2D3OW

Structure of ribosome binding domain of the trigger factor on the 50s ribosomal subunit from d. radiodurans
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
66
structure length
66
Chain Sequence
MKPSEMRNLQATDFAKEIDARKKELMELRFQAAAGQLAQPHRVRQLRREVAQLNTVKAELARKGEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title The Binding Mode of the Trigger Factor on the Ribosome: Implications for Protein Folding and SRP Interaction
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Ribosome
total genus 11
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2d3oW00
4WCEV 4WFBV 3OW2U 1VQLV 1K9MW 5DM6V 1YHQV 1KD1W 1JJ2U 1QVFU 3G6EV 1W2BU 3CCJV 1QVGU 4WF9V 1YJWV 1YIJV 3CD6V 1VQ5V 1Q86W 4WFAV 3I56V 1VQ8V 1YJ9V 3G4SV 3CC7V 1YI2V 1S72V 1VQ4V 3I55V 1VQMV 3CCVV 1K8AW 3CCMV 3CCRV 1KQSU 3CCLV 1YITV 1VQNV 2QEXV 3CCUV 1R73A 1Q7YW 1VQ6V 3CC4V 3CXCU 3G71V 1VQOV 1VQPV 2OTLV 1VQ7V 1K73W 1YJNV 2D3OW 1NJIW 1Q81W 1VQ9V 1Q82W 3CMEV 3CMAV 1N8RW 2OTJV 3CC2V 3CCSV 1KC8W 1M90W 3CCEV 1VQKV 1M1KW 3CCQV 3CPWU 2QA4V
chains in the Genus database with same CATH superfamily
2ZQMA 1UJWB 4WCEV 1NH2D 4LCUC 4Q20A 4JI8B 4Z1MG 1EZJA 5CBFA 4G27B 1S3JA 4QE9A 1N32B 2Q7HA 2NLJC 3WFVA 3JATA 3CCLV 3JASA 1PNMA 2K1EA 3B8NA 3CSXA 1VQPV 4UUJC 1S77D 4UVCA 2VQFB 5GW7A 3JCZA 3RN4A 4OPHA 3OW2U 3VQYA 1L0LH 3BAAA 5LXTA 1XMOB 1DK1A 3I56V 4PV1B 3OR7C 4J9ZB 5BR8O 1XNQO 4B08A 3CJHB 1K3EA 4DR5O 4DV5B 1W59A 3CCEV 2KG7A 3CCQV 2UXXA 3CRCA 5KHIA 4X8AA 4RQEA 2UXDB 1GKFA 3HB3B 2FKXA 1QLEC 2O57A 3G80A 3RBZA 1JX9A 1NBMG 2DWDC 1PM9A 3EVKA 1ZUQA 2LQTA 4KP4A 1V54B 2BOCC 5KX5A 3QTCA 1N34O 2WSSG 2ATKC 1YTFB 2PI5A 4JI2B 4MVOA 5KMGB 4FLZA 1SESA 2FYUH 3ZHUA 3OTOO 1AR1B 4DV4B 2H8PC 3AG2B 3BRCA 1K5SA 2WLLB 3OMAB 5CN0A 2YXLA 1H2NA 3M8AA 4WFHA 3T1CA 3IC9A 1BHBA 1SA0A 3AK2A 4GYCB 1I94O 1IVSA 3OGCC 2BOBC 3CCVV 5JCOA 1G8MA 3Q4HB 5GONA 2JJ2G 4J7JA 1ZL8B 2HP8A 2N05A 3H9VA 1L1FA 3M99B 2W6JG 3RW0A 2UXCB 1S5HC 2XTAA 4OPAA 4UV9A 1VEWA 1JJOA 2WA4A 3KCYA 3FYEB 1AJNA 1FXHA 4N23A 3LDDA 1HNWO 4LFAB 4B7EA 4LP8A 1RM1B 1F51A 4WBNA 4DV7B 4O4JB 2JGUA 4JI5B 2ADPA 4DV6B 4AHCA 5FNVB 2R9AA 1N36O 3TXSA 2DYRC 1L8DA 1SQVH 1I0HA 3ABUA 1VARA 1IBMO 3JALA 4FFBA 2P22C 2XNDG 1Q43A 3K79A 1GK9A 1OCOC 4LWSB 4JI3B 1NQTA 3JALB 1N33O 2Y0IA 1EZVH 1IZ3A 1YHQV 3K59A 2OCHA 2CK3G 3RYCA 2EIJB 3MD0A 4DR1B 2BSKA 4DRXA 3F7YC 4FZ0A 2QM7A 3OUFA 2GHYA 4W4LA 4X1KB 4X65B 2JDIG 1PL0A 4NXMO 1BS3A 3A2FA 3ZJZA 3SJAC 2EIKB 4I55B 3SYOA 1B06A 3ZHTA 3FB5C 3B77A 1JA8A 1H8EG 3QO8A 3JSNA 3ZN0A 2HVKC 5LMNO 1GN3A 3RT3C 1QR9A 1JOYA 2Q0OC 4EB6A 2WLJA 1Q82W 5FPRA 2LP7A 3RYIA 1SF9A 4LF9O 5EBLC 1WP7A 2WWWA 4EB6B 4CH3A 2PZSA 5BMVA 4Z2WA 3RYIB 1CPYA 5IY5C 2ZM6O 2Z5UA 3GWKC 4MW8A 4GX5A 1X59A 4K8XA 3CC4V 4PDRA 1MABG 4BAYA 2JS3A 4YHHB 3T1HO 1YSCA 1BL8A 3CC2V 4B3RO 4PA4A 4WFBV 2IM9A 2XT9A 5JWPA 2UUAB 1E1RG 4UB8Z 4OXSA 3ICXA 2P67A 3RWRD 1IBLB 4DR4O 1ENVA 1B04A 4LF5B 1Q90D 2QM8A 4TV9B 3L72H 1KQSU 3AG3C 4NXNB 1D2DA 1HW7A 1D5NA 2R72A 4TQDA 2WLNA 1LUWA 2VRZA 1ZWIC 2LO1A 5KAFZ 2BTQA 2OTJV 1Z5VA 1H2KA 3AG1C 1YJ9V 1VQLV 1XL4A 5H5NA 2F93B 2ILMA 4DYLA 2N04A 4JYBA 2E75B 4ZI7A 3ABMB 2H94A 2Q69A 3KKYA 4AI8A 1R6KA 1XMQB 4J42A 5H2FZ 1E1QG 3ABLC 4JI7O 1JR9A 3ZX6A 2KSDA 1B3QA 4JYYA 4YY3O 1WJZA 4MTFA 1HNXB 4PDMA 2QE7G 1WA8A 3R66A 4PELA 2KB1A 4FVMA 5B66Z 2UXBO 5L3CA 2WLIB 3BPZA 1J95A 4TUYB 4FK5C 2RDCA 3N2GB 3K5OA 4UCRA 3JD2A 3UO3A 5ITZB 1OCZB 4O2BA 1YDXA 1XUQA 1DF4A 5KA6A 2CUGA 4R6ZA 5IYBO 1MSDA 5GTHZ 4LBEC 4QGPA 1HNZO 1K8AW 4X20A 1BSMA 1M56C 1RSOA 2X6AA 1FFXB 1VQ7V 1FD9A 3EFFK 1VMGA 4JI8O 5LA6A 3UT5B 3LUTB 1N32O 2DOSA 4ABMA 2ITDC 2JEUA 5JVDB 1SZTA 1VQMV 1KKDA 2UU9B 2VQFO 2OYQA 3OEHG 3E2EA 3VQVA 1XMOO 5LHHA 1EN5A 3DXRA 5DM6V 3F5WC 2IU3A 2YI9A 2JGDB 4KFMA 5B1BC 2C2AA 4UB6Z 4DV5O 3FKSG 1T5EA 1SQXH 2RCVA 4PA3A 4UVBA 4X62B 1O9GA 4LFCB 1O9HA 2UXDO 3GVMA 2XAJA 4NR1A 4RUEA 4O2AA 4DXWA 1LNQA 4F4LA 4WFAV 2QDOA 2Y48A 3SDLA 3I55V 2F66C 4GCZA 4DK1A 2GBOA 3RYHB 2RN9A 3ASNC 4D6TH 3ZS8C 4U3JB 1IX9A 5IYDO 2DYRB 2P90A 4ZHQB 2P4VA 5JQGB 2OCCC 4JI2O 4BIZA 4N21A 2B5UA 2OT5A 4O4HA 4DV4O 4GKKB 3HKDA 5B1AB 3IFXA 1N4CA 4X89A 3WG7B 4DW1A 1NR1A 1YEWA 2XOKG 1K5QA 4EEQA 2KKWA 1XNRB 4LF8B 3E83A 2ZT9B 1DF5A 3PJSK 3RVZA 4J9YB 3ASOC 3FAVB 2FMLA 2RJZA 4IYHA 4TV8B 2YEVA 4RQFA 4X1YA 1GAXA 4MS2A 3U0ZA 5DN6G 3QO7A 4J41A 5CA1B 1YJWV 2EIMC 3QF7A 2ZXWC 3L71H 2A06H 4B3TB 2RNBA 4H0LB 2IJKA 4LF4B 2EULA 5LMUB 2JVDA 3CX5F 4IYIA 3ZHSA 2UXCO 4YJ3B 3QG5A 1H2SB 2DMXA 2YUAA 3DGEA 5BXZA 4Z1VA 5KHGA 4FLVA 2ZIMA 1K9MW 4HNAB 4CC5A 1YIJV 5F2VO 4CH5A 4LFAO 4QIWF 5C8YA 3JAWA 3SYQA 3ABKC 2JK5C 3LNMB 3J7AU 3OMNB 2W6IG 3E35A 3P32A 2ZR3A 1W0KG 4IIJB 2QWNB 4DV7O 3APOA 4YXWG 4DV6O 5IY5B 4BIUA 4PDLA 2Q7GA 3ZRWB 2LGQA 4L87A 2EILB 5LL6Y 2OIGA 4JAAA 4BWAA 4RAIA 5CMUA 3TXQA 2HR3A 1LUVA 3CD6V 3JYCA 2VWKA 2Q0AA 3AG7A 2Z3YA 4JI0B 1AJPA 3BHPA 4JI3O 2E76B 2Y4UA 2HFEC 1NI8A 5EYPB 1XEQA 3HKEA 4DR1O 5IWAB 1WP8A 3FB7C 3A8TA 3N2KA 1Q5OA 3WU2Z 1GTOA 4FJCC 3HKEB 2A9HA 4X65O 1XHZA 5CBGA 2YICA 4BIOA 2QWQB 1AI5A 1S76D 5JJEB 2PI4A 2V1DA 1BGYH 2CAZC 2XUMA 4X64B 4YIOA 4PA7A 1OCRB 3SJCC 3HKCA 2ZNIA 3APQA 1YVWA 3FFQA 2A0LA 3JATB 3VQXA 3JASB 2E3CA 1WB8A 5LGNA 3OGIB 2OWOA 5IJ9A 5DEDA 4DV3B 4ZKIA 2AHZA 5FLXN 5JJNB 1V55B 2MW2B 4CC6A 4JF3A 5LXTB 2OTLV 3O65A 1KBHA 2D3OW 4F6EA 4DUZB 3ZMVA 2X6CA 4CS4A 4MVUA 4QJFB 1IURA 4JZGA 3K57A 1KECA 1SRYA 