 4ED5A 2W01A 1U6BA 1IBLJ 1J5EJ 2DY1A 3OSPA 4O44A 3GU0A 2LU2A 4JI1J 3SCKE 5AE2A 1U4BA 3IFEA 3OV7A 3W8GA 2X7IA 3LP2B 4URQU 3THTA 1AA1B 2MKKA 3HVTB 1YLXA 4AYBD 1V3RA 4JI2J 1YBAA 4ZPDA 3A8JA 4WFYA 1CJTB 2YPZA 1FNMA 2J9EA 1WACA 1SV5B 2X1FA 2CG8A 3D0HE 1Y5IB 3J7YU 2VKZG 4KH0B 4RW7A 4GO7X 5H9EK 2VDHA 4LF4F 1TKZA 2HQ3A 1HNWF 1VC6A 4C2MA 4OZJA 3BKUA 3Q2SC 2CPFA 1RT3A 4NZ7A 5KFKA 4IR1A 2B4VA 4X4VA 2A3JA 5DG7A 3WX8A 3D68A 1SC1B 2BX6A 3IBFB 3MR2A 4RPFA 2CZ4A 1BGXT 1T95A 5JVHQ 1FRJA 3BGFA 3WQPA 1FO1A 1XERA 3GTYX 4WZQA 2ABYA 1UMJA 1CS4B 4J9RA 1NKCA 1JLGB 3LAKA 4CNZA 1EQ0A 1OPZA 2LKZA 2RRAA 2R8GA 1HD0A 1QUVA 3EPGA 2NCKL 4JV2A 2G2ZA 3T9ZA 2DNLA 4QZVB 2LXIA 1N33J 4WP3A 1YTYA 3RJMB 2QC3A 1K9MT 4DR7J 5J2NB 2Y8WA 1CJTA 1HHTP 4K5RA 4B3MF 5B0EA 1TV6B 1SV5A 4OI6A 4QOTA 3ILLA 3MM8A 2VV5A 3Q8YA 3FMWA 1WC3A 4BLGA 2O5DA 4A47A 2EW9A 3ETMA 5KG2A 4LQ9A 4I2QA 5M2RA 1LQ9A 4DX5A 2PFFB 2BJ7A 2HK3A 2K8GA 1OSCA 3IBCB 4K8RA 1X9SA 1R8PA 2JEJA 3T6BA 4C8YA 1S97A 2R2TA 4NASA 1N36J 2Y1JA 5HVGA 2UXCF 2VBZA 3JSYA 3K5OA 2E7VA 3T1HJ 2XC9A 2N7CA 4HYKA 3N6MA 4HHHA 5KFDA 1CS4A 4H4OA 4FYYB 1MN7A 5DRKA 1MLAA 1NHUA 1JLGA 2QIFA 5KT7A 4E8UA 4OZ5A 5BJRA 5JVGQ 1B0TA 4J37A 4YDXA 3B6BA 4JI0F 4TXSA 3KWMA 2CZ9A 5HP1B 4NLQA 3BBCA 1G1XA 1CEZA 2PE8A 4HACB 1XR6A 4NRTA 2V63A 2COLA 2CQ0A 4X4UA 3NGKA 3DLBA 4LSZB 5F8NA 2CJYB 4QPTA 3B54A 1TV6A 3PXGa 3QT8A 1R0CB 2Y3YA 3FEZA 2L9WA 1NKEA 2W9BB 2C3PA 2MQLA 5D0RA 4CRJA 2ALZA 2RQMA 1O0PA 2R7SA 1RWXB 2VZ9A 3H90A 1TK0A 2LP4A 2E5HA 3BB5A 2BABA 4LBPA 4LBHA 1JNZB 1U1KA 3G82B 1FVSA 2XYGB 2JLGA 2XHCA 2IRUA 2QLJB 2L48A 2JNJA 3BSNA 3GFZA 2ZD1B 1RKJA 1R43A 2HMIB 1UAWA 2QL5B 5A6PA 4A8WA 2HVEA 2BRLA 2AP6A 1XBWA 1PJ7A 1U0SA 4A8MP 1VQMS 2E29A 2QE5A 2VJVA 4F67A 2XQCA 3MEKA 1WKJA 2X1AA 2HZAA 1S48A 4HACA 3AAWB 2EG1A 1XMBA 2XWYA 5CZXA 4F36A 1MU2B 1T9VA 3MHYA 3TQ1A 1IM4A 1S4EA 3IAS9 1JX4A 1FRKA 2NXEA 2W9BA 1H2VZ 3GIKA 4ZPTR 1CQMA 3VALA 1FNOA 1NHVA 3WC2A 3OBIA 1YJ7A 4DPTA 4R25A 1WOPA 3W2WB 2B5JB 2DEIA 1N5QA 5D6GA 5B09A 1H2UX 1VQOS 2ZD1A 3HVRA 1S9GB 3M4XA 2CPHA 1VC5A 4LIWA 2ZH9A 1BQNA 4NLGA 2QT7A 2CDRB 3EE3A 1NK4A 4TU9A 1HWUA 5C7PA 5GMEA 1S6OA 2R4FA 2GMLA 3MCSA 1IKXA 4HH0A 1FTCA 3W63A 4J5OA 3RTVA 1HI0P 3LW5C 1TK8A 5KFWA 1MU2A 4B3MJ 3LQVA 3IWLA 4ED4A 2P6TA 4ELVA 5HMXA 2QSWA 1WSVA 2KT5A 3VQSA 4PQUB 2MY7A 1UL3A 5DS7A 3TO8A 2V2KA 3MM7B 2QZ8A 1S1UB 3KTQA 1X8DA 3OL8A 3FBEA 7FD1A 2KJVA 3UD5A 4IO9Q 3ZZPA 2OGUA 3DGPB 3X3UA 3W2WA 1N56A 2IM0A 2B5JA 2ROPA 5E33A 2RILA 1LXJA 3K5PA 2H3EB 4ECYA 1S0OA 5DJBA 1DTTA 1WI8A 2UXCJ 3PDNA 1GAOA 4U7CA 2YKNA 1NNDA 3TAQA 2GVZB 2AF6A 4JV0A 1FERA 2ZFHA 5CAAA 2W2MP 2CJQA 4MKBA 4FBTA 2AEMA 2WVDA 3FSYA 4JI0J 3CCTA 1GX6A 1NXIA 3Q2TC 1P1TA 2BQ3A 4EBEA 4UW2A 1FRLA 2XI2A 3R6LB 4C11A 5F41A 3TQEA 1VRTA 2VIHA 4C8OA 2V2VA 4RU2A 2NYHA 2IPOB 5IOLA 1VQ4S 4NLOA 4FS1A 5B0CA 3SCLE 4ZVOB 4PQUA 4DV5J 1T3OA 4UOHA 3MD1A 2JHEA 3Q22A 1S1UA 1VQNS 3AD9C 3N79A 2CNNB 4L73A 1IKWB 5T7LB 4ED0A 4FPRA 2DD8S 3NOCA 2GV1A 1S4FA 1F5BA 2J7WA 4NMXA 1UVKA 4WCEQ 3DGPA 2V8GA 4GVBB 1AT1B 4IFVA 1TFYA 4A48A 3D0GE 4LFCF 1S10A 