2D59A

Hypothetical protein from pyrococcus horikoshii ot3
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
141
structure length
141
Chain Sequence
TRPIDGLTDEDIREILTRYKKIALVGASPKPERDANIVMKYLLEHGYDVYPVNPKYEEVLGRKCYPSVLDIPDKIEVVDLFVKPKLTMEYVEQAIKKGAKVVWFQYNTYNREASKKADEAGLIIVANRCMMREHERLLGEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of CoA recognition by the Pyrococcus single-domain CoA-binding proteins.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein PH1109
total genus 49
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13380 CoA_binding_2 CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2d59A00
4GMGA 3NKLA 4KOAA 2YV1A 4L73A 3ICCA 3ANLA 3L4BC 4ZN6A 2D59A 2ZJ0A 4CL3A 4BO9A 4Z0TA 4U6SA 4FIZA 4WOKA 4ZRMA 5KJFA 3EUWA 2NVWA 1SEPA 3NDJA 4KTTE 3N74A 2BFMA 2LDBA 2DBVO 5JY1A 3U4CA 1WDKA 1T4BA 3AU8A 2HQ1A 1PZHA 2F1KA 4Y67A 5COQA 3PEFA 2WE7A 1AXEA 4ZHSA 5TJHA 4JNKA 1H6DA 3ROKA 4DREA 1YS4A 2XPCA 1YH3A 3PFWO 4YT8A 3SJ7A 1ML3A 4OQYA 4Z9YA 4MIYA 5IN4A 5LDGA 2RCYA 2BHLA 1R4MB 4N54A 4BGVA 3B1FA 2PKQP 2D5CA 3OJEA 1Q0HA 1BVUA 1NTOA 1ZSVA 2B5WA 2ZK7A 3G0OA 4CMJA 5A04A 2B5VA 3DAPA 3SBOA 2Y68A 3DB2A 3GN1A 1P1JA 2EKPA 3BMCB 3G17A 1DC5A 2IDZA 3PQDA 4MVJA 2FZEA 4J6FA 4R51A 3FI9A 5F3RA 3VZQA 4J4HA 1UP7A 1PSDA 3NTQA 3NTRA 5C3MA 2W98A 3UW3A 2ZYAA 1J5PA 1O0SA 2QRJA 1PS9A 1H9AA 4LK3A 1U2DA 2VHZA 3MJSA 2ILTA 1XWFA 2XXJA 2VUSA 2EV9A 4PLVA 5IXSA 3MTJA 4GBJA 3EMKA 3FTNA 1HZJA 1G0NA 2E48A 4E31A 1I32A 3ULKA 2AA3A 2G17A 2ZCUA 2GZ3A 3AUUA 4GX0A 2JD0A 3WJ7A 4AJNA 4IGEA 4RF5A 4NK4A 4Q39A 1NR1A 3ZWVA 4G5HA 4DIBA 5JAMA 5BSGA 3PP8A 1JTVA 4HP8A 3TL2A 1WP4A 1I5RA 3C7CB 2VT3A 2VYNA 4BNIA 5FEUA 3FSRA 3S2GA 4YAKA 4BKRA 3A4VA 5JDCC 4JIGA 3DEYX 1Q2XA 4FD3A 1KOLA 2E6UX 3ST7A 3OJFA 3GHHA 3ZWCA 1DJNA 3QA9A 1IOLA 4E13A 3GF4A 4DLLA 1Y1PA 4KZPA 5LCXA 5H83A 1GADO 4I5GA 1F8FA 1QORA 4XR4A 2OFPA 3R0IA 1ONPA 3STHA 3Q2IA 2DTDA 4MP6A 2C2YA 3WR5A 1MG5A 3PIIA 2NU7A 5KJCA 3PHGA 3ZHYA 1R4MA 1PU2A 2QZZA 4XX0A 1SO8A 1PR3A 2YHUA 2YUTA 3MJVA 2GO1A 4C4OA 1N8KA 4XCVA 4CLXA 3WBFA 3U4DA 2Q50A 2QRLA 1JQBA 3JQDA 1SEVA 2ZIZA 5KVCA 2FR0A 4KMSA 4D3SA 2EEZA 3KSDO 3QW2A 5THQA 4YBZA 4E3ZA 2NM0A 1DIBA 5LC1A 2NUAA 3QVOA 3D5TA 4QECA 2ZB3A 4Z0PA 3I9LA 1HDCA 1G1AA 3RU7A 3UN1A 4CMBA 1SAYA 2CZCA 4ZQHA 1EBFA 1DOHA 2OO5A 1ISJA 1YDEA 1U1IA 3MEQA 1UDCA 3AUAA 3OP4A 3RUEA 2Y1DA 1Z7BA 2R00A 1V0JA 4CV1A 5JY6A 1E0DA 5L9AA 2DBRA 5HM8A 4GLOA 2YV2A 3BZUA 3QSGA 2WEKA 3KEQA 5JMWA 5ENVA 1R0LA 1BDBA 3OM9A 3I9MA 1E3LA 4OXYA 4XJTA 3PLNA 3QWAA 1EVZA 3PDUA 4RV9A 1GQYA 3GFGA 3ZWYA 1PGOA 1P1FA 4MVJG 3V2GA 1ADBA 1CDOA 4AJOA 1VSUA 4CODB 3JQ8B 4FFOA 4LRSB 1B26A 3I3OA 1RM5A 1NAHA 4CMGA 1VL8A 3AFMA 1MV8A 2CMDA 2X8LA 1IZ0A 3S1LA 3UCXA 5JYDA 4WUVA 4W82A 3DBLA 2JFFA 2G0TA 4AJHA 2VYND 3A1NA 4AJIA 3JQ9C 3WWZA 3INRA 1WXDA 1GYRA 3IJRA 4HKTA 4HNHA 1HDOA 3WMWA 1ARZA 3KV3O 4XZ3A 2VWGA 1HTBA 2IEBA 4JCOA 3I9KA 4K1LA 1YRLA 2Y99A 1NHGA 4OAQA 5DCWA 5FWNA 1WVGA 2BFPA 3EDMA 3O9ZA 4YJGA 1XEAA 3KO8A 3WNQA 4Z9XA 2HDHA 4H16A 1C1DB 1UJMA 2YQ5A 1FK8A 1GZ4A 4BB5A 2BLLA 4BV8A 4RF3A 2VHVA 3OIFA 2IRWA 2VWPA 1V8BA 1NWHA 4Y98A 3OICA 3TFQA 3FPLA 2PD6A 4EEZA 5U9CA 1GUFA 3GPIA 3AI3A 5JFOA 1U9JA 3CH6A 4A7PA 2FN7A 2Y0DA 3UGKA 3RROA 2X22A 2J3KA 3GVHA 2X5KO 3GVCA 1EK5A 3PI7A 2Y05A 2GASA 1R66A 3GZNB 1CYDA 3K2BA 4HFMA 3RWBA 1W0CA 4D41A 3PGJA 4B3IA 3OA2A 5MGBA 4BNHA 1YGYA 5HWSA 5C5IA 2AG8A 1JDJA 1CRWG 2GUGA 3VC7A 6ADHA 3JCZA 3OBBA 2I65A 1AHIA 1R12A 5BT9A 3HB5X 1E6EA 3O26A 1PJ2A 3TOXA 3U0BA 1BW9A 1R4NB 2GERA 4BGIA 1B3RA 4XYEA 1MUUA 4J0FA 2O7SA 5KVQA 1LUAA 1PGPA 3I9JA 3JYNA 4R1NA 3RFVA 4LCJA 3ZW9A 2PK3A 1YL7A 6LDHA 1V9LA 4DC0A 1F14A 4TKMA 2AQIA 5GZ6A 2AE2A 4E6PA 3I83A 3AU9A 2PTGA 2VTEA 3OF2A 5B37A 4XGNA 4J7CA 1MFZA 1E3WA 2FR1A 1X7HA 5ILGA 3BHIA 3TQHA 2QQ5A 4QT0A 1A71A 3P7MA 4Z0HO 4FR5A 3BAZA 4I8XA 3GZNA 5T67A 1B8VA 4J1QA 4L0QA 3TZKA 2DU8A 4YTEA 3VPSA 4MIEA 3A14A 2GRAA 3PJGA 1RM4A 3E9NA 3GA0A 1OMOA 2PZJA 5IJZA 5TGDA 3ZU5A 1CQJA 1B0AA 1ZJYA 1JVBA 4MKXA 4TRJA 2BELA 3KYCA 4CMHA 2Q4EA 1EZ4A 1JAXA 2GZ1A 4WE3A 4WCDA 3D1LA 1DFGA 1P33A 1TA4A 2ZTLA 2H6EA 4F6CA 4IZIA 3HG7A 1X7DA 2PKQO 4XR9A 5G4KA 5TSDA 2VZ9A 3VZPA 1JKJA 3RSHA 3PRJA 3KETA 3UCEA 4O63O 3I4CA 4PIVA 5JS6A 5HS4A 3DBVO 4FW8A 3LC2O 4G2NA 2WYVA 3C8MA 2J3HA 5JSFA 3PZBA 3VOSA 2YZ7A 1E7QA 1XYGA 3DMTA 3IIEA 3LU1A 3PJEA 5IZCC 1U4SA 4DWVA 2P4QA 4HFRA 1HEUA 4CLDA 3JQAA 2OOSA 2HRBA 2FOIA 3LC7O 5A9SA 5AXCA 4B4OA 4Q3NA 1U8FO 2FPGA 3BXXA 5TNXA 1I3KA 3Q3CA 2PD3A 4NG5A 1GCOA 1EDOA 1E6WA 3OETA 3VVBA 3R3SA 4HY3A 1KVUA 1ZZEA 2OGUA 2X86A 3H7AA 2C0CA 4URFA 4IMPA 3S2FA 1E3WB 3ZWOA 1LDNA 1XQ6A 2X9GA 3B1JA 4MOWA 4BQRA 3OIGA 4JK3A 4MVJD 4CV2A 1KVTA 1E1LA 3UHAA 4IGFA 3WQQA 3AM4A 5DDIP 3RKRA 1XCBA 2CVQA 4G65A 2Q46A 4I5DA 4ID9A 5G4KB 5HBRA 4CLEA 1PX0A 2OHXA 2O2YA 1ENOA 3K5PA 4PFJA 5DOZA 3OECA 1WDLA 5DF1A 1DO8A 2C82A 4S3MA 5L4NA 1RYEA 3ETDA 3DONA 1YKFA 5AXAA 3IKTA 1YVEI 5TT0A 1JW9B 1VKOA 5A3VA 2EWMA 1V3TA 3Q1LA 3E48A 5IDWA 4L74A 1EVJA 3E8XA 3TOZA 4DMLA 1DRWA 1OAAA 3C85A 5L53A 4BNWA 1YO6A 1PQPA 4BS9A 2VWQA 3I6IA 1QRRA 3KB6A 4Y6RA 4UAGA 2NVBA 4PG6A 