2D4DA

The crystal structure of human beta2-microglobulin, l39w w60f w95f mutant
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
96
structure length
96
Chain Sequence
MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDWLKNGERIEKVEHSDLSFSKDFSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2-microglobulin
publication title Conformation of Amyloid Fibrils of beta2-Microglobulin Probed by Tryptophan Mutagenesis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 13
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2005-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2d4dA00
2YSSA 3EGSA 1DQLL 3K1DA 1HKFA 3MUZ1 3HZVA 5IB3A 3PWLB 4PRNA 4QRSA 4PJ5B 5DGQA 3OGCB 5K9OA 5CCKL 1V7MH 2VTFA 3O0RH 4O2EB 5KSBE 4NKOA 3HAEB 3MTRA 2F54D 1UVQB 5L88H 3T0ED 4P5KA 5JXEA 3C6LC 1EBPA 3MGTB 3IU4L 4G7VH 3PV7A 5DJ0A 3NCMA 3L3IA 4U2YA 4X5WB 4XWOC 5K33A 1EEYA 2GSIA 3EFDL 4LP4A 3TPUB 2AI0L 3IS1X 3M8OL 4TTGA 4TNVF 2JIXB 3UTQB 3KJ4C 5E70A 3C8HA 4PJFF 5E9DB 5SWZD 4HUWA 4FQ2L 5DMKB 4Y4HD 3DX6A 2AXFB 4LGSB 3CU1A 1MCIA 4XPFH 1C08A 5ISZB 1MRCH 1YJDL 3P30H 3VFVB 1DL7H 4R8WH 4FQXD 4AEEA 3D0VA 4PJDE 1QSVA 2D03H 3X13A 1B4JL 4J7RA 4BUHA 1FVCA 5EBGA 2VUOA 4ELME 4RGND 1H15A 1CN4A 1IGML 3VGBA 4XVTL 5D1XB 3WFDH 2VSCA 2NY6B 4HUXB 3GJEB 5LGKA 3TH2T 5AD0B 4NT6A 1NKOA 3U0WH 5EOQH 1IAKB 1XIWA 5GGVH 2MKWA 1MCJA 2RQ8A 3PWNB 3EOBA 3K2MC 3WIHL 5HVFB 4JFPB 4QRUA 3TT1H 1NQBA 4YZFF 4WTXA 2NY2B 1AKJB 5EA0L 4Z76A 2YD9A 2EYSA 3QUZA 4XBPA 5HXMA 4PJDA 1U95A 5JPMB 3CLFH 2VZOA 2CKBB 4CMHB 4YAQB 4FXGA 4ELMA 2ADFH 3KXFE 2J6EH 4C58B 4UQ3A 2OJZL 2NZ9D 3N06B 1IM9A 4N90E 5DD0L 2EE6A 1FDLH 3K4DA 3PWPA 4KTYA 5GZOD 4PJ8A 1UC6A 2DLTA 4PGEA 1ONQB 2V7HB 1PZ5B 3GMLA 2AVGA 2YRLA 5C9JB 3NFSL 2IANE 4QTHA 4G9FB 4R4ND 4Z7WB 4KI5D 3SCMC 4HKZB 2GK0A 2DWEB 1P9MC 5BVPL 3GNML 5C1MB 1I9JH 5HYQB 3QEHB 3RWGA 2C5DC 2B1AH 1U9KA 1PQZB 2FGWL 3LHPL 4PJBF 1KYOK 4ZUVA 5IVXB 3L1OH 1CLOH 3PDDA 2MHAB 4JANA 2I60H 4YHIB 1T20B 4HH8A 5FUZH 1W0WB 2YZ8A 2HKHH 2V2XB 1KB5B 5HHQB 2OK0H 5CBAB 1KTRL 1IGCH 1K6QH 4GLRI 5HYFA 1KJ2L 2Z91B 1CFBA 3N85L 1WBXA 5I1HL 1AQKL 1IILE 2VQ1A 1CXIA 2IG2H 4DTGH 5I8OH 2XTJB 5JW4M 2C26A 2DQHL 5EDXA 4PJ9B 3B8SA 1SVZA 4MZ3A 1OP5K 5ITBH 2X4RB 4JPKL 2HRLA 4NUGH 5I15H 3RIAK 1UEYA 3WS3B 2CRMA 2HT3C 3CFBB 2DM4A 2A74B 1W2KT 1OTTC 4K2UH 3G5ZB 1RZKH 2HJFA 2R29L 3EJZD 5ADPH 1T2JA 5C07B 3MRKB 3MRNA 1T66C 3L5JA 3TNNB 5DJXB 4RIRB 5TQ2H 1AXSA 1BJ1H 2Y5TA 4AMKL 1FJ1A 3ARTA 2X89A 1MFBL 3LRSB 4HWEL 5FF6B 2WZPD 4UTBL 2OJEA 1DR9A 2G2RB 3HTLX 2HJLB 4MJ4A 3RDTD 4ODXA 2NR6D 4GUPA 4OZGF 1RZKC 4XP1H 4RISL 2AW2A 1MOEA 3OKKA 4KPHH 5KVEH 4NWUH 5EOTB 4EUPG 1RUQH 4GW4B 4NQCA 2H6PA 2W9EH 4LLWA 2V5YA 2DQDL 4OJFH 3MREB 1BBDL 3R0NA 3GMPB 1A0QL 1AD9A 3HNVH 1NCBL 3GB7B 3IDIB 3C6SB 3FB6B 5GGTA 5E6IC 5LCVH 5T1DL 1OAQH 1YPZE 4YGVA 3IDMB 2DYPD 4NNXA 5GGVY 4LCWA 1F3JA 2BY2A 2GW5A 3P9WB 3PF2A 1TVBA 4N0RA 4ODBD 3ARSA 1R5VA 5MP6L 1JV5B 3FT2A 1J5OL 3U7YH 4GT7A 4MDIA 5LQBL 4XNYL 2J1KA 1I4FA 5F9AC 1U8HA 1RUMH 1PEZA 2BFVH 1MCDA 3GMRB 4DZBB 1OWWA 5EN2B 5CSGA 3LPWA 4H88H 1BQHB 1M6OB 4YXLH 2R0WH 3KYMB 5D7LA 3VFWB 4LSUH 1JYNA 2I5YH 2X4QA 3SDXE 1CFVL 3LS4H 4XHJC 1M4KA 4X7TB 3MBEA 4QRQA 1TJGL 2EDLA 1MVUA 4NC1E 5FDYA 3GJFA 3DO7A 4I0PD 5KANI 1DE4B 1S9WB 4UOW1 1FGVH 5CJXC 1D5ZA 3EOTH 3A67L 3SGJC 5HHOB 3I6KB 4UB0H 4IBLT 4LHUG 4HKJB 2A9ML 3S6CA 3VD9A 3S97C 2WV3A 4HHAA 4XTRC 5CMAB 4GKNA 1V7NH 3RUGA 1T3FB 1YEGH 4Y7MA 1RK1A 2F53E 1JZ3A 4S2SB 4FMFA 3VJ6A 3SDXA 3DETD 2BOBA 4OCYH 3ROLB 2M8XA 5F3HA 3QIWA 3R0MA 4G8EB 1EHAA 4HJJH 3ULUH 1NLDH 3BRGC 1DBKH 2Z35A 5C70A 2R2HA 3GSUB 5IROC 5C8JB 3ZKND 4F7MB 1FZKB 3LKPB 5HGDA 2AK1H 2BMKA 4XX1E 3ARPA 2VABB 5JXED 1BBJA 1K2DA 3MRHA 3OR6A 1HZHL 5E2VH 3CK0H 4CMHC 5IEHA 3DRQA 3K2UH 4KKAD 1EUUA 1TQCC 5D7JA 1AP2B 1YEJL 2X70A 2YPVH 4LDLB 2Y7QB 2BNUB 4G6MH 5HGAA 3C2AH 3G5YA 5DMYA 2VR9A 2A6JB 3VXPA 2B5IB 3F62A 5TPWL 5BXFA 3UTTA 4F7PA 3TO2A 1FL5A 2ERJB 1Q9LB 3DPBA 4BJLA 1HOCA 2EIEA 3BGMB 1LO4L 4H5SA 2HN7A 5F7MC 2ZUXA 4WIQA 3SPVA 2XN9E 1NCAL 3VXQB 1QFWL 5E1AB 2E6JA 3BDXA 2VLJE 4BK4A 2DMCA 1WQVT 4L8SA 1JWMA 4M4PA 3ES6A 4JN2B 1JGLL 5CGYD 5GGSB 1EEZA 5DF0A 3QHZL 3UDWC 4IEFB 1TMCB 1JHLH 2B2XL 2PTVA 2XRAL 3FO0L 2PTUA 3P40A 4URTB 4NHUB 4JFQB 4YDVB 5D7KE 1XIWD 3CC5B 4K8RD 4YC2C 3EFFA 2E3VA 3TEUA 3M1BA 5GRZA 1JPST 3QULB 3PHQB 2C3WA 5IVZB 2HJKB 4DKFH 3OHXB 3QO0A 4QOKE 2BSTA 3JBG7 1HHGA 2E7BA 3FB8B 1FIEA 3QUZD 4PJ9C 2X4UB 4RQQB 1KN2L 1M7DB 2QQLH 3FN0L 3FQXB 4N9GB 5DQJA 2VLJA 1K8DB 4Q2ZA 5DQ9B 2ESVE 3T04D 3RIFK 1DDHB 1QZ1A 4GKSA 1IM9D 1O5DT 3TA3A 5LGJB 1FO0H 3PWPD 2GQHA 4PJCE 5EU6E 5F88A 1G6RB 1KPVB 1TZIA 4PJ8D 4MAYD 4PB0H 4BFGA 5EPMB 5HPOA 3U0TB 3U2SA 5JIKA 4M6MH 4UV7L 1QLEL 3ARGA 3T08A 5DQDL 1MJ7L 1FNHA 5IBTH 5CS7A 4YPJA 3AS2A 3OXRB 5GS2D 4M1GL 1EO5A 2N7AA 5H94A 3VXOA 2BRRH 1EJOH 3U1SL 4BZYA 4EJ1C 3QJFA 2Y06H 2YWZA 3T0AA 4JHZA 4TULL 4EDXB 4HH9A 2PW2B 4CVUA 5L9DH 2GJ6E 4PJCA 1H3XA 2AXGB 4OLXH 1RHFA 1RUPL 1R3IH 5D5MF 5J0BA 1CBVH 3E2HC 2EYRB 3RVTD 1UZ6F 1T1YB 2LU3A 2F54B 1OAUL 1URLA 5D2NB 3T0EB 4S0TD 3W9EB 4UU9A 1J05B 3WUWA 4R96B 3BH8A 