2D4DA

The crystal structure of human beta2-microglobulin, l39w w60f w95f mutant
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
96
structure length
96
Chain Sequence
b'MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDWLKNGERIEKVEHSDLSFSKDFSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2-microglobulin
publication title Conformation of Amyloid Fibrils of beta2-Microglobulin Probed by Tryptophan Mutagenesis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 13
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2005-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2d4dA00
4GW4B 2ZJSH 4F7PB 4MMXC 2GFBB 5DZLA 1XGYL 4K7PH 1K8DB 4M7ZB 3D18B 4O51A 2YA2A 4X5WA 5F6HJ 4L3AA 3VCLB 5GRZA 1T04B 1NLDL 3T0WA 3UROR 5FECB 4LMQI 4Q2ZA 1FYTD 3L7EB 2YPVH 2NTFA 1P4BH 4DKEH 1KXTB 4P59L 4GRWF 1S8DB 2C4FT 4OZGA 1XR9B 2XN9A 3KPQB 4DEPC 2VDMH 2KZWA 1NBVL 1NBZA 4PD4J 3O6FB 5ERWA 2HFFB 4Y19D 2I9LB 1YQ2A 3HNVL 3JWOL 2RCSL 1IGCL 4X6EB 5BZDA 4JFYA 4QYOB 3C5ZC 5CD3B 2PW2A 2RR3A 5JZ7C 4NGHH 4Q9RH 3CH1A 3WS6C 5IEKA 3V8OA 3W9EB 2FX9H 1HXYA 1YYLH 1JK8A 3P0YL 4NNPH 3ILQD 3DECA 4WWKD 2PTVA 2VL5B 1DEEA 3DVNB 1RZ8A 2V7NB 4YHIA 3H7LA 2DQGH 2EH7H 4AEEA 2VXVH 1VDGA 3V5DB 4HXBL 3TN0A 5HI5C 4Z7UF 3VGAC 2A6JA 4F33B 2OQJA 3L3GA 1IM3B 3FN9A 1OM3L 4I4WA 1A6TB 4KRLB 2M8XA 3X11A 4KKNA 2V2WB 5A16A 5FYKH 2B4CL 3BGFC 1U8QA 4G8FA 3HMXL 4OCSH 4EEEA 4QXUL 3BD5A 4FQXB 3RTQA 1MWAH 2DQCH 5JXAH 2HFEA 4Z78A 4MXWH 1A4KB 5IT2H 3SKJL 4TTDD 3GBML 4ONGL 3G5VB 2R56H 3CXDH 3B9KD 1RHHA 3WFCH 1EEYB 2QSCH 4PJ8C 4Y1AA 2W59A 3L3IA 5TF1L 3T3MF 5E9DA 3SGDI 1G7QB 1FG9C 2AJVH 3MA9H 3VXNB 1I8IA 4G7VH 3GMOB 3QEQB 2H2PD 1I1AC 5FGCE 5IVXF 4JG0H 2GJ6B 3MRQA 1OP3K 3O3BB 5SWZB 5DHVB 4PJGF 2AQ1A 2C9AA 5ILTL 3GMQB 3H42H 5B39G 2X4RA 1AGBA 4U1GB 3MQIA 5KW9L 2IF7A 4GQ9L 1U42A 3DROA 4M6MH 4ZYKB 3HPJA 4IJ3C 4OD1L 1R3HB 3BX7C 4TSBL 4XGZA 4IDJL 4Z7UA 5CIPH 5I19L 1DR9A 4PJ7B 4UDUB 5GS1B 2CSPA 5I74B 4I8DA 3ZT7A 3VFUA 2XYCA 5EC1A 1OWRM 4HH9A 2P8LA 2VXSL 3S3SA 3MA7B 3V9FA 5GIRB 5E08H 2EDQA 4X7FC 5TDNB 1CIUA 5A43C 4PJ9D 3DV6A 3B6SB 3L9RB 2KL6A 4JCMA 1KFAL 3KHQA 1MCIA 2PXYC 1II4E 4PJIF 4LCCB 1YNKH 3WE6A 1A6PA 2BP3A 1U6AH 5E00A 5FYLH 4YQXH 1FFNB 3IKCB 4P57A 2VAAB 4LSRL 1U91B 4H0HB 3RWFB 3GSVA 5DJDB 3JBG7 5DR5L 2GIYA 2FO4B 1JRHL 1YEGL 4R3SA 4GBXD 4I18B 1A2YB 3Q1SH 1KCVH 5AUMB 5E2UL 4AIXA 2HT2D 1C5DA 2PCPA 3ULVC 4I2XA 1A8JH 5IVXA 3IU4L 2OJZL 3HI1A 5DDHB 2FECI 4PJGA 5ANMA 4WHTB 3E3QC 4IOIA 1MAJA 2P5WD 1RURH 4X99B 2Z4QA 4RFEA 5F96L 2DLGA 5BCAA 2FHFA 1MIML 4DW2L 1YUHA 3MMEA 4U1IA 1NC4B 1MCKA 3IVKA 3CXHJ 1S78C 1KGCE 5FYJL 4FG6C 4RSVA 1JGLL 5E6ZA 3S34H 1A6VH 2DDQH 4GAYA 2Y9RT 1AFVL 3PL6C 1GRWA 2Q3ZA 3U0WH 4FFZL 5ID1B 1KF9B 1JP5A 4DKFL 4JREC 1MRFL 3HLAA 4PRPD 3VD7A 4X6BB 1CZ8L 4LHQB 1I8LC 5EOQH 4F9LA 5C9JB 2W9DH 5L9DL 4PJIA 5KSBB 2A83A 2FIKA 4JPKL 3AC0A 3CCHB 2VLRD 1U8PA 2DQDL 4OGAD 4WU5A 1UWEL 3V5HA 1T6WA 1EIBA 4PJEE 4AIZB 4APQA 3EOAA 4Y2DC 1NJ9B 4QXGL 3SDXE 5F7DB 3SDCD 3OJDB 2ZUWA 3BEVB 3HE6B 2E27H 4MHHG 1YDPB 4PJDB 3DRQA 1XGQB 1G7PA 1SHMA 2VH5H 5IBTL 2F8VA 1EO5A 2LAGB 1MJ8L 2O5YL 3DVGA 4JG1L 4CADB 3C9NA 4K3EH 5HYSG 1N64H 4QHUB 3NPSB 4P2OC 3MBEB 5I1JL 4Q6YA 5F88A 4H5SA 1VGKA 1RAMA 2VIRB 1JPTL 5AWNL 2Y7QA 4EDWL 1Q9WA 4DKDC 3MRDB 3OMZA 1IM9D 1ITBB 2W9EH 4XCCH 2NYYD 4S0TD 1GGBH 3CNKA 5HYJB 4I1NB 3I9GL 3FONA 1P2CB 5D1QD 4ELKA 4EOWL 3INUH 3O4OC 5GJSH 4XVTL 1RMFH 4O2CA 3DMMC 1DBKH 1WIPA 1F4XH 4HWBH 3BXNB 3LKQA 3PJSB 2VXUL 4BQBA 5MEQA 3V4PL 2QV2A 5C8JA 3AROA 1YN7B 3L5JA 3T4AB 4U1JA 3V7AG 2FO1A 4JKWA 3MV9A 4L4JA 4LSUL 4MXQC 1I8KA 2MKLC 5IMLB 3MNWB 5F3BA 4IEFB 3IFOA 4L5FH 1HH9B 2R0ZH 1CDJA 3E2HB 1G7MB 3DIFA 3HN3A 4W4OA 3CPLB 3U6RA 4B41A 3TYGH 4W6YB 3T4YA 1FZJB 2FGZA 5EU7C 3U2SA 2BNQD 3T1FB 3RHWK 4R2GB 5C07D 2GCYB 2NMSA 1AJ7H 1XGRB 3OXRB 3QUYB 4JRXA 3TA3B 3FT4A 1P7QD 3QZWG 4NYLB 1U0QA 4QRSA 4KZEL 2EYSB 1FE8H 4UNUA 3V5KA 2X9XA 5DEGA 4G7YL 1RZKH 1JZ4A 3QDGD 4YHPA 5GPRA 3GMLB 1BFVL 2PO6B 3QI9A 2W9LA 2AEQL 1MFCH 1ZXQA 2EDJA 5DD3H 3EUUA 1HHKB 1S5HB 5F7WC 3GIZH 1G7JA 4X7TA 2OBGA 5CJOL 4JY5H 4R7DA 3FO0H 5BRZA 1F97A 2VISB 1H5BA 4K7PX 4U3CA 4NBXB 5KANG 4LSQH 3S8WA 4DFIA 1HSBA 3LN5A 1JNLL 2FX8L 5HGAA 3VRIB 5DS8A 5CP3H 5HHXL 2Y4SA 4PGEB 1PSKL 1NKOA 3BZFB 1BOGA 1U8KA 1IFHH 4KDVA 3RWJA 4Y4KB 5C0BB 4BH8B 1OGAB 5F7MC 3ULSB 1WGOA 3E0GA 1H3PH 2B7DT 2YEZA 4HUUB 5C3TA 1CL7H 5MEPA 1NC2B 5GS0D 1RIUL 4JFPA 2AJXH 2A74A 2CPCA 5ACMA 3DLQR 5ACZA 3S37L 2OX5A 5D2NA 4HMEA 4Y4FD 5EPMA 3KPSE 1YYMH 4O9HL 3DUUB 4ALAL 1N5YL 1OGTB 1TVBA 1A6ZB 4NM8L 3WO4C 3MNVB 5I1DB 1N0XL 1PEWA 3W81A 5HY9B 3MRGB 3SGEH 3B83A 5F7EL 1I9EA 4HAFA 2ZCHL 1TXKA 5IB1A 3RWCA 3I50H 5T3XE 1RUQH 4CDHA 3DX7B 1M7IB 1XR8B 3ULVE 4U6YA 2X4SB 4XMKH 1ZSDB 4ZUUB 2X1WL 1DTUA 5E1AB 1IGTA 5HI3D 1LWRA 4ZUVB 3GHBL 4ODSL 4HDIB 5FF6A 1H8NA 1CBVL 1AD0A 5E4IA 3RZCA 1JWUB 3E3QE 3QDJE 1QG3A 5DA0B 1P4IL 4NO5B 4DVBB 1EEZA 1N3NB 3UYPA 1I8MB 1KB9J 3LRSB 5M95B 4PGBB 2EDRA 2ZUSA 3VI4E 1D6EB 3SJVD 4LOUC 2OI9B 3OGCB 1J0KA 4M7JH 4NQVB 3KS0J 3NZHL 4PJFB 5I1GH 3NFSL 3FO2A 5TPWH 3HS0B 1J86A 4BFEA 1CDGA 1T3FB 1MCOH 