3GEDA 2GF2A 5JMPA 3E18A 3ENKA 3QE3A 1XQ1A 2O48X 3TRIA 2VNSA 3ONEA 1JWBB 3RIHA 4IUYA 4A03A 4FS3A 1K89A 3TSCA 3GHYA 3HB4X 4I5EA 5HA5A 2ZB4A 3I9NA 1DLIA 3WGOA 3AUSA 3PYLA 4A5OA 4AICA 4YRAA 2J5KA 3H9EO 5L7TA 1Z82A 3QY9A 2Q3EA 1GZ3A 2FPPA 1LLDA 1NVMB 3DAGA 3CPSA 2DUWA 3ASUA 4ALMA 1ID1A 4UEOA 4WLVA 1EE9A 3F1LA 4CM9D 2UYYA 3MOIA 1V3UA 1YB1A 3LC1O 4CMCA 4CMIA 5ER6A 3JQGB 4ZQBA 4XKJA 4TKLA 3HDQA 1Y9AA 3JD3A 1B2LA 3NDRA 4IJVA 4JJGA 3WIDA 5BSEA 4P22A 4JJFA 5CEJA 1KEPA 2EERA 4E5KA 4UREA 2P9CA 4I1IA 2O3QA 3IUPA 4OGWA 1ONOA 2AG5A 3GDFA 3BMCA 5JDCA 1HWYA 1BWSA 2PNFA 1ORRA 1U5AA 4WCFA 1OOEA 5C7LO 4NDNE 2NACA 1HDRA 2IYOA 3N7UA 3K31A 3Q6IA 2HCTA 4ALJA 3ADOA 4EUEA 3MOGA 5L45A 3GGPA 4NJOA 5ILOA 1M6HA 1ZSNA 2C7VA 2BGMA 3PVZA 5IZCA 4IQ8A 5IDQA 1MA0A 1BXZA 2PGJA 1C1DA 2NNLD 3D3WA 4FN4A 2Y66A 2HAEA 1NVGA 1OC2A 4OOFA 1GZ6A 4O59O 1AUPA 1XGKA 3DR3A 3M2PA 2SCUA 3I1JA 4GH5A 1KYQA 4R01A 1DEHA 1SMKA 4CR8A 5G4LA 3ZH2A 4JX8A 4JJIA 4Q3DA 2H63A 2BGLA 4U0JA 4CPDA 4AG3A 1C1XB 1GQ2A 1VL0A 3Q11A 5CG1A 4CUKA 4RVUA 4OM8A 5EMHA 4YJDA 1V35A 2X0RA 3H3JA 3W4KA 1I2BA 5L4SA 3BIOA 4YRBA 1WAMA 3I5MA 3QVWA 1I30A 3JQ8A 1DLJA 4WK6A 3JD2A 4IJWA 4UUMA 4EITA 1ZJZA 3DFUA 3X2EA 3L9WA 4W7IA 3VH4A 4YJFA 3H65A 4NIMA 3S55A 3NDIA 3OFSA 1MLDA 1FF9A 1PJQA 1GL3A 3KLMX 4BMNA 4O1MA 4GMFA 4JBGA 5EL0A 1MP0A 4AJPA 2FZWA 1EEHA 1L7EA 2YHIA 3UF0A 3FHLA 4QEDA 5JYEA 3IP3A 2GR9A 2FR8A 3JQFA 3PHHA 1H0KA 5B4VA 4N18A 3D5QA 3WBBA 5A3JA 3WXBA 5KOIA 3WB9A 2CDCA 4L4RA 3EAGA 1NR7A 3VTFA 2IXBA 4NPCA 4PRKA 2EP7A 3OEWA 3AUTA 4PZCA 4CM4B 4J9UE 3GC6A 2QIOA 1NX6A 1BW9B 2Y1GA 1Y8RA 1VJ1A 2BH9A 1D1TA 2Y1FA 3RI3A 3ZDFA 5GZ3A 1CERA 4GGPA 4WGGA 4GX5A 2YDYA 2DAPA 1Q7CA 1G6KA 3VHRA 4CM6A 3SJUA 1PWXA 1KEWA 3ON5A 1ADGA 5A5FA 4E30A 3C7DB 3LF2A 3PTZA 4ND4A 4BNNA 1BMDA 4J9VA 4FGSA 5JC8A 4E21A 3PHJA 5JCJA 4YJHB 2WWRA 3L4SO 4PG5A 2VRCA 1TT5B 1OBFO 4RVFA 4IS3A 1XSEA 1IUKA 4KQXA 1YB5A 3KXDA 2CF5A 4RVDA 5KNLA 4R41A 1I36A 3B70A 4I9NA 1P1RA 2PV7A 4J49A 4R54A 4BO4A 3S2IA 2WD7B 1EMDA 5A4DA 5I8WA 1C0PA 5A05A 3M1LA 3TF5A 3DBRB 3D0OA 5I9MA 1SPXA 4CM4A 4WOJA 3AOEC 3WGQA 4BVAA 2VTDA 2ZTUA 5JAQA 1SNYA 1QXSA 3UAGA 1TEHA 4GGOA 1GDHA 4TSKA 4DRYA 4AL4A 3HZZA 3OHSX 4N7RA 1NVTA 4FFPA 1MC5A 4PG4A 1E1MA 2HO5A 1P0FA 1PGQA 4MP3A 2UVDA 4RORA 4TWRA 5DBIA 1Y5MA 3F6YA 3WG9A 3HNPA 2GDZA 4BMVA 4E0BA 5BNTA 2JD2A 1EDZA 1UXIA 2W4QA 4RCVA 1QG6A 3LT0A 3P19A 3CEAA 4YR9A 2DBQA 3HUDA 5G0WA 5JO9A 1Y9EA 4LGVA 2A35A 3FNFA 3K2EA 5ITVA 5DCYA 3W6ZA 1C14A 3MJTA 3FR8A 4FSHA 1VLLA 4GWKA 4B7XA 2YYYA 4YQZA 1E5QA 2DLDA 2RBEA 1ZEJA 3E6AA 3GEMA 4XWYA 4B3JA 2C07A 5FI5A 3CE6A 2VUUA 3AOGA 5AOVA 1BRMA 5COBA 1HE5A 4XRGA 1U5CA 5G0UA 4A10A 3JQ9A 1K2WA 1LSJA 1VL6A 4FQ8A 3LZ6A 1YJQA 3LT2A 2B36A 4Q3BA 3GN2A 3MTGA 4Y6PA 2X4GA 1ZK2A 4OYRA 1IPFA 3R6DA 3PFFA 3W6UA 2WMDA 1HSZA 1C0KA 2EXXA 3V1YA 5CDUA 4FJ1A 4RDIA 2AEFA 1JA9A 3HHPA 4FGWA 1RKXA 4ZD6A 5F1PA 2FY8A 1E3JA 3H6KA 3GVIA 2HUNA 3H3FA 3QV1A 5TC4A 1LA2A 2ZTMA 1RJWA 2C5AA 4IDGA 4FB5A 3BHMA 1H9BA 1JU9A 1UAYA 3GAFA 5AQ1A 3ANMA 1GPJA 1Z75A 3AY3A 5JNLA 1YBMA 4UVEA 4UVGA 4PG8A 4CM1A 4PRLA 3KBOA 4MKZA 3WJAA 2I67A 4LCEA 3SVTA 2GNAA 2UDPA 4EDFA 4GVXA 1TVEA 4EEXA 4BNUA 1PGJA 5CDSA 1VJ0A 1TB4A 5TRTA 3RC1A 3QWFA 3AK4A 3ONDA 4E5YA 1YQDA 5G0SA 3DTTA 4NR0A 4E5PA 3H9GA 1DAPA 1VI2A 3T4EA 4RPJA 2VOJA 4WLOA 1FDTA 2AE1A 4HADA 1ZXLA 5KJ1A 2Q49A 1U3UA 2JFHA 2I5PO 4JXKA 1FDUA 4CMIB 1UXJA 3JD0A 5DN9A 1DC6A 4J4TA 3VTZA 3INGA 4DPMA 4CM7A 3KSUA 5FF9A 3Q9NA 2NSDA 3N58A 4BO5A 1P0CA 1PJSA 4DIFA 3FRJA 4IPTA 4IQGA 5TF4A 1BHSA 2O2SA 1E7MA 3RJ9A 3WYEA 4HFNA 4KUEA 5KIAA 1NPYA 1I33A 2C5EA 3TZQA 1D4FA 4CLOB 5L4LA 5TS3A 3ADPA 3TWOA 3WYBA 3ZHBA 1ZFNA 4UVDA 3I4FA 1T2CA 4UEKA 2JAHA 3U49A 1Y8QB 4LRTB 3TL3A 3WGIA 1PJLA 1LDBA 4IINA 5DP2A 3LLSA 4AJJA 2IYPA 4OO3A 3GEGA 4U0KA 4WNIA 1JN0A 3PPIA 2BD0A 1LU9A 3OIDA 1MG0A 1MX3A 2G82A 1A4UA 1DIAA 3E5MA 1QP8A 3JQ7B 2CNBA 1LTHR 4OKNA 3HADA 4DTIA 5K9ZA 3VPFA 4CM8A 2JJYA 1DDOA 5U1PA 3SEFA 4F45A 2VCYA 4PCVA 4RJTA 1Q7BA 2GD1O 1CQIA 4TRNA 1SCUA 3SLGA 1N1GA 4BNLA 4EJMA 2PLAA 1F06A 2C2XA 1DB3A 4FPXA 5BSFA 3Q2KA 3NEPX 1KIFA 5EPOA 3LT4A 2DVMA 2HK9A 2JCYA 1UZNA 3AW9A 1DPGA 3L77A 4YEDA 1ZIDA 2YV3A 2IODA 1BXGA 4B4UA 3HFGA 4IXTA 1BDMA 4YJGB 1LQUA 1X15A 3ROPA 4JP2A 2V6FA 4LMRA 4R9SA 2H5LA 4UUNA 4I9HA 3QHAA 5ICSA 1H6AA 4A73A 2HU2A 4IXWA 4EJ0A 1K3TA 4XEHA 4BQPA 4BKUA 4RQUA 4YAIA 4QFDA 4YDRA 3OQ6A 4DA9A 3ZZNA 1LXCA 4EW6A 4IBOA 2VT2A 4XQ9A 3DZBA 4FDAA 2IZZA 2VN8A 5F1OA 2J6IA 3GY0A 2VZ0A 2XF8A 1GPDG 1YOVA 4BNKA 1ENYA 3T7EA 4CLRB 1KEVA 5A9SB 1ZVMA 1E7SA 4BV9A 4I9UA 9LDTA 3DAFA 5BNFA 1CWUA 1EBUA 5G0TA 5CEEA 1IE3A 1XDWA 1VKNA 3GH3A 4RPGA 3E1KA 2EG9A 1UH5A 2WYWA 1N2SA 2NU8A 3M2TA 4NK5A 4LISA 1K6XA 1SBYA 3EGOA 1QYDA 2ZTVA 5MDHA 3ICPA 1JAYA 4AJEA 1SC6A 1U3VA 5B4UA 1AGNA 1Y6JA 2VRBA 1Y7TA 3ZV4A 3NUGA 2B69A 2FP4A 4XGIA 5AVOA 1LI4A 5JCXA 1I2CA 3BTUA 3JV7A 2Y0EA 4HXYA 4IZHA 1CJCA 1FXSA 4K28A 4MVJI 2V6BA 3X2FA 3BMQA 4R5HA 1LLQA 5G0VA 4D3DA 4IDEA 5EESA 4XQGA 5C37A 3ITDA 4OJNA 1KC3A 5L7YA 3OA0A 2BKAA 2DC1A 2GN8A 2I6TA 3VZRA 1ZXBA 4E2ZA 3VAZA 5JBIA 1PL6A 2X9NA 1NASA 1HDYA 4EUFA 1MGOA 4HUJA 