2D65A

Aspartate aminotransferase mutant mabc
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
396
structure length
396
Chain Sequence
MFENITTAPADPILGLADLLRADERPGKIDLGMGVYNDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPGWPTHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFTIKQNGMFFFGGLTKEQVLRLREEFGVYAVASGRLNVAGMTPDNLAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structures of Aspartate Aminotransferase with Mutations of Non-Active-Site Residues
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Aspartate aminotransferase
total genus 137
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2d65A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2d65A01
2O1BA 2HUFA 5M4DA 4F5LA 3N0LA 1LK9A 3VAXA 3QGUA 3DODA 4EB5A 4HF8A 5G2PA 3VOMA 4A72A 1E5FA 4JEYA 1IX6A 2CJDA 3HL2A 1O62A 5BJ4A 2D7YA 1ARIA 3ATHA 3BWNC 3H14A 1O69A 3NTJA 1PFFA 4AH3A 2BWNA 2VMUA 3NRAA 1QJ5A 1VP4A 2VI8A 4U1TA 3BCBA 3PD6A 3NYSA 4E77A 1ASCA 5G4IA 4AO9A 1CQ6A 4XEWA 2HUUA 3A8UX 1SF2A 5BJ3A 1AMSA 1UU0A 1X29A 2D7ZA 4CXRA 2CH2A 4JEWA 2AY9A 4OC9A 4EU1A 1OHVA 4UOYA 4F5FA 1AAMA 3L44A 2HOZA 2PO3A 5FT5A 3G8MA 1AY8A 4O6ZA 1KKJA 1MDOA 1ORDA 2YCPA 1AAWA 1DJUA 2G6WA 3BCXA 4XJMA 4DGTA 3QI6A 4W1VA 3TFTA 2VMPA 3GZCA 4ZAHA 3II0A 2W8JA 4E3QA 1N2TA 3FFHA 3RBFA 1X2AA 3EIAA 3LVMA 4FL0A 3E2ZB 1CL2A 1X0MA 1CZEA 3ELEA 2W7DA 3B46A 1FG7A 2EZ1A 3FVXA 2DKJA 3ASBA 2DGLA 1AHYA 3F0HA 2AY5A 2BWPA 2Z20A 1AJRA 2FYFA 1DTYA 4E1OA 2BI9A 2W7KA 1D7RA 4JEZA 2AY8A 1MDXA 2VGTA 1QIRA 3A9YA 4Q76A 2HP1A 1JS6A 3FQ8A 3LVJA 3W1HA 1ZODA 1S06A 1AMAA 3DU4A 1J04A 3KGXA 2R5EA 1AJSB 3PAAA 1OXPA 2FQ6A 4ZWVA 2O0RA 3EZSA 2ZY5A 1WYUB 1CJ0A 1GC4A 3E9KA 8AATA 4ZWMA 4ITGA 1MAQA 5EQCA 4EMYA 1QITA 2VMRA 1IAYA 3FSLA 3JU7A 1GBNA 3K7YA 1YNUA 2BYJA 1G7XA 2GQNA 4W1WA 4Y0HA 3FZ7A 4GE9A 3RBLA 1MGVA 1W7MA 4Q6RA 1WSTA 2R5CA 1SFFA 4MKJA 3P6KA 5C6UA 1U08A 4ZSWA 2Z61A 1OXOA 3DR4A 1CL1A 3DZZA 3PDXA 4UHMA 1BT4A 2AY1A 3FTBA 3K28A 3ZRQA 3E2ZA 1AKCA 4ADEA 3MKJA 4JEVA 3K40A 1BJNA 1C0NA 1SZKA 3ISLA 2W7FA 3QPGA 4LW2A 2AY3A 4DBCA 3GWPA 1GEXA 3GR9A 3HLMA 4ITXA 2ZSLA 4JF1A 5DJ1A 3PJ0A 3JTXA 1BKGA 2BI3A 4MQQA 1RVUA 2WK8A 3BWNA 2E7UA 3EZ1A 3BB8A 4Y0DA 1M6SA 1J32A 4OBUA 1ASMA 1AIBA 4A0GA 4AO4A 3PPLA 3I16A 4K2MA 4ADBA 1TOGA 2JJHA 3MC6A 5DX5A 1VJOA 3VP6A 1JG8A 1UU1A 2FM1A 3NYUA 3AV7A 1KL2A 1S09A 2VMXA 2YKYA 3AEPA 2DR1A 2VGUA 3DXVA 2X5FA 2AY2A 3USFA 5K8BA 4M2KA 3AELA 1ASDA 3EI7A 4A6TA 5M49A 3GZDC 3WKRA 3GJUA 1UU2A 3WCOA 1TOEA 3PGYA 3EUCA 1M0NA 1TASA 3WGBA 1CQ8A 3MAFB 4B9BA 1AKBA 1DGDA 1YOOA 1WKGA 3M5UA 3MAUA 1TARA 4A0HA 4P7YA 4F5IA 4ATQA 1V2EA 5M4BA 2W8UA 4WB0A 5EUNA 5HXXA 2Z67A 1ELQA 5FT4A 4OCAA 3MAFA 2FNIA 2AATA 2YKUA 2BI2A 3G0TA 3TFUA 4WBTA 4GDYA 2Z9XA 2VMOA 5E5IA 5F8VA 4LW4A 2C81A 3ZRRA 1X28A 2E7JA 3QM2A 1BS0A 3VK4A 3FVUA 1PMOA 1LW4A 3FVSA 4XJOA 1WKHA 4F5HA 1ASEA 3ZZJA 1H1CA 4ADCA 2D63A 2FN6A 1QZ9A 3NUIA 2ZP7A 5JAYA 3GETA 3ZZKA 1YJSA 2VLFA 4IYOA 2EPJA 4U2HA 1TOKA 3E2FA 5FT6A 1JF9A 2W7MA 2ZY3A 4GE4A 4BHDA 2BWOA 4UHNA 3RCHB 1ZC9A 5EAVA 3NU7A 4BA5A 4A6RA 4MY5A 4ZASA 3WKSA 3BN1A 1ASNA 1GC0A 3DR7A 5I92A 1ASGA 1D7SA 3BCAA 1ARTA 3E2YA 4IXSA 1MAPA 4JE5D 4RKCA 5G4JA 2XBNA 1YIYA 4N0BA 1AJSA 2W8WA 4Q75A 4E3RA 2VGVA 1XEYA 4RIZA 3RQ1A 2Z9UA 4FFCA 1ASFA 2Z1YA 4M2MA 1B9IA 3H7FA 4RM1A 2ORDA 3PDBB 4LC3A 1B8GA 4OBVA 3HMUA 1AHGA 1D2FA 1YJZA 9AATA 3D6KA 3BC8A 1ASAA 1C9CA 3HBXA 3HQTA 4PVFA 4WD2A 5G09A 1O61A 3DRDA 2AY6A 1GCKA 5EIGB 2VGWA 2QB3A 4I8AA 2HZPA 4LNMA 4PFNA 4IXOA 4WB0B 2VLHA 1CQ7A 2YKXA 2Z9WA 3CQ6A 3T32A 2XH1A 4EB7A 2BYLA 1IJIA 1IUGA 3BS8A 4RKDA 4KYOA 5HHYA 3ELPA 4LNLA 4ADDA 4JEXA 2HORA 4LNJA 2ZY4A 4L0OA 1JS3A 3AENA 1N8PA 3DYDA 3UAKA 4F5MA 3WY7A 1AHXA 4AOAA 2GMSA 1BJ4A 5EIGA 3W1JA 5EUDA 3NYTA 4WYAA 4RITA 2AEUA 2O7CA 2OKJA 1G4VA 3G7QA 3RI6A 4Y0IA 4RAEA 3KGWA 2D5YA 1XI9A 1C7OA 2YKVA 1AIAA 2BIAA 1TOIA 2X3LA 5D95A 3R4TA 1ARSA 3E77A 3N75A 3NDNA 2EGYA 1Z7DA 1OHYA 2HOYA 1AMRA 4K2IA 4PFFA 4BMKA 1RV3A 3DXWA 1EQBA 3Q8NA 2VIAA 1RVYA 1EJIA 4CBSA 5IWQA 1MDZA 4UQVA 2W7EA 3B1CA 1UKJA 2BI1A 1ASLA 4RJYA 5LH9A 1WYVB 3TQXA 4XJPA 2QMAA 2W7LA 2TPLA 1G7WA 3LV2A 5EUEA 2ZYJA 3F6TA 2EZ2A 1EG5A 3ACZA 1KL1A 4HVKA 2Q7WA 3PDBA 2VYCA 4WXFA 3PIUA 2ZJGA 2JISA 2VIBA 1YIZA 2Z1ZA 4MQPA 2OATA 2W7JA 3FQ7A 4MGRA 4KAMA 1KMKA 3EI8A 4GSAA 4R8DA 4F5KA 4RLGA 5EAAA 5E4ZA 1C4KA 1O4SA 1SPAA 2C7TA 2CANA 3B1DA 3TCMA 1W7NA 3LVLB 4ZM4A 3MEBA 2W7GA 3AEMC 2BIGA 3A9ZA 2GSAA 4ZSYA 4CVQA 3OP7A 3RUYA 1S08A 1LC7A 2VGSA 