4Z7VF 2BY1A 5DI8B 4NNPL 5DRWA 1UXSB 4L8BA 4AT6A 4EI5C 4KZDL 3HR5B 5TE4L 1A7OL 4DK3A 4P23C 4U6YB 5D7SH 1F4WL 2DIBA 5DVOA 5SWZB 1BFVL 4JO3H 1BFOB 1IGTA 3NH7H 1HH9A 4G8GE 4QHMB 4Y4HB 5HY9B 5IJKC 4JRYA 1JNNL 5C08E 3G6AA 4XB8A 3WFCL 3FONA 4NQDE 2HWZL 3QXDB 2X89D 3QUKA 4MNHA 1I7RA 4FQXB 3MRDB 4NO2B 2EXWC 3U9PL 3V7MA 1FFRA 4P48A 4RGNB 4LSSL 4UTAL 2A6IB 1ZWIA 5TQ0H 1EGJL 4FXKB 1ZV5A 5FAAA 4G80B 3PGDA 5MHSE 4ZTPL 4MHHI 1SJHB 4PR5B 3QT2A 1HSBA 1HILA 2AXJA 4NQCD 3FO1A 2JCCB 3BWAB 4N0UE 4RGOH 3IGAB 4F9LA 5J56B 1N7MH 4G8GA 5A2KH 1IC1A 4ONGH 1BP3B 3SKOB 3OJDB 4NQDA 3U6RB 3VFRB 3X11B 4LCWD 4Z0XB 2PYEA 4NHCL 4U1KA 4JDTH 1LP9F 3N1QC 1W8OA 2VIRB 43CAB 1KNOA 4GOSA 4XPAL 2Q6WB 3WD5H 1C16B 1A7QH 2GUOA 5F44A 4PRBA 2RCSL 1UXWB 3D18B 3L3HA 4OQTH 1F58L 3KLDA 3T8XB 2XWBB 3ILQC 1VFBB 5MEOB 3I6LE 3IAQA 3VU2A 1S5IH 4FOMA 1EUTA 3MRIB 2CLZA 2QSQA 5D7LD 5J57B 2NNAA 3F65A 5CWSB 1U8QB 4PGBA 4LK4A 5E5RB 1SBSL 3MLWL 4LCYA 3MBED 4D9RD 4LU5L 4OGXL 4L4VE 2LVCA 5E00A 2HFFA 2EXYD 4BSVB 3P0VL 3VFUB 3S8WA 2PR4L 3HC4H 3ZL4H 2N4IA 2XKSA 5J1AB 3G08B 3CH8A 2GSGA 2EDXA 3BQUC 5B39G 4Q9RL 1V3MA 1Y0LB 4KC3B 3TYFB 1CDJA 1BD2D 2R1YA 3OX8B 3SE3C 2YKLL 2VZVA 4XBGA 1A5FL 5EU7C 4RMVA 1X5YA 4RNRB 1EXUB 4XP6L 1NKRA 4X8JB 2YD1A 3HMXA 2EKJA 2CDFB 3LB6C 2HG5B 3WHE1 4YXKL 3BW9A 5EBLA 2GTZA 1IT9H 3QIWD 4LKXA 4L4VA 1JZ4A 1EEQA 2WQ8A 5E8NB 3DMMD 1XCQA 1KN4H 3KPRA 5HYSB 5AZEH 3U36A 4NC0B 3Q1SL 4LVHB 4M7LT 4IDJL 4O2FB 4PY8I 3HE6C 1ZVSB 3G6JB 4NIKB 4F37K 4U1IB 4YPGA 2CMRL 2IFGA 2GCYA 4K3DL 2IGFH 2IQ9L 4MSWB 4OFKA 5D7JD 2VXVH 2A38A 4P3CH 5SX4I 4NM4H 4LSVH 2ADJB 2FJGB 4FQQB 3RDTB 1HQRA 3UBXB 1PLGH 3NOIA 5T5FL 1G7IB 1BFSA 4F57H 5C0DB 4XVSH 3UTTD 1RZ8A 1G7LB 1T2QL 3F58H 1C1EH 4JHAL 2WWMC 1FYTE 3N1MC 5FOBA 3BZFB 1C5CL 2A77H 3BVNA 4GG8B 3X3FL 3IDUA 3W11D 1BZ7A 2F5AL 1RAMA 2R4RH 1HIMH 3NIDE 5F1SA 2DYPB 3ARRA 4W4OC 2I24N 5IR1B 3UTPD 2C3HA 5KSAA 1U58A 4NO5B 1KIRB 1OF2B 3CSGA 5IOPB 1G1YA 3AUVA 1FZOA 1H3PL 2MPAH 5AZ2L 2X9YA 5ITFA 3BAEL 3EO9H 1ERNA 4YX2H 4M7ZC 1BVKB 3WYRA 5ESVA 4MYWB 4HWBA 4L3CB 1OGAD 4I5BA 1BQLL 5KVDH 1HYSD 1TZHA 2D9QB 2Q1EA 2YK1L 3O45B 5JW5A 1BJ8A 2VLJD 4ZYKB 1NCWH 4XP4L 4A2LA 2GTWA 5DFVD 4LAJH 2HVJA 5HYEA 3TBSB 1U8KA 4IRJC 1P4IL 4AL8H 3ZKMD 1CGSH 3CD4A 1X4XA 1PGRB 4QXUL 4ZUUA 1JGEB 1MJUH 3RJQB 4IJ3B 5D7KD 1VFOA 3G5XA 3ARGD 3GSQA 5T3ZE 3P2TA 2R1XB 4ISVA 1RU9L 4UUJA 3JSSA 2KUTA 1FH5L 4XCCL 1JNHB 3FAXA 2BVQB 2WUCL 3MO1A 1DBMH 4WCYL 5JHLL 3RY5A 2YSSB 4Y8DC 1JUFA 3DIFA 4GW1B 3EGSB 3ZDZF 4QRTA 1A4JA 3HZVB 5IB3B 1VDGA 4PRNB 4QRSB 4D3CL 2JJWA 1T0MA 4AEHL 3MRMA 3RVWC 5K9OB 3QEUA 3MLPA 1XR9A 3O6LL 4LVOB 3RZWA 1FVDA 3QDME 1EK3A 5JMRA 2IH1B 3MCG1 4H1LA 4WUUE 4OUUB 3QUXC 5DJ0B 3L3IB 4OCXL 1A6ZB 1EEYB 5TE7H 2WSKA 2GSIB 5I1CH 4PB9L 2C7UA 2AEQH 4LQFH 3IU3A 2FX7H 5JZ7D 4XAKE 1EA9C 4YHML 1SQ2N 1DANU 4NKDA 3ULUF 4FZ8L 5D8JL 1GSMA 3DX6B 4MNGA 4JRYD 3G5VA 4M02A 4HXAL 5ADOH 2BNQA 4O9HL 1VB9A 3NFPA 4U7KA 3GHEH 3L5WA 5DC9B 1OP9A 4M1DL 2YN3A 1MIEL 2BDNH 1J18A 3X13B 5TDOA 1RFDH 4P46A 1FVCB 4JM4L 1T1ZA 4FQCH 3RPKA 4PGZA 1G1CA 3K1KC 4AM0A 2WP3T 4Q74A 1MY7A 3H0TA 3NPSB 4L8DA 3UJJL 3O9WD 3UYPA 5B39A 4NT6B 3UPRA 4M9OA 1XIWB 4I48A 4O4YH 1OOAA 1A1MA 3BJLA 3EOBB 1MSPA 4W6WB 1JF5A 2YUWA 4G8GD 5IGXH 4Z0BH 1T5XA 1QBBA 1S7QA 4MB3A 5I0ZA 2R4SH 3K80A 1FCCA 4NQDD 3PWUA 2C9AA 3C87A 2PYED 3QUZB 4Z18A 4XBPB 4X80H 3LH2H 4FXGB 1ZT1A 3C2SA 4ELMB 2ARJQ 1WTGT 4PJGE 4A6YL 4TRPL 1KTKE 3UJTH 5T1KA 1IQDA 3VG9B 2F9BT 1IM9B 2PO6C 5MHSD 3PJSA 3DHMA 3PWPB 4XC3H 5HDQH 3W9DA 1WT5A 3B5HA 4MAYB 2J7LA 3RWFA 3K8KA 3RTQC 3GMLB 3R1GH 2V2WA 1PD6A 5C0BE 1X9QA 4KHTH 4QTHB 1V7ML 3O0RL 1JGVH 2GY7B 1LVEA 4PS4H 2GK0B 4ZPTA 5L88L 4Y4KA 1RPQA 3RWGB 5BV7H 4G7VL 4NBXB 5IMMA 4ZUVB 5F8RC 4M93B 4JANB 2H3NA 1B88A 4WWID 1RZGB 4PJIE 3INUH 1RZJH 1MIMH 2DKUA 2OM5A 5B22A 2EDWA 4HK3N 3VXRE 4NN7B 1OD7A 4OLWH 1PFCA 2P47B 1AC6A 4GKZA 5INDA 3KJ6H 2VQ1B 4NC2B 2J5LB 4XPFL 2VLKE 2FO1A 4G9DA 3NCFB 1MRCL 3P30L 4WTZG 1DL7L 4R8WL 3DOSA 4X7FC 1A6AA 2D03L 2JE8A 4F7EB 2PXYC 3JWDH 4R7DA 5CFHA 4RSVA 3IRZA 3WFDL 1IMHC 1WLHA 2CXGA 4K7FB 3BUYA 3KPRD 4E0RA 2HJFB 2Z4QA 2ZUYA 4PJIA 5EOQL 3MRNB 3MRFA 5GGVL 3RVVC 1FPTH 1AXSB 2Y5TB 1U8IA 1FJ1B 3TT1L 3JWDC 3ZHLA 1MHHA 2CXKA 5I0DA 32C2A 1KCRH 4NQTA 2FIKA 4GUPB 1T21A 3CLFL 4QY8A 1T4KA 2XXMB 3OKKB 4YHYC 2EKSA 4IJ3C 2ADFL 2J6EL 2HMID 5IK3A 4K7PY 5F7KC 4NQCB 1CGWA 4HUNB 1FDLL 3MLSL 1AD9B 2JLLA 4CNIB 4R90H 3H9HB 4NYLA 2HRPH 2QKIA 4RA3A 3H3PH 1R5WA 4NNXB 3KYOA 3O6FB 4LCWB 1F3JB 1KCLA 2XV6B 1FP5A 1TVBB 5KSAD 3VFTA 1I9JL 1R5VB 4YJZL 3FT2B 4U1NA 4RCAA 5GJSH 3VRLF 1Q72H 1YNKH 4MDIB 1DP0A 2B1AL 1I4FB 3L1OL 1CLOL 1U8HB 2I60L 1Y6MR 3I50H 4Z7NE 4N68A 5FUZL 5BO1H 3MLVH 1QKZL 5GZND 2HKHL 4DFHA 3S5LA 4HUUA 4RAUB 3GIZH 2ZKHH 3MLYH 2OSLB 1GPOH 1IGCL 1K6QL 5D7LB 3DX8B 1WIOA 2YZ1A 2UY6A 4CU8A 5JW4Q 4Z7UE 1S9VB 3UBXI 2IG2L 4DTGL 5I8OL 5I8KH 3VD7A 1F6AA 3VMPA 2CIKA 1JTOA 3FZUD 3MBEB 4OQ1A 4QRQB 3QXTA 5ITBL 1NANI 1MVUB 1NJ9B 2MFNA 3LKOA 1G7MB 3GJFB 2DM7A 4JDVA 3DO7B 2H1PH 3O3EA 1J9CT 3K46A 4H25A 4KRLB 4NUGL 5I15L 1UM6H 3MSPA 3TBVA 5DEZA 1D5ZB 1A3LH 4ZOCA 5E94A 4K2UL 1BD2B 1RZKL 