3IGAC 1Y67A 4YHHO 3ZRXA 2Q5ZA 3UKMA 2QWPB 3IAYA 2KG7B 2CGOA 3BVOA 4UVAA 4GT1A 4PDVA 1DLBA 4JAVA 5GTIZ 2IH1C 1BQZA 1OCCB 4TQFA 1MA1A 2UUAO 2XASA 1IBLO 1M56B 4LF5O 4NTYA 3JD1A 3K03A 4IHJA 3JAKA 4QNHB 3UM7A 4JI6B 3K9SA 4LR3A 4NXNO 1R3KC 4BR6A 4CBCA 1IXMA 3H1LH 3QO5A 5KX5B 1Q7YW 3LSSA 4H37A 1ZSPA 2FB5A 4R7CA 2DN9A 2CTRA 5LP6C 2KQXA 4FMTA 1P7GA 1VP7A 1NVPD 1XMQO 3AK3A 3E8BA 3ETEA 1R3IC 2L6LA 1AI4A 3TETA 1NU1H 2ZNJA 1SA0B 1V9PA 4K3AA 1HNXO 4O4IA 3ZIAG 1XILA 3K3WA 2PYLA 3CCSV 1QNMA 5B3SC 1M90W 4LFBB 4DK0A 1SERA 5GONB 1PD3A 1Z5WA 1QU7A 2DW4A 1VQ8V 4TT3G 4UCVA 1K4CC 2ZR2A 1UFIA 4LF6B 3SJQC 3OUSA 4FM1A 4DR2B 1GN2A 1FYJA 4LH7A 2YIDA 4DW0A 2QA4V 3HKBA 3VOUA 1DGSA 5FPOA 4PI2A 1KB9F 2EINC 3L70H 3OTFA 1D5AA 3AG4C 4WBNB 1Y66A 3CWBH 2E5LB 1QQCA 3I5DA 4CZZA 2HVJC 3X2QB 2NN4A 2Q4PA 4FFBB 3W7XA 2UU9O 1WB7A 4EFBA 4U7NA 2A7WA 1HWYA 5IDJA 2VQEB 1KMIZ 4MVQA 5A9GA 3AK1A 3E89A 3ZBHA 3ZMZA 1QHTA 3ZN1A 3RYCB 1AB3A 3LSUA 2DQ3A 5KUKA 1TUBA 2BSKB 4DRXB 4B3SB 3H1JH 3P30A 1E79G 3RYFA 5IJ0A 2P5OA 3JCUZ 2JS5A 1PL4A 3R65A 4FLWA 2F4VB 2CH7A 1AVMA 3RYFB 1S0VA 3ZMTA 4X62O 4MT8A 4NB5A 2B1IA 2ZE7A 4LFCO 2R9RB 1VQ6V 4PA6A 1OHHG 2Y0PA 1XL6A 2HKOA 2ZKOA 4EFEA 1TAEA 1SQGA 2AGAA 3EXAA 1BE3H 1TVKA 5BY1A 3SPHA 1H38A 3C90A 1U96A 1MG1A 3JD3A 2DYSB 1Y6XA 1S72V 3H1KH 1FXKC 2PUSA 5L3BA 3BFRA 2E74B 2ADQB 1MSWD 1KP2A 2GUZA 2PTMA 4H33A 5BMVB 3J80N 4I5SA 3JD4A 2CGNA 4CS2A 1M57B 1BQ0A 4GKKO 2WLMA 4FLXA 1QBZA 1W0JG 2DE0X 3ZRSA 4J7ZA 5K1PA 3CRAA 2Q7EA 1PNKA 1HP8A 1Q86W 1XNRO 4LF8O 3AEIA 1Q3EA 5CB4A 2RQ6A 3NXSA 5CA0A 2QEXV 1K92A 1G1XB 4NTWA 1L0NH 2XAFA 2Y69C 5KLVH 4NKGB 2FTKA 3CRQA 4B3TO 4LF4O 2CE4A 2AHYA 5LMUO 4PHZA 5B1NA 1R6TA 3O9OA 2BTQB 4X1IA 2QKAA 2LW7A 1HR0B 3ZEDA 4F6RA 4WFFA 2M6YA 4X88A 2JIZG 3L75H 4MVRA 4ZI7B 1SQBH 1IBKB 4FLUA 1K34A 5J2UA 1KUQA 4FM2A 4LF7B 2F95B 1AI7A 3F5TA 1BZKA 3UCSC 3THOA 5TISZ 1XQ8A 1SKVA 2Q9LA 4XDLA 1VQ4V 4R50A 5IYZA 3DC6A 3SYPA 4U3FH 3K0DA 1WA8B 1RFYA 4UCSA 2BTOA 4DV1B 3GWOA 1N8RW 2V7QG 3FB8C 1QLEB 4JI0O 2PYJA 4H44B 1JQ0A 4ZIBA 5E79Z 4G2KA 3CB2A 1KYOF 1WN7A 4HAMA 4O2BB 5FL7G 3CCUV 4GLXA 5IWAO 3STZC 4LNUA 1FKAO 5LP6A 2ZE6A 1KC8W 2YIAA 4X20B 3B2EE 1KKCA 1RSOB 3RFRA 1FS0G 1KU9A 3H01A 4FZ1A 5LBQA 1H2GA 2YDEA 5LA6B 4X64O 1EM1A 1RPRA 4JGSA 4JV5B 1V54C 1EN4A 1RP3B 5BZBA 3T1YB 3MHSC 3K5LA 3L74H 4XDJA 2IJIA 4MSWC 4DV3O 5L3FA 4DV0B 3W7SA 4MTOA 3E8HA 4K0KB 3AG2C 2VS0A 4BW9A 4DR6B 5B3SB 1Y74A 3CYOA 1JMKC 3DXRB 4DUZO 5LYJA 4R8CA 4JZ2A 2AXTZ 3ZHQA 3BA9A 1I5XA 3TGUH 2YIBD 1TA8A 2HHHB 2F1MA 1S5JA 5KUMA 2GSMB 1EFRG 4UCTA 1M1KW 3H1IH 3TK1A 3SYCA 4J11A 2CTPA 4ZBMA 3SR2C 1FJGB 1YITV 2NNUA 1NH2B 5L3GA 3TCUA 4TOIA 2EINB 3E22A 2ARHA 4O2AB 2B1GA 5H6QA 4JI6O 3J81N 1FPOA 4U7OA 2P06A 4FFKA 2AW9A 3E8FA 4E4EA 3TJTA 5J2TA 3CCJV 5HFMA 2YXYA 1OCOB 4CH6A 1RM1C 1SQPH 4YJ2A 2ETNA 3CXHF 4O4HB 1I5YA 4LH6A 5D5PA 3HKDB 3NR7A 2CTWA 2HEPA 1H2LA 1GMGA 3OM3B 1MMMA 4H13B 3FYIB 3ML0A 4LC1A 5DECA 4IGGA 2CDYA 2W0FC 4GKJB 1P4RA 4JI1B 2YEVB 4X1YB 3BEHA 4LFBO 1PP9H 2EIJC 3QVNA 4P30A 4ICGA 4C7UA 1MNGA 1AI6A 2IU0A 1Y76A 1SETA 2H3OA 3RGBA 2YC0A 4LF6O 1X4TA 4DR2O 4DO2A 1FXKA 4ZOLA 1CP9A 1I08A 4I50A 3JARA 3S3XA 1J5EB 4KXRA 2EIKC 2ZD9A 1VQOV 4JTAB 4JI5O 1WPXA 1NJIW 1PNLA 1Q81W 5C8YB 3JAWB 5KHHA 4WFEA 2GV9A 1YZBA 3S3WA 1GM9A 2E5LO 4JASA 1W2BU 4MVMA 1AR4A 3T4ZA 4DUYB 3OD4A 2UUCB 3HR0A 2XAHA 1UPGA 4OGQB 4GX1A 1K73W 1K7DA 4IL6Z 4L8JA 2VQEO 3AG3B 2EX3A 2IJHA 1XHXA 5EZYA 1VF6C 3P3NA 4AQYB 1Q6UA 1PV0A 1GN6A 4OX9B 5JH7A 4O4LA 3AG1B 4X66B 1SQFA 4B3SO 3N2KB 2QM4A 5L3DA 1TUEB 4UCUA 3ZMUA 3K58A 1FFTB 3A0BZ 4BW5A 2F4VO 3WB2A 5LHIA 2X0LA 4DR3B 3ABLB 1M4UA 3K06A 3HKCB 1B6QA 4A5UB 4DR7B 5HFLA 3ZCCA 1JPXA 2B9ZA 4P9OA 2QTOA 2HG5C 5IJ9B 4MW3A 3G67A 3ABMC 4B3MB 3CJHA 2ZIOA 4MVSA 2WAMA 3SPJA 3D3IA 1AP6A 4Q6GA 1S5LZ 4AILC 1WPBA 2DJVA 1F7YA 2HJFC 4RO2A 1N0NA 4GUNA 3W7TA 3D8CA 1GH6A 2D2CB 2P6JA 3OT7A 4TSFG 2Z0AA 1GO3F 2P7TC 2W0XA 3A0HZ 5EC2C 5IE9A 3OAAG 2F23A 3CCRV 2AZ0A 5D5QA 4IHJB 3JAKB 1OCZC 1NTZH 2DQ0A 3KCXA 2XAQA 2ODMA 1F4MA 5KMGA 4KHPB 5H6RA 2P4KA 1HR0O 1XI1A 2WLLA 2Q73A 4KL1A 3CE2A 3SGIA 1WAZA 5IT9N 4UCOA 1ZLZA 1IBKO 1M93A 2BE3A 1ZX3A 1EN6A 5B1BB 2YSUB 4D7TA 4D7SA 2UUBB 4LF7O 2A3QA 2QTSA 1P84F 1NKDA 3IC7A 1IDSA 2QWRB 3WB1A 3Q4HA 1ZTEA 2V4DA 2XHBA 1BMFG 1NT2B 4O4IB 3STLC 5LGTA 1ZL8A 4RUFA 4DV1O 2GTAA 1M5IA 4RWUA 4EKWA 3G6BA 3K0GA 3G71V 1NZ6A 2QWOB 2F43G 1Q6IA 3IJ4A 3ASNB 2AZ2A 4JYAB 2OCCB 1DTOA 5JJJB 3BY6A 4O4JA 3HKBB 3WB0A 1R73A 5FNVA 2UXNA 1A32A 2JEXA 1JCHA 5EC1C 4JTDB 1KD1W 4JV5O 2Y4TA 4UV8A 1AILA 3T1YO 1P49A 4P2ZA 3ASOB 5L3EA 2LJ2A 4J7KA 4LWSA 4DV2B 3VQWA 4PI0A 3EHBB 3MAQA 4DV0O 2EIMB 2QSAA 4K35A 4K0KO 2ZXWB 3GB7C 3CMEV 1VF5B 4JYCA 4W4KA 3ABTA 4DR6O 5B1AC 1R6NA 1PPJH 3WG7C 1GN4A 1H2MA 2WA3A 4JI4B 4X1KA 1TUBB 3D3QA 4QPKA 2PGGA 4I4TA 3OE7G 5IJ0B 4PA9A 4MTXA 2HHHO 3K04A 2EZPA 2R9IA 4I55A 2YS8A 4I4TB 2CH7B 1YTFD 3ABKB 3CP1A 5B1OA 2VWJA 2EBOA 3LDEA 1WLEA 2Q8VA 1YXBA 1MOFA 1FJGO 3UO2A 3G6EV 2ZE5A 3VBBA 3M7MX 2IW5A 3L9DA 1YI2V 1I7FA 1BT8A 1TVKB 2ZDIC 2YXHA 1NS1A 3MDSA 1F4NA 5BR8B 1XNQB 2ITCC 4J80A 1JVMA 1K4DC 1ORQC 4IT5A 1H8HG 1VF6A 2Q67A 3D36C 2GUZB 4DR5B 1M9NA 3ETDA 2EILC 1RPOA 1AR5A 1TGOA 5LOVA 3JSLA 1NR7A 1SC5B 1VQ9V 3CMAV 2YIBA 1QCEA 4TV9A 5CB4B 5CBHA 4GKJO 5E1AC 5CA0B 4JI1O 5LOVB 3B4SA 3A0RA 5B5EZ 4HBNA 3N27A 3FD9A 1NTKH 4NVPA 4GZRB 3CCMV 1N34B 5EBMC 2ZCEA 4UXNA 2LFRA 1THZA 3T4DA 4X1IB 