5C08D 4YFEA 1YC7A 4HJGA 5TFSH 1BQHG 5CGTA 4OZHE 2ZKHL 1P69B 4JFOA 3KNBB 1HOCB 4X6DE 3UC0H 1PY4A 4OI7A 2WBJC 4HFUH 1MRCH 5DK2B 1TZIA 5LAXA 3QIWD 2A1WH 1IKNA 2EIEA 3F7YB 4U3HA 2IMMA 3WN5B 1CG9A 1HHGB 2YXMA 3EDDA 5IW1B 4X6CB 4NOBA 3QT2A 4Y5YB 1YMMD 3V0WL 2P5EB 5C6WH 4MQXC 3CSYA 1QRNB 4K55A 1JPGA 3C6LB 3RPIA 1U8IB 4UDTA 1D9KA 5B38A 4NQCB 5JMOC 3G9VA 1AIFB 1JUFB 2VLKB 3ECBA 4PREA 4H20H 1OF2B 1FYTA 3EYSL 4UBDD 3IFLL 2B2XL 3EHBC 5F6IB 5K9KA 1KYOJ 2JK5B 1LNUA 4C83B 4ZQKA 1ZGLP 3O3EA 3LEVL 5D6DA 3V52H 1RJZB 4M7LL 2E9BA 4Y19A 1PLGH 4E42B 4UB0H 5KSUB 1L7IH 1FL3A 3SDAD 3OKNB 1KTDA 3B9AA 4OUUB 2Q86B 2A9ML 1T1YA 5DUPH 1K85A 3JV0A 4O5LL 2PYFB 1NGYB 4OF8A 4WHDA 3U4EA 5KSAB 3OTTA 3VFVA 4EDXB 3V7MA 4FFYH 4HS8L 1EGJL 2OJEA 5SX4I 1LEIB 1GIGH 2Z35A 1RVFL 4S1QL 4WWKA 3K74B 1REIA 1FZOA 4DOHB 1G1CA 4QRPE 1V3MA 5GGRB 35C8H 1E4KC 2CLVB 1MCWM 2VZTA 4ZUSB 4Z7OE 1XAUA 2ADIA 5CD5C 1QLRB 1YC8A 4G3YL 2Z0BA 5IFJB 1JMXA 3QNXA 3B8YA 2FD6H 4Z7WF 4WW2F 5MEOB 3O0RH 2VDOL 3U7YH 1KB5A 3SKMB 2OR7A 1TTFA 1J0HA 3QRFM 4X8JA 2FYYA 2X9YA 3KDMA 4JZJA 1DUZB 2IG2H 2Y6SD 4QLRA 4YO0B 3GI9L 3ARZA 3MV7D 5HDQL 3OKOB 3HC3H 4YPGA 3F7RA 2DQHL 2RFXA 3AVEA 5DJCB 3B9KA 3G6JE 5EU7E 3WIHL 2EICA 3IXAB 3LMJH 4HD9A 3KPNA 1K8IA 2AXHA 5KAQG 1VHPA 4N8VB 4TUKL 4PBVC 3TNMB 4OV6F 2QR0B 2AXFA 4BSVB 1X4YA 3DETD 3QIBD 2BNUB 1S7RB 1JV5A 3RNKB 3BESR 1UCBH 4DZ8A 4CMMB 4MA7H 3QQ3B 1ZLUK 3TFKC 1SJEA 3VXUD 1UACL 2AJUL 5DC4B 2B5IB 4QHMB 4KHXH 4ZDHB 4L8DA 2ICWJ 2CDFA 1MEXH 4NC1C 5FOBB 5E7BA 4OLYH 3BSZH 5T3ZH 5DMYA 2XZAH 4I0PD 1F5WA 1LILA 1NMAL 4K71B 4YBLC 4Z95L 4PV9B 2X4NB 2VLLA 3WFBH 3T1WA 5E7FA 5I16A 1UWGL 2BX5A 1DSFL 2VR9A 5D2LB 1A7OH 4W6XB 5ID0B 3UPRB 4RGMC 4N9OB 2AK4E 1VADA 1ZANH 4IMLB 4JY6B 5IUSA 2X10A 3GI8H 5I8CB 3DBXA 4M9OA 3BH9B 5JOFA 4JGUA 1GGIL 3HUJA 4DTGL 4WV1C 4Z7WA 2BMKB 4WW2A 2Z31A 3V8CA 3QG6A 4U6XA 3OQ3B 3BPOC 3AU1B 1FO0H 3KLDA 3O3DA 4I9WD 4PRAB 5FYJU 4OGYL 4BSWB 5E8NA 2BCKB 3QDAA 3Q6FB 4QRTB 3AS2A 4PJCF 4PJ9A 5H2BA 2AV7B 2NY0B 1UKTA 4JFXA 2DQIL 1ZA6A 1MCSA 3P4NA 5DQJB 4S1DC 1ZHKA 2Y06L 3GIVA 5L0QC 4PRNB 2CXKA 5FYJD 1TZHA 3N85H 3CC5B 3FFDB 2GY7B 1I9JL 4GXVH 2B1HH 2V2XB 2XWTA 2J5LC 2DRUA 4PB0L 1SM3H 3CMGA 2J8UE 1RULH 1A7QH 4NQTA 3ZKND 3GSUA 1LO4H 1QSFA 3ZDZF 4ZOEA 5DK3A 4JFZH 2CKBH 3QG7L 4X4ZA 2NY7H 2UWEB 3SKUD 4GKOA 1S9YB 5BO1L 3X12A 4HPYL 3I6KB 2V17L 3GB7B 1JTPA 3ALWA 4RGNB 3C8DA 4E41B 3X3FH 1WLHA 5DHXB 2A6KA 2P5WA 3PQYD 4N0CD 3IB4A 3O9WD 4K7PL 5E99L 2NY6B 3TYFA 5A2KH 1X7QA 2I25N 5SWSE 3F6LA 4M00A 2X09A 3K2UL 2CRMA 2FJFA 5E5MA 1NUFA 4R0LA 4XH2A 5D1XB 1TENA 2ZCKH 5CHNB 2YPVL 4V1DB 4ZSOA 4Q6IA 5FUZL 4DKEL 2UY7A 2CIIB 3DARA 1JZ3A 3VXTB 1OLLA 2VDML 2X7LB 4XBPA 1A1NB 2X70B 3O8XD 4LKXB 2NY4B 4HGWB 5KTEL 4PJCA 1BVLA 4PRPA 3O6LL 1AH1A 2AQ3A 4ZUTB 1SYVB 1XEDA 3ZL4H 5HDBE 1MCRA 1NAMH 1QYGH 4KK6D 4NM4L 1AY1L 2QQLL 3PV6B 2O26U 2VLRA 5DJYA 1A6UH 4YEEA 3LKNB 3BWAB 4NGHL 5B8CC 4Q9RL 2HTKC 4XCFL 4ZPVB 4UQ2B 5KJRL 2HYMA 4MX7B 4MCYA 1YYLL 4PRHD 1PQZB 3KR3L 3CDFA 4M5ZH 4OIIH 1AXTH 3UCRA 4HZLA 2ZCLH 4P5KB 3HC4L 1TQCB 1R5WB 2DQGL 3SDCA 4P46B 1QNZH 1UADC 3P4LA 3RIFF 43C9A 2HJKA 4PJXE 4U7KA 3VFNB 5A3IC 3RVXD 3DX9B 1E6OH 1U3HB 3RDTC 3UTSA 3BP5B 1CGTA 4QRRA 4M1CD 2CK0H 1A1OA 2B0SL 2ZOKB 4PGZA 3BZEA 1IAIH 1U95A 2V2TB 3UDWA 5L8KB 1MWAL 2GUOA 4M1DH 5JXAL 4MXWL 1F58H 4GFTB 1NMCB 2A6IB 3DX6B 3ZKXC 5ISZB 1Z3GH 1YY9C 3ZKSD 1RZJL 4QHLA 4KHTH 3AY4C 2R56L 4PRID 4P2CG 2PYED 5EO1B 2CGRH 1X4XA 2P47B 5D1QA 3GSRA 4MNQD 5CWSB 1K5NA 2QSCL 1VB9A 4XMPL 4XTRD 3MRIB 1VCAA 3H3PH 4LQ1A 1ZVSB 3STZA 2VC2H 2AJVL 4J3OC 2AKRA 1QQDA 5KVEL 6FABH 1OW0A 4G7VL 3BGMB 4HEPG 1G9NH 4N5UA 4YR6B 3KPPB 4JG0L 4O2EB 1EERB 5GS3A 1CCZA 1MFBH 3EFDH 2ARJA 4FP8L 1KT2A 1A02N 5JOPE 2F53A 1MFAL 5D7JC 4CGTA 4M6ML 4QT5B 3VXMB 3QEUA 1MREL 4K3DL 4LLWB 1OB1B 5ESQA 5EIVA 3S35H 3JVGC 4Q9BA 2OZ4H 1HXMB 3FT3B 3HC0A 3QRGH 5D9SB 2EDYA 3IDNB 1KIRB 5LGHH 1U8HB 3HE7C 4KDTA 2BNQA 3VWKD 5C07A 4QHKJ 1A9EA 2DQJH 1I1RA 2NY1B 3WFHB 1P7QA 3EO9H 4XC1H 4OCYL 1FNAA 1UYWL 3PHOB 2M26A 4K3HA 2QSVA 2FL5B 4NWUL 1SMOA 3HKFA 5GGVH 3CH8A 3QDGA 4X5XB 1U6AL 3IDGB 5F70A 5FDWB 3I3EA 4JO1H 3MJ8A 4NWTH 5IBLC 4NC1E 2JIXD 1A64A 3S97C 2BNRE 5TH2B 4YAQA 4GRLC 5MENE 2B1AH 1TNNA 1I9IH 4A6YH 2C1PA 2X89D 5C09B 1GXEA 3MUHL 4Y16D 3CZFA 1WBXB 1FIEA 3Q1SL 1J18A 3HPLB 3MJGX 1LK3L 4X0KB 1AXSA 2G9HA 3BE1H 3MODL 4ODUA 1KLGB 2X41A 5F3HA 2QLVB 3O6FD 4H26B 1TVHA 2EZ0D 4M1GH 4KZDH 3REWB 1Q94B 2X4TB 3GMRA 5T1KA 3GM8A 1CDHA 2VOTA 3FN0H 3S34L 1A6VL 2QHLA 4IIQA 4LPVA 3BRFA 3MRFA 5FHAL 4NO0D 2VQ1A 1F11B 4HAGA 4G42A 3WXVH 1KCUH 3T0EB 3CSGA 3MRKA 3U0WL 1LO3H 4J4PC 1NAKH 4HKXB 5GGRY 4NKOB 3C09C 4TOYH 5D71H 5F89A 3QR2A 4WEUD 4H8WH 2NY2B 3NZ8A 3VRLE 4XVSL 3WUWG 4ODBD 5EOQL 5CMAB 1BOYA 1NLBL 2XIDA 4WVRA 2OLDA 1BIIB 2XKNB 4PP2B 4ONHB 3VXQB 1U93A 3MLUL 4HIEB 1VA9A 4Z0BH 3WDIA 1U3JA 1MCHA 3U4AA 2QQKH 2HTLD 5IBUG 1BPVA 4P5TA 1A9BB 7FABL 5E2VH 5I15L 2AS5M 4WUUB 4FQXD 1H15A 5C0AE 4IS6A 4XBGB 4XPAH 3OKEA 15C8L 3V4VL 5F1NB 4UIMA 3U36A 3BJ91 3MACH 3EYQC 4P9HL 4G8IA 3KXFB 1CQKA 4WU7B 1HHJA 1VFMA 5E6ID 2ADJA 3HG1D 2GITA 2ILLA 3CLEH 3VG0H 1J10A 1JL8A 