2EO5A 4CBRA 2E7IA 1M0QA 2R0TA 4XAUA 4WYDA 4DQ6A 4MKKA 2VGZA 2PB0A 4NOGA 4WYFA 1VEFA 3R9AA 1IX8A 4IYOB 1W7LA 1IAXA 2YRIA 2V0YA 3AEJC 3BWOA 1I41A 1OATA 4TMRA 2ZSMA 5J8QA 1AICA 3ECDA 4W91A 2GB3A 3NUBA 1M0OA 4OT8A 3I5TA 1AHFA 1PMMA 3N5MA 3AOWA 1AY4A 1AKAA 1ECXA 3NU8A 4R5ZA 1GD9A 3FDDA 3FDBA 1M0PA 1AX4A 1YAAA 2CY8A 2BHXA 1DFOA 2F8JA 1I29A 1LKCA 2YRRA 3QBOA 4QGRA 1B5PA 1C7NA 2CSTA 4TV7A 2D65A 1M4NA 4XJLA 2OGEA 2WK9A 3CQ5A 4CXQA 1Y4IA 3FCRA 1TOJA 4AZJA 3LWSA 5G2QA 2QB2A 2YCNA 1QGNA 4MSOA 5DB5A 3KKIA 4TN4A 3UE8A 2HOXA 4A6UA 3FQAA 4AZKA 4ATPA 4BA4A 2DGMA 4KXKA 3JW9A 1I48A 2VMNA 3IHJA 2W7HA 1B9HA 1IBJA 2D61A 3WGCA 4H51A 4IX8A 5DJ9A 1MLYA 1GDEA 4F5JA 2VMSA 2CFBA 2JGTA 1PG8A 4XK1A 2VMVA 3OKSA 2JJGA 3L8AA 1M32A 4PIWA 1GC2A 4OMAA 2JJEA 2DKBA 3IF2A 1LW5A 1B5OA 3LVKA 2D66A 3AATA 4JE5A 3WCNA 1E5EA 2C0RA 1WYUA 2AEVA 5AX8A 1DGEA 1AY5A 3FZ6A 2V1PA 2BKWA 4K2BA 3B1EA 1D7VA 2RFVA 2D64A 3FZ8A 3WLXA 3A9XA 2CJHA 3JWBA 4IW7A 3EIBA 3RCHA 1W23A 4P3MA 4WP0A 2VMZA 5FT8A 4R2NA 5LHAA 1P3WA 4MQRA 1LS3A 3QHXA 4JF0A 3EI9A 2OKKA 4WLHA 4OTLA 3ASAA 4Q31A 2E54A 1I43A 1S0AA 1ARHA 5EFSA 4IXZA 2R2NA 1LC8A 2AY7A 5HDMA 1DJEA 3AEMA 3ZRPA 1BJOA 4ZLVA 4A0RA 3JWAA 1ASBA 2DGKA 1OHWA 1N31A 4EFFA 4A0FA 4ZDPA 2OQXA 1IVRA 1WYVA 5D5SA 1BJWA 4ZM3A 3NX3A 2R5CB 2WK7A 1BQAA 3MBBA 3W1IA 1SVVA 1C7GA 3AENB 3AEOA 2NMPA 1W3UA 3PA9A 3EI5A 3WX9A 3QN6A 2VI9A 3P1TA 2HP2A 3FRKA 1GEYA 4F5GA 2ZC0A 3NNKA 4WXGA 3VK2A 4OYTA 3AEJA 5M46A 1H0CA 4R5FA 1IX7A 4UHOA 1S07A 3EI6A 2AY4A 2CTZA 1TPLA 2WKAA 4W5KA 1BQDA 2YHKA 1GC3A 4W8IA 3LG0A 1QISA 3I4JA 5E3KA 1V2FA 3HVYA 1BW0A 3B8XA 1ELUA 1SZSA 3PD6B 4J5UA 1KKPA 3CAIA 5G0AA 1D7UA 1SZUA 1M7YA 3HT4A 4IY7A 3VK3A 2QBTA 2CINA 1CZCA 2Z9VA 4W1XA 3FD0A 4GRXA 1QJ3A 4WYCA 3MADA 1BJOB 4J8LA 1TATA 1RV4A 3BV0A 2YOBA 2QLRA 2DOUA 4N0WA 4WLJA 2GMUA 4XQ2A 2ZY2A 1FG3A 1WYTB 2BI5A 1DKAA 1MLZA 2CJGA 3FFRA 3WZFA 3KE3A 3JZLA 2PB2A 3MC6C 1G4XA 1ARGA 1ZOBA 2W7IA 2VMWA 4WXBA 1AMQA 2W8VA 4BQ0A 3LY1A 1YJYA 1CS1A 2CH1A 2W8TA 2VMQA 3E6GA 3A2BA 4F4EA 1V2DA 1GEWA 1AHEA 4ISYA 2VMTA 1LC5A 3UWCA 4B98A 2ZUKA 3HDOA 1WYTA 4WYGA 3GBXA 2CB1A 4GEBA 5TF5A 4RJ0A 2FNUA 2JG2A 3F9TA 1DJ9A 3DC1A 3FKDA 3CQ4A 2BIEA 4WYEA 4ZDLA 7AATA 3AOVA 2HUIA 2X5DA 3CBFA 1V72A 1T3IA 2OGAA 4M2JA 2X8UA 3GSBA 4ZDOA 2VMYA 2YCTA 5F9SA 3TATA 4GE7A 2EH6A 2QA3A 1KMJA 3COGA 2C44A 3GZDA 4A00A 2JJFA 1B4XA 1FC4A 1Z3ZA
chains in the Genus database with same CATH superfamily
2O1BA 2HUFA 5M4DA 4F5LA 3N0LA 1LK9A 3VAXA 3QGUA 3DODA 4EB5A 4HF8A 5G2PA 3VOMA 4A72A 1E5FA 4JEYA 1IX6A 2CJDA 3HL2A 1O62A 5BJ4A 2D7YA 1ARIA 3ATHA 3BWNC 3H14A 1O69A 3NTJA 1PFFA 4AH3A 2BWNA 2VMUA 3NRAA 1QJ5A 1VP4A 2VI8A 4U1TA 3BCBA 3PD6A 3NYSA 4E77A 1ASCA 5G4IA 4AO9A 1CQ6A 4XEWA 5KTBA 2HUUA 3A8UX 1SF2A 5BJ3A 1AMSA 1UU0A 1X29A 2D7ZA 4CXRA 2CH2A 4JEWA 2AY9A 4OC9A 4EU1A 1OHVA 4UOYA 4F5FA 1AAMA 3L44A 2HOZA 2PO3A 5FT5A 3G8MA 1AY8A 4O6ZA 1KKJA 1MDOA 1ORDA 2YCPA 1AAWA 1DJUA 2G6WA 3BCXA 4XJMA 4DGTA 3QI6A 4W1VA 3TFTA 2VMPA 3GZCA 4ZAHA 3II0A 2W8JA 4E3QA 1N2TA 3FFHA 3RBFA 1X2AA 3EIAA 3LVMA 4FL0A 3E2ZB 1CL2A 1X0MA 1CZEA 3ELEA 2W7DA 3B46A 1FG7A 2EZ1A 3FVXA 2DKJA 3ASBA 2FKIA 2DGLA 1AHYA 3F0HA 2AY5A 2BWPA 2Z20A 1AJRA 2FYFA 1DTYA 4E1OA 2BI9A 2W7KA 1D7RA 4JEZA 2AY8A 1MDXA 2VGTA 1QIRA 3A9YA 4Q76A 2HP1A 1JS6A 3FQ8A 3LVJA 3W1HA 1ZODA 1S06A 1AMAA 3DU4A 1J04A 3KGXA 2R5EA 1AJSB 3PAAA 1OXPA 2FQ6A 4ZWVA 2O0RA 3EZSA 2ZY5A 1WYUB 1CJ0A 1GC4A 3E9KA 8AATA 4ZWMA 4ITGA 1MAQA 5EQCA 4EMYA 1QITA 2VMRA 1IAYA 3FSLA 3JU7A 1GBNA 2KFPA 3K7YA 1YNUA 2BYJA 1G7XA 2GQNA 4W1WA 4Y0HA 3FZ7A 4GE9A 3RBLA 1MGVA 1W7MA 4Q6RA 1WSTA 2R5CA 1SFFA 4MKJA 3P6KA 5C6UA 1U08A 4ZSWA 2Z61A 1OXOA 3DR4A 1CL1A 3DZZA 3PDXA 4UHMA 1BT4A 2AY1A 3FTBA 3K28A 3ZRQA 3E2ZA 1AKCA 4ADEA 3MKJA 4JEVA 3K40A 1BJNA 1C0NA 1SZKA 3ISLA 2A1VA 2W7FA 3QPGA 4LW2A 2AY3A 4DBCA 3GWPA 1GEXA 3GR9A 3HLMA 4ITXA 2ZSLA 4JF1A 5DJ1A 3PJ0A 3JTXA 1BKGA 2BI3A 4MQQA 1RVUA 2WK8A 3BWNA 2E7UA 3EZ1A 3BB8A 4Y0DA 1M6SA 1J32A 4OBUA 1ASMA 1AIBA 4A0GA 4AO4A 3PPLA 3I16A 4K2MA 4ADBA 1TOGA 2JJHA 3MC6A 5DX5A 1VJOA 3VP6A 2WB6A 1JG8A 1UU1A 2FM1A 3NYUA 3AV7A 1KL2A 1S09A 2VMXA 2YKYA 3AEPA 2DR1A 2VGUA 3DXVA 2X5FA 2AY2A 3USFA 5K8BA 4M2KA 3AELA 1ASDA 3EI7A 4A6TA 5M49A 3GZDC 3WKRA 3GJUA 1UU2A 3WCOA 1TOEA 3PGYA 3EUCA 1M0NA 1TASA 3WGBA 1CQ8A 3MAFB 4B9BA 1AKBA 1DGDA 1YOOA 1WKGA 3M5UA 3MAUA 1TARA 4H63Q 4A0HA 4P7YA 4F5IA 4ATQA 1V2EA 5M4BA 3N4SA 2W8UA 4WB0A 5EUNA 5HXXA 2Z67A 1ELQA 5FT4A 4OCAA 3MAFA 2FNIA 2AATA 2YKUA 2BI2A 