2D5DA

Structure of biotin carboxyl carrier protein (74val start) from pyrococcus horikoshi ot3 ligand free form ii
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
ENVVSAPMPGKVLRVLVRVGDRVRVGQGLLVLEAMKMENEIPSPRDGVVKRILVKEGEAVDTGQPLIELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Lipid binding protein,transferase
molecule keywords methylmalonyl-CoA decarboxylase gamma chain
total genus 12
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 2005-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2d5dA00
3PV0A 4DNRB 4OO1H 1TKWB 3D4RA 3QG1A 2D5DA 4G7ZC 2K32A 4DK1A 2ZT9C 1Y69U 2K7VA 3VR4A 4TKOB 1YNJC 2CW0C 1Y8PB 1OXUA 2O5IC 2JE6I 2DN8A 2A69D 2O5JC 3OW7A 1TU2B 4I7ZC 4XIGS 2A6HD 2JEAI 2EJGC 1HPCA 1V43A 2QF7A 3AB9A 4H44C 2A69C 3SE0A 4JBWA 1K8OA 5K36H 1VCIA 1GUTA 3BG3A 4KI0A 4JK1C 2KCCA 4OGQC 3QIAA 1B9NA 2JEBI 3LNNA 3PUWA 3PUZA 1OXVA 1HQMC 1E2VA 1FR3A 2AWOA 1DD2A 1O78A 2BE5C 1G291 3VR6A 3VR5A 1Q1BA 3GQBA 5KNDA 3ND8A 1GUSA 3RLFA 3IFTA 1I6VC 3HGBA 4RCNA 4L8JA 5BN5A 2PPBC 4IFDG 1PMRA 1YNNC 4IQZA 5BN3A 2A68D 3A8KE 4BA1I 2PCFB 3D31A 4H0LC 1B9MA 3M85A 2B8FA 3P20A 1CTMA 4KKSA 3VR3A 3L7ZC 3SDZA 4KKUA 1Y8OB 1E2ZA 3A8IE 3MFYA 4KN7C 3T53B 1HTPA 4LJZC 1GHKA 1HCZA 2Q8IB 1FYCA 3A7AB 3FMCA 1CFMA 4KKTA 3M4YA 3A8JE 5BN4A 2DNCA 1IW7D 1CI3M 3PUYA 4PV1C 1IW7C 4DK0A 4OO1G 2L5TA 4GZYC 2E75C 3NE5B 4XTCS 4G7HC 1V8QA 3IKJA 3W3AA 1LACA 4H13C 2A6EC 3DXJC 3CRKC 3I72A 1Q12A 1Z6HA 2R6GA 3MXUA 1GUGA 1OXXK 2A6HC 1VF5C 3TZUA 5C0XH 3ND9A 4IFDH 1DCZA 2F1MA 4TQUS 1EWHA 1Y8NB 4KN4C 1OXSC 1Q1EA 3VA7A 2A6ED 1K8MA 1SMYC 2IT1A 3OOCA 2D2CC 2V4DA 1Q90A 1OXTA 3PUVA 3OPOA 3N6RA 5K36G 1IYUA 2BE5D 1GUOA 1GHJA 2K33A 2DNEA 3LWUA 1ONLA 2EJFC 2JXMB 3QJYA 3WDNA 1H9JA 2PNRC 1QJOA 3CRLC 2LMCB 3M7NA 2E76C 4KHZA 3GD7A 5A35A 1IYVA 1VF7A 2A68C 2BA1A 1H9SB 4LK1C 3I4LA 1BDOA 1DXMA 3BDOA 1T5EA 2B8GA 3EQLC 1GJXA 3T51B 3U9SA 1VDZA 2EVBA 3VR2A 2KA7A 2BA0A 1O7LA 1LABA 4HR7B 2E74C 1H9MA 2D62A 3KLRA 1GUNA 3T56B 1H9KA 1A6XA 2YYZA 4G7OC 3H94A 5JEAG 2AUJD 2NN6I 4KMUC 4BA2I 2NN6H 3FPPA 5C0XG 1E2WA 2AUKA 2EDGA 3PUXA 2EJMA 4DNTB 1H9RA 3I73A 5KNCA 2NN6G 3A7LA 1Z7TA 5KNBA 5JEAH 2BDOA 1ZKOA 1H9SA 1ZYRC
chains in the Genus database with same CATH superfamily
4DXGA 4DK1A 1Y69U 1L2FA 2NVYB 1XPRA 1FNVA 1JWSD 1Y1VG 2RVLA 2O5IC 4BBRH 3OW7A 2Z8LA 3I56A 3G71A 1G6ZA 3HOVG 2PNHA 1JJ2A 4CDFC 1YNJD 4HMJA 1BCPD 2VS1A 4ZYSA 3T1YL 1UEAB 1YJ9A 3BVZA 4CKCA 3CF5A 2B2YA 1QUQA 1EYAA 2LXKA 3ONAB 1SNCA 1XPOA 5EJWA 3STBD 2WACA 2F0VA 1E2VA 2B2WC 3J81i 3QO2A 3CCMA 4WJ4A 3LGJA 3HGBA 2IY5B 3SGIA 1W3SA 2JSOA 1CTMA 1JOQA 2F0LA 5IE8A 1XMOL 1FNUA 1IHZA 5CC4A 2M00A 1EIYB 3HOVH 5EQ0A 4DK3C 2F3WA 1MD2D 5LL6S 4J1MA 4BBRG 1II3A 4A3IG 1VQIA 2K03A 3URYA 2DNCA 1PYWD 5IGDA 1HZCA 3KYHC 4KD3A 2HUGA 1GO3E 3EFXD 3CCJA 5IODA 3KJPA 1U4LA 3UDIA 4YHHQ 3HOXB 3E6ZX 1MSHA 1YBYA 2PQEA 4M1UB 2RBMA 4UPAA 3B6YA 2JA6B 3OOCA 4EX5A 1OXTA 1C4QA 1SYEA 2L0CA 3Q6SA 2V1CC 1KC8C 1AW7A 3W1BA 3I90A 3NTKA 2NVQH 4GKKQ 4NXNQ 2F0FA 3FPUB 3KJOA 1TS2A 5AJ3Q 3G48A 3EVQA 4C3JB 1K28A 3K7AH 1IYVA 3I4MB 1X3FA 1RJTA 2UUAL 3T51B 3S2HB 1O7LA 4B3SL 1QVFA 1CHQD 3T56B 3PQIA 2KUMA 4ZKCB 2BOSA 2NVTH 4DR2Q 1E2WA 2EDGA 3PSIA 3JAML 4OL7A 2OEOA 3X3MA 1H9RA 1R4QB 3S9WA 4GNXC 1HJPA 2X6LA 1VMCA 4LF9Q 2K32A 4ID6A 3F8TA 1B3AA 4DR1Q 4DR4L 5IGEA 4FNFA 2E2JB 1VQPA 4IALA 4A3MG 3KF6B 1AFPA 1NJIC 1BBXC 3R8BA 1HTLD 5JPNC 2ENBA 4OONA 1I4GA 5LL6X 4A3CG 2E2JH 4ZLTF 2AQ1B 4C2MH 1V1OA 3O13A 3MXNA 5H1SE 1BUVT 1FR3A 1JR0D 2F03A 4RMFA 4RWSC 4QIWB 4TVAB 4ZKBB 2RSNA 1TT2A 3TRZA 4LFCL 4YHHL 1E24A 4RKLA 4DU9A 4C3HH 1I4HA 3VYTA 1UNSA 2L12A 3I91A 1SSOA 4DV6L 4KY6A 5EKIA 2NTSA 1E2ZA 4JI2Q 3BZCA 1KHIA 2BH8A 3HOYG 3MZ5A 5EKKA 1XYIA 1E1OA 3PUYA 1SNPA 1EOTA 3U58A 4IURA 5C3EG 1M1KC 1BBWA 2HQLA 2I46A 2VQEQ 3C46A 4DAVA 3CCSA 4H13C 1NY4A 3CD6A 1GUGA 5FOBB 1L1OA 5C0XH 5IGFA 3CCLA 1S5ED 2KHSA 3OSOA 4R4TA 1LTAD 5CV5A 3FDTA 5DLQE 1PYBA 2DGYA 3KF8A 1ET6A 1GVPA 4JI6L 2N3SA 1MIUA 3PMFA 4AQYL 2DNEA 1XMQL 3NBHB 2CFMA 1A3UA 2E76C 4LF6L 5JOBA 4QCLA 1FNWA 1QZGA 4KV6A 4MHEA 2UXBQ 3U9SA 1VQEA 1GKHA 2EVBA 4OXPA 4LF8Q 4X6AH 1O7IA 1TXYA 1A6XA 2YYZA 3J80i 5JEAG 1B44D 2NN6H 1JB3A 5ELNA 3BZKA 4X66Q 4L63B 5ELCA 4GNXA 5KNCA 3CKIB 2IX0A 4DUYL 1ILQA 3U9OA 3T13A 4K8JA 3J81L 5M3FG 2KOLA 4A3MB 4DNRB 5KRUA 1EYCA 3H09A 4LF5L 4HIMA 2E2HH 2Z9HA 1XMOQ 4A76A 3DWAA 2EJGC 1PRTD 2CW0D 2R92G 3HOYB 1D5XC 4A3GH 2I5MX 4N8X1 3SHLA 2UXCL 3ULPA 3TS0A 1EY8A 2B63G 2ICEC 1B4OA 1Q8IA 1HQMC 4LW1A 2A1AA 1T5XD 1PZJD 2KVMA 1KLGD 1W6JA 5D65A 1Q1BA 3I4NH 1ICFB 3RLFA 3KLWA 5A2QE 4QIWE 1HR0Q 4K2LA 5DM63 1ENAA 4JW0A 3M85A 5E3FA 3R2IA 2JK8A 2HCIA 3D8GA 4B08A 4RKBA 1QE6A 4QGUA 2B2VC 4JC0A 1WTQA 1XJVA 1HCZA 4HJ5A 3HOZG 2BDNA 1STYA 3NENA 3PO3B 2VY3A 5E4WC 3S14B 1TS5A 3NE5B 4G7HC 1K0SA 2FJ2A 2JJQA 1DYQA 5I6WA 4Q0FA 1S5BD 2B2UC 4RFBA 1TWAB 2NUCA 2ZM6Q 2NWGA 2QW7A 3M3YH 1EWHA 5EPJA 2A6ED 5IP7G 2ZJRA 3P1HA 1EQVA 1CKNA 1GHJA 2K04A 2Q8RE 4A3FG 2AQ2B 3NXWA 1LTID 2B8GA 3I70A 2KBNA 4CJ2C 3P75A 4YWLA 4IFDI 1C48A 1SMXA 1PA6A 1LABA 2ZXPA 3DWQA 1GOZA 1I3QB 5EPKA 1LTSD 1UEBA 2R7ZH 4G7OC 3OWEB 4R4IA 3VA5A 3ERSX 1PH8A 1YHAA 4G57A 1TWFB 4UDUC 3R2TA 4F7XA 4NMZA 4KD4A 1LV9A 2F3VA 2BDOA 5E1FA 3HOWB 1TKWB 2IX1A 2EZVA 3C2PA 4TKOB 3UDFA 3HOXH 3HOUH 1OXUA 3NBIA 2PO4A 2UUAQ 2A6HD 2H5XA 3QOJA 4DV7L 3S14H 2L1BA 2F4VQ 1DJRD 2GN5A 2A69C 1P16A 2E2IH 4JK1C 2R93G 2J0TD 2OT2A 1RF2D 4BY7H 1BNZA 4L5SA 2KECA 1I4PA 1CKMA 1ML0D 2DJFC 5JEAJ 5M3MH 4A3FB 2PMZB 1TWHH 1EL0A 3QR8A 1WVLA 4B3MQ 4DR1L 3KBXA 2MP1A 4PZ6A 1KLUD 3NP8A 4PMWA 1KDCA 1T9HA 3HKZG 3CCRA 4KKUA 3RD4A 3F2UA 4S3SA 3A8IE 4PZ8A 4JI6Q 2OF1A 1QUQB 5GADC 1VQLA 1XNRQ 1KIXA 4AQYQ 3HOYH 1MI2A 2R7FA 3M4YA 5T1IA 4GOPC 2NZHA 4FXDA 3L9AX 1I50H 5M5WH 4LF7Q 2L5TA 1CKNB 4UHVA 2J7ZA 3DHQA 2IHEA 3S2HH 2FMMA 4C3HG 1QVCA 3CAMA 5GQOA 1PYSB 4J15A 1SE2A 3CPFA 5CV7A 1Y8NB 4MTKA 4X3KA 2A8VA 1JCKB 1K8MA 1SMYC 3H0GB 3W5OA 4X66L 4K5VA 2CWPA 1L0YB 1HH2P 4IJLA 1F9PA 1JJGA 2GA4B 4A3CH 5C4XH 3KBGA 4FF4A 3BDLA 1PTOC 5FO9B 3HP3A 3GTGB 4AH6A 1VMPA 4FYDA 1EY0A 1J9OA 4KHZA 4M8AA 4LUOA 1IBKQ 1EQQA 1HZBA 4A3MH 3MWYW 4DAYB 5CV8A 1X55A 5F2DA 1K3RA 4NP5A 3FKIG 3KLRA 5G3LF 1FL0A 1XX8A 3DEPA 1Y1VB 4DUZQ 1EU4A 2AUKA 1IBKL 2JA5H 1ZEQX 3HKSA 4P71A 4C1NI 2NVXB 1KRTA 2XSCA 1N33L 4IZ8A 3L3OC 1DONA 1V1PB 4C3IH 4LFBQ 3HEJA 4B3SQ 1KQSA 3NBHA 4Z9CB 3FEWX 3BVGA 2YTVA 1IBLL 2JA7B 2B63B 1STGA 1L1OC 3GTMH 1XXGA 4WORA 4DUZL 4BBSG 4GLXA 4JYAQ 1VQ9A 4A3BH 1VCIA 1PH2A 4OGQC 4R4OA 1D5ZC 3SXHA 1G6PA 1X3PA 4L5QA 1LM0A 3D6WA 1EYDA 1O7YA 4YCUA 4RCNA 4L8JA 1LT5D 4APVA 2LS01 3KK7A 1NR2A 3CXCA 4DV0L 4LNQA 3D31A 3FHWA 4H0LC 4JI5Q 3CC7A 2WKCA 3A55A 3EA6A 1HZAA 4BBSH 1Z47A 3MAQA 1GHKA 4R4CA 2XN9C 1N32Q 2Q2HA 1IW7D 1ASZA 3AEVA 1PTOH 2ZTCA 1XNQL 4KLKA 4JI8L 3SR1A 4XTCS 4X64L 1S4ZA 3IKJA 4MNOA 4A93G 2X6GA 3K7UC 5HGQA 1MJCA 3OIPA 2JYOA 1LTTD 2I5HA 4HMIA 2KQ3A 3CHBD 1HA5A 1D5MC 1KDAA 4K6LA 5M5YB 1A0IA 5JJKA 1VQJA 1K83H 1XTDA 3TEHB 1I94Q 4ZK9B 2HD3A 3OHXC 2MGSA 2QGQA 1CQFA 5CGKA 3GD7A 2X69A 2BH2A 3I4MH 4IUUA 5G3LD 2FFKB 3H91A 1BCPF 2OTLA 4OHJA 4HR7B 1X3QA 4A3EG 3K8AA 3R3OA 2O2LD 3KF8B 2G9HD 2ZJQA 4NXNL 3JAMc 1X56A 3PUXA 2EJMA 4OIJA 5BR8L 1HNWQ 4IOAA 5KNBA 1CUKA 2KEEA 3SK5A 3MVVA 5E4XA 1DZ1A 1K8AC 1LLRD 4IPCA 4F8MA 4FXGC 4O1NA 4PMCA 2ZT9C 3VR4A 4DNIA 3EJIA 1RD9D 2XRQD 3EN2A 1R9TB 2JE6I 2R7DA 2QEXA 1G2TA 1D1KA 4JI4L 1SE4A 1I5FA 2N78A 3K5NA 2EOTA 3AB9A 2NBFA 3HOZB 3GTLB 5JJIA 2WFWA 1L0XB 1AZPA 4C2MB 4DV2L 1EY9A 3PUZA 3UI2A 4KHPL 3D6CA 1OXVA 5CV4A 1SMYD 1STNA 1SJED 4JI4Q 5KNDA 4A3JG 4HEDA 3IFTA 1SYGA 2R93H 5E7NA 5GAHC 1B1ZA 3AU7A 3J81c 1LT3D 4X3TA 4BS9A 5FLXL 1PH7A 4DV2Q 1CQVA 2AQ3B 2QEJC 3S1RH 1CK1A 2BCOA 3BYYB 2JP1A 5DNFA 3J81E 2NVTB 4EQ5A 4L6TB 1A2UA 3S1NB 1IZ6A 3HOUB 1STBA 1IW7C 1QCBD 3HOWG 4DF7A 2NZOA 2PYKA 4F87A 4AYBG 4DV5Q 3M4OH 2VZAA 4XXEA 3DXJC 2FINB 2CCZA 1V1PA 2R6GA 3V96A 4JI2L 2EYPA 5M5XB 4JBMA 1S3OA 3ND9A 3CCVA 1WD1A 2F1MA 5M5XH 4GKJL 5IT9E 4R9WA 4DV3L 1E3PA 4XYOA 4V190 3H3VH 4LF8L 3CC2A 3PUVA 1TWGB 4G4KA 1XNRL 4RA8A 1E7ZA 4A3FH 2RCNA 4XQJA 3Q0AA 2QA4A 2I07B 1HZ9A 4FDBA 2JXMB 2KHIA 3QJYA 4LFBL 1TWGH 5IT9L 2EXDA 2KJXA 1KABA 2A68C 1HNWL 1B70B 5CBEE 3J80E 5GAEC 1U5KA 3T4AC 3BVMA 2E2DC 4K14A 2KA7A 4KK7A 2F0SA 2ZM6L 1WOCA 4CKBA 3RLNA 1WI5A 5IP7H 3BS1A 1PTOB 1WTPA 3M4OB 1WCMH 5I2YA 4QQBX 2IHFA 1Z7TA 4N9PA 1CZGA 4IUTA 1SFOB 4DAYA 5IOCA 2HIXA 5GROA 1AZQA 1JWUD 1STAA 3E9IA 4YY3Q 5IWAL 4X62Q 2VQFL 4Q5VA 1HR0L 4DN4M 3CMEA 1XWEA 2QDLA 4DV6Q 