1ROFA 3BGRA 2Y9HA 4LR8A 4ID5A 1HQUB 5DG8A 4ZJQA 5IWAF 4B17A 1UVJA 2GVZA 2OO4A 3K59A 2ERRA 2W2NP 1AROP 2J5AA 5KT3A 2J8SA 1NPKA 1D9DA 1F9EB 3CVKA 1VRUB 4CYUA 1PYSB 1D3WA 3CO0P 5EUHA 2BZ2A 2C3UA 1MSWD 1RHRB 1FKPB 3H20A 4RBTA 2B7CB 5D4PA 3A1YG 3KG1A 5KT6A 3D0IE 1NRKA 4DV0F 1VMBA 1RT2B 4RW8A 1JXVA 1URRA 1W26A 2QRRA 3R1HA 1VQ8S 5CD4A 2Q3PA 2W24A 1T03B 5E0OA 2QLXA 1SIWB 5ETSA 3DCAA 2E5LF 4NCGA 2GIQA 3D1OA 3U1MA 5FDLA 5IM0A 2RF2A 4GVBA 5F8LA 5L1IA 1RAGB 1Q79A 5C25A 1YJWS 5K8MA 1N32F 1RBAA 3QWUA 4ECTA 3KNAA 3B8HA 3PRVA 3GV5B 4DI6A 1BHNA 3NS7B 2FHOB 5F3TA 2K3IA 1TVRB 2X51A 3GFXA 2FC8A 3HULA 3QFHA 4ATNA 2KZZA 1QM9A 4HTIA 2MLYA 3EVWA 4IDKA 4FF1A 3HK2A 4DLGA 1FKPA 2J9DA 1KKHA 5GAGU 2FVSA 4TLQA 1Q0NA 1UFKA 4NLWA 2VODA 3SFUA 1RT2A 2YKAA 5DDRC 3PJXA 4C8NA 3J7YI 3VVTA 4DPOA 4OHWA 1UEKA 3U1LA 1LXNA 3DMJB 1H7WA 3TW0A 2IJRA 4KR0B 1F6TA 1O5JA 1SC3B 3DKDA 3UCGA 2G4BA 4TY8A 4U7UK 4X65J 3NWGA 1JNRB 2AJ2A 1UWBB 3E2EA 2XCAA 1H74A 4UQTA 3NBPA 3RBZA 4RNMA 1U1MA 3VVUA 1YKWA 2XY5A 2FUG9 5DLFA 3MR3A 2B9EA 1QD1A 4KFBB 4NLVA 4PG7A 5FLXU 1RHQB 4TYAA 2JLFA 1GMVA 3KUHA 4C8LA 2OEJA 2ILZA 4WZMA 2VOPA 3HHKA 4KBIA 3JAMY 2QMWA 4Y0FA 1U0HB 3TWZA 3BZQA 1SJFA 5DDOC 4WE1A 3NCPA 2VFUA 5IZHA 2RH3A 1EARA 2HHTA 5KOXA 3FCVA 3VAIA 2RU3A 1FF2A 2L9NA 3QAUA 1QTMA 3DMJA 2BDPA 3TZYA 3F44A 2LDYA 3BGUA 3ZZYA 4X66J 4KO0B 2ZKTA 3NGRA 3U7JA 1Y3JA 2QMXA 3UVJB 1FXLA 2DGSA 3E51A 5HO4A 2QEXS 3DHWC 3O6QA 1K47A 1VBKA 2HWIA 3ILIA 5DLGA 3KNGA 2HS3A 3JSMB 2C2EA 4IYQA 2D41A 1YI2S 1FESA 4OJGA 4LFCJ 3SV3A 4K4ZA 2OUGA 5IFMA 3QZ7A 1XTZA 3NGTA 4OYXA 2AWZA 5IWAJ 4HI1A 2BXJA 1F5AA 1JXLA 2MZRA 4LFBF 1YIJS 1Q7LB 4PXDA 3FFIB 3QRRA 2M70A 3D9BA 4GO5X 1RTHB 5FJ4A 3RB4A 3QBCA 2QN6B 1U0HA 2Z56B 3UDEA 4OI0A 4UQGA 1WEZA 4ZVSB 2OPPB 3ZZUA 4DV0J 1TL3A 3CJQA 1GMWD 2GJIA 3QJLA 2NYIA 3IGVA 3I32A 3D4JA 1B3TA 3MUVP 3P8BB 1SL1A 1JK9B 2HFSA 3BDPA 4YMEA 3JB9k 4CCHA 1RA6A 2E5LJ 3H40A 4J9PA 4G1QB 2DIUA 5T14A 3AA8A 2MPUA 3JSMA 4USUA 1WC6A 3SV4A 1N32J 2E9ZA 2DPJA 1VK8A 1IWGA 1SL2A 2QMUB 3N5BA 4DR5F 1IJFB 4ZVTB 5GVQA 1W2BR 1LK5A 4A8OA 3L7UA 3UN3A 2OTJS 1IBMF 3N6LA 4N47A 2GNKA 1RTHA 2YWEA 1NZAA 5J2PB 2Z2LA 2RDJA 1U1PA 3W3SA 3KLEB 2ZVIA 3BSAA 2G1HA 1KSPA 2HSEB 4R0JA 1H38A 3K17A 3G87A 2K2PA 3RB0A 3MGJA 3UDLA 4WFXA 1FTRA 2LA4A 4ECUA 4R5PB 4PZVA 1CG2A 1N5YB 2R7UA 2A6OA 3CD5A 4ED8A 1SIZA 3BJYA 4DCOB 3ZTQA 1RDRA 3J81Y 4Y2AA 3T5JA 5HN0A 2C2DA 5ETPA 3OR2A 4OIXA 2PMZD 1UPMB 1G2EA 4DEZA 1PCAA 4P52A 3BBFA 4X62F 3FQLA 3JQKA 2G0CA 4ETXA 2XSJB 4YFUA 4YY3F 1ZOTA 1K0VA 2XGQA 1R0BG 5J2PA 4ECVA 5SUHA 4NE9C 2IDEA 2BANA 5I3PA 3K8VA 3TA2A 4EO6A 5M2UA 4RUAA 1Q8LA 5E41A 2CNLB 4ZMMA 4KJIA 3AODA 2R3VA 1U2FA 3PYGA 4I6YA 1CJVA 2ZBPA 4ZP6A 2YY3A 4QW9A 4FNIA 4D3HA 3M2UB 1NDCA 3T6JA 4C3LA 3QGPA 2APOA 3IS9B 2E1RA 5C42B 5E3RA 5RUBA 3GIIA 1WD6A 4JV1A 2A18A 3AH6A 2R8IA 3BN4A 4ZJLA 4NWBA 1UEVA 2V8HA 1NKBA 1NDLA 1U2RA 3BPSP 2AT1B 1YGYA 4ZDNA 4DBQA 2V94A 3DRPB 2XM3A 3CWJA 3LALA 1GH8A 2EKYA 4LFBJ 2VBYA 3DI6B 4MIBA 1IQTA 3IR6B 1XNQF 4ZKAA 1EKRA 1T94A 2YQ0A 3OL6A 3LANA 2XSJA 5J2QB 1U8SA 3POTA 4NCBA 