3G0TA 3TFUA 4WBTA 4GDYA 2Z9XA 2VMOA 5E5IA 5F8VA 4LW4A 2C81A 3ZRRA 1X28A 2E7JA 3QM2A 1BS0A 3VK4A 3FVUA 1PMOA 1LW4A 3FVSA 4XJOA 1WKHA 4F5HA 1ASEA 3ZZJA 1H1CA 4ADCA 2D63A 2FN6A 1QZ9A 3NUIA 2ZP7A 5JAYA 3GETA 3ZZKA 1YJSA 2VLFA 4IYOA 2EPJA 4U2HA 1TOKA 3E2FA 5FT6A 1JF9A 2W7MA 2ZY3A 4GE4A 4BHDA 2BWOA 4UHNA 3RCHB 1ZC9A 5EAVA 3NU7A 4BA5A 4A6RA 4MY5A 4ZASA 3WKSA 3BN1A 2G7JA 1ASNA 1GC0A 3DR7A 5I92A 1ASGA 1D7SA 3BCAA 1ARTA 3E2YA 4IXSA 1MAPA 4JE5D 4RKCA 5G4JA 3N7NA 2XBNA 1YIYA 4N0BA 4K05A 1AJSA 2W8WA 4Q75A 4E3RA 2VGVA 1XEYA 4RIZA 3RQ1A 2Z9UA 4FFCA 1ASFA 2Z1YA 4M2MA 1B9IA 3H7FA 4RM1A 2ORDA 3PDBB 4LC3A 1B8GA 4OBVA 3HMUA 1AHGA 1D2FA 1YJZA 9AATA 3D6KA 3BC8A 1ASAA 1C9CA 3HBXA 3HQTA 4PVFA 4WD2A 5G09A 1O61A 3DRDA 2AY6A 1GCKA 5EIGB 2VGWA 2QB3A 4I8AA 2HZPA 4LNMA 4PFNA 3N4RA 4IXOA 4WB0B 2VLHA 1CQ7A 2YKXA 2Z9WA 3CQ6A 3T32A 2XH1A 4EB7A 2BYLA 1IJIA 1IUGA 3BS8A 4RKDA 4KYOA 5HHYA 3ELPA 4LNLA 4ADDA 4JEXA 2HORA 4LNJA 2ZY4A 4L0OA 1JS3A 3AENA 1N8PA 3DYDA 3UAKA 4F5MA 3WY7A 1AHXA 4AOAA 2GMSA 1BJ4A 5EIGA 3W1JA 5EUDA 3NYTA 4WYAA 4RITA 2AEUA 2O7CA 2OKJA 1G4VA 3G7QA 3RI6A 4Y0IA 4RAEA 3KGWA 2D5YA 1XI9A 1C7OA 2YKVA 1AIAA 2BIAA 1TOIA 2X3LA 5D95A 3R4TA 1ARSA 3E77A 3N75A 3NDNA 2EGYA 1Z7DA 1OHYA 2HOYA 1AMRA 4K2IA 4PFFA 4BMKA 1RV3A 3DXWA 1EQBA 3Q8NA 2VIAA 1RVYA 1EJIA 4CBSA 5IWQA 1MDZA 4UQVA 2W7EA 3B1CA 1UKJA 2BI1A 1ASLA 4RJYA 5LH9A 1WYVB 3TQXA 4XJPA 2QMAA 2W7LA 2TPLA 1G7WA 3LV2A 2EYQA 5EUEA 2ZYJA 3F6TA 2EZ2A 1EG5A 3ACZA 1KL1A 4HVKA 2Q7WA 3PDBA 2VYCA 4WXFA 3PIUA 2ZJGA 2JISA 2VIBA 1YIZA 2Z1ZA 4MQPA 2OATA 2W7JA 3FQ7A 4MGRA 4KAMA 1KMKA 3EI8A 4GSAA 4R8DA 4F5KA 4RLGA 5EAAA 5E4ZA 1C4KA 1O4SA 1SPAA 2C7TA 2CANA 3B1DA 3TCMA 1W7NA 3LVLB 4ZM4A 3MEBA 2W7GA 3AEMC 2BIGA 3A9ZA 2GSAA 4ZSYA 4CVQA 3OP7A 3RUYA 1S08A 1LC7A 2VGSA 2EO5A 4CBRA 2E7IA 1M0QA 2R0TA 4XAUA 4WYDA 4DQ6A 4MKKA 2VGZA 2PB0A 4NOGA 4WYFA 1VEFA 3R9AA 1IX8A 4IYOB 1W7LA 1IAXA 2YRIA 2V0YA 3AEJC 3BWOA 1I41A 1OATA 4TMRA 2ZSMA 5J8QA 1AICA 3ECDA 4W91A 2GB3A 3NUBA 1M0OA 2QSRA 4OT8A 3I5TA 1AHFA 1PMMA 3N5MA 3AOWA 1AY4A 1AKAA 1ECXA 3H9XA 3NU8A 4R5ZA 1GD9A 3FDDA 3FDBA 1M0PA 1AX4A 1YAAA 2CY8A 2BHXA 1DFOA 2F8JA 1I29A 1LKCA 2YRRA 3QBOA 4QGRA 1B5PA 1C7NA 2CSTA 4TV7A 2D65A 1M4NA 4XJLA 2OGEA 2WK9A 3CQ5A 4CXQA 1Y4IA 3FCRA 1TOJA 4AZJA 3LWSA 5G2QA 2QB2A 2YCNA 1QGNA 4MSOA 5DB5A 3KKIA 4TN4A 3UE8A 2HOXA 4A6UA 3FQAA 4AZKA 4ATPA 4BA4A 2DGMA 1KAFA 4KXKA 3JW9A 1I48A 2VMNA 3IHJA 2W7HA 1B9HA 1IBJA 2D61A 3WGCA 4H51A 4IX8A 5DJ9A 3N4XA 1MLYA 1GDEA 4F5JA 2VMSA 2CFBA 2JGTA 1PG8A 4XK1A 2VMVA 3OKSA 2JJGA 3L8AA 1M32A 4PIWA 1GC2A 4OMAA 2JJEA 2DKBA 3IF2A 1LW5A 1B5OA 3LVKA 2D66A 3AATA 4JE5A 3WCNA 1E5EA 2C0RA 1WYUA 2AEVA 5AX8A 1DGEA 1AY5A 3FZ6A 2V1PA 2BKWA 4K2BA 3B1EA 1D7VA 2RFVA 2D64A 3FZ8A 3WLXA 3A9XA 2CJHA 3JWBA 4IW7A 3EIBA 3RCHA 1W23A 4P3MA 4WP0A 2VMZA 5FT8A 4R2NA 5LHAA 1P3WA 4MQRA 1LS3A 3QHXA 4JF0A 3EI9A 2OKKA 4WLHA 4OTLA 3ASAA 4Q31A 2E54A 1I43A 1S0AA 1ARHA 5EFSA 4IXZA 2R2NA 1LC8A 2AY7A 5HDMA 1DJEA 3AEMA 3ZRPA 1BJOA 4ZLVA 4A0RA 3JWAA 1ASBA 2DGKA 1OHWA 1N31A 4EFFA 4A0FA 4ZDPA 2OQXA 1IVRA 1WYVA 5D5SA 1BJWA 4ZM3A 3NX3A 2R5CB 2WK7A 1BQAA 3MBBA 3W1IA 1SVVA 1C7GA 3AENB 3AEOA 2NMPA 1W3UA 3PA9A 3EI5A 3WX9A 3QN6A 2VI9A 3P1TA 2HP2A 3FRKA 1GEYA 4F5GA 2ZC0A 3NNKA 4WXGA 3VK2A 4OYTA 3AEJA 5M46A 1H0CA 4R5FA 1IX7A 4UHOA 1S07A 3EI6A 2AY4A 2CTZA 1TPLA 2WKAA 4W5KA 1BQDA 2YHKA 1GC3A 4W8IA 3LG0A 1QISA 3I4JA 5E3KA 1V2FA 3HVYA 1BW0A 3B8XA 1ELUA 1SZSA 3PD6B 4J5UA 1KKPA 3CAIA 5G0AA 1D7UA 1SZUA 1M7YA 3HT4A 4IY7A 3VK3A 2QBTA 2CINA 1CZCA 2Z9VA 4W1XA 3FD0A 4GRXA 1QJ3A 4WYCA 3MADA 1BJOB 4J8LA 1TATA 1RV4A 3BV0A 2YOBA 2QLRA 2DOUA 4N0WA 4WLJA 2GMUA 4XQ2A 2ZY2A 1FG3A 1WYTB 2BI5A 1DKAA 1MLZA 2CJGA 3FFRA 3WZFA 3KE3A 3JZLA 2PB2A 3MC6C 1G4XA 1ARGA 1ZOBA 2W7IA 2VMWA 4WXBA 1AMQA 2W8VA 4BQ0A 3LY1A 1YJYA 1CS1A 2CH1A 2W8TA 2VMQA 3E6GA 3A2BA 4F4EA 1V2DA 1GEWA 1AHEA 4ISYA 2VMTA 1LC5A 3UWCA 4B98A 2ZUKA 3HDOA 1WYTA 4WYGA 3GBXA 2CB1A 4GEBA 5TF5A 4RJ0A 2FNUA 2JG2A 3F9TA 1DJ9A 3DC1A 3FKDA 3CQ4A 2BIEA 4WYEA 4ZDLA 7AATA 3AOVA 2HUIA 2X5DA 3CBFA 1V72A 1T3IA 2OGAA 4M2JA 2X8UA 3GSBA 4ZDOA 2VMYA 2YCTA 5F9SA 3TATA 4GE7A 2EH6A 2QA3A 1KMJA 3COGA 2C44A 3GZDA 4A00A 2JJFA 1B4XA 1FC4A 1Z3ZA
chains in the Genus database with same CATH topology