2H1EA 5LMUL 2KCCA 4H02A 1S5CD 1AE2A 2RA4A 1KXLA 4DV5L 3TBIB 3U4ZA 3UDXA 4I7AA 1LUZA 3GP7A 1MBYA 1I6VC 2B63H 2C35B 1EUJA 2L9HA 1WYDA 4ILWA 4EQNA 2PCFB 1B9MA 1STEA 3D4WA 1JJCB 2B8FA 4JPBW 3SDZA 1I4XA 4JV5Q 1AH9A 1SJHD 1NTGA 4KN7C 5IGGA 1F9QA 4DA2A 4JYAL 5C4ZA 2K28A 2E5LL 1YI2A 3A8JE 1RTNA 3CCQA 4QL5A 4OO1G 1SYFA 5C3WA 4BXXG 4YIJA 3FKIB 1EIHA 2EQSA 3CRKC 3OWFA 2XRSD 1Z6HA 1Z9FA 1N34Q 1BKBA 1CSQA 2LY7A 1VQHA 2SOBA 3KLSA 2D2CC 1QNKA 5ELEA 4BY7B 4KHVA 3KFUA 4KY7A 1EZ6A 5C4JH 1SN8A 3ITPA 1MSGA 1SAPA 1RTOA 3WDNA 3H0GG 4X65Q 4O0AA 4X64Q 3J81j 4CJ1B 4FXKC 3BDOA 3EQLC 2PI2A 1FVIA 3SVMA 3VR2A 4DR7Q 1PTOF 4V0BA 1B8AA 4Y7NH 5CBAE 5C44H 1A3TA 3E0JA 2F0TA 3IFDA 5C0XG 3S17B 4KHPQ 5EBCA 1KNAA 1WCMG 2Q2TA 2E2HB 1AE3A 1UWVA 3A7LA 4HAEA 3K7AB 3OTOQ 1RKNA 1RIPA 1HUNA 5LHY1 1EY6A 1SBBB 5C3EH 3D4RA 1TR5A 2JA5B 2YTYA 3EROA 4ZQ3A 2LXJA 2JA8H 3W1GA 5IYCH 2PQAA 2CH4A 1HNXL 2DN8A 1TU2B 1VQ6A 1G91A 2B2TC 2Y0SB 2M9VA 1V43A 4TRDA 4HJ7A 1F2MA 5COYA 4CBVA 3BG3A 4JI3L 1B9NA 3LNNA 3MXNB 3PO2H 2MUYA 5KIXA 4JCVE 3DWPA 1G291 2AHOB 1N33Q 1PHJA 5GAGC 2UUCQ 2OQ0A 4RHRA 1PH6A 4UP7A 3MTSA 1H95A 1LTBD 1QG7A 3HOWH 2D0PA 3L2PA 1VS0A 3BJUA 3V2TA 1X32A 2KEDA 3DLLA 1DGSA 5FLXc 1WFQA 1I4RA 1XMQQ 1NMGA 2DY8A 2XTIA 3S16H 4GZYC 1I50B 4LF6Q 3GTQB 1PH1A 5FLXE 3GTPH 3WWVA 1NNXA 2RKSA 1Q82C 1TWCB 3R93A 4A3JH 1RL2A 3TQYA 5CYUA 3S15H 3I7FA 1L1OB 2ZJPA 1N32L 1Y1WB 5IYBG 1EYGA 2EY5A 5K5PA 1XNQQ 1PH5A 4NW2A 1JICA 1Q46A 1ESFA 2K52A 1EQRA 2K33A 1EY5A 2RDGA 1A2TA 1X65A 3AMUA 2Z0SA 5HGTA 1H9SB 3I4LA 2JA7G 5EBDA 1EIGA 1Y14B 2YV5A 4X62L 2G5DA 3P7JA 1W2BA 4QY7A 1EFID 2K50A 3TZDA 1UE5A 3I2ZA 2AUJD 3BZDB 1EWCA 2CHBD 2F0QA 3NUCA 5AJ3L 1XPUA 3KDFB 2WAQE 2RHSB 3NELA 3J7AF 3TSSA 5C3EB 1BVSA 1V9PA 3PV0A 1IBML 4YCWA 4EQPA 2DJGC 3HFZB 1VQOA 3J7AV 2XNAC 2WV6D 2YU9B 2EY6A 4GOPB 5IYDH 1BO0A 1EEID 2LSSA 2WB1G 3I4MG 1AP0A 3TREA 3X3NA 2OWOA 1JC7A 4BY1B 1Q7YC 5I9PA 1LT4D 4OEMB 1GUTA 4KI0A 3SK8A 1LYLA 3BYTB 2AWOA 3G6EA 4J8QA 1O78A 2B2VA 1F77A 2CVRA 2VB3X 5M9OA 3ND8A 1I3QH 1YNND 1A63A 1MHWC 1JOOA 3T1YQ 4A93H 1QNUA 3FRPB 3P20A 2B29A 1Y8OB 2E8GA 3MC0B 4OELB 3GO5A 5NUCA 3NPPA 5IY0A 1CA6A 1BQQT 1STHA 1FYCA 1Y1VH 4KKTA 2PZUA 5LMUQ 4RGTA 4BBRB 1O7ZA 3A5ZB 1WTOA 4DK0A 4MZ9A 2NB0A 5LMNW 1SNQA 4XQQA 2Q2UA 3I72A 1PXUA 1K8GA 1VF5C 4U68A 4HJ8A 3AYHB 4KN4C 1Q1EA 3D0FA 1FJGL 1JWMD 2K5NA 1A62A 1Q90A 4ME3A 4B3TQ 4A3BB 3N6RA 5K36G 2FXQA 4ODGA 4A3BG 3STBC 2F0JA 1U0LA 4R8NA 3RMHA 1PTOD 4K0KQ 4BBSB 1SLJA 5A35A 5KGUA 3T16A 3F2BA 1ESRA 1SYBA 1PFNA 1T5EA 2KCNA 4LFAL 3TP7A 4A93B 3K5LA 3F2CA 3RZOB 5FLMH 1CA5A 3TP6A 2ASBA 2MPMA 5IGCA 1SYCA 2UU9L 2NVYH 2P5ZX 4WJWA 3NQIA 1BCPB 1ZKOA 2WINB 3KOJA 2NTTA 4P2CB 4HIOA 3S1QH 4J6HA 1JE4A 4BY1H 3GTOB 2F0EA 4A3LH 1HPCA 2SNMA 2MHVA 5EAYA 1ILPA 4H44C 3UE1A 1PZKD 3ER0A 5CR3A 4HJAA 1TS4A 1TS3A 1HQRD 2FMCA 4K6DA 2A74C 3MEFA 2Z1CA 2RDFA 5ELOA 1LTGD 2I5LX 1DOMA 1R4PB 4OWWB 1YEZA 2Z6BA 3RLOA 2F0DA 3H6MA 1WD0A 2PPBC 1YNNC 1WJJA 1BF4A 4XYQA 4FVMA 1SE3A 2LKVA 2WB1E 2VQFQ 5A2QL 3OYYA 2QILA 2SNSA 4DPGA 2PW7A 3RZDB 2ES2A 4UAIA 5BN4A 1MGSA 3T1HL 1I4QA 4LFCQ 2UXCQ 5C0XI 4DXFA 2K6AA 4K0KL 1E0BA 1VQCA 2PZTA 1N36Q 5J3BA 2FHTA 1V8QA 1X9NA 1I94L 1Q8KA 1RHPA 3GTKH 2EXZA 3I8ZA 5M3MG 4ZAIA 4NXMQ 1SFOH 3KDFA 2EY2A 5ELDA 3PCOB 4IN3A 1J5EQ 2N88A 5C6AA 4JG2A 4NB3A 1WTRA 3M9BA 1B53A 3NTHA 5LMNQ 2HT1A 3TP8A 2VNUD 1E1TA 1GUOA 1SE8A 3NEMA 2CQOA 1IBMQ 3NTIA 2B3GA 4JI7L 2VL6A 4JI0L 1HFNA 1DXMA 1SR3A 3HOUG 3HOXG 3G6JB 2Z4IA 3PGZA 1WCMB 3NQTA 2E74C 1ZXTA 3K5OA 4NKLA 1PH4A 1ENFA 5T1GA 4P75A 1ASYA 3PO2B 2L4NA 1CM9A 4A3IB 1GD7A 4ME5A 2CH4W 5FKAC 4BWGB 3S1MH 4OO1H 1WTWA 2R3ZA 5J22A 4JOIA 1Y8PB 1EFWA 1NAPA 3GTKB 4CJ0B 2WAQG 3RUZA 1TY0A 1P8LA 1YJNA 1PRTB 1SNDA 2VW9A 1FGUA 4R4QA 2YU9H 4IPGA 4JV5L 4DV1L 3CP0A 3CPWA 3NHHA 4I65A 2WB1B 4JI8Q 1A3VA 1BR9A 3NWSA 5DM73 1Q3LA 4FF3A 1LO5D 2EYHA 5IWAQ 1BXTA 4LUVA 4WRDA 1XTCD 5IT9c 4HCEA 2K14A 2A68D 4CKEA 1N36L 2N49A 2RHQB 3F2DA 1FJGQ 3PO3H 3S1MB 4RGOS 1WTVA 1J6QA 3A7AB 3HOZH 3SEBA 3K80C 1J5EL 1SYDA 2Z4HA 5M3FB 1K3BC 4C3IB 1YJWA 3J80c 3PIPA 1DM0B 4P74A 3C3LA 4ALPA 1TWAH 1QILA 4B3ML 3I4NG 4WFN3 4JI0Q 5I4DA 3VA7A 5JJLA 3S15B 1PFMA 2KCMA 4PZ7A 4KJNA 2OQKA 5IGBA 3H15A 3OW2A 1D2BA 4ZUJA 4E6IA 1M4VA 2ZXOA 1VQKA 2Y0SE 3IRBA 1G2SA 3DM3A 1IYUA 1DOLA 3ICEA 4A3GG 5EKLA 5C4HA 2EY1A 3N52A 3PIO3 3CRLC 3TDQA 1JT8A 3GTGH 1GM5A 1X6OA 4DR4Q 2C9OA 2K5HA 2EYOA 3OTOL 5C4XB 1X54A 1GJXA 3ULLA 1TVXA 3SK4A 2EPBA 4R1JA 1GUNA 2MJ8A 4RCOA 4KMUC 4PQXA 4BA2I 2UUBQ 5EGTA 4HIDA 1NR4A 2KCTA 1F2YA 2NN6G 5JEAH 1SXTA 3LWEA 4HTHA 5C5LA 3F1ZA 5C4JB 4WJ3M 2K7VA 4GN5A 4AYBB 2RDHA 3RZOH 4PNYA 5C5MA 4L5TA 3PF5A 1U4PA 2O5JC 4XIGS 1X3EA 2Q8TA 1JMCA 1CT1D 1TIID 1YNXA 4XQNA 2B2UA 1VQMA 2KHJA 3TN2A 3CCUA 3HRZC 4JBWA 4PG3A 4A3DB 4QUFA 4A3DH 3QIAA 4JBJA 2L15A 1IXRA 5BR8Q 4FF1A 4DV7Q 3I3CA 2M2LA 5BN5A 3GTOH 2C5CA 3A8KE 1SROA 3M4QA 2MQHA 4KY5A 4JVZA 1YIJA 3MFYA 4IO9A 1HNZQ 1HTPA 4CDCC 2AMCB 2MO1A 2SEBD 3FVQA 2IW3A 1CFMA 1EOVA 1L0WA 3HG9A 1A15A 3SK6A 4OWTB 5AFWA 3K58A 3KF6A 3GTMB 1CHPD 4QUCA 5CV6A 4C3HB 3CQZB 1UE6A 4YCVA 1OXXK 4X65L 4P73A 4DR5Q 1Q81C 4C56C 4A3EH 1K73C 3OIQA 5DAUA 1B50A 1AEXA 2RSOA 4LMQD 1HUMA 5JPMC 2PI2E 3I4OA 4QB4A 4C1NK 1NE3A 4L5RC 3LWUA 2QKIC 3C1FA 1HFGA 1C8CA 1BCPC 1MKHA 4EGVA 2ATWA 2F0NA 1PH9A 4LF5Q 1D7QA 3K6OA 5TSSA 1JQYD 2F0KA 2B2YC 2Q2IA 2RQXA 1U9RA 3TMEA 2RCFA 2I0QA 1C7YA 1IKLA 1H9MA 4ZCKA 4QJFA 2CQAA 4FF2A 2EE1A 1EY4A 4IFDJ 3ZJYC 4GKKL 1YHQA 1PRTF 1Y1WG 2K1BA 2VUMG 3AFPA 2K5DA 3QG1A 3GV3A 3RN2A 4A3KB 1FD7D 1N9WA 2CW0C 1J8IA 4U673 4I7ZC 4PMBA 1OTCA 4IJHA 2NVQB 3NSWA 2UU9Q 1PFBA 4JI5L 3TS2A 3E9HA 3SE0A 4DV4L 5K36H 3H3VC 2K5WA 3EIVA 4GS3A 1QB5D 4DR2L 3J7A5 4LF7L 2ZXRA 3S17H 1U4MA 4DR3L 3VYUA 5KYIA 4DUYQ 1IL2A 3UDGA 4RHSA 3QOLA 1KTKA 4QMGA 4B3RL 2OTJA 1TWHB 1FGBD 1PMRA 4LAAA 5BN3A 3GTJH 4OIKA 3HKZE 4HIKA 1QVGA 4DV4Q 3L7ZC 4YY3L 1YVCA 2EYLA 4DAPA 3M3YB 3GTQH 4DR3Q 3VYRA 5L37A 2IWHA 4A3IH 2A19A 4O2DA 1F2LA 4IUVA 1RODA 1OO9B 2TMPA 4C3IG 3S2DH 4X3UA 1PRTC 5M3MB 4B3TL 2JN4A 1N8RC 4EVOA 1LACA 3KUPA 2VUMH 1D1IA 2JA5G 3OMGA 1Q12A 3MXUA 1Y1WH 2A6HC 2JA8B 3UE0A 2HDLA 1WTXA 2YTXA 1DCZA 2K75A 2JQOA 2PZWA 3DM1A 1B2TA 3VDYA 4GLAC 3FKIH 2F0GA 2SDFA 1EIFA 2TSSA 1I6HH 4Y52H 3AFQA 2MNAA 4B9WA 2Z6KA 2MO0A 2IX3A 1GUWA 3CMAA 1UAPA 5C4XG 3U4VA 5I6YA 4LF4L 4A3JB 1BDOA 5IYDG 2CWAA 3W2DA 3K0XA 1TWFH 4JBKA 3Q24A 1LTLA 4A3GB 3WOFA 5LMNL 2D62A 1MJEA 4NXML 2K4KA 1H9KA 4N8FA 5HY6A 4DV3Q 1VQBA 1IBLQ 2NN6I 3RZDH 5CMDA 3I73A 4JI7Q 4FO2A 1F9RA 5JJZA 3IL8A 1ZYRC 5C44B 1B7YB 4B3RQ 3FP9A 5ISRA 2ICIA 2NYZD 1AN8A 2HDMA 1QZHA 5IIFA 1PDQA 2JA7H 3GTLH 2XWJB 3NWTA 3J7YW 2H4OA 1EU3A 5IP9H 1HNZL 2QF7A 2WKDA 5FJ8G 4KTAA 2K5VA 3MXGA 4GN4B 4ABNA 1SNOA 2J4XA 4JI1L 4A4IA 4CDDC 3CC4A 3DMUA 2LFNA 1JB7A 1EWIA 2EIFA 3CU7A 3PUWA 5IYBH 3Q23A 4BY7G 2CKZB 3RR5A 4YWMA 4CDEC 2AWNA 4A3DG 4IQZA 1JORA 1NSNS 1NCVA 4A75A 2ZTEA 5D3DA 3VR3A 3MA2B 4A3EB 3Q8DA 2L55A 4ZRZA 1VQGA 4AIMA 2F4VL 2R61A 4A3KG 1G8ZD 3ERQA 4NPSA 1CI3M 1GXDC 1KNEA 2E75C 3WOEA 2O4XA 2VXWA 4AYBE 4P72A 1ZYRD 2K5QA 1K9MC 4K5XA 1I6HB 4XDXA 3TZUA 4IUPA 1DOKA 1VQ4A 4TQUS 1BBUA 2R7ZG 2B2TA 1VQDA 4UP8A 1X3GA 3PO2G 4LFAQ 4IPHA 1UUPA 3KLSX 1EY7A 3MHBA 2UXDQ 2B2WA 2F0WA 5FK9C 2JA6G 1H9JA 1JE5A 4C3JH 3HZXA 2JA9A 2NVXH 3JAME 1O80A 2AKWB 2HHHL 3M4PA 1HRJA 5IYCG 2JA8G 1A8VA 2XIWA 3D4DA 3QB3A 2BA0A 2RF4A 1F2ZA 1ET9A 3J80L 1VQ5A 3H94A 3GTJB 4RH6A 5C0XJ 5D3IB 4DNTB 3GDEA 1YHBA 5JVG3 5C44G 5M5WB 2WP8J 1S72A 2F0HA 2EYJA 1TWCH 3PF4A 1CSPA 1C9OA 2D5DA 3HKZB 4CGYB 4G7ZC 3TP5A 4IOCA 3GTPB 1YNJC 1CZWA 2HQEA 1C0AA 1IYJB 1TQOA 3K59A 1HA6A 2N8NA 2UUBL 4DGZA 5KYLA 5J1ZA 3PO3G 1KAAA 3H0GH 4LWCA 5CORA 2EYMA 2F0PA 5C3XA 3AQQA 5HURA 3T1HQ 1WTHA 3D3RA 2XWBB 1VQAA 1PFSA 1EZ8A 3C1EA 2PW5A 5I2XA 4GLVB 4R8IA 1DD2A 3RN5A 2BE5C 3I55A 4YWKA 3VR6A 2R7ZB 3GQBA 2E2IB 1GUSA 1G51A 5DEHA 3S16B 3L0OA 4IFDG 3G7LA 3U50C 4GKJQ 4BA1I 1V1QA 1HNXQ 2EYFA 2R92H 1SRUA 2Y0SG 1ENCA 4BXXH 1IKMA 3HS0C 3BU2A 3T53B 3QWNA 1NMFA 4B9XA 2IL8A 2QDBA 3FMCA 1PV4A 2UXDL 2VUMB 4OX9Q 3JC66 4MIUA 1D8LA 4RGNA 3Q22A 1VQ8A 4JI3Q 1E22A 4PV1C 2F52A 2HCCA 2ID0A 4RGMA 4X3SA 3E5SA 4N9TA 5CV9A 5M3FH 4GOPA 2ZTDA 2D0OA 2A6EC 2WIIB 2F0OA 1M90C 2UUCL 4HJ9A 4IFDH 2N55A 2R93B 3J7ZC 1NUCA 2F0IA 4F88A 4QF4A 2V4DA 4KJOA 2NZ1D 3GV6A 3S2DB 3OPOA 1UE1A 4XT3B 2OCEA 4HN7A 2D9UA 1KL9A 5D14A 4LF9L 3S1NH 3VYSA 1QJOA 3M7NA 2L11A 1KRSA 2F4IA 3ULJA 1PVOA 1S5DD 3G4SA 1VF7A 2BA1A 4LK1C 1D6EC 2A5HA 1VDZA 3DUZA 4OWXB 1IL8A 2QCPX 2KENA 3LX0A 3EBEA 4RG1A 4POFA 1YITA 1R9TH 4Y7NB 3I4NB 3BDCA 3DEOA 4JOIC 4JI1Q 2GVBA 1K0RA 3FPPA 5JVH3 4DAMA 3CCEA 4CHTB 4ZUIA 1LT6D 1UE7A 4POGA 4NDXA 3S1RB 2K01A 1CKOA 1H9SA 1VQ7A 4HSPA 5EPLA 4IUQA 4DR7L 1HHVA 3K57A 1BOSA 4LF4Q 2A69D 1EEFD 1YZ6A 3A5UA 2A73B 3M7GA 2JEAI 3K0YA 3MXPA 2PQAB 4C3JG 4DFAA 5I9OA 2JA6H 1VQFA 1NBWA 2XVSA 4TSSA 1JOKA 3K5MA 4HSVA 4K2KA 1K8OA 1LTRD 3HOVB 3V05A 2JEBI 4GN3B 1RDPD 2VQEL 5M5YH 2E5LQ 2R92B 3OMCA 4MN3A 4DR6L 4OX9L 1Q86C 3VR5A 2B39A 1SDFA 2F0UA 2XGTA 5KEEA 4IUNA 4RAUC 1N34L 2GVAA 4K8IA 4KKSA 4DKAC 2IPKD 1ICWA 4UP9A 3E3XA 2ALYB 2WAQB 3H3VI 4A3LG 3RNUA 1PLFA 3CW2C 3A54A 4LJZC 4A3KH 4MTNA 2Q8IB 4H7BA 3NK9A 4O42A 4DR6Q 2Z6KC 4BY1G 3JAMi 1VQNA 2VB2X 1B3QA 3ZYYX 4FP5D 2DY7A 2G9DA 2MFIA 5ELBA 3PIP3 5ELFA 3A74A 5FO8B 3S1QB 1QWYA 1KDBA 3W3AA 2HHHQ 1QOHA 2UXBL 3K81C 1SEBD 1EQTA 1RCVD 2DUDA 1PH3A 1KD1C 1TY2A 4DV0Q 2F3IA 2OXPA 3E0EA 1OXSC 4EQOA 3CQZH 4GNXB 5FLMG 1M8AA 3MEHA 2IT1A 4HCSA 4OO1I 2F0MA 4ULLA 1HXYD 4DK6C 1K83B 1U4RA 2IJ0A 2BE5D 2PMZE 1S5FD 1ONLA 5FJ8H 2EJFC 1S40A 5IP9G 2PNRC 2LMCB 1F9SA 5J39A 4DR5L 3IAYA 2K05A 3MFGA 4IPDA 3S24A 1HR0W 4LUZA 4XT1B 2HIVA 5JAVA 3A0JA 4UY8C 4DV1Q 1SNMA 4K5WA 1PZID 3A56A 3PIOA 5FO7B 1KAWA 1W6KA