5LHGA 1YCIA 2JRIA 3OTOB 4GX2A 4F6RB 5KA5A 1EBOA 1LR1A 4JTCB 1J5EO 1OV9A 1ZAUA 3DSQA 2M7WA 2BCCH 2NR5A 4HYOA 1OCRC 2IH3C 5EIBD 5J2UB 4I9WA 5IYCO 3ZHRA 2ZE8A 1U97A 1I94B 4ASUG 2QKCA 5IYZB 4K8ZA 4DUYO 3K5MA 1Y4MA 4QPJA 2UUCO 3KG2A 2WLIA 4TUYA 1XREA 1FAFA 2GTSA 1JJ2U 3W7UA 3N2GA 1V55C 2Q68A 4I0XA 1VQ5V 3U10A 4X9QA 1AP5A 5ITZA 4MTGA 1GM8A 4I0XB 4JPRA 5KHKA 4AQYO 3OR6C 1HNWB 4OX9O 2WPDG 3CPWU 1AJQA 1KP3A 3ZMSA 4E2LA 4X66O 3ZHVA 2K9PA 4LNUB 1FFXA 3QNEA 3K5NA 1OCCC 5LP6B 1Q8IA 2Q6AA 2XAGA 2X7RB 2QJ1A 1SQQH 3UT5A 3CHXA 1N36B 5AG2A 3P3PA 4DR3O 2WLKA 3DC5A 4YIPA 5KAIZ 3UQ8A 5JVDA 3W7WA 4TWKA 2WLHA 3E86A 1IBMB 3B40A 1CXZB 4DR7O 2PF4E 1QVFU 3SPCA 2ZINA 2HLDG 4GX0A 3ETGA 5J9PC 1VIBA 1N33B 3BABA 3MHHC 5EBWC 1VF7A 2JGDA 4B3MO 2LGWA 4FLYA 1FXVA 1OZ0A 3OFNG 1Y74B 4FPPA 3B8MA 3HPLC 1R3JC 1URFA 5LYJB 2L35A 2EJ7A 1CEZA 1G4YB 4NXMB 1G6UA 1XOUA 4MVZA 2X6BA 3CEIA 3KZIZ 3FX7A 1WNSA 4KUMA 4I9QA 5JCOC 1ROPA 3AG4B 1OJHA 3K08A 1N0JA 4J10A 4PJ0Z 1R3LC 3SYAA 3DTUB 5LMNB 3RYHA 1YF2A 3E22B 1QVGU 4WF9V 4U3JA 3T2MA 1JFFA 2PY5A 4ZHQA 3G4SV 3CRMA 5JQGA 4LF9B 1F23A 2GDSA 4XBFA 5KHJA 4KHPO 3BA8A 5J2TB 3CXCU 1JFFB 4B7KA 1SS3A 3L73H 2ZM6B 1P7BA 3CS5A 4YJ2B 5LGUA 1COWG 1PKXA 4PD4F 2CTQA 2LW1A 1VQKV 2G38A 3PN1A 1R1BA 1IXBA 2QGNA 1HDJA 5C93A 1QR8A 1AROP 3OEEG 3CRRA 3SPIA 3T1HB 3LSQA 2EZOA 2DWEC 5H9CA 4B3RB 3X2QC 4FM0A 2UUBO 3FAVA 2EJRA 3OMIB 4TV8A 1NTMH 4HZ3A 3SPGA 5EIBC 4DR4B 4XDKA 1Z2GA 5CA1A 5A2QN 4FIPC 1GRJA 3LDCA 1Q6HA 2IJJA 2OIEA 4P9PA 3U11A 2IBZH 1K33A 4YJ3A 4CH4A 4WFGA 5K1XA 2HJDA 3CC7V 4JAUA 4QE7A 1US6A 1Y76B 2A79B 2ZDIA 1MZFA 4NTXA 2LFSA 3K9AA 1SZXA 3SJBC 4HNAA 1BHAA 1QLNA 1YJNV 1FXKB 4ZOLB 4I50B 1K97A 3RVYA 3JD0A 3JARB 3C3TA 4JYAO 3ZRVA 3ETQA 3D36A 4IIJA 4JI7B 1MZEA 2YI8A 2MK3A 4G28B 3BCCH 3JAMN 2R70A 4YY3B 3ZRWA 1BCCH 1NVPB 2JJ1G 3H1HH 2UXBB 2QKSA 3B09A 1XDCA 2DYSC 2RMKB 4UFZA 3F7VC 3FB6C 4DV2O 2Y69B 1XBLA 4CS3A 2N74A 5EYPA 1M57C 4I7ZB 3E8GA 3C3SA 5EZYB 1VQNV 4FLTA 1GM7A 5CA3A 5EK0A 4JI4O 1HNZB 5JH7B 2FL4A 3LNNA 4O4LB 2QR4A 4NYKA
chains in the Genus database with same CATH topology
2ZQMA 1UJWB 4WCEV 1NH2D 2XAJA 4LCUC 4Q20A 4RUEA 2AHYA 4Z1MG 4DXWA 1EZJA 1LNQA 5B1NA 4F4LA 5CBFA 4G27B 2OCCB 1S3JA 4QE9A 4WFAV 1DTOA 2Y48A 3I55V 4GCZA 2NLJC 3BY6A 3WFVA 4WFFA 3CCLV 1PNMA 2K1EA 1R73A 3ASNC 3B8NA 4X88A 1VQPV 4UUJC 2UXNA 2JIZG 5IYDO 2DYRB 2P90A 4MVRA 1S77D 4UVCA 2OCCC 5GW7A 3JCZA 2JEXA 1JCHA 5EC1C 1K34A 3OW2U 4JTDB 4BIZA 1KD1W 4N21A 2B5UA 2OT5A 1AI7A 4UV8A 4P2ZA 3ASOB 5L3EA 3I56V 4XDLA 1VQ4V 3OR7C 4J9ZB 4R50A 5B1AB 3IFXA 4X89A 3WG7B 1NR1A 3SYPA 3EHBB 2XOKG 3K0DA 1K5QA 2EIMB 3E83A 1K3EA 1DF5A 3PJSK 3RVZA 2ZXWB 3GWOA 4J9YB 3GB7C 3ASOC 3CMEV 4JYCA 1N8RW 2V7QG 3ABTA 1QLEB 3FB8C 2YEVA 4RQFA 3CCEV 5B1AC 4MS2A 1R6NA 3CCQV 2UXXA 3WG7C 4X8AA 5DN6G 3QO7A 1YJWV 4QPKA 4RQEA 2EIMC 1JQ0A 3OE7G 2ZXWC 4G2KA 1GKFA 3HB3B 4PA9A 4MTXA 1QLEC 4HAMA 2IJKA 3RBZA 5FL7G 1JX9A 3K04A 1NBMG 2EZPA 2DWDC 2R9IA 3CCUV 3STZC 1YTFD 3ABKB 3CP1A 5B1OA 4KP4A 3DGEA 1KC8W 1V54B 2EBOA 2BOCC 3LDEA 1WLEA 1K9MW 1MOFA 2WSSG 3G6EV 2ATKC 3VBBA 1FS0G 3H01A 5LBQA 1YIJV 2IW5A 1YTFB 1H2GA 2PI5A 4MVOA 4QIWF 1YI2V 3SYQA 3ABKC 2JK5C 3LNMB 3OMNB 2W6IG 1SESA 3E35A 1RPRA 3P32A 4JGSA 2ZR3A 1V54C 1W0KG 2ZDIC 1AR1B 5BZBA 2H8PC 3AG2B 3MHSC 1K5SA 2WLLB 3OMAB 5CN0A 4YXWG 1F4NA 5IY5B 4BIUA 4XDJA 4PDLA 2IJIA 2ITCC 3ZRWB 4MSWC 1JVMA 1K4DC 1ORQC 4L87A 2EILB 1H8HG 5L3FA 4WFHA 3T1CA 1BHBA 3W7SA 2Q67A 4MTOA 3E8HA 4RAIA 5CMUA 3AG2C 1M9NA 2HR3A 3CD6V 3JYCA 5B3SB 3ETDA 3OGCC 2BOBC 2Z3YA 3CYOA 3CCVV 2EILC 1G8MA 1RPOA 1AJPA 4R8CA 2JJ2G 1NR7A 1I5XA 2HFEC 1VQ9V 3CMAV 1QCEA 5KUMA 1L1FA 3M99B 5CBHA 2GSMB 1EFRG 2W6JG 5E1AC 3FB7C 3RW0A 1M1KW 3TK1A 1S5HC 3SYCA 1GTOA 4FJCC 4UV9A 3A0RA 4ZBMA 2A9HA 3FYEB 1AJNA 1FXHA 4N23A 3LDDA 5CBGA 3CCMV 1YITV 2NNUA 1NH2B 5L3GA 3TCUA 1AI5A 2EINB 5EBMC 1S76D 4UXNA 2B1GA 2LFRA 5H6QA 2PI4A 2V1DA 4LP8A 1THZA 1RM1B 1F51A 3T4DA 4PA7A 4U7OA 1OCRB 5LHGA 4GX2A 2A0LA 3E8FA 5KA5A 1EBOA 4JTCB 3CCJV 5LGNA 5HFMA 2M7WA 1OCOB 1RM1C 4HYOA 4ZKIA 2DYRC 1OCRC 2AHZA 2IH3C 3ABUA 4I9WA 5IYCO 2XNDG 1V55B 4JF3A 2OTLV 1I5YA 2D3OW 4ASUG 3K79A 1GK9A 1OCOC 3ZMVA 2X6CA 1Y4MA 4QPJA 1GMGA 3OM3B 1NQTA 3KG2A 2WLIA 4MVUA 4QJFB 1YHQV 1KECA 1JJ2U 3FYIB 3ML0A 2CK3G 4LC1A 2EIJB 3MD0A 3W7UA 1V55C 2Q68A 1SRYA 1VQ5V 3IGAC 2W0FC 3ZRXA 1P4RA 3F7YC 2YEVB 3UKMA 2QM7A 3OUFA 3BEHA 4MTGA 2GHYA 4UVAA 4GT1A 1GM8A 1DLBA 4PDVA 4JAVA 2IH1C 1OCCB 2EIJC 2JDIG 1PL0A 4P30A 4JPRA 2XASA 3OR6C 1AI6A 2IU0A 1M56B 2WPDG 3ZJZA 1SETA 3CPWU 2EIKB 3JD1A 1AJQA 1KP3A 3K03A 3ZMSA 4E2LA 4QNHB 3UM7A 3QNEA 3SYOA 1OCCC 4DO2A 2Q6AA 1FXKA 1CP9A 2XAGA 1R3KC 3FB5C 2X7RB 3B77A 4CBCA 1IXMA 1H8EG 3QO5A 3QO8A 3ZN0A 2EIKC 2HVKC 1Q7YW 2ZD9A 1QR9A 1VQOV 4JTAB 1WPXA 2WLKA 3LSSA 4H37A 1NJIW 1JOYA 1PNLA 4R7CA 2WLJA 1Q81W 1Q82W 3W7WA 4WFEA 2LP7A 4TWKA 2WLHA 3E86A 4FMTA 1GM9A 5EBLC 1NVPD 4JASA 2WWWA 1QVFU 3SPCA 1W2BU 4MVMA 3T4ZA 3E8BA 2HLDG 4GX0A 3ETEA 1CPYA 3ETGA 5IY5C 5J9PC 2XAHA 1R3IC 2Z5UA 4MW8A 1AI4A 3MHHC 5EBWC 3TETA 4GX5A 3CC4V 4PDRA 1MABG 4BAYA 4GX1A 3ZIAG 1K7DA 1K73W 1FXVA 1OZ0A 3OFNG 4FPPA 3K3WA 1YSCA 1BL8A 3CCSV 3CC2V 3AG3B 3B8MA 3HPLC 5B3SC 1R3JC 1M90W 2IJHA 1SERA 4PA4A 1PD3A 4WFBV 1CEZA 1G4YB 1E1RG 4OXSA 2DW4A 2P67A 4MVZA 2X6BA 1ENVA 1VQ8V 4TT3G 2QM8A 1K4CC 2ZR2A 3AG1B 4KUMA 3SJQC 3AG3C 3OUSA 1KQSU 1ROPA 5L3DA 2WLNA 1TUEB 3ZMUA 3AG4B 1FFTB 1ZWIC 3K08A 