1ONNA 4PLPA 4L4SA 3K92A 1IPEA 2EKQA 1L1FA 1PS8A 4QO7A 3MWEB 4L75A 3TZ6A 1UXKA 3R1IA 4IY1A 3KTDA 1FDVA 3BTVA 3C1TA 5EN4A 3ZWMA 1CIVA 4ZU3A 3L6OO 1PL7A 4J90A 4RGBA 3ZGYA 4TQGA 4F6LA 3JQBC 1BVRA 1YL5A 2GCGA 4ND1A 3L4BA 3BMOA 2NVUB 5IG2A 2GZ2A 3E5RA 4GI2A 4KUGA 3A06A 3GGOA 1QR6A 2HLPA 1P45A 3SC4A 3T4XA 2FPIA 1F0YA 2ZJ1A 5ES3A 4LSWA 3UH1A 4II2A 1HKUA 4NU5A 4CQMB 2WSBA 4TVBA 2BGKA 3GUCA 4R16A 5K6AA 4JLWA 4CV3A 1UR5A 1M2WA 1PZGA 1AXGA 4QFCA 3W8EA 3CZMA 3ZWPA 4CQMA 3ZU4A 1EVIA 2HJRA 4DQXA 5B1YA 4BNFA 3DBRA 2Q99A 3UCFA 3GRKA 3UVEA 3WOHA 4B4VA 1BXKA 1DHRA 1A5ZA 4ND3A 4RDHA 3WGZA 5I9LA 2HMWA 3GLQA 3JQEA 4PLZA 2FRDA 2NTJA 3CKYA 4TRRA 3U09A 4I5FA 1ULUA 4U8GA 4BMSA 4Q3AA 4DLAA 4CM8B 1EQ2A 1T24A 2QRKA 2I3AA 1X1TA 1CEQA 3FD8A 2AXQA 1NFRA 2NV6A 4E2XA 8LDHA 2X1HA 1X1EA 4BNXA 1IHXA 1WDMA 2PA3A 2BRUA 3HWRA 3SXPA 4BGEA 1A7KA 4XQCA 4OXNA 5DZSA 1S7CA 1SB8A 3GDGA 3PHIA 4OMUA 3IL2A 1YONA 3ZNOA 5F5LA 3KM0A 4CM5A 1ZEMA 4J3FA 1Y5RA 3ASVA 4NFSA 1RM0A 3H4VA 5KVVA 3FWZA 4E5MA 4HFJA 2P91A 3MJCA 4J7XA 2ZQZA 3W4JA 4LSMA 3BTOA 1XIVA 3IP1A 3ZU3A 1PS0A 3IOYA 4CMKA 3RVDA 1Z7EA 3LT1A 3W1VA 1OC4A 5EQDA 3NGXA 1LBEA 1LNQA 4AJKA 1HT0A 4IDFA 5JDIC 1NQTA 4DQVA 3RC7A 2QW8A 3ETGA 4O0LA 2R6JA 5T6BA 4YACA 1QLHA 1FDSA 4XDZA 1QYWA 4CMEA 3E03A 4FFLA 2CY0A 3SLKA 2ZCVA 4MPDA 3ROQA 3K8ZA 4FC7A 4IJUA 1ISIA 1VE9A 4H7PA 1A9ZA 1O89A 1PJCA 1B3BA 2EF1A 1XKQA 4QO8A 4F3YA 4P38A 4BGUA 2AQHA 3OH8A 4GKBA 5U4QA 2WE8A 2HMSA 3WIEA 3G3EA 3RBZA 2W8ZA 1PIWA 3H9JA 4Q3EA 1C1XA 5I8ZA 4RPLA 4KTVE 2PY6A 1DAOA 2Q45A 2WM3A 3RUIA 1KBZA 5IZ4A 2VOEA 4GX1A 1NNUA 1UP4A 3V2HA 5C7IO 2YDXA 3H9UA 4MVJP 4B7UA 1T4DA 1PWZA 3V5NA 5F1KA 3ZNNA 4EBFA 3QJ5A 1B8PA 1E92A 4GPD1 4HBGA 4WCFC 4YAGA 4RO0A 3TDKA 3JQFC 2XOXA 2RHRA 4ND2A 5IF3A 3WGHA 4R5MA 3WGTA 4MKRA 2ET6A 3KYCB 3WX0A 4DBVO 1VC2A 4QUKA 3DO5A 3UFXA 2Q1SA 3ZWXA 2GN6A 2O3TA 5TX7A 1SZJG 4DYVA 1FDWA 1KY4A 2J5RA 2A94A 1N92A 1E77A 1IZ9A 3P2OA 2UAGA 4MVJE 2QYTA 4DXHA 4Q3CA 1H6CA 1Z73A 2DKNA 3TZHA 1NBOA 1U28A 1NPTO 1O95A 4P4LA 2G76A 2AQ8A 3VPGA 3HN2A 3FCOA 3WS7A 2X7HA 4NNJA 4AFNA 2JHGA 3BTSA 3JQGA 5H81A 4EJ6A 5IAAA 1GR0A 3KOUA 3O4RA 3WDSA 1R0KA 2OORA 4BNVA 4D46A 4OIMA 3ABIA 1XR3A 4LW8A 2JHFA 3DDNA 1UXGA 2D0IA 2EGHA 4A26A 1NXQA 2W2LD 5JDIA 3ROMA 4D0SA 4WEQA 1AE1A 4D42A 4MP8A 1BXGB 3K30A 1NM5A 2X0NA 3DZIA 3QWBA 5EINA 4PG7A 2FMUA 1U4OA 1VJTA 1N9GB 4L4XA 2JL1A 4RVSA 2X5OA 1JWAB 1LRJA 1PZEA 2IZ0A 3W4IA 2HK7A 5JCJD 3PWKA 1TT5A 2VRCD 1E7RA 4OSOA 2PD4A 3DZGA 1DBVO 1PGNA 3JD4A 3DZHA 2PZKA 4J43A 2R2GA 3VPXA 2EJWA 1ZNQO 2Q1WA 3COSA 4ZGWA 1LQTA 4Z9FA 4B8ZA 2A9FA 4D43A 1S6YA 2CUKA 1MFPA 4HWKA 4JBHA 3H2ZA 1NFFA 5FYDA 1Y8QA 3I9OA 3L6EA 3G1UA 1LDMA 4BOYA 2JAPA 4Q9NA 1Q1NA 1ZKMA 4YT2A 3K96A 3PDJA 2E82A 1EUCA 4BO6A 2PH3A 2X58A 3GR6A 5HTOA 5ENDA 1RWBA 5FI3A 4K9DA 2Q2QA 1NP3A 4M8SA 4UUOA 1YQXA 1ZMOA 4E33A 1EFLA 1NQOA 4FOOA 1ISMA 1DC4A 3GVXA 5EIOA 3WWYA 3FNGA 3BMNA 2I99A 3GZ4A 5CPFA 2ZKLA 3NJ4A 2X5JO 5CP8A 5THKA 1ENZA 4DPLA 3D4PA 4BO8A 3AM3A 4ALNA 1XLTA 4BKQA 3PJFA 3RBXA 2W2KA 2NVUA 1ZW1A 3TFOA 4KQWA 2P9GA 3QIVA 2UUPA 1ZO8A 3GK3A 5L7WA 3OMLA 3EVTA 3PZRA 4BNJA 1W4ZA 4J1NA 1ADFA 2BFOA 2X0JA 3NT4A 1IULA 2NTVA 2Q2VA 5L51A 3DOJA 2B37A 3D64A 3JQAB 1SOWA 3DBHB 3RCBA 1O6ZA 5KJEA 3H5AA 4FC6A 1HL3A 5GMOA 2YY7A 3KRTA 3QVTA 4MVJF 1HE3A 4PVDA 1MXHA 2X6TA 3D4NA 3O8QB 5IXYA 2DTXA 3QP9A 2BI7A 1GEEA 2Q4BA 1U3WA 2O3UA 4WASA 1DSSG 1QYXA 1PR9A 1X7GA 4ONEA 4QX6A 1VSVA 5IDYA 4G81A 3IMFA 5J23A 4DC1A 1AN9A 3JYOA 3JTMA 1LDYA 1IYZA 2YFQA 3RUFA 4EZBA 1JVSA 5A9RA 1BTOA 1XELA 3ZV3A 5KTKA 4XYGA 2AMFA 4QTZA 4Y8VA 1J4AA 2P68A 4DGSA 2DT5A 3GQVA 3F9IA 3GUYA 3O8QA 1N7GA 2EIHA 3DZFA 4W9NA 4BNMA 1K6JA 3VH1A 1ENPA 1Q0QA 4YXFA 2CDBA 3DBHA 3QQPA 2PGLA 2OXIA 4R9RA 3UUWA 4ZJUA 3RKUA 3RU9A 3KLPX 2CVOA 4W99A 4BUCA 1PQUA 2CFCA 4RPHA 5KJ6A 4BO7A 2Q1TA 3AY7A 3F5QA 4J2OA 4BKPA 4NH4A 4BNZA 1KVSA 2VYVA 3TZCA 4CQLA 1UAGA 5F21A 1PJ4A 3R3JA 1DXYA 1HYGA 4PLTA 2QX7A 4QSMA 4UUPA 4WECA 2EJVA 2O23A 4NFYA 5EQFA 4CM9A 2A92A 3GNSA 1JLLA 3BMNB 2VYVD 1UDBA 1XHLA 5T8KA 3VKVA 4NBUA 5B4TA 1X0VA 1HRDA 3B6ZA 2PZLA 3WMXA 1B15A 2UUOA 4IIUA 1R37A 2OZPA 4CR7A 3FTPA 2NU9A 4WJZA 2Z1NA 4WLEA 1E7YA 1LJ8A 4ZQGA 5CEFA 4J1TA 3K6JA 4OH1A 1P1IA 4JP3A 1YDWA 3F3SA 5TLSA 3PYMA 4FCCA 3LK7A 3BA1A 5DT9A 3I23A 1YBVA 3H2SA 3C1AA 5B12A 1DIHA 4D0RA 1NQ5A 1T2FA 3HSKA 2VHYA 4WLNA 1K5HA 2V6MA 2IZ1A 3U9LA 1HE4A 2JKVA 2C20A 5JLAA 5LDHA 2EW2A 4FBGA 2GSDA 1EUDA 3WSWA 3WGGA 4RF2A 3JD1A 1MC4A 1PJ3A 1ZBQA 3DTYA 1C0IA 1GU7A 1EK6A 4IIVA 1A7AA 2VUTA 3EZLA 3ZN2A 3LYLA 4PLCA 4GWGA 2AW5A 4E2WA 3CSDA 4ZQEA 2DTEA 4JGBA 4XB2A 3RUAA 3C7AA 1QLJA 1KC1A 1MB4A 4U6QA 1NQAO 1HE2A 3C3XA 2Q1UA 3INTA 3CZRA 1H93A 1Z45A 2B35A 3DXFA 4NJMB 1V6AA 1NHWA 3TNLA 5A1TA 2BF7A 2TMGA 4H3VA 3A28A 5IDXA 3D3WB 2CVZA 2X23A 3CMCO 3GFBA 5DBGA 2I3GA 3H9QA 1M66A 4M49A 5COAA 3ZNQA 4BKOA 5KCZA 1IL0A 5ICMA 1GV1A 2D5AA 4RVGA 5KKAA 3OJ0A 4KDEA 2RIRA 4OSPA 3GVPA 4R1SA 3ENNA 4J0EA 4TRMA 4W9NC 4JBIA 4J2HA 1HLDA 3BYZA 4LMPA 2C59A 4CQLB 3PHLA 4TZKA 2O7QA 4BNTA 1B14A 2O4CA 2Y1CA 1KS9A 4ITUA 1Z74A 1BSVA 2ZYGA 1X14A 2B0JA 3CMMA 5AXBA 1W73A 1P3DA 1GUYA 4FFMA 4IMRA 