chains in the Genus database with same CATH topology
4DXGA 4DK1A 1Y69U 2NVYB 1FNVA 1JWSD 2RVLA 2O5IC 3OW7A 2Z8LA 1G6ZA 1YNJD 4HMJA 1BCPD 4ZYSA 1UEAB 3BVZA 4CKCA 2B2YA 1EYAA 3ONAB 1SNCA 5EJWA 2WACA 2F0VA 1E2VA 2B2WC 3QO2A 3HGBA 2JSOA 1CTMA 1JOQA 2F0LA 1FNUA 1IHZA 5CC4A 2M00A 5EQ0A 2F3WA 1MD2D 5LL6S 4J1MA 1II3A 2K03A 3URYA 2DNCA 1PYWD 5IGDA 4KD3A 2HUGA 3EFXD 5IODA 1U4LA 3HOXB 3E6ZX 1MSHA 2PQEA 4M1UB 2RBMA 2JA6B 3OOCA 1OXTA 1C4QA 1SYEA 2L0CA 3Q6SA 1AW7A 3I90A 3NTKA 2F0FA 3FPUB 1TS2A 3EVQA 4C3JB 1IYVA 3I4MB 1RJTA 3T51B 3S2HB 1O7LA 1CHQD 3T56B 2KUMA 4ZKCB 2BOSA 1E2WA 2EDGA 3JAML 4OL7A 2OEOA 3X3MA 1H9RA 1R4QB 3S9WA 2X6LA 1VMCA 2K32A 4ID6A 1B3AA 5IGEA 4FNFA 2E2JB 4IALA 1AFPA 1BBXC 3R8BA 1HTLD 5JPNC 2ENBA 1I4GA 5LL6X 4ZLTF 2AQ1B 1V1OA 3O13A 3MXNA 1BUVT 1FR3A 1JR0D 2F03A 4RWSC 4QIWB 4ZKBB 2RSNA 1TT2A 4RKLA 4DU9A 1I4HA 3VYTA 1UNSA 2L12A 3I91A 1SSOA 4KY6A 5EKIA 2NTSA 1E2ZA 3MZ5A 5EKKA 1XYIA 3PUYA 1SNPA 1EOTA 4IURA 2I46A 3C46A 4DAVA 4H13C 1GUGA 5FOBB 5C0XH 5IGFA 1S5ED 2KHSA 3OSOA 1LTAD 5CV5A 3FDTA 3KF8A 1ET6A 3PMFA 2DNEA 1A3UA 2E76C 5JOBA 4QCLA 1FNWA 4KV6A 4MHEA 3U9SA 2EVBA 1A6XA 2YYZA 5JEAG 1B44D 2NN6H 1JB3A 4L63B 5ELCA 5KNCA 3CKIB 2IX0A 1ILQA 3U9OA 3T13A 4K8JA 3J81L 2KOLA 4A3MB 4DNRB 5KRUA 1EYCA 3H09A 3DWAA 2EJGC 1PRTD 2CW0D 3HOYB 1D5XC 3SHLA 1EY8A 2ICEC 1Q8IA 1B4OA 1HQMC 1T5XD 1PZJD 2KVMA 1KLGD 1W6JA 5D65A 1Q1BA 3RLFA 5A2QE 4K2LA 5DM63 1ENAA 3M85A 5E3FA 3R2IA 2HCIA 3D8GA 4B08A 4RKBA 1QE6A 2B2VC 1WTQA 1HCZA 2BDNA 1STYA 3PO3B 5E4WC 3S14B 1TS5A 3NE5B 4G7HC 2FJ2A 1DYQA 5I6WA 4Q0FA 1S5BD 2B2UC 4RFBA 1TWAB 2NUCA 2NWGA 1EWHA 5EPJA 2A6ED 3P1HA 1EQVA 1GHJA 2K04A 2Q8RE 2AQ2B 3NXWA 1LTID 2B8GA 3I70A 4CJ2C 3P75A 4IFDI 1C48A 1LABA 2ZXPA 3DWQA 1GOZA 1I3QB 5EPKA 1LTSD 4G7OC 3OWEB 3VA5A 4G57A 1TWFB 4UDUC 3R2TA 4F7XA 4NMZA 4KD4A 1LV9A 2F3VA 2BDOA 5E1FA 3HOWB 1TKWB 2IX1A 2EZVA 3C2PA 4TKOB 1OXUA 3NBIA 2PO4A 2A6HD 3QOJA 2L1BA 1DJRD 2A69C 4JK1C 2J0TD 2OT2A 1RF2D 1BNZA 2KECA 1I4PA 1ML0D 5JEAJ 4A3FB 2PMZB 1EL0A 1WVLA 3KBXA 2MP1A 1KLUD 3NP8A 4PMWA 1KDCA 4KKUA 3RD4A 3F2UA 4S3SA 3A8IE 2OF1A 1MI2A 3M4YA 5T1IA 4FXDA 3L9AX 2L5TA 2J7ZA 3DHQA 2FMMA 4C3HG 1SE2A 5CV7A 1Y8NB 4X3KA 1JCKB 1K8MA 1SMYC 3H0GB 4K5VA 1L0YB 1F9PA 2GA4B 3KBGA 4FF4A 3BDLA 5FO9B 1PTOC 3GTGB 3HP3A 4FYDA 1VMPA 1EY0A 1J9OA 4KHZA 4M8AA 3MWYW 5CV8A 5F2DA 4NP5A 3KLRA 5G3LF 1XX8A 3DEPA 1Y1VB 1EU4A 2AUKA 1ZEQX 4C1NI 2NVXB 2XSCA 4IZ8A 3L3OC 1DONA 1V1PB 3HEJA 3NBHA 4Z9CB 3FEWX 3BVGA 2JA7B 2B63B 1STGA 1XXGA 4WORA 1VCIA 4OGQC 1D5ZC 3SXHA 1X3PA 3D6WA 1EYDA 1O7YA 4RCNA 4L8JA 1LT5D 2LS01 3KK7A 1NR2A 3D31A 4H0LC 2WKCA 3A55A 3EA6A 1Z47A 3MAQA 1GHKA 2XN9C 1IW7D 1PTOH 3SR1A 4XTCS 1S4ZA 3IKJA 2X6GA 3OIPA 2JYOA 1LTTD 4HMIA 2KQ3A 3CHBD 1HA5A 1D5MC 1KDAA 4K6LA 5M5YB 4ZK9B 3OHXC 2MGSA 1CQFA 5CGKA 3GD7A 2X69A 4IUUA 5G3LD 2FFKB 3H91A 1BCPF 4OHJA 4HR7B 1X3QA 3R3OA 2O2LD 2G9HD 3PUXA 2EJMA 4OIJA 5KNBA 2KEEA 3SK5A 3MVVA 5E4XA 1DZ1A 1LLRD 4F8MA 4FXGC 4O1NA 4PMCA 2ZT9C 3VR4A 3EJIA 1RD9D 2XRQD 1R9TB 2JE6I 1G2TA 1D1KA 1SE4A 3K5NA 2EOTA 3AB9A 2NBFA 3HOZB 3GTLB 1AZPA 1L0XB 4C2MB 1EY9A 3PUZA 3UI2A 3D6CA 1OXVA 5CV4A 1SMYD 1STNA 1SJED 5KNDA 4HEDA 3IFTA 1SYGA 1B1ZA 3AU7A 1LT3D 4X3TA 4BS9A 5FLXL 1CQVA 2AQ3B 2QEJC 1CK1A 2BCOA 3BYYB 2JP1A 5DNFA 3J81E 2NVTB 4L6TB 1A2UA 3S1NB 3HOUB 1STBA 1IW7C 1QCBD 4DF7A 2PYKA 4F87A 4XXEA 3DXJC 2FINB 1V1PA 2R6GA 3V96A 2EYPA 5M5XB 3ND9A 1WD1A 2F1MA 5IT9E 4R9WA 4XYOA 4V190 3PUVA 1TWGB 4G4KA 4RA8A 4XQJA 3Q0AA 2I07B 2JXMB 3QJYA 5IT9L 2KJXA 1KABA 2A68C 5CBEE 3J80E 3T4AC 3BVMA 2E2DC 4K14A 2KA7A 4KK7A 2F0SA 4CKBA 3BS1A 1PTOB 1WTPA 3M4OB 5I2YA 1Z7TA 4N9PA 1CZGA 4IUTA 1SFOB 4DAYA 5IOCA 1AZQA 1JWUD 1STAA 4Q5VA 4DN4M 1XWEA 2H1EA 2KCCA 1S5CD 2RA4A 3TBIB 3GP7A 1MBYA 1I6VC 4EQNA 2L9HA 4ILWA 2PCFB 1B9MA 1STEA 3D4WA 2B8FA 3SDZA 1I4XA 1SJHD 4KN7C 5IGGA 1F9QA 4DA2A 5C4ZA 2K28A 3A8JE 1RTNA 4OO1G 1SYFA 5C3WA 4YIJA 3FKIB 1EIHA 3CRKC 3OWFA 2XRSD 1Z6HA 2LY7A 2SOBA 3KLSA 2D2CC 1QNKA 5ELEA 4BY7B 4KHVA 4KY7A 1EZ6A 3ITPA 1MSGA 1SAPA 1RTOA 3WDNA 4CJ1B 4FXKC 3BDOA 3EQLC 3SVMA 3VR2A 1PTOF 4V0BA 5CBAE 1A3TA 3E0JA 2F0TA 3IFDA 5C0XG 3S17B 5EBCA 1KNAA 2E2HB 3A7LA 4HAEA 3K7AB 1RKNA 1HUNA 5LHY1 1EY6A 1SBBB 3D4RA 1TR5A 2JA5B 3EROA 4ZQ3A 2DN8A 1TU2B 1G91A 2B2TC 2Y0SB 2M9VA 1V43A 4TRDA 1F2MA 5COYA 4CBVA 3BG3A 1B9NA 3LNNA 2MUYA 5KIXA 3DWPA 1G291 4RHRA 3MTSA 1LTBD 1QG7A 3V2TA 1X32A 2KEDA 1I4RA 2DY8A 4GZYC 1I50B 3GTQB 5FLXE 2RKSA 1TWCB 3R93A 5CYUA 1Y1WB 2EY5A 5K5PA 4NW2A 1JICA 1ESFA 2K33A 1EY5A 2RDGA 1A2TA 3AMUA 5HGTA 1H9SB 3I4LA 5EBDA 1EIGA 3P7JA 1EFID 3TZDA 2AUJD 3BZDB 1EWCA 2CHBD 2F0QA 3NUCA 3J7AF 3TSSA 5C3EB 3PV0A 4EQPA 3J7AV 2XNAC 2WV6D 2YU9B 2EY6A 1BO0A 1EEID 1AP0A 3X3NA 1JC7A 4BY1B 5I9PA 1LT4D 1GUTA 4KI0A 3SK8A 3BYTB 2AWOA 4J8QA 1O78A 2B2VA 1F77A 2CVRA 2VB3X 5M9OA 3ND8A 1YNND 1JOOA 1QNUA 3FRPB 3P20A 1Y8OB 3MC0B 3GO5A 5NUCA 3NPPA 1CA6A 1BQQT 1STHA 1FYCA 4KKTA 2PZUA 4RGTA 4BBRB 1O7ZA 1WTOA 4DK0A 2NB0A 1SNQA 4XQQA 3I72A 1PXUA 1VF5C 4U68A 4KN4C 1Q1EA 1JWMD 1Q90A 4A3BB 3N6RA 5K36G 4ODGA 2F0JA 4R8NA 3RMHA 1PTOD 4BBSB 5A35A 5KGUA 3T16A 1ESRA 1SYBA 1PFNA 1T5EA 2KCNA 3TP7A 4A93B 3K5LA 3RZOB 1CA5A 3TP6A 2MPMA 5IGCA 1SYCA 4WJWA 3NQIA 1BCPB 1ZKOA 2WINB 2NTTA 4P2CB 4J6HA 1JE4A 3GTOB 2F0EA 1HPCA 2SNMA 2MHVA 1ILPA 4H44C 1PZKD 5CR3A 1TS4A 1TS3A 1HQRD 2FMCA 4K6DA 2A74C 2Z1CA 2RDFA 1LTGD 1DOMA 1R4PB 2F0DA 3H6MA 1WD0A 2PPBC 1YNNC 1BF4A 4XYQA 4FVMA 1SE3A 2LKVA 5A2QL 2QILA 2SNSA 2PW7A 3RZDB 4UAIA 5BN4A 1MGSA 1I4QA 5C0XI 4DXFA 2K6AA 1E0BA 2PZTA 2FHTA 1V8QA 1RHPA 2EXZA 3I8ZA 4ZAIA 2EY2A 5ELDA 4IN3A 2N88A 5C6AA 1WTRA 1B53A 3NTHA 3TP8A 2VNUD 1GUOA 3NTIA 1HFNA 1DXMA 3G6JB 2Z4IA 1WCMB 3NQTA 2E74C 1ZXTA 3K5OA 4NKLA 1ENFA 5T1GA 3PO2B 2L4NA 1CM9A 4A3IB 4ME5A 5FKAC 4BWGB 4OO1H 1WTWA 2R3ZA 5J22A 1Y8PB 1NAPA 3GTKB 4CJ0B 3RUZA 1TY0A 1PRTB 1SNDA 3NHHA 4I65A 2WB1B 1A3VA 1BR9A 3NWSA 5DM73 1Q3LA 4FF3A 1LO5D 2EYHA 1BXTA 4WRDA 1XTCD 4HCEA 2A68D 4CKEA 3S1MB 4RGOS 1WTVA 3A7AB 3SEBA 1SYDA 2Z4HA 5M3FB 4C3IB 1DM0B 3C3LA 1QILA 4WFN3 5I4DA 3VA7A 3S15B 1PFMA 4KJNA 5IGBA 1D2BA 4ZUJA 4E6IA 1M4VA 2ZXOA 1G2SA 1IYUA 1DOLA 5EKLA 5C4HA 2EY1A 3N52A 3PIO3 3CRLC 3TDQA 2C9OA 5C4XB 2EYOA 1GJXA 1TVXA 3SK4A 2EPBA 1GUNA 2MJ8A 4RCOA 4KMUC 4PQXA 4BA2I 5EGTA 1NR4A 1F2YA 2NN6G 5JEAH 1SXTA 3LWEA 4HTHA 5C5LA 5C4JB 2K7VA 4AYBB 2RDHA 4PNYA 5C5MA 1U4PA 2O5JC 4XIGS 2Q8TA 1CT1D 1TIID 4XQNA 2B2UA 3TN2A 3HRZC 4JBWA 4A3DB 4QUFA 3QIAA 4FF1A 3I3CA 2M2LA 5BN5A 2C5CA 3A8KE 4KY5A 3MFYA 1HTPA 2SEBD 3FVQA 2IW3A 1CFMA 3HG9A 1A15A 3SK6A 3K58A 5AFWA 3GTMB 1CHPD 4QUCA 5CV6A 4C3HB 3CQZB 1OXXK 4C56C 3OIQA 5DAUA 1B50A 1AEXA 2RSOA 4LMQD 1HUMA 5JPMC 4QB4A 4C1NK 3LWUA 2QKIC 1C8CA 1HFGA 3C1FA 1BCPC 4EGVA 2F0NA 3K6OA 5TSSA 1JQYD 2F0KA 2B2YC 2RQXA 1U9RA 3TMEA 1IKLA 1H9MA 4FF2A 2CQAA 2EE1A 1EY4A 4IFDJ 1PRTF 2K1BA 2K5DA 3QG1A 3GV3A 4A3KB 1FD7D 2CW0C 1J8IA 4U673 4I7ZC 4PMBA 2NVQB 3NSWA 1PFBA 3SE0A 5K36H 3H3VC 2K5WA 1QB5D 2ZXRA 1U4MA 3VYUA 5KYIA 4RHSA 3QOLA 1KTKA 4QMGA 1TWHB 1FGBD 1PMRA 4LAAA 5BN3A 4OIKA 3L7ZC 2EYLA 4DAPA 3M3YB 3VYRA 2IWHA 1F2LA 4IUVA 1RODA 1OO9B 2TMPA 4C3IG 4X3UA 1PRTC 5M3MB 4EVOA 1LACA 3KUPA 1D1IA 3OMGA 1Q12A 3MXUA 2A6HC 2JA8B 2HDLA 1WTXA 1DCZA 2PZWA 3DM1A 1B2TA 2F0GA 2SDFA 2TSSA 4B9WA 2IX3A 1GUWA 