4KTEH 5IROA 1FZKA 2Q76A 2ENSA 3AAZA 1X5IA 3LCYA 1EO8L 1F8TH 5C08A 3FRUA 2RHEA 3O4LE 3O2DH 2R9HC 4JPWH 3RNQA 5E24E 2W9EL 1FJ1A 1BLNA 2GJ6D 5DRNA 4Z18A 3TIEA 4BKLA 5EUOB 5SWZD 3GRWA 4LK4A 2FSEA 4UU9A 4LGSB 5DFTA 1YNTB 3ME0A 4EUPH 4LASH 1BZ7B 5JO5A 2V9TA 3QUMH 1YMMA 2V5RA 3SO5A 1RMFL 4B5EA 3QULB 2XWBB 1VPOH 3V6ZB 1E4WL 1F4XL 4HWBL 1QO3B 1TCMA 5HGBA 2EIZA 5KVFL 5I1HL 5SWQA 5TDOB 3U0TB 5ENWB 1XCQB 3IDUA 4UT6H 4F8QA 2A9NL 1MQKH 1GGYA 1CXEA 3VXOA 3LKRB 4K3JH 3RY6C 3QXDB 2IANA 4YBHA 4KGJA 2BSRA 3V7AE 3SDYL 3O6MH 1AO7A 1SY6H 4L5FL 1KG0B 1CF8H 4MD0B 2R0ZL 3CSBA 4YPJA 3ZDXF 1AD9B 2IPTH 5L88H 4H1LH 3WLWD 1FCCA 5F9JA 1S7QA 1ORQA 4BUHA 1C1EL 3HMXA 5GRVL 5IQ7L 1A14H 3TYGL 3Q6GH 3GSQA 4B7IA 5D70L 1CXLA 3IKKA 4GS7C 4PJBB 3F58H 3QWRA 4U1LA 1FE8L 1YEJL 1CR9H 4HFWB 4PV8A 3ARDC 2WBKA 3IGAB 1RZKL 4F7MB 4U1KA 3KG5A 2KQMA 5DUMH 2GSIA 3RUGF 5DD3L 1KBGH 1T2JA 4P2YA 1Q38A 4MCZB 3K2MC 4HG4J 2HVJB 3J7HA 3S5LG 3Q5TA 4JANA 3BO8A 4LQFH 5MERA 1HHIB 5TF0A 3WD5H 5SV3A 2YRLA 4JAMA 5I6XB 1H3UA 1IBGH 5DD5L 3GJFA 1MRDH 1OSPH 5FA4B 2A77H 2ZSVA 1IFHL 1WITA 3MV7A 1Z0MA 1AHWB 4MZ3A 4GLRH 3TT1H 1RK0B 3BP7B 4N0FA 1H3PL 1Q9OB 2XFXA 4BSJA 4XCYB 4P2RE 2AJXL 4MA3A 2FWOA 5E1HB 4OIAA 4XZUA 4LLYB 3GMNB 3LB6D 3IYLW 3QIBA 5HHME 4F7TA 2HT3C 1UQSA 1DFBH 1YYML 2PR4L 2F54E 5HXMA 3VMNA 1TJGH 3KPRE 4XC3H 3KPMA 3MYJA 4P4KB 3VXUA 2ZUVA 3MJ9A 4P3DB 4GAJH 4LHUB 1MHEB 1FL6A 4NRZA 5I1AB 3ULUD 3UTOA 3WEXA 3HE6D 4U1SA 3WSQH 1SQ2N 2ZPKH 1LEGB 1RUQL 3RUGA 3ARBC 4MSWB 4NUJB 4QRUB 5JLZB 3FT2B 1V7NH 3PWPA 4XMKL 1GAFL 1GH7A 3T77B 5ICYA 3MBED 1JTTA 5MP6L 2BDNL 5D7IB 5DGRA 5I66B 4LLDB 1QKZH 1IEHA 1KELH 3QIUB 4XBEL 3VXSB 5IW3A 1EEUA 4HHAB 1JRHI 3MV8B 4PJ5D 2I9TB 3RIFK 5HYJD 4HJ0D 1JNHA 3IDIB 4M7JL 5DJZB 3MNZA 4UTAL 4LL9A 2OP4L 1KB9K 2H26B 4M93B 5K9OA 3SGJC 1DQQB 1ZS8A 3MLSH 2ERJB 4XWGL 3ILPB 5J6HA 4G9FB 4TVPE 4K94C 1I7TA 5J11C 4Y5VC 3GGWB 3RWEB 4MNGE 1T2QL 4M62L 5EZJB 1ZE3C 4JDTH 2VLJB 4KROC 1IAKB 3BQUA 4YBQC 5TFSL 5IVZA 1IL1B 4F3FB 2QQNL 5BMFH 2IFFH 3QWOA 2VUYA 3FCTB 4LIQE 4HFUL 1CFQB 2LQRA 5HI4C 4WGVB 4Z9KB 2MSPA 1P6FA 4KGLA 5FB8B 4GKZB 2UVFA 1PZ5A 5IFHH 3OKLA 5LGJA 4KKAC 3DHMA 5IB5A 3OR6A 3PQYA 5TJWK 2DBLH 3RGHA 1FH5H 1EAPA 3RL2A 5D5MF 4ZS7H 4G8GB 3FFCE 5DO2D 3CAFA 1TZGL 1AQDB 2BJMH 2Q7NA 3BKJH 4MA8L 4LFHG 3S35X 1KPRB 1S7XA 4R2GD 3QUYD 3TA3D 2BVOA 2EC9T 5TE6H 2UY6A 4B53A 3MXVH 5TGBB 4PGCA 3DX8A 5BJTA 4JFQB 2DM4A 1UGNA 3K8KA 1NCWL 2PO6D 2NW3A 3UBXG 4OM0H 1L7IL 1KYOK 5DUPL 2F15A 4ZS6D 4N90D 1JPFB 3LQZB 3QFJB 4ZFZA 2EDFA 1OSZB 5I18H 3ZLQC 2P24B 5J3HD 1G6RH 4PRHA 4QHKI 4NT6B 4Y7MA 2ADGA 2R1XB 3ARGB 1HINH 4OGZA 3RL1A 2NNAB 1GVIA 1OD7A 3PNWB 2GJZA 2FJHB 5EB9A 3O2WL 3DWTA 5D8JH 1D5ZA 4FRWA 3PHQB 1HHHA 3ILQC 4Y4KD 5C0BD 2R2EB 1OGAD 4UQ3B 1KC5H 5D7LB 1NC2D 5IJKC 3VFPB 2CRIA 3TZVC 4ENEC 1CI5A 4O51B 4L4TA 2F74B 2JB5H 2VDKH 1WFTA 5D5MA 1G9MC 2O93L 4JHBA 3DUHA 1FVDA 1JMZA 2OTUB 1JHKL 4NRXA 3RAJL 1MJUH 5HJ3B 4WFFE 3BPCB 4Q2ZB 5HDOA 1QHOA 1ZT7A 4MD5B 1RUML 4Q9CA 3S6CA 4NKMB 2IG2L 3UAJD 2YS4A 1RIHH 2FBJH 3HC3L 2NW2A 4GAGH 4NQSA 4YHYC 5A2JH 1ZTXH 2MNUA 3EYOA 1NBZB 3NCJL 5LQBH 4M61A 3B5HA 4JFDB 4P49A 1F4AA 3LMJL 5DYOA 1PDKA 4JFYB 1DLHA 3MLXH 4U1NA 5CSBA 1OP5H 3TBWB 4Q0XH 4QTIH 5IEKB 1UCBL 4UOW0 5CINH 4AL8L 1JK8B 4ERSL 2VQUA 3U46B 1FVCA 5I0ZA 2FZ3A 5KAQF 4FS0A 4L3EB 3VA6A 1J0ZA 3VU2A 3CVHB 4OLYL 1FAIH 4JPVL 4YHIB 4OQ1A 5DVMA 2XICA 2H2PC 4KU1A 3V79C 5EG6C 1ZVYA 3ZTJH 2A6JB 2OQJB 4F80A 3T3PF 3D0LA 3ZYZA 4XHJD 4IMKA 5A16B 1OY3B 3GI8L 4EI5B 4NKDA 1I1FB 4OB5L 3ZE1F 3FAWA 4R97C 1N6QL 2HFEB 5FK9A 1FO0L 3FOMA 3UTQA 3M17B 4C58B 1FLTX 2I60L 1ZLVH 4XXCC 1RHHB 4OZ4A 4PJ9C 5HDLA 4Y1AB 1I85A 5D2NE 3L3IB 5DMIH 4CJ1A 1S3KH 3N85L 2K7QA 4PRBA 4JEGB 5EA0H 4GW4A 4GXVL 4QOKE 1QRND 3PP4H 3C6LD 2FNBA 4HXAH 2JIXA 1SM3L 3HNTL 3K1DA 4NQCD 1I8IB 4BYHA 3FOLA 1RULL 2AI0H 4NZTH 4WGWB 2VLKD 2X89A 3QXVA 4Y16A 5C2BL 4JFZL 3MRQB 1PG7H 1DN0A 2J3SA 1CE1H 3VXRA 4GBXC 1S8DA 4RISH 1FNGB 1XR9A 5CZXD 1AGBB 4HSQA 3D69B 5J1AA 5JR1L 3KPQA 1S7WA 3HPJB 4UAOB 2Y25A 4U05A 4XGZB 4H0GA 1QBAA 3O6FA 2HFFA 3CFKA 2I9LA 4I3GA 1MJJB 2NCMA 1W0YT 5D1ZB 3A6CH 4QYOA 5CD3A 1FSKC 1LO0H 3P3YA 5EC1B 5KSAD 5DTFB 1X3DA 4HH9B 4NO0A 1E4JA 2P8LB 2BRQA 2C5DC 3W9EA 2NXZB 5B4MC 3PGFL 2E8YA 1J0YA 3DV6B 4NNYA 4NHUB 4LVEA 2G60L 2V7NA 1NGWB 3HZVA 5DFWH 3WE6B 5E00B 5C71A 1OD9A 2HKFL 3ARRA 1IGJA 1QYGL 3VW3H 4KMQA 4WJ5A 1INQA 4G6JL 5HHOB 4L8SC 3EIFA 2NR6D 1IM3A 4D9RD 1A6UL 3HFML 2RGSA 5JW3L 3P4OA 3HMWH 2JJVA 1A6TA 1GGCH 4R3SB 2V2WA 1CFSB 1WUNT 2E6PA 1HZHH 2IAMD 1A22B 1C5DB 2FH6A 1AXTL 3TM6A 3OSKA 2PCPB 4OGAC 4FQXA 4I2XB 4MJIE 3VH8B 3ZKMC 3HI1B 3ROOA 1A4KA 3OG4B 5ANMB 3TV3H 2N7AA 1J87A 4IOIB 3BPLB 4RFEB 4TQEH 1ND0B 3G5VA 5CJQH 2DM2A 1YUHB 1OTTD 1E6OL 3MMEB 2Z93B 4U1IB 3OXSA 1S5IL 5E6IA 5K93A 4CMHB 1EEYA 3HG1A 3ARFB 3ZTNH 1X6NA 3NACL 3MXWH 1CICB 5CJBA 1FYTE 2XKUA 4ZFFA 5KN5A 5D7SL 4JY4A 3QQ4A 3BT2H 1NUGA 1GYAA 1F58L 2R29H 2FLBT 4OQTL 5K59E 5T3XH 1HWHB 2GJ6A 3O3BA 4KHTL 4Y19E 3DVFA 3GMQA 2R2CA 2A83B 3H3KA 4XCEA 1J1OH 2A6DA 3VGEA 1HNFA 1U8PB 3H3PL 4NDMA 5JW4R 1N5AB 5IV2B 1KCLA 5T5NF 4WEMB 4KRNA 3LPFA 