1U25A 2CJXB 3M8QA 1LW2B 2QFJA 4LF7F 4B3OB 3MPDA 5DM6Q 2DY9A 3AD7C 1YBUA 3OXGA 5HSPA 4OMFG 1GX5A 4CLUA 2C3YA 2XSFA 1S0VA 5G0RB 2YH0A 3D6FB 5KT4A 1GMUA 2NSBA 2XNQA 1F3FA 4K4SA 2BEFA 1SL0A 3MEDB 3O5TB 1DTQA 1AUDA 4RL1A 4ZVFA 4NXMF 2LQ5A 5EWFA 4K0KF 4K4XA 4P72A 3D7SB 1SJ4P 1MMLA 3HJFA 1W2IA 1DQAA 3H25A 2DR5A 1YSJA 4LQ3A 1S12A 4ECSA 4LFAF 1KQGB 3DRPA 4ANEA 1HR0F 4DR5J 2B6AA 3NCRA 2D9OA 1S79A 3HF5A 1FX4A 5ETOA 1YJUA 2H1YA 4GVLA 3DI6A 3FSIA 1I94F 2WCXA 4JOUA 1VS3A 4C7QA 5J2QA 2EFPA 2LFVA 2YQ3A 1BD6A 3BREA 2JEFA 1X4BA 2IA6A 2KZMA 2A10A 1QLNA 3IN5A 4B3OA 2DGUA 2AJ1A 3AJ2A 4ZVRB 4QIGA 5I3UB 1ZPVA 4ZLPA 2B4UA 4WKYA 1VJWA 4Y6IA 3M8SA 3L95X 3JTNA 4UOFA 5G0RA 4X4TA 1HNIB 1YVFA 1S57A 1SKSA 4LJMA 4DX8H 4X4PA 1IKVA 1VYAA 2OEKA 3MEDA 1VOMA 3OHBA 2AQ4A 2O01C 3R5BA 2KXNB 4AXJA 3R97A 1JLCB 4ZLJA 1WUUA 1RWVB 1XN9A 4CQ1A 4X84A 3W2VB 3UR3C 1VIXA 2HVHA 1RGVA 3UI3A 1T7PA 2JL9A 4MKVA 5A2QY 4DQPA 1N0VC 1UFWA 2R42A 4PXCA 3HP6A 3T1YF 4X62J 4UOGA 2C28A 1WC1A 3EDQB 1CC7A 2L9DA 4HDGA 5B0AA 5GAGI 4ZVPB 4AL7A 1VQPS 3BQ2A 3MOJB 2HZCA 5C24B 3CIMA 4WK1A 4QW8A 3MMAB 4JI5F 2KHDA 2F40A 4CTAB 2DRAA 2JWNA 3BR9A 3THVA 2HHXA 2MSTA 4YP3A 2K06A 3OUYA 3K57A 1EAYC 1RWWB 4M5JA 1S1XB 2CIMA 3QFWA 2C2MB 2IM2A 1JLCA 3Q89A 4YR3A 4ANCA 4LF5J 5F3ZA 1UVIA 1RABB 4QIFA 2AW0A 2QLWA 3QO9A 3W2VA 2A6MA 2DH8A 4ED3A 2HRTA 1PBAA 2F5GA 4DSFA 4AQYJ 3TI0A 1K73T 5F8HA 3FBBA 1Q81T 4F26A 2F1FA 1XNQJ 2OP5A 3KLHB 3L3CA 1KHVA 4NMLA 3M7VA 4MFBB 2ZE2A 9RUBA 3LP1A 4LF7J 3MAHA 3LGMA 3D2WA 4J9NA 3MM5B 1KVKA 4G65A 5C24A 4O0IA 2BJ8A 2KFZA 3MMAA 3LWLA 3BQ0A 2WVBA 1KRPA 5HAOA 2HS0A 4CTAA 3DOLB 4DS5A 1F1BB 2D3O1 4ZVEA 3CUNA 4EO8A 2IDLA 3T1AA 2MZJA 2JOQA 1NJIT 1V3ZA 4ZPBA 1S1XA 2Z2MA 1XC9A 3HCXA 2DRDA 4NXMJ 4K0KJ 4NLSA 4DG1B 1RZMA 3QIPB 3OLAA 2HQGA 1TQLA 4U67Q 3PIPQ 2W8LA 4JYAJ 1TR0A 4FYVB 3RRKA 1RT4A 4KGZB 1K0TA 2YKOA 1J27A 2UUCF 1HR0J 1PC4A 2VQEF 1BMQB 1C2PA 2DPIA 3CIZA 5L1KA 2ATLA 2PD1A 4RU9A 1RTDA 1I94J 3UFCX 3GIJA 2ZM6F 5F0UA 3D6TB 4NZ0A 3KLHA 3VCDA 4X2BA 4EMDA 2QA4S 4MFBA 5KT5A 3IG1B 3MUTP 5E7OB 4RNFA 2V2QA 3KUEA 3MM5A 2IM1A 1U1QA 3W8PA 4DFMA 2VPYB 3TX0A 2CQCA 2LXUA 1UJ6A 4I2PB 2PN6A 1VI7A 4DL2A 1FHTA 1DY3A 3PFEA 3FCWA 4M5IA 4OZ1A 2R7TA 3RB3A 1IJEB 1RAOA 3K5NA 2UXDF 3HD2A 4MIWA 4GKKF 2MHNA 4H4KC 4W4MA 2GQQA 3BQ1A 1RTIB 4OHXA 3PVXA 2QG9B 2VG6B 3HVAA 2LU1A 3BYPA 1AFIA 1LWFB 1DHMA 2VB6A 1HLWA 3HHLB 2QYGA 4RW6A 1TU0B 2AV5A 3VAHA 1B0VA 2HGLA 2JVOA 3CJSA 1BWVA 2DXEA 2P9CA 4DQIA 3T1YJ 1IM6A 2Q43A 3QT5A 4USTA 5L9XA 1ELOA 1V3SA 1Y4ZB 1NPRA 5GAEU 1HQ2A 2RVJA 2DO0A 2W4DA 1WTBA 3C3LA 3RG6A 4AE5A 2ZJQQ 2BQRA 1EB0A 2FGCA 5AXLA 3JAMU 2W9AA 1OQ3A 4L72B 1I3OB 1X0PA 3CCJS 3NOGA 3UR0A 2YX1A 3J81j 5E3QA 1VQYA 3VAFA 3HKWA 2PO4A 3M30B 2DO4A 4R8UB 3TZZA 3DNCA 4NYZA 2JH3A 2FLPA 3ITHB 4JP8A 4I2PA 2Y8YA 1IBCB 1RU2A 3A8KA 4RW4B 4WFNQ 1VFJA 1MWQA 3GIRA 2V68A 4DX7A 2DRBA 3BBBA 4ZCKA 3C2PA 5LMNF 4GRSA 2YWGA 4E2FB 1R89A 2HK2A 1DLOB 3N0VA 3OR1B 2QA1A 1RTIA 5C2CA 3FSXA 2HQIA 3ET6A 1LWFA 3SDEA 2JFKA 1AFJA 2GS8A 1N6QB 4MJKA 1CQNA 3RBDA 2O66A 1NJWA 1HMVA 1HNVA 3LPEA 2OELA 