1UAPA 5I6YA 4A3JB 1BDOA 3W2DA 3Q24A 4A3GB 3WOFA 2D62A 1H9KA 2NN6I 5CMDA 3I73A 4FO2A 1F9RA 5JJZA 3IL8A 1ZYRC 5C44B 5ISRA 2ICIA 2NYZD 1AN8A 2HDMA 5IIFA 1PDQA 2XWJB 3NWTA 3J7YW 2H4OA 1EU3A 2QF7A 2WKDA 4KTAA 3MXGA 4ABNA 1SNOA 2J4XA 3DMUA 2LFNA 3CU7A 3PUWA 3Q23A 2AWNA 4IQZA 1JORA 1NSNS 1NCVA 5D3DA 3VR3A 3MA2B 4A3EB 4ZRZA 2L55A 2R61A 1G8ZD 3ERQA 1CI3M 1GXDC 1KNEA 2E75C 3WOEA 2O4XA 2VXWA 1ZYRD 2K5QA 4K5XA 1I6HB 4XDXA 3TZUA 4IUPA 1DOKA 4TQUS 2B2TA 1UUPA 3KLSX 1EY7A 3MHBA 2B2WA 2F0WA 5FK9C 1H9JA 3HZXA 3JAME 1O80A 1HRJA 2XIWA 3D4DA 3QB3A 2BA0A 1F2ZA 1ET9A 3J80L 3H94A 3GTJB 4RH6A 5C0XJ 5D3IB 4DNTB 5JVG3 5M5WB 2WP8J 2F0HA 2EYJA 4G7ZC 2D5DA 3HKZB 4CGYB 3TP5A 3GTPB 1YNJC 1CZWA 2HQEA 1TQOA 3K59A 1HA6A 4DGZA 5KYLA 5J1ZA 1KAAA 5CORA 2EYMA 2F0PA 5C3XA 5HURA 3D3RA 2XWBB 1EZ8A 3C1EA 2PW5A 5I2XA 4R8IA 1DD2A 2BE5C 3VR6A 2R7ZB 3GQBA 2E2IB 1GUSA 5DEHA 3S16B 4IFDG 3G7LA 4BA1I 2EYFA 1ENCA 1IKMA 3HS0C 3T53B 3QWNA 4B9XA 2IL8A 2QDBA 3FMCA 2VUMB 4MIUA 4RGNA 3Q22A 4PV1C 2HCCA 2ID0A 4RGMA 4X3SA 3E5SA 4N9TA 5CV9A 2A6EC 2WIIB 2F0OA 4IFDH 2N55A 2R93B 1NUCA 2F0IA 4F88A 4QF4A 2V4DA 4KJOA 2NZ1D 3GV6A 3S2DB 3OPOA 4XT3B 4HN7A 2D9UA 5D14A 3VYSA 1QJOA 3M7NA 2L11A 2F4IA 1S5DD 1VF7A 2BA1A 4LK1C 1D6EC 2A5HA 1VDZA 3DUZA 1IL8A 2QCPX 3LX0A 4Y7NB 3I4NB 3BDCA 3DEOA 3FPPA 5JVH3 4CHTB 4ZUIA 1LT6D 4NDXA 3S1RB 2K01A 1H9SA 4HSPA 5EPLA 4IUQA 1HHVA 3K57A 1BOSA 2A69D 1EEFD 2A73B 3M7GA 2JEAI 3K0YA 3MXPA 4C3JG 4DFAA 5I9OA 2XVSA 4TSSA 1JOKA 3K5MA 4HSVA 4K2KA 1K8OA 1LTRD 3HOVB 3V05A 2JEBI 1RDPD 2R92B 3OMCA 4MN3A 3VR5A 2B39A 1SDFA 2F0UA 5KEEA 4IUNA 4RAUC 4K8IA 4KKSA 2IPKD 1ICWA 2WAQB 1PLFA 3A54A 4LJZC 2Q8IB 4H7BA 3NK9A 4O42A 2VB2X 3ZYYX 4FP5D 2DY7A 2G9DA 3PIP3 5ELBA 5ELFA 5FO8B 3S1QB 1QWYA 1KDBA 3W3AA 1QOHA 1SEBD 1EQTA 1RCVD 1TY2A 2OXPA 1OXSC 4EQOA 1M8AA 3MEHA 2IT1A 4HCSA 4OO1I 2F0MA 4ULLA 1HXYD 1K83B 1U4RA 2IJ0A 2BE5D 1S5FD 1ONLA 2EJFC 2PNRC 2LMCB 1F9SA 5J39A 3IAYA 2K05A 3MFGA 4XT1B 5JAVA 1SNMA 4K5WA 1PZID 3A56A 5FO7B 1W6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PV0 A;  4DNR B;  4OO1 H;  1TKW B;  3D4R A;  3QG1 A;  2D5D A;  4G7Z C;  2K32 A;  4DK1 A;  2ZT9 C;  1Y69 U;  2K7V A;  3VR4 A;  4TKO B;  1YNJ C;  2CW0 C;  1Y8P B;  1OXU A;  2O5I C;  2JE6 I;  2DN8 A;  2A69 D;  2O5J C;  3OW7 A;  1TU2 B;  4I7Z C;  4XIG S;  2A6H D;  2JEA I;  2EJG C;  1HPC A;  1V43 A;  2QF7 A;  3AB9 A;  4H44 C;  2A69 C;  3SE0 A;  4JBW A;  1K8O A;  5K36 H;  1VCI A;  1GUT A;  3BG3 A;  4KI0 A;  4JK1 C;  2KCC A;  4OGQ C;  3QIA A;  1B9N A;  2JEB I;  3LNN A;  3PUW A;  3PUZ A;  1OXV A;  1HQM C;  1E2V A;  1FR3 A;  2AWO A;  1DD2 A;  1O78 A;  2BE5 C;  1G29 1;  3VR6 A;  3VR5 A;  1Q1B A;  3GQB A;  5KND A;  3ND8 A;  1GUS A;  3RLF A;  3IFT A;  1I6V C;  3HGB A;  4RCN A;  4L8J A;  5BN5 A;  2PPB C;  4IFD G;  1PMR A;  1YNN C;  4IQZ A;  5BN3 A;  2A68 D;  3A8K E;  4BA1 I;  2PCF B;  3D31 A;  4H0L C;  1B9M A;  3M85 A;  2B8F A;  3P20 A;  1CTM A;  4KKS A;  3VR3 A;  3L7Z C;  3SDZ A;  4KKU A;  1Y8O B;  1E2Z A;  3A8I E;  3MFY A;  4KN7 C;  3T53 B;  1HTP A;  4LJZ C;  1GHK A;  1HCZ A;  2Q8I B;  1FYC A;  3A7A B;  3FMC A;  1CFM A;  4KKT A;  3M4Y A;  3A8J E;  5BN4 A;  2DNC A;  1IW7 D;  1CI3 M;  3PUY A;  4PV1 C;  1IW7 C;  4DK0 A;  4OO1 G;  2L5T A;  4GZY C;  2E75 C;  3NE5 B;  4XTC S;  4G7H C;  1V8Q A;  3IKJ A;  3W3A A;  1LAC A;  4H13 C;  2A6E C;  3DXJ C;  3CRK C;  3I72 A;  1Q12 A;  1Z6H A;  2R6G A;  3MXU A;  1GUG A;  1OXX K;  2A6H C;  1VF5 C;  3TZU A;  5C0X H;  3ND9 A;  4IFD H;  1DCZ A;  2F1M A;  4TQU S;  1EWH A;  1Y8N B;  4KN4 C;  1OXS C;  1Q1E A;  3VA7 A;  2A6E D;  1K8M A;  1SMY C;  2IT1 A;  3OOC A;  2D2C C;  2V4D A;  1Q90 A;  1OXT A;  3PUV A;  3OPO A;  3N6R A;  5K36 G;  1IYU A;  2BE5 D;  1GUO A;  1GHJ A;  2K33 A;  2DNE A;  3LWU A;  1ONL A;  2EJF C;  2JXM B;  3QJY A;  3WDN A;  1H9J A;  2PNR C;  1QJO A;  3CRL C;  2LMC B;  3M7N A;  2E76 C;  4KHZ A;  3GD7 A;  5A35 A;  1IYV A;  1VF7 A;  2A68 C;  2BA1 A;  1H9S B;  4LK1 C;  3I4L A;  1BDO A;  1DXM A;  3BDO A;  1T5E A;  2B8G A;  3EQL C;  1GJX A;  3T51 B;  3U9S A;  1VDZ A;  2EVB A;  3VR2 A;  2KA7 A;  2BA0 A;  1O7L A;  1LAB A;  4HR7 B;  2E74 C;  1H9M A;  2D62 A;  3KLR A;  1GUN A;  3T56 B;  1H9K A;  1A6X A;  2YYZ A;  4G7O C;  3H94 A;  5JEA G;  2AUJ D;  2NN6 I;  4KMU C;  4BA2 I;  2NN6 H;  3FPP A;  5C0X G;  1E2W A;  2AUK A;  2EDG A;  3PUX A;  2EJM A;  4DNT B;  1H9R A;  3I73 A;  5KNC A;  2NN6 G;  3A7L A;  1Z7T A;  5KNB A;  5JEA H;  2BDO A;  1ZKO A;  1H9S A;  1ZYR C; 
#chains in the Genus database with same CATH topology
 4DXG A;  4DK1 A;  1Y69 U;  1L2F A;  2NVY B;  1XPR A;  1FNV A;  1JWS D;  1Y1V G;  2RVL A;  2O5I C;  4BBR H;  3OW7 A;  2Z8L A;  3I56 A;  3G71 A;  1G6Z A;  3HOV G;  2PNH A;  1JJ2 A;  4CDF C;  1YNJ D;  4HMJ A;  1BCP D;  2VS1 A;  4ZYS A;  3T1Y L;  1UEA B;  1YJ9 A;  3BVZ A;  4CKC A;  3CF5 A;  2B2Y A;  1QUQ A;  1EYA A;  2LXK A;  3ONA B;  1SNC A;  1XPO A;  5EJW A;  3STB D;  2WAC A;  2F0V A;  1E2V A;  2B2W C;  3J81 i;  3QO2 A;  3CCM A;  4WJ4 A;  3LGJ A;  3HGB A;  2IY5 B;  3SGI A;  1W3S A;  2JSO A;  1CTM A;  1JOQ A;  2F0L A;  5IE8 A;  1XMO L;  1FNU A;  1IHZ A;  5CC4 A;  2M00 A;  1EIY B;  3HOV H;  5EQ0 A;  4DK3 C;  2F3W A;  1MD2 D;  5LL6 S;  4J1M A;  4BBR G;  1II3 A;  4A3I G;  1VQI A;  2K03 A;  3URY A;  2DNC A;  1PYW D;  5IGD A;  1HZC A;  3KYH C;  4KD3 A;  2HUG A;  1GO3 E;  3EFX D;  3CCJ A;  5IOD A;  3KJP A;  1U4L A;  3UDI A;  4YHH Q;  3HOX B;  3E6Z X;  1MSH A;  1YBY A;  2PQE A;  4M1U B;  2RBM A;  4UPA A;  3B6Y A;  2JA6 B;  3OOC A;  4EX5 A;  1OXT A;  1C4Q A;  1SYE A;  2L0C A;  3Q6S A;  2V1C C;  1KC8 C;  1AW7 A;  3W1B A;  3I90 A;  3NTK A;  2NVQ H;  4GKK Q;  4NXN Q;  2F0F A;  3FPU B;  3KJO A;  1TS2 A;  5AJ3 Q;  3G48 A;  3EVQ A;  4C3J B;  1K28 A;  3K7A H;  1IYV A;  3I4M B;  1X3F A;  1RJT A;  2UUA L;  3T51 B;  3S2H B;  1O7L A;  4B3S L;  1QVF A;  1CHQ D;  3T56 B;  3PQI A;  2KUM A;  4ZKC B;  2BOS A;  2NVT H;  4DR2 Q;  1E2W A;  2EDG A;  3PSI A;  3JAM L;  4OL7 A;  2OEO A;  3X3M A;  1H9R A;  1R4Q B;  3S9W A;  4GNX C;  1HJP A;  2X6L A;  1VMC A;  4LF9 Q;  2K32 A;  4ID6 A;  3F8T A;  1B3A A;  4DR1 Q;  4DR4 L;  5IGE A;  4FNF A;  2E2J B;  1VQP A;  4IAL A;  4A3M G;  3KF6 B;  1AFP A;  1NJI C;  1BBX C;  3R8B A;  1HTL D;  5JPN C;  2ENB A;  4OON A;  1I4G A;  5LL6 X;  4A3C G;  2E2J H;  4ZLT F;  2AQ1 B;  4C2M H;  1V1O A;  3O13 A;  3MXN A;  5H1S E;  1BUV T;  1FR3 A;  1JR0 D;  2F03 A;  4RMF A;  4RWS C;  4QIW B;  4TVA B;  4ZKB B;  2RSN A;  1TT2 A;  3TRZ A;  4LFC L;  4YHH L;  1E24 A;  4RKL A;  4DU9 A;  4C3H H;  1I4H A;  3VYT A;  1UNS A;  2L12 A;  3I91 A;  1SSO A;  4DV6 L;  4KY6 A;  5EKI A;  2NTS A;  1E2Z A;  4JI2 Q;  3BZC A;  1KHI A;  2BH8 A;  3HOY G;  3MZ5 A;  5EKK A;  1XYI A;  1E1O A;  3PUY A;  1SNP A;  1EOT A;  3U58 A;  4IUR A;  5C3E G;  1M1K C;  1BBW A;  2HQL A;  2I46 A;  2VQE Q;  3C46 A;  4DAV A;  3CCS A;  4H13 C;  1NY4 A;  3CD6 A;  1GUG A;  5FOB B;  1L1O A;  5C0X H;  5IGF A;  3CCL A;  1S5E D;  2KHS A;  3OSO A;  4R4T A;  1LTA D;  5CV5 A;  3FDT A;  5DLQ E;  1PYB A;  2DGY A;  3KF8 A;  1ET6 A;  1GVP A;  4JI6 L;  2N3S A;  1MIU A;  3PMF A;  4AQY L;  2DNE A;  1XMQ L;  3NBH B;  2CFM A;  1A3U A;  2E76 C;  4LF6 L;  5JOB A;  4QCL A;  1FNW A;  1QZG A;  4KV6 A;  4MHE A;  2UXB Q;  3U9S A;  1VQE A;  1GKH A;  2EVB A;  4OXP A;  4LF8 Q;  4X6A H;  1O7I A;  1TXY A;  1A6X A;  2YYZ A;  3J80 i;  5JEA G;  1B44 D;  2NN6 H;  1JB3 A;  5ELN A;  3BZK A;  4X66 Q;  4L63 B;  5ELC A;  4GNX A;  5KNC A;  3CKI B;  2IX0 A;  4DUY L;  1ILQ A;  3U9O A;  3T13 A;  4K8J A;  3J81 L;  5M3F G;  2KOL A;  4A3M B;  4DNR B;  5KRU A;  1EYC A;  3H09 A;  4LF5 L;  4HIM A;  2E2H H;  2Z9H A;  1XMO Q;  4A76 A;  3DWA A;  2EJG C;  1PRT D;  2CW0 D;  2R92 G;  3HOY B;  1D5X C;  4A3G H;  2I5M X;  4N8X 1;  3SHL A;  2UXC L;  3ULP A;  3TS0 A;  1EY8 A;  2B63 G;  2ICE C;  1B4O A;  1Q8I A;  1HQM C;  4LW1 A;  2A1A A;  1T5X D;  1PZJ D;  2KVM A;  1KLG D;  1W6J A;  5D65 A;  1Q1B A;  3I4N H;  1ICF B;  3RLF A;  3KLW A;  5A2Q E;  4QIW E;  1HR0 Q;  4K2L A;  5DM6 3;  1ENA A;  4JW0 A;  3M85 A;  5E3F A;  3R2I A;  2JK8 A;  2HCI A;  3D8G A;  4B08 A;  4RKB A;  1QE6 A;  4QGU A;  2B2V C;  4JC0 A;  1WTQ A;  1XJV A;  1HCZ A;  4HJ5 A;  3HOZ G;  2BDN A;  1STY A;  3NEN A;  3PO3 B;  2VY3 A;  5E4W C;  3S14 B;  1TS5 A;  3NE5 B;  4G7H C;  1K0S A;  2FJ2 A;  2JJQ A;  1DYQ A;  5I6W A;  4Q0F A;  1S5B D;  2B2U C;  4RFB A;  1TWA