2D59A

Hypothetical protein from pyrococcus horikoshii ot3
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
141
structure length
141
Chain Sequence
TRPIDGLTDEDIREILTRYKKIALVGASPKPERDANIVMKYLLEHGYDVYPVNPKYEEVLGRKCYPSVLDIPDKIEVVDLFVKPKLTMEYVEQAIKKGAKVVWFQYNTYNREASKKADEAGLIIVANRCMMREHERLLGEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of CoA recognition by the Pyrococcus single-domain CoA-binding proteins.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein PH1109
total genus 49
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13380 CoA_binding_2 CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2d59A00
4G65A 1U3VA 3PIIA 3FF4A 4EUHA 4GKBA 1PJ2A 1P77A 5ADHA 1O0SA 2YFHA 2NTVA 4XGIA 1PU2A 1U28A 4CM8A 4DL9A 2W2LD 4RZHA 1GV0A 1ZMOA 4XYLA 2C5EA 1BW9B 4H7PA 3BMNA 1PEDA 3NT2A 1PTJA 3QVTA 1YDEA 4BNHA 3JQGB 2HDHA 3SVTA 2HK8A 3F4BA 4K26A 5IXYA 1EFKA 1E3WB 3KSDO 5TRTA 3JYLA 5JFOA 4XR9A 4UVDA 1Y9AA 4HBGA 2PGLA 4KWHA 2PZMA 3WYBA 2V6MA 3GN1A 1IZ9A 3BMOB 4FD3A 3ADPA 3F1LA 4P4NA 4UREA 4MIOA 4WUVA 3C7AA 5HWSA 2XPCA 2IZ1A 2XAAA 2VRCD 1GZ6A 1WWKA 2P4QA 4KDFA 5CFZA 1CQIA 3PQFA 4IUYA 1Q0LA 4E2XA 5CG2A 1ADBA 4MKXA 3EDMA 3GF4A 4XCVA 4XGKA 1T2CA 2WWRA 4N5LA 3RWBA 3DHEA 2W8ZA 4JK3A 3PPIA 5DULA 3STHA 4PZDA 2EW8A 3DB2A 4GBJA 4KDEA 3MEQA 3ETGA 4JJGA 3KXDA 1TEHA 4OYRA 3VC7A 4R54A 1BDMA 2JAHA 3QV1A 1ENPA 3RJ5A 3S2EA 4A7PA 3F47A 1Z82A 4HX5A 5I7VA 1IPFA 1JU9A 3U62A 1KVRA 1JWAB 4HWKA 1EDZA 4NH4A 2IXBA 3UOGA 1ISJA 4NNJA 2WE8A 1QV7A 4FFRA 3GHYA 4UEKA 3CIFA 1SO8A 3DAGA 4NFYA 4IXTA 1WDKA 3JSAA 2BFMA 3ZNPA 4EITA 4CLRB 3QY9A 3RASA 1NFQA 1ZMTA 1JAYA 2V7PA 1J5PA 5EINA 5JO0A 1X13A 2GPTA 3RU9A 3DDNA 1T2EA 1ZK4A 3TZQA 1C0KA 4WPGA 1U1IA 2JAPA 1E6UA 2ZTUA 4L8VA 1DRUA 3NAQA 2UYYA 4L75A 5IN5A 1E1NA 5IDXA 1YWGO 3LSYA 4CQMD 4FGSA 1GQ2A 2PZLA 4II3A 4CMAA 2PH5A 1FXSA 2YQ4A 5LDGA 3L6OO 4YJFB 3OHSX 3ABIA 4LGVA 3HG7A 3P5SA 3HB5X 4WCFA 4ZQEA 1AHIA 4ROSA 1T26A 1T25A 4HNHA 1PQPA 3KV3O 2OL4A 2C20A 2E82A 2B35A 4JJFA 5F5LA 5TT0A 3L77A 1LQUA 1X0VA 1G1AA 1ARZA 2GZ1A 4M49A 1IOLA 1NVTA 3NTQA 2NVWA 5T57A 2CY0A 1H94A 3L4BA 1B8PA 5G0WA 3M6IA 3PLRA 2A92A 5CPBA 1EE9A 3BMQA 1Q2XA 3WGYA 3ZZNA 2QYSA 4EJ6A 3PHGA 1C1DB 2DVMA 3BTVA 1F8FA 4BO5A 3UICA 2HAEA 2X1HA 4D46A 1ISGA 4CM7A 2Y0EA 4D3FA 4BNJA 2LDBA 2OUIA 3FI9A 2PZJA 1LNQA 1VJ1A 3KO8A 2GDZA 4A2CA 2ZB8A 4BNXA 3JYOA 5I8ZA 3GRPA 3V2UA 1DLJA 1WVGA 1AGNA 1T1SA 5IZ4A 1PJCA 2ZJ1A 3H7AA 3INRA 1KC1A 1DJQA 1ZK0A 1CWUA 2W2LA 3PXXA 4TVOA 3INTA 3DBRB 1GADO 3BAZA 3E6AA 4EBFA 3ANLA 3BHJA 5JAIA 5T5QA 5JAMA 3JD4A 1A71A 4BNLA 3HN7A 3ETDA 4UUMA 5FF9A 1W73A 4XIYA 3FBTA 3CZRA 5F1OA 5IXSA 2AA3A 1SB8A 1SEVA 2J3KA 1P1FA 1XDWA 4OM8A 1FDTA 1K2WA 4CM6A 1L7DA 4CL8A 2HMTA 4IMRA 3ULKA 3EAGA 4R5MA 1KY4A 2GERA 1A4UA 1L1FA 2UUPA 1RJWA 3DOJA 4OSPA 4PLPA 3OJFA 3O4RA 2NQ8A 4NJOA 5KVQA 4L4SA 3O8QB 1VL8A 2CMDA 4DVJA 4W9NA 4CUKA 1Z74A 3QA9A 3Q3CA 1QYCA 1I3KA 2EJVA 3BTUA 2DM6A 4XYEA 3B70A 3E5RA 4R41A 4BKUA 1DAPA 1HWYA 2PK3A 2Q4EA 3G79A 4ILKA 2XOXA 4XJTA 1YQXA 1UXGA 1F8GA 4O59O 4BGIA 2YHIB 1ML3A 4GX0A 3HNPA 4TRNA 4TKLA 1E77A 2X5OA 4WLOA 4D0RA 4FGWA 1ZW1A 5LC1A 2AMFA 2EGHA 2P2SA 3FPCA 5JC8A 3UAGA 3TFQA 3TFOA 1PWXA 3K31A 4RF2A 3GHHA 1HTBA 4GVLA 1GUZA 3T4XA 1K6XA 4ZJUA 1EDOA 2VOEA 1PS8A 3GVHA 4WECA 1P1KA 4RF3A 3IC5A 3GFGA 4I8XA 2FPGA 1ORRA 2HQ1A 1QXSA 3D3WA 3PFFA 2X6TA 5DBFA 3ST7A 3WLFA 1DLIA 3GVXA 1T4DA 3PK0A 4XEHA 4ZN6A 4LMRA 3JQAD 3BMCA 3NDJA 2PKQP 3IUSA 2CZCA 4PLZA 1ZUD1 3DMYA 4RPHA 2OP0A 3WYEA 3VOSA 3ASVA 1HL3A 4CR7A 3M1AA 3CE6A 3Q9UA 1R4NB 1P74A 2O48X 3ZV6A 3O9ZA 3TOXA 1R15A 2YY7A 2D8AA 3K2EA 4PLFA 3ZH2A 4DIBA 2FN7A 1GFSA 1GR0A 3GPIA 2B5WA 3OP4A 4OL9A 3WTCA 1SAYA 2Q1TA 4PRKA 4E30A 4E31A 2W2KA 2O2SA 1GPDG 2JHGA 3MTJA 1I0ZA 1PX0A 2JFHA 4R1TA 4PG5A 2NLOA 4J3FA 2PZKA 3AI1A 3SC6A 4RVHA 3ZWYA 1TI7A 2OBNA 4RVSA 1YVEI 4B3JA 3C7CB 1Y9EA 4CLRA 2BLLA 4XWYA 2JCXA 4PN3A 3L4SO 3W1VA 4AJPA 1JWBB 3ZWXA 2CFCA 2O3TA 2YQ5A 1NPYA 3MTGA 1NASA 3CMCO 4EGFA 1A5ZA 3JQFA 3N74A 3ANNA 1C14A 1UAGA 5U9CA 1LLDA 3KYDA 3NEPX 3Q6IA 4J9VA 4DTIA 1YOVB 2Q1UA 4YJFA 1T2DA 2VHYA 4FIZA 2VN8A 3L07A 2J8ZA 1QR6A 3V2HA 3LT4A 4PLWA 1WDMA 3GMDA 5BQFA 2YW9A 4QEDA 1WAMA 1SBYA 1KEWA 4ZQFA 1V6AA 4RPKA 4WNIA 1PGQA 1GUYA 3TZCA 3ZV3A 4MKRA 3PRJA 3WSWA 3RC7A 3OJEA 3TWOA 5L4NA 2AQIA 2GN9A 2ILTA 3FR8A 2NADA 3PHIA 1FK8A 5JAZA 5JY1A 2IRWA 1VE9A 1FMCA 3CXRA 1XQ6A 1NAIA 2DPGA 3DMTC 1QP8A 2UDPA 4IDEA 3E8XA 3EW7A 1V3UA 4UEOA 4YJHA 3UUWA 1I30A 3BHMA 4YAIA 1IE3A 3CZMA 1E3WA 4UVGA 2GGSA 3WS7A 2WJPA 3O26A 5L7YA 4IDDA 4BO4A 1GEGA 3L6EA 4KUEA 4BMVA 2D4AA 3WXBA 4CV2A 4RVFA 3ZWBA 5COBA 1GZ3A 2WSBA 3PFWO 4YRAA 4EDFA 1YRLA 4WE3A 2Y66A 1MV8A 3SLGA 3QWAA 3TDKA 3W8DA 2JCYA 2Y1EA 3QP9A 5BNFA 3MJEA 1A7KA 3L9XA 1UDAA 3X2FA 1KERA 2V65A 4RVGA 4Z6KA 1K6IA 3AY3A 1M66A 5JDCC 1PJBA 2C0CA 1BGVA 3DBRA 2I99A 1BWSA 3KVOA 5H82A 3RAJA 2DBRA 3Q2KA 3GVCA 1HDGO 3GQVA 2P9CA 1E7WA 1XCBA 2SCUA 1HDYA 1HLPA 1VSVA 2AE2A 3NTRA 4URFA 2G1UA 4JQCA 3ROMA 3ENNA 5AQ1A 3ZNOA 3JQBC 4MVJG 2AEMA 5DNAA 1TVEA 1JLLA 1O6ZA 1T1RA 7MDHA 2B36A 1NNUA 1E6EA 1RM5A 4NK4A 4Z3KA 3D3EA 1AE1A 4CL3A 5L95A 