4KKOB 3TVZA 4B3SF 5AE3A 3GWCA 4LUBA 3CJ8A 4Y2MA 1QE1A 4KQZA 1OQ6A 1B70B 3NL0A 1F9HA 3LOUA 4OFZA 3R2DJ 3AJ1A 1PAEX 4I4BA 3W5YA 1MG7A 8RUCA 1T9WA 5KFEA 3J7Z5 5J1EB 1HW9A 1VQ7S 1SH3A 1JJHA 2OPQA 2YH1A 4R8UA 4WIIA 2QL7B 3PW7A 4PAAA 2EFOA 2YQ1A 4Q0BA 5HBMB 1G6BA 1RK8A 1VHFA 1NCLA 3PYDA 2DJWA 1K1SA 4DFJA 2HBZB 3LA0A 2IHR1 4I64A 2YNGA 5ITHA 2U2FA 4P10A 3M1VB 4LF2A 1XNRF 1JIHA 3EYZA 1MW7A 3OT9A 4DHVA 2UUCJ 3A8EA 2VQEJ 3ZZOA 2MQOA 4QCLA 3CMQA 3HM9A 3KOAA 3CCES 5H9FK 2Q6CA 4B3TF 3TZXA 1BLUA 3T9NA 3OTDA 4AL5A 2X3GA 4KKOA 2ZM6J 3QSYB 4PG4A 3TUZC 2IMWP 5CXTA 1TUVA 4PXEA 5G4DA 2YVSA 3IWNC 2CWXA 5KFUA 3CGIA 3BN7A 4NEZA 3CCVS 3GCWP 5JXSA 2CPZA 2J7KA 2KFYA 2B43A 3HSDA 2XWXA 5K9FA 5DDQC 2MSSA 3JTPA 4YB1P 1HARA 3D1QA 2GMJA 1KTQA 2OPSA 3FZ2A 2ZDPA 2B9WA 3MPWA 3RRGA 1LKZA 4BS2A 4MH8A 4A8XA 3VZHA 2ADBA 1ZH5A 1URNA 2UXDJ 4GKKJ 3MM9A 3BO2A 3IWXA 1DBDA 3IRXB 4DUYF 5HK4A 3AQPA 1JLBA 4OJHA 1G7CB 5KG7A 1HBOA 1X9WA 4FYDA 1DZ5A 3D66A 2LQ9A 4Z7CA 3KLFA 2PSZA 2YNIB 2XMUA 2BOPA 2C42A 3GE9A 4WYLA 4DPXA 3M2VA 2ZWOA 4HL9A 3HMJG 3NNAA 3DM2B 3L9ZA 3UE2A 2H4YB 3OVSA 2ZOMA 1D8YA 2M52A 2MZSA 3BSOA 3HSZA 3TOQA 4F02A 3PYEA 3KXDA 1GMWA 4B9VA 5D0HA 1HD1A 4DCJB 3GSDA 2NXJA 4ZN3A 3QLHB 3E01A 4URGA 2CXEA 1S9EB 5GADU 2JC0A 1CVJA 1S59A 2D7SA 5K14B 4F3MA 3QGHA 3DLJA 3FBFA 2IJFA 5LSLA 2AYGA 2ZZTA 5D4NA 1QSLA 4M8LA 1LWEA 5CYQB 4WFZA 3WIUA 1SC4B 3Q8UA 5B0FA 1B64A 4LRCA 5GMKa 1KQKA 3W7BA 3GILA 5T41A 3KLVA 3TZWA 2VFSA 4IQXA 3R9LA 4ELUA 3O1LA 3MR5A 1KOOA 1VJQA 4CO2A 1U24A 1U47A 5L46A 3RUBL 1U8WA 1WKLA 2PMWA 1BUXA 3IR7B 4DX6A 4ZCMA 3MI7X 1N8RT 2YNIA 3I9ZA 4DZDA 4EZ6A 4AD6A 3DM2A 3KK1B 2HNYB 5B0BA 3C14A 4P2SA 2GW8A 4B3SJ 1X4FA 1EETB 1TL7A 2L3MA 5B7WA 2E9TA 1CLFA 2WSEC 3QATA 5B0DA 4YB7A 1V5VA 2C2NA 3P49B 4OZ0A 2O67A 1WG4A 4RNNA 2GIRA 2AJQA 2FYXA 3TYTA 3LGNA 3QLHA 4R0EA 3AT1B 3C8YA 5MAOA 5DZ7A 3QWPA 2ZZMA 4NYOA 2XZTB 1RT1A 2E7XA 3DLEB 1QDUB 2IY5B 1OO0B 3OD2A 2HHVA 4L3NA 3HX9A 1SJ3P 2Q1LA 2ZJPQ 2NQPA 1B99A 4OZ2A 3NLCA 1UW4A 1JLEB 1WEYA 4CNYA 3TJAA 3M8ZA 2EG2A 2W8KA 2YNFB 3K58A 2W7AA 1DURA 5A8KA 1FWLA 2DK2A 4I56A 4QWDA 1M5PC 2IC3B 3CDAA 4USHA 1S6PA 4LF1A 4DSEA 1JKHB 2HNYA 1FD8A 4B3TJ 2AZ1A 4F0HA 5KG4A 3PG9A 2XY7A 4B9SA 1EETA 1LWXA 2NUHA 3M6WA 3NKYA 4HR2A 3JYTB 1QVFR 3UNYA 4DF4A 1PBUA 4QR1A 1MNEA 3R7NB 3OJUA 2UUTA 3D6MB 3GYNA 2BYCA 3P96A 3G8TA 1Y00A 3ZTPA 2O3DA 2YKMA 1HBNA 2C22A 2B9YA 1YJTA 3TP2A 2HHQA 2XLKA 3IM9A 1U1OA 3GPAA 4KYZA 2UUBF 3UN5A 4ZP8A 1OY8A 1HNZF 3O44A 1V9OA 3DLEA 3UW1A 2LQ8A 2AZ3A 1X4AA 2UVUA 4FF3A 1X5PA 2FJXA 3EZUA 3PEHA 3MEEB 5KFTA 3TAMA 4NXNF 3MCOA 2XYPB 2Q6BA 4DUYJ 3I0RA 4LVNP 5KTQA 2WTFA 3Q8RB 2ILYA 2VD3A 2XYHB 2BBEA 4CM0A 3CMES 3KHLA 2MTLA 2IC3A 4ZJOA 2ATCB 3MMJA 5LL6d 4ZVQB 1NMEB 3CJ4A 2PA3A 3KDOA 3SSQA 3SEOA 1JKHA 2FLLA 5E3CA 2DNKA 2MDAA 4DQRA 1UFLA 4N56A 2MQ8A 4LRDA 4K2XA 3N01A 4W98A 1YWXA 3CNQP 2AGOA 2KVIA 1D0EA 2J0SD 3K2YA 4RUHA 3JYTA 4J9LA 1QY7A 2HHHF 3CCMS 3T3FA 4ETZA 3CXCR 4ES1A 5LOQA 3DOMA 5JUMA 3JS9A 5AE1A 1SH2A 3TR5A 3ULHA 1RT6B 4MK8A 3UDVA 4P71A 1H73A 1WELA 2B56A 2RKIB 1KN6A 2KYXA 4DU8A 