B;  2NUC A;  2ZM6 Q;  2NWG A;  2QW7 A;  3M3Y H;  1EWH A;  5EPJ A;  2A6E D;  5IP7 G;  2ZJR A;  3P1H A;  1EQV A;  1CKN A;  1GHJ A;  2K04 A;  2Q8R E;  4A3F G;  2AQ2 B;  3NXW A;  1LTI D;  2B8G A;  3I70 A;  2KBN A;  4CJ2 C;  3P75 A;  4YWL A;  4IFD I;  1C48 A;  1SMX A;  1PA6 A;  1LAB A;  2ZXP A;  3DWQ A;  1GOZ A;  1I3Q B;  5EPK A;  1LTS D;  1UEB A;  2R7Z H;  4G7O C;  3OWE B;  4R4I A;  3VA5 A;  3ERS X;  1PH8 A;  1YHA A;  4G57 A;  1TWF B;  4UDU C;  3R2T A;  4F7X A;  4NMZ A;  4KD4 A;  1LV9 A;  2F3V A;  2BDO A;  5E1F A;  3HOW B;  1TKW B;  2IX1 A;  2EZV A;  3C2P A;  4TKO B;  3UDF A;  3HOX H;  3HOU H;  1OXU A;  3NBI A;  2PO4 A;  2UUA Q;  2A6H D;  2H5X A;  3QOJ A;  4DV7 L;  3S14 H;  2L1B A;  2F4V Q;  1DJR D;  2GN5 A;  2A69 C;  1P16 A;  2E2I H;  4JK1 C;  2R93 G;  2J0T D;  2OT2 A;  1RF2 D;  4BY7 H;  1BNZ A;  4L5S A;  2KEC A;  1I4P A;  1CKM A;  1ML0 D;  2DJF C;  5JEA J;  5M3M H;  4A3F B;  2PMZ B;  1TWH H;  1EL0 A;  3QR8 A;  1WVL A;  4B3M Q;  4DR1 L;  3KBX A;  2MP1 A;  4PZ6 A;  1KLU D;  3NP8 A;  4PMW A;  1KDC A;  1T9H A;  3HKZ G;  3CCR A;  4KKU A;  3RD4 A;  3F2U A;  4S3S A;  3A8I E;  4PZ8 A;  4JI6 Q;  2OF1 A;  1QUQ B;  5GAD C;  1VQL A;  1XNR Q;  1KIX A;  4AQY Q;  3HOY H;  1MI2 A;  2R7F A;  3M4Y A;  5T1I A;  4GOP C;  2NZH A;  4FXD A;  3L9A X;  1I50 H;  5M5W H;  4LF7 Q;  2L5T A;  1CKN B;  4UHV A;  2J7Z A;  3DHQ A;  2IHE A;  3S2H H;  2FMM A;  4C3H G;  1QVC A;  3CAM A;  5GQO A;  1PYS B;  4J15 A;  1SE2 A;  3CPF A;  5CV7 A;  1Y8N B;  4MTK A;  4X3K A;  2A8V A;  1JCK B;  1K8M A;  1SMY C;  3H0G B;  3W5O A;  4X66 L;  4K5V A;  2CWP A;  1L0Y B;  1HH2 P;  4IJL A;  1F9P A;  1JJG A;  2GA4 B;  4A3C H;  5C4X H;  3KBG A;  4FF4 A;  3BDL A;  1PTO C;  5FO9 B;  3HP3 A;  3GTG B;  4AH6 A;  1VMP A;  4FYD A;  1EY0 A;  1J9O A;  4KHZ A;  4M8A A;  4LUO A;  1IBK Q;  1EQQ A;  1HZB A;  4A3M H;  3MWY W;  4DAY B;  5CV8 A;  1X55 A;  5F2D A;  1K3R A;  4NP5 A;  3FKI G;  3KLR A;  5G3L F;  1FL0 A;  1XX8 A;  3DEP A;  1Y1V B;  4DUZ Q;  1EU4 A;  2AUK A;  1IBK L;  2JA5 H;  1ZEQ X;  3HKS A;  4P71 A;  4C1N I;  2NVX B;  1KRT A;  2XSC A;  1N33 L;  4IZ8 A;  3L3O C;  1DON A;  1V1P B;  4C3I H;  4LFB Q;  3HEJ A;  4B3S Q;  1KQS A;  3NBH A;  4Z9C B;  3FEW X;  3BVG A;  2YTV A;  1IBL L;  2JA7 B;  2B63 B;  1STG A;  1L1O C;  3GTM H;  1XXG A;  4WOR A;  4DUZ L;  4BBS G;  4GLX A;  4JYA Q;  1VQ9 A;  4A3B H;  1VCI A;  1PH2 A;  4OGQ C;  4R4O A;  1D5Z C;  3SXH A;  1G6P A;  1X3P A;  4L5Q A;  1LM0 A;  3D6W A;  1EYD A;  1O7Y A;  4YCU A;  4RCN A;  4L8J A;  1LT5 D;  4APV A;  2LS0 1;  3KK7 A;  1NR2 A;  3CXC A;  4DV0 L;  4LNQ A;  3D31 A;  3FHW A;  4H0L C;  4JI5 Q;  3CC7 A;  2WKC A;  3A55 A;  3EA6 A;  1HZA A;  4BBS H;  1Z47 A;  3MAQ A;  1GHK A;  4R4C A;  2XN9 C;  1N32 Q;  2Q2H A;  1IW7 D;  1ASZ A;  3AEV A;  1PTO H;  2ZTC A;  1XNQ L;  4KLK A;  4JI8 L;  3SR1 A;  4XTC S;  4X64 L;  1S4Z A;  3IKJ A;  4MNO A;  4A93 G;  2X6G A;  3K7U C;  5HGQ A;  1MJC A;  3OIP A;  2JYO A;  1LTT D;  2I5H A;  4HMI A;  2KQ3 A;  3CHB D;  1HA5 A;  1D5M C;  1KDA A;  4K6L A;  5M5Y B;  1A0I A;  5JJK A;  1VQJ A;  1K83 H;  1XTD A;  3TEH B;  1I94 Q;  4ZK9 B;  2HD3 A;  3OHX C;  2MGS A;  2QGQ A;  1CQF A;  5CGK A;  3GD7 A;  2X69 A;  2BH2 A;  3I4M H;  4IUU A;  5G3L D;  2FFK B;  3H91 A;  1BCP F;  2OTL A;  4OHJ A;  4HR7 B;  1X3Q A;  4A3E G;  3K8A A;  3R3O A;  2O2L D;  3KF8 B;  2G9H D;  2ZJQ A;  4NXN L;  3JAM c;  1X56 A;  3PUX A;  2EJM A;  4OIJ A;  5BR8 L;  1HNW Q;  4IOA A;  5KNB A;  1CUK A;  2KEE A;  3SK5 A;  3MVV A;  5E4X A;  1DZ1 A;  1K8A C;  1LLR D;  4IPC A;  4F8M A;  4FXG C;  4O1N A;  4PMC A;  2ZT9 C;  3VR4 A;  4DNI A;  3EJI A;  1RD9 D;  2XRQ D;  3EN2 A;  1R9T B;  2JE6 I;  2R7D A;  2QEX A;  1G2T A;  1D1K A;  4JI4 L;  1SE4 A;  1I5F A;  2N78 A;  3K5N A;  2EOT A;  3AB9 A;  2NBF A;  3HOZ B;  3GTL B;  5JJI A;  2WFW A;  1L0X B;  1AZP A;  4C2M B;  4DV2 L;  1EY9 A;  3PUZ A;  3UI2 A;  4KHP L;  3D6C A;  1OXV A;  5CV4 A;  1SMY D;  1STN A;  1SJE D;  4JI4 Q;  5KND A;  4A3J G;  4HED A;  3IFT A;  1SYG A;  2R93 H;  5E7N A;  5GAH C;  1B1Z A;  3AU7 A;  3J81 c;  1LT3 D;  4X3T A;  4BS9 A;  5FLX L;  1PH7 A;  4DV2 Q;  1CQV A;  2AQ3 B;  2QEJ C;  3S1R H;  1CK1 A;  2BCO A;  3BYY B;  2JP1 A;  5DNF A;  3J81 E;  2NVT B;  4EQ5 A;  4L6T B;  1A2U A;  3S1N B;  1IZ6 A;  3HOU B;  1STB A;  1IW7 C;  1QCB D;  3HOW G;  4DF7 A;  2NZO A;  2PYK A;  4F87 A;  4AYB G;  4DV5 Q;  3M4O H;  2VZA A;  4XXE A;  3DXJ C;  2FIN B;  2CCZ A;  1V1P A;  2R6G A;  3V96 A;  4JI2 L;  2EYP A;  5M5X B;  4JBM A;  1S3O A;  3ND9 A;  3CCV A;  1WD1 A;  2F1M A;  5M5X H;  4GKJ L;  5IT9 E;  4R9W A;  4DV3 L;  1E3P A;  4XYO A;  4V19 0;  3H3V H;  4LF8 L;  3CC2 A;  3PUV A;  1TWG B;  4G4K A;  1XNR L;  4RA8 A;  1E7Z A;  4A3F H;  2RCN A;  4XQJ A;  3Q0A A;  2QA4 A;  2I07 B;  1HZ9 A;  4FDB A;  2JXM B;  2KHI A;  3QJY A;  4LFB L;  1TWG H;  5IT9 L;  2EXD A;  2KJX A;  1KAB A;  2A68 C;  1HNW L;  1B70 B;  5CBE E;  3J80 E;  5GAE C;  1U5K A;  3T4A C;  3BVM A;  2E2D C;  4K14 A;  2KA7 A;  4KK7 A;  2F0S A;  2ZM6 L;  1WOC A;  4CKB A;  3RLN A;  1WI5 A;  5IP7 H;  3BS1 A;  1PTO B;  1WTP A;  3M4O B;  1WCM H;  5I2Y A;  4QQB X;  2IHF A;  1Z7T A;  4N9P A;  1CZG A;  4IUT A;  1SFO B;  4DAY A;  5IOC A;  2HIX A;  5GRO A;  1AZQ A;  1JWU D;  1STA A;  3E9I A;  4YY3 Q;  5IWA L;  4X62 Q;  2VQF L;  4Q5V A;  1HR0 L;  4DN4 M;  3CME A;  1XWE A;  2QDL A;  4DV6 Q;  2H1E A;  5LMU L;  2KCC A;  4H02 A;  1S5C D;  1AE2 A;  2RA4 A;  1KXL A;  4DV5 L;  3TBI B;  3U4Z A;  3UDX A;  4I7A A;  1LUZ A;  3GP7 A;  1MBY A;  1I6V C;  2B63 H;  2C35 B;  1EUJ A;  2L9H A;  1WYD A;  4ILW A;  4EQN A;  2PCF B;  1B9M A;  1STE A;  3D4W A;  1JJC B;  2B8F A;  4JPB W;  3SDZ A;  1I4X A;  4JV5 Q;  1AH9 A;  1SJH D;  1NTG A;  4KN7 C;  5IGG A;  1F9Q A;  4DA2 A;  4JYA L;  5C4Z A;  2K28 A;  2E5L L;  1YI2 A;  3A8J E;  1RTN A;  3CCQ A;  4QL5 A;  4OO1 G;  1SYF A;  5C3W A;  4BXX G;  4YIJ A;  3FKI B;  1EIH A;  2EQS A;  3CRK C;  3OWF A;  2XRS D;  1Z6H A;  1Z9F A;  1N34 Q;  1BKB A;  1CSQ A;  2LY7 A;  1VQH A;  2SOB A;  3KLS A;  2D2C C;  1QNK A;  5ELE A;  4BY7 B;  4KHV A;  3KFU A;  4KY7 A;  1EZ6 A;  5C4J H;  1SN8 A;  3ITP A;  1MSG A;  1SAP A;  1RTO A;  3WDN A;  3H0G G;  4X65 Q;  4O0A A;  4X64 Q;  3J81 j;  4CJ1 B;  4FXK C;  3BDO A;  3EQL C;  2PI2 A;  1FVI A;  3SVM A;  3VR2 A;  4DR7 Q;  1PTO F;  4V0B A;  1B8A A;  4Y7N H;  5CBA E;  5C44 H;  1A3T A;  3E0J A;  2F0T A;  3IFD A;  5C0X G;  3S17 B;  4KHP Q;  5EBC A;  1KNA A;  1WCM G;  2Q2T A;  2E2H B;  1AE3 A;  1UWV A;  3A7L A;  4HAE A;  3K7A B;  3OTO Q;  1RKN A;  1RIP A;  1HUN A;  5LHY 1;  1EY6 A;  1SBB B;  5C3E H;  3D4R A;  1TR5 A;  2JA5 B;  2YTY A;  3ERO A;  4ZQ3 A;  2LXJ A;  2JA8 H;  3W1G A;  5IYC H;  2PQA A;  2CH4 A;  1HNX L;  2DN8 A;  1TU2 B;  1VQ6 A;  1G91 A;  2B2T C;  2Y0S B;  2M9V A;  1V43 A;  4TRD A;  4HJ7 A;  1F2M A;  5COY A;  4CBV A;  3BG3 A;  4JI3 L;  1B9N A;  3LNN A;  3MXN B;  3PO2 H;  2MUY A;  5KIX A;  4JCV E;  3DWP A;  1G29 1;  2AHO B;  1N33 Q;  1PHJ A;  5GAG C;  2UUC Q;  2OQ0 A;  4RHR A;  1PH6 A;  4UP7 A;  3MTS A;  1H95 A;  1LTB D;  1QG7 A;  3HOW H;  2D0P A;  3L2P A;  1VS0 A;  3BJU A;  3V2T A;  1X32 A;  2KED A;  3DLL A;  1DGS A;  5FLX c;  1WFQ A;  1I4R A;  1XMQ Q;  1NMG A;  2DY8 A;  2XTI A;  3S16 H;  4GZY C;  1I50 B;  4LF6 Q;  3GTQ B;  1PH1 A;  5FLX E;  3GTP H;  3WWV A;  1NNX A;  2RKS A;  1Q82 C;  1TWC B;  3R93 A;  4A3J H;  1RL2 A;  3TQY A;  5CYU A;  3S15 H;  3I7F A;  1L1O B;  2ZJP A;  1N32 L;  1Y1W B;  5IYB G;  1EYG A;  2EY5 A;  5K5P A;  1XNQ Q;  1PH5 A;  4NW2 A;  1JIC A;  1Q46 A;  1ESF A;  2K52 A;  1EQR A;  2K33 A;  1EY5 A;  2RDG A;  1A2T A;  1X65 A;  3AMU A;  2Z0S A;  5HGT A;  1H9S B;  3I4L A;  2JA7 G;  5EBD A;  1EIG A;  1Y14 B;  2YV5 A;  4X62 L;  2G5D A;  3P7J A;  1W2B A;  4QY7 A;  1EFI D;  2K50 A;  3TZD A;  1UE5 A;  3I2Z A;  2AUJ D;  3BZD B;  1EWC A;  2CHB D;  2F0Q A;  3NUC A;  5AJ3 L;  1XPU A;  3KDF B;  2WAQ E;  2RHS B;  3NEL A;  3J7A F;  3TSS A;  5C3E B;  1BVS A;  1V9P A;  3PV0 A;  1IBM L;  4YCW A;  4EQP A;  2DJG C;  3HFZ B;  1VQO A;  3J7A V;  2XNA C;  2WV6 D;  2YU9 B;  2EY6 A;  4GOP B;  5IYD H;  1BO0 A;  1EEI D;  2LSS A;  2WB1 G;  3I4M G;  1AP0 A;  3TRE A;  3X3N A;  2OWO A;  1JC7 A;  4BY1 B;  1Q7Y C;  5I9P A;  1LT4 D;  4OEM B;  1GUT A;  4KI0 A;  3SK8 A;  1LYL A;  3BYT B;  2AWO A;  3G6E A;  4J8Q A;  1O78 A;  2B2V A;  1F77 A;  2CVR A;  2VB3 X;  5M9O A;  3ND8 