2OTJV 4BW5A 1R3LC 3SYAA 3DTUB 3AG1C 2QA4V 5LHIA 2X0LA 1YJ9V 1VQLV 3ABLB 3VOUA 1XL4A 1QVGU 4WF9V 3T2MA 2EINC 3K06A 4JYBA 3G4SV 3AG4C 3ABMB 2H94A 2Q69A 1B6QA 1F23A 1Y66A 4XBFA 1R6KA 5HFLA 3ZCCA 1E1QG 1JPXA 4CZZA 2HVJC 3CXCU 3ABLC 4P9OA 2QTOA 2HG5C 4MW3A 3X2QB 1P7BA 5LGUA 1COWG 1PKXA 3ABMC 1VQKV 4MTFA 3W7XA 4PDMA 2QE7G 5C93A 1QR8A 1AROP 3OEEG 4U7NA 3SPIA 1HWYA 3LSQA 5IDJA 4PELA 4MVSA 2EZOA 2DWEC 4MVQA 5H9CA 2KB1A 2WAMA 3X2QC 3SPJA 2EJRA 3OMIB 3D3IA 3E89A 5L3CA 2WLIB 4HZ3A 1J95A 3ZMZA 3SPGA 4FK5C 3ZN1A 2DQ3A 4XDKA 2HJFC 5KUKA 4RO2A 3JD2A 4FIPC 3W7TA 3P30A 3LDCA 2P6JA 1E79G 4TSFG 2IJJA 1GO3F 1OCZB 2P7TC 4P9PA 1DF4A 1K33A 5KA6A 3R65A 4WFGA 4R6ZA 5EC2C 5IYBO 3CC7V 3OAAG 1S0VA 4JAUA 4LBEC 4QE7A 3ZMTA 2A79B 1K8AW 3CCRV 2ZDIA 4MT8A 2LFSA 2B1IA 1M56C 3K9AA 1OCZC 2R9RB 2DQ0A 1VQ6V 2X6AA 4PA6A 2XAQA 1BHAA 1OHHG 1QLNA 1VQ7V 1YJNV 3EFFK 1FXKB 1XL6A 1F4MA 2HKOA 1K97A 3RVYA 3JD0A 5H6RA 3ZRVA 3LUTB 3D36A 3SPHA 2MK3A 2WLLA 1H38A 4G28B 1MG1A 3JD3A 2DYSB 2ITDC 2JEUA 1S72V 1FXKC 3ZRWA 1SZTA 1VQMV 1KKDA 5L3BA 1MSWD 1KP2A 5B1BB 1NVPB 2JJ1G 3OEHG 2YSUB 4H33A 4I5SA 2QKSA 3JD4A 3E2EA 1M57B 2DYSC 1NKDA 3IC7A 5LHHA 2WLMA 3F7VC 1QBZA 5DM6V 3F5WC 3FB6C 2IU3A 1W0JG 4KFMA 3ZRSA 1BMFG 2Y69B 3STLC 5B1BC 5LGTA 1PNKA 1Q86W 2C2AA 4RUFA 3AEIA 1M57C 3FKSG 3E8GA 4EKWA 3NXSA 1VQNV 2QEXV 1GM7A 1K92A 3K0GA 3G71V 2XAFA 5CA3A 4PA3A 2Y69C 5EK0A 4UVBA 2F43G 2FTKA 3ASNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WCE V;  4WFB V;  3OW2 U;  1VQL V;  1K9M W;  5DM6 V;  1YHQ V;  1KD1 W;  1JJ2 U;  1QVF U;  3G6E V;  1W2B U;  3CCJ V;  1QVG U;  4WF9 V;  1YJW V;  1YIJ V;  3CD6 V;  1VQ5 V;  1Q86 W;  4WFA V;  3I56 V;  1VQ8 V;  1YJ9 V;  3G4S V;  3CC7 V;  1YI2 V;  1S72 V;  1VQ4 V;  3I55 V;  1VQM V;  3CCV V;  1K8A W;  3CCM V;  3CCR V;  1KQS U;  3CCL V;  1YIT V;  1VQN V;  2QEX V;  3CCU V;  1R73 A;  1Q7Y W;  1VQ6 V;  3CC4 V;  3CXC U;  3G71 V;  1VQO V;  1VQP V;  2OTL V;  1VQ7 V;  1K73 W;  1YJN V;  2D3O W;  1NJI W;  1Q81 W;  1VQ9 V;  1Q82 W;  3CME V;  3CMA V;  1N8R W;  2OTJ V;  3CC2 V;  3CCS V;  1KC8 W;  1M90 W;  3CCE V;  1VQK V;  1M1K W;  3CCQ V;  3CPW U;  2QA4 V; 
#chains in the Genus database with same CATH topology
 2ZQM A;  1UJW B;  4WCE V;  1NH2 D;  4LCU C;  4Q20 A;  4JI8 B;  4Z1M G;  1EZJ A;  5CBF A;  4G27 B;  1S3J A;  4QE9 A;  1N32 B;  2Q7H A;  2NLJ C;  3WFV A;  3JAT A;  3CCL V;  3JAS A;  1PNM A;  2K1E A;  3B8N A;  3CSX A;  1VQP V;  4UUJ C;  1S77 D;  4UVC A;  2VQF B;  5GW7 A;  3JCZ A;  3RN4 A;  4OPH A;  3OW2 U;  3VQY A;  1L0L H;  3BAA A;  5LXT A;  1XMO B;  1DK1 A;  3I56 V;  4PV1 B;  3OR7 C;  4J9Z B;  5BR8 O;  1XNQ O;  4B08 A;  3CJH B;  1K3E A;  4DR5 O;  4DV5 B;  1W59 A;  3CCE V;  2KG7 A;  3CCQ V;  2UXX A;  3CRC A;  5KHI A;  4X8A A;  4RQE A;  2UXD B;  1GKF A;  3HB3 B;  2FKX A;  1QLE C;  2O57 A;  3G80 A;  3RBZ A;  1JX9 A;  1NBM G;  2DWD C;  1PM9 A;  3EVK A;  1ZUQ A;  2LQT A;  4KP4 A;  1V54 B;  2BOC C;  5KX5 A;  3QTC A;  1N34 O;  2WSS G;  2ATK C;  1YTF B;  2PI5 A;  4JI2 B;  4MVO A;  5KMG B;  4FLZ A;  1SES A;  2FYU H;  3ZHU A;  3OTO O;  1AR1 B;  4DV4 B;  2H8P C;  3AG2 B;  3BRC A;  1K5S A;  2WLL B;  3OMA B;  5CN0 A;  2YXL A;  1H2N A;  3M8A A;  4WFH A;  3T1C A;  3IC9 A;  1BHB A;  1SA0 A;  3AK2 A;  4GYC B;  1I94 O;  1IVS A;  3OGC C;  2BOB C;  3CCV V;  5JCO A;  1G8M A;  3Q4H B;  5GON A;  2JJ2 G;  4J7J A;  1ZL8 B;  2HP8 A;  2N05 A;  3H9V A;  1L1F A;  3M99 B;  2W6J G;  3RW0 A;  2UXC B;  1S5H C;  2XTA A;  4OPA A;  4UV9 A;  1VEW A;  1JJO A;  2WA4 A;  3KCY A;  3FYE B;  1AJN A;  1FXH A;  4N23 A;  3LDD A;  1HNW O;  4LFA B;  4B7E A;  4LP8 A;  1RM1 B;  1F51 A;  4WBN A;  4DV7 B;  4O4J B;  2JGU A;  4JI5 B;  2ADP A;  4DV6 B;  4AHC A;  5FNV B;  2R9A A;  1N36 O;  3TXS A;  2DYR C;  1L8D A;  1SQV H;  1I0H A;  3ABU A;  1VAR A;  1IBM O;  3JAL A;  4FFB A;  2P22 C;  2XND G;  1Q43 A;  3K79 A;  1GK9 A;  1OCO C;  4LWS B;  4JI3 B;  1NQT A;  3JAL B;  1N33 O;  2Y0I A;  1EZV H;  1IZ3 A;  1YHQ V;  3K59 A;  2OCH A;  2CK3 G;  3RYC A;  2EIJ B;  3MD0 A;  4DR1 B;  2BSK A;  4DRX A;  3F7Y C;  4FZ0 A;  2QM7 A;  3OUF A;  2GHY A;  4W4L A;  4X1K B;  4X65 B;  2JDI G;  1PL0 A;  4NXM O;  1BS3 A;  3A2F A;  3ZJZ A;  3SJA C;  2EIK B;  4I55 B;  3SYO A;  1B06 A;  3ZHT A;  3FB5 C;  3B77 A;  1JA8 A;  1H8E G;  3QO8 A;  3JSN A;  3ZN0 A;  2HVK C;  5LMN O;  1GN3 A;  3RT3 C;  1QR9 A;  1JOY A;  2Q0O C;  4EB6 A;  2WLJ A;  1Q82 W;  5FPR A;  2LP7 A;  3RYI A;  1SF9 A;  4LF9 O;  5EBL C;  1WP7 A;  2WWW A;  4EB6 B;  4CH3 A;  2PZS A;  5BMV A;  4Z2W A;  3RYI B;  1CPY A;  5IY5 C;  2ZM6 O;  2Z5U A;  3GWK C;  4MW8 A;  4GX5 A;  1X59 A;  4K8X A;  3CC4 V;  4PDR A;  1MAB G;  4BAY A;  2JS3 A;  4YHH B;  3T1H O;  1YSC A;  1BL8 A;  3CC2 V;  4B3R O;  4PA4 A;  4WFB V;  2IM9 A;  2XT9 A;  5JWP A;  2UUA B;  1E1R G;  4UB8 Z;  4OXS A;  3ICX A;  2P67 A;  3RWR D;  1IBL B;  4DR4 O;  1ENV A;  1B04 A;  4LF5 B;  1Q90 D;  2QM8 A;  4TV9 B;  3L72 H;  1KQS U;  3AG3 C;  4NXN B;  1D2D A;  1HW7 A;  1D5N A;  2R72 A;  4TQD A;  2WLN A;  1LUW A;  2VRZ A;  1ZWI C;  2LO1 A;  5KAF Z;  2BTQ A;  2OTJ V;  1Z5V A;  1H2K A;  3AG1 C;  1YJ9 V;  1VQL V;  1XL4 A;  5H5N A;  2F93 B;  2ILM A;  4DYL A;  2N04 A;  4JYB A;  2E75 B;  4ZI7 A;  3ABM B;  2H94 A;  2Q69 A;  3KKY A;  4AI8 A;  1R6K A;  1XMQ B;  4J42 A;  5H2F Z;  1E1Q G;  3ABL C;  4JI7 O;  1JR9 A;  3ZX6 