2UU9F 6FDRA 4P2FA 3ZZ0A 2HFNA 3GR0A 4KGKA 4WK3A 2MJUA 2FZGB 4JI7J 4QIWD 3QRQA 2C2ZB 3MCMA 1H3DA 2RS8A 1NJXA 3ISNC 1KD1T 1D8ZA 2NXUA 2ZH6A 1NK0A 2GAGC 4E0DA 2C2RA 3TA0A 4JI8F 2HKEA 4HEA9 1JLAA 2XHWA 4IRDA 2RRBA 3NEKA 1N34J 2LA6A 2GQ2A 3V2UC 4ZVHA 2HS4A 4PG5A 3AA9A 5DQGA 5GAEI 2RT3A 1HBUA 5KFSA 1LV5A 4QQBA 2A0FB 3B82A 3ZNUA 1M5HA 2WZ1A 5BXIA 4DF8A 2CJKA 4ED2A 1T05B 3ZO7A 1TMJA 1YRXA 2FJBB 1RT6A 1FDNA 2KRBA 4W92B 3HLUA 5C5JA 1VR6A 2JZ5A 2AD9A 1RQ0A 1QVGR 2I0XA 3W5XA 1T0TV 2O1PA 2QSFA 2VPWB 5KFVA 1NHKL 2MKYA 3A12A 3KJQB 2EFGA 2FB0A 3OQ2A 5I42B 4ZA1A 3CT9A 4CH0S 1TKZB 1AW0A 1HA1A 3DFEA 1HWLA 1RP5A 4I7FB 4DR2F 1RT3B 1RLCL 2CPJA 1C4CA 1S76D 3R5DA 2R7OA 1AUSL 4PEOA 4A8QA 4GKJJ 4F2SA 5KG3A 1R8CA 3NMAA 2VDIA 2J0XA 2WAQD 1HKAA 2EXUA 2VICA 1M5KC 5AT1B 3GIMA 2HBQB 2J9DE 4FP9A 1N5TA 2IAJB 3I0SA 2XBPA 4EZ9A 3MURP 2UP1A 2M2BA 4TU8A 4NLDA 3ENWA 3JSBA 2OFHX 3IO1A 5AXMA 1WF0A 1D9AA 2ZH1A 1UETA 4HH1A 3GFHA 4KGMA 4FVCA 2FJVA 3IXQA 3H8YA 1LOUA 4KE5A 1T05A 1PYOB 2KT3A 3P6YC 2GAHC 2MLXA 3ISND 1VLOA 3FKBA 3MM8B 1REVB 1HNZJ 4PRFA 4DN0A 1F2GA 3P5BP 5I42A 1C0TA 3EZ5A 4NXNJ 3HZGA 4I2QB 3G71S 1C4AA 4I7FA 2ZOFA 5HVFA 5CABA 3CC7S 2JJ4D 2XI3A 2BM0A 3GCXP 1FEHA 5ETMA 1FNXH 4F7VA 4PQAA 4WP8A 5DDPC 2IAJA 4ERDA 3BS9A 4H4OB 1TK5A 1KS2A 2R7XA 1RAIB 4DV2F 3O2IA 1FK9A 2HHHJ 2YWHA 4CO0A 3OPKA 1ICEB 1VIOA 5IQ6A 3SQGB 4O3RA 5KFNA 2OKQA 1YJ9S 2DHXA 4U9RA 4AT1B 2GQCA 4UF4A 1T9TA 3PW5A 2Z0GA 4NA1A 4WKRA 1NSQA 4UZBA 2B9XA 3VR1A 2LXFA 4LT6A 2UU9J 1REVA 3MMBA 2XO7A 2A2DA 3Q8VA 4PYAA 2HFZA 3GV8B 1P8GA 2FLOA 3K7RA 1UJ4A 1HHQA 3EICA 4X64F 4ES3A 3PX6A 1S0MA 2MGZA 4NA3A 2FD2A 2BOAA 1CC8A 1R7IA 2MKIA 2WHOA 2KHCA 4RLEA 4IG3A 2KFNA 1HBMB 2RE1A 3MFHA 1N88A 4WXOA 1S0NA 5CCLA 2LEPA 1KBRA 4ZPVR 1NH7A 2AX1A 1T9YA 2J6SA 1EQMA 1RAJA 4C0BA 4CO1A 1R8HA 3S1TA 2OAUA 4PG6A 1FWPA 3GR1A 3SYZA 3AD8C 3H4DA 1RE1B 2Z57B 2DIVA 1PGZA 4ZIWA 2VQFF 2V9KA 3SQGA 5GADI 1TKXA 4PPZA 3R6GB 3W64A 1KP6A 5CA5A 1FDAA 1MROA 1C0UA 2RHQB 1W25A 3D1HA 1SB6A 2E7WA 2M3DA 4A8KA 4A8YA 1LNQA 3OFEA 4RKUC 4BWJA 1FI4A 5FD1A 1UVLA 2DNMA 2RSQA 1FXDA 1HW8A 4QWAA 2IRYA 2JDJA 5KG0A 3HJVA 4DLEA 1ULRA 1RWMB 1RT7A 1A0OB 4M5NA 2WSCC 2G2OA 1U26A 4OYPA 1OYDA 1R31A 2ZZNA 1AXQA 2OIHA 1NJZA 1HBMA 2BE2B 3HKZD 3M8YA 4OZNA 1Q95G 2F8HA 1RBOB 4FYWB 2GX8A 1BQNB 5D0EA 5DM7Q 4P2XA 2V69A 3MF5A 2V2ZA 3N4WA 1JJ2R 4EU0A 2I6WA 2H54B 1XMQF 3GG0A 2VF3A 3M6XA 2LEBA 5CD4H 2XO6A 3MD3A 1IKXB 1RCXB 3KFWX 4C3MA 1SCJB 3A3PB 3MECB 1TL4A 3ETOA 1M0SA 1O51A 2N3OA 3GJRB 5U47A 3IBWA 3SSSA 2KKHA 2C3MA 3VAGA 4BC7A 3G4SS 1QUPA 4OI2A 1NB7A 1K44A 5D4LA 3SMZA 2FJEB 3HD1A 4EK2A 4LF4J 1HNWJ 1UVNA 3VAMA 4DR1F 3VGVA 2DHHA 1FE0A 1NLKL 5HQLA 1WEXA 4FF4A 2JLEA 1FJCA 3MXHP 3KG0A 2VHGA 4WP9A 1N48A 3R5GA 2VG7B 4RBVA 2H5JB 1DTTB 3EJMA 2BE2A 2WVCA 2YKNB 2ZUAA 5D3GA 2X1GA 2ZBIA 1TUGB 1Y10A 3W66A 4M5LA 4PXBA 4UY85 1JLFA 5M2PA 4DV2J 2VC0A 3FEXB 4OX7A 4KGXB 1KFSA 1DJ0A 2RHSB 4H4KA 4C11B 3MECA 1KLNA 4E98A 3L7OA 5KFMA 4K4VA 3H42A 1VRTB 1JLQA 4OL8A 2E5GA 1ZTTA 5ETQA 3H5XA 2ZHOA 3OW2R 1UKUA 3SFGA 3OL9A 4C97A 2QJ3A 1IQZA 2X3DA 