2O1BA 2HUFA 5M4DA 4F5LA 3N0LA 1LK9A 3VAXA 3QGUA 3DODA 4EB5A 4HF8A 5G2PA 3VOMA 4A72A 1E5FA 4JEYA 1IX6A 2CJDA 3HL2A 1O62A 5BJ4A 2D7YA 1ARIA 3ATHA 3BWNC 3H14A 1O69A 3NTJA 1PFFA 4AH3A 2BWNA 2VMUA 3NRAA 1QJ5A 1VP4A 2VI8A 4U1TA 3BCBA 3PD6A 3NYSA 4E77A 1ASCA 5G4IA 4AO9A 1CQ6A 4XEWA 5KTBA 2HUUA 3A8UX 1SF2A 5BJ3A 1AMSA 1UU0A 1X29A 2D7ZA 4CXRA 2CH2A 4JEWA 2AY9A 4OC9A 4EU1A 1OHVA 4UOYA 4F5FA 1AAMA 3L44A 2HOZA 2PO3A 5FT5A 3G8MA 1AY8A 4O6ZA 1KKJA 1MDOA 1ORDA 2YCPA 1AAWA 1DJUA 2G6WA 3BCXA 4XJMA 4DGTA 3QI6A 4W1VA 3TFTA 2VMPA 3GZCA 4ZAHA 3II0A 2W8JA 4E3QA 1N2TA 3FFHA 3RBFA 1X2AA 3EIAA 3LVMA 4FL0A 3E2ZB 1CL2A 1X0MA 1CZEA 3ELEA 2W7DA 3B46A 1FG7A 2EZ1A 3FVXA 2DKJA 3ASBA 2FKIA 2DGLA 1AHYA 3F0HA 2AY5A 2BWPA 2Z20A 1AJRA 2FYFA 1DTYA 4E1OA 2BI9A 2W7KA 1D7RA 4JEZA 2AY8A 1MDXA 2VGTA 1QIRA 3A9YA 4Q76A 2HP1A 1JS6A 3FQ8A 3LVJA 3W1HA 1ZODA 1S06A 1AMAA 3DU4A 1J04A 3KGXA 2R5EA 1AJSB 3PAAA 1OXPA 2FQ6A 4ZWVA 2O0RA 3EZSA 2ZY5A 1WYUB 1CJ0A 1GC4A 3E9KA 8AATA 4ZWMA 4ITGA 1MAQA 5EQCA 4EMYA 1QITA 2VMRA 1IAYA 3FSLA 3JU7A 1GBNA 2KFPA 3K7YA 1YNUA 2BYJA 1G7XA 2GQNA 4W1WA 4Y0HA 3FZ7A 4GE9A 3RBLA 1MGVA 1W7MA 4Q6RA 1WSTA 2R5CA 1SFFA 4MKJA 3P6KA 5C6UA 1U08A 4ZSWA 2Z61A 1OXOA 3DR4A 1CL1A 3DZZA 3PDXA 4UHMA 1BT4A 2AY1A 3FTBA 3K28A 3ZRQA 3E2ZA 1AKCA 4ADEA 3MKJA 4JEVA 3K40A 1BJNA 1C0NA 1SZKA 3ISLA 2A1VA 2W7FA 3QPGA 4LW2A 2AY3A 4DBCA 3GWPA 1GEXA 3GR9A 3HLMA 4ITXA 2ZSLA 4JF1A 5DJ1A 3PJ0A 3JTXA 1BKGA 2BI3A 4MQQA 1RVUA 2WK8A 3BWNA 2E7UA 3EZ1A 3BB8A 4Y0DA 1M6SA 1J32A 4OBUA 1ASMA 1AIBA 4A0GA 4AO4A 3PPLA 3I16A 4K2MA 4ADBA 1TOGA 2JJHA 3MC6A 5DX5A 1VJOA 3VP6A 2WB6A 1JG8A 1UU1A 2FM1A 3NYUA 3AV7A 1KL2A 1S09A 2VMXA 2YKYA 3AEPA 2DR1A 2VGUA 3DXVA 2X5FA 2AY2A 3USFA 5K8BA 4M2KA 3AELA 1ASDA 3EI7A 4A6TA 5M49A 3GZDC 3WKRA 3GJUA 1UU2A 3WCOA 1TOEA 3PGYA 3EUCA 1M0NA 1TASA 3WGBA 1CQ8A 3MAFB 4B9BA 1AKBA 1DGDA 1YOOA 1WKGA 3M5UA 3MAUA 1TARA 4H63Q 4A0HA 4P7YA 4F5IA 4ATQA 1V2EA 5M4BA 3N4SA 2W8UA 4WB0A 5EUNA 5HXXA 2Z67A 1ELQA 5FT4A 4OCAA 3MAFA 2FNIA 2AATA 2YKUA 2BI2A 3G0TA 3TFUA 4WBTA 4GDYA 2Z9XA 2VMOA 5E5IA 5F8VA 4LW4A 2C81A 3ZRRA 1X28A 2E7JA 3QM2A 1BS0A 3VK4A 3FVUA 1PMOA 1LW4A 3FVSA 4XJOA 1WKHA 4F5HA 1ASEA 3ZZJA 1H1CA 4ADCA 2D63A 2FN6A 1QZ9A 3NUIA 2ZP7A 5JAYA 3GETA 3ZZKA 1YJSA 2VLFA 4IYOA 2EPJA 4U2HA 1TOKA 3E2FA 5FT6A 1JF9A 2W7MA 2ZY3A 4GE4A 4BHDA 2BWOA 4UHNA 3RCHB 1ZC9A 5EAVA 3NU7A 4BA5A 4A6RA 4MY5A 4ZASA 3WKSA 3BN1A 2G7JA 1ASNA 1GC0A 3DR7A 5I92A 1ASGA 1D7SA 3BCAA 1ARTA 3E2YA 4IXSA 1MAPA 4JE5D 4RKCA 5G4JA 3N7NA 2XBNA 1YIYA 4N0BA 4K05A 1AJSA 2W8WA 4Q75A 4E3RA 2VGVA 1XEYA 4RIZA 3RQ1A 2Z9UA 4FFCA 1ASFA 2Z1YA 4M2MA 1B9IA 3H7FA 4RM1A 2ORDA 3PDBB 4LC3A 1B8GA 4OBVA 3HMUA 1AHGA 1D2FA 1YJZA 9AATA 3D6KA 3BC8A 1ASAA 1C9CA 3HBXA 3HQTA 4PVFA 4WD2A 5G09A 1O61A 3DRDA 2AY6A 1GCKA 5EIGB 2VGWA 2QB3A 4I8AA 2HZPA 4LNMA 4PFNA 3N4RA 4IXOA 4WB0B 2VLHA 1CQ7A 2YKXA 2Z9WA 3CQ6A 3T32A 2XH1A 4EB7A 2BYLA 1IJIA 1IUGA 3BS8A 4RKDA 4KYOA 5HHYA 3ELPA 4LNLA 4ADDA 4JEXA 2HORA 4LNJA 2ZY4A 4L0OA 1JS3A 3AENA 1N8PA 3DYDA 3UAKA 4F5MA 3WY7A 1AHXA 4AOAA 2GMSA 1BJ4A 5EIGA 3W1JA 5EUDA 3NYTA 4WYAA 4RITA 2AEUA 2O7CA 2OKJA 1G4VA 3G7QA 3RI6A 4Y0IA 4RAEA 3KGWA 2D5YA 1XI9A 1C7OA 2YKVA 1AIAA 2BIAA 1TOIA 2X3LA 5D95A 3R4TA 1ARSA 3E77A 3N75A 3NDNA 2EGYA 1Z7DA 1OHYA 2HOYA 1AMRA 4K2IA 4PFFA 4BMKA 1RV3A 3DXWA 1EQBA 3Q8NA 2VIAA 1RVYA 1EJIA 4CBSA 5IWQA 1MDZA 4UQVA 2W7EA 3B1CA 1UKJA 2BI1A 1ASLA 4RJYA 5LH9A 1WYVB 3TQXA 4XJPA 2QMAA 2W7LA 2TPLA 1G7WA 3LV2A 2EYQA 5EUEA 2ZYJA 3F6TA 2EZ2A 1EG5A 3ACZA 1KL1A 4HVKA 2Q7WA 3PDBA 2VYCA 4WXFA 3PIUA 2ZJGA 2JISA 2VIBA 1YIZA 2Z1ZA 4MQPA 2OATA 2W7JA 3FQ7A 4MGRA 4KAMA 1KMKA 3EI8A 4GSAA 4R8DA 4F5KA 4RLGA 5EAAA 5E4ZA 1C4KA 1O4SA 1SPAA 2C7TA 2CANA 3B1DA 3TCMA 1W7NA 3LVLB 4ZM4A 3MEBA 2W7GA 3AEMC 2BIGA 3A9ZA 2GSAA 4ZSYA 4CVQA 3OP7A 3RUYA 1S08A 1LC7A 2VGSA 2EO5A 4CBRA 2E7IA 1M0QA 2R0TA 4XAUA 4WYDA 4DQ6A 4MKKA 2VGZA 2PB0A 4NOGA 4WYFA 1VEFA 3R9AA 1IX8A 4IYOB 1W7LA 1IAXA 2YRIA 2V0YA 3AEJC 3BWOA 1I41A 1OATA 4TMRA 2ZSMA 5J8QA 1AICA 3ECDA 4W91A 2GB3A 3NUBA 1M0OA 2QSRA 4OT8A 3I5TA 1AHFA 1PMMA 3N5MA 3AOWA 1AY4A 1AKAA 1ECXA 3H9XA 3NU8A 4R5ZA 1GD9A 3FDDA 3FDBA 1M0PA 1AX4A 1YAAA 2CY8A 2BHXA 1DFOA 2F8JA 1I29A 1LKCA 2YRRA 3QBOA 4QGRA 1B5PA 1C7NA 2CSTA 4TV7A 2D65A 1M4NA 4XJLA 2OGEA 2WK9A 3CQ5A 4CXQA 1Y4IA 3FCRA 1TOJA 4AZJA 3LWSA 5G2QA 2QB2A 2YCNA 1QGNA 4MSOA 5DB5A 3KKIA 4TN4A 3UE8A 2HOXA 4A6UA 3FQAA 4AZKA 4ATPA 4BA4A 2DGMA 4KXKA 3JW9A 1I48A 2VMNA 3IHJA 2W7HA 1B9HA 1IBJA 2D61A 3WGCA 4H51A 4IX8A 5DJ9A 3N4XA 1MLYA 1GDEA 4F5JA 2VMSA 2CFBA 2JGTA 1PG8A 4XK1A 2VMVA 3OKSA 2JJGA 3L8AA 1M32A 4PIWA 1GC2A 4OMAA 2JJEA 2DKBA 3IF2A 1LW5A 1B5OA 3LVKA 2D66A 3AATA 4JE5A 3WCNA 1E5EA 2C0RA 1WYUA 2AEVA 