1YWGO 1WMAA 4DBZA 4LVCA 3DOOA 3KYBA 3B1KA 5CDTA 2DFDA 1GEGA 1HETA 4ILKA 3AFNA 1Z6ZA 3GNTA 3CXRA 2QHXA 2HMUA 1PZFA 2O3JA 4R68A 1P77A 1H94A 2Z1MA 3AOEA 1XA0A 4YYZA 1R6DA 3IC5A 1DIRA 4J7UA 4QXMA 3ZV6A 3MWDB 3RQSA 3RC9A 5A02A 1I01A 4B7CA 1O8CA 4K6FA 2VZ8A 4W4TA 1OZAA 3KSZO 1YQGA 3EHEA 1I24A 2OP0A 3FPCA 3HDYA 3HN7A 4AJ4A 5ADHA 5A9TA 4YQYA 3DWFA 4NI5A 3VDQA 4KP7A 4XDYA 4TMFA 3WLFA 5KWEA 2O3RA 4A27A 1D1SA 5JC1A 2CD9A 2DM6A 2D4AA 2Z5LA 3I6QA 3RUDA 1WMBA 4N5LA 3WFIA 1HYEA 4YCAA 3DFZA 1HZZA 4AVYA 3GT0A 3VPHA 4RF4A 3ZHZA 2Y67A 4GVLA 4TZTA 4XGKA 4UVHA 3WLEA 1BGVA 1E6UA 2J3JA 2DFVA 1U3TA 3SX2A 2NQ8A 4PZDA 1UXHA 4CUJA 4O5OA 1M6WA 5TQVA 4CLRA 1CF2O 4ZQFA 2DQ4A 1X0XA 4TROA 4DMMA 3IS3A 1KETA 3M1AA 5K0ZA 4YT5A 1LEHA 3NX4A 1ZMTA 4FJ0A 1LRKA 4Y9DA 2JCXA 4BO3A 2W2KB 2OP1A 2RHCA 3NT2A 1P44A 4PLWA 7ADHA 3RUHA 3EYWA 2EP5A 4N5MA 1GD1O 2PR2A 3DL2A 1K6IA 1RM3A 4M1QA 3RC2A 3F4BA 1KVRA 1UUFA 3IJPA 1N5DA 4ZICA 2CSUA 3VH2A 4L9RA 1Y81A 3E9MA 3U62A 1I3MA 1DJQA 3K9QO 3C1OA 4ALLA 1YJ8A 4DVJA 4JROA 1I2ZA 2I76A 7MDHA 4O6VA 1QMGA 5G2OA 3CINA 2WD7A 2IEDA 2IXAA 1E3SA 1HDGO 1O9BA 3ONFA 4DYDA 3BMOB 4CV0A 1GTMA 3F46A 2NU6A 2EW8A 4NHEA 3ETEA 3KYDA 4YT4A 1W6UA 3RFTA 2WD8A 1NYTA 3GOHA 1GUZA 3JQ6A 2J8ZA 4YJHA 1M75A 1DFHA 2O3SA 2B83A 3DMTC 1QV6A 3FN4A 3VVCA 3VZSA 2XXBA 5CDGA 3DOCA 1K0UA 1GY8A 1XU9A 4WLUA 1E1NA 1A4IA 4NBRA 5DOVA 4P4GA 3RJ5A 4BO0A 4XD2A 1I8TA 1VM6A 1YE3A 4RLHA 1AHHA 2AQKA 1L7DA 4PGFA 1ZK0A 2EGGA 1B16A 5TJ9A 4D7AA 1DHTA 5L95A 3MZ0A 4LN1A 4YB8A 2FHSA 1U8XX 3L0DA 5I7FA 4CLOA 2P4HX 2P9EA 1N1EA 4I08A 3QRWA 4YAJA 1YXMA 3Q9UA 3AY6A 1ADCA 5T5QA 1J6UA 2J3IA 4IDDA 3VH3A 5DBFA 4YPOA 3DHYA 3D3EA 3QWHA 1ZK3A 3H5NA 1F12A 1EFKA 1IHYA 4B3HA 4QQRA 3ZI0A 3RFXA 4MINA 4JN6B 3NT5A 4CL8A 4J91A 2W2LA 1ZH8A 4TVOA 4NU6A 3S8MA 3ZNPA 3GMSA 1EVYA 3OQBA 4INAA 2QYSA 4AJLA 1C0LA 1A9YA 4NBTA 1A72A 3PGXA 3QWIA 2ZYDA 3GG9A 3PWSA 3BHJA 4E4YA 4E32A 1Q0LA 1UP6A 3LSYA 4M89A 1E3IA 5ER9A 3U4HA 3KVOA 2FWMX 5C7OO 3PK0A 2NADA 1E5LA 1HDXA 5K6AC 4J16A 2H9IA 3WTCA 4CUZA 1E3EA 2GN4A 3AM5A 1LLCA 1VRWA 3RBVA 1XG5A 1SOVA 3JQCA 5BNIA 5JAZA 3CUKA 4RZHA 3KEOA 2YQ4A 4WLFA 3BMQB 3U3XA 1T26A 4PLGA 4IS2A 3NGLA 2Y0CA 1J0XO 2VNAA 1YL6A 1M76A 3H5RA 5ITWA 1LSOA 4HNGA 3JYQA 1FJHA 4J4BA 4R1TA 4YWJA 4OL9A 3OQ1A 4BO2A 3PQFA 3MCVA 3DHEA 5CHEA 5JAIA 1LC3A 4XYMA 1P9LA 1PEDA 2V7PA 3L6DA 2PZMA 2W90A 2VHXA 3KZVA 3ZHXA 2Z95A 1KERA 1YB4A 1T2AA 1E1KA 1T2DA 2C29D 4RVHA 2NQTA 1Q7GA 4IDAA 1GCUA 2V65A 3E9QA 4Z3KA 1H2HA 1FMCA 3AJRA 3GNQA 4ROSA 4HX5A 4E5NA 1J49A 2FSSA 1ZSYA 4XQEA 4GKVA 1OFGA 4BIIA 1V3VA 1XU7A 3WICA 2RH4A 4NBVA 1DRVA 4KDFA 1YOVB 5BQFA 4R3WA 4OOEA 3IAHA 1RPNA 4R3NA 2E4AA 4A0SA 1WNTA 4B4WA 5TIIA 5DNAA 2GGSA 3TPCA 3RASA 5T8KC 1F8GA 1WLYA 1DFIA 5I9NA 5T57A 2TMDA 1B8UA 1ISFA 2C54A 3CIFA 3JQBA 3P5SA 4OHUA 3AI2A 3GG2A 4KUHA 3WNVA 4ESOA 4GX2A 2V6GA 1NAIA 4RPKA 4CR6A 4DPKA 3C24A 3EZYA 4C7KA 2HMVA 4KWHA 3AI1A 5L3ZA 3A9WA 4L8VA 4R4JA 1HXHA 3IUSA 4DUPA 1LSUA 3B20A 4Y6SA 4MVJM 3GGGA 2B4TO 3WQRA 2NTNA 2I9PA 3EW7A 4XRRA 3UXYA 3ANNA 1H5QA 3F4LA 4IJKA 2ZQYA 4K6CA 3HFSA 4CJXA 5CAEA 2BMAA 3WTBA 3FBTA 2BFAA 3NRCA 1NFQA 2DBZA 3JQAD 4OXKA 1GV0A 1P31A 1QSGA 1M67A 4WPGA 3ZV5A 4PZEA 3W8DA 3WFJA 4RZIA 3DZJA 4II3A 2PH5A 3TJRA 3EY4A 1T1RA 4ZVVA 1I3LA 5T64A 4B8WA 2PWZA 4EI2A 5GZ1A 4D44A 3PYXA 4GSLA 3UICA 5A5EA 3NTOA 3PQEA 4MIOA 3ZWBA 1U2GA 2YW9A 2P2SA 3U4IA 4GQAA 1R15A 4AJ2A 2A4KA 3TN7A 2Y93A 2HSDA 5A03A 5HRUA 1E7WA 3LLVA 3O03A 2OMEA 2QZ9A 4BL5A 2WYUA 2PKRA 1TT7A 3JYLA 3IKVA 4E12A 1H2BA 1PJTA 1ULSA 2HMTA 3RAJA 2B4QA 2VHWA 5DCUA 1Y8RB 1CETA 1PL8A 2EKLA 4IM7A 4NZ9A 1JKFA 3G1TA 2G5CA 1ISGA 2OL4A 3RUCA 3GPDG 1LC0A 2GN9A 3K73O 4X54A 3V1TC 4M87A 1I10A 1VPDA 3CTMA 1BG6A 2WJPA 2GPTA 1F17A 4ZRNA 1HDZA 3PLRA 2WTBA 1TXGA 2JCVA 2HRZA 4MJLA 2NWQA 1D3AA 2NLOA 2FSVA 3GAZA 1U7HA 1R16A 3OJOA 4ZA2A 2VWHA 4BNYA 5AXDA 1G0OA 3IDSA 4Z6KA 1KEUA 2QG4A 4UULA 3JYPA 3ZCXA 4D3FA 4Z3DA 1NPDA 5BSHA 1RYDA 3QVXA 1UZLA 3ZWWA 3FWNA 2YJZA 5HS6A 4YJFB 3ITKA 1GAEO 1T25A 2UV8A 1TLTA 5CDYA 1PJBA 1DC3A 3U5TA 1OI7A 4PVCA 4MO2A 4XJSA 4L76A 4XYBA 4WKGA 2G1UA 4ND5A 3D4OA 2HJSA 1GYPA 5JE8A 2CDAA 4H15A 2Y1EA 3NV9A 3DZKA 3HJAA 4GL4A 3DC2A 4CQMD 3OSUA 4D45A 2OBYA 5IN5A 3WYCA 1PTJA 3DQPA 4BO1A 5KKCA 1LLUA 2DPHA 1N7HA 3M6IA 4RQTA 2O4UX 4NMHA 1X13A 2OUIA 3FNEA 4DLBA 1KY5A 4EGFA 1KVQA 3PJDA 5CFZA 3V8BA 4DQUA 4NJMA 4P4NA 4XYLA 1LDEA 4S1VA 1WWKA 4BNGA 1IB6A 3EVNA 3GDOA 4PLHA 4D79A 4PN3A 2BI8A 2B4RO 4RLSA 4BB6A 4FOSA 1I3NA 3GRPA 1R4NA 3G49A 5EJ2A 4PLYA 3F5SA 3LQFA 4C7JA 4E2YA 4OQZA 3HDHA 4FFRA 1WPQA 4IDCA 4OKIA 4M55A 3RD5A 2Y1OA 3F47A 3L9XA 3ZWAA 4R1UA 5KVSA 1WZIA 2X0IA 3ZWNA 1P74A 4CMEC 4XA8A 1D7OA 1B7GO 2LDXA 3AWDA 4DL9A 4U5QA 3S2EA 4M86A 2P5YA 1O94A 3F1KA 3NJ8A 2HK8A 1PQWA 3OEYA 4JQCA 1P1HA 4W7HA 5TT1A 1LX6A 5F5NA 2VQ3A 4XB1A 3WQSB 3HDJA 3NYWA 1HLPA 3KYDB 1NWCA 3LF1A 1EE2A 2POQX 1D8AA 3ZU2A 1EUZA 1JKIA 2P5UA 4YAEA 2Q2WA 1N9GA 1GFSA 4IQ0A 4PLFA 2F00A 5AYVA 4EUHA 1ZK1A 3UKOA 2HKIA 3FR7A 4GLLA 4N5NA 4XIYA 5H82A 4NQZA 2D1YA 2PFGA 2CF6A 1UZMA 5A06A 4MDHA 2JD1A 1T2EA 4GSKA 3P2YA 2DPGA 4YVFA 1EQUA 3PXXA 2D8AA 1DIGA 9LDBA 