3KK2A 2W2OP 4MMOA 4X64J 3AQOA 2RUGA 4PYDA 3HO1A 3NNCA 1SQGA 4ED7A 4A8FA 3T5KA 2CUYA 3LP0B 5L39A 2FVQA 2PMHA 2PFDA 2W1BA 2VG7A 4IFVB 2CAJA 1R8BA 1FJEB 1RTJA 2WBRA 3BGRB 3K89A 2QYCA 1RJJA 5AXNA 4ID5B 1LEOA 2HGNA 3D54A 5E3PA 1X9MA 2R8KA 2D1CA 3LH2S 3G8QA 4MAKA 5A0YB 3BH6B 1NUEA 4CYUB 4M94A 1OSDA 2JX2A 4QR0A 1JQGA 3CDBA 2POKA 2ADCA 2OSRA 2DR7A 2KRRA 4QYRA 4ECZA 3EVMA 2VQFJ 2FJWA 5JJBA 4FYXB 1L5UA 1UA0A 1RYSA 3GONA 2DH9A 2LLZA 4IOBA 4Z2XA 4RW8B 4EBDA 1Q8BA 2P2CB 4TY9A 4OYIA 2I2YA 2R2RA 1GTEA 1NK5A 2Z4PA 3WC0A 1PIEA 4MK9A 2LMIA 3QGIA 4NCGB 4FXDA 1T02A 1TZ0A 3R2CJ 5FDLB 5IM0B 2IVFB 2M8DB 2RF2B 3LP0A 2FJAB 4DSIA 4L76A 5C25B 1KNZA 4M5DA 1X5OA 2CZVC 2CPXA 1MWYA 4ECXA 3H2VE 1VBZA 3BR8A 3VF0B 2E5JA 4K4YA 4B9LA 1U48A 3V6KA 2HHSA 2RJZA 1ZETA 1BY9A 1KONA 4IKAA 4I68A 5A0YA 4IR9A 2J0WA 2WSFC 5J1PA 2F4FA 1YZ6A 1XMQJ 2FY1A 2XMTA 1KQSR 4IDKB 3ZZTA 1NO8A 4KHPF 2B8QA 1UEUA 4UOCA 1UZDA 2GO8A 4OQJA 3J7ZT 2HQCA 2E1CA 3N9UC 1G4CA 1SC6A 3EGZA 2HZVA 1ZYQA 1VC0A 4I67A 2HQFA 3MZIA 4N77A 1HNXF 2GHVC 5CYMB 1BE4A 2BW2A 3T5HA 1WHYA 4U8YA 4P6QA 1P1LA 4NLTA 3DLKA 1WI6A 1X5SA 1RAAB 1EP4A 2LQBA 4DR1J 2IBOA 1L3UA 4XIUA 4DR6F 4TY8B 5F8MA 1IBKF 2CPDA 4DL4A 1YQHA 2Y1RI 3I55S 4DUTA 1ZS6A 2ZITA 3NBPB 5DZ6A 3ILJA 5BR8F 2DITA 2VJUA 2QLFB 3C66A 4ZVUB 3LUYA 4WTOB 4PUOB 2BJ1A 4YB6A 2CNKB 3MCNA 2ZOGA 1AYEA 4YOEA 2W7OA 2Q66A 3T41A 1NH8A 4NLRA 4PABA 4WPAA 2WB1D 4JI2F 4FPIA 1DQ8A 3O8WA 3WIVA 4GMKA 1GXUA 3M9NB 3NAHA 4WE1B 4C8KA 3R8YA 5IS2A 4CM2A 2RQKA 1KVIA 4UT4A 3RGIA 3EVOA 4O4RA 1FD2A 4WBFA 5EX0A 1IVZA 3F41A 1GXLA 5CYMA 4NRUA 3MM6A 3KKFA 2Z30B 3H4BA 2BE9B 4RW9A 2EFVA 2MZQA 1WG1A 3DOKB 4QWCA 3HT3A 3OFFA 2AYMA 4HDHA 3K0JA 2WONA 3ADAC 3VAJA 5IT0A 3VHQA 1FCAA 4PUOA 1OY6A 2W25A 3MFIA 2DYAA 2DHAA 5KG1A 4F4WA 2VU5A 3MEGB 1ACMB 3KG4A 3KUGA 2NREA 1NU4A 5AJ3F 5H9EJ 1HYSA 3HFKA 2BQUA 3B4MA 3C16B 1T9UA 3H0PA 1N33F 2A1BA 4O3SA 2W4PA 4Y2CA 5HANA 2KM8B 2WOMA 2FLNA 2FIUA 1TL1B 3HVWA 4DU7A 1ZAXA 3N28A 3EM1A 1TL3B 3W9JA 4J9UE 1G3OA 2UVRA 5L38A 1TTHB 2G13A 4PWWA 3GMGA 4Y3CA 3S7RA 4XTTA 3M2RB 1MWZA 2VASA 3DOKA 8AT1B 3A8IA 1RWOB 2GJFA 2HLTA 4Y34A 2AEJA 2ZBRA 2HG4A 3I4HX 2CA9A 1WSRA 3HSGA 1VK3A 4HLBA 3AY0A 2D9PA 3LF0A 4M5MA 4Y28C 3BDEA 1HI8A 1Q5VA 1R3NA 3MEGA 5DGAA 1RAEB 4ZPWR 4IO1A 2HW3A 1S6UA 4CIOA 3C16A 4ER8A 1S1VB 3HHEA 2C1EB 1J5OB 3L09A 2GC8A 4TNOA 1X4EA 4CT9A 2CQ2A 2Y1LB 1I1GA 4KHPJ 2ZKUA 1X7VA 1TL1A 4TVAB 1NDKA 1O8BA 2AIRB 1XR7A 4EWTA 1QAIA 3Q0AA 4C98A 5HLFB 1KLMA 4JUZA 3TX8A 4RBUA 1FRHA 1S6QA 3F73A 3P3DA 1PG5B 1U49A 4QYZK 3UCZP 3UD3P 1HNXJ 4ED1A 1QAJA 2CQ3A 2V4JB 1FFGB 3M2RA 3Q8PB 1AB8A 1Q7YT 2HNDA 1IBKJ 4OYBA 4BDPA 3UN2A 3PZPA 1VQ9S 4K2JA 4TYBA 1NK6A 2PEBA 1RT5B 2GVDA 2EBEA 3TRGA 4NI2B 3EXCX 1WJ9A 2Q79A 4TLRA 3NXZA 2C3OA 2CG4A 2MKHA 1R0AB 3UPFA 3WX4A 3OR2B 3S01A 4ZCLA 2MXYA 1EKSA 1S1VA 2B4PA 1J5OA 5THWA 1WWHA 2XS2A 3CF5Q 2CDQA 1V5IB 2IRXA 4CH7A 3PW2A 2BANB 3CD0A 4NYPA 3MTKA 2K7KA 3QYYA 2U1AA 3GG1A 5HLFA 1XEZA 2UUAF 2H51B 2AJ4A 4USMA 1GFWB 3P45B 1FT8A 1CJVB 3R1LA 4KB7A 1O6XA 3U02A 2ASJA 3PV8A 2XMKA 3QSIA 3D6HB 3J7AN 2V4JA 