4Y5VA 2E7CA 4OCNC 4R3SA 5H37H 5ADPL 5KN5A 1KYOJ 2NY4C 4HHAB 1R0AH 2QADC 4GKNB 5TQ2L 3RUGB 3U0PA 3W0WE 4WI8A 1FAKT 4JG1L 4Z7UA 3VJ6B 4ZO7A 2BOBB 5IIEA 5F3HB 3QIWB 1WBYA 3RI5K 4BQ6A 1YY9D 4XP1L 2Z35B 3KGRA 2R2HB 3MRRA 1CK0H 4KPHL 4NWUL 3ALPA 5KVEL 1K4DA 2RAMA 2WQRA 2AQ1A 3DMMB 1FBIL 5ESQB 4WI9A 1RUQL 1XF2A 2ZUVA 4F8TA 5CJBA 5HGDB 1IAMA 1XCTB 2BMKB 2W9EL 3BISA 4OJFL 1T04A 1K2DB 3OR7B 4X4ZA 4LFHG 3EJJX 3OR6B 4MXVE 5DD3H 3HNVL 4ZAKA 5IEHB 3DRQB 4F9PC 3CFEA 4LEXH 5D7JB 5LCVL 3ULVD 3SDDA 1OAQL 5IB4A 5HGAB 1I1AB 3W0WA 1U8MB 3BESR 2X7LA 3CFCH 4BH7B 5JPNA 4P2QD 5DURD 5FM5M 5E8PA 4H0HB 3HPJA 3RNQB 2MWCA 3P4LA 4GRLA 1FV1A 4MAYC 4OV5B 3MLRH 3UTTB 4RX4A 1RZ7H 3AREA 1FL5B 3TO2B 4F7PB 4OF6A 3U7YL 2BNQD 5IHBA 2DN7A 3SJVA 1OW0A 3C5ZA 5A40E 2HN7B 4TUJA 2P1YA 3SPVB 1RUML 2BFVL 4YXHH 2NX5E 2WAHA 5DHVH 5EUOF 2UUDH 4K23H 3HUJB 3CPLA 2D7MA 4P46D 4W68A 2KZ1B 2XOTA 1JWMB 4X9FA 4UV4H 3ES6B 3TN0C 4YXLL 5EB9A 1EEZB 2R0WL 3BYTA 4PFEA 4LSUL 2I5YL 4BFIA 1NEZA 1QOKA 4L4TB 5SWQB 3LS4L 2Q8AH 4L1DA 5CD3A 5C0FA 2PTTB 3TNMA 2VDKH 1AJ7H 3PHSA 1W8NA 3EFFB 4NN7C 2HP4A 4PRPE 1CDCA 5KJRH 4X98B 4P57A 1FGVL 3QO0B 3WIHA 3EOTL 4D0BA 1OGAB 2J5LC 2BSTB 4DZ8A 1A6TA 4UB0L 4UILH 2NX5A 1ZHKA 4BELD 3O4LE 2A2QT 5DQJB 2DQTH 2ZNXA 1RULL 4Q2ZB 5SX5H 5FM4A 3T2NH 1F42A 1V7NL 2EIDA 4OGYH 1YEGL 5T1KD 4GKSB 5DFWH 4OCWH 1DQDH 3BIBX 4YHPA 5F88B 1QFUH 1TZIB 5E03A 3WS6A 3QQ9C 4OCYL 4HJJL 3ULUL 1NLDL 1DBKL 4PRPA 4OIIH 2VSDA 3ARGB 3JV4B 3KAAA 4GS7B 2X05A 4WWKA 4KJPD 5BRZA 2AK1L 4HK0A 3Q2CA 1DBBH 4Y4KD 3TVMA 2BSSA 3DNKA 4Z7QE 5IHLB 2JTDA 5E2VL 3CK0L 5H94B 6CGTA 5J3HD 3K2UL 3NACH 2NYYC 4X7SH 5K59F 3MRGA 2YPVL 3THMH 4L5FH 3RY4A 4G6ML 3QJFB 1E28A 4K71B 3C2AL 5KBNC 1SVCP 3IJHB 4CADA 4HH9B 3GO1H 4OF0A 5D2LE 2IMNA 1JGDB 5FO8A 1WAAF 3AY4C 4QWWC 3O6FC 5KSVB 5EORH 3G9AB 3QG7H 1Q9WA 2B8OT 4H20H 4P59H 2PUQT 3BH8B 4KV5E 4R7NA 4NQXB 5L2JA 5DRWB 1PKQE 1BWWA 4U49A 3LIZH 4AT6B 2CK2A 4GG6F 2G5RA 5D1ZD 3CXDL 3RWHA 5F97E 1ZA3A 5GISH 3RPIA 1INEH 1JHLL 4IRSA 2VKXA 5JORA 1IGTB 3QR2A 3O81A 4JRYB 2HFGH 2BOCA 3G6AB 3REWB 3FONB 3W39A 3FRUB 4DKFL 1HI6B 2J12B 4DGIH 1JHTA 5IMKA 1NBQA 2WLZA 4M8QA 3MV8E 4APQA 3ULSA 2MQCA 3RU8H 1ZWIB 4JHWH 3WJJC 2QQLL 3T0DA 3D39E 1PKQA 3PGDB 2EXYC 1HSBB 3O9WB 1QD0A 1QP1A 4ETYA 4LHUB 3SKMA 1FO0L 2CIIA 4PY7B 1T03H 3WO4C 3RGVA 4PB0L 3AC0A 1JBJA 2E8ZA 4M6ML 3T65A 4CMMA 3MRBA 4L9LC 4XB7A 5CIPA 2A0LC 3PE9A 1GRWA 2PYEB 3BSZH 4U1KB 1CFSA 4X6EA 1FNGA 5HD8D 1IGFH 3WDIA 2W0FA 4PG2C 4HXBH 2BRRL 3DYPA 3D39A 2GUOB 4OFIA 1CICD 4PRBB 3DMMC 5F89A 1EJOL 3L3HB 3ZYIA 4NN5B 2Y06L 2QQQA 4WUKH 2ICCA 1HINH 4F3FA 2APVA 5L9DL 4KKCD 1R3IL 5A2IH 2BY3A 2CLZB 1CBVL 4ELKB 1T5WA 2DD8H 1I1AC 4Q97A 1OAYH 2XG5A 4JZJA 2FJFA 3V5HA 4MA8H 2EDJA 4LCYB 5IFAH 5E00B 2HFFB 1U3HC 5FDWA 1QSEE 1OPGH 1RHHA 2IADA 2GSGB 5LKNA 1N8ZA 4GJTB 5D7SL 2Z9TA 1I8MB 4XBGB 1S8DB 1H5BC 3NH7L 3BKCH 2F8VA 2R0KH 4UQ2A 1M71A 3B6SB 4L4JA 3HN3A 2YUVA 3VWJC 3LKRB 2EDYA 4JQIH 1JRHH 1KEMH 1NC2A 3VI3F 5EBLB 2GTZB 5GRVK 4G43A 5TQ0L 1NUNB 4KUZL 4J3UA 4G6FD 1P6FA 2XZQH 4Y5XA 3RVUC 5JW4N 1XCQB 3KPRB 2LE9A 2R2BB 1NGZB 3EJYC 4FTVA 3LPGA 3ZHKA 5CGMA 2YPKA 4RGOL 4EN3A 2D9CA 2D4DA 1RVFH 4TVPH 4YPGB 2CLVA 5FECA 3QCTH 1N7ML 2UWEE 2UZYB 4XPBH 5FGCB 3VI4F 3ARXA 4ONGL 3SDDD 3MLTA 2FLBT 3CLEH 4WV1A 1HQRB 1PJ9A 3LV3A 3VH8A 4CBPA 2C3VB 1RZIA 1D9KC 4JDTL 4GRLD 3OKLA 5DO2D 1H0DA 4EUPH 1RZ8B 4RX4D 3WD5L 4G8IB 1A7QL 2DQEL 3SJVD 4LNVA 5FOBB 4OQTL 5DZOA 3SO3B 1CVSC 3J8F7 3BVNB 3QI9C 2PF6A 2QR0A 5T3XH 1T6WA 5CEYA 2B7DT 2ZOLA 3BIKA 1BZ7B 1N6QH 2EC9T 3QUYC 3BKYH 5I9QB 1WWAX 3WSQH 2UWEA 4G3YH 4KRPC 2YD7A 1YC8A 2KQNA 3I2CH 5K9KA 5F7HA 1RZFH 1H8NA 1U58B 5FIEA 3H2WA 4FFVD 4ZSOB 1FZOB 2H2PC 3ARFA 5ITFB 5K9JH 1A6PA 3STLB 3LN9A 2NY0D 2V6HA 1Q9KB 3ZL4L 5ESVB 4JB9H 4I5BB 5EUKA 3B9KC 3NGBC 4R6UA 3P4NA 1IAIH 4S1DD 1UACH 1WFOA 2NX5D 3Q5TA 4M5YL 5SV4A 2XFXA 2O26U 5JLZB 4K3EH 2XNAA 1ZKAA 1A3QA 2F19L 3OWEA 4WGVB 1RIVH 5E4EB 2HVJB 3LZFH 2GKIA 4I0KA 1U8KB 4GXVH 2G75A 4U1SA 4MA3A 1ZGLA 2Y1VA 1IT9L 3ZE0E 4MJ6B 5A2LH 3HE7C 1OCWL 3G5XB 3GSQB 5TJWK 4PJFA 1KN4L 4K55A 1K8IA 3L3GA 4WWKD 5DJ6A 5AZEL 5BRZD 2EDHA 3GZKA 3F12A 3TVMD 4XNUH 3OG4B 3MO1B 4D9QE 1KB5H 1EFXA 1P2CA 2IGFL 3BGAA 2VXVL 1UADC 4P3CL 3WNMA 1JUFB 4LSVL 1XAUA 4NM4L 2A6KA 3O9WC 3DIFB 3D25B 2AABH 3U82B 4X6CE 2QBWA 2Q86B 4FFWD 1A4JB 2FRGP 1PLGL 4HWUA 4JJ5A 4WFGD 3X12A 1NCCH 4F57L 3E3QC 3MRMB 5D7IE 2AV1B 1FFPA 4XVSL 1S9KC 1UM5H 4PGCB 1XR9B 2X5PA 3F58L 1C1EL 1MHCA 2A77L 4H1LB 4UINH 5B21A 2X6MA 1LO0H 2R4RL 1HIML 2C7UB 3WL9A 5FYLE 2AEPH 1CLCA 5TH2B 2ZCKL 4P2QB 5DURB 2A6DB 4NN5C 2BNRB 1DUZA 4IRSD 2OLDA 4NKDB 3HRZA 4TNVK 4MNGB 2MPAL 3G5VB 1ZGLP 2BNQB 2OL3H 3WIFA 3NFPB 1I8KA 4OGZA 3EO9L 1DLHA 4XP5L 4YX2L 3ZYJA 1BF2A 1CWVA 1UT9A 3L5WB 1T7VA 2CO7B 3CFIC 2I9TB 2EZ0D 3NIGE 4XXDA 5KVDL 4P46B 1ZMYA 3GMNB 4UNUA 4KJWC 1T1ZB 3O6MH 2E9WA 4MJ5A 4NFDA 4KVNH 5EULV 3H0TB 3MXVH 4L8DB 2IBZY 4I1NB 1IGYA 2DQJH 2JB6A 3GSWA 5B39B 2VDQH 3UPRB 2J3SA 2VB5A 2B0SH 4I48B 4AL8L 1OGTA 1CGSL 3AFLA 4PJBA 4HS6A 1MJUL 4I4WA 3RGVD 1LK3L 5T1MB 1ACYH 1D6VH 1S7QB 3QNZA 3PWUB 3PDOB 1XGPB 4PJAF 4AIZB 1I3RA 