The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
5
|
sequence length |
53
|
structure length |
53
|
Chain Sequence |
ATCATAWSSSSVYTNGGTVSYNGRNYTAKWWTQNERPGTSDVWADKGACGTGS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
chitinase C
|
publication title |
Identification of the substrate interaction region of the chitin-binding domain of Streptomyces griseus chitinase C
pubmed doi rcsb |
source organism |
Streptomyces griseus
|
molecule tags |
Hydrolase
|
total genus |
5
|
structure length |
53
|
sequence length |
53
|
ec nomenclature |
ec
3.2.1.14: Chitinase. |
pdb deposition date | 2005-10-11 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02839 | CBM_5_12 | Carbohydrate binding domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Ribbon | Seminal Fluid Protein PDC-109 (Domain B) | Carbohydrate-binding module superfamily 5/12 |
#chains in the Genus database with same CATH superfamily 1UR8 A; 4Z2K A; 4Z2J A; 1E6R A; 1W1Y A; 3WD0 A; 1H0G A; 1GOI A; 4HMD A; 4Z2H A; 1UR9 A; 4Z2L A; 3WD1 A; 3WD4 A; 1E6Z A; 4MB5 A; 2RTS A; 1W1V A; 1E15 A; 4Z2I A; 1W1P A; 4Z2G A; 1OGG A; 4HME A; 1AIW A; 4MB4 A; 1ED7 A; 1OGB A; 1O6I A; 4TX8 A; 2D49 A; 4HMC A; 1E6N A; 3WD3 A; 1GPF A; 1W1T A; 1H0I A; 4MB3 A; 3WD2 A; 1E6P A; #chains in the Genus database with same CATH topology 4OJL A; 4HMD A; 5BPV A; 2Y2H A; 4Z2L A; 4MB5 A; 3HSH A; 4LG2 A; 3L28 A; 2Y2K A; 1PDC A; 1QO6 A; 4HME A; 1CK7 A; 2Y2Q A; 3HON A; 1KS0 A; 2Y2J A; 1E8B A; 2Y2G A; 4OJ5 A; 4NYY A; 1W1T A; 4GHL A; 3MQL A; 4OJ6 A; 3FKE A; 2UWX A; 4IBD A; 2Y2L A; 2V5O A; 3WD0 A; 2JCH A; 1CXW A; 4IJF A; 4IBF A; 4NYU A; 3N3F A; 4NZ4 A; 4NZ5 A; 1W1V A; 4Z2G A; 1AIW A; 4IJE A; 1J7M A; 2D49 A; 4HMC A; 3M7P A; 1YU4 A; 4OJO A; 1YU0 A; 1E6P A; 1UR8 A; 4IBK A; 4Z2K A; 4Z2J A; 4GHA A; 1YU2 A; 1W1Y A; 1H0G A; 4GH9 A; 4Z2H A; 1UR9 A; 1H8P A; 4NZ1 A; 3KS8 A; 4NZ3 A; 3L2A A; 4OUI A; 4IBB A; 2JE5 A; 1EAK A; 1E15 A; 1W1P A; 2FN2 A; 1YUE A; 1OGG A; 1YU1 A; 2Y2O A; 2Y2N A; 4IBG A; 1E88 A; 4MB4 A; 3L26 A; 2XD5 A; 3WD3 A; 3L25 A; 1GPF A; 3WD2 A; 1H0I A; 2IOU A; 4OJP A; 3L27 A; 1E6R A; 2Y2M A; 1GOI A; 1GXD A; 3WD1 A; 3WD4 A; 1E6Z A; 4IBE A; 4IBI A; 2Y2I A; 2FFF B; 2RTS A; 1L6J A; 4QNL A; 4Z2I A; 3WX7 A; 1ED7 A; 1OGB A; 1O6I A; 2Y2P A; 4TX8 A; 3L29 A; 4IBJ A; 1E6N A; 3KS4 A; 1YU3 A; 4IBC A; 4MB3 A; 4NY2 A; 2BG1 A; 2XD1 A; #chains in the Genus database with same CATH homology 1UR8 A; 4Z2K A; 4Z2J A; 1E6R A; 1W1Y A; 3WD0 A; 1H0G A; 1GOI A; 4HMD A; 4Z2H A; 1UR9 A; 4Z2L A; 3WD1 A; 3WD4 A; 1E6Z A; 4MB5 A; 2RTS A; 1W1V A; 1E15 A; 4Z2I A; 1W1P A; 4Z2G A; 1OGG A; 4HME A; 1AIW A; 4MB4 A; 1ED7 A; 1OGB A; 1O6I A; 4TX8 A; 2D49 A; 4HMC A; 1E6N A; 3WD3 A; 1GPF A; 1W1T A; 1H0I A; 4MB3 A; 3WD2 A; 1E6P A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...