4DSJA 2E1MC 1HL6A 3I31A 1IWAA 1LWCA 5CQGA 2P9GA 3H7HB 1HPZA 3IM8A 3CTRA 2CQDA 1RT5A 2WBMA 4NI2A 3X1LB 1H2TZ 2I9SA 1SBRA 1L3KA 2CQ1A 3CC2S 4J9QA 1R0AA 1HWJA 2Y1IA 4OV6A 3QIDA 1QSSA 1WC4A 4F4YA 5AJ3J 2CQBA 1N4LA 1Q1KA 3PFOA 4DDFA 4Q2MA 2FJDB 2ZH3A 3PW4A 1JJCB 3R7BB 3LP2A 3CCQS 2GHWA 3I5AA 3FZBA 3HVTA 2KYZA 1YHQS 1ZA2B 3UCUP 2UV8G 5KT2A 3POTB 2ZH7A 5L1JA 2F9JA 3M8QB 4CLWA 2H48B 2RS2A 3DDNA 2JRSA 3RAMA 3W9IA 1N5SA 1RU1A 4NLUA 4OX8A 1OIAA 1R6YA 1SXLA 1UP1A 1J2VA 3GZ7A 4UUWA 2ZH5A 2V4QA 3SCJE 3PRBA 2EPIA 4DL7A 2I5JB 2XLIA 3JSRA 4DJBA 1WHWA 1ITPA 4NA2A 2MEWA 4CO5A 4W90B 1DTQB 1FEEA 3NG8A 3W65A 4ZP7A 4ECQA 1KOHA 2YWFA 1TUWA 3AJDA 3DN9A 4OYAA 4J9OA 1Y0HA 2MKJA 4URSA 6FD1A 2EEYA 3HXMA 2BM1A 4D3GA 2DGVA 2FHKA 4XDCA 5BYSA 1X0FA 1VLYA 1WHVA 2B6AB 1Z1ZA 1Q8IA 1YX2A 1A7GE 2NPIA 2JVRA 1XK8A 2PC6A 1B4SA 5K8OA 4KPCA 4DZ6A 4ES2A 5MLCV 2D69A 1SJRA 1ZBTA 2L41A 2VA2A 1JMTA 3MR7A 2RRNA 4N5SA 2HWTA 2XMVA 5J2NA 3NRBA 4RNOA 4OYMA 2ZVSA 3Q24A 4DV5F 3OSNA 2BRKA 4YDDB 4OI1A 5KFQA 2HNZB 2P5VA 1KR4A 1VBYA 2I5JA 4OX6A 4ZIVA 2DR8A 1A6LA 4O3QA 2MQQA 1IKVB 3EGVA 4CLYA 3NS6A 1WDTA 1CJUB 2G1DA 1SVDA 1GNKA 3NGUA 1ZM2A 1XIQA 1RHJB 3BEGB 4U7UD 3U1NA 1SH0A 2N7YA 3BV8A 2ZC3A 1MMNA 2BACA 2N82B 3TAPA 5CYJA 4HT7A 3V81B 4V19X 1M1KT 1YG0A 4CP5A 3ZXWA 3QMQA 4KAIA 1R27B 3H2UB 1IBMJ 2MZTA 4C0OC 5HP1A 4USVA 1RLDA 3R27A 5ADZA 1OJ4A 3SQOP 3GYGA 4ITSA
chains in the Genus database with same CATH topology
4KC5A 2H9ZA 3PACA 4YUDA 5KFGA 3BZQA 1SJFA 3DOMA 5DDOC 5JUMA 4WE1A 2EK6A 3B78A 1U6FA 3NCPA 2VFUA 5IZHA 5AE1A 2RH3A 1SH2A 3H59A 4IUFA 4Q44A 4Q2LA 3TR5A 2HHTA 3M30A 3ULHA 1RT6B 4YR0A 4MK8A 5KOXA 2UVVA 3PNIA 1S1WB 3ITHA 4FXWA 3CCLS 3VAIA 4AL6A 1WELA 2RU3A 2B56A 5KG5A 2RKIB 1KN6A 4RW4A 1E6VB 2KYXA 1FF2A 2L9NA 3QAUA 1QTMA 1JLQB 2UU9F 3DMJA 2BDPA 6FDRA 4YHHF 4F4ZA 5CZVA 2HNZA 3V6DB 3ZZ0A 2HFNA 3GR0A 1X5TA 4KGKA 4WK3A 2F8EX 3OUYB 3I56S 2MJUA 3F44A 2LDYA 2YWKA 4M1KA 3E8OA 3BGUA 2CPYA 4QIWD 3ZZYA 1DARA 3LPYA 4FZVA 3KLGB 5DQHA 1H3DA 5BYQA 4KO0B 3UQSA 4BHQA 1DLOA 2ZKTA 2RS8A 3DU5A 1NJXA 3ISNC 5SZTA 3U7JA 3KK2B 1Y3JA 2QMXA 1KD1T 3OR1A 1FA0A 2YKPA 4AFFA 2DGSA 3E51A 5HO4A 2QEXS 1FXLA 3DHWC 3O6QA 1D8ZA 2NXUA 2HWIA 2ZH6A 1NK0A 5DLGA 4P7VA 3KNGA 2HS3A 4E0DA 4QIEA 3JSMB 2C2EA 2UZAA 3DXBA 2C2RA 4IYQA 1S9FA 2D41A 1Q82T 3I4PA 1YI2S 4QBUA 1FESA 4OJGA 1N6QA 3SV3A 3TA0A 3QO9B 2J8AA 4JI8F 3V4IA 4K4ZA 5IFMA 3QZ7A 3C6TA 1K8AT 1XTZA 3C46A 1OS5A 4HEA9 2HMIA 1JLAA 2M8HA 2XHWA 3BO4A 4HT5A 2AWZA 5GAHI 4IRDA 2RRBA 4HI1A 4EYIB 2LA6A 3WDOA 2BXJA 2GQ2A 1F5AA 1RTJB 2HGMA 3DHXA 3F56A 3V2UC 4DN9A 4YB5A 1JXLA 4ZVHA 2MZRA 2HS4A 4LFBF 3V81A 4OI4A 4F3OA 1YIJS 3CULA 1T3NA 3RRHA 2IJNA 4PG5A 2CPIA 3SSRA 1Q7LB 2DT9A 3AA9A 5DQGA 1ZPWX 3FJ2A 4F25A 5GAEI 4PXDA 2D3OR 4MYTA 3BGLA 2RT3A 3FFIB 2M70A 2NR0A 1HBUA 4DWIA 5KFSA 3MR6A 2K1RB 3V6JA 4GO5X 1LV5A 1RTHB 3CC4S 1S99A 5FJ4A 3PEJA 2XMWA 4QQBA 4C8ZA 3B82A 4BCAA 1YRTA 3RB4A 4QIVA 1L3VA 2LVWA 1M5HA 3DDKA 2ZE2B 5KFXA 4OI0A 4UQGA 2I1RA 1LFPA 1WEZA 4X4RA 3FRZA 4DF8A 2DNYA 3LP1B 2CJKA 2OPPB 2V8DA 4ED2A 3QPIA 2VFVA 5J1EA 1T05B 