2AEJA 1T1SA 3PWZA 1WW8A 5DP1A 4W6ZA 4AJ1A 4NFHA 2GYYA 5DULA 1GQQA 2EHDA 4K26A 4EYEA 2J5QA 3D7LA 3DMYA 3VKUA 4BHTA 5CG2A 3HQ4O 4CLHA 4UEJA 1DRUA 3HE3A 3PIDA 1QKIA 4B79A 3MJEA 1YBAA 4CM3A 3FF4A 3V2UA 4MVJH 5JO0A 2E49A 3JQ7A 3QLJA 3QVSA 4WEOA 3WSVA 4A2CA 2OBNA 3W8FA 1UDAA 2AHRA 3EC7A 4CMAA 1WZEA 5L40A 3SC6A 4GAEA 4R69A 4DIOA 2XAAA 1LRLA 1GYQA 4KWIA 3KUXA 5I7SA 5I7EA 4FJ2A 2ZB7A 4YRDA 3OJLA 2D3TA 2ZB8A 1QYVA 3L07A 3FNHA 2WDZA 1ZK4A 2IE0A 1A27A 1ISHA 1R0SA 2RH8A 4XIJA 1LDGA 3WGYA 3Q0EA 5GY7A 3ORFA 1HYHA 1TI7A 4M54A 8ADHA 1IY8A 1ZUD1 3H8VA 5CPBA 3GMDA 4LVUA 3FBGA 3LDHA 1O5IA 3JSAA 1H6BA 3NAQA 1SB9A 1HF3A 2AEMA 1ZCJA 2PGDA 3O38A 3E82A 4ALKA 1QV7A 2X9VA 4NBWA 3IQDB 2JFGA 4UVIA 5JPIA 1HSOA 1MXFA 2DUUA 5EERA 2H1SA 4ALIA 3VDRA 3DHNA 5JXWA 3DBLB 4IDBA 2R00C 2YHIB 2E37A 4F46A 3KHUA 3G79A 3MJ4A 2I66A 5BR7A 4FFNA 3EK2A 4YA6A 3V1UA 2O50A 4HV4A 1P1KA 1W8DA 2RAFA 4J1SA 2GLXA 1C3VA 5IFLA 1U7TA 3ZW8A 5FFFA 3UOGA 3I52A 2ZATA 2YFHA 1I0ZA 2C7GA 3LVFO 4WCFB 4WNCA 1QYCA 5JW6A 4U7WA 5I7VA 3T7CA 2D2IA 1LSSA 4P8RA 4RL6A
chains in the Genus database with same CATH superfamily
1F0PA 2ADFA 1L3IA 4DNXA 5KDDA 3NKLA 5C8XA 1Y34E 5ARDA 1XRSB 1DEOA 1J9EA 2XMSA 3A6ZA 4O33A 4HAWA 2C4WA 2D62A 1KZ6A 3EWIA 4LZLA 4PGHA 3NKFA 3S5JA 1QCCA 3L7AA 5D87A 3TOVA 4D8TA 2QTLA 4RK1A 5DCLA 3LSTA 1XTRA 4FK8A 4UEWA 3P0RA 3K0KA 1A0OA 4C4XA 1J1ZA 2BFMA 2HCRA 2OK8A 1GAQA 2WJZB 4PHGA 3RS8A 2DBVO 4I2VA 4HAIA 4WA7A 2YRFA 4KNWA 2PKWA 3C15C 1MJNA 2Z9BA 2BFEB 4I1YA 1CY6A 5HJ2A 3RIXA 3WB0A 3K6SA 2FYTA 2EL9A 4YCLA 2O7VA 1BA2A 2X41A 3K9WA 4QPJC 4GKKB 5COQA 3ID6C 3SF0A 4JLSA 2RE8A 4MVYA 2OTCA 1WS6A 1ZM2A 2ZBGA 1M2FA 3SHFA 1CNEA 4BPBA 5LSAA 3PFWO 1IXSB 2AKAB 4IP0A 1BMQA 1ML3A 2H5IA 3ENQA 3HHEA 4KO1S 4K6HA 2XTNA 5HVNA 2J09A 3MN1A 2I62A 3EISA 5IN4A 2V1UA 5LDGA 3V4LA 3TLAA 2OOKA 1Z9BA 4EJSA 3V4OA 5IEJA 4JJZA 5H8WA 5C35A 1J8MF 1NM5C 1Q0HA 3G0OA 3QEKA 1WKVA 2DHRA 1KJQA 4HQRA 4NWIA 5AKLA 1T3LA 4CMJA 1R0RE 4HAUA 2Y68A 3SZRA 3GN1A 3QKUA 1P1JA 3IPAA 4F12A 3BMCB 1SUAA 1IDN1 4KREA 2CHGA 4MPJA 1KYXA 4Q21A 4EGSA 1F20A 2IDKA 3SE0A 3DKIA 4EP1A 5LD2C 1MHPA 1T34A 3C41J 3T3PB 3UW3A 4OFZA 2QRJA 5DM60 3KSAC 2YOFA 3C87A 2QEQA 4O2RA 5IJAA 3K0FA 4LK3A 1U2DA 2BBWA 2VHZA 2XWJI 4P4TA 3HJUA 2BSXA 1CJKC 2EV9A 3HXLA 1ZCZA 1F6BA 2R4QA 2RKOA 3AIOA 2I87A 3EMKA 3MTJA 4KO3S 4I4TA 4N0MA 1G0NA 3BH6A 3EG9B 3R0XA 2ECPA 2ASVA 3QX8A 5DTRA 4AJNA 3TRJA 2NUPB 4IO1A 5JALA 1ZITA 1H69A 3AYZB 2FTKE 5HCUA 2Q3FA 4UD6A 2VJPA 3BEDA 3ZWVA 1RI2A 4Q9KA 5C1OA 2IHJA 5AM5A 3V4VB 4F7WA 2QD1A 4PINA 4J0GA 4F2HA 3JW8A 2J5XA 5M2QA 3DMDA 2O8DB 2O1EA 3JWGA 2NZ2A 5TARA 2H3HA 3PVCA 4C08A 4XX1A 4CCYB 3S2GA 4YAKA 2D06A 4KQJA 4YUYA 3OZUA 3DEYX 1B8NA 3NZEA 3H1PA 1WJGA 2E6UX 4IQ4A 4JIGA 4YA6A 5CH5A 2PQ2A 1NU6A 3ZWCA 1JDBC 4F8YA 4KR7A 2VJKA 5H1YA 1IOLA 4E13A 4WTOA 5JD6A 1R10A 1U11A 4NDAA 4XWGA 3W1EA 5LCXA 1SIOA 4QC2A 5H83A 4H1HA 1GADO 1K1EA 2ZVJA 5DHSA 5AKZA 5A3RA 3TTWA 2QAGB 4B6SA 4I1RA 4JAVC 4P53A 1ONPA 4D4MA 4Z1MA 2V6IA 1CK4A 2C2YA 1WXEA 1D2EA 4MZDA 4O4JA 3WR5A 1LK7A 1ZGJA 5EFZA 4ZMSA 3U7RA 1E4OA 3ZJVA 2HPZA 4DB2A 1NZJA 1SO8A 3BGVA 1RCFA 1JAHA 3MWJA 3MJVA 2GO1A 4QYMA 4R6XA 4ZK2A 4XCVA 4C03A 4J0DA 3L1IA 4ZVRA 3JZMA 1CUWA 1JMVA 2CLFB 3CPJB 2Q50A 3I12A 2OILA 3KKPA 3B2NA 4QJ4A 5I7AA 2PYIA 1CJSA 3TLYA 3REGA 1U0NA 3DD1A 5KX5B 1E79D 1H1LA 2PUCA 3C16C 1QGZA 1B93A 1WTCA 3HZRA 3TNFA 2IU6A 2RI1A 2NUAA 3DL4A 3FGNA 4DLYA 1HDCA 5CMLA 1TCBA 1EVQA 3B6JA 3NKVA 1EBFA 1AV7A 4LXTA 5E9JA 2PCLA 5EYPB 4HWPA 2WSLA 2R47A 2HW8A 1X87A 1U1IA 4FFDA 1R88A 2AOWA 2Z8YM 3AUAA 3NHWA 4LE0A 2Y1DA 2N9UA 4FFWA 4MYDA 5AI9A 3O8RA 3ETLA 2VI5A 4OXRA 1Z6XA 3TEFA 5HM8A 3WKDA 2WKQA 3VHQA 1KI3A 4L27A 1PZNA 4YECA 2PJUA 3QSGA 3PEWA 3W3ZB 4ERNA 3KEQA 2RAUA 1R0LA 2VAVA 1Y4UA 2E4WA 1REQB 2XJ9A 3SIXA 3ZDDA 1DE0A 1A3CA 1CCWA 4GYWA 3DBIA 2FZ5A 3PLNA 4CNQA 3ZWYA 3GFGA 1ULBA 1P1FA 1TTQB 2QTRA 3EXHB 3MTIA 3X1ZA 7YASA 1CDOA 4XXHA 4AJOA 1AZWA 1VSUA 3BL8A 4CODB 4KPEC 3D1JA 3JQ8B 4FFOA 3CO5A 2XRZA 3BIFA 5CXQA 3NNNA 4CMGA 1N2ZA 1Q7RA 1VL8A 3SP1A 1RKVA 1MV8A 2CMDA 3QUTA 5TMPA 2BJHA 5JYDA 1ZX1A 4OGKA 2YR0A 3RARA 1JPNA 2X77A 2I2AA 4IIJA 1VHTA 3MWFA 1UKYA 3L0BA 3VRHA 4C14A 3BRWD 4UHBA 1RKUA 3DTVD 2G0TA 3SS8A 4F85A 3A1NA 4TTPA 1E4EB 5AVRA 1AUXA 3LHIA 1WXDA 3SDZA 1GYRA 2YVAA 2EJCA 3PHCA 3UMGA 4EPTA 1CIJA 1XLWA 1VYUA 2XQIA 5DEIA 2ANBA 2CYAA 4QBIA 5ULLA 5KQGA 1HTBA 4JCOA 4K1LA 4MMYB 1YRLA 2ZRNA 1FYFA 5FWNA 1Z63A 1J20A 3NB0A 1FXWF 3VYWA 3KOYA 1XEAA 2C78A 2PUHA 3KO8A 3LI2A 3WNQA 4Z9XA 3M81A 4C4PA 4E94A 4H16A 4GOOD 5ANRB 1EBBA 2I1WA 4Y7CA 3KVRA 2O8VA 4KAAA 2GEDA 4BV8A 3HCRA 2WU0A 2R6CA 2IRWA 1TM2A 2FWIA 1NGSA 4RMJA 1C8BA 4UAUA 1OWPA 4D1YA 4FOLA 3OICA 4LV6A 1TQ4A 3ANYB 3MCZA 4MQEB 3SZUA 3KSBC 4RSMA 5ED0A 1DAIA 4EEZA 4RPCA 4EENA 1P91A 1GTSA 1BYUA 2C9OA 3AI3A 3FZEA 3IGFA 1TK9A 3OIUA 1G9XA 1W581 4MAAA 5EJIA 4DXDA 4ZDIA 4P3OA 3RROA 3TVYA 5D51S 4M1OA 3VOAA 3GVHA 3NLLA 3RGWS 4P4UA 3GLHA 3TR5A 3BS4A 1CYDA 4HFMA 2HQBA 1L8AA 3OA2A 3HI6A 5MGBA 2OLJA 2PL3A 1OW3B 2GUGA 1TU4A 4G0NA 3OBBA 4MS4A 1T2VA 3AIMA 1ABFA 1T5BA 1YR6A 4GOLD 1E6EA 4PX5A 5CLQA 2XNKA 5EVJA 3ZCQA 