3DGGA 2ZSVA 2E7LC 4B53A 1CGTA 4M61B 1BEYH 3U48A 1FNSH 1ZT1B 1DBML 4PTUB 4ZOBA 4K3GA 4OM1H 3OKEB 5T1KB 4BK5A 4TVSa 1MCBA 3PJSB 4OZ4A 1TETL 3W9DB 3M17A 2FBOJ 5K93A 3CVIH 2D7QA 2XPGB 1SJEA 4GW5A 2WINA 2V2WB 4RAHA 4J3SA 1HHKA 3G9VA 4P4KC 4KJQC 1HE7A 4J4PA 2UZXB 2Z8VC 4DQOH 4ZPTB 1EDQA 4LCIH 5EU5A 4Y4KB 4NM8H 2UYLA 4HIEA 5HHNA 5I2IA 1A6UH 5TE7L 5I1CL 5IMMB 4LARH 1JPFA 2AEQL 5DK3A 4LQFL 4XRCA 4OZFH 2FX7L 1L9NA 3C09B 4OZGA 2XQBH 4PBVC 4AYFA 5F9OH 1W72H 3OJVC 5B4MC 5I1KH 3QO1A 1DEEB 1P7KA 3M07A 1LK2B 5ICXA 4GKZB 4NZDA 5INDB 4ZQKB 3SOBH 5C2BH 4G9DB 3GHEL 5A2JH 2BDNL 2MKLC 2ZSWA 1NC2D 1RFDL 4JFFE 4WTWA 4RFNB 5MERA 1F00I 4Y5YA 4FQCL 5D1ZB 2P7TA 4KKBC 3KLAA 3V5DA 4Y16D 4GXUM 1QRKA 4MJIE 3ZE2E 1GXEA 4XCNB 3IJYA 4O00A 5I1JH 1QPPA 4E0RB 3QP3A 4FTVD 2Z4QB 4ZFFB 4PJIB 5FUOH 4O4YL 4EN3D 1RI8A 1D5BA 1U8IB 5IGXL 2WIIB 4Z0BL 2EEBA 2Q3ZA 3DLQR 4I18B 4OCRH 2R4SL 2F15A 4YHZH 32C2B 3BP4B 2FIKB 2V9QA 4XPGH 5MENE 1QRNA 2WW8A 2RB8A 4X80L 4EQ2A 4QY8B 3LH2L 3O41A 4ZS6C 1T4KB 1T7WA 4JFFA 5ETUA 4KDVA 4GBXA 4M1CD 4CGTA 1ZA6A 4KDTA 3F7VA 4PLKD 3UJTL 1KCVH 4EBQH 4MJIA 4XC3L 5DZLA 5HDQL 4MXWH 3AAZA 1T7XA 5IMLA 2V9RA 1RV6X 2DDQH 4NYLB 2DTMH 3R1GL 4ZDHA 4J1UB 3L3OB 5HI5C 4C4KO 1JVKA 4KHTL 4J23A 3KYOB 2BP3A 1JGVL 3SGKA 4PS4L 5GGQH 4GRWE 3VFTB 3TJHD 2YUZA 2AP2A 4MDJA 2JJSC 5MENA 3O2DA 4U1NB 3IFOA 5BV7L 1A4KB 5EIIA 4JRWA 4WFED 3HNSH 3TWCH 3IFPA 3Q5YA 4L3EE 1CICB 4XP9H 3ARQA 2HTLD 4DGYH 2HYMA 5DJDA 5KTEH 1OTUC 5D6CA 5DT1H 1ZLVH 5I75C 2NMSA 3INUL 1RZJL 1MIML 3HCVA 5FUCC 3S5LB 2V7NA 2N1KA 1G6RH 3ZSSA 4OLWL 2OZ4H 2E9JA 3ALWA 1CT8A 1IZKA 2OI9C 3V6OC 5IV2A 3FQRA 3KJ6L 5CSBA 4P2CG 5CKAA 1F6AB 2CIKB 5D71H 3LKOB 3KWWA 1ETZA 3JWDL 4H25B 5TF0A 4UOJA 2OQJA 4X7CC 4JRXE 4P5TA 3BDBA 4PJHF 4L3EA 5KOMC 5E94B 3S37H 5C0AB 4Y5VB 5KN5B 3LSOA 3QH3A 4ODVH 3UTSE 4FQPA 3SDAA 3N1GC 4HFWB 5F7YC 2YPLE 1FPTL 4U1MA 4KHXH 1UCBH 4ZD3H 1X5XA 1EFXD 4B50A 3GSOB 2RIKA 1KCRL 3E6HA 3GRWH 5IIEB 1WBYB 2VC2H 3MLZH 3WNNA 3WKMH 2BSRA 3UC0H 4G6FB 4EEEA 2A73B 4JVUA 3LMJH 3OAYK 3BGFC 1I7ZA 2NY5H 3PIQB 4JRXA 3QA3A 5C6PB 5CEZH 4PP1C 3SKJH 4PUBL 1QBMH 4ETQA 4UIMB 4YIQA 4MVBD 4R90L 3CFEB 1OAZL 3BOVA 4WNQA 1MHEA 2HRPL 2YPLA 4HJGB 4NWTH 5HVHC 5IB4B 3H3PL 3KPMA 2EDNA 4OCMC 1LE9B 4QXGH 2X7LB 5I73B 4LVNB 5JW3H 4JCLA 5E8PB 4QHNA 1HXYA 4YBLC 4GRLB 5FGRA 4YNYB 1YEDA 1SEBB 1AHWA 4LCCB 1G7JA 3TH4T 5GJSL 4LF3A 4JY5H 1Q72L 1YNKL 3SJVB 4GSDH 2Y23A 1CXHA 1MAJA 4TUJB 4WW2C 4WJ5A 3I50L 2VDNH 5BO1L 3MLVL 5DEGA 3CPLB 3K81A 3GIZL 1YEKH 4F33A 3FFCE 5J3HC 2ZKHL 3MLYL 4XWGH 1GPOL 1Q9OA 1YMHB 4PRHA 2NY7H 4NZUH 4Z78A 4BFIB 4QNPF 3D0LA 4LLAA 3ARBA 3Q48A 1NEZB 3A6OA 3SQBA 4HX1B 3WXVH 5I8KL 5TF1H 4GQ9H 4ZPVA 4LCUA 5CD3B 5C0FB 3TNMB 2FO4A 2FLRT 2H1PL 2YN5A 1UM6L 2NY0B 4KMLB 4P57B 5IQ7H 1A3LL 4D0BB 5FYJE 1FNAA 4DZ8B 1KT2B 2XQYK 3MA9H 2NX5B 1VPOH 5D5MA 1ZHKB 2OR7A 1SYVB 3PWVA 4HAGA 3IF1A 1CU4H 3OL2A 1R0AL 3FFCA 2KPNA 1Z9MA 1X5GA 1JHKL 5D1ZC 4R4BA 2XA3A 4HUVA 4Z7VA 4A6YA 4LEOA 1JZ7A 4YHPB 3QEGL 5LBSH 3SEPA 3C6LA 2J8UE 3UZQA 1AO7E 4FFZH 4N5UA 1CK0L 4J4PD 4I18C 4WWKB 4BQ8A 5BRZB 3KPPA 5C0NC 5GGUA 1C7TA 3TVMB 4J6RH 4E42B 5F72S 5DD3L 1GHFH 1MRDH 2ED7A 1CR9H 2YA2A 3MRGB 4LEXL 15C8H 3GSNH 3WLWC 1E28B 5DS8A 1FRGH 1KGCE 3CFCL 4CADB 4U05A 1G7PB 5EZLA 2IH3B 3MLRL 4U6TA 2J8UA 5KS9E 1FZJA 1LNUA 4QEGA 4YXHL 1Q9WB 2APWA 3D1MC 5JW4R 4K23L 4R7NB 2ICEA 5L2JB 1BAFH 3KDMB 4H8WH 3HZMA 4YHKH 4UV4L 3UYRH 4WFFE 5CBEA 3VGFA 2IQAA 3DRTA 2X1PA 4CN6A 1LP9A 5I16A 4IRSB 5EG6C 4YBQD 5JORB 3MNVA 1P7QB 2HFEA 2NTSP 2Q8AL 3B9VA 1O7SA 3BEWA 1AJ7L 2VLLB 3WHXA 3IETB 3IDNA 1YN6B 5KJRL 3MC0A 4K94H 1SMAA 1ZLSH 2VAAA 1CFTA 5J11B 2FDBP 2FD6L 5I74B 1JHTB 5IMKB 5KS9A 4M8QB 1TVDA 4UILL 1QRND 4F2MA 1JMZA 4JFFD 4PV8A 2OR8A 4DVBA 1PKQB 2DQTL 4AENA 4GBXD 3T2NL 1FZMA 1KACB 4OGYL 4ZODA 1A14H 4JKLA 5ID0A 4K94C 3SCMA 4K9EC 2O5ZH 4OCWL 3SKMB 2CIIB 4QRRA 1DQDL 1P9MA 1U8LA 1QFUL 1MQKH 2F8XC 2EEAA 3RGVB 3VD4A 3CDCA 5GHWH 3NTCH 2HTKD 5IHZA 4P3WA 1U3JA 3U79A 3SGEH 5JQ6H 4OIIL 4GAFB 1UENA 4PJ7F 4CMMB 4TNWK 1R3HA 4MA1C 3NN8A 3LQAH 2MNUA 1A02N 5ICYA 3OQ3B 4NQUA 1CFSB 1DBBL 4X6EB 3MZGB 3DO3A 5MEND 1T80A 2W0FB 4LNRA 5A2FA 2Y36H 5JTWA 1KIPA 3NACL 4X7SL 3THML 4S1SH 4L5FL 3FT3A 4JAMA 4J3VA 4W81A 5D93B 3TCXA 4ZFZA 2V5TA 4BSJA 1RMFH 4PRIA 2KDGA 4F3FB 1WBZA 3LQAC 3GO1L 5MEPB 2EDOA 3QEQA 4NBYB 2C4FU 3VG0L 5TDPB 1T5WB 4FXLA 4LLVA 5J6HA 1HSAB 1SEQH 4JZJB 2FJFB 4CL7A 5EORL 4LVNC 4CU6A 2A1WH 3QG7L 4H20L 3UAJC 4PREB 1FG2A 1VGEH 4LCCC 3LIZL 5FDWB 4DN3H 3VFPA 7FABH 2RBLA 3PNWA 4P5TD 3QFDA 3OXSA 5DJ2B 5GISL 1RHHB 2IADB 4LPVA 1INEL 1HQ4A 2VLMD 3SDAD 2CRYA 4YDLB 4PJ5E 2HFGL 1Q94A 2H2SC 4UQ2B 1M71B 4JFDB 2E9IA 2VZTA 2NLJA 5KW9H 5F9WB 4DGIL 1CLYH 4KK6C 1XGRA 1XH3A 1NC2B 5CGTA 5E08H 3RU8L 3V52H 4JHWL 4KROC 4Y16B 4Y5XB 1A7PH 5E6IA 2NY0C 3SKNA 2CJUH 4JRXD 4KZEL 4R2GD 1OTSD 4FTVB 3E6FB 4X83A 2YPKB 4Z6AT 5JA8B 4OZHF 4EN3B 5E9DE 1HEZB 3RWDB 5FECB 1T03L 4N1HB 1FORH 4X9GA 2VH5H 5CZXD 2YPLD 3MLTB 1YEEH 1ES0A 2Q20A 4O2EA 5ISZE 4KKLC 4WV1B 4KK5D 1E4WH 2FJHB 3BSZL 4YUEH 4ENED 3OKLB 1H0DB 1IGFL 3MGTA 5FXCH 3O3AB 4HXBL 5DUMH 5FHBH 3IS0X 3TPUA 