1K5HA 4IZIA 5TLSA 3P19A 4RPJA 4NR0A 5TSDA 4MVJE 1EFLA 3A28A 2E48A 1PL8A 3ZW8A 2AG5A 1PS9A 1IPEA 1O94A 4KP7A 4YT4A 1NPTO 1WMAA 2FSVA 1U9JA 4CMHA 4BVAA 3AWDA 3ZU4A 2OXIA 1OAAA 3AK4A 3P7MA 1I32A 1WP4A 4NBVA 4A26A 1CIVA 1NP3A 3RFXA 1LSUA 1VM6A 3LLSA 2PD4A 1A9YA 1J49A 1N5DA 2RH8A 2YDXA 1PGNA 4I5GA 3S8MA 3VVBA 1N7GA 1WMBA 1VI2A 4TRJA 3GMSA 2YYYA 3W4KA 1AN9A 4RJTA 4ZICA 3E48A 3E1KA 3WQSB 3ZI0A 4FQ8A 4DRYA 1Y8RB 1E5LA 4Q3NA 4OIMA 1UXHA 5DP1A 4ZGWA 2QZZA 1D3AA 3ONEA 5JNLA 2E6UX 4PLVA 1ENOA 2Y1CA 1EEHA 2DTEA 3U4CA 2R00A 1QYWA 1DC4A 3LC1O 3DMTA 1RM4A 3X2EA 4BNFA 3I23A 5JMPA 3V2GA 1Y5RA 3CINA 2TMGA 3N7UA 1BHSA 2IZ0A 2X22A 1QYXA 5A3VA 2VZ0A 1N2SA 3BZUA 4EEXA 3ENKA 1MG0A 1S7CA 1MFPA 1NR7A 4PLHA 1NPDA 3E82A 1E6WA 2OORA 3EYWA 3HUDA 4BV9A 5G2OA 4L9RA 1QYVA 3PI7A 5CEEA 1NM5A 4D0SA 1NFFA 1P0CA 4XYBA 2HLPA 1FDVA 4OKIA 3KETA 5MDHA 1Q0QA 4S1VA 2QYTA 4DGSA 4DXHA 5FWNA 2I65A 1EVYA 3DBHA 1OFGA 2CUKA 3OQ1A 1RWBA 4UVEA 1A72A 2E37A 4LW8A 2X9GA 3C24A 4X54A 1Y6JA 4BHTA 1UXJA 1P9LA 2ZYAA 5JCJD 4DLLA 1IHXA 5KJEA 3PZRA 2Z5LA 3U49A 3OQBA 4WLEA 2QRKA 2EKQA 4MVJD 4QQRA 4WGGA 3K8ZA 3NT4A 4GLLA 3GNTA 1OC4A 1HYEA 1DXYA 1MX3A 1X7GA 2VTDA 2I9PA 2B4QA 3B1KA 5JE8A 1EE2A 4R1NA 3OFSA 4QTZA 3Q9NA 3E9QA 3QVXA 3KEQA 3U4DA 4CUJA 2ZB7A 3RUFA 4J4HA 1U7HA 5JCJA 5CEJA 4B7CA 2CDCA 3JQGA 4E21A 2C2XA 3WGZA 2AQKA 3CSDA 1PGOA 3CMMA 3KBOA 4IZHA 4MDHA 3C1OA 1C1XA 2BGKA 5CDTA 2CVZA 2JHFA 3JD2A 1HF3A 2YFQA 4R4JA 3GT0A 2GLXA 1NVGA 5ENVA 1BSVA 3I52A 4AJKA 1H0KA 3L9WA 3WJAA 4GX2A 4BO3A 1KYQA 4IM7A 2DLDA 8LDHA 3IP3A 1DEHA 4BO9A 5KVVA 1CQJA 3M1LA 3QE3A 3BTSA 3IJPA 1X7HA 3W4JA 2VTEA 2CSUA 1M67A 1R6DA 2CVOA 2Y67A 1G0NA 4YVFA 1CETA 5TJ9A 2TMDA 4ID9A 3I9LA 4W4TA 3VH1A 1ZEMA 3RC9A 4P22A 1ULSA 1B14A 4FFNA 2ZJ0A 2P5UA 2HUNA 1OC2A 5JMWA 4LMPA 4HV4A 2WD7A 4CJXA 2Z1MA 4N5MA 1BW9A 4A03A 3JQBA 4QX6A 4H15A 5G0TA 2OMEA 3RUCA 4BNMA 4NBRA 2BMAA 2VRCA 3JQ7B 4J7XA 2W90A 1F14A 5KJFA 4NFHA 1TXGA 2ZTVA 3BMNB 5BSFA 3NV9A 4Y67A 1XEAA 3ZHZA 1VC2A 1PWZA 3UCXA 4XKJA 1LI4A 2Y0DA 5DOVA 1NVMB 1Z7EA 3WWYA 3ZV5A 5IDYA 3DZJA 5HS4A 1BXKA 3AUSA 1U7TA 3EGOA 3FTPA 4O63O 2BFPA 2DBQA 2I3GA 1I2CA 4IQ0A 2DT5A 1M76A 1GUFA 2YZ7A 3PQEA 1EBFA 5EJ2A 3ZWWA 4CR8A 3ZWMA 3ZU2A 4E0BA 3A14A 5J23A 4Y6SA 2DQ4A 1LRLA 1W0CA 4NIMA 4PLGA 4WOJA 1OI7A 2B69A 3L6DA 5HM8A 2UVDA 1WXDA 4R1UA 5HTOA 3LVFO 4CMCA 4RQUA 4IINA 4BGUA 8ADHA 3LF2A 3GA0A 3OA0A 5H81A 5T8KA 4BB6A 4EI2A 4QSMA 3QVWA 2BKAA 2Y1DA 3H9QA 4NU5A 4RPGA 1X1EA 4JN6B 3GVPA 2I66A 3HB4X 2ZKLA 3FHLA 4ND3A 4WOKA 3EZLA 5L53A 1CEQA 1DPGA 1LRJA 1RKXA 3G3EA 3ITDA 1C1DA 4B8ZA 5BSEA 2X58A 4E5PA 5CHEA 3GAZA 5JSFA 5IF3A 4Z9XA 4YT2A 2NNLD 2PD6A 3A9WA 1HYGA 3JQFC 3KTDA 1R4MA 2EP7A 5AYVA 4OHUA 3I9KA 3K73O 4E12A 5KOIA 4AJ1A 3GK3A 4EZBA 2AW5A 2VNSA 1ZK2A 1RYDA 4Y98A 4NQZA 4PZEA 4FW8A 4FFLA 2IEDA 1ISHA 1HDXA 2PKQO 3DC2A 3JYNA 1N1EA 5THQA 3H3JA 1YJ8A 2B4RO 1PJSA 1LSOA 1VJ0A 1ZO8A 1KEVA 4CM1A 2FR8A 4DA9A 2EKLA 2Q49A 4J1TA 3NYWA 2YUTA 1VRWA 2I76A 4GLOA 1U4OA 4CQLA 5EESA 5A03A 4M89A 2AEJA 2PKRA 2Q2VA 3W6ZA 3A1NA 4QUKA 3KYBA 1R12A 4D43A 1DIRA 1ZNQO 2YV2A 3BMQB 4FCCA 1K0UA 3H5NA 3QVOA 3QHAA 1JKJA 1DRWA 3WGTA 1NTOA 3JQAB 1JDJA 2RIRA 1ZXLA 1F0YA 4P4GA 4E2WA 3FN4A 4WASA 2EXXA 6ADHA 1Z73A 3QQPA 4YAKA 2IXAA 2WEKA 1EQUA 1NHGA 3DXFA 5A9SB 1I2BA 3WFIA 3AUTA 1PJQA 1E1MA 4HY3A 4I9UA 3ZWCA 4IDAA 4AFNA 3EC7A 1LQTA 1QRRA 2BH9A 3RCBA 5I7SA 1LDGA 3IDSA 3BIOA 4INAA 1GL3A 2FP4A 4MKZA 3JQ9C 5LCXA 4PZCA 5JBIA 3VPGA 4BNGA 1C0IA 2RAFA 3GUCA 2J5QA 4TVBA 2V6BA 4W99A 4WLFA 3KYCA 2HMWA 1KY5A 4YJGA 4M54A 2R2GA 4NI5A 4PLCA 1XU7A 1IB6A 4YPOA 5IDWA 4M86A 4XB2A 4II2A 2C82A 4W9NC 4XQCA 5EERA 3PGJA 3OEWA 4YXFA 2UV8A 1E5QA 4XB1A 4WLNA 5ES3A 1NXQA 2WD8A 3EUWA 3JQDA 2G82A 1HE5A 4IDBA 2VHXA 3PQDA 1LXCA 1LTHR 1PJTA 2FR1A 4PIVA 3PTZA 2ZQYA 3O8QA 5A1TA 3KZVA 4BNYA 9LDBA 1DO8A 1NFRA 5KVCA 4BQRA 2AQ8A 3WQRA 4AICA 1M2WA 4BIIA 2RHRA 1E3IA 2GN8A 5L40A 3LU1A 2P9EA 1QLJA 1HE3A 2HJRA 3FNFA 4DPMA 5TIIA 3LZ6A 3FRJA 1WZIA 4FC6A 1S6YA 2VT3A 3AM5A 1DSSG 1R16A 3MOGA 4JGBA 2X86A 5U4QA 4C7JA 3IOYA 4YYZA 3SJ7A 3E9MA 5JLAA 2OZPA 1E7RA 2VNAA 1DIBA 4NHEA 4JROA 1QKIA 2NTJA 2FZWA 4IY1A 3WICA 4PVCA 4IQ8A 2I6TA 2X8LA 3VHRA 2AQHA 3QWBA 4RL6A 3WR5A 4TRMA 2PFGA 3RKRA 3IS3A 3PYMA 4BO1A 4OMUA 2HKIA 2GZ2A 1XG5A 1CYDA 4J2OA 4LVCA 2R00C 1HSOA 1ZXBA 4LSMA 1XYGA 4TKMA 2HRZA 4D41A 5A9RA 1I8TA 1UDCA 5L3ZA 2WD7B 1N9GB 4L74A 1BXGA 3AOEA 2W2KB 3AFMA 5L45A 1LDBA 1V8BA 1PR3A 1OMOA 2EGGA 4JP3A 9LDTA 5C37A 2VHZA 2IODA 3INGA 4B7UA 3BYZA 2VT2A 1ZFNA 4QECA 1KOLA 2H6EA 4QT0A 5THKA 4BKPA 1P0FA 3TSCA 1SMKA 3BHIA 3LQFA 4YJHB 2VUSA 4WK6A 3FWNA 4NU6A 3KUXA 1YE3A 3OICA 1BG6A 4FR5A 4LK3A 3WB9A 1GQQA 1SPXA 1D1SA 4NZ9A 2E49A 1PL6A 4DMLA 1HDRA 4M55A 3DTYA 3NKLA 5BR7A 2EW2A 4GQAA 2VWPA 4XQGA 1NAHA 4WEOA 2I67A 1F12A 5EQFA 4TQGA 5KJ6A 1ZSVA 4DYDA 2ZB3A 1HLDA 1PZHA 3BA1A 2NU6A 3GDFA 1EVIA 3A06A 3SEFA 2JL1A 3B1JA 3TPCA 3VZQA 3QIVA 2Q46A 1DJNA 5DCUA 2D3TA 5F1PA 4Q3CA 4WKGA 4GSLA 4ZQBA 1TT7A 1EK6A 1ONNA 3OM9A 2VWHA 1WDLA 4KTVE 1SEPA 3RBXA 3D7LA 4AJOA 3DQPA 4R9SA 4Y9DA 4O0LA 3OA2A 1HZZA 1QV6A 4OXKA 3RKUA 3OSUA 1HE2A 1MGOA 2EHDA 4R01A 