1Y1KE 1BW9A 1R4NB 3KKNA 3STYA 4DVGA 4ZGBA 2R8RA 2J7PA 4XYEA 2JFYA 5DYYA 1PGPA 2IYFA 2FI1A 4R1NA 5IBRA 3ZW9A 2DH6A 2ZJBA 4OBXA 3GEIA 1FTSA 2BGRA 3N2GB 4R0NA 3NG1A 3U3RA 4C0AC 2AQIA 4JELA 2NUPA 4FFVA 1M8JA 2AE2A 2HCBA 3AU9A 2PTGA 2I3DA 4YX9A 1RWWA 4IFTA 4I55A 4J7CA 1L8OA 2DCUA 3BZBA 4RCYA 5JHHB 1Y4SA 2Q5JA 4IIJB 4X71A 1Y4ZA 1XN4A 2LBPA 2RARA 4ZOLF 4YRIA 4QYXA 4TTVA 4BTLA 1A71A 3O0DA 3P7MA 3O7WA 1AQ6A 1RHRA 3GEPA 4I4IA 1KI6A 1M1XB 1L9XA 4J1QA 4M1MA 3TZKA 1FVXA 1S1CA 3Q10A 4X1OA 2PMFA 3LV8A 3EXHA 4L5JA 4MIEA 1JE1A 5DV9A 5DM70 1RYMA 1AC5A 5K8JB 5LP6B 2QN8A 3GUZA 3TSZA 5K2OA 4ENPA 4G5SA 2WP0A 5C2JB 3HSYA 1VOTA 1YA4A 1K97A 5PGMA 3ZU5A 5IJZA 3O91A 1ZL0A 4BC1A 4O4JF 1B0AA 1UFVA 2GTPA 1ZJYA 4NAVA 1AKYA 4EKYA 4TRJA 4H2DA 1S3IA 3MS4A 1EJ0A 3MJHA 3OMXA 5BW4A 3E70C 1EZ4A 4NESA 1MDBA 4ZTZB 3G0IA 4UASA 1OPRA 1P33A 2PL9A 4FGZA 4Z9BA 1TA4A 2ZTLA 3KT3A 1B76A 4JB2A 3G6WA 4GT1A 2WYOA 3PSHA 4ISCA 3CT4A 2RCNA 3K0CC 4IZIA 3CY6A 2VQFB 1W96A 1A77A 2ZDQA 4UBNA 3N07A 1NIJA 2ZRJA 3JVVA 3HPQA 2XUIA 1JIKA 2EIXA 3IUJA 4UEQA 5G4KA 3X1XA 4XDGA 1XAGA 5C5DA 5A2QA 1FFHA 3W6OA 4L1KA 4DJTA 1FB5A 3IA7A 4R6WA 3KETA 1ADYA 1PX2A 4LXHA 4F9EA 1HA3A 4EB6A 4QDOA 3MNFA 3DBVO 4FW8A 5HS4A 4MQFA 3PC2A 1JU3A 4PYLA 3C8HA 2J3HA 3UBMA 1BJTA 4NLLA 3H5LA 2Y9PB 3VOSA 1ZU5A 5AH0A 1U9IC 4W8GA 3LU1A 4UDYX 5K0SA 1L2TA 2AYZA 3TLXA 3W2EA 2NU7B 2MTBA 4DWVA 3V7FA 2P4QA 3T7SA 4QUHA 2IHKA 4HFRA 4EGJA 1YRYE 2HRBA 3IB6A 3RAGA 5A9SA 1OZHA 1Z2AA 2PRJA 4IH4A 4BXOB 3PQ7A 1EFVB 4RAOA 3KQLA 3KKZA 2P9ZA 1EGHA 1JFVA 4Q3NA 5HK9A 5EKTA 3ICVA 1MR3F 1Y9DA 4QUDA 5TNXA 4F91B 3PXUA 4ZFNA 1I3KA 2R1VA 3Q3CA 4MGEA 4TQUS 5A5DA 1AQJA 2AZ4A 4IDPA 4ND7A 1N33B 1ZZEA 1N57A 2FRXA 3ONNA 1G2OA 5TVKA 1J0AA 1JH9A 1SKYB 2DPYA 2C0CA 4GP7A 4U2EA 2GCNA 2M9MA 3S2ZA 1DKPA 3B1JA 1UC8A 4F96A 5BWLA 2NMVA 1RYBA 1W2WB 3CZ5A 4ZVOA 3O2JA 2OB2A 1R1DA 3P5BA 4ZVLA 1LI5A 1N34B 1EA7A 4KQKA 1QLWA 1E1LA 2YXDA 5F51A 4IGFA 4J16C 4E22A 1Q12A 2BLNA 4D5EA 3RKRA 4ZN6A 4HVAA 3P4XA 1SXJC 2GJAA 2UZ1B 2JA2A 2F90A 3QELA 3V8VA 2XTZA 2C2GA 2WV7A 1G8AA 1WDLA 1OT3A 3QFCA 4LZAA 3VJMA 4AF8A 5AVTA 1TUBB 4M4SA 4BC0A 4PHHA 3EW9A 2GA8A 1JF8A 3OCXA 5JFTA 4FX5A 5EP1A 1LPAB 3SKYA 1YKFA 5AXAA 4GP9A 3Q3GE 2H5JA 5DLQC 5TT0A 1JW9B 5A3VA 2ZUEA 4ADSG 1FUYB 3E48A 5IDWA 3TOZA 4DMLA 1CQIB 5L53A 4BNWA 4C0WA 4HXEB 1Y42X 5GZ3A 3FXAA 1PQPA 2VWQA 3KB6A 4Y6RA 4UAGA 4PG6A 3B6IA 4B47A 5K3DA 1HOTA 1QRDA 1JQAA 4ZYZA 3FROA 4QJIA 3PE6A 4W5OA 2O48X 3PHBE 1RQXA 4ZMRA 2GPBA 1P9RA 4NCJA 2AOVA 1UF9A 1BDIA 1NOIA 4EJSB 1NBMA 1DG9A 2C2HA 4L02A 1JWBB 3RIHA 1MAVA 3YASA 4C20A 4IUYA 2UUCB 1OVGA 1TLLA 1Q91A 2O52A 4NRDA 1K89A 3ND9A 5BN5A 1I9CA 2QVGA 1P9WA 1YUNA 3GHYA 3HB4X 1RXWA 5T4EA 4GO1A 1DLIA 1M0EA 3WGOA 2BKUA 2X0DA 3AUSA 3H42B 3OO0A 3IIIA 1DDIA 3LUJA 5EIAA 3ICWA 3I6ZA 3EVFA 3FAKA 4MV8A 1FJGB 5E8RA 4B6FA 4DCVA 4DRXB 1Z82A 2Q5OA 5EIEA 1D0IA 1XAIA 4WBNA 3MUFA 4UFOA 4BQIA 3B9QA 1L5MA 3DAGA 1GWNA 3CPSA 1Z33A 5CURA 2PS9A 4UUBA 2C3UA 4LFCB 5JZMA 2RFLA 1ORHA 1IUNA 1HOXA 3HYNA 4LPKA 5CLIA 1KRHA 4HNVA 5KTRA 4H18A 3ZD8A 3RVOA 4CF3A 2QTZA 4CMCA 3LC1O 1EGAA 1V95A 4QYSA 4BLWA 5ER6A 1X2EA 2B5OA 4MS1B 4QPDA 5C46F 1EFHA 1RRMA 5GM1A 4XKJA 3LY7A 3DPIA 2XVAA 4G63A 3JD3A 1QIGA 2A1IA 4IJVA 1IHDA 4JB8A 2P3SA 5BN1A 2R8YA 1KO7A 1DT5A 1BQEA 2PSHA 4QG3A 4UREA 5IUJC 2P9CA 4RPIA 4TS9A 3ZI7A 4IHAA 2XIJA 5DNEA 5FBHA 3S2YA 4FHCA 5CB4A 1U7WA 2XGOA 5AVYA 4WX2B 4WCFA 2BGJA 3KZKA 2OAP1 3HYSA 2NACA 4IZ6A 2AX3A 2NO5A 4O3FA 4ZOBA 1Q57A 4KH0A 5CA1A 2JI9A 4ALJA 2IPLA 1QWSA 3ADOA 1NL3A 1Z0UA 3MBIA 4M1KA 4EF5A 5L45A 3BFVA 1BE8A 3WYDA 4IF4A 1FQJA 3I6YA 1J22A 2NP6A 3TQOA 4R0MA 1UADA 2AR0A 4ECAA 1Q0TA 4LF6B 4K9LA 2AFIB 3WDKA 3T5MA 1BD4A 3JATA 4KQ2A 1YI0A 5JV5A 1C1DA 3ETJA 2HLDD 2RKWA 3D3WA 4FN4A 3TD2A 5FNVB 3GGJA 1C30B 3FLEA 3THXA 4Q0MA 2PSEA 1L5HB 4UTOA 2PEYA 2BTQB 2J87A 4Q4AB 2Q8NA 3GAAA 5AICA 2SCUA 1TMKA 4GH5A 4Q05A 4WAUA 3V8PA 5H5JA 3X44A 4CR8A 2REBA 1KP9A 1U7UA 1U2SA 3E23A 1G5IA 3A0UA 3EH2A 3PFNA 4JX8A 3T99A 1JJAA 5I7RA 4JJIA 3PC6A 4Q3DA 5H9VA 1P60A 2BGLA 1E1CB 2GPAA 5F9FA 1C1XB 2JLZA 2FMTA 4GS5A 1VL0A 3FFBA 4MUNA 1D7AA 4CUKA 2ZZMA 3CR7A 4IHKA 4NE7A 1V35A 3K5HA 3U37A 3QKRA 1AMOA 2XY4A 4YRBA 1H2EA 2BSAA 4LZNA 3T52A 1I30A 4UPVA 1JDZA 4ZVKA 2A78A 3UV3A 1FMTA 4WK6A 2VXOA 3JD2A 3L5OA 4IJWA 2QUHA 4KWCA 4EITA 1ZI9A 1UBLS 3DFUA 3L9WA 3DUWA 4Y2XA 5K09A 2BDUA 3UAWA 3WRYC 4YJFA 4F9TA 2YTZA 3RC8A 1RHJA 3NDIA 4FEGA 5GGXA 4D6XA 3M4NA 1MLDA 5G1PA 1FX0A 3BD7A 4EBBA 1GL3A 2NZYA 4PHCA 3QHQA 4EIWA 2O6HA 1K7SN 4O1MA 3TAXA 1GDDA 3QEMB 1N32B 4LGMA 2YZMA 3WP1B 3VI3B 1GSOA 4AJPA 4EY6A 3D81A 5BR4A 2QPTA 1Z56C 1AQLA 1ZNYA 3UF0A 1RQGA 4NU0A 1QQ5A 1YDGA 1JR3E 4P3KA 2PKYX 2D1SA 2ZAOA 2FR8A 4NCIA 4C04A 4EFLA 4NH0A 1VA4A 2CSXA 4N18A 3UAVA 3QBEA 4TV9A 5AW8A 2R86A 5KOIA 3PDCA 2BHRA 4L4RA 5J4KA 4BZWA 1NR7A 4NSNA 4DIEA 4TN5A 2WUWE 2IXBA 5DBHX 5CFQA 4JKIA 5D1HA 1O2DA 4CM4B 5FJIA 4GZLA 3KZCA 1PNRA 3GC6A 3IEIA 4OUDB 4HUQB 4LDQA 4ZAGA 4RA6B 1BW9B 2I7DA 1E9SA 1VYVA 1SXJB 2QXTA 4I4TB 4IILA 4IWNA 4KQFA 4M76B 4PQRA 1YHZA 1EQAA 2Y1FA 3SSAA 3RI3A 3WQBA 2WFAA 3U3OA 4DNFA 6ADHA 2QT1A 3EUEA 1P2SA 