5T3XE 3KLHC 4M6OH 5DHYA 4WUKL 4F8QA 1B6UA 1FSKB 4HW6A 4XNZC 2QR0B 1HINL 5CEYB 2ZOLB 3BIKB 1NGWA 5E9DA 4K8RH 5AYUH 4PRHD 1MCFA 1NDMA 4XPHH 8FABA 5CJXA 2DD8L 3SGJA 1OAYL 2GIYA 5ISZA 2Z8SA 4OLYH 3VFVA 4B0MM 4OZIF 1MCHA 3N0PB 1GIGH 1KULA 5IFAL 3W2DH 4TPRH 4JJHA 4U7MA 3S3PA 2V17L 3LD8B 1OPGL 4OGAC 2AGJH 2CH8A 4ODUB 1MHPH 3B2VH 1RY7B 1Q0XH 3P4NB 1CGVA 1LDPH 2VXSH 4UBDC 4X5LA 2XFXB 3BKCL 1IAKA 3CX5K 2R0KL 3QDGD 2APFA 5IROA 4Z7WE 3EO1B 1LGVA 3N50A 2DF3A 4JQIL 4U1SB 3MRLB 4MA3B 1KEML 2UVEA 5F6HJ 1ZGLB 5C0IA 4DN4H 4DW2H 1CDUA 3CFKB 2CKBA 3W81A 3FKUS 4XWOD 4YHLH 3PQYA 4F58H 4PJFB 3L3GB 5DJ6B 4RRPG 5FYJD 3TFKC 3CZFA 3F12B 2XA8H 5ICZB 4C55A 3F5WA 1RVFL 4TVPL 2DJUA 2FECL 3V6ZA 4OCLC 1P2CB 4XPBL 1IKFH 5INCB 3P4MA 4EZMA 4NN6C 2A6KB 1L4IA 2XTJE 4DCQA 3CLEL 4LPXA 2EIZA 4JJ5B 4JFOA 3X12B 3RQ3A 3KVQA 5HYQA 1FFPB 3C60C 4JPWL 3T09A 1PQZA 3UDWA 3CMOH 4RGMB 1B4RA 1T20A 2NW3A 2AJ3B 1J87A 1W0WA 5C07E 4JN1H 3MROA 4NBZB 1N6QL 1J1OH 2V2XA 3WL9B 3BKYL 5CBAA 2DLIA 5H8DA 3WSQL 4G3YL 3I2CL 1RZFL 4OF3A 2GJZB 3HRZB 4PJ9A 1FLTX 1QBLH 5K9JL 1JCKA 1I8KB 2FNBA 2QSVA 1A7RH 1L7IL 5IP4A 1HWHB 4JB9L 5EO0A 1S9XB 1EPFA 4HIIB 4XXDB 4RA0C 1IAIL 1UACL 5F7DB 4WW2F 1X5KA 5C07A 3NABH 4K3EL 4MJ5B 5DJXA 5AWNL 4RIRA 4XMLH 4WFFD 5GGTH 5AG8A 1RIVL 2E27H 1EVTC 2JB6B 3GSWB 3LZFL 5KSUA 2D0GA 3SCMD 4QRRD 1HKLH 3NVQA 5J6GB 2G2RA 4F15C 4PJBB 1N59A 2NTFB 4I4WB 4D0DA 1FO0A 5HSFA 3QBTB 3BPOB 1FG9C 4NKIL 5GSVA 3QNZB 3JXAA 5I1LB 4UAOB 2R23A 4GW4A 3HG1E 3REVB 3DGGB 2ZSVB 4OV6F 1NUDA 2B20A 1B3JA 2VL5A 3MREA 4XNUL 2X4NB 1AXTH 4FG6C 1KB5L 3GB7A 3C6SA 4Y16C 3GMQB 2ATKA 4OZ4B 4Y1AA 3M17B 3VFSA 2AABL 4PRID 3QEQD 4GW5B 2WINB 4MCYA 4XNQA 3V8OA 1NCCL 1HHKB 1IVLA 1JV5A 3BYYA 5DZNA 2OTUA 4OM0H 2CSPA 4EI5A 1UM5L 2YS4A 2HT2C 2HT3D 5GRUH 5TE6H 4FQIH 4QLRA 3DVGA 5EU5B 5HHOE 1T7ZA 4P23A 1OTTD 4HIEB 4UINL 4FMKA 5HHNB 3HG1A 5I1AA 4DZBA 1IKNC 5EN2A 5IJKA 5I2IB 1M6OA 1LO0L 4M1CC 1T66D 3QWOA 1JPFB 2BHYA 3QHTC 1LILA 4X6DF 2NQCA 4XRCB 4JG0H 4OZGB 5FYKE 4RAVA 4LDOB 3VRLE 3BPNB 3ZKXB 1IEAB 1F3RB 1P7KB 4X7TA 3UZVB 3S3SA 3G04B 2OL3L 4HGWA 5ICXB 2YD4A 3EOYG 4O02H 3UO1H 3L3DB 1ZK9A 2E6PA 3TGXA 3FQNA 2R0LH 3TJHC 1AGDB 2ZSWB 2VLRA 1L0XA 5MERB 4NPYA 3BZEA 2FHBA 1N6UA 3O6ML 1XF5B 5D1QC 2P7TB 5F7NC 3KLAB 2DICA 3V5DB 4LQ1A 4POZC 4HS8H 4KVNL 2VZSA 5E6ID 1N4XH 3MXVL 3IJYB 4YEEA 1VFAB 3KLSA 2DQJL 2VDQL 4S2SA 3C5SA 3AS0A 2G9HB 1NBVH 1NDGB 2YD2A 5DD1H 3S4SA 3BZDA 2AJXH 4KDWA 3ARUA 4N8VG 1CGYA 1ACYL 1D6VL 3GSUA 1KPUA 4F7MA 1UKSA 4P2OD 5T5NF 3UROR 1QRNB 4MB5A 5JIHA 1CFNB 3O41B 4G7YH 5ETUB 1BEYL 5DK2B 1FNSL 2ICWB 5JDSB 1ZA6B 1X5IA 1BQUA 3QIBC 3F7VB 4OM1L 2R2EA 2WBWB 4TYUA 5ESAA 2Y7QA 2EE2A 4C56A 3CVIL 2GFBB 4XHJD 2H32H 4R0LC 1KC5L 4ZDHB 2A6JA 1VENA 3F7YA 1JNLH 2D31B 4DQOL 4LRIC 4LCIL 2EYTA 2YMXH 5ISZD 2WWKT 4NM8L 1TPXC 3BQUA 3SE3A 5EIIB 4O51B 4EQ3A 1A6UL 2CRIA 2ZUQB 3MV01 4Q6YA 4XTRD 4LARL 1GGYA 5ACZB 1JI2A 3S37X 3ZT5A 5DJDB 2FYYA 2OX5A 3BRFA 2XQBL 4DJMA 3X3GH 5F9OL 5DYOB 1W72L 2ZUTA 4EXPX 5I1KL 3MJ7A 4PJEF 5J13B 5SWSD 4MVBC 5F1IB 4G6KH 4YDVA 1PSKH 4OCSH 1CT8B 4HT1H 3QULA 3QCUH 3KS0H 4YBHA 3SOBL 2FZ3A 5LG1A 5C2BL 1OWRM 5AAWA 3P3YA 2AEIT 1JZ5A 1OHQA 2GK2A 2XYCA 1UWXK 3KWWB 1ETZB 3HE6A 5IVOA 2X4UA 3FQXA 4N9GA 3PQYD 4XCEA 5E2UH 1D6EB 5I1JL 3GBMH 3LSOB 3QH3B 4S10A 3SDAB 5LGJA 5FUOL 1D7FA 1KPVA 5BW7C 1QFWI 1TFHA 1VEOA 2EICA 1N0LA 2GEEA 1ITCA 2WP3O 5J1TC 3RX8A 4OCRL 2F54E 3BN9C 2HA1A 2CD0A 4YHZL 3E6HB 3T0EE 4DAGH 1PVHA 4XPGL 3GMMB 2JJTC 2GHWB 2YRZA 3OXRA 1UH4A 3MJ8A 4NSKA 1Z6JT 1I7ZB 4JRXB 3VGHA 4R2GB 1KCVL 4W4OA 2WBJC 5EZOH 3QA3B 4EBQL 5MI0B 4PIRF 2P5ED 4MXWL 5SWZE 5FM5O 4EDXA 4YIQB 3I85A 2CLRA 1T7YA 1AGBB 2DDQL 1G0YR 2DTML 5DEFA 1D5IH 4WNQB 3I9GH 1MHEB 2YPLB 4WW1B 2Z0BA 3KPMB 3HI5H 1JYXA 2EYRA 4QHNB 2F54A 1HXYB 5GGQL 3L7EA 2ZP0T 2ZUWA 4FHBD 2OS7A 3ZZ1A 3W9EA 1G7JB 4PJ9D 1BX2A 3VD5A 4KWUA 3TWCL 3HNSL 1QO3A 1MI5A 1U91A 3PL6C 5BJTA 1UXSA 3OB0K 5IB5A 4XP9L 3SE8H 3UMTA 4WJ5B 4DGYL 3HR5A 3EIFA 5KTEL 5DT1L 1E4KC 5DEGB 5IESH 4IRJA 4KJYA 2JCCE 1JZ2A 4JFXA 4F33B 3SN6N 1G6RL 2O61A 4PRHB 3BP5B 3Q6GH 2OZ4L 4CVZA 4Z78B 1TTFA 2J88H 3D0LB 5KSBF 5FV2A 1JPSH 1QNZH 4ZPVB 4LCUB 3ZKXC 1NGYA 2FO4B 5D71L 1A7NH 1TQBB 2VR5A 1MLBA 3AM8C 1OP3H 4M7KH 5K9QG 3TM6A 4XC1H 1CIDA 3S37L 3HC3H 3QSKB 1SJHA 5BMFH 1LDSA 2X42A 5D5MB 4MAUL 4ODVL 2P24A 4PTTB 3PWVB 1OLLA 2JCCA 1WAAA 1U41A 5FOJA 3QDGB 3EYVA 3IGAA 4KHXL 1UCBL 4ZD3L 3GIVA 5L8LB 3NFNA 4I13B 5D6DC 1ZLWK 4HUVB 4Z7VB 4A6YB 3SKOA 4Y1AD 3OJDA 4R26H 3U6RA 3B2UD 3GRWL 3DV6A 3X11A 1A6VH 4Z0XA 1AQDA 4PJDF 4ZNCD 4GG6A 1WFNA 2VC2L 3MLZL 4TTDC 3QUXA 3UC0L 4FP8H 2YBRA 1F6LL 3LMJL 4EI5D 2NY5L 2XKUA 3KPPB 4ZXBC 1J0HA 3C08H 5CEZL 5GGUB 4P23D 5JIPA 4UT7H 1QBML 1A64A 3HG1D 3LKNA 4YFDB 1BIIA 3UJIH 3VXSB 1MCNA 3MPCA 1IAOB 1TJHH 4NWTL 4P4RB 3V0AC 3B43A 4WU7A 3BT2L 1IEHA 4QXGL 5F93C 4U1GC 5I8EA 5JW3L 3HMXH 4GAJH 1U8QA 4MNQE 2HLFC 2EXWD 4MX7A 3VRIA 4MXQC 5EOCH 3WFZA 3QXAA 1FYHB 3D3VB 4JY5L 3GI8H 1P4BH 4GSDL 2CPCA 1WZ1H 2YWYA 1FZJB 2DLGA 4BSVA 1G9MH 5J1AA 2D2OA 3N1FC 2VDNL 2VLRD 2OR9H 1GZQA 1Y0LA 2BVEA 1YEKL 3FT4B 3G6JE 4UT6H 4XWGL 5H37G 5CBEB 3WV0A 