1BTOA 3B1FA 3TF5A 2J3IA 1D7OA 4FFPA 1JAXA 1UZMA 1HT0A 2YHUA 3GG9A 3CUKA 4OGWA 3ZW9A 3HDQA 4BKRA 3RIHA 5COQA 5I9NA 5JDCA 1ISMA 3GNQA 5JYDA 3AI2A 1R4MB 2EIHA 2O2YA 2HRBA 4JNKA 1CF2O 1J6UA 2BFAA 5MGBA 4DLAA 1Z75A 5FI5A 4HFNA 4CLDA 4DBVO 4U8GA 1MUUA 1UP4A 4XYMA 2EKPA 3U0BA 4I9HA 5ICMA 5T8KC 5JS6A 2VQ3A 3PDUA 4AJ4A 3GZNB 3ZHYA 2NVUA 4CMEA 3CH6A 4FBGA 4EYEA 1RM3A 3MOIA 4PLTA 1MA0A 4WCFC 3IUPA 4D3SA 3D1LA 2P91A 4E2YA 2I3AA 4ZHSA 2NQTA 4DC1A 1FDSA 2NUAA 5ER6A 5FEUA 3VVCA 1GDHA 3G1UA 2NM0A 1DFHA 4IJUA 5AXAA 4BO6A 4GMFA 1D1TA 4YJGB 2C2YA 3CTMA 1EUCA 4A0SA 1G6KA 2PD3A 1XELA 3JQ6A 4MVJA 5I8WA 2AG8A 3JCZA 2UUOA 4R69A 1ZCJA 3ZWOA 3R1IA 3F3SA 5DCYA 4FB5A 2EERA 1ZH8A 3DFUA 4FC7A 1ULUA 3RI3A 2Q2QA 1Q7BA 1OBFO 2ZTLA 3F1KA 2BGLA 4YR9A 4U6QA 5C7IO 2HSDA 4D45A 5DCWA 3KRTA 3PJEA 4UEJA 5L7WA 3UKOA 1DC5A 1I36A 3C85A 3GAFA 1HKUA 2A4KA 3NRCA 3S55A 2HU2A 1ENYA 3K30A 4GGOA 3RBVA 5IN4A 2HO5A 4ZQGA 3K9QO 4I08A 1IL0A 3K92A 5EMHA 4IGEA 3WDSA 3WOHA 1O89A 4BS9A 4GI2A 2W98A 1XKQA 3W8EA 3VKUA 1LX6A 3JD1A 2VYND 3JYPA 1KETA 4WNCA 3JV7A 3AU9A 3PEFA 4EEZA 3DOOA 2VYNA 2NU8A 1VSUA 4GKVA 1HETA 2GUGA 4IMPA 3RJ9A 4CLXA 1B8UA 3WMXA 3ZN2A 3T7EA 1O8CA 3I9OA 4P8RA 1LU9A 2CF5A 1AUPA 1O95A 1MG5A 1I2ZA 3GGPA 4LCJA 5CP8A 3I5MA 3FPLA 2X5KO 3PHHA 5IG2A 3VZSA 3H9UA 4YTEA 2JFFA 1T4BA 4UUNA 3E18A 3JQ8A 4GL4A 1PL7A 2O3SA 1U3UA 3ETEA 3I9MA 4FSHA 2BGMA 2QRJA 2WMDA 3PYXA 4KUGA 1KS9A 4IDGA 4OOEA 3JQEA 4FJ0A 3PWZA 1YQDA 2PH3A 1BMDA 3R0IA 1OZAA 3H9EO 4DQVA 3RUEA 1VL6A 1VKOA 1UUFA 2J3HA 4PCVA 1DFIA 2C29D 3TNLA 4DLBA 1ADGA 4E5NA 5IJZA 3IIEA 5I9MA 3LT1A 2VZ8A 5TS3A 3UHAA 4EJMA 5IZCA 1PJ3A 1UP7A 3GH3A 2F00A 1U3WA 3WGIA 4BO7A 2RHCA 3O38A 3WLEA 5TQVA 4CQMA 3M2TA 1RYEA 5A05A 4OAQA 3NJ8A 4W82A 1YB4A 4AJHA 1TT5A 3G49A 3TZKA 4B4OA 5L7TA 1ZVMA 3MCVA 4D42A 4OO3A 3LC2O 3AW9A 3H9GA 3PHLA 5FYDA 1HE4A 4MVJM 5EPOA 4MIEA 5ILOA 3ANMA 1Y7TA 3Q2IA 2IE0A 4UUOA 3FD8A 5KWEA 3L4BC 4PG8A 1BDBA 1PGJA 5K0ZA 2B83A 4HKTA 1UXIA 1LLCA 4J1QA 3SBOA 4FJ1A 1XGKA 2X4GA 2JFGA 3JTMA 3OBBA 2E4AA 1U5AA 2DBVO 3HFGA 4J1SA 3KOUA 1YB1A 3WIEA 3O03A 4C4OA 1H9AA 4BNKA 1B3RA 2I5PO 3ZU5A 4Z3DA 1WW8A 4PVDA 4CM4B 1LUAA 3K96A 3F5QA 1HSZA 1O9BA 5G4KB 3LYLA 4EUFA 3EK2A 4MO2A 2LDXA 2FSSA 2HCTA 4ALLA 4BO0A 4BNZA 4K28A 3GEMA 3AUUA 4K6FA 3D4OA 2C7VA 4Y6PA 3R3JA 2OOSA 4YEDA 1SOVA 2QRLA 4JJIA 2XF8A 3VAZA 1W8DA 3JD0A 5TX7A 5A9TA 1KIFA 2X0JA 2GYYA 4GMGA 1E3LA 1NWCA 1SCUA 2FZEA 1YL6A 4D7AA 4RORA 4J2HA 4MVJF 5CDGA 4B4UA 1P3DA 4JBHA 1LDMA 1BXZA 1Y8QB 1VL0A 3I4CA 3W6UA 3E03A 2Y68A 1ZJYA 1EUDA 1R37A 4K9DA 1TLTA 2PGDA 4CM5A 4PGFA 3UN1A 4U7WA 1F17A 1R4NA 2X9NA 3R3SA 2O7QA 2XXJA 4WJZA 1WPQA 2QIOA 4GGPA 3D5QA 4GX5A 2DU8A 4RLSA 1B2LA 3E9NA 1PS0A 2Y05A 3MWDB 4XA8A 3AY6A 1Z45A 1DIAA 5G0VA 2P5YA 4FFMA 2BI8A 3FBGA 1P1HA 3GG2A 4H3VA 4QO7A 4E32A 2D5AA 2WYWA 4Z0TA 4XD2A 5T64A 3GGGA 1DIGA 3RSHA 1PZGA 4IDCA 1GV1A 4F6LA 3RC1A 2VWQA 1HZJA 5BNTA 1E3SA 2B4TO 4AVYA 4ZU3A 2F1KA 3KLPX 1NBOA 1AHHA 2ZCUA 4CM3A 5JXWA 4GSKA 4NFSA 3NUGA 2P4HX 4CMJA 1UAYA 1YL5A 4YQYA 3H5AA 4E2ZA 4TMFA 1Y81A 1E1KA 4Q3DA 3OQ6A 1GAEO 4KQXA 4U6SA 5AOVA 1DOHA 4A5OA 1LDEA 1EUZA 4IXWA 4CLHA 3ONDA 4HP8A 1TB4A 3S2GA 2POQX 4J0FA 5A04A 1PR9A 1QLHA 1LLQA 3ZWNA 2B5VA 5KTKA 3RD5A 5JDIA 2PV7A 4OSOA 1EQ2A 3JQAA 3UFXA 4J43A 4TZTA 3CEAA 5I7EA 4WCFB 1TA4A 4YB8A 3KLMX 3SC4A 3AI3A 3E5MA 4B79A 4DPLA 4U5QA 1E3EA 1E92A 3TJRA 1NR1A 1A7AA 4YT8A 5JC1A 3PVZA 1IZ0A 2V6GA 4R1SA 5AXBA 5GY7A 3N58A 5A9SA 1YJQA 1UXKA 4WLVA 3ITKA 1D8AA 3IP1A 1XIVA 4JLWA 1XR3A 1I33A 1YGYA 4J4TA 3UF0A 2HJSA 1VPDA 2BRUA 2Y93A 4DYVA 2EF1A 4KQWA 1XA0A 2FPPA 4QO8A 5GMOA 1V9LA 1Y5MA 1IYZA 1YH3A 3EY4A 2H5LA 4J1NA 4OXYA 2FMUA 4CQLB 4Q3AA 4AG3A 2GNAA 4MVJI 5CDSA 2YJZA 4EW6A 5F1KA 3M2PA 1WNTA 2O4UX 3AY7A 3HDJA 1YBAA 4DIOA 4IJWA 5TGDA 4BMSA 3QJ5A 3AUAA 3FTNA 3LC7O 1KVSA 1SZJG 1U3TA 5KJCA 2X5JO 5FI3A 3CPSA 2ZB4A 3SXPA 2C7GA 1HYHA 3RQSA 1X0XA 3DZKA 1LDNA 1G0OA 3Q11A 4IIVA 3GR6A 4J16A 4NBUA 5DZSA 3RC2A 1L7EA 4M1QA 4BNTA 4NG5A 4ND5A 7ADHA 3PJDA 1GU7A 4OOFA 3FWZA 4BQPA 4UAGA 1NQAO 1HDOA 4L73A 4QXMA 2D2IA 4B7XA 5LDHA 2JD2A 4ND1A 4FOOA 5HA5A 5EL0A 4CMIA 4ALKA 3I4FA 1M6WA 1GCUA 4KUHA 5ILGA 2H9IA 4TWRA 1FF9A 1MFZA 3TZHA 4RCVA 4ALMA 4DMMA 1H2BA 1JTVA 2EWMA 1LEHA 2J5RA 4UVIA 3JQCA 4OH1A 6LDHA 4CV0A 4RF5A 1XQ1A 3ZDFA 5I9LA 3EZYA 1VLLA 4Q39A 3ASUA 3TL3A 4GH5A 4W7HA 3ZWAA 4KMSA 4XGNA 4B8WA 2YHIA 2IDZA 3BXXA 4KZPA 3GY0A 3KHUA 5T67A 5ITVA 3UVEA 4ONEA 4YJDA 1XLTA 2NU7A 1X1TA 4JCOA 2PLAA 3UCFA 4DBZA 5CDUA 3U09A 3EVTA 4R68A 4XDZA 4BB5A 1PZEA 1YB5A 3PWSA 4H16A 4L0QA 4N18A 5GZ1A 2NSDA 3KEOA 3OJLA 3VPFA 4I1IA 5B4VA 2AEFA 3FR7A 3QWHA 2WYUA 1GYQA 2VWGA 4KOAA 4QFDA 3U3XA 4I5EA 3H9JA 4R3WA 4GPD1 4RDHA 2PY6A 2VZ9A 5L9AA 4A73A 1ONOA 4CM8B 1N1GA 3BMCB 5FFFA 3HFSA 4OXNA 1T2FA 1OOEA 3P2OA 5K9ZA 3HJAA 3DO5A 2DBZA 3AM3A 2Z1NA 3DHYA 3GPDG 3CKYA 2BI7A 4J7CA 4NBWA 4PRLA 2OBYA 4BNWA 1PJ4A 5JO9A 3RVDA 1E7MA 3V5NA 3KSZO 3KB6A 4W7IA 3IKTA 4IPTA 2NWQA 2QQ5A 2R6JA 5TC4A 4YRBA 3GC6A 4G81A 3V1TC 3S1LA 3NX4A 5ENDA 1T2AA 4R51A 3GNSA 4E6PA 4MP6A 4XDYA 4MINA 4NJMA 4XZ3A 3OECA 3U4IA 1IULA 1DIHA 1ZK3A 2B0JA 1BVRA 3C1TA 4HFJA 1H6AA 