1NSNH 1EGJA 4UV4L 2MTPA 4APQB 3EOAB 5C7XH 4XMLL 4HUVA 1T6VN 3A0OA 1MFNA 2AGJH 1G9NL 1NFKA 2VO5A 4KKBD 5L2KE 5J13C 1BFOB 3RVWD 3TCLB 3NIGE 4WI4A 5SX5H 3EFDL 4Q58C 5GIRA 1U8OA 1WZLA 5TDNA 3B6SA 2NY0D 3L9RA 1JN6A 1FRGL 3DRQB 2XY2A 2DLIA 3X17A 1G7PB 1WZMA 3MX0A 1BWMA 2NZIA 4LCCA 4QHNB 4LNRB 1PEZA 2DQUH 1FFNA 3WFDL 3DVGB 3IKCA 3C9NB 4J3SA 5IB4A 2VAAA 4N0YL 3FZUD 4RMTA 5JXEC 1IC1A 4H5SB 3RWFA 3QRGL 3WFEH 3SPVA 2FGWH 2OTWA 4LKCA 5DJDA 3W82A 4GXUM 4UT7L 4I18A 2DQJL 4G8EA 2OL3H 5ITBH 4PY7A 4QNPE 5I1IH 3SO3B 5IHLB 5TE4H 4WEBH 1NGQL 3WIHA 4KQ3H 5DDHA 5GGVL 4ELKB 1EK3A 4RGND 4E41D 3P73A 3MLZH 3MLVL 4RFNC 4WHTA 4JO1L 4NWTL 2D2OA 4CBPA 1NCAL 1BQUA 5A2LH 2OCFD 3H9YA 3QUKA 1F6AA 3VMOA 3SCMC 3TO4C 4X4XB 2C7UA 3M1BA 1I9IL 2R0WL 4A6YL 5MEQB 3U4BL 5DEFB 3TBVB 1Y0LA 2Z9TA 5D93B 2V5YA 4UILH 5C8JB 5D1XD 4Y8DC 5JUEH 4V1DD 4U1JB 3WNKA 1X5LA 3LEXB 3QUXB 4IRZH 5ID1A 1I8KB 2EE3A 4ZFOL 4BUGA 2XZQH 4YHML 3BE1L 2ZWLT 3S3JA 3QO0B 2NY4D 2H32B 2OSLA 5BXFA 2VDLL 3BPNB 4UINH 2A2QT 3EDEA 4WW1A 3MRHB 2BY3A 3DIFB 5C9JA 5M7QA 2XTJC 4M1GL 5GZOD 3SE8H 4XP9L 2IEPA 4HQQH 1MIEL 3ZE2F 4GG8B 4LVNC 1GL4B 3WHXB 1FDLH 2AJ3A 1HK6A 2WK2A 4XPBL 3AMLA 4TSCH 3WXVL 1KCUL 3NCBB 2YK1L 4HF5H 4QRSB 4KXZH 4Y4FC 1LO3L 1Z9SA 5GXBB 1KPVA 3V5KB 4DEPB 4M7LT 1NJ9A 1VGEH 3SEPA 1DBMH 3P30H 5I1KH 4O58H 1AC0A 2BY0A 1G9EA 3UTPE 3G6DL 3ZE0E 3HB3D 5ETUA 3R8BB 4K8RD 4YC2C 3HE6A 3PDDA 2OR8A 3WNMA 4GO6B 1YDPA 3C5ZB 1KN4L 1U3HD 2R4RH 3QDMA 4X7TB 3ARTA 1L4IA 1R5VA 4CVWA 1KJ3H 4P2QE 5BRZB 3VWJA 4CRPA 1H5BB 4MYWB 2EXYC 4F8TA 4CADA 5KS9F 1T7WA 1WIUA 5J1TC 4PB9H 5E2VL 5DS8B 1MCCA 2VIRA 1P53A 4F2MB 1BBJA 1BOGB 1U8KB 3MRDA 4Z7VE 5FGBA 5ISZD 3RWJB 3N9GL 5FYKE 3MRPB 4N0UE 4PJ5A 2YEZB 3W0WE 5MEPB 2F8OA 1P2CA 2AEIT 5JW5B 4E0RB 5CFHA 5ACZB 3NCYP 3BGFB 2CJUH 3SE3C 4Y5XC 3T2PA 1F8TL 5C0CE 1WZ1H 3BXNA 1AR1C 1L0QA 5GRWA 3O2DL 1TVBB 1VFBB 2ARWA 4RMRA 5DD0H 3DSFH 1CS6A 4PRPE 4LGRB 2PETA 4OM1L 2WM0A 3TT3H 4HUXB 3FQUA 4KRMB 1HDMB 2BXZA 4X83A 1E4XH 4PJ8B 5GISL 3WYRA 5IMLA 1F42A 3QUML 5CUSH 1HH9A 4RIRA 3QIWC 3VXMD 3U1SL 5FGSA 5GS2D 3SE4C 1VPOL 4X4YB 1IGTB 2GTWA 4YJZL 1JGVH 3CPLA 1AD0B 4UT6L 5JHDD 1EEZB 1MQKL 4OBSA 5KS9A 3G08A 1FZJA 2W0LA 3T1FA 2GCYA 1NCDL 1XGRA 3OXRA 1N4XL 2NY1D 4K3JL 4N1CA 4NFBA 4NYLA 2EYSA 2H9GB 4JFHE 2G5BA 2QEJA 1ZHBA 3CVHL 1SY6L 3O6ML 4IJ3B 5IIEA 1G7IB 2EYRA 3CDGB 3W11D 3FO2B 1TMCB 5KOMC 3UJIH 2IPTL 4GMSH 2HLFC 1NEZA 5C6PB 4XVUC 2Q87A 1MOEA 2H1PL 1HHKA 2D7OA 4KV5F 1A14L 2WINB 3Q6GL 1G0YR 3SDAC 1Q9KA 2HP4A 1MWAA 5C09D 3SKOB 4C4KO 5FYLE 2VISA 3OJVC 2A38A 4C56B 3F58L 1T1ZA 3DYMA 5BV7C 1CDBA 5BQ7A 4AMKH 1ADQL 3CU1A 3KPSB 1CR9L 2BOCA 5LAXB 1T89A 4PGEA 5C0RH 1CG9B 5C0JB 2Q7YB 1PG7X 4Y4KA 5DUML 4YDLC 4BH8A 1OGAA 3GO1H 4ZO8A 3ULSA 1AGDB 5INCA 3CSYB 4DKAA 4HUUA 2BC4B 4UDTB 3RPIB 2OK0H 1D9KB 5B38B 4HBCH 4JN1H 4LF3A 1QBLH 1TQBB 2BFVH 3RI5F 1ITCA 1J5OH 2C3XA 1PAMA 1UA6L 3DO3A 4LDOB 5GGUA 3T09A 5I73B 3F12A 3WD5L 4PREB 3ALPA 4HG4K 1IBGL 4F9PC 3L5XH 3DUUA 3T0ED 5L2JB 5DF0A 1V3KA 2DKSA 1MRDL 4KJWD 2A77L 3QPQD 1JZ8A 1AQKL 1A6ZA 4S1SH 3QDJB 1NL0L 3O3EB 3U82B 2VQTA 5L7XH 5I1DA 4XAKE 3QXAA 4LAQH 3TT1L 2NY2D 2CR6A 3MRGA 5EN2B 3VXPB 1T1XB 5IM7A 5F8RC 3HAEB 1KTDB 2IBZY 1IC4L 4BZ1H 1OP3H 1R3KB 1A7PH 2YR3A 2X05A 3HR5B 1ACYH 1M7IA 2YPKB 3DX7A 5C2UB 1XR8A 4CU7A 2HJFB 3PL6B 5HGHB 1DFBL 1ZSDA 1HIMH 4XNMA 4ZUUA 5E1AA 3D39E 2OJEB 3DGCR 4HDIA 4XC3L 3SDDC 5FGRA 4JREB 4DVBA 4WUUD 2UUDK 2Z35B 3WO3B 4Y2OA 4GAJL 1N3NA 5HGGS 4JQXA 1I8MA 1FZOB 3W39B 4IOFC 4OZHB 3NAAH 1D6EA 2JJSA 3KXFD 4JRYA 4I0PC 5E8EB 3OGCA 3WSQL 4HKZA 4PJFA 5GJTH 4PG2A 1L0XA 32C2A 4TSAH 1KJVA 3HS0A 3WFZA 4XP6H 1T3FA 4TRPL 2FYYB 1UZ6F 3L3JB 4JZJB 4Y2DB 3VFSA 3WNLA 1QKZL 3EZJB 5T1DH 4ELMF 5T1MA 2XTJE 5CBEA 2WSKA 4NP4L 4DUXA 2RFXB 5BW7A 2UZXB 5C0IA 3F7YA 4POZD 3V6OC 3G5ZB 4TPRL 3KPNB 4BQCA 1K8IB 1MUJA 4NHCL 4FZEL 2DLTA 2Q8BH 4EUPG 2E7LA 1JV5B 4AH2B 3C6LA 4DZ8B 1SJEB 4JDTL 4X8XA 3PP3K 3WJJC 1AIFA 1JUFA 4L8DB 1FC1A 1XGUA 4NPYB 4P4RA 2R23B 5DFVD 4WCYL 1OAKH 4GUPA 3BYTA 3BMVA 4EXKA 2DM7A 4I3RL 4C83A 1VKXB 2MKWA 4RDQF 4FABL 1FPTH 5C0FB 1OARH 5KSUA 4E42A 3DBXB 3OKNA 3P9MB 3BOVA 3O9WC 4WW2B 3QXUA 4JDZA 1F3DJ 2Z31B 1R24A 1KPUB 4U6XB 1G7HA 4EDXA 5E8NB 4QO1A 3SJVE 3O3UN 5IB2B 5J12B 4ELMA 1FFOB 4KFZC 2KQNA 3HA0A 3GIVB 4G5ZL 3H0TA 4E5XB 5GGRA 1TZHB 3FB7B 4OM0L 5FFLA 1YA5A 2CLVA 2XXCB 3O8XC 2EKJA 3Q3GB 2A0LD 2XWTB 4N9GB 1IRAY 1WZKA 5CS7A 1FNHA 4KK6C 5IFJA 3GSUB 1QSFB 3I02A 4F7EA 5I18L 3SKMA 5HYQB 1G6RL 2PW1B 1S7TB 3QCVL 2XRAL 1IGYB 1XGPA 4ZXBA 1WWAX 1LD9B 2IAMA 3CX2A 4P99A 1DDHB 3X12B 5DI8B 5K9QG 5D8JL 3OKOA 4IRSC 1CLOH 3QNZA 2OTPA 3PF2A 1MCFA 4QRQB 2CRYA 2VDQL 5DJCA 4KJYA 5DJ8A 3E1F1 3TYFB 4S2SA 3IXAA 1CGSH 1MCEA 2MQ0A 4PJHE 4HWBA 5I75C 5BVPH 2VDKL 4Z7QE 5F1OB 4EZMA 4KKLC 4UOJA 5E5MB 3SE9L 4R0LB 2GTZB 1MJUL 1D7FA 1EFQA 1S7RA 2YXFA 2QSTA 4ZSOB 4Q6IB 3RWHB 3ELAT 5FUCC 1FGNH 4P4KD 1FAKT 1LK2A 2KDGA 2BSSB 3NIFF 4ZDHA 3RU8H 2MHAA 4S1RH 4XVJH 4LHUD 1EVUA 1V3LA 4PJCB 1ZTXL 5LQBL 1RV6X 4MDJB 4R4NC 4XNUH 3GK8L 2X4NA 1WAAF 4QEGA 2JCCE 1C16B 2VZOA 3MLXL 2YZ1A 1M71A 5DJYB 4OKVA 4XTRC 4Q0XL 3O41B 5I8CA 5CINL 