The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
8
|
sequence length |
61
|
structure length |
61
|
Chain Sequence |
GSHMYDNLYLHGIEDSEAGSADSYTSRPSDSDVSLEEDREAIRQEREQQAAIQLERAKSKP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Metal transport
|
| molecule keywords |
calcium channel, voltage-dependent, beta 4 subunit isoform a
|
| publication title |
Solution structure of the N-terminal A domain of the human voltage-gated Ca2+channel beta4a subunit
pubmed doi rcsb |
| source organism |
Homo sapiens
|
| total genus |
8
|
| structure length |
61
|
| sequence length |
61
|
| ec nomenclature | |
| pdb deposition date | 2005-10-10 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF12052 | VGCC_beta4Aa_N | Voltage gated calcium channel subunit beta domain 4Aa N terminal |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Ybab; Chain: A; | Ybab; Chain: A; |
#chains in the Genus database with same CATH superfamily 2D46 A; #chains in the Genus database with same CATH topology 1WD5 A; 2D46 A; 1YBX A; 3FEW X; 1J8B A; 1PUG A; 3F42 A; #chains in the Genus database with same CATH homology 2D46 A; 3FEW X;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