2ET6A 4CMGA 1IHYA 5BSGA 3U5TA 3KYCB 3MJSA 1GZ4A 3QSGA 2AHRA 4CR6A 4CQMB 1F06A 2VUTA 3DTTA 3TN7A 1M6HA 2O7SA 3OEYA 2QW8A 2FOIA 2GD1O 3D64A 4NK5A 4YRDA 5A5FA 3Q1LA 1ZK1A 3PJFA 1NQ5A 4CLOA 2DAPA 2JD1A 2HMVA 3ADOA 3AJRA 1MB4A 1ADFA 5K6AC 1H2HA 4YAEA 1DRVA 1YOVA 1ZKMA 3RFVA 1P1IA 1JKFA 2EJWA 1NYTA 3QRWA 3ZHXA 1DHTA 2V6FA 1T24A 3A4VA 4IQGA 3LF1A 1ENZA 3WYCA 3R6DA 5I7FA 5ICSA 4CPDA 4M87A 1JN0A 3U4HA 1O5IA 3VH3A 3AM4A 1X7DA 2YV3A 2OGUA 2JKVA 3GEDA 3NJ4A 4CV1A 3FNEA 4YWJA 3UGKA 2NTNA 2Y99A 1MP0A 3PP8A 1YL7A 3COSA 3GZ4A 1JVSA 1EBUA 5ITWA 4KTTE 4G5HA 5B37A 4PFJA 2O3RA 1U8XX 3ZNNA 3QVSA 1EZ4A 3WFJA 1EMDA 2FHSA 4MP3A 4J9UE 2XXBA 4F46A 3QW2A 1Q0HA 4TROA 5B4TA 1VKNA 3WGGA 2D59A 1E1LA 3OETA 3VH2A 3MJCA 4YQZA 3G1TA 2VCYA 5DN9A 4BO8A 2QHXA 2WTBA 3BTOA 3OIDA 2CDBA 1H6CA 2HMUA 3VDQA 1E3JA 1P45A 4RVUA 3F46A 4BOYA 1SNYA 2CD9A 2IYPA 3S2IA 2Q2WA 4BUCA 3NGXA 3WBBA 2HK9A 3IJRA 3PZBA 4JBIA 1EK5A 2ZYDA 4B3HA 2NU9A 2VUUA 4GWGA 5BT9A 3GDOA 4LISA 2A35A 2WYVA 1I3MA 3RBZA 4NBTA 1EVZA 3IQDB 4FDAA 4R9RA 5CPFA 3W8FA 3D4NA 2OHXA 5F5NA 4P38A 2CVQA 3UCEA 3DL2A 4K6CA 1LSJA 2PGJA 1I3LA 3NGLA 4AJJA 4C7KA 4B4VA 3DAPA 3DBLA 2EV9A 3PHJA 3VPXA 3IL2A 1C0LA 1CDOA 2VYVA 3QLJA 1PQWA 4RV9A 2BELA 4AL4A 4RDIA 4O6VA 4LN1A 5GZ3A 3GOHA 2VYVD 3HDYA 1U5CA 2FY8A 2PNFA 4WLUA 2ZQZA 5G0SA 3MJ4A 4CM9A 4HADA 4D44A 3VPSA 3GZNA 2NVUB 4K1LA 2G0TA 4IS3A 4BL5A 2GZ3A 1HRDA 3RUIA 3WBFA 4J0EA 4R3NA 2RH4A 2CDAA 4TZKA 3B6ZA 2P68A 3VKVA 5HS6A 4BNNA 2Y1FA 3HSKA 2X0NA 1A9ZA 4JIGA 4PG7A 3JQ8B 4Z9FA 5BSHA 1WZEA 3WWZA 4BMNA 1A4IA 2C59A 1U8FO 3AOGA 3JYQA 4DREA 4Q3BA 1UP6A 3ICCA 2JCVA 1R0SA 3RUDA 1ZIDA 3H2ZA 4XYGA 1C3VA 1DHRA 3NDRA 1H6BA 4G2NA 1QSGA 4ND2A 4UVHA 1PJLA 4MP8A 4J7UA 2JD0A 4BV8A 2ZCVA 5DT9A 4IS2A 5G0UA 4ALNA 2Q4BA 1B3BA 4ALJA 1XHLA 5IFLA 4P4LA 2DKNA 4JX8A 2C54A 1MC5A 1Q7CA 1K6JA 3KSUA 3OMLA 3WGQA 3GRKA 1CRWG 2EP5A 2O3QA 2EG9A 1U2DA 4IBOA 3S2FA 2W4QA 1U4SA 1Y1PA 3AOEC 5TT1A 5COAA 4CV3A 1YONA 2Z95A 2HMSA 5JDIC 1PGPA 1LA2A 1FJHA 2DUUA 4ZD6A 5JAQA 1KEUA 2IEBA 3IAHA 1SB9A 2OP1A 4L76A 4ND4A 4YDRA 3C3XA 1UH5A 2A9FA 4ZVVA 5DDIP 1PSDA 4AJIA 3ZCXA 3ZV4A 4N5NA 5A06A 1HEUA 1E0DA 1YXMA 5DBGA 2GO1A 3W4IA 5CDYA 1BVUA 2QX7A 4HUJA 1X15A 3TQHA 4BGEA 5A4DA 3NDIA 4Z9YA 1H6DA 1PIWA 3SJUA 1LJ8A 2J6IA 3VZRA 1V35A 2ZYGA 1C0PA 1SOWA 2O3JA 1XSEA 1N7HA 2BF7A 2FPIA 3TRIA 3OJOA 3U9LA 5B1YA 1B7GO 4W6ZA 2BFOA 3HN2A 4CMEC 2Y0CA 4XJSA 4O1MA 3H6KA 2GCGA 4MIYA 4RQTA 4KWIA 2Q3EA 4RF4A 3EMKA 2Q50A 1YQGA 3NTOA 1D4FA 3LK7A 2GRAA 3OH8A 5TF4A 5TNXA 1I24A 4FJ2A 4XRRA 4CLEA 4YACA 1H93A 2B37A 5JYEA 4WEQA 4J6FA 4XIJA 4GWKA 3DFZA 4ESOA 3HHPA 3OIFA 1UZNA 3LT0A 1HDCA 2OO5A 1NQOA 1NX6A 1NQTA 4I5DA 4PG4A 2UAGA 4XQEA 1JA9A 1ZSYA 1ZEJA 2NVBA 1A27A 1UJMA 4TSKA 4E5KA 4Q9NA 4HXYA 4S3MA 3PGXA 2O23A 1B8VA 3H5RA 3WJ7A 1K89A 3P2YA 3RU7A 1KEPA 3KM0A 1KVTA 3V1UA 1MC4A 3PYLA 1X14A 3I83A 3ON5A 4U0KA 1V0JA 2D1YA 5B4UA 3I6IA 3WGHA 3T4EA 4EUEA 2VHWA 4HFMA 4UULA 3RUAA 3ZGYA 1GY8A 1JQBA 1R0KA 5T6BA 4Y8VA 3G17A 4B3IA 5CEFA 3JQ9A 3QWFA 2Q99A 3DAFA 4E33A 3HQ4O 3K5PA 3TL2A 4ITUA 5C7LO 3WTBA 4B4WA 5JY6A 5L4SA 4AJNA 4RGBA 3JQ7A 2X23A 4UUPA 4LRSB 4BKQA 3DR3A 3GFBA 3C8MA 1MXHA 1ISIA 1XWFA 1DFGA 4M8SA 2J5KA 3MJVA 1E7YA 4LRTB 1QYDA 3VTZA 3H2SA 4Y6RA 2X7HA 1W4ZA 1Y8QA 4MJLA 2PTGA 2ZATA 4YAJA 5B12A 1TT5B 4J4BA 1JKIA 1ZSNA 4IIUA 2PA3A 3DHNA 5HRUA 1XU9A 4LVUA 3WMWA 3PIDA 4GAEA 1ADCA 1Z7BA 4RLHA 1B0AA 3H4VA 3GUYA 3MWEB 5EIOA 2GN6A 4FPXA 4NDNE 5F3RA 3KYDB 2GN4A 2JJYA 5KIAA 3Q0EA 5DF1A 3PDJA 5IAAA 2DFVA 4AJEA 3H65A 3AFNA 1UZLA 1E7SA 1KC3A 4ZA2A 3OIGA 3RFTA 4L4XA 2VRBA 2Q45A 1B26A 3PJGA 4FN4A 4DIFA 5U1PA 4O5OA 1HXHA 5KCZA 4E3ZA 4BGVA 1I10A 3NT5A 4RVDA 1J4AA 2GSDA 1I3NA 1R66A 5IZCC 5C7OO 5A3JA 5KVSA 1DC6A 5G4KA 1YBVA 1DBVO 1Z6ZA 3B20A 4F6CA 4CLOB 1NHWA 2EEZA 1DAOA 3HADA 2GASA 1QMGA 4OQZA 3V8BA 3UXYA 1I01A 5H83A 3WGOA 4ZRMA 4DWVA 4RO0A 3G0OA 4YAGA 1K3TA 2O4CA 4JP2A 4L4RA 2NACA 1EVJA 2AXQA 3BMOA 4CODB 1LC3A 4E5YA 1ZJZA 1R0LA 3TZ6A 3H3FA 3SX2A 3GGOA 1B15A 3AU8A 5F21A 1SC6A 2RCYA 2QZ9A 3F6YA 3EVNA 4BNVA 4CUZA 1AXGA 3ICPA 3GLQA 3WX0A 3WG9A 3HE3A 1IY8A 2DTXA 2Q1WA 2G17A 4BO2A 3PWKA 5K6AA 3RUHA 5JW6A 3F5SA 1H5QA 5DBIA 1YDWA 3DZIA 4TRRA 3ROKA 4OJNA 1LDYA 4Q3EA 4YCAA 4PLYA 4DUPA 1PQUA 1Y8RA 2NV6A 3GDGA 1YKFA 1P44A 3WIDA 3OJ0A 4I9NA 4NPCA 3VTFA 3FCOA 4CMIB 3ROQA 4WCDA 3DZFA 1AXEA 4FFOA 4FOSA 4D79A 1RM0A 1BRMA 4J91A 1DDOA 5AXCA 3WSVA 3D0OA 2FRDA 1V3TA 3JD3A 4QFCA 2H63A 2RBEA 2J3JA 3IKVA 1E7QA 1CJCA 1KVUA 2G76A 1ISFA 1RPNA 1ONPA 1CERA 1V3VA 2C07A 2DUWA 2O50A 2VHVA 3ZWPA 1I5RA 5GZ6A 4E4YA 3FNGA 3L0DA 4JXKA 3GEGA 1NWHA 2FR0A 4DPKA 4HFRA 1JVBA 2PWZA 5A02A 1ID1A 3VDRA 3MZ0A 2HK7A 4AJLA 1VJTA 3DBLB 4D3DA 3ZHBA 1YBMA 4MPDA 4N7RA 3UW3A 3DZHA 4BKOA 4A10A 1P1JA 1GEEA 4E13A 4XRGA 1P33A 1P31A 2DTDA 1ZBQA 3DZGA 3GVIA 4AJ2A 1YS4A 3GN2A 3K2BA 4XX0A 5DP2A 3WNVA 3I3OA 4EJ0A 3LT2A 2ZTMA 1LC0A 1Q7GA 1IUKA 1YO6A 3FNHA 1P1RA 5JPIA 3DWFA 2QG4A 2GF2A 5KJ1A 4MOWA 4RZIA 2OFPA 5JCXA 5HBRA 4MVJP 3EHEA 3DONA 1UR5A 1GPJA 4A27A 1N8KA 3K6JA 3ZNQA 5AXDA 3DOCA 4U0JA 3HDHA 3DZBA 4YBZA 3F9IA 2FWMX 4GVXA 5IDQA 1GD1O 1HDZA 4PG6A 2DPHA 2X9VA 