2ZOLA 1JYVA 3K4ZA 3JWDH 2BMKA 3QAZB 1OTSD 3WO4B 3AU1A 3VXSD 3LIZH 1UJ3A 2GT9B 4PRAA 3SDCB 1UT9A 5HHVH 3MV8D 2BCKA 4QRTA 3Q6FA 4XHQA 2NY3C 43C9B 2HJKB 4KUZL 5GSRB 2AV7A 1ZA3B 4KI5C 4LPUA 2NY5H 1NEUA 5DQJA 3UTSB 4ESKA 4MA1B 4P48A 4PRNA 2P1YA 2D03H 4QRRB 3WJLA 2Y72A 3CC5A 3FFDA 1A1OB 4G9FD 3NIDF 5LXGH 2V2XA 3BZEB 4PLJC 3JZ7A 1CFVL 1U95B 1MCBA 2IWGA 3VD3A 2VLJD 1E6JH 3FRPA 1WTGT 3R06B 1WV7T 5SWSB 3I2CH 1BREA 2V7HA 1OCWL 4B50A 3S96A 1HKFA 3KPLB 4W4NA 4QHLB 5F9AC 3VWKC 4L9LC 1EA9C 3EBAA 3LS4L 3I6KA 3GSRB 5EU6E 1K5NB 1S7SB 2QSQA 5EA0L 3STZB 1WAAA 2VLMD 1LO2H 4C59B 3PP4L 5E2TH 4HXAL 2AKRB 3QQ9C 4KJQD 3RY4A 1CL7I 4G8GD 5FXCH 3F8UB 1QQDB 3V6FB 2AI0L 5EORL 1WCBA 4M7ZC 1XF4B 2KUTA 1KTKE 3D87B 4OD3H 4FQ2H 3GHEH 5D1XA 5CHNA 2WBJB 4ONFH 4V1DA 1KT2B 5L8LB 5E95B 2AEPL 1T7VA 2CIIA 4RISL 3VXTA 4FA8A 2F53B 2YD9A 5EZOL 5EOCH 4ZAKC 4LKXA 4M7KH 4YX2L 4HGWA 1MY5A 2R4SH 4JKMA 1SYVA 1QOKA 4GRWH 5ESQB 1KIPA 1YPZF 3SGEI 1UG9A 4K23H 2VAJA 4ISVA 2EO9A 3HC0B 4WI9A 1PBYA 3OB0K 3BWAA 3MFGB 2BNQB 4KK9D 4ZPVA 4UQ2A 2EDWA 3DXAD 1A9EB 4MX7A 2KH2B 4M5YL 4TNWK 2VXTH 3KLHC 2DJ4A 2ITCA 1MFDL 3ARGD 5I17B 3JTTB 5LWYH 4KQ4H 3BD3A 3KYKH 5F7UA 4P5KA 3UTTA 2BY2A 2M2DA 3CGTA 4OFDA 3UTZA 4GSDH 3X3GH 5D7LD 5IFAH 3VFNA 4RZCB 3DX9A 2CDEB 1A5FH 4Y4HC 3HMWL 4JZOB 2C1PB 3LSOA 3CZFB 2ZOKA 4XP5H 1WISA 1HZHL 2V2TA 4HUMB 4EBQH 5JW4N 4UIKH 1PYWA 1Z6JT 4ODUB 1ZGLM 4JFEE 3TV3L 3DX6A 4TQEL 4JCLA 1TTGA 3SBWC 1TVHB 1F4YH 3H9SA 4JFDD 4PR5A 5CWSA 3UPAA 2ICCA 1V3JA 5CGYC 5T1KB 2UVEA 3ZTNL 3MXWL 1YPZA 2DF3A 2DKMA 4IIQB 2E7MA 2LAAA 2VQ1B 3GMPA 3GNMH 3BRGC 4G42B 4GW1B 4JO2H 5ICZA 3BT2L 1RIVL 3GSOA 1ZLWK 1C7SA 4CUCA 4LSDA 4Z7NE 4L3ED 5T3XL 1I4FA 4K7FA 4DZBB 4ZPTA 3KPPA 2XKSA 5F89B 3ULVL 5DQDH 5B3NA 5IW6B 4JPIB 1JGUH 1J1OL 4P9MH 1U93B 4AENB 3NVQA 1IC7L 5T3ZE 1IVLA 4EI5D 1T20B 2APFA 3V4UH 4I13B 1N7MH 1HXMA 4P5TB 3C2AL 5C7XL 3T65B 3LS5L 5JHDA 5GS1C 1GC1H 1H15B 5I74C 1DEDA 4MAUL 1NFDE 5MENB 1RUPL 4X4MA 4UIMB 4HIHB 5JIPA 1QLEH 4YBLB 3P0GB 3WFHA 4TVPH 4N8VG 4NN7B 1FBIL 4P0DA 1BJ1J 3BIBX 4G8IB 5EUKA 3IU3B 1CE6B 1HHJB 1RUKH 2UZYB 3TP4A 2GITB 3WUZA 4X5XA 3IDGA 1NUDA 5FUCE 1FZKB 2HT4C 1GGTA 1P5UA 1UB6B 2XI9A 2CUHA 1T0MB 5AG8A 3MBXH 5DT1L 4LIQH 5DMKA 5C08B 4YHKH 3WLWC 2VITB 3FRUB 1OHQA 2FGWL 1S7VB 3KYNA 5HVGB 2GK2A 2W07A 5CSZB 3QUZA 3TIEB 4PRIE 4BKLB 5HSFA 2PYEE 1Q1JH 2FSEB 3OGOE 4WTZA 1ES0A 3D3VA 5CILH 1JGEB 3TBYB 4MNQE 5TE4L 4H8WC 2VUOA 5AG9A 1UKSA 5GRXG 2FRGP 2FATL 4EVNB 5KVGH 1T66D 4R8WH 5JO5B 3RWDB 5F1SA 1MHPH 3MLZL 2EDBA 4J3TA 1VSCA 2J5LB 2Z92A 4PTUA 3RPKA 3PWNA 1I75A 4KK8D 1KTRL 1NCCL 5D1ZD 1Q94A 5SWQB 1V8HA 1QD0A 2X4TA 1B2WH 4IRJD 4KVNH 3TWCH 4YDIH 1WWWX 3AREA 4HZAA 2YPLA 5EWIL 1WBYB 4KI5E 4LLUA 4G80A 3VXOB 1F11A 1EXUB 3T0EA 2NXZD 1JYNA 3FB6A 2ZUQB 3ZHDA 5EUOF 4GG6E 2IANB 2JELH 4J23A 2XZQL 2BSRB 3MV11 3OKMB 4NKOA 5F72S 1AO7B 3EGSA 1ZLUH 3W9DB 5CMAA 5FO9B 4ZOBA 1MVUB 2C3WA 5IMMB 1ORQB 1ZEAH 4NQDE 4MNHB 2O5ZH 5HHOD 3VXQA 4C54A 3ARPA 5I0DA 4WFGE 3GSQB 1FDLL 4HKJB 5DWUL 3DO7B 4YXHL 4TSCL 2V5TA 1DLFL 1GHFH 2WW8A 1P1ZB 1P7KA 4PV8B 5HYSB 4WHYG 2VTFA 5I1KL 4U1KB 5I1CH 3MROA 2GSIB 1LVEA 2P44B 1TIUA 3U9UB 1XCTA 1F3RB 1DL7H 1KJ3L 3ARFD 3BO8B 1RUAH 3AMKA 2IQ9L 5B8CB 2JTDA 4FQQA 1CICD 1X5FA 2R0KL 3AM8C 4AT6B 1L7TH 2EDDA 3GJFB 3NPSC 3MBEC 3O6KH 3VD9A 2J8OA 2YD4A 5EUOA 4LSVH 4N0FB 1A21A 2XFXB 5IESH 3RDTB 5I8OH 1DVFC 4XRCB 1QLFA 2FWOB 3NCCB 4YDKH 2D7TL 4XZUB 1BHGA 5TQ2L 4HCRL 1CD1B 1V7MH 1P9MC 4F7TB 3QULA 1UQSB 5M94B 2F5AH 3EO0A 3KGRA 3KPMB 2GSGB 4APQD 1UM5H 1MPAH 2Z91A 4R26L 3THMH 1FL6B 5L6YL 3TT3L 4NRZB 4JHWH 1X5XA 3CK0L 1E4XL 4MLSA 5H37H 1EUUA 1ZK9A 1GZPB 1CGVA 2XQYG 4U1SB 2BHYA 3MGTB 1CU4H 1KG0A 1WWCA 2Z8RA 4JM2C 5F7FA 3PWPB 3CFJA 2ZG1A 4AYFA 3CMOH 2BXYA 4AG4H 4HK3J 2BVPA 5GGQH 1IC5H 2X5PA 2LFGA 4WENB 4DN3L 4NZRH 1JNHB 3VFMA 2ICES 3QUYC 2X40A 1YZZA 3OR7A 4LSSL 4MXVF 3TA3C 2L0DA 3MNZB 1QHPA 2R8SH 3IGAA 1RZ7H 2YA1A 1ZS8B 4WI8A 1AC6A 4GMSL 2E3VA 1SYSB 1QA9A 5J6GA 1YEIH 1I7TB 4FQIH 2GW5A 2PO6C 4MCZA 3QEQE 4P2RB 3PIQB 2DMCA 3BQUB 4PUBL 5IVZB 1CGUA 3OAUH 4MJ6A 2IPUK 4OQTA 5SWZE 1XH3B 4U0RC 4ZS6C 2E9IA 2HRPL 3ETBF 5HHMB 3QWOB 2I5YL 3H8NA 4U6VL 1UM6H 1KCSL 3QUXD 3ZDYF 2F54B 1IAII 5J3HC 5CCKH 5FA4A 1WEJL 3P4MA 5C0RL 3OKLB 3RVUC 5LGJB 4RRPG 1AHWA 3OR6B 2CLZA 1OAYH 1ZV5A 3BZDA 4PJ7E 1BZQK 1I7UB 1EAPB 3RL2B 1Q9OA 3NH7H 1PX4A 1XIWC 4XPHL 3IFNH 4GRLB 4WY7L 1GZQA 2ADFH 5AYQA 2XQYK 2BFVL 2WNGA 2XQBH 3H9ZA 2VDNH 1BJMA 4WO4C 4K94H 4LLYA 3GMNA 4I0CC 5IGXH 3QHFL 1OPGL 1D6VL 2CMRH 2A73A 3L5XL 3LKOA 2GEEA 1FLRH 2HWZL 4P4KA 4PGCB 3DX8B 3K4AA 1KUMA 5BJTB 4S1SL 1DN2A 1F90H 5LG1A 4CJ0A 1EBAA 2OXHA 4YDVA 3DJ9A 3UAJC 5EFIA 4KJPC 1I3VA 4LRIA 4MS8C 4JR9H 5I1AA 4IHOB 4PLOB 3OV6A 5I1LA 5DRZB 3C5ZD 4BZ1L 1LEGA 1A7PL 1YECH 2N7BA 2O5XH 4MSWA 4NUJA 4QRUA 3G04A 3FT2A 5BRZD 1LP9F 2OMNA 4U1HB 2QHRL 3F65A 3T77A 1J8HE 2AK1L 4FHBD 2ADGB 3LQAH 5I66A 3HI5L 3RL1B 2GJZB 4LLDA 3MJ7A 4MNGB 3HI6L 5EO9B 1J1PH 3VXSA 4OLEA 4QGTA 2AV1B 3MV8A 5TQ0L 3NAAL 2I9TA 2XA3A 3MC0A 4XPTL 1BQHB 5KVDH 5GJTL 4U3XA 4JQIH 4L4TB 4HWEL 2CLRB 1DQQA 2OI9C 3L5WB 4TSAL 3QCUH 4OFPA 1L6XA 1FFRA 