A;  2KSD A;  1B3Q A;  4JYY A;  4YY3 O;  1WJZ A;  4MTF A;  1HNX B;  4PDM A;  2QE7 G;  1WA8 A;  3R66 A;  4PEL A;  2KB1 A;  4FVM A;  5B66 Z;  2UXB O;  5L3C A;  2WLI B;  3BPZ A;  1J95 A;  4TUY B;  4FK5 C;  2RDC A;  3N2G B;  3K5O A;  4UCR A;  3JD2 A;  3UO3 A;  5ITZ B;  1OCZ B;  4O2B A;  1YDX A;  1XUQ A;  1DF4 A;  5KA6 A;  2CUG A;  4R6Z A;  5IYB O;  1MSD A;  5GTH Z;  4LBE C;  4QGP A;  1HNZ O;  1K8A W;  4X20 A;  1BSM A;  1M56 C;  1RSO A;  2X6A A;  1FFX B;  1VQ7 V;  1FD9 A;  3EFF K;  1VMG A;  4JI8 O;  5LA6 A;  3UT5 B;  3LUT B;  1N32 O;  2DOS A;  4ABM A;  2ITD C;  2JEU A;  5JVD B;  1SZT A;  1VQM V;  1KKD A;  2UU9 B;  2VQF O;  2OYQ A;  3OEH G;  3E2E A;  3VQV A;  1XMO O;  5LHH A;  1EN5 A;  3DXR A;  5DM6 V;  3F5W C;  2IU3 A;  2YI9 A;  2JGD B;  4KFM A;  5B1B C;  2C2A A;  4UB6 Z;  4DV5 O;  3FKS G;  1T5E A;  1SQX H;  2RCV A;  4PA3 A;  4UVB A;  4X62 B;  1O9G A;  4LFC B;  1O9H A;  2UXD O;  3GVM A;  2XAJ A;  4NR1 A;  4RUE A;  4O2A A;  4DXW A;  1LNQ A;  4F4L A;  4WFA V;  2QDO A;  2Y48 A;  3SDL A;  3I55 V;  2F66 C;  4GCZ A;  4DK1 A;  2GBO A;  3RYH B;  2RN9 A;  3ASN C;  4D6T H;  3ZS8 C;  4U3J B;  1IX9 A;  5IYD O;  2DYR B;  2P90 A;  4ZHQ B;  2P4V A;  5JQG B;  2OCC C;  4JI2 O;  4BIZ A;  4N21 A;  2B5U A;  2OT5 A;  4O4H A;  4DV4 O;  4GKK B;  3HKD A;  5B1A B;  3IFX A;  1N4C A;  4X89 A;  3WG7 B;  4DW1 A;  1NR1 A;  1YEW A;  2XOK G;  1K5Q A;  4EEQ A;  2KKW A;  1XNR B;  4LF8 B;  3E83 A;  2ZT9 B;  1DF5 A;  3PJS K;  3RVZ A;  4J9Y B;  3ASO C;  3FAV B;  2FML A;  2RJZ A;  4IYH A;  4TV8 B;  2YEV A;  4RQF A;  4X1Y A;  1GAX A;  4MS2 A;  3U0Z A;  5DN6 G;  3QO7 A;  4J41 A;  5CA1 B;  1YJW V;  2EIM C;  3QF7 A;  2ZXW C;  3L71 H;  2A06 H;  4B3T B;  2RNB A;  4H0L B;  2IJK A;  4LF4 B;  2EUL A;  5LMU B;  2JVD A;  3CX5 F;  4IYI A;  3ZHS A;  2UXC O;  4YJ3 B;  3QG5 A;  1H2S B;  2DMX A;  2YUA A;  3DGE A;  5BXZ A;  4Z1V A;  5KHG A;  4FLV A;  2ZIM A;  1K9M W;  4HNA B;  4CC5 A;  1YIJ V;  5F2V O;  4CH5 A;  4LFA O;  4QIW F;  5C8Y A;  3JAW A;  3SYQ A;  3ABK C;  2JK5 C;  3LNM B;  3J7A U;  3OMN B;  2W6I G;  3E35 A;  3P32 A;  2ZR3 A;  1W0K G;  4IIJ B;  2QWN B;  4DV7 O;  3APO A;  4YXW G;  4DV6 O;  5IY5 B;  4BIU A;  4PDL A;  2Q7G A;  3ZRW B;  2LGQ A;  4L87 A;  2EIL B;  5LL6 Y;  2OIG A;  4JAA A;  4BWA A;  4RAI A;  5CMU A;  3TXQ A;  2HR3 A;  1LUV A;  3CD6 V;  3JYC A;  2VWK A;  2Q0A A;  3AG7 A;  2Z3Y A;  4JI0 B;  1AJP A;  3BHP A;  4JI3 O;  2E76 B;  2Y4U A;  2HFE C;  1NI8 A;  5EYP B;  1XEQ A;  3HKE A;  4DR1 O;  5IWA B;  1WP8 A;  3FB7 C;  3A8T A;  3N2K A;  1Q5O A;  3WU2 Z;  1GTO A;  4FJC C;  3HKE B;  2A9H A;  4X65 O;  1XHZ A;  5CBG A;  2YIC A;  4BIO A;  2QWQ B;  1AI5 A;  1S76 D;  5JJE B;  2PI4 A;  2V1D A;  1BGY H;  2CAZ C;  2XUM A;  4X64 B;  4YIO A;  4PA7 A;  1OCR B;  3SJC C;  3HKC A;  2ZNI A;  3APQ A;  1YVW A;  3FFQ A;  2A0L A;  3JAT B;  3VQX A;  3JAS B;  2E3C A;  1WB8 A;  5LGN A;  3OGI B;  2OWO A;  5IJ9 A;  5DED A;  4DV3 B;  4ZKI A;  2AHZ A;  5FLX N;  5JJN B;  1V55 B;  2MW2 B;  4CC6 A;  4JF3 A;  5LXT B;  2OTL V;  3O65 A;  1KBH A;  2D3O W;  4F6E A;  4DUZ B;  3ZMV A;  2X6C A;  4CS4 A;  4MVU A;  4QJF B;  1IUR A;  4JZG A;  3K57 A;  1KEC A;  1SRY A;  3IGA C;  1Y67 A;  4YHH O;  3ZRX A;  2Q5Z A;  3UKM A;  2QWP B;  3IAY A;  2KG7 B;  2CGO A;  3BVO A;  4UVA A;  4GT1 A;  4PDV A;  1DLB A;  4JAV A;  5GTI Z;  2IH1 C;  1BQZ A;  1OCC B;  4TQF A;  1MA1 A;  2UUA O;  2XAS A;  1IBL O;  1M56 B;  4LF5 O;  4NTY A;  3JD1 A;  3K03 A;  4IHJ A;  3JAK A;  4QNH B;  3UM7 A;  4JI6 B;  3K9S A;  4LR3 A;  4NXN O;  1R3K C;  4BR6 A;  4CBC A;  1IXM A;  3H1L H;  3QO5 A;  5KX5 B;  1Q7Y W;  3LSS A;  4H37 A;  1ZSP A;  2FB5 A;  4R7C A;  2DN9 A;  2CTR A;  5LP6 C;  2KQX A;  4FMT A;  1P7G A;  1VP7 A;  1NVP D;  1XMQ O;  3AK3 A;  3E8B A;  3ETE A;  1R3I C;  2L6L A;  1AI4 A;  3TET A;  1NU1 H;  2ZNJ A;  1SA0 B;  1V9P A;  4K3A A;  1HNX O;  4O4I A;  3ZIA G;  1XIL A;  3K3W A;  2PYL A;  3CCS V;  1QNM A;  5B3S C;  1M90 W;  4LFB B;  4DK0 A;  1SER A;  5GON B;  1PD3 A;  1Z5W A;  1QU7 A;  2DW4 A;  1VQ8 V;  4TT3 G;  4UCV A;  1K4C C;  2ZR2 A;  1UFI A;  4LF6 B;  3SJQ C;  3OUS A;  4FM1 A;  4DR2 B;  1GN2 A;  1FYJ A;  4LH7 A;  2YID A;  4DW0 A;  2QA4 V;  3HKB A;  3VOU A;  1DGS A;  5FPO A;  4PI2 A;  1KB9 F;  2EIN C;  3L70 H;  3OTF A;  1D5A A;  3AG4 C;  4WBN B;  1Y66 A;  3CWB H;  2E5L B;  1QQC A;  3I5D A;  4CZZ A;  2HVJ C;  3X2Q B;  2NN4 A;  2Q4P A;  4FFB B;  3W7X A;  2UU9 O;  1WB7 A;  4EFB A;  4U7N A;  2A7W A;  1HWY A;  5IDJ A;  2VQE B;  1KMI Z;  4MVQ A;  5A9G A;  3AK1 A;  3E89 A;  3ZBH A;  3ZMZ A;  1QHT A;  3ZN1 A;  3RYC B;  1AB3 A;  3LSU A;  2DQ3 A;  5KUK A;  1TUB A;  2BSK B;  4DRX B;  4B3S B;  3H1J H;  3P30 A;  1E79 G;  3RYF A;  5IJ0 A;  2P5O A;  3JCU Z;  2JS5 A;  1PL4 A;  3R65 A;  4FLW A;  2F4V B;  2CH7 A;  1AVM A;  3RYF B;  1S0V A;  3ZMT A;  4X62 O;  4MT8 A;  4NB5 A;  2B1I A;  2ZE7 A;  4LFC O;  2R9R B;  1VQ6 V;  4PA6 A;  1OHH G;  2Y0P A;  1XL6 A;  2HKO A;  2ZKO A;  4EFE A;  1TAE A;  1SQG A;  2AGA A;  3EXA A;  1BE3 H;  1TVK A;  5BY1 A;  3SPH A;  1H38 A;  3C90 A;  1U96 A;  1MG1 A;  3JD3 A;  2DYS B;  1Y6X A;  1S72 V;  3H1K H;  1FXK C;  2PUS A;  5L3B A;  3BFR A;  2E74 B;  2ADQ B;  1MSW D;  1KP2 A;  2GUZ A;  2PTM A;  4H33 A;  5BMV B;  3J80 N;  4I5S A;  3JD4 A;  2CGN A;  4CS2 A;  1M57 B;  1BQ0 A;  4GKK O;  2WLM A;  