2D49A

Solution structure of the chitin-binding domain of streptomyces griseus chitinase c
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
53
structure length
53
Chain Sequence
ATCATAWSSSSVYTNGGTVSYNGRNYTAKWWTQNERPGTSDVWADKGACGTGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the substrate interaction region of the chitin-binding domain of Streptomyces griseus chitinase C
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase
molecule keywords chitinase C
total genus 5
structure length 53
sequence length 53
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2005-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02839 CBM_5_12 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 2d49A00
1H0GA 1AIWA 1E6RA 4HMCA 4MB3A 1H0IA 1E15A 3WD2A 1GPFA 4HMDA 4MB5A 3WD1A 1W1YA 1W1PA 1E6NA 4HMEA 4Z2GA 4Z2IA 1E6ZA 4TX8A 1ED7A 2D49A 1W1TA 1E6PA 1O6IA 4Z2HA 3WD3A 3WD0A 4Z2LA 2RTSA 4Z2JA 4MB4A 1OGGA 4Z2KA 1UR8A 1GOIA 1W1VA 1OGBA 1UR9A 3WD4A
chains in the Genus database with same CATH superfamily
1H0GA 2UWXA 2V5OA 4MB3A 1H0IA 4NZ5A 3WD2A 2XD5A 4OJ5A 2FN2A 1W1YA 1W1PA 1J7MA 3MQLA 4Z2GA 4TX8A 2Y2JA 2D49A 2Y2QA 3N3FA 3HONA 3KS4A 2RTSA 1QO6A 4Z2JA 2Y2OA 1H8PA 4MB4A 4NYUA 1W1VA 1OGBA 1UR9A 1E6RA 4LG2A 4QNLA 2JE5A 1E15A 2JCHA 4HMDA 3WD1A 4NZ4A 3L26A 4IBDA 4NYYA 1YU3A 2Y2HA 3WX7A 2Y2PA 4IBIA 1E6ZA 1PDCA 1E6PA 1E88A 2Y2MA 4Z2LA 4NZ1A 1OGGA 4IBBA 4OJPA 4IJEA 4GHLA 3WD4A 1CK7A 5BPVA 4OJ6A 4HMCA 2Y2LA 1EAKA 1YU4A 4GH9A 2XD1A 2Y2IA 4IBFA 1E8BA 1E6NA 3L25A 1CXWA 1W1TA 1O6IA 3FKEA 2IOUA 3L28A 4Z2KA 3L27A 1L6JA 1GXDA 3L29A 4NY2A 1AIWA 4OJOA 2FFFB 2Y2NA 1GPFA 4MB5A 1YU2A 4OUIA 3L2AA 1YU0A 4IBKA 4OJLA 4IBJA 4HMEA 4IBEA 4Z2IA 1KS0A 4NZ3A 1ED7A 2Y2GA 3HSHA 2Y2KA 4Z2HA 4IBGA 4IJFA 1YU1A 2BG1A 3WD3A 3M7PA 3WD0A 3KS8A 4IBCA 1UR8A 1YUEA 1GOIA 4GHAA
chains in the Genus database with same CATH topology
1H0GA 1AIWA 1E6RA 4HMCA 4MB3A 1H0IA 1E15A 3WD2A 1GPFA 4HMDA 4MB5A 3WD1A 1W1YA 1W1PA 1E6NA 4HMEA 4Z2GA 4Z2IA 1E6ZA 4TX8A 1ED7A 2D49A 1W1TA 1E6PA 1O6IA 4Z2HA 3WD3A 3WD0A 4Z2LA 2RTSA 4Z2JA 4MB4A 1OGGA 4Z2KA 1UR8A 1GOIA 1W1VA 1OGBA 1UR9A 3WD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H0G A;  1AIW A;  1E6R A;  4HMC A;  4MB3 A;  1H0I A;  1E15 A;  3WD2 A;  1GPF A;  4HMD A;  4MB5 A;  3WD1 A;  1W1Y A;  1W1P A;  1E6N A;  4HME A;  4Z2G A;  4Z2I A;  1E6Z A;  4TX8 A;  1ED7 A;  2D49 A;  1W1T A;  1E6P A;  1O6I A;  4Z2H A;  3WD3 A;  3WD0 A;  4Z2L A;  2RTS A;  4Z2J A;  4MB4 A;  1OGG A;  4Z2K A;  1UR8 A;  1GOI A;  1W1V A;  1OGB A;  1UR9 A;  3WD4 A; 
#chains in the Genus database with same CATH topology
 1H0G A;  2UWX A;  2V5O A;  4MB3 A;  1H0I A;  4NZ5 A;  3WD2 A;  2XD5 A;  4OJ5 A;  2FN2 A;  1W1Y A;  1W1P A;  1J7M A;  3MQL A;  4Z2G A;  4TX8 A;  2Y2J A;  2D49 A;  2Y2Q A;  3N3F A;  3HON A;  3KS4 A;  2RTS A;  1QO6 A;  4Z2J A;  2Y2O A;  1H8P A;  4MB4 A;  4NYU A;  1W1V A;  1OGB A;  1UR9 A;  1E6R A;  4LG2 A;  4QNL A;  2JE5 A;  1E15 A;  2JCH A;  4HMD A;  3WD1 A;  4NZ4 A;  3L26 A;  4IBD A;  4NYY A;  1YU3 A;  2Y2H A;  3WX7 A;  2Y2P A;  4IBI A;  1E6Z A;  1PDC A;  1E6P A;  1E88 A;  2Y2M A;  4Z2L A;  4NZ1 A;  1OGG A;  4IBB A;  4OJP A;  4IJE A;  4GHL A;  3WD4 A;  1CK7 A;  5BPV A;  4OJ6 A;  4HMC A;  2Y2L A;  1EAK A;  1YU4 A;  4GH9 A;  2XD1 A;  2Y2I A;  4IBF A;  1E8B A;  1E6N A;  3L25 A;  1CXW A;  1W1T A;  1O6I A;  3FKE A;  2IOU A;  3L28 A;  4Z2K A;  3L27 A;  1L6J A;  1GXD A;  3L29 A;  4NY2 A;  1AIW A;  4OJO A;  2FFF B;  2Y2N A;  1GPF A;  4MB5 A;  1YU2 A;  4OUI A;  3L2A A;  1YU0 A;  4IBK A;  4OJL A;  4IBJ A;  4HME A;  4IBE A;  4Z2I A;  1KS0 A;  4NZ3 A;  1ED7 A;  2Y2G A;  3HSH A;  2Y2K A;  4Z2H A;  4IBG A;  4IJF A;  1YU1 A;  2BG1 A;  3WD3 A;  3M7P A;  3WD0 A;  3KS8 A;  4IBC A;  1UR8 A;  1YUE A;  1GOI A;  4GHA A; 
#chains in the Genus database with same CATH homology
 1H0G A;  1AIW A;  1E6R A;  4HMC A;  4MB3 A;  1H0I A;  1E15 A;  3WD2 A;  1GPF A;  4HMD A;  4MB5 A;  3WD1 A;  1W1Y A;  1W1P A;  1E6N A;  4HME A;  4Z2G A;  4Z2I A;  1E6Z A;  4TX8 A;  1ED7 A;  2D49 A;  1W1T A;  1E6P A;  1O6I A;  4Z2H A;  3WD3 A;  3WD0 A;  4Z2L A;  2RTS A;  4Z2J A;  4MB4 A;  1OGG A;  4Z2K A;  1UR8 A;  1GOI A;  1W1V A;  1OGB A;  1UR9 A;  3WD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...