A;  1I3Q H;  1YNN D;  1A63 A;  1MHW C;  1JOO A;  3T1Y Q;  4A93 H;  1QNU A;  3FRP B;  3P20 A;  2B29 A;  1Y8O B;  2E8G A;  3MC0 B;  4OEL B;  3GO5 A;  5NUC A;  3NPP A;  5IY0 A;  1CA6 A;  1BQQ T;  1STH A;  1FYC A;  1Y1V H;  4KKT A;  2PZU A;  5LMU Q;  4RGT A;  4BBR B;  1O7Z A;  3A5Z B;  1WTO A;  4DK0 A;  4MZ9 A;  2NB0 A;  5LMN W;  1SNQ A;  4XQQ A;  2Q2U A;  3I72 A;  1PXU A;  1K8G A;  1VF5 C;  4U68 A;  4HJ8 A;  3AYH B;  4KN4 C;  1Q1E A;  3D0F A;  1FJG L;  1JWM D;  2K5N A;  1A62 A;  1Q90 A;  4ME3 A;  4B3T Q;  4A3B B;  3N6R A;  5K36 G;  2FXQ A;  4ODG A;  4A3B G;  3STB C;  2F0J A;  1U0L A;  4R8N A;  3RMH A;  1PTO D;  4K0K Q;  4BBS B;  1SLJ A;  5A35 A;  5KGU A;  3T16 A;  3F2B A;  1ESR A;  1SYB A;  1PFN A;  1T5E A;  2KCN A;  4LFA L;  3TP7 A;  4A93 B;  3K5L A;  3F2C A;  3RZO B;  5FLM H;  1CA5 A;  3TP6 A;  2ASB A;  2MPM A;  5IGC A;  1SYC A;  2UU9 L;  2NVY H;  2P5Z X;  4WJW A;  3NQI A;  1BCP B;  1ZKO A;  2WIN B;  3KOJ A;  2NTT A;  4P2C B;  4HIO A;  3S1Q H;  4J6H A;  1JE4 A;  4BY1 H;  3GTO B;  2F0E A;  4A3L H;  1HPC A;  2SNM A;  2MHV A;  5EAY A;  1ILP A;  4H44 C;  3UE1 A;  1PZK D;  3ER0 A;  5CR3 A;  4HJA A;  1TS4 A;  1TS3 A;  1HQR D;  2FMC A;  4K6D A;  2A74 C;  3MEF A;  2Z1C A;  2RDF A;  5ELO A;  1LTG D;  2I5L X;  1DOM A;  1R4P B;  4OWW B;  1YEZ A;  2Z6B A;  3RLO A;  2F0D A;  3H6M A;  1WD0 A;  2PPB C;  1YNN C;  1WJJ A;  1BF4 A;  4XYQ A;  4FVM A;  1SE3 A;  2LKV A;  2WB1 E;  2VQF Q;  5A2Q L;  3OYY A;  2QIL A;  2SNS A;  4DPG A;  2PW7 A;  3RZD B;  2ES2 A;  4UAI A;  5BN4 A;  1MGS A;  3T1H L;  1I4Q A;  4LFC Q;  2UXC Q;  5C0X I;  4DXF A;  2K6A A;  4K0K L;  1E0B A;  1VQC A;  2PZT A;  1N36 Q;  5J3B A;  2FHT A;  1V8Q A;  1X9N A;  1I94 L;  1Q8K A;  1RHP A;  3GTK H;  2EXZ A;  3I8Z A;  5M3M G;  4ZAI A;  4NXM Q;  1SFO H;  3KDF A;  2EY2 A;  5ELD A;  3PCO B;  4IN3 A;  1J5E Q;  2N88 A;  5C6A A;  4JG2 A;  4NB3 A;  1WTR A;  3M9B A;  1B53 A;  3NTH A;  5LMN Q;  2HT1 A;  3TP8 A;  2VNU D;  1E1T A;  1GUO A;  1SE8 A;  3NEM A;  2CQO A;  1IBM Q;  3NTI A;  2B3G A;  4JI7 L;  2VL6 A;  4JI0 L;  1HFN A;  1DXM A;  1SR3 A;  3HOU G;  3HOX G;  3G6J B;  2Z4I A;  3PGZ A;  1WCM B;  3NQT A;  2E74 C;  1ZXT A;  3K5O A;  4NKL A;  1PH4 A;  1ENF A;  5T1G A;  4P75 A;  1ASY A;  3PO2 B;  2L4N A;  1CM9 A;  4A3I B;  1GD7 A;  4ME5 A;  2CH4 W;  5FKA C;  4BWG B;  3S1M H;  4OO1 H;  1WTW A;  2R3Z A;  5J22 A;  4JOI A;  1Y8P B;  1EFW A;  1NAP A;  3GTK B;  4CJ0 B;  2WAQ G;  3RUZ A;  1TY0 A;  1P8L A;  1YJN A;  1PRT B;  1SND A;  2VW9 A;  1FGU A;  4R4Q A;  2YU9 H;  4IPG A;  4JV5 L;  4DV1 L;  3CP0 A;  3CPW A;  3NHH A;  4I65 A;  2WB1 B;  4JI8 Q;  1A3V A;  1BR9 A;  3NWS A;  5DM7 3;  1Q3L A;  4FF3 A;  1LO5 D;  2EYH A;  5IWA Q;  1BXT A;  4LUV A;  4WRD A;  1XTC D;  5IT9 c;  4HCE A;  2K14 A;  2A68 D;  4CKE A;  1N36 L;  2N49 A;  2RHQ B;  3F2D A;  1FJG Q;  3PO3 H;  3S1M B;  4RGO S;  1WTV A;  1J6Q A;  3A7A B;  3HOZ H;  3SEB A;  3K80 C;  1J5E L;  1SYD A;  2Z4H A;  5M3F B;  1K3B C;  4C3I B;  1YJW A;  3J80 c;  3PIP A;  1DM0 B;  4P74 A;  3C3L A;  4ALP A;  1TWA H;  1QIL A;  4B3M L;  3I4N G;  4WFN 3;  4JI0 Q;  5I4D A;  3VA7 A;  5JJL A;  3S15 B;  1PFM A;  2KCM A;  4PZ7 A;  4KJN A;  2OQK A;  5IGB A;  3H15 A;  3OW2 A;  1D2B A;  4ZUJ A;  4E6I A;  1M4V A;  2ZXO A;  1VQK A;  2Y0S E;  3IRB A;  1G2S A;  3DM3 A;  1IYU A;  1DOL A;  3ICE A;  4A3G G;  5EKL A;  5C4H A;  2EY1 A;  3N52 A;  3PIO 3;  3CRL C;  3TDQ A;  1JT8 A;  3GTG H;  1GM5 A;  1X6O A;  4DR4 Q;  2C9O A;  2K5H A;  2EYO A;  3OTO L;  5C4X B;  1X54 A;  1GJX A;  3ULL A;  1TVX A;  3SK4 A;  2EPB A;  4R1J A;  1GUN A;  2MJ8 A;  4RCO A;  4KMU C;  4PQX A;  4BA2 I;  2UUB Q;  5EGT A;  4HID A;  1NR4 A;  2KCT A;  1F2Y A;  2NN6 G;  5JEA H;  1SXT A;  3LWE A;  4HTH A;  5C5L A;  3F1Z A;  5C4J B;  4WJ3 M;  2K7V A;  4GN5 A;  4AYB B;  2RDH A;  3RZO H;  4PNY A;  5C5M A;  4L5T A;  3PF5 A;  1U4P A;  2O5J C;  4XIG S;  1X3E A;  2Q8T A;  1JMC A;  1CT1 D;  1TII D;  1YNX A;  4XQN A;  2B2U A;  1VQM A;  2KHJ A;  3TN2 A;  3CCU A;  3HRZ C;  4JBW A;  4PG3 A;  4A3D B;  4QUF A;  4A3D H;  3QIA A;  4JBJ A;  2L15 A;  1IXR A;  5BR8 Q;  4FF1 A;  4DV7 Q;  3I3C A;  2M2L A;  5BN5 A;  3GTO H;  2C5C A;  3A8K E;  1SRO A;  3M4Q A;  2MQH A;  4KY5 A;  4JVZ A;  1YIJ A;  3MFY A;  4IO9 A;  1HNZ Q;  1HTP A;  4CDC C;  2AMC B;  2MO1 A;  2SEB D;  3FVQ A;  2IW3 A;  1CFM A;  1EOV A;  1L0W A;  3HG9 A;  1A15 A;  3SK6 A;  4OWT B;  5AFW A;  3K58 A;  3KF6 A;  3GTM B;  1CHP D;  4QUC A;  5CV6 A;  4C3H B;  3CQZ B;  1UE6 A;  4YCV A;  1OXX K;  4X65 L;  4P73 A;  4DR5 Q;  1Q81 C;  4C56 C;  4A3E H;  1K73 C;  3OIQ A;  5DAU A;  1B50 A;  1AEX A;  2RSO A;  4LMQ D;  1HUM A;  5JPM C;  2PI2 E;  3I4O A;  4QB4 A;  4C1N K;  1NE3 A;  4L5R C;  3LWU A;  2QKI C;  3C1F A;  1HFG A;  1C8C A;  1BCP C;  1MKH A;  4EGV A;  2ATW A;  2F0N A;  1PH9 A;  4LF5 Q;  1D7Q A;  3K6O A;  5TSS A;  1JQY D;  2F0K A;  2B2Y C;  2Q2I A;  2RQX A;  1U9R A;  3TME A;  2RCF A;  2I0Q A;  1C7Y A;  1IKL A;  1H9M A;  4ZCK A;  4QJF A;  2CQA A;  4FF2 A;  2EE1 A;  1EY4 A;  4IFD J;  3ZJY C;  4GKK L;  1YHQ A;  1PRT F;  1Y1W G;  2K1B A;  2VUM G;  3AFP A;  2K5D A;  3QG1 A;  3GV3 A;  3RN2 A;  4A3K B;  1FD7 D;  1N9W A;  2CW0 C;  1J8I A;  4U67 3;  4I7Z C;  4PMB A;  1OTC A;  4IJH A;  2NVQ B;  3NSW A;  2UU9 Q;  1PFB A;  4JI5 L;  3TS2 A;  3E9H A;  3SE0 A;  4DV4 L;  5K36 H;  3H3V C;  2K5W A;  3EIV A;  4GS3 A;  1QB5 D;  4DR2 L;  3J7A 5;  4LF7 L;  2ZXR A;  3S17 H;  1U4M A;  4DR3 L;  3VYU A;  5KYI A;  4DUY Q;  1IL2 A;  3UDG A;  4RHS A;  3QOL A;  1KTK A;  4QMG A;  4B3R L;  2OTJ A;  1TWH B;  1FGB D;  1PMR A;  4LAA A;  5BN3 A;  3GTJ H;  4OIK A;  3HKZ E;  4HIK A;  1QVG A;  4DV4 Q;  3L7Z C;  4YY3 L;  1YVC A;  2EYL A;  4DAP A;  3M3Y B;  3GTQ H;  4DR3 Q;  3VYR A;  5L37 A;  2IWH A;  4A3I H;  2A19 A;  4O2D A;  1F2L A;  4IUV A;  1ROD A;  1OO9 B;  2TMP A;  4C3I G;  3S2D H;  4X3U A;  1PRT C;  5M3M B;  4B3T L;  2JN4 A;  1N8R C;  4EVO A;  1LAC A;  3KUP A;  2VUM H;  1D1I A;  2JA5 G;  3OMG A;  1Q12 A;  3MXU A;  1Y1W H;  2A6H C;  2JA8 B;  3UE0 A;  2HDL A;  1WTX A;  2YTX A;  1DCZ A;  2K75 A;  2JQO A;  2PZW A;  3DM1 A;  1B2T A;  3VDY A;  4GLA C;  3FKI H;  2F0G A;  2SDF A;  1EIF A;  2TSS A;  1I6H H;  4Y52 H;  3AFQ A;  2MNA A;  4B9W A;  2Z6K A;  2MO0 A;  2IX3 A;  1GUW A;  3CMA A;  1UAP A;  5C4X G;  3U4V A;  5I6Y A;  4LF4 L;  4A3J B;  1BDO A;  5IYD G;  2CWA A;  3W2D A;  3K0X A;  1TWF H;  4JBK A;  3Q24 A;  1LTL A;  4A3G B;  3WOF A;  5LMN L;  2D62 A;  1MJE A;  4NXM L;  2K4K A;  1H9K A;  4N8F A;  5HY6 A;  4DV3 Q;  1VQB A;  1IBL Q;  2NN6 I;  3RZD H;  5CMD A;  3I73 A;  4JI7 Q;  4FO2 A;  1F9R A;  5JJZ A;  3IL8 A;  1ZYR C;  5C44 B;  1B7Y B;  4B3R Q;  3FP9 A;  5ISR A;  2ICI A;  2NYZ D;  1AN8 A;  2HDM A;  1QZH A;  5IIF A;  1PDQ A;  2JA7 H;  3GTL H;  2XWJ B;  3NWT A;  3J7Y W;  2H4O A;  1EU3 A;  5IP9 H;  1HNZ L;  2QF7 A;  2WKD A;  5FJ8 G;  4KTA A;  2K5V A;  3MXG A;  4GN4 B;  4ABN A;  1SNO A;  2J4X A;  4JI1 L;  4A4I A;  4CDD C;  3CC4 A;  3DMU A;  2LFN A;  1JB7 A;  1EWI A;  2EIF A;  3CU7 A;  3PUW A;  5IYB H;  3Q23 A;  4BY7 G;  2CKZ B;  3RR5 A;  4YWM A;  4CDE C;  2AWN A;  4A3D G;  4IQZ A;  1JOR A;  1NSN S;  1NCV A;  4A75 A;  2ZTE A;  5D3D A;  3VR3 A;  3MA2 B;  4A3E B;  3Q8D A;  2L55 A;  4ZRZ A;  1VQG A;  4AIM A;  2F4V L;  2R61 A;  4A3K G;  1G8Z D;  3ERQ A;  4NPS A;  1CI3 M;  1GXD C;  1KNE A;  2E75 C;  3WOE A;  2O4X A;  2VXW A;  4AYB E;  4P72 A;  1ZYR D;  2K5Q A;  1K9M C;  4K5X A;  1I6H B;  4XDX A;  3TZU A;  4IUP A;  1DOK A;  1VQ4 A;  4TQU S;  1BBU A;  2R7Z G;  2B2T A;  1VQD A;  4UP8 A;  1X3G A;  3PO2 G;  4LFA Q;  4IPH A;  1UUP A;  3KLS X;  1EY7 A;  3MHB A;  2UXD Q;  2B2W A;  2F0W A;  5FK9 C;  2JA6 G;  1H9J A;  1JE5 A;  4C3J H;  3HZX A;  2JA9 A;  2NVX H;  3JAM E;  1O80 A;  2AKW B;  2HHH L;  3M4P A;  1HRJ A;  5IYC G;  2JA8 G;  1A8V A;  2XIW A;  3D4D A;  3QB3 A;  2BA0 A;  2RF4 A;  1F2Z A;  1ET9 A;  3J80 L;  1VQ5 A;  3H94 A;  3GTJ B;  4RH6 A;  5C0X J;  5D3I B;  4DNT B;  3GDE A;  1YHB A;  5JVG 3;  5C44 G;  5M5W B;  2WP8 J;  1S72 A;  2F0H A;  2EYJ A;  1TWC H;  3PF4 A;  1CSP A;  1C9O A;  2D5D A;  3HKZ B;  4CGY B;  4G7Z C;  3TP5 A;  4IOC A;  3GTP B;  1YNJ C;  1CZW A;  2HQE A;  1C0A A;  1IYJ B;  1TQO A;  3K59 A;  1HA6 A;  2N8N A;  2UUB L;  4DGZ A;  5KYL A;  5J1Z A;  3PO3 G;  1KAA A;  3H0G H;  4LWC A;  5COR A;  2EYM A;  2F0P A;  5C3X A;  3AQQ A;  5HUR A;  