5AX8A 1DGEA 1AY5A 3FZ6A 2V1PA 2BKWA 4K2BA 3B1EA 1D7VA 2RFVA 2D64A 3FZ8A 3WLXA 3A9XA 2CJHA 3JWBA 4IW7A 3EIBA 3RCHA 1W23A 4P3MA 4WP0A 2VMZA 5FT8A 4R2NA 5LHAA 1P3WA 4MQRA 1LS3A 3QHXA 4JF0A 3EI9A 2OKKA 4WLHA 4OTLA 3ASAA 4Q31A 2E54A 1I43A 1S0AA 1ARHA 5EFSA 4IXZA 2R2NA 1LC8A 2AY7A 5HDMA 1DJEA 3AEMA 3ZRPA 1BJOA 4ZLVA 4A0RA 3JWAA 1ASBA 2DGKA 1OHWA 1N31A 4EFFA 4A0FA 4ZDPA 2OQXA 1IVRA 1WYVA 5D5SA 1BJWA 4ZM3A 3NX3A 2R5CB 2WK7A 1BQAA 3MBBA 3W1IA 1SVVA 1C7GA 3AENB 3AEOA 2NMPA 1W3UA 3PA9A 3EI5A 3WX9A 3QN6A 2VI9A 3P1TA 2HP2A 3FRKA 1GEYA 4F5GA 2ZC0A 3NNKA 4WXGA 3VK2A 4OYTA 3AEJA 5M46A 1H0CA 4R5FA 1IX7A 4UHOA 1S07A 3EI6A 2AY4A 2CTZA 1TPLA 2WKAA 4W5KA 1BQDA 2YHKA 1GC3A 4W8IA 3LG0A 1QISA 3I4JA 5E3KA 1V2FA 3HVYA 1BW0A 3B8XA 1ELUA 1SZSA 3PD6B 4J5UA 1KKPA 3CAIA 5G0AA 1D7UA 1SZUA 1M7YA 3HT4A 4IY7A 3VK3A 2QBTA 2CINA 1CZCA 2Z9VA 4W1XA 3FD0A 4GRXA 1QJ3A 4WYCA 3MADA 1BJOB 4J8LA 1TATA 1RV4A 3BV0A 2YOBA 2QLRA 2DOUA 4N0WA 4WLJA 2GMUA 4XQ2A 2ZY2A 1FG3A 1WYTB 2BI5A 1DKAA 1MLZA 2CJGA 3FFRA 3WZFA 3KE3A 3JZLA 2PB2A 3MC6C 1G4XA 1ARGA 1ZOBA 2W7IA 2VMWA 4WXBA 1AMQA 2W8VA 4BQ0A 3LY1A 1YJYA 1CS1A 2CH1A 2W8TA 2VMQA 3E6GA 3A2BA 4F4EA 1V2DA 1GEWA 1AHEA 4ISYA 2VMTA 1LC5A 3UWCA 4B98A 2ZUKA 3HDOA 1WYTA 4WYGA 3GBXA 2CB1A 4GEBA 5TF5A 4RJ0A 2FNUA 2JG2A 3F9TA 1DJ9A 3DC1A 3FKDA 3CQ4A 2BIEA 4WYEA 4ZDLA 7AATA 3AOVA 2HUIA 2X5DA 3CBFA 1V72A 1T3IA 2OGAA 4M2JA 2X8UA 3GSBA 4ZDOA 2VMYA 2YCTA 5F9SA 3TATA 4GE7A 2EH6A 2QA3A 1KMJA 3COGA 2C44A 3GZDA 4A00A 2JJFA 1B4XA 1FC4A 1Z3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O1B A;  2HUF A;  5M4D A;  4F5L A;  3N0L A;  1LK9 A;  3VAX A;  3QGU A;  3DOD A;  4EB5 A;  4HF8 A;  5G2P A;  3VOM A;  4A72 A;  1E5F A;  4JEY A;  1IX6 A;  2CJD A;  3HL2 A;  1O62 A;  5BJ4 A;  2D7Y A;  1ARI A;  3ATH A;  3BWN C;  3H14 A;  1O69 A;  3NTJ A;  1PFF A;  4AH3 A;  2BWN A;  2VMU A;  3NRA A;  1QJ5 A;  1VP4 A;  2VI8 A;  4U1T A;  3BCB A;  3PD6 A;  3NYS A;  4E77 A;  1ASC A;  5G4I A;  4AO9 A;  1CQ6 A;  4XEW A;  2HUU A;  3A8U X;  1SF2 A;  5BJ3 A;  1AMS A;  1UU0 A;  1X29 A;  2D7Z A;  4CXR A;  2CH2 A;  4JEW A;  2AY9 A;  4OC9 A;  4EU1 A;  1OHV A;  4UOY A;  4F5F A;  1AAM A;  3L44 A;  2HOZ A;  2PO3 A;  5FT5 A;  3G8M A;  1AY8 A;  4O6Z A;  1KKJ A;  1MDO A;  1ORD A;  2YCP A;  1AAW A;  1DJU A;  2G6W A;  3BCX A;  4XJM A;  4DGT A;  3QI6 A;  4W1V A;  3TFT A;  2VMP A;  3GZC A;  4ZAH A;  3II0 A;  2W8J A;  4E3Q A;  1N2T A;  3FFH A;  3RBF A;  1X2A A;  3EIA A;  3LVM A;  4FL0 A;  3E2Z B;  1CL2 A;  1X0M A;  1CZE A;  3ELE A;  2W7D A;  3B46 A;  1FG7 A;  2EZ1 A;  3FVX A;  2DKJ A;  3ASB A;  2DGL A;  1AHY A;  3F0H A;  2AY5 A;  2BWP A;  2Z20 A;  1AJR A;  2FYF A;  1DTY A;  4E1O A;  2BI9 A;  2W7K A;  1D7R A;  4JEZ A;  2AY8 A;  1MDX A;  2VGT A;  1QIR A;  3A9Y A;  4Q76 A;  2HP1 A;  1JS6 A;  3FQ8 A;  3LVJ A;  3W1H A;  1ZOD A;  1S06 A;  1AMA A;  3DU4 A;  1J04 A;  3KGX A;  2R5E A;  1AJS B;  3PAA A;  1OXP A;  2FQ6 A;  4ZWV A;  2O0R A;  3EZS A;  2ZY5 A;  1WYU B;  1CJ0 A;  1GC4 A;  3E9K A;  8AAT A;  4ZWM A;  4ITG A;  1MAQ A;  5EQC A;  4EMY A;  1QIT A;  2VMR A;  1IAY A;  3FSL A;  3JU7 A;  1GBN A;  3K7Y A;  1YNU A;  2BYJ A;  1G7X A;  2GQN A;  4W1W A;  4Y0H A;  3FZ7 A;  4GE9 A;  3RBL A;  1MGV A;  1W7M A;  4Q6R A;  1WST A;  2R5C A;  1SFF A;  4MKJ A;  3P6K A;  5C6U A;  1U08 A;  4ZSW A;  2Z61 A;  1OXO A;  3DR4 A;  1CL1 A;  3DZZ A;  3PDX A;  4UHM A;  1BT4 A;  2AY1 A;  3FTB A;  3K28 A;  3ZRQ A;  3E2Z A;  1AKC A;  4ADE A;  3MKJ A;  4JEV A;  3K40 A;  1BJN A;  1C0N A;  1SZK A;  3ISL A;  2W7F A;  3QPG A;  4LW2 A;  2AY3 A;  4DBC A;  3GWP A;  1GEX A;  3GR9 A;  3HLM A;  4ITX A;  2ZSL A;  4JF1 A;  5DJ1 A;  3PJ0 A;  3JTX A;  1BKG A;  2BI3 A;  4MQQ A;  1RVU A;  2WK8 A;  3BWN A;  2E7U A;  3EZ1 A;  3BB8 A;  4Y0D A;  1M6S A;  1J32 A;  4OBU A;  1ASM A;  1AIB A;  4A0G A;  4AO4 A;  3PPL A;  3I16 A;  4K2M A;  4ADB A;  1TOG A;  2JJH A;  3MC6 A;  5DX5 A;  1VJO A;  3VP6 A;  1JG8 A;  1UU1 A;  2FM1 A;  3NYU A;  3AV7 A;  1KL2 A;  1S09 A;  2VMX A;  2YKY A;  3AEP A;  2DR1 A;  2VGU A;  3DXV A;  2X5F A;  2AY2 A;  3USF A;  5K8B A;  4M2K A;  3AEL A;  1ASD A;  3EI7 A;  4A6T A;  5M49 A;  3GZD C;  3WKR A;  3GJU A;  1UU2 A;  3WCO A;  1TOE A;  3PGY A;  3EUC A;  1M0N A;  1TAS A;  3WGB A;  1CQ8 A;  3MAF B;  4B9B A;  1AKB A;  1DGD A;  1YOO A;  1WKG A;  3M5U A;  3MAU A;  1TAR A;  4A0H A;  4P7Y A;  4F5I A;  4ATQ A;  1V2E A;  5M4B A;  2W8U A;  4WB0 A;  5EUN A;  5HXX A;  2Z67 