3PW0A 3ZZUA 3CJ3A 1TL3A 3KJVB 3NCQA 3U27A 4J9KA 1YRXA 2FJBB 1TL5A 1QJHA 1RT6A 5EHHA 1FDNA 2KRBA 2QA2A 2GJIA 4W92B 3HLUA 2HHPA 5C5JA 1S1WA 1S7HA 1X4DA 2JZ5A 2ZH4A 4JI3F 3PKYA 5LMUF 2AD9A 2NYIA 3QJLA 1RQ0A 1SJ1A 3IGVA 1E6VA 3I32A 3CD6S 2YX7A 1DAXA 2I0XA 3MUVP 4FS2A 1QVGR 2EC0A 2O1PA 3BO3A 5HBMA 4YR2A 2QSFA 1SL1A 3G6ES 4ALZA 1JK9B 2EFQA 2VPWB 5KFVA 3V6DA 4DV3F 2UVWA 4OX9F 3BDPA 3EGNA 4YMEA 2EFGA 3JB9k 2FB0A 4WTYA 4CCHA 4K5SA 2LCWA 3OQ2A 5I42B 4X65F 4ZA1A 1RA6A 2EVZA 3CT9A 4CH0S 1TKZB 4C0HA 3H40A 4J9PA 1AW0A 4Q8EA 1HA1A 3DFEA 3NGDA 1HWLA 3KLGA 2M7SA 4B3RF 2VPZB 4G1QB 1RP5A 5FIIA 2MY8A 4I7FB 2VC1A 3CD7A 4WYWA 1TKDA 1M5VC 4DV7F 3M1VA 4XAKA 4ID8A 5KFZA 1RT3B 2DIUA 4DR2F 2CPJA 1C4CA 3LWMA 5T14A 1S76D 2F3JA 3AA8A 3R5DA 3QJJA 2FVRA 2V5HG 2MPUA 2R7OA 2KJWA 3JSMA 2FVCA 4PWUA 3SV4A 3UDCA 4A8QA 1S77D 1C1CB 4F2SA 2E9ZA 5KFOA 1PC5A 3S6EA 5KG3A 1S9GA 3M9MB 1YJVA 1R8CA 2DPJA 4DL0C 3NMAA 1VK8A 2WRMA 3I87A 4U6PA 2J0XA 2WAQD 1H98A 2B3TB 1GXTA 1SL2A 2M0GB 4M5DB 1N0UA 5HI7A 4LF8F 1M5KC 3K5LA 3N5BA 3GIMA 4DR5F 4KIAA 1IJFB 1RT4B 2J9DE 4FP9A 4QWBA 1N5TA 5L8RC 2IAJB 4V19J 3I0SA 2R8JA 2KH9A 5GVQA 2XBPA 1W2BR 4EZ9A 1LK5A 3MURP 2UP1A 4EEYA 2FTRA 4A8OA 3RYLA 1JXEA 2M2BA 4DV1F 4WXWA 2OTJS 3HDSA 4CZCA 4TU8A 1Q86T 4NLDA 1IBMF 1K1QA 3ENWA 3JSBA 1RTDB 2OFHX 2J9CA 3IO1A 1YRUA 3KMQA 4DUZF 3SI8A 3N6LA 5L9NA 4P7TA 4N47A 2K1RA 5AXMA 1WF0A 1D9AA 2GNKA 1D1UA 1RTHA 2YWEA 1NZAA 5J2PB 2Z2LA 1FVQA 3G6YA 1P6TA 2ZH1A 1UETA 4HH1A 4B02A 1PSDA 3GFHA 2RDJA 4KGMA 1U1PA 2OPRB 4FVCA 2FJVA 3W3SA 3IXQA 3H8YA 4MK7A 3HHLC 5D4OA 3KLEB 1LOUA 4KE5A 4LVOP 4L6V3 3V6HA 2H5EA 3BSAA 1T05A 4O4GB 5KFFA 3KJVA 2FHJD 2KT3A 4RNHA 1KSPA 1XWLA 2KT2A 3P6YC 2NZ4A 4CT8A 1HWKA 2AGPA 4R0JA 1H38A 5F8IA 1U6ZA 3ISND 4G1IA 3MM7A 5IQQA 5HMWA 2MJNA 2CKWA 1YJRA 2LEAA 1SUQB 3MM8B 5LXYA 4DS4A 4NPOA 3KHHA 1REVB 2K2PA 3RB0A 3MGJA 3UDLA 5KFYA 1S72S 3PO4A 2R7QA 4A4JA 2MHEA 4WFXA 5LJ5Y 4JI7F 1FTRA 1PILA 2DNHA 2LA4A 4DN0A 2LECA 4PRFA 3D28A 4F4KA 2DNPA 1F2GA 2ASLA 4X66F 1IKYB 5I42A 2DGOA 4ECUA 4R5PB 1APSA 4TKTA 1FDDA 1C0TA 3EZ5A 1CG2A 5CCMA 3IRXA 3HZGA 4I2QB 1N5YB 2R7UA 3G71S 1C4AA 4UUXA 4I7FA 3H98A 3CD5A 4ED8A 3DLKB 1SIZA 2ZOFA 2RD5C 1EP4B 3CO9A 4ZVGA 3BJYA 3WBZA 3MTJA 4KHMA 2VG5B 3N5FA 3CC7S 1RDRA 5DGBA 4KRWA 2JJ4D 2JC1A 1MMDA 1C1CA 3IGNA 4DL6A 2CQHA 2BM0A 2XI3A 4Y2AA 3J81Y 3T5JA 2ZHBA 5HN0A 1N5YA 1FEHA 1N34F 2J0QD 1FNXH 1FRIA 3O3LA 3CCWA 4QWEA 4FXVA 2C2DA 4MYUA 3OR2A 4OIXA 2BA9A 2PMZD 4PQAA 1ZM9A 4RW6B 5DDPC 2IAJA 2VKRA 1G2EA 2IA0A 2PA8D 4DEZA 2VH7A 4ERDA 2V4RA 2XNRA 3BS9A 2F9DA 5KFAA 1OPIA 4H4OB 4X62F 1TK5A 2NLWA 3FQLA 1KS2A 2OMLA 2R7XA 2G0CA 3MAQA 1WF2A 2BJEA 4DV2F 5KFIA 3HHDA 4ETXA 2XSJB 4YFUA 4YY3F 1ZOTA 1K0VA 2XGQA 3O2IA 1X4HA 1FK9A 5J2PA 4ECVA 2XMMA 2DB1A 5SUHA 2YWHA 1JJ4A 2R7RA 4NOHA 4CO0A 1TFWA 2OPRA 2BANA 5I3PA 3TVYA 3K8VA 1XMOF 3TA2A 4EO6A 5M2UA 3OPKA 4RUAA 1Q8LA 1VIOA 4K4UA 2FHMA 1S9EA 5IQ6A 4O4GA 5E41A 3SQGB 4USIA 4ELTA 3NAIA 5KFJA 5K14A 4O3RA 5KFNA 2OKQA 3KLIB 1YJ9S 3KHRA 4ZMMA 2DHXA 4U9RA 3PM9A 4KJIA 1IN0A 1E6YB 2GQCA 4N8OA 1U2FA 3RW7A