4Z0HO 3T7CA 4JBGA 4BNIA 2Q1SA 4IJVA 5KKCA 3LDHA 1KBZA 4LSWA 4IDFA 2D5CA 2X0IA 2DC1A 3HZZA 3WNQA 2IYOA 4XR4A 1DB3A 3DEYX 2IZZA 4FS3A 5AVOA 1Q1NA 1U2GA 2DFDA 2WM3A 3C7DB 3ZU3A 5L51A 2GR9A 1PZFA 2D0IA 3OF2A 3H8VA 2WDZA 5CG1A 4IJKA 2G5CA 5TJHA 2H1SA 1LBEA 3DBHB 2ZK7A 4N54A 4NMHA 2CF6A 1QG6A 5C5IA 3FSRA 4GX1A 4R5HA 2AE1A 1MLDA 4E5MA 2YV1A 1H9BA 1MXFA 4ZQHA 1WLYA 3WQQA 2O3UA 5CAEA 1LRKA 3I1JA 4MVJH 5KNLA 5A5EA 1W6UA 1KVQA 2BHLA 1B16A 2A94A 1QORA 1GCOA 2Y1OA 5DOZA 3TOZA 1LLUA 3ONFA 5G4LA 2WE7A 3DBVO 3V1YA 4ZRNA 1N9GA 4CMKA 4CMBA 1BXGB 4ALIA 4CM9D 2X0RA 1N92A 1UDBA 5EN4A 1C1XB 2CNBA 1DC3A 4OKNA 2P9GA 2BD0A 1GTMA 2PR2A 4OQYA 3I9JA 1FDUA 3RROA 3VPHA 3F4LA 3ZWVA 4DQUA 5C3MA 4DC0A 3D4PA 1GYRA 5BNIA 4XQ9A 2VOJA 4HNGA 3VH4A 1GQYA 4R16A 4YT5A 3UH1A 4DQXA 3VZPA 3IMFA 3ORFA 1GYPA 1M75A 5ER9A 1JW9B 3I9NA 3C1AA 4IGFA 1J0XO 3D5TA 3PLNA 4NJMB 5KKAA 2C5AA 2YDYA 4YA6A 3LLVA 2ZIZA 4BNUA 3D3WB 4F45A 4J90A 4LCEA 4RPLA 3MJTA 1FDWA 2Y1GA 3SLKA 4Z0PA 5L4LA 4F3YA 1LSSA 1ZZEA 3HWRA 4I5FA 3QWIA 5EQDA 3I6QA 4J49A 3ROPA 4CM4A
chains in the Genus database with same CATH superfamily
2FW8A 3KFLA 2BDTA 3EC1A 2PSJA 4JXZA 3FF4A 5HFAA 1ZM3A 3RF7A 4FK8A 4MUYA 1O0SA 4XGIA 1F60A 2NTVA 3RWMB 3KDSE 4LC0A 1REQA 1U28A 5FCDA 4NENA 1NP7A 3THOA 4RZHA 4PQGA 3VGPA 5JWRA 2HA5A 5B7GA 5F73A 1T3TA 1BW9B 1T9KA 3EMBA 3PNMA 4MLPA 3JS5A 4X45A 1L0BA 4RKYA 5BMOA 2YCBA 4UAUA 2C78A 3U44B 1YDEA 2G8NA 2ZBUA 1MVLA 3GGSA 3NXSA 2RGCA 5CIQA 2HDHA 1PE0A 4XX1A 3RYHB 1QP0A 1XA3A 4JP5A 5CFNA 4Z54A 2I8CA 4YCNA 1EFKA 2ZI4A 4CU2A 4UOQA 4I9FA 4KN5A 1CUVA 2VCEA 1YQTA 2H0QA 2FEXA 2XBLA 3IP8A 3SYLA 1XLTC 2OO7A 3N2KB 1UOEA 6AT1A 5IASA 2VT6A 5HDBB 1GOTA 1J2UA 4KWHA 3WYBA 2V6MA 3BMOB 3X1YA 4FD3A 2YKGA 2OO5C 4FXPA 2VYQA 4P4NA 4AZ3A 5JASA 4PX9A 3EUAA 3C7AA 1IBKB 3A9CA 1I4OA 4LOKA 2FF7A 2VJKA 3HCBA 1Z5PA 3WKAA 4KDFA 2FSGA 1QIMA 2DY1A 4IUYA 1U0EA 5CG2A 1E2MA 1ADBA 2SNIE 5FBQB 2WMYA 2QRZA 3R3UA 4ZOCA 3CZPA 5DBOA 3MT9A 3VC3A 4BFTA 1T2CA 2WWRA 3DHEA 1W85B 4P7JA 4ZAGA 5ALOA 4XLLA 4X6UA 3EN0A 5DULA 4HWRA 5B2ZA 4PZDA 2X9QA 5AW5A 1H0HA 3AIMA 3KT8A 1O94D 4JJGA 4L8WB 4MQ5A 2IYRA 2JAHA 4NQRA 1ENPA 1LVHA 4TXNA 3QUBA 1F20A 4EYGA 4C6RA 3BEDA 4F85A 2OFWA 2NU9B 3O84A 5AKLA 2W0MA 3HFJA 1KVRA 4RMHA 1F6WA 3LLUA 5ERYA 4ZVKA 2QZSA 5E4JA 2IXBA 1YS6A 4X97A 3UOGA 1ORVA 1RXCA 2BLNA 1TEVA 3I34X 4PRZA 2GK6A 3GHYA 1DTSA 5EP4A 1II9A 3DAGA 3W34A 3ZXYA 5CNIA 1GPLA 4LWQA 1P61B 3IO3A 5EZQA 3B2QA 4QQ8A 3QEJA 3IEMA 1HTTA 4CLRB 5BMVB 2GN0A 2O8FA 3CX7A 2P4EA 3RASA 5J2TF 1TUIA 1ZMTA 1JAYA 2BN4A 1B6RA 2WA1A 1J5PA 2C84A 3JVVA 3THYA 4UNPA 2MWMA 5FWAA 1T2EA 4QUJA 2YV4A 4HNUA 2XZOA 4TYQA 4AS3A 5BVHA 1OYVA 1E1NA 3E3AA 1XZFA 1GG9A 1EINA 3HV2A 1JT2A 2XWQA 1Q7TA 1W0KA 2Y1LA 4L8FA 1FS4A 4CMAA 3U4QA 3DZ8A 1URPA 2DFNA 5LDGA 5AJHA 4RKRA 3OHSX 3ABIA 4Z4GA 2OXCA 4MWCA 2NYUA 2YJNA 1FFSA 2J30A 3GUVA 3WKCA 1MAUA 2IUFA 2QR5A 2XMCA 1T25A 4IH9A 4KO8A 1PQPA 3QVVA 1CCWA 3QLVA 3NDBB 2JDIA 3CNHA 4JJFA 1M6VB 2D8MA 2WJ4A 5F5LA 4OQNA 3L77A 4BECA 1C3LA 2Z2KA 2A9OA 1MTZA 1ARZA 2GZ1A 3A8TA 1QO0D 1ZINA 3OZCA 2E5WA 5GV7A 2NVWA 5G0WA 1H94A 3T4PA 1B8PA 2F90A 1EUYA 5CFMA 4QU9A 3ZG6A 3KE8A 5CPBA 5J40A 3BMQA 1C9EA 5DNUA 4AMGA 5IJ0A 2B9VA 3UBMA 4RXTA 1QFYA 4RTSA 3OP1A 4YCLA 4M9XA 4L7QA 1F8UA 1G8AA 1N2GA 2WVAA 3JW8A 1FSZA 4EQ6A 1T4CB 3LQ2A 4Q1VA 1T5SA 5DYNA 2GD0A 2OPBA 1PJAA 4ZPJA 5BR1A 2FUKA 3C3MA 2E4WA 4CTOA 3V7NA 1U2DC 2I1VB 4V0QA 1BWPA 2PYIA 4YCBA 4E1AA 1L7XA 2ZSUA 2DYKA 4GP7A 3PFCA 4MLDA 3KO8A 2GDZA 4JLPA 4XM0A 2QSYA 4BNXA 4M9QA 4DNXA 3GRPA 2BBWA 3QMWA 5D51S 2HJHA 1WVGA 3G0BA 4Z8XA 1PV2A 4B3XA 4QJ5A 1IAQA 4ZC8A 3INRA 1X1CA 4HYQA 1NG9A 1CWUA 4TSFD 4TVOA 4D0NA 4PZ0A 2Z8YA 3VJRA 4DADA 2AI2A 3BAZA 4BAUA 3R0JA 3ANLA 3BHJA 4L7VA 4JVLA 4I8DA 4YCMA 4V38A 3JD4A 1JG7A 2Z4SA 3HN7A 2FQQA 4BVLA 1GPWB 1U2TA 4UUMA 5HRCA 3OPQA 3FBTA 3Q0TA 2F9FA 4HAOA 1SEVA 4P7KA 1W35A 3CGWA 4OM8A 5JV5A 1E20A 3HXTA 4EHAA 1E5XA 2R3SA 2FMTA 2V3VA 2YVLA 4IMRA 4JVOA 2ZLBA 2GERA 3QUSA 1L1FA 5I7UA 1S2DA 1DU4A 2UUPA 1ZCBA 2FV8A 2Z2XA 3AKYA 2VC2B 3FCYA 3FG9A 3OZDA 4KGVA 4N7BA 4MJ7A 4B33A 2NQ8A 3QVJA 1FSGA 5GJVC 2HRRA 4I2NA 4LECA 3OOHA 4V2UA 4P53A 5L3QB 3FOZA 1CSEE 3VHXA 5D5PA 3WLAA 2VP5A 1BX1A 4DVJA 4EL0A 3AG5A 4W9NA 3CF2A 1Z9BA 3CCBA 4BWYA 1WLSA 1Y9ZA 3CA8A 2EJVA 3MJHA 3BTUA 4XYEA 2PMEA 3VU9B 3ODPA 1PJRA 2ZSDA 2MSEB 1VXRA 1ZKDA 2Q4EA 4CEIB 3DTVA 2EW1A 4JEIA 3E3OA 2VPTA 1E62A 1UXGA 5FOVA 4MO9A 2J9XB 2EL7A 2YXLA 4L51A 2XYHA 3AVWA 4RY8A 1I6LA 2EAUA 4EX7A 2AMFA 1BA2A 3FPCA 5BSWA 3IQEA 1MH9A 5JC8A 3C0KA 1M2HA 1YB7A 2GBLA 1PWXA 5BYKA 1FUEA 4DUYB 1KYTA 1J20A 3CT4A 1F9AA 4KSCA 3RU3A 3GHHA 2ZZMA 5I9BA 3SD7A 1Y3AA 4L85A 3OT5A 3K1YA 1XOIA 3GVHA 4IDQA 1FVFA 1HURA 1MAAA 1OX4B 3D8NA 4KRXA 4B9AA 4D4HA 5J1SB 4I8XA 2ZULA 3RAEC 3AF6A 1QXSA 5DBFA 2GI4A 3ST7A 1GGMA 1DLIA 1OZHA 2JIZD 2QW1A 3ORQA 4PX2A 1XCOA 2RGBA 3QBEA 4LMRA 2IOFK 3JQAD 5FLXA 1DBSA 1L5FA 1RI5A 3BMCA 3NDJA 5F35A 2KPOA 1NQWA 1RHRA 4BLTA 4R9NA 1ZUD1 3DMYA 1AQJA 3WYEA 4OYHA 2WJYA 1HFEL 4M0UA 2GILA 4QQFA 1F8YA 1UBNA 3DJYA 2Q5LA 4RHFA 2P27A 1NZFA 3EWNA 3JWEA 4CIVA 3N53A 2YY7A 5IAKA 5JYCA 5B7PA 2HF2A 