3QEGL 1RU9H 4LRNH 3ILPA 5D5MB 3EJYC 4A6YA 1BAFL 1FVDB 5I30H 5C92A 4XP6L 4G9FA 4NRXB 5DVOA 1QBML 4PFEA 3C87A 1HYRC 4OCXH 3LN9A 4XHJC 5EZJA 2VLJA 3B9EA 3C60A 4JRWA 4ETQA 4ORGB 4ZFOA 1H0DA 4TVSa 4X7EC 4U7MA 2NW2B 1IL1A 4NQSB 4F3FA 3EYOB 1ZLSL 1J05B 3FCTA 5KSBE 4LPCA 3RFZC 4M61B 5D7KE 4PJ8D 1TJHH 3N1MC 5DYOB 5FB8A 2ENYA 4AEIH 1MI5B 4U1NB 3RGVA 1F6LL 3WN5C 1CGWA 1W72L 5I1EL 4Y5YC 4PYHA 4G8GA 1G9MH 1LP9A 4DAGL 2FZ3B 3PDOA 1X6LA 1KPRA 1KB5H 2VABA 3ULUE 5A1AA 3IS1X 3BP4A 4MD4A 4PJDE 4ODVH 5ESAB 1MHHA 1MFEL 4B0MM 5GRUH 3TVMA 4JFQA 3B2UD 1QSEA 2WANA 5JW4Q 4OZIF 4ZD3H 1T5WB 3VI3F 1FPTL 4RGOH 2MCPH 1J11A 2C4XA 3JSSA 4FMFA 4PJAE 4ZUWA 5CSGA 5MHSD 3M8OH 4EKXA 3FQRA 3WDJA 1JPFA 4WTWA 1QFWH 3QJFA 5FK9B 5HD8C 4J3XA 1TTUA 4UNVA 1OSZA 1FORL 5D72H 3DXAA 2P24A 3SGKC 4C56D 4O4YH 5DJ2B 2VSDA 4LU5L 5HYJE 5KSAC 4NT6A 2R1XA 3ARGA 3KPSD 1HI6A 2NNAA 1H3VA 2PXYD 2FJHA 4LLAA 1OOAA 2W38A 4X7SH 3MREA 1CD8A 3L95A 4UQ3A 3GUTA 3C5SA 2FB4H 5D7LA 1ODAA 4NQEA 2JIXB 1D9KD 1S9WB 4NUGH 3VFPA 5DQ9B 3EFFA 5ESVA 2J7LA 2HVKA 1DQDH 3FOLB 2F74A 3O2DA 3S4SA 1ONQA 4Y16B 1IJ9A 5EDXA 5F7NC 1GOHA 2OTUA 5HJ3A 3BPCA 3ULVD 4MD5A 1DN0B 3B5TA 5AZEL 3VXRB 3IFPB 4HPOH 4NKMA 4KVCL 5J1AB 1L9NA 2MMXA 2R1YB 3QDJD 2R2HB 1I9RH 3HCVA 1S7WB 3CIQA 3QUMA 3U7AA 1A1MA 4OFYA 3CFKB 4JFDA 1S78D 4DGIH 1IMHC 4IBLT 1CGSL 2BVTA 4OIBA 5EZIH 5FM5M 4OZIA 1B0GA 4G43A 2DD8L 1C5BH 3MLWL 3T0DA 3LKSA 3JTSA 3PL6D 1YJDC 3ROLB 3VRJA 6CGTA 4NO0B 2ITDA 3O45A 3TBWA 4DQOH 3ARXA 1QPXA 3ARWA 4FQHA 1ZKAA 5DLMH 3WLBB 4NNYB 1K4DA 2EECA 3U46A 4L3EA 4M6OL 4XVJL 5EU4A 3CVHA 3HZVB 1SY6A 5JORB 5E2WH 4J7RA 3L3DB 1I1YB 1IAOA 4XNUL 3MOAL 1IGJB 4H1LA 2NX5A 4WJ5B 1INQB 3M45A 2DI8A 1J1XH 2BY1A 3A6OA 4YXKH 3P4OB 4XAWL 4XPFH 1B0WA 5MI0B 2UZIL 4QWWD 3BH8A 3BVNB 4LCUB 4EI5A 1I1FA 5A2IH 4FQ1L 2HKHL 4Y2DD 3VFWA 5K9JH 1ADQA 4XP1L 4XPGL 3V6BR 3ROOB 1IQDB 5C0BE 4D9QD 1IGIH 5T1LD 2JJTA 3M17A 1KJ2B 3D1MC 2DL9A 4CDGC 5FM8A 5C6TH 3UZVB 1U3YA 3OXSB 4PP1C 5E6IB 3NA9H 3ARBB 2R0LL 4NFDA 3T2NL 3HG1B 2NY0C 3QJHB 4F7CA 2D03L 1N59A 1OAXH 3SY0A 5DURB 1DQLL 3KPOB 4HUNB 4ZFFB 4KK5D 5KN5B 1K4CB 3DURB 4JY4B 4LHUG 4PG9A 5DGQA 4LVOB 3QQ4B 3K80A 1KOAA 4DCQA 4KPHH 1QFUH 1E6JL 3DTXA 3F7VB 4ZO7A 2X44D 4E9LA 1CK0H 1KENH 5GGTH 5IWLA 5K9QI 2R69H 1U8JA 2HMID 2ATPA 4X80H 1VEMA 3BKML 1FNGA 5E8PA 3D69A 4XCEB 5JIKA 3ZYIA 2A6DB 4NDMB 4NQXA 3EOYG 3DMMD 1LO2L 1BVKA 4GLRI 5E2TL 4QRPD 1P6AB 3MSPA 4UOW1 5GHWH 4NC2B 1MJJA 4KROB 4YWGL 3LPGA 2Z8VC 5D1ZA 4OV5B 1IAMA 4HUVB 1AGEB 4IRJA 2NY6C 2Z31D 4F57H 5IOPB 4OD3L 4RMWA 5DTFA 3MOQA 3K8LA 2H8PB 4ONFL 4HGKC 1U8OB 1KIQA 2OR9H 4PLKD 4I77H 2FX7H 3O11A 4NKIL 5JOEA 3CLFL 4PJFE 1T03H 1JN6B 1FV1A 4N8PA 3C8HA 3LD8B 4NHUA 2Y23A 2VZVA 4OLZH 1NGWA 5DD1H 4M7KL 3S98A 1HN1A 3L5HA 5CZKA 5ALBH 3WKMH 5IB4B 3PE9A 2KBGA 4Y88A 1IGFH 2DJUA 5HHOA 3RIAF 4JDVA 4JQVA 3SPVB 2OTWB 4LKCB 5GZOC 1QSFD 1T83C 1K2DB 1ZWIB 4G8EB 1CFSA 4UUJA 1YEDA 3QO1A 2LV4A 2DMBA 2VJXA 4PY7B 3FQWB 4KQ4L 3VH8A 2EO1A 2WLYA 4FTVB 4X6CE 1MAMH 1M7XA 2P5EE 3P73B 4BQ8A 1M4KA 4F37K 4AZ8A 1QRNE 5LBSH 4GSDL 1ND0A 3Q5YA 4RX4A 3TPKA 1WT5A 2AJSH 1AI1L 4ODTH 4P46C 4NQCE 1CLYH 1MSPA 2LTQC 5CEXB 2Z93A 3QUKB 4K8RC 3R1GH 1F6AB 1A5FL 1NANH 5JPMA 2DLFH 2VLKE 2C7UB 3ARFA 3M1BB 1RI8A 4P3CH 3WKNA 3D6GA 1NCUA 1U3HC 1Y0LB 1YEFH 1CICA 4LP5A 3D9AL 3X14A 3VFOB 4EBQL 1DE4B 3GSNB 1ETZA 1UXWB 4UNTA 4D9LH 3KS0H 4W70A 2D4FA 2OSLB 5BXFB 4WW1B 5L2KB 4FQCH 4NCDA 1WCQA 4XNZB 4X9HA 4LGPB 1D5BA 4QXTA 4MDIB 2KKQA 1IEBB 4LP4A 5KBNC 2AJ3B 2H2SC 1N5AA 5IV2A 1XFPA 4JO2L 5I71C 1BP3B 1A7NL 2HFGH 1IAIM 1KPVB 2QADC 2EE9A 3C5JA 4GMTH 1SMAA 1F4WL 4Y8AA 2DQTH 1BFOA 1NDGB 3TCLA 4PJEF 4YHZL 5DQDL 3BDYL 1B4JL 5ETUB 3FQTB 3U7WL 1JGUL 5JQHC 2ESVE 1ROWA 4GOSA 4D9RE 3SDXF 3QDMB 3UTSD 1R5VB 4QHNA 4LNRA 4ZO6A 1BJ8A 2XPGB 4QRRD 3VWJB 1GOGA 3CUPB 2VR4A 2WUBH 1N7ML 1G6RA 3G9AB 3KYOA 5GS0H 2VR5A 2IQAB 2QTEA 5E5RB 4UTBH 1BBJB 5SWSD 4CW1A 4TVPL 3WXWL 4PJ5B 1CDIA 4YE4H 3DUSB 4LOUD 4XNQA 3TBTB 2JKXA 3MOBL 1CLZL 2NY1C 1ZT4A 4D0BB 4OCWL 3S9DB 2E8ZA 2AJZA 4XB7A 3UJTL 3MCLH 4LIQL 4R97B 1JCKA 4YHKL 1NMBH 5CEZD 1MJ7H 3E6HB 4X4XA 5DMGC 4HIXH 4DK6A 5AAWA 4H88L 5DEFA 4M3KB 3TBVA 4LSTL 3P77A 2Q8AL 2JB6A 1JWMA 3TO2B 1T7ZA 4NRYB 3LEYL 4QF1B 5DK0A 2AW2A 5AAMA 1BFTA 3RA7L 1Q1JL 2WBJD 3TH3T 3FQUB 5CILL 3LEXA 1YEEL 3QUXA 3QDHA 2F53D 4YXLH 4PJEA 5ALCL 4R8WL 2EDLA 5D2LE 2YZ8A 1R3JB 3VJ6B 3QO0A 4RIRB 3LPWA 2H32A 3MRHA 5HVHB 2GTWB 3SDXA 1RFDH 2Y07L 1XGYH 1Q72L 3Q0HA 2FEDC 3VDBA 1B2WL 4KVNL 4GG8A 3TWCL 4WFHE 4YDIL 3WHXA 4LVHC 2F58L 3WUWB 5KS9B 3G08B 2J6EH 5J1SC 1ZGLB 1NLDH 1RSFA 4P2QB 3EHBD 1TPXC 2XWJB 43CAB 4PRDA 1H8OA 4OLVL 2DI7A 2G5BB 4P59H 2VN7A 3MLRH 1ZHBB 4F58H 5IIEB 2EYRB 3D25B 3QPQC 3OAZK 4U0QB 4YZFE 4AIOA 5AZ2H 3GRWH 5I8EB 1NEZB 4KI1A 2KPNA 2NY2C 4N0UB 4N5ED 5F9WC 3C5ZA 4BH7A 4ZMAT 3HNVH 3JWOH 4PS4H 2VDRL 3W0WB 1IGCH 1Q9KB 1MWAB 1A3RL 3WS6A 3IDXH 4FXGB 4QXWA 2UWEE 4NN6B 1T1ZB 3HZKB 5BQ7B 3MRJB 4D0DB 2YRZA 1INDL 2BOCB 3EOBB 3EOTH 3P0YH 5C70A 5C0CB 4E41E 5J7CC 4F2MA 4RA0C 4RCAA 1IQWH 3PV7A 3VG9C 4FQLH 1BQLL 3MRPA 3GSXB 5INCB 2GAZB 3MTRA 3F7QA 4HXBH 4OLXH 4LF3B 5DZOA 