4FLX A;  1QBZ A;  1W0J G;  2DE0 X;  3ZRS A;  4J7Z A;  5K1P A;  3CRA A;  2Q7E A;  1PNK A;  1HP8 A;  1Q86 W;  1XNR O;  4LF8 O;  3AEI A;  1Q3E A;  5CB4 A;  2RQ6 A;  3NXS A;  5CA0 A;  2QEX V;  1K92 A;  1G1X B;  4NTW A;  1L0N H;  2XAF A;  2Y69 C;  5KLV H;  4NKG B;  2FTK A;  3CRQ A;  4B3T O;  4LF4 O;  2CE4 A;  2AHY A;  5LMU O;  4PHZ A;  5B1N A;  1R6T A;  3O9O A;  2BTQ B;  4X1I A;  2QKA A;  2LW7 A;  1HR0 B;  3ZED A;  4F6R A;  4WFF A;  2M6Y A;  4X88 A;  2JIZ G;  3L75 H;  4MVR A;  4ZI7 B;  1SQB H;  1IBK B;  4FLU A;  1K34 A;  5J2U A;  1KUQ A;  4FM2 A;  4LF7 B;  2F95 B;  1AI7 A;  3F5T A;  1BZK A;  3UCS C;  3THO A;  5TIS Z;  1XQ8 A;  1SKV A;  2Q9L A;  4XDL A;  1VQ4 V;  4R50 A;  5IYZ A;  3DC6 A;  3SYP A;  4U3F H;  3K0D A;  1WA8 B;  1RFY A;  4UCS A;  2BTO A;  4DV1 B;  3GWO A;  1N8R W;  2V7Q G;  3FB8 C;  1QLE B;  4JI0 O;  2PYJ A;  4H44 B;  1JQ0 A;  4ZIB A;  5E79 Z;  4G2K A;  3CB2 A;  1KYO F;  1WN7 A;  4HAM A;  4O2B B;  5FL7 G;  3CCU V;  4GLX A;  5IWA O;  3STZ C;  4LNU A;  1FKA O;  5LP6 A;  2ZE6 A;  1KC8 W;  2YIA A;  4X20 B;  3B2E E;  1KKC A;  1RSO B;  3RFR A;  1FS0 G;  1KU9 A;  3H01 A;  4FZ1 A;  5LBQ A;  1H2G A;  2YDE A;  5LA6 B;  4X64 O;  1EM1 A;  1RPR A;  4JGS A;  4JV5 B;  1V54 C;  1EN4 A;  1RP3 B;  5BZB A;  3T1Y B;  3MHS C;  3K5L A;  3L74 H;  4XDJ A;  2IJI A;  4MSW C;  4DV3 O;  5L3F A;  4DV0 B;  3W7S A;  4MTO A;  3E8H A;  4K0K B;  3AG2 C;  2VS0 A;  4BW9 A;  4DR6 B;  5B3S B;  1Y74 A;  3CYO A;  1JMK C;  3DXR B;  4DUZ O;  5LYJ A;  4R8C A;  4JZ2 A;  2AXT Z;  3ZHQ A;  3BA9 A;  1I5X A;  3TGU H;  2YIB D;  1TA8 A;  2HHH B;  2F1M A;  1S5J A;  5KUM A;  2GSM B;  1EFR G;  4UCT A;  1M1K W;  3H1I H;  3TK1 A;  3SYC A;  4J11 A;  2CTP A;  4ZBM A;  3SR2 C;  1FJG B;  1YIT V;  2NNU A;  1NH2 B;  5L3G A;  3TCU A;  4TOI A;  2EIN B;  3E22 A;  2ARH A;  4O2A B;  2B1G A;  5H6Q A;  4JI6 O;  3J81 N;  1FPO A;  4U7O A;  2P06 A;  4FFK A;  2AW9 A;  3E8F A;  4E4E A;  3TJT A;  5J2T A;  3CCJ V;  5HFM A;  2YXY A;  1OCO B;  4CH6 A;  1RM1 C;  1SQP H;  4YJ2 A;  2ETN A;  3CXH F;  4O4H B;  1I5Y A;  4LH6 A;  5D5P A;  3HKD B;  3NR7 A;  2CTW A;  2HEP A;  1H2L A;  1GMG A;  3OM3 B;  1MMM A;  4H13 B;  3FYI B;  3ML0 A;  4LC1 A;  5DEC A;  4IGG A;  2CDY A;  2W0F C;  4GKJ B;  1P4R A;  4JI1 B;  2YEV B;  4X1Y B;  3BEH A;  4LFB O;  1PP9 H;  2EIJ C;  3QVN A;  4P30 A;  4ICG A;  4C7U A;  1MNG A;  1AI6 A;  2IU0 A;  1Y76 A;  1SET A;  2H3O A;  3RGB A;  2YC0 A;  4LF6 O;  1X4T A;  4DR2 O;  4DO2 A;  1FXK A;  4ZOL A;  1CP9 A;  1I08 A;  4I50 A;  3JAR A;  3S3X A;  1J5E B;  4KXR A;  2EIK C;  2ZD9 A;  1VQO V;  4JTA B;  4JI5 O;  1WPX A;  1NJI W;  1PNL A;  1Q81 W;  5C8Y B;  3JAW B;  5KHH A;  4WFE A;  2GV9 A;  1YZB A;  3S3W A;  1GM9 A;  2E5L O;  4JAS A;  1W2B U;  4MVM A;  1AR4 A;  3T4Z A;  4DUY B;  3OD4 A;  2UUC B;  3HR0 A;  2XAH A;  1UPG A;  4OGQ B;  4GX1 A;  1K73 W;  1K7D A;  4IL6 Z;  4L8J A;  2VQE O;  3AG3 B;  2EX3 A;  2IJH A;  1XHX A;  5EZY A;  1VF6 C;  3P3N A;  4AQY B;  1Q6U A;  1PV0 A;  1GN6 A;  4OX9 B;  5JH7 A;  4O4L A;  3AG1 B;  4X66 B;  1SQF A;  4B3S O;  3N2K B;  2QM4 A;  5L3D A;  1TUE B;  4UCU A;  3ZMU A;  3K58 A;  1FFT B;  3A0B Z;  4BW5 A;  2F4V O;  3WB2 A;  5LHI A;  2X0L A;  4DR3 B;  3ABL B;  1M4U A;  3K06 A;  3HKC B;  1B6Q A;  4A5U B;  4DR7 B;  5HFL A;  3ZCC A;  1JPX A;  2B9Z A;  4P9O A;  2QTO A;  2HG5 C;  5IJ9 B;  4MW3 A;  3G67 A;  3ABM C;  4B3M B;  3CJH A;  2ZIO A;  4MVS A;  2WAM A;  3SPJ A;  3D3I A;  1AP6 A;  4Q6G A;  1S5L Z;  4AIL C;  1WPB A;  2DJV A;  1F7Y A;  2HJF C;  4RO2 A;  1N0N A;  4GUN A;  3W7T A;  3D8C A;  1GH6 A;  2D2C B;  2P6J A;  3OT7 A;  4TSF G;  2Z0A A;  1GO3 F;  2P7T C;  2W0X A;  3A0H Z;  5EC2 C;  5IE9 A;  3OAA G;  2F23 A;  3CCR V;  2AZ0 A;  5D5Q A;  4IHJ B;  3JAK B;  1OCZ C;  1NTZ H;  2DQ0 A;  3KCX A;  2XAQ A;  2ODM A;  1F4M A;  5KMG A;  4KHP B;  5H6R A;  2P4K A;  1HR0 O;  1XI1 A;  2WLL A;  2Q73 A;  4KL1 A;  3CE2 A;  3SGI A;  1WAZ A;  5IT9 N;  4UCO A;  1ZLZ A;  1IBK O;  1M93 A;  2BE3 A;  1ZX3 A;  1EN6 A;  5B1B B;  2YSU B;  4D7T A;  4D7S A;  2UUB B;  4LF7 O;  2A3Q A;  2QTS A;  1P84 F;  1NKD A;  3IC7 A;  1IDS A;  2QWR B;  3WB1 A;  3Q4H A;  1ZTE A;  2V4D A;  2XHB A;  1BMF G;  1NT2 B;  4O4I B;  3STL C;  5LGT A;  1ZL8 A;  4RUF A;  4DV1 O;  2GTA A;  1M5I A;  4RWU A;  4EKW A;  3G6B A;  3K0G A;  3G71 V;  1NZ6 A;  2QWO B;  2F43 G;  1Q6I A;  3IJ4 A;  3ASN B;  2AZ2 A;  4JYA B;  2OCC B;  1DTO A;  5JJJ B;  3BY6 A;  4O4J A;  3HKB B;  3WB0 A;  1R73 A;  5FNV A;  2UXN A;  1A32 A;  2JEX A;  1JCH A;  5EC1 C;  4JTD B;  1KD1 W;  4JV5 O;  2Y4T A;  4UV8 A;  1AIL A;  3T1Y O;  1P49 A;  4P2Z A;  3ASO B;  5L3E A;  2LJ2 A;  4J7K A;  4LWS A;  4DV2 B;  3VQW A;  4PI0 A;  3EHB B;  3MAQ A;  4DV0 O;  2EIM B;  2QSA A;  4K35 A;  4K0K O;  2ZXW B;  3GB7 C;  3CME V;  1VF5 B;  4JYC A;  4W4K A;  3ABT A;  4DR6 O;  5B1A C;  1R6N A;  1PPJ H;  3WG7 C;  1GN4 A;  1H2M A;  2WA3 A;  4JI4 B;  4X1K A;  1TUB B;  3D3Q A;  4QPK A;  2PGG A;  4I4T A;  3OE7 G;  5IJ0 B;  4PA9 A;  4MTX A;  2HHH O;  3K04 A;  2EZP A;  2R9I A;  4I55 A;  2YS8 A;  4I4T B;  2CH7 B;  1YTF D;  3ABK B;  3CP1 A;  5B1O A;  2VWJ A;  2EBO A;  3LDE A;  1WLE A;  2Q8V A;  1YXB A;  1MOF A;  1FJG O;  3UO2 A;  3G6E V;  2ZE5 A;  3VBB A;  3M7M X;  2IW5 A;  3L9D A;  1YI2 V;  1I7F A;  1BT8 A;  1TVK B;  2ZDI C;  2YXH A;  1NS1 A;  3MDS