A;  1ELQ A;  5FT4 A;  4OCA A;  3MAF A;  2FNI A;  2AAT A;  2YKU A;  2BI2 A;  3G0T A;  3TFU A;  4WBT A;  4GDY A;  2Z9X A;  2VMO A;  5E5I A;  5F8V A;  4LW4 A;  2C81 A;  3ZRR A;  1X28 A;  2E7J A;  3QM2 A;  1BS0 A;  3VK4 A;  3FVU A;  1PMO A;  1LW4 A;  3FVS A;  4XJO A;  1WKH A;  4F5H A;  1ASE A;  3ZZJ A;  1H1C A;  4ADC A;  2D63 A;  2FN6 A;  1QZ9 A;  3NUI A;  2ZP7 A;  5JAY A;  3GET A;  3ZZK A;  1YJS A;  2VLF A;  4IYO A;  2EPJ A;  4U2H A;  1TOK A;  3E2F A;  5FT6 A;  1JF9 A;  2W7M A;  2ZY3 A;  4GE4 A;  4BHD A;  2BWO A;  4UHN A;  3RCH B;  1ZC9 A;  5EAV A;  3NU7 A;  4BA5 A;  4A6R A;  4MY5 A;  4ZAS A;  3WKS A;  3BN1 A;  1ASN A;  1GC0 A;  3DR7 A;  5I92 A;  1ASG A;  1D7S A;  3BCA A;  1ART A;  3E2Y A;  4IXS A;  1MAP A;  4JE5 D;  4RKC A;  5G4J A;  2XBN A;  1YIY A;  4N0B A;  1AJS A;  2W8W A;  4Q75 A;  4E3R A;  2VGV A;  1XEY A;  4RIZ A;  3RQ1 A;  2Z9U A;  4FFC A;  1ASF A;  2Z1Y A;  4M2M A;  1B9I A;  3H7F A;  4RM1 A;  2ORD A;  3PDB B;  4LC3 A;  1B8G A;  4OBV A;  3HMU A;  1AHG A;  1D2F A;  1YJZ A;  9AAT A;  3D6K A;  3BC8 A;  1ASA A;  1C9C A;  3HBX A;  3HQT A;  4PVF A;  4WD2 A;  5G09 A;  1O61 A;  3DRD A;  2AY6 A;  1GCK A;  5EIG B;  2VGW A;  2QB3 A;  4I8A A;  2HZP A;  4LNM A;  4PFN A;  4IXO A;  4WB0 B;  2VLH A;  1CQ7 A;  2YKX A;  2Z9W A;  3CQ6 A;  3T32 A;  2XH1 A;  4EB7 A;  2BYL A;  1IJI A;  1IUG A;  3BS8 A;  4RKD A;  4KYO A;  5HHY A;  3ELP A;  4LNL A;  4ADD A;  4JEX A;  2HOR A;  4LNJ A;  2ZY4 A;  4L0O A;  1JS3 A;  3AEN A;  1N8P A;  3DYD A;  3UAK A;  4F5M A;  3WY7 A;  1AHX A;  4AOA A;  2GMS A;  1BJ4 A;  5EIG A;  3W1J A;  5EUD A;  3NYT A;  4WYA A;  4RIT A;  2AEU A;  2O7C A;  2OKJ A;  1G4V A;  3G7Q A;  3RI6 A;  4Y0I A;  4RAE A;  3KGW A;  2D5Y A;  1XI9 A;  1C7O A;  2YKV A;  1AIA A;  2BIA A;  1TOI A;  2X3L A;  5D95 A;  3R4T A;  1ARS A;  3E77 A;  3N75 A;  3NDN A;  2EGY A;  1Z7D A;  1OHY A;  2HOY A;  1AMR A;  4K2I A;  4PFF A;  4BMK A;  1RV3 A;  3DXW A;  1EQB A;  3Q8N A;  2VIA A;  1RVY A;  1EJI A;  4CBS A;  5IWQ A;  1MDZ A;  4UQV A;  2W7E A;  3B1C A;  1UKJ A;  2BI1 A;  1ASL A;  4RJY A;  5LH9 A;  1WYV B;  3TQX A;  4XJP A;  2QMA A;  2W7L A;  2TPL A;  1G7W A;  3LV2 A;  5EUE A;  2ZYJ A;  3F6T A;  2EZ2 A;  1EG5 A;  3ACZ A;  1KL1 A;  4HVK A;  2Q7W A;  3PDB A;  2VYC A;  4WXF A;  3PIU A;  2ZJG A;  2JIS A;  2VIB A;  1YIZ A;  2Z1Z A;  4MQP A;  2OAT A;  2W7J A;  3FQ7 A;  4MGR A;  4KAM A;  1KMK A;  3EI8 A;  4GSA A;  4R8D A;  4F5K A;  4RLG A;  5EAA A;  5E4Z A;  1C4K A;  1O4S A;  1SPA A;  2C7T A;  2CAN A;  3B1D A;  3TCM A;  1W7N A;  3LVL B;  4ZM4 A;  3MEB A;  2W7G A;  3AEM C;  2BIG A;  3A9Z A;  2GSA A;  4ZSY A;  4CVQ A;  3OP7 A;  3RUY A;  1S08 A;  1LC7 A;  2VGS A;  2EO5 A;  4CBR A;  2E7I A;  1M0Q A;  2R0T A;  4XAU A;  4WYD A;  4DQ6 A;  4MKK A;  2VGZ A;  2PB0 A;  4NOG A;  4WYF A;  1VEF A;  3R9A A;  1IX8 A;  4IYO B;  1W7L A;  1IAX A;  2YRI A;  2V0Y A;  3AEJ C;  3BWO A;  1I41 A;  1OAT A;  4TMR A;  2ZSM A;  5J8Q A;  1AIC A;  3ECD A;  4W91 A;  2GB3 A;  3NUB A;  1M0O A;  4OT8 A;  3I5T A;  1AHF A;  1PMM A;  3N5M A;  3AOW A;  1AY4 A;  1AKA A;  1ECX A;  3NU8 A;  4R5Z A;  1GD9 A;  3FDD A;  3FDB A;  1M0P A;  1AX4 A;  1YAA A;  2CY8 A;  2BHX A;  1DFO A;  2F8J A;  1I29 A;  1LKC A;  2YRR A;  3QBO A;  4QGR A;  1B5P A;  1C7N A;  2CST A;  4TV7 A;  2D65 A;  1M4N A;  4XJL A;  2OGE A;  2WK9 A;  3CQ5 A;  4CXQ A;  1Y4I A;  3FCR A;  1TOJ A;  4AZJ A;  3LWS A;  5G2Q A;  2QB2 A;  2YCN A;  1QGN A;  4MSO A;  5DB5 A;  3KKI A;  4TN4 A;  3UE8 A;  2HOX A;  4A6U A;  3FQA A;  4AZK A;  4ATP A;  4BA4 A;  2DGM A;  4KXK A;  3JW9 A;  1I48 A;  2VMN A;  3IHJ A;  2W7H A;  1B9H A;  1IBJ A;  2D61 A;  3WGC A;  4H51 A;  4IX8 A;  5DJ9 A;  1MLY A;  1GDE A;  4F5J A;  2VMS A;  2CFB A;  2JGT A;  1PG8 A;  4XK1 A;  2VMV A;  3OKS A;  2JJG A;  3L8A A;  1M32 A;  4PIW A;  1GC2 A;  4OMA A;  2JJE A;  2DKB A;  3IF2 A;  1LW5 A;  1B5O A;  3LVK A;  2D66 A;  3AAT A;  4JE5 A;  3WCN A;  1E5E A;  2C0R A;  1WYU A;  2AEV A;  5AX8 A;  1DGE A;  1AY5 A;  3FZ6 A;  2V1P A;  2BKW A;  4K2B A;  3B1E A;  1D7V A;  2RFV A;  2D64 A;  3FZ8 A;  3WLX A;  3A9X A;  2CJH A;  3JWB A;  4IW7 A;  3EIB A;  3RCH A;  1W23 A;  4P3M A;  4WP0 A;  2VMZ A;  5FT8 A;  4R2N A;  5LHA A;  1P3W A;  4MQR A;  1LS3 A;  3QHX A;  4JF0 A;  3EI9 A;  2OKK A;  4WLH A;  4OTL A;  3ASA A;  4Q31 A;  2E54 A;  1I43 A;  1S0A A;  1ARH A;  5EFS A;  4IXZ A;  2R2N A;  1LC8 A;  2AY7 A;  5HDM A;  1DJE A;  3AEM A;  