5T1KD 3TJEH 5JW5A 4E0RA 3STLA 2YHGA 1CDUA 3WIIL 5GGUB 1T80A 4ZNEE 3F12B 1F4HA 1OM3H 3BKCH 4WI7A 1L7TL 1IGML 1AGFB 2B4CH 2VYRE 4MVBD 4JM4H 2OXGA 2ATKB 3HMXH 3O6KL 1VFBA 4QXUH 2ZNXA 5BV7H 5ADPL 1C08A 3EW3B 3QXAB 1CGYA 3IDMB 4HUXA 3SKJH 1HDMA 1JFQL 5IM7B 1UH4A 5CIPB 2GYSA 1JYXA 4PJ8A 3WNOA 5JHLH 2VE6B 5JPNB 3OB8A 4JKPL 2DIBA 4OLWH 3BKYH 3CDYA 5DHYA 4X4YA 4XNMB 2J2ZA 3OWEA 3TFKD 4P5TD 4NNXA 1EFXB 3HHRB 1I1AA 4WDIA 3ULVF 1KCRH 3THML 3MO1A 5MEND 2DWEB 4JHWL 5EBGA 4J6RH 3OAYK 4HT1L 4NZJA 2H9GA 3V0VB 3GJFH 4JRYB 5ILTH 5DFVC 5H94B 4HKZB 1KV3A 4OD2B 2X4OB 1G7IA 3CDGA 1M6OA 1O7VA 1NCBH 32C2B 4GQ9H 3VI4F 3DYPA 1KJVB 3IJYA 3PWLB 4LBEA 4OD1H 5A2FA 4TSBH 1Z9LA 4IDJH 1XZ0A 5I19H 1AE6H 4AG4L 2WINA 3VFSB 5GGQL 3NBNA 3NTCL 2GJJA 3BISA 3SKOA 3STBA 2X4UB 4JHAL 5ISZE 5T1MB 5CBEB 1HEZA 4MAYC 2AP2A 1T22B 4C56A 1QFOA 2FH8A 2VXSH 5C0IB 3VMPA 3P9LA 3KPSA 4OZHF 5D96C 1FYHB 2PXYA 1CDCA 1VEPA 3MJ9H 4R9HA 1KFAH 2P4AB 4OT1L 1RZ7L 1MUJB 4X6DF 5C0JA 2Q7YA 1KJ2L 5IKCA 1GGUA 3WHE0 5DMJB 5J9PB 3KJ4B 1AGDA 4FQIL 2BC4A 4OSUL 3QBTB 3RKDD 1ACZA 2L4OA 1VEOA 2NPLX 2CIKB 3OAUL 1N0LA 3DGGB 1EBPA 2EEDA 1XGUB 4Z0XA 3I6LE 4P4RB 5L2JA 4RBPK 1UM6L 4GUPB 3LQMA 3D39B 2IAND 5CCKL 3T8XB 3NPZB 1LO5B 4RFNB 1AO7D 3VXME 3QDJA 1WWBX 1OAYL 5EN2A 1OP9A 3VXPA 4AJ0A 1MLBA 1T1XA 3E8UH 2DQFB 3IFNL 3SCMB 3HAEA 2GY5A 1MIMH 2XQBL 4MLIA 3J8F7 1JNJA 2VDNL 3IRZA 1R3KA 4U4BA 2JJUA 3MLYL 4JDZB 4K94L 1R24B 2YPKA 3HR5A 4AY0A 5FYJH 1G7HB 5LJYH 2HJFA 3PL6A 5HGHA 4HEME 3BI9X 5GZNC 4WNQB 3QWRD 3PWUA 1B88A 1AFVH 1FLRL 3ARVA 3OX8A 1HQ4A 5HYFA 4ELMB 4YHLL 4FFZH 1LDSA 2YBRA 4DKFH 3TIDA 1DANU 3W39A 3BRDA 3F5WB 3H0TB 1YY8B 4JR9L 1ZOXA 1I8LA 4OZHA 3MGAA 1QR1A 2XTJB 1JPSL 2E6JA 1QEWA 1CZ8H 1M05B 8FABA 4X6DA 5E8EA 5L9DH 3L5IA 2AXGA 5C09E 2HTKD 3H9HA 3I02B 4F7EB 4ZTPL 4Z7OF 1G1YA 2EC9U 2DQDH 3BP6A 3JV4A 4OKDA 1XGPB 4HUWB 4ZXBB 3L3JA 4Y2DA 2IAMB 1UWEH 1M1SA 3FB5A 4YFLF 2AEWA 4Q97A 1X5GA 5C86A 3QNZB 5T1LA 1OTSC 2YD5A 3QIUC 2Q1EA 5CJXC 4KJYB 3RDTD 5DJ8B 1FNSH 4S2SB 4JQIL 3G5ZA 3TBSA 1GOFA 1W8NA 4DVRL 1PG7W 4LRNL 4O02L 4C55A 3G6JF 4P2OA 4M93C 3T0EE 5I9QC 2F19H 4AH2A 2ERJC 4JG1H 4M6AA 2BZDA 5I1JH 4KDWA 1LK2B 1PKQE 4YNYB 1KULA 2MHAB 2CO6B 1JPTH 5LGKA 5AWNH 3MPCA 4NPYA 1R0AH 4LEXL 3T0BA 3B9VA 2R23A 4OI8A 1G0DA 2KZ1B 3ZHKA 3GSNL 1R5IB 1TJHL 1BZ9A 25C8L 3RVTD 1VKXA 1QZ1A 4RFOL 1M71B 2NQCA 5H37G 4OKVB 3HRZB 3DMMA 3PWPD 4M02A 4Y5XB 5C0FA 3L3HA 4LPXA 4QRPA 4EN3C 3F7PC 3I6GA 2ZOLB 4G6FB 3P9MA 4WUUE 1G9ML 2HH0L 1MNUL 4KJQC 3UP1A 5F7KC 1KPUA 1QSVA 4XT1C 3V4PH 1UJ3B 4K7PY 3KXFE 5IB2A 1TJIL 5D7JD 4KXZI 5GRUL 1YEHL 5H35B 1FFOA 1Y6NR 4KTDL 4P23C 3QXWA 4E5XA 4UV7L 3FB7A 3S36H 1HSAB 4RGOL 2MCPL 4YFLI 4OZFA 3FN3A 3Q3GA 4N9GA 1P84J 2XG4A 3QH3B 3RX8A 1FZMA 4P2RD 2LE9A 3BQUD 3G6JA 3HE7D 3PGDB 4LSPL 4PJHB 5JNYA 4HIJA 3BDBA 2WQ8A 2V7HB 4MJ5B 1ZMYA 3S96B 4BQ9A 5HYQA 2PW1A 4O4YL 1S7TA 2J8UF 1DBBH 1IGYA 3TJHD 5HHMD 4KK9C 4U7SA 1LD9A 2WUCL 1DDHA 1PKOA 1BM3L 2F54D 3MZGB 3UO1L 4BK4A 5DI8A 3UPCA 4X7SL 1T5XA 5DJ6A 4G7YH 1GPOH 3KJ6H 5IBLD 2XTLA 2ZJSL 5F93C 1BFVH 4HCRA 4QRQA 2YD3A 3GSWB 4FOMA 4OFKA 2AEQH 3WIFB 4GRLD 4U2ZA 5GSVA 1DQDL 1W2KT 1WCBB 5GGSB 1U3ZA 3ESVF 3JWDC 2GTZA 5IEHB 2AK4A 3RWHA 4NCC1 1P4BL 4HPOL 1JNLH 2FX8H 2BSSA 3IAPA 1I9RL 4YDLB 2NY5C 1JIBA 2EE6A 2N1KA 3FB8A 1KIPB 5FO7A 4MDJA 3K4DA 3MV01 5CJ8A 1E4XI 5IR1A 5EZIL 4ISVB 1C16A 1G84A 1RIUH 3CFEA 1FL5A 3KVQA 5HDBF 3UMTA 4PD4K 2WV3A 4PJBE 3O41A 2WWKT 2FX9L 3BW9B 4NNPL 2ITCB 4O9HH 5GQBA 1KTLB 4H0IA 1EZVX 2IADA 4ALAH 1L0YA 5A40E 5B38G 3UTTB 2GT9A 2EH7L 5E2WL 4NM8H 2VXVL 2W1NA 3UTZB 5FAAA 4HC1H 3U83A 5GSRA 5E4EB 3TGXA 4AEFA 1QPPA 1ZA3A 5F7EH 5AD0A 1DQMH 4KRPC 1FNEB 2ZCHH 4L4TD 3TN0C 4YXKL 4PJXF 5EU6B 2R1WA 3DRTB 3LSOB 5FYKL 1UH3A 2O61A 3LY6A 1JWSA 4J12A 3BZ4A 4L4VE 4OCSL 3ZSSA 2DQCL 4GT7A 1CBVH 1PYWB 3R06A 3FFCD 1P4IH 5SWSA 4K2UH 5IT2L 2ZSWB 3RTQC 3KPLA 3EYQD 5FA3B 4IOSD 4TUJA 3CXDL 1FNLA 3H9SB 4P3WA 4PR5B 1IKFH 3WFCL 3MUY1 1MI5D 1S7SA 4F15C 1X44A 2CRZA 4RNRB 1N6VA 1A7RH 1YPZB 4L8CB 2RBLA 3NFSH 3UYRH 5T5FH 3GMPB 2WLZA 5ICZB 3MA9L 4KPHL 3GSOB 3V6FA 1QFUL 2EE2A 1V5JA 1XF4A 2V9RA 1I4FB 4K7FB 1MCQA 4ZPTB 3SHSA 5JTWA 5GGTL 4PPTA 4EIGB 3CFIC 2WBJA 3O2VH 5EZLA 3BUYB 4X80L 2VL4A 3H42L 5BS0B 3K81A 1ED3A 5JQ6H 1RZIB 4G9DA 3G5YA 3V0WH 3K0WA 4UAOC 5D7IE 5B22A 1UKQA 4PJXA 4KK8C 4NSKA 5JHDB 5E56A 1F2QA 3VXSE 3IJSB 1DZBA 1RZGA 3BWUC 1J9CT 2HG5B 5E08L 4I77L 5I17A 4KMTH 1VESA 4I48A 3IFLH 5EUKB 3JTTA 2NXZC 2B2XH 4UZGA 1YNKL 5DD1L 3IXTB 3LHPH 5FYLL 4YQXL 4G9FE 3LEVH 4ODXA 2UUDH 5DHVH 5T33H 4OF3A 5EO0A 4KH2A 4RZCA 5DMKB 2CDEA 5J57B 2A9MH 4XXDB 2SEBA 4O5LH 4JZOA 3KYNB 1MF2H 3TLRA 4AM0B 3ARQA 3QUZB 5IHZB 1KCVL 4HS8H 1EGJH 1ES0B 2WWMC 3D3VB 3VXRD 4LHJB 2D31B 1L6ZA 3QP3A 1NBQA 1RVFH 1Q0XH 4M9PA 1EAJA 1E4KA 1K6QH 2VLME 1EHLH 1RURL 3EZ8A 3ARUA 5LBSL 4PTUB 2DOCA 2Z92B 4I0KA 4MWFB 3U0PA 3PWNB 1W72A 1CLYL 1FN4B 4FXLA 3BPLC 1U92B 2NXYC 4J1UA 1BD2E 2FHBA 4HWZB 3K3QA 3WDHA 3AREB 4CMHC 4G3YH 2YPLB 1Q0YH 1FVEB 3N1QC 2DDQL 5CLWA 1FFPB 1GC1C 1QUNA 4LLUB 5B39A 4G80B 5E70A 4GW1A 3CXHK 3FB6B 3U30B 2IH3B 1KEGH 4LCWE 4D9LL 4DZBA 3GI9H 4XI5D 