5FK9B 3JWNC 2IQAB 1EX0A 4HGKC 5IB1A 3DRTB 1LP9B 1SM3H 1CXFA 4C57C 1EXUA 1I7UA 3V8CA 5FYKD 3WXVL 3NCYP 3MNVB 4GQ9L 5TF1L 2HG5A 3KNBB 1RUKH 2A9NH 3BEWB 4MNQA 1WC7B 3WHXB 5J13C 4TSAH 3IDNB 4OKDA 1P84K 4RWYH 4QT5B 5IQ7L 3AB0C 2VAAB 2PO6A 5C0GA 3R8QA 4NQSA 4IIQC 4KK8C 3MA9L 5HYSA 1VPOL 3ILQD 2QQKH 1MLCA 4PV8B 4NKMA 1CU4L 4Q6IC 1Q1JH 2JF1A 3RTQA 1ZVSA 4AENB 3AGVA 1FZMB 4U1IA 1UM4L 1L7TH 3H8NA 1PY9A 5ID0B 4MSWA 3SCMB 4PV9A 4QRRB 2ADJA 4TSCL 1ADQH 1U8LB 4WFHD 2VZ3A 2I25N 1BGXH 1KXTB 1NFDF 1Z0MA 2VE6B 5LBSL 3SQOH 4NO0A 3UBXA 4AQ1B 1WICA 1EHLH 5IHZB 2GJJA 1MCEA 3L5HA 3EKCA 4X9IA 4FFZL 4QYOA 4M00A 3NN8B 1U92B 1YQ2A 3GI9H 3BZFA 2XKNA 3WJLC 3BQUD 3NCEB 4J6RL 4LNRB 1C12A 3BP7A 1GHFL 1MRDL 1CR9L 1TZGH 4TUKH 3D5OF 15C8L 3GSNL 3FT3B 1S5HA 3OKMA 1TITA 4ZFZB 2O5XH 1FRGL 3MQIA 4PRIB 5EU4A 1WBZB 1GVIA 3LB6D 5IR1A 3QEQB 5CJQH 5MI0C 4OD1H 1VKXA 3QFJE 2R15A 5KAQF 2B39A 5IOPA 4JM2C 4LSRL 3RJDA 2PXYA 5D4QA 1A3RH 2FSEA 3FL7A 4J2XA 4LLVB 4RBPH 5J6HB 5EIQA 3UEZA 1BVKA 2XWJA 4KTDH 1SYSA 4KK5C 1CL7H 4L3CA 2ICWI 1FG2B 1BAFL 4H8WL 3HE6D 4AIXA 4YHKL 3UYRL 1I9IH 3VFPB 3PNWB 3OXSB 5FHAH 4ZYKA 1AC0A 1KIQA 1YPZF 2BHUA 43C9A 4E5XA 1MCQA 1HQ4B 3ZDYE 3TBSA 3MRQA 2X9XA 3LVEA 4ZFGH 1CE6A 1Q94B 3QFJA 3ZKSD 5GS1C 1UB5A 4K94L 4PBWD 1OQOA 3UPAA 2NLJB 1ZLSL 3NA9H 4PYHA 1AGCA 2WWMD 1XH3B 4LL9A 1N2RA 5T3ZH 2EH7H 4H1LH 1X6NA 4Q9CA 2P8MA 2BVQA 4M7LH 3S35H 3SE9H 5E6IB 4P0DA 3HB3C 3SKNB 5DC4B 2DQGH 1A14L 5HI4C 3HI1B 5A43C 5CP3H 1TNMA 2O5ZL 3SDXF 1X3DA 3MCLH 1FFOA 4GW1A 3CJJA 1MQKL 1KCKA 5GHWL 3NTCL 1OSPH 3A6BH 5JQ6L 1ES0B 1AIFB 2G60H 2Q76A 3LQAL 1GGCH 4P2OB 4UI2A 5IBUG 2EE3A 2IH1A 2X4SA 2W9LA 3T4YB 1WZMA 1MUJA 2Y36L 3DURA 2ADGA 4OUUA 1A6ZA 1X5AA 1MI5D 3MR9B 3V7AE 1BIHA 4S1SL 1LO2H 4K3JH 2RHEA 5DHYB 1UYWH 2YD8A 4PRDB 1RMFL 4IRJD 1NGWB 2BSED 3ZT6A 1JIBA 1NDMB 8FABB 35C8H 1W0YT 4Y4FC 2WANA 1SEQL 5J4MA 5JNYA 2A1WL 4S1RH 4QHKI 1D5MA 1J7VR 2VJXA 1I1CA 1XZ0A 2MQ3A 2W07A 4XMPH 1CGUA 1U2CA 4JR9H 3FOLB 4DN3L 1O7VA 7FABL 3EHBC 2BXYA 1PG7W 1ZOXA 4JCMA 1QR1A 3PWPE 1QSFA 3R4DA 3CDFA 5SWSB 3TYGH 3TP4A 4HULB 3O2VH 3RVWD 5KW9L 3MRCA 1PY4A 5KVGH 1CLYL 2FH6A 4LDEB 4GMTH 5E08L 1Z2KA 5C0IB 2I07A 3V52L 1FC2D 3QUXD 4ONFL 4F9PA 1WT5C 1TQCB 3PQYB 1DUYB 1A7PL 1KTLB 2CJUL 3GSVA 2FEEL 3CZFB 2KL6A 1ZHBB 2Z31B 3F5WB 3AXLB 4MAYA 1FORL 1TJIH 3FTGB 3V6ZB 2VH5L 4QGTA 4B5EA 3ZO0A 4DFIA 1NMAL 2Y25A 3BP6A 3P4MB 2IPTH 1YEEL 1ZE3C 3QUMA 4DCQB 2VQUA 1E4WL 2EIZB 4M9PA 4P3DB 4JFOB 1ITBB 3EYFB 4YUEL 5E5UB 5CZVH 4HLZH 3TN0A 5B3JF 2Z8RA 5DUML 5FHBL 4Y2OA 4CRPA 4XXCC 3MRJA 2NW3B 4M6OL 2P5EB 5GJTL 1JTPA 1RZGA 1D5XB 4PJCF 1RK0B 4O58H 3MROB 1N6VA 1AXIB 3CU7A 4YC2B 3X17A 4K8RL 5E1HB 5AYUL 1MWAH 4XPHL 5L0QC 5FGSA 3K4AA 1AD0A 1PBYA 4NZJA 2P46B 3QRGH 5IM7B 4HQQH 1J11A 4U31A 4OLYL 1GIGL 2NY3D 3MBXH 2P44B 4MNQD 3W2DL 5BS0A 4DUXA 4TPRL 3RHWF 4F7EA 4OIBA 3HAEG 2X10A 3VFMA 1NH6A 4LIQE 1QACA 4NQCE 2AGJL 5EO0B 1MHPL 1M05A 1EMTH 2PO6D 3B2VL 4K7FA 1Q0XL 1LDPL 2APBA 2VXSL 3VDCA 2V5SA 5HHVL 3AVEA 1U42A 1U8JA 4FQLL 3RTQD 4LLUA 2XWTA 1WK0A 1BQSA 1KJ3H 3LPFA 5I17A 5E5MA 4JFEE 4LCWE 5KSUB 5HVWA 4XAWH 3JWOH 1JF1A 1N59B 4JPVH 1C5DB 5CJ5A 3B9AA 4D0DB 1FO0B 4JFYB 4NO0D 1IC4H 4QO1A 2BX5A 4DN4L 4WVRA 4X4XA 4DW2L 3F7PC 4YHLL 5GSVB 3GSRA 2AAVA 4F58L 1ZVYA 5HGGS 2SEBA 2Z92A 5ABDE 2R23B 1XF3B 4L9DA 1MCKA 4M6AA 5L8JB 1T1WB 3FRPG 2UUDK 2VL5B 3NAAH 4JO2H 3MMEA 1KEGH 1VEPA 4CNIA 3H9HA 2PCPB 5D7LE 3E2HB 4GRMA 1IKFL 2ATKB 3DROA 4Y1AB 3GUTB 3AY4A 4IOFC 3O6FA 4JFEA 3VFSB 5CUSH 3CX5J 4P2RA 4D94A 5C0EA 4D9RE 4MCYB 4XNQB 1OAXH 1T2XA 2AJUH 2PXYD 3Q6FA 2OTUB 3ZYOA 4EI5B 1EAPB 3QPXH 3DVGB 4P23B 2P45B 4P2OC 1FNEB 4M5ZH 1BD2E 3HG1B 5I1AB 4WHCA 3S34H 4JN1L 1J1OL 4RAUA 3QWOB 3RVVD 3HS0A 4F37F 2OSLA 5IW1A 4DKEH 3RUGE 1BMGA 2ICES 3DX8A 3QXVA 4RAVB 1S9VA 3OKNA 4AY0A 3UYOD 5HGHA 2GITA 3B9EA 1QBLL 3QFJD 1NJ9A 2DL9A 4HGWB 4X6FA 1G7MA 1A7RL 2NY1C 2FX9H 1V05A 3FQNB 2X44D 5A16B 5CCKH 2VLRB 3WFEH 3DI2B 1BD2A 4NPYB 3BZEB 1HYRC 2IEPA 5TGBB 3EDEA 5JO5A 5D70H 4XMLL 3KG5A 5GGTL 4L9LA 4YQXH 3C5SB 2AI0H 1HKLL 3GEWB 2Z93A 1S78C 1ACZA 1EZVY 3S4SB 5LJYH 3UTTE 3MA7A 4P9HH 4MCZA 4QHUB 4PG2A 1CDIA 1KPUB 3WDHA 5ESQA 3DMMA 3MFGB 1B0WA 5DVMA 3KHQA 1XCTA 3HUJE 2OMBA 2LU7A 1AXTL 2IPUG 3OR7A 4CVXB 2R2EB 5ESAB 4P9HC 3UTPE 3ULUC 1I1AA 3NZ8A 1U8MA 2UY7A 4L4TE 4BH7A 4C56B 1OLZA 4TUOA 3RNQA 4PJHA 2WM0A 3GJFK 1WIPA 2Z31C 4OV5A 3F7YB 2P5WA 1YZZA 2D7TH 4OM0L 5GRUL 5TE6L 4FQIL 1OGAE 2EYTB 3WIHH 3BQUB 2YA0A 3H9SE 5E6ZA 1H5BA 3HUJA 2NY4D 2VZUA 4POUB 2QADD 3RKDC 2GY5A 2M2DA 3TIEA 2FYYB 1DEDA 4JG0L 4Y19B 1SBBA 3VWJA 1BJMA 2NW2A 1QSFD 1NBYB 2VISB 3MJ7B 4L4TA 4J3XA 5SWQA 1E27B 2PTTA 4JREB 2EH8H 5LVEA 4O02L 3UO1L 2HLAA 4R97C 2FZ3B 4X98A 1DVFC 4JM2F 3GMOB 2R0LL 1OGAA 1CGXA 4Z9KB 3HE6B 3H9SA 4QNPE 3T0BA 3UXFA 1QVOB 1UJ3B 3GFUA 2JJVA 3NIDF 4HS8L 3S96A 4NCC1 2R69H 4NGHH 1N4XL 4XCEB 1TIUA 4V2BA 4F7TA 5C6TH 5CD5C 3BD5A 5DVLA 2WBKA 3WFHA 1BQHG 1YQVH 3RX5A 3VXME 5CEXB 3DJ9A 3ZSTA 3BN3B 1D9KA 5DD1L 4OAWA 1JNJA 3WN5C 3MGOA 2IC2A 2AJXL 4W70A 1CIUA 5EUOB 2Q87A 4JQXC 1KF9B 4KMQA 3JV4A 2ORBH 4ZFOL 4HV8B 3NIFE 2EECA 3QI9A 2RJMA 5IFJA 1VA9A 