2D49A

Solution structure of the chitin-binding domain of streptomyces griseus chitinase c
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
53
structure length
53
Chain Sequence
ATCATAWSSSSVYTNGGTVSYNGRNYTAKWWTQNERPGTSDVWADKGACGTGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chitinase C
publication title Identification of the substrate interaction region of the chitin-binding domain of Streptomyces griseus chitinase C
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase
total genus 5
structure length 53
sequence length 53
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2005-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02839 CBM_5_12 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 2d49A00
1UR8A 4Z2KA 4Z2JA 1E6RA 1W1YA 3WD0A 1H0GA 1GOIA 4HMDA 4Z2HA 1UR9A 4Z2LA 3WD1A 3WD4A 1E6ZA 4MB5A 2RTSA 1W1VA 1E15A 4Z2IA 1W1PA 4Z2GA 1OGGA 4HMEA 1AIWA 4MB4A 1ED7A 1OGBA 1O6IA 4TX8A 2D49A 4HMCA 1E6NA 3WD3A 1GPFA 1W1TA 1H0IA 4MB3A 3WD2A 1E6PA
chains in the Genus database with same CATH superfamily
4OJLA 4HMDA 5BPVA 2Y2HA 4Z2LA 4MB5A 3HSHA 4LG2A 3L28A 2Y2KA 1PDCA 1QO6A 4HMEA 1CK7A 2Y2QA 3HONA 1KS0A 2Y2JA 1E8BA 2Y2GA 4OJ5A 4NYYA 1W1TA 4GHLA 3MQLA 4OJ6A 3FKEA 2UWXA 4IBDA 2Y2LA 2V5OA 3WD0A 2JCHA 1CXWA 4IJFA 4IBFA 4NYUA 3N3FA 4NZ4A 4NZ5A 1W1VA 4Z2GA 1AIWA 4IJEA 1J7MA 2D49A 4HMCA 3M7PA 1YU4A 4OJOA 1YU0A 1E6PA 1UR8A 4IBKA 4Z2KA 4Z2JA 4GHAA 1YU2A 1W1YA 1H0GA 4GH9A 4Z2HA 1UR9A 1H8PA 4NZ1A 3KS8A 4NZ3A 3L2AA 4OUIA 4IBBA 2JE5A 1EAKA 1E15A 1W1PA 2FN2A 1YUEA 1OGGA 1YU1A 2Y2OA 2Y2NA 4IBGA 1E88A 4MB4A 3L26A 2XD5A 3WD3A 3L25A 1GPFA 3WD2A 1H0IA 2IOUA 4OJPA 3L27A 1E6RA 2Y2MA 1GOIA 1GXDA 3WD1A 3WD4A 1E6ZA 4IBEA 4IBIA 2Y2IA 2FFFB 2RTSA 1L6JA 4QNLA 4Z2IA 3WX7A 1ED7A 1OGBA 1O6IA 2Y2PA 4TX8A 3L29A 4IBJA 1E6NA 3KS4A 1YU3A 4IBCA 4MB3A 4NY2A 2BG1A 2XD1A
chains in the Genus database with same CATH topology
1UR8A 4Z2KA 4Z2JA 1E6RA 1W1YA 3WD0A 1H0GA 1GOIA 4HMDA 4Z2HA 1UR9A 4Z2LA 3WD1A 3WD4A 1E6ZA 4MB5A 2RTSA 1W1VA 1E15A 4Z2IA 1W1PA 4Z2GA 1OGGA 4HMEA 1AIWA 4MB4A 1ED7A 1OGBA 1O6IA 4TX8A 2D49A 4HMCA 1E6NA 3WD3A 1GPFA 1W1TA 1H0IA 4MB3A 3WD2A 1E6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UR8 A;  4Z2K A;  4Z2J A;  1E6R A;  1W1Y A;  3WD0 A;  1H0G A;  1GOI A;  4HMD A;  4Z2H A;  1UR9 A;  4Z2L A;  3WD1 A;  3WD4 A;  1E6Z A;  4MB5 A;  2RTS A;  1W1V A;  1E15 A;  4Z2I A;  1W1P A;  4Z2G A;  1OGG A;  4HME A;  1AIW A;  4MB4 A;  1ED7 A;  1OGB A;  1O6I A;  4TX8 A;  2D49 A;  4HMC A;  1E6N A;  3WD3 A;  1GPF A;  1W1T A;  1H0I A;  4MB3 A;  3WD2 A;  1E6P A; 
#chains in the Genus database with same CATH topology
 4OJL A;  4HMD A;  5BPV A;  2Y2H A;  4Z2L A;  4MB5 A;  3HSH A;  4LG2 A;  3L28 A;  2Y2K A;  1PDC A;  1QO6 A;  4HME A;  1CK7 A;  2Y2Q A;  3HON A;  1KS0 A;  2Y2J A;  1E8B A;  2Y2G A;  4OJ5 A;  4NYY A;  1W1T A;  4GHL A;  3MQL A;  4OJ6 A;  3FKE A;  2UWX A;  4IBD A;  2Y2L A;  2V5O A;  3WD0 A;  2JCH A;  1CXW A;  4IJF A;  4IBF A;  4NYU A;  3N3F A;  4NZ4 A;  4NZ5 A;  1W1V A;  4Z2G A;  1AIW A;  4IJE A;  1J7M A;  2D49 A;  4HMC A;  3M7P A;  1YU4 A;  4OJO A;  1YU0 A;  1E6P A;  1UR8 A;  4IBK A;  4Z2K A;  4Z2J A;  4GHA A;  1YU2 A;  1W1Y A;  1H0G A;  4GH9 A;  4Z2H A;  1UR9 A;  1H8P A;  4NZ1 A;  3KS8 A;  4NZ3 A;  3L2A A;  4OUI A;  4IBB A;  2JE5 A;  1EAK A;  1E15 A;  1W1P A;  2FN2 A;  1YUE A;  1OGG A;  1YU1 A;  2Y2O A;  2Y2N A;  4IBG A;  1E88 A;  4MB4 A;  3L26 A;  2XD5 A;  3WD3 A;  3L25 A;  1GPF A;  3WD2 A;  1H0I A;  2IOU A;  4OJP A;  3L27 A;  1E6R A;  2Y2M A;  1GOI A;  1GXD A;  3WD1 A;  3WD4 A;  1E6Z A;  4IBE A;  4IBI A;  2Y2I A;  2FFF B;  2RTS A;  1L6J A;  4QNL A;  4Z2I A;  3WX7 A;  1ED7 A;  1OGB A;  1O6I A;  2Y2P A;  4TX8 A;  3L29 A;  4IBJ A;  1E6N A;  3KS4 A;  1YU3 A;  4IBC A;  4MB3 A;  4NY2 A;  2BG1 A;  2XD1 A; 
#chains in the Genus database with same CATH homology
 1UR8 A;  4Z2K A;  4Z2J A;  1E6R A;  1W1Y A;  3WD0 A;  1H0G A;  1GOI A;  4HMD A;  4Z2H A;  1UR9 A;  4Z2L A;  3WD1 A;  3WD4 A;  1E6Z A;  4MB5 A;  2RTS A;  1W1V A;  1E15 A;  4Z2I A;  1W1P A;  4Z2G A;  1OGG A;  4HME A;  1AIW A;  4MB4 A;  1ED7 A;  1OGB A;  1O6I A;  4TX8 A;  2D49 A;  4HMC A;  1E6N A;  3WD3 A;  1GPF A;  1W1T A;  1H0I A;  4MB3 A;  3WD2 A;  1E6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...