3EGSB 4JFFE 5D6CB 1I3GH 4YHOH 3PP3H 4FQCL 4OLUH 3TH2T 5IW6A 2DQHH 4JPIA 2W9DL 3C8KA 3JV6A 5I75B 3WIHH 3IDJA 4L1DA 3VRLF 4F9LC 3QFJE 3DI2B 4AENA 3GJEA 2K3TA 2HT3D 4TUKH 5IQ9B 1H3TA 3PDGA 1FO0B 1T20A 4LPYA 3T65A 2WQRA 1P7KB 4OAWA 2VB5A 2BNRA 1UACH 2AJUH 4Z76B 2DQTL 4APQC 5MENA 1S9VA 3LV3A 5EOTA 4HIHA 4R96A 3MROB 3OPZH 4BQ6A 4LMQE 5D7LE 5CEYB 2E27L 2D7MA 3RWIB 1LDPH 1NMAH 4Z95H 3IU3A 1CE6A 2VH5L 3ARBD 1XCTB 2P7TA 1RJYB 4JO3H 1JF5A 4GH7B 4K9EC 4OCRH 1NQBA 4FQQB 1UB6A 4K3EL 5DURD 1N64L 1LE9B 1QFHA 1T0MA 2CKBB 4WV1A 4OZGE 2VITA 2XN9E 1S7VA 3FO9B 1HCVA 4XCCL 4U49A 5CSZA 3RHWF 2MQCA 2NY3B 1GGBL 5EBLA 3ZYOA 5BZWB 4OGYH 3TBYA 1JGEA 1CTOA 4EVNA 1QLFB 3RP1A 5F97E 3RWDA 3INUL 5GJSL 2YKLH 3SO3C 1C12A 2Y06H 1F3JB 1S7UB 4UT9H 3ULUH 4Z5RA 1DBKL 3MCLL 1HNGA 5HBBA 1I9JH 3EO0B 4KROD 3PWJA 4YBQD 1MJ7L 2C1OA 4PB0H 4D0CA 4CNIA 5BOPA 4NQDB 2Z91B 2BOBB 1WBYA 1UZ8B 1EXUA 1OAZH 5HI4D 5D93C 3T2OA 1B0RB 4I5BA 1NAMB 1G6VK 1PFCA 4KKAD 3OKMA 2E7HA 3C08H 5C0AA 5EH1A 3W9DA 3CFJB 5FO9A 1RFDL 2W60A 1MVUA 3BPNC 5IMMA 5E99H 4G6KH 4MNHA 4NIKB 1T0PB 4BM7A 2BVPB 4W4OC 3S36X 2J6EL 4HKJA 3DO7A 3K2UH 3LAFA 4A2LA 1AJ7L 4GRWE 5EBWA 3CVIH 1P1ZA 3VFMB 5FUZH 4HLJA 3OR7B 4ZAKB 3MLRL 4Y1AE 4F58L 4FTVD 1JF1A 5HYSA 1O5DT 3O4LA 3O3AA 1VFUA 5E9DE 4MHHI 3L3OB 5AZ2L 1QA9B 3GRWL 5J6GB 5KTEH 3WL9A 3O6LH 1XMWA 1MFCL 1CN4A 3U9UA 3QI9C 5GGSY 4PS4L 1EHAA 3GIZL 4NM4H 1AY1H 3ZMRA 2QQLH 2C3HA 5B8CA 2ZUTA 4JY5L 3FO0L 2EDEA 3GM0A 3IDXL 4MJ6B 4LSQL 4AT6A 4XCFH 5KJRH 1H5BC 5FKPB 4YHNA 5BVJA 4BFIA 3EOTL 3KR3H 3WV0A 3P4MB 1IQWL 4Z7UE 4FQLL 1EDQA 2CLZB 3HC4H 1J8KA 5L2KD 1CWVA 3TZVD 4ENED 1CL7L 3RDTA 1TETH 1GZQB 4OLXL 4XRCA 4Y4HB 5FO8A 1NDMB 1X5KA 1YMHA 3TJEL 1OTUD 4XX1G 1CD1A 1O0VA 4Q74A 4PYGA 3BKCL 4NO3A 4WWID 1G0XA 2A73B 3BJLA 3LKOB 4FFWC 3DOSA 5D2NC 2X1QA 2B0SH 4JM4L 2Z8SA 2FCBA 2GSGA 1X5YA 3OKKA 3RBGA 3KYMA 3OKDA 3S37X 5BV7L 3DYOA 1U2HA 4YDVB 3AY4A 5EFIB 1PJ9A 1DQJB 1RZJH 3AFLA 3VGDA 5I1LB 3CJJA 3E6FB 5HHOE 1GZPA 3T3ME 4J2XA 5JHLL 2BVYA 3QDMD 3I50L 1TCRA 2D4DA 3MGTA 4XMPH 3QZWA 3BKYL 3G04B 4OLWL 3T0VA 3VWJD 1OL0A 4V2BA 5F71A 4PGJA 4GKNA 1D3CA 4I2XE 1P4LA 4M6NH 5IVXE 1KCRL 4MQ7B 4HS3A 5KVEH 4N1EA 3MJ7B 4PJGE 5ANME 2WAHA 4L3CB 1DQTA 3RZCC 2ICEB 2V5MA 2R39A 1FC2D 3KLAB 4J6RL 1KJMA 5D7JA 3OB0H 5C0ND 4FP8H 5TE7H 3D0VB 5I1GL 3TC9A 1MFAH 1NCBL 3D85B 4QKXB 5TPWL 4A6YB 2XG5A 3B2UC 3JVGA 1SYSA 5EU5A 1MREH 4K3DH 2CXGA 1AE6L 1MCOL 3MCKA 5KANI 4P2RA 3C2SA 3C60B 3PIQA 3HE7A 4ETQB 3EKCA 4ZFOB 1H0DB 2DS4A 3PGCA 1XH3A 4KKCD 3G5XB 5EULV 3UC0L 1CVSC 2IALA 4PJIE 1MRCL 2F54A 1MH5B 4OCYH 2A1WL 3MJ9L 1QVOB 3KPRA 1UYWH 2ZG3A 5JIHA 3AS1A 4NWUH 4ZOAA 2N56A 3RGVB 1IKNC 5EBMB 4PGDA 1DANT 4OFIA 1I7UA 3QEHA 1IZJA 1ZHLA 2DM3A 3UTPD 4GRLA 4LLMA 1LP9B 4RWHA 1D9KC 3PDOB 2PKDA 4OCLC 1PD6A 2DI9A 1TQBC 1EEQA 3LQAC 4HKBA 2BVQB 2P46B 4H20L 1CIDA 1UCTA 2GQHA 2VABB 3IETA 4P2QD 5I73C 2I07B 3BP4B 2I26N 4MD4B 1J8HB 5FYKU 1MHHB 3VD5A 2D0HA 3TVMB 1LK3H 4HS6B 4WFED 1NBYB 1QSEB 3V52L 1ZLWH 3MODH 3LRGA 4Y89A 3E8UL 1NGPH 4CN1A 1PLGL 4IHOA 4R90H 4UB0L 5D6DC 1WBZA 5DRZA 5FYKD 4ZUWB 3W0WD 3FQRB 3QJFB 4L29A 2MOVA 3GKZA 3FKUS 4U1HA 5B4MD 3DXAB 4FFYL 3A67H 5FHAH 3I3BA 4J4PA 3TNNB 1GIGL 1HI6B 5C0CD 3QSKB 4MNGA 1HCFX 4QCIB 1MCNA 4TYUA 4UMGA 3WS3B 5EO9A 4G6AD 3MREB 4WWKC 35C8L 4X6FA 3DPBA 3L95B 2AV1A 3GUTB 3C5SB 3TCXA 4XVSH 3VFGH 4NQEB 1BQHA 4M03A 3EFFB 5ESVB 2HVKB 1NLBH 3T2QA 2CLRA 2FD6L 3L5WA 3S4SB 1ONQB 3O0RL 3MLUH 3U7YL 5HPMB 2PF6A 3GFUA 3MUGB 5JDSA 3MV9E 4XCNA 4QWWC 4ZO9A 4GRMA 1JVKA 1UFUA 3ZKMD 3S3PA 7FABH 2FR4A 5I15H 3FFCA 3ISWA 4ORGA 4JZJC 4EUPB 1BQSA 1F45A 3HCVB 5JA8B 15C8H 3QUMB 3V4VH 1J05A 1A1MB 1NUNB 4TTDC 1FNSL 5IMKA 4P9HH 1FG2B 4OZIB 1B0GB 4G43B 4JFHD 1MI5A 3B9KC 3LKSB 3JTSB 3VRJB 4JRXE 2ITDB 2F19L 2QJDA 3O45B 3IF1A 4MA7L 3PHSA 1NCNA 4YUEH 1EO8H 4FQHB 4CVZB 1EFXD 1K4DB 4KK5C 4KHXL 4PJAB 1RY7B 5HHQA 1MEXL 4YK4C 5EU4B 3QXTA 3BSZL 1R0AL 5T3ZL 2XZAL 2YC1A 5FYLD 1OAQH 1IAOB 1DVFB 5ESAA 4H1LB 1UENA 2NX5B 4JRYD 2HMIC 3L7FA 1XF5A 4RAUA 3WFBL 2YWYA 5BRZE 1A7OL 4QTHA 1T5WA 1ZANL 4WUKH 3BH8B 3VFWB 4FXKA 1VACA 1E4WH 4GQPH 4BA8A 1YJDH 5KVFH 5I1HH 1MCWW 2A9NH 4WW2C 5I76A 5ITFA 1UJTA 2Z31C 3RY6A 5DJ2A 1C8PA 2JLLA 4L8BB 2HJLA 3WNPA 4PLKC 4JM2B 4F7CB 5J12C 3SDYH 1Q9LA 5AEAA 3S36L 1N59B 1E28A 3SY0B 5JXED 2B1HL 4XAKD 4PG9B 1S9WA 4CU6A 5DQ9A 1HH6B 2EDKA 4DCQB 3DTXB 1A7QL 4JZNA 1LO4L 1C1EH 4NN5B 5IQ7H 2CKBL 3MRBB 1P84K 1DBBL 1U8JB 2NY7L 5D70H 2ATPB 5I8KH 1NFIA 2W0PA 5DSCA 3ARDA 3D39D 3IFPA 4AQ1B 5E8PB 1YEJH 2HT2C 2R1YA 2R2HA 3X3FL 1GPOL 1KXQE 2ORBH 3KJ6L 4NQXB 1I7RA 2XZCH 4NZUH 1BVKB 3S88H 3SCMD 2W91A 3IS0X 3TO4D 4LDEB 2H6PA 1QP1A 4IRJB 2MPAH 2CK2A 4U0RB 5KSVB 4RMUA 3GJFK 3ROLA 2DTMH 2IH1B 2ZCKL 4HULB 4YDJA 3SKNA 1KIQB 4R0LC 4QY8A 3O11B 3WLBA 3QWQB 1FQ9C 5DD5H 1FV1B 4Q6IC 5IMOA 5JORA 3BEWA 4HX1B 4BK5A 1XIWB 2XTJD 1I1YA 3L3DA 3ZL4L 1NAML 2NZ9D 4JJ5A 5MHSE 3VD4A 1OWWA 4WO4B 4JDVB 4L9DA 1T0NB 3JV5A 1NGXB 4C56E 5F6HI 2IFGA 3BVNA 4LCUA 4UUJB 4WHYH 1YEDB 3QO1B 2PR4H 2XY1A 3MRMB 4ZXBD 4QOKA 4M5ZL 4OIIL 5HPOA 4XP4H 2ZCLL 1IQDA 5IK3A 2EXWD 3QFDA 3QAZC 1QNZL 3S7GA 1KEMH 1KJ2A