3T1H Q;  1WTH A;  3D3R A;  2XWB B;  1VQA A;  1PFS A;  1EZ8 A;  3C1E A;  2PW5 A;  5I2X A;  4GLV B;  4R8I A;  1DD2 A;  3RN5 A;  2BE5 C;  3I55 A;  4YWK A;  3VR6 A;  2R7Z B;  3GQB A;  2E2I B;  1GUS A;  1G51 A;  5DEH A;  3S16 B;  3L0O A;  4IFD G;  3G7L A;  3U50 C;  4GKJ Q;  4BA1 I;  1V1Q A;  1HNX Q;  2EYF A;  2R92 H;  1SRU A;  2Y0S G;  1ENC A;  4BXX H;  1IKM A;  3HS0 C;  3BU2 A;  3T53 B;  3QWN A;  1NMF A;  4B9X A;  2IL8 A;  2QDB A;  3FMC A;  1PV4 A;  2UXD L;  2VUM B;  4OX9 Q;  3JC6 6;  4MIU A;  1D8L A;  4RGN A;  3Q22 A;  1VQ8 A;  4JI3 Q;  1E22 A;  4PV1 C;  2F52 A;  2HCC A;  2ID0 A;  4RGM A;  4X3S A;  3E5S A;  4N9T A;  5CV9 A;  5M3F H;  4GOP A;  2ZTD A;  2D0O A;  2A6E C;  2WII B;  2F0O A;  1M90 C;  2UUC L;  4HJ9 A;  4IFD H;  2N55 A;  2R93 B;  3J7Z C;  1NUC A;  2F0I A;  4F88 A;  4QF4 A;  2V4D A;  4KJO A;  2NZ1 D;  3GV6 A;  3S2D B;  3OPO A;  1UE1 A;  4XT3 B;  2OCE A;  4HN7 A;  2D9U A;  1KL9 A;  5D14 A;  4LF9 L;  3S1N H;  3VYS A;  1QJO A;  3M7N A;  2L11 A;  1KRS A;  2F4I A;  3ULJ A;  1PVO A;  1S5D D;  3G4S A;  1VF7 A;  2BA1 A;  4LK1 C;  1D6E C;  2A5H A;  1VDZ A;  3DUZ A;  4OWX B;  1IL8 A;  2QCP X;  2KEN A;  3LX0 A;  3EBE A;  4RG1 A;  4POF A;  1YIT A;  1R9T H;  4Y7N B;  3I4N B;  3BDC A;  3DEO A;  4JOI C;  4JI1 Q;  2GVB A;  1K0R A;  3FPP A;  5JVH 3;  4DAM A;  3CCE A;  4CHT B;  4ZUI A;  1LT6 D;  1UE7 A;  4POG A;  4NDX A;  3S1R B;  2K01 A;  1CKO A;  1H9S A;  1VQ7 A;  4HSP A;  5EPL A;  4IUQ A;  4DR7 L;  1HHV A;  3K57 A;  1BOS A;  4LF4 Q;  2A69 D;  1EEF D;  1YZ6 A;  3A5U A;  2A73 B;  3M7G A;  2JEA I;  3K0Y A;  3MXP A;  2PQA B;  4C3J G;  4DFA A;  5I9O A;  2JA6 H;  1VQF A;  1NBW A;  2XVS A;  4TSS A;  1JOK A;  3K5M A;  4HSV A;  4K2K A;  1K8O A;  1LTR D;  3HOV B;  3V05 A;  2JEB I;  4GN3 B;  1RDP D;  2VQE L;  5M5Y H;  2E5L Q;  2R92 B;  3OMC A;  4MN3 A;  4DR6 L;  4OX9 L;  1Q86 C;  3VR5 A;  2B39 A;  1SDF A;  2F0U A;  2XGT A;  5KEE A;  4IUN A;  4RAU C;  1N34 L;  2GVA A;  4K8I A;  4KKS A;  4DKA C;  2IPK D;  1ICW A;  4UP9 A;  3E3X A;  2ALY B;  2WAQ B;  3H3V I;  4A3L G;  3RNU A;  1PLF A;  3CW2 C;  3A54 A;  4LJZ C;  4A3K H;  4MTN A;  2Q8I B;  4H7B A;  3NK9 A;  4O42 A;  4DR6 Q;  2Z6K C;  4BY1 G;  3JAM i;  1VQN A;  2VB2 X;  1B3Q A;  3ZYY X;  4FP5 D;  2DY7 A;  2G9D A;  2MFI A;  5ELB A;  3PIP 3;  5ELF A;  3A74 A;  5FO8 B;  3S1Q B;  1QWY A;  1KDB A;  3W3A A;  2HHH Q;  1QOH A;  2UXB L;  3K81 C;  1SEB D;  1EQT A;  1RCV D;  2DUD A;  1PH3 A;  1KD1 C;  1TY2 A;  4DV0 Q;  2F3I A;  2OXP A;  3E0E A;  1OXS C;  4EQO A;  3CQZ H;  4GNX B;  5FLM G;  1M8A A;  3MEH A;  2IT1 A;  4HCS A;  4OO1 I;  2F0M A;  4ULL A;  1HXY D;  4DK6 C;  1K83 B;  1U4R A;  2IJ0 A;  2BE5 D;  2PMZ E;  1S5F D;  1ONL A;  5FJ8 H;  2EJF C;  1S40 A;  5IP9 G;  2PNR C;  2LMC B;  1F9S A;  5J39 A;  4DR5 L;  3IAY A;  2K05 A;  3MFG A;  4IPD A;  3S24 A;  1HR0 W;  4LUZ A;  4XT1 B;  2HIV A;  5JAV A;  3A0J A;  4UY8 C;  4DV1 Q;  1SNM A;  4K5W A;  1PZI D;  3A56 A;  3PIO A;  5FO7 B;  1KAW A;  1W6K A; 
#chains in the Genus database with same CATH homology
 4DXG A;  4DK1 A;  1Y69 U;  2NVY B;  1FNV A;  1JWS D;  2RVL A;  2O5I C;  3OW7 A;  2Z8L A;  1G6Z A;  1YNJ D;  4HMJ A;  1BCP D;  4ZYS A;  1UEA B;  3BVZ A;  4CKC A;  2B2Y A;  1EYA A;  3ONA B;  1SNC A;  5EJW A;  2WAC A;  2F0V A;  1E2V A;  2B2W C;  3QO2 A;  3HGB A;  2JSO A;  1CTM A;  1JOQ A;  2F0L A;  1FNU A;  1IHZ A;  5CC4 A;  2M00 A;  5EQ0 A;  2F3W A;  1MD2 D;  5LL6 S;  4J1M A;  1II3 A;  2K03 A;  3URY A;  2DNC A;  1PYW D;  5IGD A;  4KD3 A;  2HUG A;  3EFX D;  5IOD A;  1U4L A;  3HOX B;  3E6Z X;  1MSH A;  2PQE A;  4M1U B;  2RBM A;  2JA6 B;  3OOC A;  1OXT A;  1C4Q A;  1SYE A;  2L0C A;  3Q6S A;  1AW7 A;  3I90 A;  3NTK A;  2F0F A;  3FPU B;  1TS2 A;  3EVQ A;  4C3J B;  1IYV A;  3I4M B;  1RJT A;  3T51 B;  3S2H B;  1O7L A;  1CHQ D;  3T56 B;  2KUM A;  4ZKC B;  2BOS A;  1E2W A;  2EDG A;  3JAM L;  4OL7 A;  2OEO A;  3X3M A;  1H9R A;  1R4Q B;  3S9W A;  2X6L A;  1VMC A;  2K32 A;  4ID6 A;  1B3A A;  5IGE A;  4FNF A;  2E2J B;  4IAL A;  1AFP A;  1BBX C;  3R8B A;  1HTL D;  5JPN C;  2ENB A;  1I4G A;  5LL6 X;  4ZLT F;  2AQ1 B;  1V1O A;  3O13 A;  3MXN A;  1BUV T;  1FR3 A;  1JR0 D;  2F03 A;  4RWS C;  4QIW B;  4ZKB B;  2RSN A;  1TT2 A;  4RKL A;  4DU9 A;  1I4H A;  3VYT A;  1UNS A;  2L12 A;  3I91 A;  1SSO A;  4KY6 A;  5EKI A;  2NTS A;  1E2Z A;  3MZ5 A;  5EKK A;  1XYI A;  3PUY A;  1SNP A;  1EOT A;  4IUR A;  2I46 A;  3C46 A;  4DAV A;  4H13 C;  1GUG A;  5FOB B;  5C0X H;  5IGF A;  1S5E D;  2KHS A;  3OSO A;  1LTA D;  5CV5 A;  3FDT A;  3KF8 A;  1ET6 A;  3PMF A;  2DNE A;  1A3U A;  2E76 C;  5JOB A;  4QCL A;  1FNW A;  4KV6 A;  4MHE A;  3U9S A;  2EVB A;  1A6X A;  2YYZ A;  5JEA G;  1B44 D;  2NN6 H;  1JB3 A;  4L63 B;  5ELC A;  5KNC A;  3CKI B;  2IX0 A;  1ILQ A;  3U9O A;  3T13 A;  4K8J A;  3J81 L;  2KOL A;  4A3M B;  4DNR B;  5KRU A;  1EYC A;  3H09 A;  3DWA A;  2EJG C;  1PRT D;  2CW0 D;  3HOY B;  1D5X C;  3SHL A;  1EY8 A;  2ICE C;  1Q8I A;  1B4O A;  1HQM C;  1T5X D;  1PZJ D;  2KVM A;  1KLG D;  1W6J A;  5D65 A;  1Q1B A;  3RLF A;  5A2Q E;  4K2L A;  5DM6 3;  1ENA A;  3M85 A;  5E3F A;  3R2I A;  2HCI A;  3D8G A;  4B08 A;  4RKB A;  1QE6 A;  2B2V C;  1WTQ A;  1HCZ A;  2BDN A;  1STY A;  3PO3 B;  5E4W C;  3S14 B;  1TS5 A;  3NE5 B;  4G7H C;  2FJ2 A;  1DYQ A;  5I6W A;  4Q0F A;  1S5B D;  2B2U C;  4RFB A;  1TWA B;  2NUC A;  2NWG A;  1EWH A;  5EPJ A;  2A6E D;  3P1H A;  1EQV A;  1GHJ A;  2K04 A;  2Q8R E;  2AQ2 B;  3NXW A;  1LTI D;  2B8G A;  3I70 A;  4CJ2 C;  3P75 A;  4IFD I;  1C48 A;  1LAB A;  2ZXP A;  3DWQ A;  1GOZ A;  1I3Q B;  5EPK A;  1LTS D;  4G7O C;  3OWE B;  3VA5 A;  4G57 A;  1TWF B;  4UDU C;  3R2T A;  4F7X A;  4NMZ A;  4KD4 A;  1LV9 A;  2F3V A;  2BDO A;  5E1F A;  3HOW B;  1TKW B;  2IX1 A;  2EZV A;  3C2P A;  4TKO B;  1OXU A;  3NBI A;  2PO4 A;  2A6H D;  3QOJ A;  2L1B A;  1DJR D;  2A69 C;  4JK1 C;  2J0T D;  2OT2 A;  1RF2 D;  1BNZ A;  2KEC A;  1I4P A;  1ML0 D;  5JEA J;  4A3F B;  2PMZ B;  1EL0 A;  1WVL A;  3KBX A;  2MP1 A;  1KLU D;  3NP8 A;  4PMW A;  1KDC A;  4KKU A;  3RD4 A;  3F2U A;  4S3S A;  3A8I E;  2OF1 A;  1MI2 A;  3M4Y A;  5T1I A;  4FXD A;  3L9A X;  2L5T A;  2J7Z A;  3DHQ A;  2FMM A;  4C3H G;  1SE2 A;  5CV7 A;  1Y8N B;  4X3K A;  1JCK B;  1K8M A;  1SMY C;  3H0G B;  4K5V A;  1L0Y B;  1F9P A;  2GA4 B;  3KBG A;  4FF4 A;  3BDL A;  5FO9 B;  1PTO C;  3GTG B;  3HP3 A;  4FYD A;  1VMP A;  1EY0 A;  1J9O A;  4KHZ A;  4M8A A;  3MWY W;  5CV8 A;  5F2D A;  4NP5 A;  3KLR A;  5G3L F;  1XX8 A;  3DEP A;  1Y1V B;  1EU4 A;  2AUK A;  1ZEQ X;  4C1N I;  2NVX B;  2XSC A;  4IZ8 A;  3L3O C;  1DON A;  1V1P B;  3HEJ A;  3NBH A;  4Z9C B;  3FEW X;  3BVG A;  2JA7 B;  2B63 B;  1STG A;  1XXG A;  4WOR A;  1VCI A;  4OGQ C;  1D5Z C;  3SXH A;  1X3P A;  3D6W A;  1EYD A;  1O7Y A;  4RCN A;  4L8J A;  1LT5 D;  2LS0 1;  3KK7 A;  1NR2 A;  3D31 A;  4H0L C;  2WKC A;  3A55 A;  3EA6 A;  1Z47 A;  3MAQ A;  1GHK A;  2XN9 C;  1IW7 D;  1PTO H;  3SR1 A;  4XTC S;  1S4Z A;  3IKJ A;  2X6G A;  3OIP A;  2JYO A;  1LTT D;  4HMI A;  2KQ3 A;  3CHB D;  1HA5 A;  1D5M C;  1KDA A;  4K6L A;  5M5Y B;  4ZK9 B;  3OHX C;  2MGS A;  1CQF A;  5CGK A;  3GD7 A;  2X69 A;  4IUU A;  5G3L D;  2FFK B;  3H91 A;  1BCP F;  4OHJ A;  4HR7 B;  1X3Q A;  3R3O A;  2O2L D;  2G9H D;  3PUX A;  2EJM A;  4OIJ A;  5KNB A;  2KEE A;  3SK5 A;  3MVV A;  5E4X A;  1DZ1 A;  1LLR D;  4F8M A;  4FXG C;  4O1N A;  4PMC A;  2ZT9 C;  3VR4 A;  3EJI A;  1RD9 D;  2XRQ D;  1R9T B;  2JE6 I;  1G2T A;  1D1K A;  1SE4 A;  3K5N A;  2EOT A;  3AB9 A;  2NBF A;  3HOZ B;  3GTL B;  1AZP A;  1L0X B;  4C2M B;  1EY9 A;  3PUZ A;  3UI2 A;  3D6C A;  1OXV A;  5CV4 A;  1SMY D;  1STN A;  1SJE D;  5KND A;  4HED A;  3IFT A;  1SYG A;  1B1Z A;  3AU7 A;  1LT3 D;  4X3T A;  4BS9 A;  5FLX L;  1CQV A;  2AQ3 B;  2QEJ C;  1CK1 A;  2BCO A;  3BYY B;  2JP1 A;  5DNF A;  3J81 E;  2NVT B;  4L6T B;  1A2U A;  3S1N B;  3HOU B;  1STB A;  1IW7 C;  1QCB D;  4DF7 A;  2PYK A;  4F87 A;  4XXE A;  3DXJ C;  2FIN B;  1V1P A;  2R6G A;  3V96 A;  2EYP A;  5M5X B;  3ND9 A;  1WD1 A;  2F1M A;  5IT9 E;  4R9W A;  4XYO A;  4V19 0;  3PUV A;  1TWG B;  4G4K A;  4RA8 A;  4XQJ A;  3Q0A A;  2I07 B;  2JXM B;  3QJY A;  5IT9 L;  2KJX A;  1KAB A;  2A68 C;  5CBE E;  3J80 E;  3T4A C;  3BVM A;  2E2D C;  4K14 A;  2KA7 A;  4KK7 A;  2F0S A;  4CKB A;  3BS1 A;  1PTO B;  1WTP A;  3M4O B;  5I2Y A;  1Z7T A;  4N9P A;  1CZG A;  