3DWTA 4G7YL 1C8PA 1CDBA 4RMTA 3MJ8B 4NSKB 1DQJA 3TN0D 3QUYA 5IW6A 2H9GA 1KCUH 2LV4A 4EUPA 1R6VA 3FMGH 4LMQI 1TENA 2ADIA 1E4XH 3CNKA 1WEJH 5A3IC 3IJHA 4OZFG 3VXMA 2CLRB 4JRYE 5DEFB 2IBGA 3CCHB 3AS1A 1JGDA 1BOGA 1Z5LB 1JNLL 4M7ZB 3HFMH 1OSZA 3B2UC 1AI1H 3L7EB 5KSVA 2YMXL 3B9KA 4AMKH 2N56A 1GGBL 1BX2B 3QISA 4LLQB 2Q7YA 4NQXA 5BS0D 1QO3B 1MI5B 1U91B 5BJTB 5DMGD 5IB5B 1EFQA 3CX2A 2W0LA 3CFJA 4N8CH 4P9MH 4PY8J 3JVGC 4PGJA 3X3GL 4IRJB 3RWJA 1PYWB 4KJYB 4JFXB 4S11A 3DUSB 1OY3B 3E3QE 3DXAE 3QQ9D 2O61B 4G6KL 1PSKL 2OBGA 4HJ0D 3I3EA 4CVZB 2DQDH 4HT1L 4HZLA 3REWA 4EKXA 3ETBF 3QCUL 3HE7A 3FRUA 1DSFH 1X4ZA 2PYEE 1HI6A 5CIPH 1OM3H 1NGYB 1MLBB 1KXVC 1WITA 3VXUB 3SBWC 3WNKA 1NCNA 2NYYD 4XCFH 5SV3A 1BM3H 1CE1H 5E2UL 4UNTA 3GBML 3QAZC 1KENH 3O9WA 2P24B 4LHUA 4XNYH 4YO0B 4WI5A 4PY7A 5M7QA 2LTQC 3P9LA 5I18H 3EYVB 3DXAA 3GIVB 3NFNB 3O6KH 2Q3AA 2KKQA 3U4AA 4KH2A 1DZBA 4PG9A 4DAGL 3DV6B 4QWWD 4XH2B 3O6FD 4JFED 3TLRA 2DIJA 1AQDB 5FKAA 4GG6B 3T2OA 3CSYB 4P2RD 2QSCH 4CU7A 2AS5M 1V5JA 5EZJB 3QUXB 1X4YA 4XVJH 4N8VB 2YBRB 4NRXB 3D85A 1NAKH 4CDHA 3S7GA 5EZOL 4DOHB 3L3JA 1M1SA 1J88A 3ESUF 4QRPA 4Z77A 3LKNB 3JZ7A 1BIIB 1D5IL 3I9GL 1S3KH 2ZCHH 3WMSA 4WU7B 3FOMA 3NCJH 4BKLA 3HI5L 1NAMH 4ELKA 4I9WE 5I8EB 3WFBH 4XCYA 3RAJH 1J8HA 4BZ2H 1HCVA 3IYLW 4MX7B 3VRIB 4LGPB 1ORQA 1GH7A 3QXAB 3TO4B 4PJGF 1U36A 2J2ZA 3SE8L 3KPRE 3C9NB 4Q7DA 2BVUA 3SDCC 3IKCA 5IESL 1GZQB 4JKKA 4PJ7A 3MJ9H 1I8MA 3RA7H 3I84A 1S8DA 4ZTOH 3H9ZA 2ENYA 3Q6GL 5FGCE 5IB1B 3B6SA 1ZVHA 2J88L 5ANME 4IDLA 4W6XB 4ZUSB 1I7UB 5B8CC 1JPSL 1E4XI 1QNZL 2A0LD 3EYQC 3LKRA 1OVZA 1YEJH 2NY3B 4MNQB 4JZNA 1A7NL 1RSFA 4JREC 3MOAH 4M7KL 1MNUH 1HCFX 4XGZA 1RJZB 1CQYA 3TIDA 4XC1L 2DQCH 3ISWA 1S7VA 2PO6B 3HC3L 5C0GB 4JY6B 4NQSB 2AJZB 5BMFL 2R2BA 1NGZA 2R56H 5C2UB 1MLCB 4I3SH 4NKMB 3RTQB 1HNFA 1UJ3C 1NCAH 3VA6A 4P4KA 2R1WB 5CZKA 4MWFA 4PV9B 1FC1A 4R26L 5ANMA 1I1AD 3U30C 4B41A 1A6VL 4ZSOE 1HH6B 3MOQA 3VWKB 5BZDA 4NO0B 1ZXQA 2C3VA 2QQNH 3C5JA 4EIZC 3IFLH 3FO0H 3RL1A 4FP8L 4QYOB 2P5WD 4Q58C 4G8IA 3TC9A 4PRAA 1U3HD 3RZCC 4CW1A 1TVHA 1FL3B 4XMKH 3C08L 2XKNB 4I8DA 1NL0L 4UT7L 1C12B 3BP7B 3O8XC 1FFQA 3UJIL 1I8LC 1H3WM 5HGBA 4PGDB 5BV7B 1S5HB 3OKMB 2DM2A 5F6IC 1JN6A 4ONOA 5I1EH 2K9UA 5EU4B 3VWJD 3HMXL 2BJMH 1VKXB 4GAJL 1VACA 5GGRB 4ZSOA 4L4TD 3LN5A 4LPWA 2PXYB 4JKPH 5EOCL 5KZCB 3VMNA 1W72A 2FSEB 4YDIL 3FB7B 1DQQA 1T83C 3STLA 3GI8L 1P4BL 3VE0B 1WZ1L 4OZHA 3RVUD 2XWJB 2NXZB 3MV11 1SYSB 1Q9KA 3V2AR 2CDGA 3EJYD 1YUHA 5EBMA 4TQEL 2OR9L 3H9SD 2UV3A 4UT6L 3S35X 5BCAA 5JLZA 2LVEA 1KIQB 4DK6A 43C9B 4E5XB 2VO5A 1SM3L 2JKXA 2XG4A 3VXNA 3BX7C 3MRQB 4H26A 2ZG1A 1WGOA 5EWIL 4N0CC 2A9NL 1CE6B 3QFJB 1D9KD 1UB5B 4TSAL 4UOW0 4YHYB 1H3VA 4RWYL 3EDFA 3P0YH 4KMTH 4MJ6A 4TVPD 1AGCB 4RMSA 1EO7A 4DGVH 4HCRA 1N2RB 4KVCH 4Z7NF 2VN4A 3BHBA 4HMDA 3QI9D 2P8MB 3B83A 1Q1JL 2DI8A 3ULVE 3QUYD 2HAZA 4OZIA 1L7TL 3V6OE 4C56D 1P53A 2J4WH 4Z7UF 4KRPD 1FVEB 4P2QE 3MNZA 3CVHL 2BNRE 1YY8A 1ADQL 4JY4A 1FFOB 3BD3A 4KTEH 3D25A 5ERWB 4D0CA 4KZDH 1BGXL 2MQ0A 4UDTB 2Q86A 3O4OC 2H2PD 2JJSA 3IDYB 4MNGE 3VXMD 1EHLL 3T4AA 1CG9A 2BNQE 4HF5H 2AV1A 3BMWA 4YDJA 3ALXA 2Q76B 4PGCA 5H2BB 3GI9L 1F45A 5DRXB 1P84J 4YLQT 1REIA 3B9KD 2X4SB 1WISA 5F1NA 2HWZH 3SKUD 3SE4C 1MUJB 3KPOA 1BF8A 3DURB 2ADGB 1J0IA 1TZGL 2X41A 4TUKL 4BUGA 5T5NG 1BLNA 3V6OA 1IM3B 2P4AB 5FYLH 2O5XL 5TH2A 4P2QA 2A6DA 5CJQL 2BNRA 4OD1L 5HHPA 4LPYA 1AFVH 1ED3B 4U3XA 3RGHA 4MMZC 1A3RL 3O2WH 3MZTA 4AZ8A 2VN7A 3HE7D 4UT9H 4KTDL 3WE6A 2OZ4A 5JNYB 1CL7L 1TCMA 3H3BC 1D5MB 2AJVH 2I9TA 2F74A 2NY4B 4OI7A 1XZ0B 4MXVF 3GMNA 2FH8A 2CDEA 3MODH 1OARH 2QADB 3TO4C 1I9IL 2W0KA 3RX7A 5FHAL 2V2TB 1GOHA 5CHNB 25C8H 3V6FA 1QR1B 2Y9RT 3OAZK 5E7FA 4EI6B 3G6DH 1H8OA 4FFYH 2DTSA 1QSFB 4IS6A 4WENB 4LHUD 3AU1A 1PDKA 4ZFGL 4JO1H 5I76A 3DXAD 1YEFL 2CGRH 2VL4A 5HVGB 2XY2A 4QHLB 3MRCB 2Y4SA 3NA9L 5T1MA 1QR4A 4WHYH 3PDOA 4N5EC 5T3ZL 1XGPA 2EH7L 4AIZA 2B4CH 2NY3C 4ORGB 2I07B 4UMGA 3MUGA 2W9DH 4M61A 4M7LL 3S35L 3SE9L 1P7HL 3D85D 4NP4H 3EAKA 4PTUA 4OD2B 4AQOA 3OKEA 3GSVB 5EFIA 2DQGL 4OGXH 1I85C 5GRXG 1VCAA 3HI6H 4D2NA 1JGUH 3MCLL 3VXTA 4NZTH 4QRPD 1HXMA 2XPGA 3RKPA 1M7XA 12E8H 4X7DC 1OSPL 3A6BL 3BP6B 1EZVX 1RIHH 3QUMB 4TOYH 1A5FH 4JO4H 1GGCL 2K7QA 4WW2A 2MSPA 5FKPA 1S9YA 1RJYA 1J8HD 5DTFA 3VWKC 5FGBC 5C7XH 3HC0A 3TN0B 4KJWD 4YE4H 2BC4A 3UZEA 3QIUD 4JQVA 3WNPA 1LO2L 3MRJB 4K3JL 4B7LA 1X7QA 3F6LA 1UYWL 3GBNH 1NPUA 3N1PC 3LEXA 3ET9F 5HYJA 1DEEA 3ZDXF 1S7XB 3RWCB 3Q1SH 4PJAB 4CJ1A 5BV7C 1LK2A 35C8L 1AD0B 4HS3A 3IT8D 4ZQKA 3RVXC 4I9WD 4X6DE 4S1RL 4CN1A 1CS6A 1F4YH 5BS0B 3MJGX 4Z7QF 4HIJA 1RZJC 4XMPL 5DUBA 4XI5D 4JR9L 3VFMB 4KXZH 5D1ZA 3WNOA 4PJXF 2EC9U 4U1HA 3EDKA 1M05B 2NXZC 1J0JA 3GGWA 4XCNA 4ZFFA 3ZE1F 5FCUH 3U0WL 5D2LF 3TYGL 4JE4B 4I77H 4CN4A 1U8JB 5I1IH 4LLUB 2XWTB 4R4FH 5I17B 3O2VL 1KBGH 5EO1A 5E5MB 4P4KD 2WIIA 2NXYC 4KJQD 4I18A 5IBLC 1U0QA 5KVGL 1KJMA 3TBTB 3FJTA 1JF1B 3BP4A 4X6DA 2FL5A 4X4XB 3O2DH 3NCYS 1CI5A 3GSRB 4PBXA 1QFHA 1PAMA 2SEBB 2B1HH 2Z92B 4OLUH 5C3LD 4Y8AA 3WBDA 3QNYA 3OAYH 1YN7B 1V3LA 5B4MD 3V7AG 3MMEB 3VA2C 1TJIL 4WO4C 1KB9K 4ZS7H 4GRMB 4J1UA 