A;  1F4N A;  5BR8 B;  1XNQ B;  2ITC C;  4J80 A;  1JVM A;  1K4D C;  1ORQ C;  4IT5 A;  1H8H G;  1VF6 A;  2Q67 A;  3D36 C;  2GUZ B;  4DR5 B;  1M9N A;  3ETD A;  2EIL C;  1RPO A;  1AR5 A;  1TGO A;  5LOV A;  3JSL A;  1NR7 A;  1SC5 B;  1VQ9 V;  3CMA V;  2YIB A;  1QCE A;  4TV9 A;  5CB4 B;  5CBH A;  4GKJ O;  5E1A C;  5CA0 B;  4JI1 O;  5LOV B;  3B4S A;  3A0R A;  5B5E Z;  4HBN A;  3N27 A;  3FD9 A;  1NTK H;  4NVP A;  4GZR B;  3CCM V;  1N34 B;  5EBM C;  2ZCE A;  4UXN A;  2LFR A;  1THZ A;  3T4D A;  4X1I B;  5LHG A;  1YCI A;  2JRI A;  3OTO B;  4GX2 A;  4F6R B;  5KA5 A;  1EBO A;  1LR1 A;  4JTC B;  1J5E O;  1OV9 A;  1ZAU A;  3DSQ A;  2M7W A;  2BCC H;  2NR5 A;  4HYO A;  1OCR C;  2IH3 C;  5EIB D;  5J2U B;  4I9W A;  5IYC O;  3ZHR A;  2ZE8 A;  1U97 A;  1I94 B;  4ASU G;  2QKC A;  5IYZ B;  4K8Z A;  4DUY O;  3K5M A;  1Y4M A;  4QPJ A;  2UUC O;  3KG2 A;  2WLI A;  4TUY A;  1XRE A;  1FAF A;  2GTS A;  1JJ2 U;  3W7U A;  3N2G A;  1V55 C;  2Q68 A;  4I0X A;  1VQ5 V;  3U10 A;  4X9Q A;  1AP5 A;  5ITZ A;  4MTG A;  1GM8 A;  4I0X B;  4JPR A;  5KHK A;  4AQY O;  3OR6 C;  1HNW B;  4OX9 O;  2WPD G;  3CPW U;  1AJQ A;  1KP3 A;  3ZMS A;  4E2L A;  4X66 O;  3ZHV A;  2K9P A;  4LNU B;  1FFX A;  3QNE A;  3K5N A;  1OCC C;  5LP6 B;  1Q8I A;  2Q6A A;  2XAG A;  2X7R B;  2QJ1 A;  1SQQ H;  3UT5 A;  3CHX A;  1N36 B;  5AG2 A;  3P3P A;  4DR3 O;  2WLK A;  3DC5 A;  4YIP A;  5KAI Z;  3UQ8 A;  5JVD A;  3W7W A;  4TWK A;  2WLH A;  3E86 A;  1IBM B;  3B40 A;  1CXZ B;  4DR7 O;  2PF4 E;  1QVF U;  3SPC A;  2ZIN A;  2HLD G;  4GX0 A;  3ETG A;  5J9P C;  1VIB A;  1N33 B;  3BAB A;  3MHH C;  5EBW C;  1VF7 A;  2JGD A;  4B3M O;  2LGW A;  4FLY A;  1FXV A;  1OZ0 A;  3OFN G;  1Y74 B;  4FPP A;  3B8M A;  3HPL C;  1R3J C;  1URF A;  5LYJ B;  2L35 A;  2EJ7 A;  1CEZ A;  1G4Y B;  4NXM B;  1G6U A;  1XOU A;  4MVZ A;  2X6B A;  3CEI A;  3KZI Z;  3FX7 A;  1WNS A;  4KUM A;  4I9Q A;  5JCO C;  1ROP A;  3AG4 B;  1OJH A;  3K08 A;  1N0J A;  4J10 A;  4PJ0 Z;  1R3L C;  3SYA A;  3DTU B;  5LMN B;  3RYH A;  1YF2 A;  3E22 B;  1QVG U;  4WF9 V;  4U3J A;  3T2M A;  1JFF A;  2PY5 A;  4ZHQ A;  3G4S V;  3CRM A;  5JQG A;  4LF9 B;  1F23 A;  2GDS A;  4XBF A;  5KHJ A;  4KHP O;  3BA8 A;  5J2T B;  3CXC U;  1JFF B;  4B7K A;  1SS3 A;  3L73 H;  2ZM6 B;  1P7B A;  3CS5 A;  4YJ2 B;  5LGU A;  1COW G;  1PKX A;  4PD4 F;  2CTQ A;  2LW1 A;  1VQK V;  2G38 A;  3PN1 A;  1R1B A;  1IXB A;  2QGN A;  1HDJ A;  5C93 A;  1QR8 A;  1ARO P;  3OEE G;  3CRR A;  3SPI A;  3T1H B;  3LSQ A;  2EZO A;  2DWE C;  5H9C A;  4B3R B;  3X2Q C;  4FM0 A;  2UUB O;  3FAV A;  2EJR A;  3OMI B;  4TV8 A;  1NTM H;  4HZ3 A;  3SPG A;  5EIB C;  4DR4 B;  4XDK A;  1Z2G A;  5CA1 A;  5A2Q N;  4FIP C;  1GRJ A;  3LDC A;  1Q6H A;  2IJJ A;  2OIE A;  4P9P A;  3U11 A;  2IBZ H;  1K33 A;  4YJ3 A;  4CH4 A;  4WFG A;  5K1X A;  2HJD A;  3CC7 V;  4JAU A;  4QE7 A;  1US6 A;  1Y76 B;  2A79 B;  2ZDI A;  1MZF A;  4NTX A;  2LFS A;  3K9A A;  1SZX A;  3SJB C;  4HNA A;  1BHA A;  1QLN A;  1YJN V;  1FXK B;  4ZOL B;  4I50 B;  1K97 A;  3RVY A;  3JD0 A;  3JAR B;  3C3T A;  4JYA O;  3ZRV A;  3ETQ A;  3D36 A;  4IIJ A;  4JI7 B;  1MZE A;  2YI8 A;  2MK3 A;  4G28 B;  3BCC H;  3JAM N;  2R70 A;  4YY3 B;  3ZRW A;  1BCC H;  1NVP B;  2JJ1 G;  3H1H H;  2UXB B;  2QKS A;  3B09 A;  1XDC A;  2DYS C;  2RMK B;  4UFZ A;  3F7V C;  3FB6 C;  4DV2 O;  2Y69 B;  1XBL A;  4CS3 A;  2N74 A;  5EYP A;  1M57 C;  4I7Z B;  3E8G A;  3C3S A;  5EZY B;  1VQN V;  4FLT A;  1GM7 A;  5CA3 A;  5EK0 A;  4JI4 O;  1HNZ B;  5JH7 B;  2FL4 A;  3LNN A;  4O4L B;  2QR4 A;  4NYK A; 
#chains in the Genus database with same CATH homology
 2ZQM A;  1UJW B;  4WCE V;  1NH2 D;  2XAJ A;  4LCU C;  4Q20 A;  4RUE A;  2AHY A;  4Z1M G;  4DXW A;  1EZJ A;  1LNQ A;  5B1N A;  4F4L A;  5CBF A;  4G27 B;  2OCC B;  1S3J A;  4QE9 A;  4WFA V;  1DTO A;  2Y48 A;  3I55 V;  4GCZ A;  2NLJ C;  3BY6 A;  3WFV A;  4WFF A;  3CCL V;  1PNM A;  2K1E A;  1R73 A;  3ASN C;  3B8N A;  4X88 A;  1VQP V;  4UUJ C;  2UXN A;  2JIZ G;  5IYD O;  2DYR B;  2P90 A;  4MVR A;  1S77 D;  4UVC A;  2OCC C;  5GW7 A;  3JCZ A;  2JEX A;  1JCH A;  5EC1 C;  1K34 A;  3OW2 U;  4JTD B;  4BIZ A;  1KD1 W;  4N21 A;  2B5U A;  2OT5 A;  1AI7 A;  4UV8 A;  4P2Z A;  3ASO B;  5L3E A;  3I56 V;  4XDL A;  1VQ4 V;  3OR7 C;  4J9Z B;  4R50 A;  5B1A B;  3IFX A;  4X89 A;  3WG7 B;  1NR1 A;  3SYP A;  3EHB B;  2XOK G;  3K0D A;  1K5Q A;  2EIM B;  3E83 A;  1K3E A;  1DF5 A;  3PJS K;  3RVZ A;  2ZXW B;  3GWO A;  4J9Y B;  3GB7 C;  3ASO C;  3CME V;  4JYC A;  1N8R W;  2V7Q G;  3ABT A;  1QLE B;  3FB8 C;  2YEV A;  4RQF A;  3CCE V;  5B1A C;  4MS2 A;  1R6N A;  3CCQ V;  2UXX A;  3WG7 C;  4X8A A;  5DN6 G;  3QO7 A;  1YJW V;  4QPK A;  4RQE A;  2EIM C;  1JQ0 A;  3OE7 G;  2ZXW C;  4G2K A;  1GKF A;  3HB3 B;  4PA9 A;  4MTX A;  1QLE C;  4HAM A;  2IJK A;  3RBZ A;  5FL7 G;  1JX9 A;  3K04 A;  1NBM G;  2EZP A;  2DWD C;  2R9I A;  3CCU V;  3STZ C;  1YTF D;  3ABK B;  3CP1 A;  5B1O A;  4KP4 A;  3DGE A;  1KC8 W;  1V54 B;  2EBO A;  2BOC C;  3LDE A;  1WLE A;  1K9M W;  1MOF A;  2WSS G;  3G6E V;  2ATK C;  3VBB A;  1FS0 G;  3H01 A;  5LBQ A;  1YIJ V;  2IW5 A;  1YTF B;  1H2G A;  2PI5 A;  4MVO A;  4QIW F;  1YI2 V;  3SYQ A;  3ABK C;  2JK5 C;  3LNM B;  3OMN B;  2W6I G;  1SES A;  3E35 A;  1RPR A;  3P32 A;  4JGS A;  2ZR3 A;  1V54 C;  1W0K G;  2ZDI C;  1AR1 B;  