1I51A 3ZVKA 1IY1A 1QHHA 3SIRA 3GPIA 4UW9A 4JX9A 3B9BA 3L92A 2Q1TA 2KJQA 4PCUA 3WTCA 2V54A 2NAFA 2W2KA 4ZI3A 5JJ5A 5KINB 2JHGA 1KQNA 1PX0A 3LFUA 3ZGNA 3GLGE 4H6XA 1VB5A 4NATA 2QTVA 3HKDB 5EHQA 1NL3A 4Q4AA 3SC6A 2CXUA 1KYXA 4IW3B 3I39X 1ODKA 2EZ4A 3TKLA 5KHLB 2OBNA 4EGSA 2F1IA 5JOQA 1GCIA 3CEMA 5I51A 2CXOA 3SJCA 1WD5A 2NN3C 1RS0A 5ALSA 2ZWMA 4CLRA 4LYEA 2IEGA 2PU7A 3CLKA 5IHPA 5J4HA 2BLLA 2HQOA 4M0CA 4XWYA 2JGIA 4EELA 3L4SO 3K1AB 4RGVA 2NG1A 1OFTA 2FG5A 2O5VA 3OWOA 1XKXA 4ZO9A 1U2PA 2J4FA 2W2MA 1VSQA 3FDZB 4OQFA 3KB1A 3QEAZ 2J3MA 5A0TA 4FLFA 3T7TA 3C4VA 5EPUA 4I1RA 1N3YA 1C14A 4NPHA 1P60A 1LLDA 2B4KA 4E5SA 4BVKA 3AYXB 3LXRA 4K8RB 2PUJA 2BHTA 1YOVB 3CUYA 1GZVA 1NVDA 3HKBA 1M10A 3CPHA 2BMVA 2NZ2A 2VHUA 3N8NA 4JR1A 4RQBA 3HXPA 2VT7A 3TSOA 3HEAA 2JARA 1QGDA 3A36A 1WDMA 3B1ZA 3GMDA 3EVEA 5JCPA 2QD5A 4XLZA 5LLDA 1WD7A 2YW9A 1U8EA 2JZOA 1MRZA 3K4PA 1NNSA 1T6NA 3OO1A 1CNFA 1GZSA 2HF9A 4HTFB 5D85A 3U0VA 5CBPA 4BRZA 1V6AA 4N9QA 4RZXA 2XB9A 5DLYA 1XAJA 4RXUA 1PGQA 4I6JA 1GUYA 2AOUA 2ZWPA 3N5CA 4MKRA 2ZZKA 2WF7A 4X6YA 1YAHA 3TZCA 2QG9A 3SICE 4C2UA 4JI4B 4D9CA 1UPAA 5CNJA 3QJGA 5L4NA 2ZWOA 4EP1A 1YZHA 2FFJA 2NADA 1BQEA 3DO6A 2OSVA 3DDZX 2IV2X 5HP4A 3GRRA 3MWYW 4MW2A 1FUYB 3PF8A 5B6IA 1VE9A 3DDCA 3DFKA 4LYHA 3VJMA 1JHYA 2G6TA 2VCHA 3GJ5A 3OUZA 2DPGA 4Z8YA 2UDPA 4IDEA 4IUDS 3E8XA 4LXQA 1ECBA 4IIJA 4Y0NA 3UWMA 1LPMA 1EFTA 3HJFA 3AVTA 5D87A 4QM6A 2RI6A 5C8VA 3CNQS 5D3QA 3CZMA 3DQQA 1E3WA 4LDNA 1I0IA 3V00A 3FSJX 1OH8A 2WJPA 2IKQA 5L7YA 4BO4A 4BRUA 2D4AA 5DGDA 1ZAKA 4X8OA 2WSBA 4LWPA 5DK4A 4WE3A 4EDFA 1KRXA 3SLGA 3UGTA 5MFPA 3W8DA 2JCYA 3QP9A 2OQRA 3MJEA 4NVRA 4RC9A 1Z39A 2I2DA 1BGWA 1UDAA 2R6HA 5IW8A 1KDYA 4P5EA 1QU3A 4Z6KA 2V65A 2QD2A 3CW8X 3A9UA 2OCLA 3SFZA 4ZFNA 1IBRA 2A1UA 3DBRA 3PNBA 2I99A 1BWSA 2O52A 4KPGA 4KXWA 5FORA 5H82A 3RAJA 3RVQA 2DBRA 2W6NA 3Q2KA 4KQKA 1CRPA 3GVCA 3W1EA 1ULHA 4GPIB 4NDZA 2GBGA 2ST1A 1G2PA 2OSBA 4P0TA 2PUBA 1HLPA 1NNLA 2H4HA 3B9RA 2WZCA 4URFA 1C7QA 1VGRA 2G1UA 1RD4A 3DAOA 2PMFA 1JHOA 1K1EA 5IC6A 4LUCA 3NTLA 5EXSA 3I01M 2I3DA 3A6KA 4TOIA 3ZX5A 3U56A 4ZGGA 2AEMA 1TVEA 2WSIA 3CLVA 5TMBA 3H5OA 5BV0A 4KK3A 1H69A 1IC6A 1V41E 3TCNA 3OJWA 4IIEA 3UV6A 3QVMA 4W5NA 1U8AA 2PLFA 1HG1A 2A9QA 3OUTA 1M2OA 4KQJA 4M7WA 4NK4A 3WZMA 5L95A 5IANA 1O96B 4IZIA 3P19A 4FTWA 4H08A 1SBZA 1Z4NA 3NH9A 4GD3Q 4RPJA 4A23A 3PI6A 1T3SA 1EFLA 2M98A 4MVJE 3JWHA 1IATA 3D0KA 3SBXA 3M4XA 1ZUHA 1TEXA 3NVDA 3KYJB 5J2UA 3FUWA 1O58A 4TT8A 1QCCA 3G2QA 1ULZA 2QT1A 4RJJA 4D96A 3U1BA 4NZOA 2FSVA 1U9JA 3L7AA 3RQIA 3AWDA 4C2BA 3ZU4A 2OXIA 1OAAA 3AK4A 4L1KA 1I32A 3BGIA 4NBVA 4P33A 1KO8A 5ILQA 5I01A 4R2HA 4XX0B 1JKXA 4D97A 1XTPA 2JGEA 4ND8A 1LSUA 1VM6A 4G9BA 4BZPA 3HM9A 2PD4A 3NM4A 4JUDX 1KJ9A 3ZDYB 2IGTA 1HK7A 1UDRA 1JSCA 2BZ1A 5H0IA 3S8MA 5KREA 4A4DA 5LOVB 1ECPA 1Z2PX 1VI2A 4TRJA 2JLWA 1WBDA 2YYYA 4DNQA 3K09A 1A9OA 1AN9A 4ZICA 3P2KA 3ZCVA 1X1RA 2ZTSA 3E1KA 4BX3A 1K7EB 4GDMA 2CBGA 2V7GA 3HJRA 4J75A 2IU0A 1N6PA 5DP1A 2VQEB 4G2TA 2WF9A 4UTXA 2A5FA 5F98A 1HV8A 3SFTA 4BRSA 2F3QA 4X91A 4DY6A 2O0MA 1TQHA 1KAHA 2AW3A 2Z3VA 3I2IA 3P9PA 1IN1A 1QYWA 1DC4A 1JHRA 1RM4A 4BNFA 1ZCZA 1IQ0A 3P8ZA 3C6KA 5EMMA 2X22A 4ARUA 1J97A 1TQ2A 1TJ5A 4M53A 3BXPA 3W5BA 1V2HE 2ARKA 5FTMA 3RARA 1CNMA 3BZUA 5AO9A 4B34A 4EEXA 3ZBQA 2IA5A 1O7JA 3HBJA 1MG0A 1NVKA 2QX9A 3DM5A 3BGSA 3HHEA 4HQRA 4NMMA 1UPBA 1KYYA 4PLHA 3UAZA 4LY9A 3EYWA 4MUXA 4RK0A 3FFWA 5G2OA 4RA6A 4UFNA 3WYAA 3ZLBA 4WOBA 1AB5A 3K15A 1P0CA 1BCRA 2ADFA 2HLPA 4MMXB 4ZJZA 2VAXA 1LPAB 4I50A 1G21B 4OKIA 1YVPA 1ZIXA 2XYGA 1IZ8A 4QD3A 4AMZA 4AX4A 4PO8A 2I65A 1DUVG 4DGSA 4V1CI 1OFGA 3OQ1A 1O4VA 3KQHA 1A72A 4ASUA 2YBDA 4QOEA 4WFJA 3MWFA 2X9GA 1KDPA 2JCGA 1Y6JA 3C1UA 3BCHA 3D0QA 1GTRA 3BHNA 1P9LA 5JCJD 3E2PA 4WXPA 3WKBA 5ECWA 5KJEA 4Q7EA 2NXJA 1A8SA 4E15A 2EKQA 1J8MF 4QQRA 4KDRA 3ZLTA 3NT4A 4F6RB 2IDKA 3HXQA 1WXXA 3DYVA 1OC4A 3R7NA 1QZZA 2XRYA 2B4QA 5B58C 3KPVA 4JLJA 3KNZA 2X0KA 4R1NA 5F7OA 3K9WA 3OFSA 4QTZA 3HPRA 3E9QA 10MHA 1YDHA 2EGUA 3U4DA 3FB1A 4YMGA 3MFQA 4FWTA 2QDXA 4OPMA 1H8ED 1JNYA 2H1FA 2WHYA 3JQGA 4E21A 3R5HA 2C2XA 4V0LA 2Z4TA 5TQJA 3W2FA 2CMFA 2EFCB 1AD2A 4A8JB 3G68A 3A26A 1TIBA 1QANA 4IZOA 2JFPA 4B40A 3KQWA 1YMQA 1T5IA 2PZFA 4Q1DA 1N0IA 3M34A 4O5AA 2YV5A 1JAHA 1PFGA 3EYAA 5K4HA 1A2BA 5CA1B 5CDTA 2JHFA 3JR3A 4FN5A 2YFQA 1G2QA 3ABRB 5ALQA 5F1YA 2H5JA 3KJNA 2DFKB 2P3SA 3KVNA 3RIXA 1C4WA 2XOEA 2FG7C 4BVHA 1W25A 3WJAA 4BO3A 1U0TA 3E27A 2W2TA 3F73A 1E2HA 1O97D 2QM0A 2DLDA 3QU5A 2YYAA 4ZOQI 2H2AA 1E5VA 2FEWB 3HJHA 2EX1A 1DEHA 2WFMA 5BURA 1CQJA 3M1LA 5FUYA 5LYYA 3BOSA 3H99A 1ZLYA 1Z68A 2CL5A 1PYGA 3BTSA 4LBWA 3W4JA 1X7HA 1OTYA 1ZA1A 1E61A 4KXLA 5DBEX 5BWNA 2Y1WA 2CVOA 2Y67A 4O4LA 3AKEA 5CAEA 4PC1A 5HNKA 3TSZA 4LJSA 4W5TA 1OXMA 4U00A 1Y7HA 3CF4G 2TMDA 3O8BA 5UKDA 4A8JC 3QPCA 1Q2UA 2JA1A 2WPDD 3T0FA 1IEVA 4R6WA 2P5UA 3SIPA 4AP6A 4URXR 4GRAA 3RREA 4HV4A 5BUSA 4P3KA 4KQGA 2P9YA 4DG9A 4YV1A 1MU0A 5FA5A 4BNMA 1KPHA 1AQ6A 1MB2A 3KG2A 5EZSA 5BR8B 4IXNA 1PK8A 3IOCA 1F14A 1AA9A 5D1HA 3CCCA 4JELA 1TXGA 4NFHA 4PS0A 4GKJB 3CR7A 1N33B 1GT91 5JH7A 1JMYA 3BMNB 3EGCA 4UM9D 