3ZRP A;  1BJO A;  4ZLV A;  4A0R A;  3JWA A;  1ASB A;  2DGK A;  1OHW A;  1N31 A;  4EFF A;  4A0F A;  4ZDP A;  2OQX A;  1IVR A;  1WYV A;  5D5S A;  1BJW A;  4ZM3 A;  3NX3 A;  2R5C B;  2WK7 A;  1BQA A;  3MBB A;  3W1I A;  1SVV A;  1C7G A;  3AEN B;  3AEO A;  2NMP A;  1W3U A;  3PA9 A;  3EI5 A;  3WX9 A;  3QN6 A;  2VI9 A;  3P1T A;  2HP2 A;  3FRK A;  1GEY A;  4F5G A;  2ZC0 A;  3NNK A;  4WXG A;  3VK2 A;  4OYT A;  3AEJ A;  5M46 A;  1H0C A;  4R5F A;  1IX7 A;  4UHO A;  1S07 A;  3EI6 A;  2AY4 A;  2CTZ A;  1TPL A;  2WKA A;  4W5K A;  1BQD A;  2YHK A;  1GC3 A;  4W8I A;  3LG0 A;  1QIS A;  3I4J A;  5E3K A;  1V2F A;  3HVY A;  1BW0 A;  3B8X A;  1ELU A;  1SZS A;  3PD6 B;  4J5U A;  1KKP A;  3CAI A;  5G0A A;  1D7U A;  1SZU A;  1M7Y A;  3HT4 A;  4IY7 A;  3VK3 A;  2QBT A;  2CIN A;  1CZC A;  2Z9V A;  4W1X A;  3FD0 A;  4GRX A;  1QJ3 A;  4WYC A;  3MAD A;  1BJO B;  4J8L A;  1TAT A;  1RV4 A;  3BV0 A;  2YOB A;  2QLR A;  2DOU A;  4N0W A;  4WLJ A;  2GMU A;  4XQ2 A;  2ZY2 A;  1FG3 A;  1WYT B;  2BI5 A;  1DKA A;  1MLZ A;  2CJG A;  3FFR A;  3WZF A;  3KE3 A;  3JZL A;  2PB2 A;  3MC6 C;  1G4X A;  1ARG A;  1ZOB A;  2W7I A;  2VMW A;  4WXB A;  1AMQ A;  2W8V A;  4BQ0 A;  3LY1 A;  1YJY A;  1CS1 A;  2CH1 A;  2W8T A;  2VMQ A;  3E6G A;  3A2B A;  4F4E A;  1V2D A;  1GEW A;  1AHE A;  4ISY A;  2VMT A;  1LC5 A;  3UWC A;  4B98 A;  2ZUK A;  3HDO A;  1WYT A;  4WYG A;  3GBX A;  2CB1 A;  4GEB A;  5TF5 A;  4RJ0 A;  2FNU A;  2JG2 A;  3F9T A;  1DJ9 A;  3DC1 A;  3FKD A;  3CQ4 A;  2BIE A;  4WYE A;  4ZDL A;  7AAT A;  3AOV A;  2HUI A;  2X5D A;  3CBF A;  1V72 A;  1T3I A;  2OGA A;  4M2J A;  2X8U A;  3GSB A;  4ZDO A;  2VMY A;  2YCT A;  5F9S A;  3TAT A;  4GE7 A;  2EH6 A;  2QA3 A;  1KMJ A;  3COG A;  2C44 A;  3GZD A;  4A00 A;  2JJF A;  1B4X A;  1FC4 A;  1Z3Z A; 
#chains in the Genus database with same CATH topology
 2O1B A;  2HUF A;  5M4D A;  4F5L A;  3N0L A;  1LK9 A;  3VAX A;  3QGU A;  3DOD A;  4EB5 A;  4HF8 A;  5G2P A;  3VOM A;  4A72 A;  1E5F A;  4JEY A;  1IX6 A;  2CJD A;  3HL2 A;  1O62 A;  5BJ4 A;  2D7Y A;  1ARI A;  3ATH A;  3BWN C;  3H14 A;  1O69 A;  3NTJ A;  1PFF A;  4AH3 A;  2BWN A;  2VMU A;  3NRA A;  1QJ5 A;  1VP4 A;  2VI8 A;  4U1T A;  3BCB A;  3PD6 A;  3NYS A;  4E77 A;  1ASC A;  5G4I A;  4AO9 A;  1CQ6 A;  4XEW A;  5KTB A;  2HUU A;  3A8U X;  1SF2 A;  5BJ3 A;  1AMS A;  1UU0 A;  1X29 A;  2D7Z A;  4CXR A;  2CH2 A;  4JEW A;  2AY9 A;  4OC9 A;  4EU1 A;  1OHV A;  4UOY A;  4F5F A;  1AAM A;  3L44 A;  2HOZ A;  2PO3 A;  5FT5 A;  3G8M A;  1AY8 A;  4O6Z A;  1KKJ A;  1MDO A;  1ORD A;  2YCP A;  1AAW A;  1DJU A;  2G6W A;  3BCX A;  4XJM A;  4DGT A;  3QI6 A;  4W1V A;  3TFT A;  2VMP A;  3GZC A;  4ZAH A;  3II0 A;  2W8J A;  4E3Q A;  1N2T A;  3FFH A;  3RBF A;  1X2A A;  3EIA A;  3LVM A;  4FL0 A;  3E2Z B;  1CL2 A;  1X0M A;  1CZE A;  3ELE A;  2W7D A;  3B46 A;  1FG7 A;  2EZ1 A;  3FVX A;  2DKJ A;  3ASB A;  2FKI A;  2DGL A;  1AHY A;  3F0H A;  2AY5 A;  2BWP A;  2Z20 A;  1AJR A;  2FYF A;  1DTY A;  4E1O A;  2BI9 A;  2W7K A;  1D7R A;  4JEZ A;  2AY8 A;  1MDX A;  2VGT A;  1QIR A;  3A9Y A;  4Q76 A;  2HP1 A;  1JS6 A;  3FQ8 A;  3LVJ A;  3W1H A;  1ZOD A;  1S06 A;  1AMA A;  3DU4 A;  1J04 A;  3KGX A;  2R5E A;  1AJS B;  3PAA A;  1OXP A;  2FQ6 A;  4ZWV A;  2O0R A;  3EZS A;  2ZY5 A;  1WYU B;  1CJ0 A;  1GC4 A;  3E9K A;  8AAT A;  4ZWM A;  4ITG A;  1MAQ A;  5EQC A;  4EMY A;  1QIT A;  2VMR A;  1IAY A;  3FSL A;  3JU7 A;  1GBN A;  2KFP A;  3K7Y A;  1YNU A;  2BYJ A;  1G7X A;  2GQN A;  4W1W A;  4Y0H A;  3FZ7 A;  4GE9 A;  3RBL A;  1MGV A;  1W7M A;  4Q6R A;  1WST A;  2R5C A;  1SFF A;  4MKJ A;  3P6K A;  5C6U A;  1U08 A;  4ZSW A;  2Z61 A;  1OXO A;  3DR4 A;  1CL1 A;  3DZZ A;  3PDX A;  4UHM A;  1BT4 A;  2AY1 A;  3FTB A;  3K28 A;  3ZRQ A;  3E2Z A;  1AKC A;  4ADE A;  3MKJ A;  4JEV A;  3K40 A;  1BJN A;  1C0N A;  1SZK A;  3ISL A;  2A1V A;  2W7F A;  3QPG A;  4LW2 A;  2AY3 A;  4DBC A;  3GWP A;  1GEX A;  3GR9 A;  3HLM A;  4ITX A;  2ZSL A;  4JF1 A;  5DJ1 A;  3PJ0 A;  3JTX A;  1BKG A;  2BI3 A;  4MQQ A;  1RVU A;  2WK8 A;  3BWN A;  2E7U A;  3EZ1 A;  3BB8 A;  4Y0D A;  1M6S A;  1J32 A;  4OBU A;  1ASM A;  1AIB A;  4A0G A;  4AO4 A;  3PPL A;  3I16 A;  4K2M A;  4ADB A;  1TOG A;  2JJH A;  3MC6 A;  5DX5 A;  1VJO A;  3VP6 A;  2WB6 A;  1JG8 A;  1UU1 A;  2FM1 A;  3NYU A;  3AV7 A;  1KL2 A;  1S09 A;  2VMX A;  2YKY A;  3AEP A;  2DR1 A;  2VGU A;  3DXV A;  2X5F A;  2AY2 A;  3USF A;  5K8B A;  4M2K A;  