5BZB A;  2H8P C;  3AG2 B;  3MHS C;  1K5S A;  2WLL B;  3OMA B;  5CN0 A;  4YXW G;  1F4N A;  5IY5 B;  4BIU A;  4XDJ A;  4PDL A;  2IJI A;  2ITC C;  3ZRW B;  4MSW C;  1JVM A;  1K4D C;  1ORQ C;  4L87 A;  2EIL B;  1H8H G;  5L3F A;  4WFH A;  3T1C A;  1BHB A;  3W7S A;  2Q67 A;  4MTO A;  3E8H A;  4RAI A;  5CMU A;  3AG2 C;  1M9N A;  2HR3 A;  3CD6 V;  3JYC A;  5B3S B;  3ETD A;  3OGC C;  2BOB C;  2Z3Y A;  3CYO A;  3CCV V;  2EIL C;  1G8M A;  1RPO A;  1AJP A;  4R8C A;  2JJ2 G;  1NR7 A;  1I5X A;  2HFE C;  1VQ9 V;  3CMA V;  1QCE A;  5KUM A;  1L1F A;  3M99 B;  5CBH A;  2GSM B;  1EFR G;  2W6J G;  5E1A C;  3FB7 C;  3RW0 A;  1M1K W;  3TK1 A;  1S5H C;  3SYC A;  1GTO A;  4FJC C;  4UV9 A;  3A0R A;  4ZBM A;  2A9H A;  3FYE B;  1AJN A;  1FXH A;  4N23 A;  3LDD A;  5CBG A;  3CCM V;  1YIT V;  2NNU A;  1NH2 B;  5L3G A;  3TCU A;  1AI5 A;  2EIN B;  5EBM C;  1S76 D;  4UXN A;  2B1G A;  2LFR A;  5H6Q A;  2PI4 A;  2V1D A;  4LP8 A;  1THZ A;  1RM1 B;  1F51 A;  3T4D A;  4PA7 A;  4U7O A;  1OCR B;  5LHG A;  4GX2 A;  2A0L A;  3E8F A;  5KA5 A;  1EBO A;  4JTC B;  3CCJ V;  5LGN A;  5HFM A;  2M7W A;  1OCO B;  1RM1 C;  4HYO A;  4ZKI A;  2DYR C;  1OCR C;  2AHZ A;  2IH3 C;  3ABU A;  4I9W A;  5IYC O;  2XND G;  1V55 B;  4JF3 A;  2OTL V;  1I5Y A;  2D3O W;  4ASU G;  3K79 A;  1GK9 A;  1OCO C;  3ZMV A;  2X6C A;  1Y4M A;  4QPJ A;  1GMG A;  3OM3 B;  1NQT A;  3KG2 A;  2WLI A;  4MVU A;  4QJF B;  1YHQ V;  1KEC A;  1JJ2 U;  3FYI B;  3ML0 A;  2CK3 G;  4LC1 A;  2EIJ B;  3MD0 A;  3W7U A;  1V55 C;  2Q68 A;  1SRY A;  1VQ5 V;  3IGA C;  2W0F C;  3ZRX A;  1P4R A;  3F7Y C;  2YEV B;  3UKM A;  2QM7 A;  3OUF A;  3BEH A;  4MTG A;  2GHY A;  4UVA A;  4GT1 A;  1GM8 A;  1DLB A;  4PDV A;  4JAV A;  2IH1 C;  1OCC B;  2EIJ C;  2JDI G;  1PL0 A;  4P30 A;  4JPR A;  2XAS A;  3OR6 C;  1AI6 A;  2IU0 A;  1M56 B;  2WPD G;  3ZJZ A;  1SET A;  3CPW U;  2EIK B;  3JD1 A;  1AJQ A;  1KP3 A;  3K03 A;  3ZMS A;  4E2L A;  4QNH B;  3UM7 A;  3QNE A;  3SYO A;  1OCC C;  4DO2 A;  2Q6A A;  1FXK A;  1CP9 A;  2XAG A;  1R3K C;  3FB5 C;  2X7R B;  3B77 A;  4CBC A;  1IXM A;  1H8E G;  3QO5 A;  3QO8 A;  3ZN0 A;  2EIK C;  2HVK C;  1Q7Y W;  2ZD9 A;  1QR9 A;  1VQO V;  4JTA B;  1WPX A;  2WLK A;  3LSS A;  4H37 A;  1NJI W;  1JOY A;  1PNL A;  4R7C A;  2WLJ A;  1Q81 W;  1Q82 W;  3W7W A;  4WFE A;  2LP7 A;  4TWK A;  2WLH A;  3E86 A;  4FMT A;  1GM9 A;  5EBL C;  1NVP D;  4JAS A;  2WWW A;  1QVF U;  3SPC A;  1W2B U;  4MVM A;  3T4Z A;  3E8B A;  2HLD G;  4GX0 A;  3ETE A;  1CPY A;  3ETG A;  5IY5 C;  5J9P C;  2XAH A;  1R3I C;  2Z5U A;  4MW8 A;  1AI4 A;  3MHH C;  5EBW C;  3TET A;  4GX5 A;  3CC4 V;  4PDR A;  1MAB G;  4BAY A;  4GX1 A;  3ZIA G;  1K7D A;  1K73 W;  1FXV A;  1OZ0 A;  3OFN G;  4FPP A;  3K3W A;  1YSC A;  1BL8 A;  3CCS V;  3CC2 V;  3AG3 B;  3B8M A;  3HPL C;  5B3S C;  1R3J C;  1M90 W;  2IJH A;  1SER A;  4PA4 A;  1PD3 A;  4WFB V;  1CEZ A;  1G4Y B;  1E1R G;  4OXS A;  2DW4 A;  2P67 A;  4MVZ A;  2X6B A;  1ENV A;  1VQ8 V;  4TT3 G;  2QM8 A;  1K4C C;  2ZR2 A;  3AG1 B;  4KUM A;  3SJQ C;  3AG3 C;  3OUS A;  1KQS U;  1ROP A;  5L3D A;  2WLN A;  1TUE B;  3ZMU A;  3AG4 B;  1FFT B;  1ZWI C;  3K08 A;  2OTJ V;  4BW5 A;  1R3L C;  3SYA A;  3DTU B;  3AG1 C;  2QA4 V;  5LHI A;  2X0L A;  1YJ9 V;  1VQL V;  3ABL B;  3VOU A;  1XL4 A;  1QVG U;  4WF9 V;  3T2M A;  2EIN C;  3K06 A;  4JYB A;  3G4S V;  3AG4 C;  3ABM B;  2H94 A;  2Q69 A;  1B6Q A;  1F23 A;  1Y66 A;  4XBF A;  1R6K A;  5HFL A;  3ZCC A;  1E1Q G;  1JPX A;  4CZZ A;  2HVJ C;  3CXC U;  3ABL C;  4P9O A;  2QTO A;  2HG5 C;  4MW3 A;  3X2Q B;  1P7B A;  5LGU A;  1COW G;  1PKX A;  3ABM C;  1VQK V;  4MTF A;  3W7X A;  4PDM A;  2QE7 G;  5C93 A;  1QR8 A;  1ARO P;  3OEE G;  4U7N A;  3SPI A;  1HWY A;  3LSQ A;  5IDJ A;  4PEL A;  4MVS A;  2EZO A;  2DWE C;  4MVQ A;  5H9C A;  2KB1 A;  2WAM A;  3X2Q C;  3SPJ A;  2EJR A;  3OMI B;  3D3I A;  3E89 A;  5L3C A;  2WLI B;  4HZ3 A;  1J95 A;  3ZMZ A;  3SPG A;  4FK5 C;  3ZN1 A;  2DQ3 A;  4XDK A;  2HJF C;  5KUK A;  4RO2 A;  3JD2 A;  4FIP C;  3W7T A;  3P30 A;  3LDC A;  2P6J A;  1E79 G;  4TSF G;  2IJJ A;  1GO3 F;  1OCZ B;  2P7T C;  4P9P A;  1DF4 A;  1K33 A;  5KA6 A;  3R65 A;  4WFG A;  4R6Z A;  5EC2 C;  5IYB O;  3CC7 V;  3OAA G;  1S0V A;  4JAU A;  4LBE C;  4QE7 A;  3ZMT A;  2A79 B;  1K8A W;  3CCR V;  2ZDI A;  4MT8 A;  2LFS A;  2B1I A;  1M56 C;  3K9A A;  1OCZ C;  2R9R B;  2DQ0 A;  1VQ6 V;  2X6A A;  4PA6 A;  2XAQ A;  1BHA A;  1OHH G;  1QLN A;  1VQ7 V;  1YJN V;  3EFF K;  1FXK B;  1XL6 A;  1F4M A;  2HKO A;  1K97 A;  3RVY A;  3JD0 A;  5H6R A;  3ZRV A;  3LUT B;  3D36 A;  3SPH A;  2MK3 A;  2WLL A;  1H38 A;  4G28 B;  1MG1 A;  3JD3 A;  2DYS B;  2ITD C;  2JEU A;  1S72 V;  1FXK C;  3ZRW A;  1SZT A;  1VQM V;  1KKD A;  5L3B A;  1MSW D;  1KP2 A;  5B1B B;  1NVP B;  2JJ1 G;  3OEH G;  2YSU B;  4H33 A;  4I5S A;  2QKS A;  3JD4 A;  3E2E A;  1M57 B;  2DYS C;  1NKD A;  3IC7 A;  5LHH A;  2WLM A;  3F7V C;  1QBZ A;  5DM6 V;  3F5W C;  3FB6 C;  2IU3 A;  1W0J G;  4KFM A;  3ZRS A;  1BMF G;  2Y69 B;  3STL C;  5B1B C;  5LGT A;  1PNK A;  1Q86 W;  2C2A A;  4RUF A;  3AEI A;  1M57 C;  3FKS G;  3E8G A;  4EKW A;  3NXS A;  1VQN V;  2QEX V;  1GM7 A;  1K92 A;  3K0G A;  3G71 V;  2XAF A;  5CA3 A;  4PA3 A;  2Y69 C;  5EK0 A;  4UVB A;  2F43 G;  2FTK A;  3ASN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...