1BU8A 2W2OA 4MI1A 4Y67A 3OIVA 5BN4B 1SKBA 3B13B 3QLEA 1V96A 2WAYA 2IHZA 3STUA 1PWZA 4IV8A 3TIXB 3UCXA 1S7GA 2HBQA 4KQFA 5CDHA 4GOND 4HN9A 1N2JA 1Z7EA 2A4MA 2BGIA 1CLUA 3DZJA 2C1XA 1EP9A 2WIFA 2BTOA 4I36A 4KRYA 1R5BA 1I94B 4GP9A 3FTPA 4O63O 4OMFG 2FPPB 2QWXA 3T1OA 1N4AA 1I2CA 2OV1A 4TMZA 4UAVA 4EF4A 2V74B 2HWYA 3FUCA 1M76A 3MS4A 4P82A 1GUFA 2XAUA 3PQEA 4PYIA 5EJ2A 3ZWWA 4CR8A 4GL2A 2VXCA 2E55A 1PLJA 4QOSA 4YJ3F 5KHAA 1KK3A 1KR2A 1NBEA 3A14A 1DT3A 4D25A 3D4IA 4HDQB 2DQ4A 1JIUA 4Y6SA 2H7YA 1C81A 1Y9DA 2O0KA 4O4IF 4PLGA 5CK4A 1GPAA 1OI7A 5ERGB 2B69A 4JLUA 4AN1A 1IDOA 4FHZA 1NULA 3L6DA 3M6UA 5E1OA 5LBTA 4S04A 1U1EA 3G8YA 1DKMA 2XUAA 3IEXA 1NATA 2CYBA 2C57A 4B48A 3ROXA 4I4TA 2WSLA 3KJGA 1JZQA 1JILA 5T8KA 4BB6A 3OZRA 5JAUA 2OB2A 5IAGA 5T41A 3C8UA 3ELYA 2QVBA 4K9NA 4YFVA 1GDDA 3ETNA 4DJTA 1NF3A 2AN9A 2MIIA 3EZLA 1K66A 4N3BA 2HSWA 5L53A 1CEQA 3ITDA 4I0WB 4ISBA 3LG2A 2OYSA 4UNNA 5AW2A 4QRDA 4E5PA 4IHJA 1TM5E 1TKAA 4PWZA 1NT2A 4B2YA 4ZMBA 2V55B 4FUQA 5JSFA 2PQ6A 5IF3A 1KOJA 1WDTA 1CY8A 1G8PA 4NYJR 1S4MA 3A9WA 1Z16A 3JQFC 4KJZA 2XE7A 4M22A 4OHUA 3I9KA 4XI9A 4CFSA 1V45E 1ZI6A 3G02A 2CNNA 3BXFA 2JGAA 2GAFA 1LV7A 2ATXA 2R8ZA 1YUNA 3GK3A 3KFVA 2AW5A 4MEBA 4P86A 1EVLA 3U3RA 4R0MA 1VG8A 1MENA 3O1HB 4LA4A 4AAYA 3Q7TA 1E1QA 4C06A 2R6R1 2FW7A 3LHDA 4Z1MD 4FW8A 3Q8LA 1YUBA 3EGWA 4ASUD 5HZGA 3JYNA 2VQSA 4J3JA 5IDWA 4C78A 5AVTA 3H3JA 1YJ8A 2ODWA 4HZUA 4JZYA 1LSOA 1VJ0A 4WJKB 1KEVA 2FFBA 1BCRB 2ZJAA 4U7HA 3RGWS 4BVEA 2XBUA 1V9CA 2GEKA 2Z30A 3Q85A 2YUTA 3O4GA 1KPGA 3OE7D 2ORIA 4OSEA 5AK6A 3A2KA 3GW8A 3BS4A 3UV7A 3M33A 2QV0A 2WFLB 2PKRA 3ESDA 2BKXA 2Q2VA 5DYGA 3R75A 4A1OA 3W6ZA 5GONA 1JHDA 1P0MA 1R12A 1ZNQO 2YV2A 3PXAA 1N0HA 1JKJA 4J6EA 1GARA 1X7XB 1CX9B 1NTOA 3RH0A 1BQ3A 3CKKA 3OX1A 4HEA6 3TSWA 3N2IA 4B17A 2REBA 1GAXA 1YI1A 4IV0A 3A0UA 2EXXA 3RVBA 3GCZA 4E4TA 3EDCA 4FEAA 3K1JA 5K0LA 5G02A 1KBOA 1EKXA 1MJFA 2WEKA 3FDIA 1ODIA 4H77A 1NHGA 4YONB 4S2EA 3TNDA 3T3DA 1A77A 1U81A 1JG3A 1LCIA 2AK2A 3URMA 3WZLA 1DBPA 2HXYA 3AUTA 3AHDA 4PSAA 5CNKA 4ZRDA 3TQTA 3UATA 721PA 1HDIA 2QAGA 3FJ1A 4IDAA 4O29A 1U7DA 3RRYA 4WKCA 3UT5A 3WP0A 4Q66C 2EC5A 2BH9A 1EESA 3IV6A 1LDGA 2ZJ3A 3BCRA 1KI6A 4MNTA 1ZUNB 4Y6OA 1SD2A 1VLJA 1E6CA 4FYPA 3L84A 2FP4A 4MKZA 4MQ6A 4F91B 5FA6A 3FZGA 3VPGA 1XVLA 1C0IA 2VNJA 3GUCA 4LWZA 4W99A 4FMPA 3DT6A 4YK7A 2VO1A 4X85A 3K9NA 1KY5A 3NC0C 3VR0A 1UPXA 3TL6A 1KAEA 2R2GA 4M54A 2VF5X 3MPOA 5BRNA 1WULS 2CDNA 3RC3A 4E5UA 4M86A 5MFZA 1LZKA 2C82A 4W9NC 5ALJA 5EA2A 5JSKA 2QTMA 3FBWA 1DOAA 1ZM2A 4AY4A 3L40A 7YASA 2HI0A 3L93A 3CLSD 4WBNF 5L3QA 1E5QA 1WSBA 4ZEVA 1LF5A 1R64A 2WKWA 3D2LA 2YXNA 4BX8A 5DTRA 5BWBA 1OH7A 3T99A 3N8GA 2YHBA 4RD2A 1NRXA 4Y1FA 3PQDA 2JA2A 2XSZD 4ZYLA 4FT4A 3IA2A 1SKYB 1OLXA 1KQ3A 4L6CA 1T1GA 2FR1A 1NSYA 4PIVA 5FTKA 3RLIA 5ALVA 2IZOA 4DA4A 3NUZA 3DTVB 3Q88A 3VHXB 2QTVB 3KUKA 1G8SA 3RANA 3DL7A 1ODTC 2HC9A 4P7GA 1QKJA 3AF1A 1P2TA 3NFRA 3O1LA 1MHPA 4BIIA 2RHRA 2GN8A 5KTPA 5IT9A 3LU1A 1GGNA 2QN9A 4B32A 3NHPA 1L8XA 4DPMA 5HX7A 3WLKX 2Z1DA 3LZ6A 1E2QA 4ZVMA 5B1DA 4CF5A 2ZRBA 1XEWX 4ZQCB 1ULBA 4LZPA 3T8YA 3WJ2A 3O73A 4NH0A 2RKOA 2ZIXB 1R16A 3AM5A 4JGBA 4CVNA 5EIFA 2J32A 2OAEA 1RCTE 1AU9A 1IN4A 2P2GA 2QN2A 1EXMA 3E9MA 3I2HA 2BGTA 2XVAA 5AM4A 1UBRS 4R71A 4NHEA 4PXAA 1QKIA 4X5OA 1TW2A 3BIWA 3HEMA 3V3TA 2I2BA 2PVPA 1M2EA 3VPAA 4Y9UA 1MQ8B 5LP6F 2I6TA 3GFOA 4N03A 4HK4A 4ZOLF 4ZCTA 2BFCB 1GTJ1 2AQHA 4HBZA 4RL6A 2YN2A 4RJ2A 3OEED 5EYPB 4B3CA 5JQGA 3PUVA 2D3WA 3OIWA 2WZBA 4BO1A 2GZ2A 1JDBC 1I2AA 1KS2A 2L19A 1IUOA 2XDYA 3TMAA 2DERA 1XZBA 1ZXBA 3AUXA 1XYGA 3HRIA 1QAOA 1YDMA 3PX3A 1LGYA 1K4MA 2DUMA 3LHFA 2WUGA 3O3OB 4UATA 2G1AA 2DWQA 2ZPAA 5LP6B 3IEUA 4GUDA 3IKMB 1KYZA 1N9GB 5EQTA 3RFFA 3V7UA 1KH3A 4G24A 3EEBA 3BFXA 4M36A 2AD5A 2JIMA 3MMNA 4RYLA 4U7TB 3TE7A 3U2QA 1HNXB 3QOFA 1AK9A 3TNYA 2EGGA 2V7WA 3P96A 4JP3A 2IT1A 4QM7A 5C37A 3HJNA 2H59A 1U80A 3INGA 3W5JA 4GZMA 1SBQA 3SZRA 4B3RB 1MB3A 2Y9MB 3AUYA 2FCAA 1N2IA 1FUKA 4JWTA 1Q0PA 2BJVA 2Z0MA 1ABBA 2RG7A 1XAHA 3CSSA 2J48A 2VSXA 2JLRA 2QTTA 1JA1A 1I4EB 2R44A 1P0FA 3A6FA 4P3XA 3BHIA 4IIJB 3ORYA 1HQKA 5ALFA 3CWZA 2VUSA 3NUQA 4WK6A 5CB4F 3LZCA 4NU6A 4OBEA 3LBYA 3KUXA 1RKBA 1YE3A 1G20E 3HB7A 4NOMA 4DJEC 3GLIA 4J29A 1Q15A 5DYIA 4BASA 5IYZF 5HRAA 3NBZC 1JQAA 3G5UA 5SZKB 2DB3A 3FETA 2E49A 4NYJQ 4DEYA 1YA6A 1HDRA 3NKLA 4OI2A 1UXOA 5BR7A 4GQAA 2VWPA 2C4UA 3PVSA 2DPXA 4WEOA 3W2EA 5CB4B 2HQSA 3HBMA 4TYMA 3V2IA 3R44A 1OVGA 2CLFB 5KAPA 3WB1A 4BNDA 2ZB3A 1KZHA 1HLDA 1PZHA 5TQ0B 2NU6A 3KE9A 2C2GA 3SEFA 1X77A 2XNCA 2H4YA 2GEUA 1WUIS 3K5IA 4HOYA 4O4HF 5JSQA 3SM3A 3ND6A 4H0CA 4PYJA 3PNSA 2Q3LA 5JNWA 1GRRA 1P7PA 1Z6PA 2D13A 5B1SA 2IZ7A 1TMKA 3D4BA 1EK6A 3B78A 1BKSB 1HMYA 1JXOA 1TMOA 2C5FA 4G0YA 4KTVE 1SEPA 3DNFA 1CUDA 3RBXA 3PQ8A 2LR0A 5CBPB 5JNVA 4DR7B 1TQ6A 1NU6A 3CNNA 4L57A 2O8BB 1HZZA 1QV6A 4YHHB 3RKUA 8OHMA 1D04A 2B99A 3E9CA 4R01A 3BGOS 2ACKA 5H9WA 1Y34E 2FEAA 2GKSA 4UHBA 3PC3A 3RR2A 2IVZA 2O05A 4YREA 3CUKA 2PMBA 4D81A 4OHWA 1R00A 1ISMA 3EG5A 3QPBA 2CSXA 2JPDA 3DVAA 5JYDA 1QR2A 1X74A 4AUNA 4DCMA 5C4MA 2D62A 1MVNA 1R4MB 2AMJA 1RRMA 2O2YA 