4IUT A;  1SFO B;  4DAY A;  5IOC A;  1AZQ A;  1JWU D;  1STA A;  4Q5V A;  4DN4 M;  1XWE A;  2H1E A;  2KCC A;  1S5C D;  2RA4 A;  3TBI B;  3GP7 A;  1MBY A;  1I6V C;  4EQN A;  2L9H A;  4ILW A;  2PCF B;  1B9M A;  1STE A;  3D4W A;  2B8F A;  3SDZ A;  1I4X A;  1SJH D;  4KN7 C;  5IGG A;  1F9Q A;  4DA2 A;  5C4Z A;  2K28 A;  3A8J E;  1RTN A;  4OO1 G;  1SYF A;  5C3W A;  4YIJ A;  3FKI B;  1EIH A;  3CRK C;  3OWF A;  2XRS D;  1Z6H A;  2LY7 A;  2SOB A;  3KLS A;  2D2C C;  1QNK A;  5ELE A;  4BY7 B;  4KHV A;  4KY7 A;  1EZ6 A;  3ITP A;  1MSG A;  1SAP A;  1RTO A;  3WDN A;  4CJ1 B;  4FXK C;  3BDO A;  3EQL C;  3SVM A;  3VR2 A;  1PTO F;  4V0B A;  5CBA E;  1A3T A;  3E0J A;  2F0T A;  3IFD A;  5C0X G;  3S17 B;  5EBC A;  1KNA A;  2E2H B;  3A7L A;  4HAE A;  3K7A B;  1RKN A;  1HUN A;  5LHY 1;  1EY6 A;  1SBB B;  3D4R A;  1TR5 A;  2JA5 B;  3ERO A;  4ZQ3 A;  2DN8 A;  1TU2 B;  1G91 A;  2B2T C;  2Y0S B;  2M9V A;  1V43 A;  4TRD A;  1F2M A;  5COY A;  4CBV A;  3BG3 A;  1B9N A;  3LNN A;  2MUY A;  5KIX A;  3DWP A;  1G29 1;  4RHR A;  3MTS A;  1LTB D;  1QG7 A;  3V2T A;  1X32 A;  2KED A;  1I4R A;  2DY8 A;  4GZY C;  1I50 B;  3GTQ B;  5FLX E;  2RKS A;  1TWC B;  3R93 A;  5CYU A;  1Y1W B;  2EY5 A;  5K5P A;  4NW2 A;  1JIC A;  1ESF A;  2K33 A;  1EY5 A;  2RDG A;  1A2T A;  3AMU A;  5HGT A;  1H9S B;  3I4L A;  5EBD A;  1EIG A;  3P7J A;  1EFI D;  3TZD A;  2AUJ D;  3BZD B;  1EWC A;  2CHB D;  2F0Q A;  3NUC A;  3J7A F;  3TSS A;  5C3E B;  3PV0 A;  4EQP A;  3J7A V;  2XNA C;  2WV6 D;  2YU9 B;  2EY6 A;  1BO0 A;  1EEI D;  1AP0 A;  3X3N A;  1JC7 A;  4BY1 B;  5I9P A;  1LT4 D;  1GUT A;  4KI0 A;  3SK8 A;  3BYT B;  2AWO A;  4J8Q A;  1O78 A;  2B2V A;  1F77 A;  2CVR A;  2VB3 X;  5M9O A;  3ND8 A;  1YNN D;  1JOO A;  1QNU A;  3FRP B;  3P20 A;  1Y8O B;  3MC0 B;  3GO5 A;  5NUC A;  3NPP A;  1CA6 A;  1BQQ T;  1STH A;  1FYC A;  4KKT A;  2PZU A;  4RGT A;  4BBR B;  1O7Z A;  1WTO A;  4DK0 A;  2NB0 A;  1SNQ A;  4XQQ A;  3I72 A;  1PXU A;  1VF5 C;  4U68 A;  4KN4 C;  1Q1E A;  1JWM D;  1Q90 A;  4A3B B;  3N6R A;  5K36 G;  4ODG A;  2F0J A;  4R8N A;  3RMH A;  1PTO D;  4BBS B;  5A35 A;  5KGU A;  3T16 A;  1ESR A;  1SYB A;  1PFN A;  1T5E A;  2KCN A;  3TP7 A;  4A93 B;  3K5L A;  3RZO B;  1CA5 A;  3TP6 A;  2MPM A;  5IGC A;  1SYC A;  4WJW A;  3NQI A;  1BCP B;  1ZKO A;  2WIN B;  2NTT A;  4P2C B;  4J6H A;  1JE4 A;  3GTO B;  2F0E A;  1HPC A;  2SNM A;  2MHV A;  1ILP A;  4H44 C;  1PZK D;  5CR3 A;  1TS4 A;  1TS3 A;  1HQR D;  2FMC A;  4K6D A;  2A74 C;  2Z1C A;  2RDF A;  1LTG D;  1DOM A;  1R4P B;  2F0D A;  3H6M A;  1WD0 A;  2PPB C;  1YNN C;  1BF4 A;  4XYQ A;  4FVM A;  1SE3 A;  2LKV A;  5A2Q L;  2QIL A;  2SNS A;  2PW7 A;  3RZD B;  4UAI A;  5BN4 A;  1MGS A;  1I4Q A;  5C0X I;  4DXF A;  2K6A A;  1E0B A;  2PZT A;  2FHT A;  1V8Q A;  1RHP A;  2EXZ A;  3I8Z A;  4ZAI A;  2EY2 A;  5ELD A;  4IN3 A;  2N88 A;  5C6A A;  1WTR A;  1B53 A;  3NTH A;  3TP8 A;  2VNU D;  1GUO A;  3NTI A;  1HFN A;  1DXM A;  3G6J B;  2Z4I A;  1WCM B;  3NQT A;  2E74 C;  1ZXT A;  3K5O A;  4NKL A;  1ENF A;  5T1G A;  3PO2 B;  2L4N A;  1CM9 A;  4A3I B;  4ME5 A;  5FKA C;  4BWG B;  4OO1 H;  1WTW A;  2R3Z A;  5J22 A;  1Y8P B;  1NAP A;  3GTK B;  4CJ0 B;  3RUZ A;  1TY0 A;  1PRT B;  1SND A;  3NHH A;  4I65 A;  2WB1 B;  1A3V A;  1BR9 A;  3NWS A;  5DM7 3;  1Q3L A;  4FF3 A;  1LO5 D;  2EYH A;  1BXT A;  4WRD A;  1XTC D;  4HCE A;  2A68 D;  4CKE A;  3S1M B;  4RGO S;  1WTV A;  3A7A B;  3SEB A;  1SYD A;  2Z4H A;  5M3F B;  4C3I B;  1DM0 B;  3C3L A;  1QIL A;  4WFN 3;  5I4D A;  3VA7 A;  3S15 B;  1PFM A;  4KJN A;  5IGB A;  1D2B A;  4ZUJ A;  4E6I A;  1M4V A;  2ZXO A;  1G2S A;  1IYU A;  1DOL A;  5EKL A;  5C4H A;  2EY1 A;  3N52 A;  3PIO 3;  3CRL C;  3TDQ A;  2C9O A;  5C4X B;  2EYO A;  1GJX A;  1TVX A;  3SK4 A;  2EPB A;  1GUN A;  2MJ8 A;  4RCO A;  4KMU C;  4PQX A;  4BA2 I;  5EGT A;  1NR4 A;  1F2Y A;  2NN6 G;  5JEA H;  1SXT A;  3LWE A;  4HTH A;  5C5L A;  5C4J B;  2K7V A;  4AYB B;  2RDH A;  4PNY A;  5C5M A;  1U4P A;  2O5J C;  4XIG S;  2Q8T A;  1CT1 D;  1TII D;  4XQN A;  2B2U A;  3TN2 A;  3HRZ C;  4JBW A;  4A3D B;  4QUF A;  3QIA A;  4FF1 A;  3I3C A;  2M2L A;  5BN5 A;  2C5C A;  3A8K E;  4KY5 A;  3MFY A;  1HTP A;  2SEB D;  3FVQ A;  2IW3 A;  1CFM A;  3HG9 A;  1A15 A;  3SK6 A;  3K58 A;  5AFW A;  3GTM B;  1CHP D;  4QUC A;  5CV6 A;  4C3H B;  3CQZ B;  1OXX K;  4C56 C;  3OIQ A;  5DAU A;  1B50 A;  1AEX A;  2RSO A;  4LMQ D;  1HUM A;  5JPM C;  4QB4 A;  4C1N K;  3LWU A;  2QKI C;  1C8C A;  1HFG A;  3C1F A;  1BCP C;  4EGV A;  2F0N A;  3K6O A;  5TSS A;  1JQY D;  2F0K A;  2B2Y C;  2RQX A;  1U9R A;  3TME A;  1IKL A;  1H9M A;  4FF2 A;  2CQA A;  2EE1 A;  1EY4 A;  4IFD J;  1PRT F;  2K1B A;  2K5D A;  3QG1 A;  3GV3 A;  4A3K B;  1FD7 D;  2CW0 C;  1J8I A;  4U67 3;  4I7Z C;  4PMB A;  2NVQ B;  3NSW A;  1PFB A;  3SE0 A;  5K36 H;  3H3V C;  2K5W A;  1QB5 D;  2ZXR A;  1U4M A;  3VYU A;  5KYI A;  4RHS A;  3QOL A;  1KTK A;  4QMG A;  1TWH B;  1FGB D;  1PMR A;  4LAA A;  5BN3 A;  4OIK A;  3L7Z C;  2EYL A;  4DAP A;  3M3Y B;  3VYR A;  2IWH A;  1F2L A;  4IUV A;  1ROD A;  1OO9 B;  2TMP A;  4C3I G;  4X3U A;  1PRT C;  5M3M B;  4EVO A;  1LAC A;  3KUP A;  1D1I A;  3OMG A;  1Q12 A;  3MXU A;  2A6H C;  2JA8 B;  2HDL A;  1WTX A;  1DCZ A;  2PZW A;  3DM1 A;  1B2T A;  2F0G A;  2SDF A;  2TSS A;  4B9W A;  2IX3 A;  1GUW A;  1UAP A;  5I6Y A;  4A3J B;  1BDO A;  3W2D A;  3Q24 A;  4A3G B;  3WOF A;  2D62 A;  1H9K A;  2NN6 I;  5CMD A;  3I73 A;  4FO2 A;  1F9R A;  5JJZ A;  3IL8 A;  1ZYR C;  5C44 B;  5ISR A;  2ICI A;  2NYZ D;  1AN8 A;  2HDM A;  5IIF A;  1PDQ A;  2XWJ B;  3NWT A;  3J7Y W;  2H4O A;  1EU3 A;  2QF7 A;  2WKD A;  4KTA A;  3MXG A;  4ABN A;  1SNO A;  2J4X A;  3DMU A;  2LFN A;  3CU7 A;  3PUW A;  3Q23 A;  2AWN A;  4IQZ A;  1JOR A;  1NSN S;  1NCV A;  5D3D A;  3VR3 A;  3MA2 B;  4A3E B;  4ZRZ A;  2L55 A;  2R61 A;  1G8Z D;  3ERQ A;  1CI3 M;  1GXD C;  1KNE A;  2E75 C;  3WOE A;  2O4X A;  2VXW A;  1ZYR D;  2K5Q A;  4K5X A;  1I6H B;  4XDX A;  3TZU A;  4IUP A;  1DOK A;  4TQU S;  2B2T A;  1UUP A;  3KLS X;  1EY7 A;  3MHB A;  2B2W A;  2F0W A;  5FK9 C;  1H9J A;  3HZX A;  3JAM E;  1O80 A;  1HRJ A;  2XIW A;  3D4D A;  3QB3 A;  2BA0 A;  1F2Z A;  1ET9 A;  3J80 L;  3H94 A;  3GTJ B;  4RH6 A;  5C0X J;  5D3I B;  4DNT B;  5JVG 3;  5M5W B;  2WP8 J;  2F0H A;  2EYJ A;  4G7Z C;  2D5D A;  3HKZ B;  4CGY B;  3TP5 A;  3GTP B;  1YNJ C;  1CZW A;  2HQE A;  1TQO A;  3K59 A;  1HA6 A;  4DGZ A;  5KYL A;  5J1Z A;  1KAA A;  5COR A;  2EYM A;  2F0P A;  5C3X A;  5HUR A;  3D3R A;  2XWB B;  1EZ8 A;  3C1E A;  2PW5 A;  5I2X A;  4R8I A;  1DD2 A;  2BE5 C;  3VR6 A;  2R7Z B;  3GQB A;  2E2I B;  1GUS A;  5DEH A;  3S16 B;  4IFD G;  3G7L A;  4BA1 I;  2EYF A;  1ENC A;  1IKM A;  3HS0 C;  3T53 B;  3QWN A;  4B9X A;  2IL8 A;  2QDB A;  3FMC A;  2VUM B;  4MIU A;  4RGN A;  3Q22 A;  4PV1 C;  2HCC A;  2ID0 A;  4RGM A;  4X3S A;  3E5S A;  4N9T A;  5CV9 A;  2A6E C;  2WII B;  2F0O A;  4IFD H;  2N55 A;  2R93 B;  1NUC A;  2F0I A;  4F88 A;  4QF4 A;  2V4D A;  4KJO A;  2NZ1 D;  3GV6 A;  3S2D B;  3OPO A;  4XT3 B;  4HN7 A;  2D9U A;  5D14 A;  3VYS A;  1QJO A;  3M7N A;  2L11 A;  2F4I A;  1S5D D;  1VF7 A;  2BA1 A;  4LK1 C;  1D6E C;  2A5H A;  1VDZ A;  3DUZ A;  1IL8 A;  2QCP X;  3LX0 A;  4Y7N B;  3I4N B;  3BDC A;  3DEO A;  3FPP A;  5JVH 3;  4CHT B;  4ZUI A;  1LT6 D;  4NDX A;  3S1R B;  2K01 A;  1H9S A;  4HSP A;  5EPL A;  4IUQ A;  1HHV A;  3K57 A;  1BOS A;  2A69 D;  1EEF D;  2A73 B;  3M7G A;  2JEA I;  3K0Y A;  3MXP A;  4C3J G;  4DFA A;  5I9O A;  2XVS A;  4TSS A;  1JOK A;  3K5M A;  4HSV A;  4K2K A;  1K8O A;  1LTR D;  3HOV B;  3V05 A;  2JEB I;  1RDP D;  2R92 B;  3OMC A;  4MN3 A;  3VR5 A;  2B39 A;  1SDF A;  2F0U A;  5KEE A;  4IUN A;  4RAU C;  4K8I A;  4KKS A;  2IPK D;  1ICW A;  2WAQ B;  1PLF A;  3A54 A;  4LJZ C;  2Q8I B;  4H7B A;  3NK9 A;  4O42 A;  2VB2 X;  3ZYY X;  4FP5 D;  2DY7 A;  2G9D A;  3PIP 3;  5ELB A;  5ELF A;  5FO8 B;  3S1Q B;  1QWY A;  1KDB A;  3W3A A;  1QOH A;  1SEB D;  1EQT A;  1RCV D;  1TY2 A;  2OXP A;  1OXS C;  4EQO A;  1M8A A;  3MEH A;  2IT1 A;  4HCS A;  4OO1 I;  2F0M A;  4ULL A;  1HXY D;  1K83 B;  1U4R A;  2IJ0 A;  2BE5 D;  1S5F D;  1ONL A;  2EJF C;  2PNR C;  2LMC B;  1F9S A;  5J39 A;  3IAY A;  2K05 A;  3MFG A;  4XT1 B;  5JAV A;  1SNM A;  4K5W A;  1PZI D;  3A56 A;  5FO7 B;  1W6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...