3UUFA 1NI5A 1XN1A 4AC9A 3IAM6 3VHRA 4CM6A 4C7XA 4J07A 3FVQA 5TE9A 4EHAA 3K9FC 3KTFA 3QUAA 3PIRA 4HXGA 1ADGA 1NC3A 3LYAA 4MIKA 3DHVA 4ND4A 4FGSA 3ZGNA 2JLVA 2BL4A 4BDSA 4MQ4A 1E0AA 2H59A 3EGCA 4CWAA 2VRCA 2I2WA 1OFHA 4U8HA 3PJRA 2FW9A 1IY2A 3P45A 5EPEA 1IUKA 4KQXA 4RVDA 1T9GR 4XVHA 1I36A 4F38A 1TNDA 2PV7A 2DPXA 3B13B 1KO8A 3R41A 5A4DA 2LZ0A 2C8KA 4ZDJA 2IYVA 2PBRA 2IPXA 3ORYA 4ENTA 5F2NA 3FLMA 3DE1X 4ZYLA 3TF5A 2DFPA 2B94A 3D0OA 5FOWA 4JYZA 5I9IA 4RLFA 4CM4A 1L4LA 1NJ1A 3AOEC 1KJIA 4MVCA 4HDOB 2O8FA 4X8OA 3KWMA 3RDPA 1FP1D 1U0GA 3UAGA 3NC4A 2H2IA 3OT1B 2WHPA 2BGNA 4GGOA 5ALUA 4CE6A 3UJ8A 4EHDA 5KOJA 3M70A 2RGUA 4N7RA 1UEXC 2H0AA 1MC5A 2W93A 1PGQA 1XMVA 2XGGA 3DE2X 3NPAA 3GJ0A 1W49A 4NDZA 2UVDA 1A9SA 1J00A 3MQ4A 4P08A 3EGWA 4TMZA 4AY5A 2OZVA 4TWRA 5DBIA 1PT7A 3WG9A 4BMVA 4E0BA 3KNZA 4FKZA 4RCVA 1TZKA 2E4VA 1QG6A 5CDFE 4JYCA 3PTLA 4IIFA 3LT0A 2Q29A 3NFYA 3ESZA 2Y76A 1QH0A 2DBQA 3K1YA 2ZAYA 1S9DA 1N5MA 3K2EA 3HCWA 1WD7A 3GQBB 3HZHA 1IG3A 1C14A 5D7NA 2HV9A 3MD0A 1FP7A 3PEUA 4YQZA 4PC1A 4AP6A 2VRWA 2RBEA 1ZEJA 3HJGA 4XWYA 2VBFA 2OCPA 4CQNA 2YWGA 1LPMA 3F8SA 2O0JA 4N3AA 3J80A 3BB1A 4UAJA 1OFUX 3AOGA 3OM0A 1G21E 4HLQB 5AOVA 3O3MB 2R1UA 5H3CA 3ZDQA 8AT1A 1L5QA 2BR3A 3NTUA 3OT5A 1BWQA 1OU4A 1S3SA 4GOJA 5TPZD 2JAUA 1YFLA 3Q5EA 1XRJA 3PL5A 5CTJA 2YRXA 1CR6A 1RYFA 3V8EA 1M83A 2NZXA 3V7WA 3GN2A 5LOVF 4Y6PA 2X4GA 4RTLA 2IYRA 2F62A 1QBKC 3OQJA 4IW3B 1KWKA 2OM6A 3FPEA 1BEUB 4N0EA 1CUYA 4LMBA 4RUKA 1YNOA 3EEFA 4FJ1A 4RDIA 4EA9A 2HC9A 2LW7A 4FDLA 4QKQA 1OROA 4NX2A 2IPOA 4FGWA 2HYIC 1C30A 3W90A 1Z4IA 1E3JA 1WB5A 4ZKDA 3STTA 1F4VA 3GVIA 4HWRA 1DAFA 4D0LB 1ODIA 2BN4A 3QV1A 4O2BA 4QD3A 1IHOA 2ZTMA 2C5AA 4DDTA 5L40A 5J1SB 5FNVF 2BR5A 4UUAA 4XDHA 2IUSA 4TKVB 3VU9A 4U4AA 3OOHA 4NBKA 1H9BA 4L07A 4OY3A 4KR3A 5CCEA 2JIDA 3AY3A 2D00A 1YBMA 4PG8A 4X90A 4CM1A 5JARA 5JNTA 3KBOA 4XUCA 2J45A 2I67A 3DDZX 3T1HB 2IUFA 1IZ7A 4HB2A 4LCEA 3GV0A 4EDFA 1KEKA 2QUAA 2ON6A 4EEXA 4GRDA 4LFAB 1GPH1 1P7PA 1T43A 1PGJA 4L8YA 4U7DA 4QOIA 3BBPA 5KO2A 1R8JA 2WK1A 2IHVA 3CX7A 3ONDA 1YQDA 5G0SA 4NR0A 4E5PA 4ITVA 4HDMA 1F8XA 1KYYA 1VI2A 2EBFX 3RSGA 4GL2A 1EFRD 4ZCPA 3DEJA 9MHTA 1GQOA 5CXXA 2AJDA 1I7PA 1BYIA 1USWA 1C41A 2OCAA 8GPBA 4PTYA 1UPFA 2I5PO 3NWJA 5DBOA 4C0KA 4CRWB 3CUYA 1OI4A 3RYCA 1PVOA 4ACAA 3K5IA 3WBJA 4CTNA 2J9FB 1Z35A 2NO4A 1YR1A 3Q0IA 1JIXA 1RAEA 3KSUA 3N2ZB 4MPRA 4TMWA 1XMQB 3Q9NA 4R71A 2O7RA 1P0CA 4KVGA 4DIFA 3PFCA 1PDOA 4ZCQA 1R9JA 1GU1A 1E7MA 4KXYA 3RT1A 4G0UA 4HFNA 5SYAA 4JEUA 1YMVA 2TYSB 2VDVE 4QUJA 4E1VA 4RD3A 2IOHA 3N76A 2CFSA 3BE8A 3LCVB 2C5EA 3OZCA 5CCXA 1N2HA 2VHUA 3MRSA 1IWBB 3G0GA 2W6QA 3TWOA 4F1JA 1J5EB 1PFGA 4F5YA 1ZFNA 4UVDA 5FNZA 1MX1A 3SIWA 1T2CA 3EWSA 4UUQA 2BEUA 2G4CA 4JUIA 4F3CA 4N7MA 4LRTB 1FUKA 1PJLA 1XA3A 1ACJA 3GLKA 2Z2IA 4QVKA 5IJWA 4AY3A 4CHGA 4H3HB 2DXIA 4LYEA 4IMIB 5CFRA 3GMIA 1D2CA 4OO3A 1IXKA 3GEGA 4N47A 1X19A 4P7GA 2E18A 5IMBA 3DDUA 4L4ZA 3Q7EA 1J1IA 2ZRIA 5AM3A 5EKDA 1XTJA 1JR3D 2CNBA 1LTHR 1RZUA 5F73A 1O4WA 1P7YA 2I4RA 1QZZA 3BE4A 4Y9RA 2F4VB 4U7GA 1Q7BA 1F4LA 2GD1O 1J0BA 3I01A 3Q15C 2A0FA 4ENQA 4RJTA 1W29A 1LV7A 2ODAA 2XYQA 3GIWA 4K1XA 5NLLA 4JI1B 1L6IA 1F51E 3RBAA 3WVNA 1YVUA 4EG1A 4PAWA 1KMMA 2I6GA 3LT4A 1WUYA 2JCYA 2ZG6A 3R6WA 3AHDA 1DPGA 5A4IS 2EU8A 3HFGA 4JKYA 1BDMA 3CJTA 3NETA 1X15A 1HI9A 3A4MA 2KWIA 3SI7A 4U3JA 2V55B 1FQWA 5IPFA 2H5LA 4LZPA 5C5CA 2MSWA 3GPBA 3IMCA 3OC0A 4YASA 5ICSA 2O54A 3HO1A 1G4UR 1HQCA 3WXMA 2HU2A 1WSAA 1HNZB 1PYGA 3QE4A 1TZ2A 1NXXA 3IPYA 3QVVA 3B3QA 1S9HA 1SBTA 3KOMA 4P84A 1HQKA 1WCV1 2ZBPA 1LXCA 5DRYA 3F2VA 1AK2A 3U7GA 4LQDA 4NKRA 1IRIA 2VT2A 1SZDA 4OQMA 3FOZA 2XCIA 3DQZA 3TD9A 4M7PA 4IIGA 4CN8A 2GM3A 2J6IA 3GY0A 1CLEA 3G5UA 2VZ0A 4OGLA 2PJZA 3W2GA 2WY2D 3SEAA 3LWNA 4Z2AA 1D9ZA 1ND5A 1XZHA 2M1XA 1YOVA 3SPXA 4BNKA 4DCCA 3T7EA 4CLRB 3MELA 3CW9A 4RTKA 3DXZA 2JVIA 4JP1A 1FMLA 1U2DC 2MYPA 1QMPA 3DVAB 1ODKA 4LEIA 2Q5FA 4JBYA 3P9YA 5DHAA 4G4JA 4EG5A 1K4YA 4MMZB 3TJZA 5B1EA 5EJ4A 3TUJC 1JDSA 4EOGA 2VG8A 1IE3A 3EDOA 2FWBA 4U39A 1U63A 1U7XA 2EG9A 2Z2ZA 3H05A 2QYOA 1N2SA 5J43A 3M2TA 1YK1A 1CF9A 1DVRA 1XDUA 3WGMA 4DE5A 1EGQA 1W47A 3L02A 5EMNA 1MHTA 1IK6A 4OK5A 4HUTA 2OM2A 1U2ZA 1G8MA 2W6MA 3D2CA 2ZTVA 1PP4A 1UBRS 3MTEA 4RIGA 2IYQA 1U8TA 4R8VA 1JAYA 3VZCA 4RGYA 4AJEA 5B4UA 3MGKA 1W7AA 1AGNA 3LHFA 1Y6JA 1HURA 5ARCA 2IHNA 2B69A 2PUAA 1R0YA 5AVOA 3WS7A 1IBLB 4UPDA 3BTUA 4MVJI 2Y0EA 3RWMB 2QV0A 3WNDA 4EFKA 5M04A 1ESCA 1RMYA 2J0UA 3O31A 2AGVA 2V6BA 2QMUA 3DNPA 3X2FA 2RGRA 4D3DA 1NMZA 1CY1A 3LUCA 1N1MA 3OCVA 4M0MA 4PE5B 4BX8A 4DCNA 1N0WA 1XD9A 3F96A 2J32A 3SN6A 1QM5A 2WKSA 2GBIA 4EDHA 3D7MA 2F8TA 3W78A 2JI7A 3I8XA 3WLOA 1KC3A 2VDQB 2OZLA 3H2HA 3NM6B 3RJTA 4OKSA 3I0ZA 5EFOA 2IUEA 2BTEA 4BBAA 2ZJZA 4PQEA 5KTSA 4RNDB 1NXPA 3ICOA 5D00A 2ZVPX 4HUJA 4IWXA 1GNLA 2A4MA 1Q92A 2XYVA 1WOMA 3G9ZA 1R6UA 4JKOA 4J3JA 4XOIA 2EKQA 1XP8A 1XZ8A 1ELOA 1H3NA 1PS8A 3BJMA 3IDQA 3MWEB 2B7CA 3NAMA 3OE5A 3AG5A 3TZ6A 3CONA 3OTQA 5IULC 4FHDA 1K8QA 5EN4A 2WF8A 2C9ZA 3C5VA 3EPPA 3VBCA 1Q50A 1R8SA 3OLWA 3L6OO 4RGBA 1P5FA 1T15A 4ZPJA 4TQGA 1NVVR 1NVBA 3R7LA 3RHFA 3LCUA 