3L3OA 3V9FA 2IPTL 3DROB 4JFEB 3GSNA 4P2RB 3T3PF 1CXKA 5C0EB 1VHPA 4GRWH 3IDYC 3UTOA 5CZVL 5DR5H 3Q6FB 1VFMA 1A4KA 5JA9A 2XY1A 4KKBD 2DWDA 5EZIH 1CICA 4QXUH 3QWRA 4WY7H 3PWJA 4NJ9H 5C0AE 1AGEA 5LAXA 2VITA 2R0ZH 4O58L 3HS0B 3P77A 5IW1B 2FATH 4JKWA 2OK0L 2FHCA 5F7UA 1MWAL 3EYSH 1YA5A 2APTA 5FO9A 3QRGL 4HQQL 3OKNB 4NUJA 5HGHB 4ZO8A 2GITB 2VNCA 3MBXL 3CSBA 4IHOB 3KHOA 4ZS6D 4X6FB 1KXQE 1TTGA 2AK4B 4V1DA 1OB1A 2ARJA 1A2YB 3JV6A 1EMTL 2C3GA 5C0AA 1KELH 3PGCB 3WO4B 5DUPH 4YFLI 4HFWA 5JO5B 3ZLQC 3MXWH 5GGRY 1KJ3L 5HI5D 5F1KC 1EO8H 4L9LB 3WHE0 3GSOA 2PKDA 4XAWL 3JWOL 1A22B 2Z93B 1VESA 4JPVL 4IMKC 3MA7B 4MCZB 2Y6SC 2K7PA 3SJVE 1F8TH 4Y2DC 1MCOH 2A73A 3IDGA 1MCPH 3PIQA 1TXKA 4ONHB 1OTUD 5CLTA 3NAAL 5I19H 4RMWA 4WU5A 1KEGL 4UIMA 2IFFH 4HJGA 4KGLA 4UDUB 3NZ8B 5HHXH 1LE9A 2H8PA 1INQA 1F4XH 5CUSL 5LGHH 4TUOB 2BNRD 4PJHB 2OCFD 4MQ7A 1OAXL 4YNYA 1SEBA 2P5WB 4LCCA 2AJUL 4U3CA 1A21A 1U3HB 4Z7OE 3DVNA 3QPXL 1XR8B 4M5ZL 1I3VA 2AJYH 3QJHA 3LRHA 2OXHA 1H5BB 3S34L 5K9QI 3ROOA 5HDBE 4H88L 1F13A 5E7BA 2UWEF 4DKEL 4G6AC 1YMHA 3TIEB 1NCDH 3VWJB 1YNLH 3V4VH 4GLRH 1HK6A 3WXWH 2NW2B 4HX1A 1NGQH 2ZOKB 5IB2A 1AE6H 1EIBA 4KAQH 5E99H 1I75A 2HLAB 1WUNT 2FX9L 2QLVB 4S0SD 5KAQG 5BRZE 2XACC 4WTZA 4P5MA 1ORSB 3LDBC 2BHZA 4PP1D 1KT2A 3WFEL 5FYJH 2FX8H 1KIUA 3F6IA 3H9SB 4NRZA 4OKVB 5JQHC 4LOUC 1SYVA 5DMGC 1JFQH 4HDIA 1XT5A 1JF6A 3S96B 5D70L 3OKDA 2IALA 1T22B 4F7TB 3SY0B 3WFHB 1DFBH 1II4E 4YQXL 3QB7C 2E9BA 4WFGE 3V6BR 1MCSA 1UZ8A 1D9KB 4KY1H 1DQMH 4OAWB 1P1ZA 5CEZD 3MGOB 4HJ0C 4P9HL 5H35A 3P73A 2KQMA 4KRMB 1WCQA 4KQ4H 5TFSH 4CJ0A 1J12A 1LE5A 3QI9B 2R8SH 1U2HA 5IFJB 5IG7B 3MV7D 4E42A 2N7BA 1DQJB 5KSBA 5IW6B 3QUYB 1N26A 2H9GB 3T77B 4EUPB 4KRPB 2ADIB 2QHLA 3WO3B 3BPCA 4WEMB 3NBNA 4O5LH 3VXMB 4X5XA 5HYJD 3MV9B 3QG6A 2YEZB 3D9AH 1G7PA 1OQXA 2IH3A 2BCKA 1BOGB 3FHQA 4Y88A 3ZE0F 2D7TL 1P4LA 2XZAH 1OSZB 1UWGH 1XF1A 3DHJA 2FHFA 1NMCB 1KJ2A 3NGBB 3B9KB 4CVWA 1P69B 2HT4C 5HBBA 1NGXA 5JR1H 2Q7YB 3ORJA 1GZPA 5DMJB 3KDMA 5B38G 4E41D 3CFJB 4PLJC 1MPAH 5J12C 3RWJB 3OAUH 1QFOA 4X6CF 3V5KB 5IJVB 3EZ8A 1LHZA 4KK9C 1P7QA 5F70A 5D7IF 2VLLA 2EH8L 4HZLB 3IETA 3MLSH 5GS0H 3HE7B 1YN6A 5DWUH 5L2KE 3EYUH 2DMKA 1IC7H 3E0GA 3SDYH 5C0ND 2X1XR 1HN1A 2VYRE 1MAKA 2DQUH 4WI7A 3S9DB 2DI7A 1U8OA 2IAMD 2R69L 4NGHL 4XX1G 3H42H 3WLWD 5C6TL 5GS0C 5L6YH 1YQVL 1BZ9A 4LP5A 1I3GH 3KXFA 1ZSDA 4MS8D 2ITDA 3P9LB 3EOAA 1OD9A 3DXAB 3C60A 3UP1A 1QKZH 2CUHA 2HFTA 4HWNA 4BA8A 3PUCA 2C3XA 4B7IA 4JFZH 1S7SA 4PG9B 3CAFA 2BVTA 2ORBL 4W6YB 5L2KA 5FKAB 5FYJU 3FO2B 3NIGF 5IBTL 3DARA 1QYGH 2IANA 3MX0A 4N0FA 1ZLUH 4J8RA 4HIXH 3D85B 1F6FB 3LEYH 3VW3H 3HZKA 1KCUL 4HEPG 1NFDE 5ALBH 3FMGL 3QWRD 3L3JB 1Z9OA 1E4XL 4PPTA 3C8KB 3IKKA 4PLOB 4QRPB 1WEJL 4Z77B 5MEPA 4OLZH 4LHQB 3T2PA 4OLXL 4JFDE 2MTPA 1MCCA 3FOMB 5F3BA 5DRZB 4BKLB 3MRPA 4NRYA 5TDPA 3HFML 1HSAA 4XCYB 1ROWA 2E7MA 1AI1L 1N0XH 1J8HB 3TESA 2XZCH 5C0RH 2VXQH 5A1AA 5TDNB 1ORQB 4JG1H 2ZZUT 4POYA 4OB5H 3MUJA 4PREA 3QIUB 4V1DD 2OL3B 5DJ2A 1NFDA 3IKCB 3HLAB 4N8CL 4P9ML 4FTVE 1JPGA 5T1LA 2WWKO 4V2CB 5C0AD 1FBIH 4PJ7B 4JO3L 2ITCA 5EC1B 5HI3C 5E2TH 4JFDA 1KCSH 4NQEE 1Y6NR 5CP7A 2JJUA 3TZVD 1MVFA 1DSFL 2X1WL 1OM3L 2FBJH 3HAEH 4YFLF 5AEAA 2J8OA 4JZNB 4XGZB 3TIDB 4XCFL 4Y16A 5GRVL 2ZWLT 1M7IA 1S7VB 1BM3L 3WUWG 4JZOA 1CE1L 1KENL 1A8JH 4RFOH 3QNXA 3E6FA 5KG9A 1GOFA 3D2UA 4F7CA 5I18L 1HEZA 1R3KB 3PP3K 3RWDA 4HPYH 2XTLA 3MCKB 4P4KB 5J8OA 3O6KL 4MWFB 1K3ZA 4X8XA 4NQEA 5CJOH 5ANMB 3F7QA 4YGAB 1H3GA 5BZDB 3ARDB 5CJ8A 5F96H 2QSCL 2FJHA 4RZCB 3C5JB 3UAJD 4WFEE 2H41A 3M45A 1IKNA 1YPZA 3RL1B 4XVJL 1K9TA 1NAKL 3O3AA 4PRAB 4CW1B 1TVHB 1FNFA 3ZE2F 1UB6B 8CGTA 1G84A 1F3DJ 1MQ8A 3JTSA 3CMGA 4QTIH 1ZS8A 3GKWH 3FFDB 5HGBB 3GSXA 1S3KL 2H2SD 2ZCHL 2DLFH 1AGFB 1JN6B 3NCJL 3OKOA 1S5IL 1UH2A 4Z5RA 1NAML 2OXGA 3WLBA 3VGAB 3WFBL 5JMOC 1RULH 3RAJL 4J12A 1BVLA 1VACB 4OZFB 4KK6D 4BZ2L 3ZTNH 5DDHB 5E2JA 3LN5B 5D1XC 2H45A 3HZYA 1W72B 2NY6C 5LWYH 5D1QA 1DQQB 2BVPA 1DN0A 4KROD 1SJVA 2CKBH 3CDGA 4OZHB 4PJFE 2RFXA 3HC4L 1SHMA 4ODUA 2CDGB 1WJ3A 1NMCC 1YUHB 5EBMB 1L9MA 3B5TA 3MJ9L 3RA7L 2FEDC 2APXA 4ZTOL 3KYNA 4GFTB 5B38A 2NY2C 3GM0A 2MOVA 4OUOA 1S7UA 3WEXA 4DUWA 3VXNB 3EO1A 4GRWF 4H26B 4KKLD 4RFEB 1NLBH 3P0GB 5IWLC 3MRLA 3FN3A 1F4HA 3MOAL 1MNUL 2F53A 3CFKA 3QIBA 1H8SA 2DQCL 1GGTA 3T2QA 2CR6A 3BHBB 3LAFA 3KLHD 2R56L 4NOBA 1IEBA 4I3SL 4ZFOA 1RUAH 4KGJA 4YZFE 4R0LA 5ICZA 3ZTJG 4OZIB 3BMVA 1BWMA 3WDJA 4M48H 4ODHH 1J1XH 5INCA 1UWEH 3MNZB 4LRIA 1YY8B 4JY4B 2XICA 3CXDH 4D0CB 5I1GH 4M4RA 2QQNL 3T4AB 3IFLL 1CG9B 3KYAA 4YDJB 2H32A 3I75B 3JTTB 4QXTA 1KLUA 3K8MA 4OGAD 4XMKL 4QGYA 1QLRB 5I75B 5F21B 2R39A 5F1NB 1JRHI 1MFAH 2AJ3A 4WI4A 3KPOB 4UBDD 1QFWM 1K3IA 4AEFA 1NSNH 3VMOA 2YRPA 2XTJC 2XN9A 1BLNB 2OI9B 4CAGA 4ORZC 5IMOA 5I1EL 5FA3B 2ARWA 5B3JE 2BJML 5HHPB 4PJBE 2GJZA 1P7QD 4JKPL 2X4TA 1UJTA 2VWEC 2FECI 4ZO9A 3WE6B 1GL4B 5DA4A 3DX7A 1S9XA 4MA7H 1X5JA 2F74B 2YOCA 1T89C 3TFKD 4HIIA 2AJSH 5F7DA 2CDEB 5BW7A 3BKMH 3QIUC 4QOKA 2I9LB 2OMNA 2C1OB 2J8HA 1NCWL 4KUCF 1EGJA 3QPQC 3V6FB 1V8HA 3W82A 3BDYH 4UIKH 4IS6B 1ZGLM 3DBXA 3AU1B 2VOTA 3B5GA 5J6GA 3KXFD