3B82A 3D8RA 4G4SO 5HIAA 1W88A 1J6UA 2BFAA 2XUJA 3WHLA 2QNRA 5JZOA 5MGBA 1YZQA 3DM9B 1Z75A 2XKKA 3HCFA 4HFNA 4DBVO 1KMHB 1ECGA 4Y9TA 3WV5A 1O6CA 4MV3A 5HIJA 4I9HA 1NNI1 5MN6A 1ZMRA 5JS6A 2Y76A 3UB4A 5FTLA 1FX0A 4KAAA 5LA6A 5M5BA 2VQ3A 2IPOA 3PDUA 1ZIPA 4LJLA 4WMLA 3ZHYA 2NVUA 5E2AA 1BE0A 1GLGA 4AF8A 4CMEA 2N1MA 2ZRCA 1MA0A 4WCFC 5HMLA 4BLOA 1WABA 3L1JA 3OURA 4Q4HA 4GQBA 3UV3A 2P91A 1FJ2A 1UMKA 5FEUA 2NQTA 4DC1A 4PZLA 5ER6A 2XHEA 4XSVA 2QU8A 5IEBA 3UMMA 1HGXA 5FQOA 4Z99A 4Y1RB 1PTJC 3ZGXA 1UC9A 4OU5A 4U63A 3ZVNA 4PYRA 2JJ2A 2P2NA 2PSEA 2RGWA 1QTIA 4W5WA 2P4SA 2XKBA 3IVRA 4YJGB 5JSYA 3AFGA 1UMBA 5EHIA 2PD3A 3BILA 3D6MA 1N1MA 4A8PA 4ZU1X 2UUOA 5HQJA 5B58T 1ZCJA 3ZWOA 4V03A 3EIHA 4WAUA 3DDWA 2ZUWA 2EERA 1ZH8A 1JIKA 3AT1A 1ULUA 3RI3A 3I64A 5H3LA 3ND5A 1BFUA 1EFPB 1UINA 1J07A 2ZYWX 4ZKDA 2ZTLA 3CLSC 3GYBA 1CV2A 2YS6A 1R3DA 1KZ6A 3CONA 2PT5A 1G8JA 2RJ3A 4LY3A 4UU0A 3AF0A 2C9BA 3PXGA 2W2NA 4BQSA 2O5CA 3KUDA 4PANA 2H16A 3U6BA 2Q9BA 5EE0A 1RWMA 3MN1A 4KQMA 2LV8A 3WVNA 4N0PA 4B31A 2OUKA 5C8XA 3QJYA 1ENYA 2HWUA 1V1MA 3BF7A 2A57A 2IJGX 4C0BA 2XWBF 3K9QO 3N75A 1YUMA 5CCDA 1MMFB 3IPCA 3M7IA 4IGEA 3WOHA 1EWQA 2B3TA 1O89A 4G0PA 4OL0A 1TKBA 1PEAA 1TAHA 1XKQA 2CE2X 1A97A 2QEQA 3VKUA 3C6MA 3W8EA 3M9LA 1KETA 1MC1A 1Y5LA 2R7KA 4WNCA 3JV7A 3LL4A 4DMFA 5REQA 4EEZA 2Z5GA 3UAWA 1MX9A 1ZOOA 2IHYA 3M5CA 2BBOA 1B8UA 1D03A 1U2RA 3QFTA 1R6VA 1QS0A 2Q9CA 2VP6A 3I8OA 1P2UA 2B8JA 1RE0A 2XGOA 3ECAA 3I9OA 3OLQA 3R5XA 4FKBA 3T7EA 3ZDCA 2JBHA 3C3PA 4D3ZA 3AZOA 2EZ9A 3CRRA 3KZMA 3PC2A 1E3MA 1A8HA 3GGPA 4RAQA 3I5MA 3IDOA 1N9KA 1WUYA 3FPLA 3CUSA 1IJEA 5D3KA 3SZOA 4E09A 2CJPA 3NHKA 1E1RD 2ALJA 2JCBA 4E7PA 1ZN9A 3K2IA 4UUNA 4Z0NA 3UJ9A 4HLNA 2H06A 4IILA 2IW3A 1U3UA 4D4LA 4FSHA 4WT7A 2QRJA 3VAYA 2R87A 1U8ZA 1CULC 2QGNA 1XQXA 3D6FA 2QM8A 3GJ7A 4U2CA 3SSMA 3VR1A 3QY0A 1KK2A 1RKUA 3PCTA 5SICE 2OHFA 4OOEA 3PWZA 3L0YA 1NYLA 1YQDA 2ZI7A 3UA3A 2G6BA 3H9EO 3LYHA 3ZIAA 3RUEA 4DNFA 4DQVA 2DLCX 2FETA 1VL6A 3EEFA 3O1IC 4QXOA 1U3GA 2MYPA 5A4JA 3SWWA 4PCVA 1EHYA 3FPFA 3HP7A 4E5NA 2PKCA 1N2XA 2O6HA 3ZZ0A 5AOAA 3EZNA 3UHAA 2WJVA 3L8DA 4DDHA 4GOKA 2CV0A 1NI4B 1U3WA 2DFLA 4EI8A 4BO7A 4ZDIA 1IZZA 2PWPA 1RYEA 1WZNA 3A4TA 2XKAA 4GYWA 4EGAA 2DGDA 4ZHQB 3L05A 2P30A 2ZITA 4C7OB 3ONNA 5FTJA 4I6EA 3FJYA 3FGPA 3LC2O 5FYDA 2JFZA 4MVJM 2ZXFA 1RHKA 5CDFE 3KWLA 3T1HB 1QQ7A 1T5DX 2IE0A 3WI7A 5IK2D 4BBZA 1XVIA 5JTTA 1K4KA 2WSSA 3EZGA 1FJGB 3IOEA 1BDBA 1PGJA 3DTNA 4R7ZA 4GEKA 2B83A 1AGXA 1O6FA 2I6FA 3RM3A 3LVQE 4RELA 2LUOA 4E46A 5AW6A 4WD3A 4Y7CA 2AUMA 3QU9A 5DTIA 1T1EA 4U8HA 3H2KA 3KYIB 4JJEA 1XTRA 5CVCA 3WIEA 4JYZA 1FIUA 4BNKA 2I5PO 3DLIA 3BG5A 4TKVA 1N25A 5FNVA 2IPAB 4L5IA 2P9BA 1WW8A 3CRQA 4RMJA 4TTQA 4G1UC 1KAQA 4B7ZA 4DUGA 4AIIA 4B5LA 2HV8A 1LUAA 4MW0A 2M9MA 4MV5A 5G4KB 4KVFA 3LYLA 2NZWA 5KC9A 3EK2A 3LWZA 2UZ1A 3CGGA 1SZDA 4TLDA 5E1DA 4P4SA 1O9GA 3UANA 3EULA 3P4UA 2C7VA 4I1OA 1HT2E 4HPXB 2OOSA 4MCAA 4YEDA 1LVGA 1CQJB 1SOVA 5HVNA 4JJIA 2BFWA 3GFSA 3OQPA 3DMRA 5DM4A 2XI4A 3JD0A 4TMVA 5K0JA 4OGFA 1MO3A 1T6ZA 3GT7A 4NULA 1SCUA 1QQAA 1AY0A 1SXPA 5IARA 2CNDA 3FMOB 4RORA 4IOLA 4D0GA 4H6PA 4CEJA 1YQEA 4R2KA 1TE2A 1U0LA 3DLCA 4JBHA 4B4UA 5FV4A 3S29A 5ARBA 1GTSA 1BXZA 3AFOA 1MD9A 1Y8QB 3FFTA 3NAZA 2VPWA 3SAJA 1Q17A 1VOTA 4EJSA 3QUTA 2NUPB 3EQ9A 4U39A 1JJ7A 4AYXA 2Y68A 2ZP1A 4FR0A 4XLTA 1EUDA 2CJFA 4K9DA 2PGDA 4CM5A 5I3ZA 4X94A 1KXJA 4HZIA 4ZO8A 3UN1A 5I9SA 1R4NA 4EA9A 1Y6GA 5K8VA 3F9CA 1BMFD 3MMPA 4ME6A 2QRHA 1W36D 1LFAA 1RWVA 3EG9B 3UK6A 4GGPA 3S99A 4NS1A 4HTAA 4JQZA 1CJBA 2Z8ZA 2AGVA 4IKPA 1ZN2A 2ZYUX 2OGSA 1DEXA 2ECQA 1LVUA 3ZC3A 2BFEA 3E9NA 1NBHA 2HCRA 1PS0A 2Y05A 1GN8A 3MWDB 4JC0A 4QTXA 4X8LA 1IXSB 5CLLA 2Z8YM 1TECE 4C43A 2P5YA 1HYQA 4MUFA 4FFMA 1QZUA 1QQ6A 4H3VA 4QO7A 1EI9A 4X60A 4QL3A 3RNOA 4YHBA 2XVXA 3ODGA 2H4ZA 1M0WA 1SC4A 1S2LA 4XD2A 3RVJA 4DSOA 4F4DA 4WNAA 1JFTA 1QGUB 1GV1A 4NESA 3V9PA 4F6LA 3RC1A 2JAXA 3PT5A 3UWDA 3WK8A 1PYOA 1W75A 1EFPA 1UADA 5IRCD 3MS2A 2B4TO 2ISQA 3W5HA 2UYHA 5J5VA 3GUZA 2AYYA 3FWPA 1JL3A 1ORDA 2ZS7A 4AG5A 2NMVA 1Z6GA 3O4FA 2JLVA 1Z8NA 2B6HA 4YAWA 3B89A 5EQJB 2SBTA 4GSKA 4NFSA 3CX3A 4UE3S 4CM3A 4CMJA 1YL5A 3NPMA 5GAJA 4ZVQA 1E1KA 3ESCA 4LRWA 2Q8QA 4KQXA 2CFTA 4TYPA 4TV9A 6REQA 4LYYA 2WG1A 3OAAA 1LDEA 4QYTA 1G42A 1YNOA 3FW1A 1TB4A 2H2FA 5DI9A 3V1NA 1VG0B 2GLTA 1KL7A 2WRZA 2HFKA 5BOVA 2COKA 5JD6A 1QLHA 2X76A 3Q6MA 3ZWNA 4B5KA 1OKKD 1SUPA 3VRHA 1GCAA 3HJBA 1XMVA 1JAIA 3IOBA 4C0AC 3GLTA 4TS3A 2HNBA 1E96A 2OEPA 3PE3A 3RD5A 4RIFA 3B85A 1JFRA 3CG0A 3B7WA 4OSOA 4RD6A 1T8PA 4J43A 4UUAA 2QRVA 3ZVRA 2JEOA 3TG8A 1TA4A 3KLMX 4DA7A 2CD7A 1XLUA 5AH0A 4CU5A 4U5QA 3NBAA 4ZOBA 5IT5A 1KJNA 5AUPB 4MGYR 1HNZB 3A1EA 3DGEC 1T1IA 5JD4A 1NSFA 3HUUA 4R1SA 3QBDA 2WWIA 4KACA 3ITKA 4YLEA 5KYXA 3H2YA 1K8RA 1XIVA 5AHWA 1XR3A 3AZPA 2I6SA 3QYPA 2RGAA 3WLSA 3TGWA 1XKLA 3CZ5A 1XDZA 2FE1A 2QMUA 4JVSB 4RX1A 4E6EA 5JNTA 4CDGA 4QO8A 4WI1A 5GMOA 3KP1A 4X63A 2VATA 5IT0A 1L4GA 1Y5MA 1RRCA 2Z9BA 2X2EA 5TVGA 5A2GA 2GRJA 3R40A 2C92A 1VL5A 3EY4A 2QTRA 2A1IA 2YHAA 2VDWB 3AEKB 4L8GA 1ELOA 3LHKA 3LY5A 1QHXA 2DY0A 4AG3A 1U8YA 4FINA 1M7HA 4MZD