4QDXA 5K03A 1BVRA 1L5NA 4CG3A 1ZI6A 3R9WA 1U6KA 2QWXA 3E5RA 4D9IA 3E81A 5L3SB 2J0QA 4EHJA 2W4IA 3TMYA 3UJAA 3A06A 3GGOA 1QR6A 3IKJA 3T4XA 4PBSA 2AFRA 2HY7A 4KXXA 1F0YA 4EQ6B 4LSWA 3UH1A 1TAUA 2LXNA 4P4SA 2GF9A 3FIJA 2BGKA 1ZY2A 4TVBA 3W7AA 4LCBA 2QGFA 1OJ7A 3GUCA 3K1JA 4JLWA 4JR0A 2FG7C 2Z5FA 1P2TA 3AVPA 2G71A 1AXGA 3DMGA 3CZMA 4KXQA 3W8EA 1ESDA 4CQMA 1PK7A 3OIVA 2AD5A 1OH7A 1K4KA 3CF0A 2DWPA 1IXZA 4WBSA 2FPIB 2IH5A 1WCXA 3W5IA 3M4YA 2Q99A 1O6FA 4LBYA 4C4RA 5ELXA 2QRZA 1KZGB 1Z25A 1MZVA 3UVEA 2C7PA 1BS2A 3ILHA 4RDHA 3GLVA 3DDHA 4URHA 5FWAA 3NHLA 4W7SA 2F3RA 2NTJA 3CKYA 1V8FA 1F48A 2BHNA 2BMFA 2YZKA 4LXGA 3IUBA 2VNJA 1K9SA 3FYUB 1ZGZA 1X74A 3N6VA 4NMMA 3UAZA 3UNXA 3WAKA 2DFTA 1BXRB 4FDUA 1EQ2A 3Q8KA 1GPYA 3I0MA 2I3AA 2O8BB 1JSRA 4AZSA 1CJUC 2IIQA 1NFRA 4E2XA 4NV1A 4PGAA 4LNAA 1IHXA 1WDMA 2RGCA 3WZ2A 2PA3A 3IEKA 5FPHA 3MOSA 4Q1FA 1R0XA 4RXMA 5ESWA 5D3ZA 1JTFA 3O3NB 4ZI5A 2BISA 3ZGZA 2R8OA 5DZSA 4NMWA 4DSAA 3PHIA 1NOKA 3O4VA 3ZNOA 4ARCA 2PZ8A 3TLMA 1CY2A 4C22A 3ZQ6A 1J2EA 2I8AA 3RVJA 1IZYA 4GM4A 5CBKA 2ORVA 1ZEMA 4J3FA 5IK2D 2NN3C 5IJ0B 2WJAA 1CEXA 1N3LA 1O4VA 2XNHA 4HFJA 3MJCA 4C7VA 4LSMA 4FI3F 2XZPA 3FHJA 1E62A 2CMGA 3HP1A 4ARUA 1U3DA 4E46A 3HY3A 4F9FA 1GA1A 2O8EB 3IOYA 3N6XA 4CMKA 1K66A 2WKWA 1A04A 3EIQA 3RVDA 4KI0A 4B33A 4D8XA 3ZVLA 1RWOA 1OC4A 5EQDA 4OMFG 1LBEA 1LNQA 1HT0A 5K8CA 2YMQA 1QIEA 1JE0A 4CIYA 2QSJA 1NQTA 4JHLA 1BNCA 1D9XA 4RFSA 1M1NB 2JF0A 3BCSA 4WZAE 7MHTA 5MF6A 3I72A 2DR3A 5GAJA 5T6BA 1HK7A 3MWDA 3HL4A 4AMUA 2JLXA 1FDSA 3SG0A 1LVGA 2HWWA 4CMEA 3PFBA 5D86A 4W9RA 2PKXA 3TTSA 1Z6QA 5GINE 2CY0A 2RHJA 2ZCVA 4QDUA 2JLBA 3NIGB 1AG9A 1N6HA 1NLZA 3ROQA 1KDZA 1JEQB 4FC7A 4IJUA 1JHRA 1OX5A 4P83A 4IFEA 1ISIA 1VE9A 2PT6A 2QUZA 2QY6A 1FFDA 2FPGB 4H7PA 4NYIR 4OI2A 2HHHB 1GO2A 3D3NA 1KDRA 4L72A 4JH0A 1A96A 4QGBA 3I2HA 2A5DA 3KAJA 3BC1A 3AUYA 4P38A 5E1DA 3RG8A 2AQHA 5C8YF 5U4QA 4LJRA 2WE8A 2QR5A 1KQOA 1OBCA 1UKEA 3IKLA 2YMLA 4F5DA 1YVDA 3R4VA 2F8LA 4FD2A 5BSMA 2RGWA 3QPAA 2PYZA 4N82A 4PPQA 2H1LA 1WXXA 2W8ZA 4WERA 4Z54A 4TSFA 2JA1A 3HCFA 1IN5A 2Z3ZA 3RUIA 1SZPA 1XQ9A 1WA5A 3Q6NA 4GX1A 2GUWA 3VU8A 3RS3A 1YQWA 1D0VA 4L08A 2WJ3A 1UFRA 2DT8A 3L0PA 5D2CA 3W77A 4PFQA 3ZNNA 4IMJB 4EBFA 3FPSA 1V1RA 5AHKA 2XMCA 3E7DA 5LWQA 4Z53A 4CIVA 3K8YA 1QK3A 3FMGA 3GUUA 1B8PA 4I55F 4LYJA 5J5AA 1NSYA 4V0ME 3LQ4A 3R2JA 1JHMA 1GZ5A 4YAGA 3B1XA 2ZE8A 4Q6BA 2B8WA 3LS2A 4ND2A 5CYGA 2WJYA 4RSRA 4WFJA 3U7QA 3DLCA 4MKRA 3V9PA 3GLIE 1VL5A 1PT9A 1ZN2A 4YRNA 5CBPA 3HRHA 5K0CA 3ZE6A 1RU3A 4QUKA 2Q1SA 4R7GA 4PC6A 2GN6A 3IUEA 2ZRMA 3T3OA 4UDNA 2O3TA 5TX7A 1SZJG 3LUKA 5TEWA 1FDWA 4KU4A 3NNDA 2BJVA 4Z5XA 3CW8X 1UBEA 2A94A 1N92A 2ZPTX 3N59A 5F7XA 5IKXA 1E77A 1JDPA 5ECDA 3SJAA 1KRXA 1EDDA 3OI7A 1IZ9A 4P7JA 4TXJA 4ZIRA 2W8BA 3S5UA 1G60A 4LK2A 4YO8A 4AXXA 4QATA 2GEFA 3D8TA 4FFSA 4JR2A 2R8EA 3P0EA 3TXXA 1NPTO 1O95A 2X8AA 4P4LA 4Z4IA 2G76A 3VPGA 4PCAA 4QM7A 3HN2A 1Z5OA 5IBQA 1WM1A 5H81A 3M6LA 2QTAA 5FPTA 1IMJA 5HQJA 4EJ6A 3PUZA 3OFKA 4B3RB 3KJXA 4DCTA 3O4RA 1AKRA 4P33A 3WDSA 1CD5A 1L7VC 2OORA 4DIMA 3PDWA 4OIMA 2QJFA 3ABIA 1ZS9A 1IU9A 3CX4A 4P7FA 3DDNA 2F9LA 4WXYB 4MWDA 1WSWA 1KZ9A 4FE3A 1RE0A 1QUFA 3ROMA 4DR6B 5JRDS 4FBLA 4X1IB 1AE1A 1GG5A 1GSAA 1L7XA 1KJJA 2YN2A 5FA8A 4D42A 2NXJA 1QX4A 1YA8A 1TM7E 2G88A 2ZDGA 4EI7A 1VYHA 3OE7D 2OQRA 4LXXA 3V55A 1XTSA 3AERA 4Q15A 1H0HA 3OZGA 1U4OA 4GBED 4RVSA 1TQ2A 3TBHA 3DEAA 1FFBA 2VP9A 1GQRA 2IZ0A 2OPBA 3CPHA 3W4IA 5FWXA 2VRCD 5BNWA 3FTFA 4JI2B 4G5RA 1O96B 5FBVB 3IIJA 1ECJA 1KDPA 3COVA 3DZHA 3JD4A 3KVVA 1DP4A 1RP1A 2R2GA 3RW9A 4AK9A 4OV6B 1LQTA 3L41A 3RHTA 2XOEA 1EWTA 4L85A 3W7VA 1KPHA 2A9FA 1QU2A 1APBA 3NAGA 3O2QB 2VK2A 4BB0A 3EXIA 2YIVX 4U02A 2CUKA 1MFPA 3U16A 4YIHA 2CXTA 1VFNA 5DXAA 2BDTA 2DJ5A 3H2ZA 5FYDA 3T3DA 3G1UA 1LDMA 2IX3A 1ZOLA 3JQQA 3NIDB 2V7EA 2P2LA 4Q9NA 5DTJA 4ZVUA 1K5PA 3HB7A 4TV8B 3UFBA 4YT2A 2BMEA 3L7JA 3NTLA 3PDJA 3PX3A 3FTEA 3IEUA 3S0JA 5HKOA 3VHXA 2TMKA 1O6GA 2ZU6A 2JCSA 2Q4RA 2BEWA 3TCXB 1T6NA 1E6LA 1QAOA 3R7AA 3GAMA 2JH3A 1T2NA 2IYZA 2NXWA 5ENDA 5EMJA 3S40A 4X65B 3F2IA 2Q2QA 3JSXA 1WLSA 4NICA 2PMBA 1EWRA 2ACEA 2GFQA 2JC3A 3I37X 3QU5A 3LC0A 1COWD 1NQOA 2CE2X 1ISMA 2RG1A 3KKKA 4YJ2A 1KIMA 3JS5A 4EVRA 3FNGA 3VYUB 2I99A 4A5SA 1X6VA 3AKEA 2CW5A 2ZKLA 4WKBA 4Y1FA 3CLRD 4OHZA 4BO8A 2WTNA 4MR8A 1XLTA 3ZZ1A 4CIBA 3RBXA 2W2KA 3QVGA 3NANA 4KQWA 3TQTA 3BCUA 4OQXA 4PZZA 2HA7A 4K6OA 1ZO8A 3GK3A 1FX0B 2PWYA 1AO0A 3OMLA 4BWVA 4FNAA 3PZRA 4BNJA 5KYNA 1VMKA 2YMMA 3BFPA 3E4CA 2DPLA 1H8HA 2BFOA 3DWEX 2QDKA 3NT4A 4J1NA 4DBLC 3MWEA 2Q2VA 2HJGA 3DOJA 1DWOA 1O9GA 2B37A 2NW6A 3Q7IA 1SOWA 2PIDA 4UW9A 9ABPA 3ZLJA 1GVNB 1ORTA 1XDBA 3OTHA 4M3NA 1E6CA 4U7JA 5DMXA 2JK0A 1MXHA 2ZT5A 4MI1A 4UHCA 3QJGA 1VXOA 1OZGA 3CH5A 4OMCA 1EFCA 3I5YA 1RRGA 4FYXA 4WXHA 4B3FX 3ZV7A 4DW8A 1GEEA 5K4AA 3O3OB 1E9RA 1QDEA 2Q4BA 2X1MA 5AI4A 4ZALA 1HYBA 1VSTA 1YFZA 1QTQA 2XOKD 4H35A 4HCJA 1PR9A 1X7GA 1OWNA 2ORWA 2XBUA 3IOMA 4ONEA 3UAOA 4DA8A 4DC1A 1E3MA 4EB0A 2HDNB 4B6PA 1IYZA 2CNDA 2QVXX 4N5DA 3I6MA 2ERYA 4E08A 3TB6A 1JVSA 5A9RA 2ZVDA 1PYOA 3FWYA 2VJNA 2DBYA 1WUTA 3BRWA 1RWXA 2VPXA 4H0F