3AEL A;  1ASD A;  3EI7 A;  4A6T A;  5M49 A;  3GZD C;  3WKR A;  3GJU A;  1UU2 A;  3WCO A;  1TOE A;  3PGY A;  3EUC A;  1M0N A;  1TAS A;  3WGB A;  1CQ8 A;  3MAF B;  4B9B A;  1AKB A;  1DGD A;  1YOO A;  1WKG A;  3M5U A;  3MAU A;  1TAR A;  4H63 Q;  4A0H A;  4P7Y A;  4F5I A;  4ATQ A;  1V2E A;  5M4B A;  3N4S A;  2W8U A;  4WB0 A;  5EUN A;  5HXX A;  2Z67 A;  1ELQ A;  5FT4 A;  4OCA A;  3MAF A;  2FNI A;  2AAT A;  2YKU A;  2BI2 A;  3G0T A;  3TFU A;  4WBT A;  4GDY A;  2Z9X A;  2VMO A;  5E5I A;  5F8V A;  4LW4 A;  2C81 A;  3ZRR A;  1X28 A;  2E7J A;  3QM2 A;  1BS0 A;  3VK4 A;  3FVU A;  1PMO A;  1LW4 A;  3FVS A;  4XJO A;  1WKH A;  4F5H A;  1ASE A;  3ZZJ A;  1H1C A;  4ADC A;  2D63 A;  2FN6 A;  1QZ9 A;  3NUI A;  2ZP7 A;  5JAY A;  3GET A;  3ZZK A;  1YJS A;  2VLF A;  4IYO A;  2EPJ A;  4U2H A;  1TOK A;  3E2F A;  5FT6 A;  1JF9 A;  2W7M A;  2ZY3 A;  4GE4 A;  4BHD A;  2BWO A;  4UHN A;  3RCH B;  1ZC9 A;  5EAV A;  3NU7 A;  4BA5 A;  4A6R A;  4MY5 A;  4ZAS A;  3WKS A;  3BN1 A;  2G7J A;  1ASN A;  1GC0 A;  3DR7 A;  5I92 A;  1ASG A;  1D7S A;  3BCA A;  1ART A;  3E2Y A;  4IXS A;  1MAP A;  4JE5 D;  4RKC A;  5G4J A;  3N7N A;  2XBN A;  1YIY A;  4N0B A;  4K05 A;  1AJS A;  2W8W A;  4Q75 A;  4E3R A;  2VGV A;  1XEY A;  4RIZ A;  3RQ1 A;  2Z9U A;  4FFC A;  1ASF A;  2Z1Y A;  4M2M A;  1B9I A;  3H7F A;  4RM1 A;  2ORD A;  3PDB B;  4LC3 A;  1B8G A;  4OBV A;  3HMU A;  1AHG A;  1D2F A;  1YJZ A;  9AAT A;  3D6K A;  3BC8 A;  1ASA A;  1C9C A;  3HBX A;  3HQT A;  4PVF A;  4WD2 A;  5G09 A;  1O61 A;  3DRD A;  2AY6 A;  1GCK A;  5EIG B;  2VGW A;  2QB3 A;  4I8A A;  2HZP A;  4LNM A;  4PFN A;  3N4R A;  4IXO A;  4WB0 B;  2VLH A;  1CQ7 A;  2YKX A;  2Z9W A;  3CQ6 A;  3T32 A;  2XH1 A;  4EB7 A;  2BYL A;  1IJI A;  1IUG A;  3BS8 A;  4RKD A;  4KYO A;  5HHY A;  3ELP A;  4LNL A;  4ADD A;  4JEX A;  2HOR A;  4LNJ A;  2ZY4 A;  4L0O A;  1JS3 A;  3AEN A;  1N8P A;  3DYD A;  3UAK A;  4F5M A;  3WY7 A;  1AHX A;  4AOA A;  2GMS A;  1BJ4 A;  5EIG A;  3W1J A;  5EUD A;  3NYT A;  4WYA A;  4RIT A;  2AEU A;  2O7C A;  2OKJ A;  1G4V A;  3G7Q A;  3RI6 A;  4Y0I A;  4RAE A;  3KGW A;  2D5Y A;  1XI9 A;  1C7O A;  2YKV A;  1AIA A;  2BIA A;  1TOI A;  2X3L A;  5D95 A;  3R4T A;  1ARS A;  3E77 A;  3N75 A;  3NDN A;  2EGY A;  1Z7D A;  1OHY A;  2HOY A;  1AMR A;  4K2I A;  4PFF A;  4BMK A;  1RV3 A;  3DXW A;  1EQB A;  3Q8N A;  2VIA A;  1RVY A;  1EJI A;  4CBS A;  5IWQ A;  1MDZ A;  4UQV A;  2W7E A;  3B1C A;  1UKJ A;  2BI1 A;  1ASL A;  4RJY A;  5LH9 A;  1WYV B;  3TQX A;  4XJP A;  2QMA A;  2W7L A;  2TPL A;  1G7W A;  3LV2 A;  2EYQ A;  5EUE A;  2ZYJ A;  3F6T A;  2EZ2 A;  1EG5 A;  3ACZ A;  1KL1 A;  4HVK A;  2Q7W A;  3PDB A;  2VYC A;  4WXF A;  3PIU A;  2ZJG A;  2JIS A;  2VIB A;  1YIZ A;  2Z1Z A;  4MQP A;  2OAT A;  2W7J A;  3FQ7 A;  4MGR A;  4KAM A;  1KMK A;  3EI8 A;  4GSA A;  4R8D A;  4F5K A;  4RLG A;  5EAA A;  5E4Z A;  1C4K A;  1O4S A;  1SPA A;  2C7T A;  2CAN A;  3B1D A;  3TCM A;  1W7N A;  3LVL B;  4ZM4 A;  3MEB A;  2W7G A;  3AEM C;  2BIG A;  3A9Z A;  2GSA A;  4ZSY A;  4CVQ A;  3OP7 A;  3RUY A;  1S08 A;  1LC7 A;  2VGS A;  2EO5 A;  4CBR A;  2E7I A;  1M0Q A;  2R0T A;  4XAU A;  4WYD A;  4DQ6 A;  4MKK A;  2VGZ A;  2PB0 A;  4NOG A;  4WYF A;  1VEF A;  3R9A A;  1IX8 A;  4IYO B;  1W7L A;  1IAX A;  2YRI A;  2V0Y A;  3AEJ C;  3BWO A;  1I41 A;  1OAT A;  4TMR A;  2ZSM A;  5J8Q A;  1AIC A;  3ECD A;  4W91 A;  2GB3 A;  3NUB A;  1M0O A;  2QSR A;  4OT8 A;  3I5T A;  1AHF A;  1PMM A;  3N5M A;  3AOW A;  1AY4 A;  1AKA A;  1ECX A;  3H9X A;  3NU8 A;  4R5Z A;  1GD9 A;  3FDD A;  3FDB A;  1M0P A;  1AX4 A;  1YAA A;  2CY8 A;  2BHX A;  1DFO A;  2F8J A;  1I29 A;  1LKC A;  2YRR A;  3QBO A;  4QGR A;  1B5P A;  1C7N A;  2CST A;  4TV7 A;  2D65 A;  1M4N A;  4XJL A;  2OGE A;  2WK9 A;  3CQ5 A;  4CXQ A;  1Y4I A;  3FCR A;  1TOJ A;  4AZJ A;  3LWS A;  5G2Q A;  2QB2 A;  2YCN A;  1QGN A;  4MSO A;  5DB5 A;  3KKI A;  4TN4 A;  3UE8 A;  2HOX A;  4A6U A;  3FQA A;  4AZK A;  4ATP A;  4BA4 A;  2DGM A;  1KAF A;  4KXK A;  3JW9 A;  1I48 A;  2VMN A;  3IHJ A;  2W7H A;  1B9H A;  1IBJ A;  2D61 A;  3WGC A;  4H51 A;  4IX8 A;  5DJ9 A;  3N4X A;  1MLY A;  1GDE A;  4F5J A;  2VMS A;  2CFB A;  2JGT A;  1PG8 A;  4XK1 A;  2VMV A;  3OKS A;  2JJG A;  3L8A A;  1M32 A;  4PIW A;  1GC2 A;  4OMA A;  2JJE A;  2DKB A;  3IF2 A;  1LW5 A;  1B5O A;  3LVK A;  2D66 A;  3AAT A;  4JE5 A;  3WCN A;  1E5E A;  2C0R A;  1WYU A;  2AEV A;  5AX8 A;  1DGE A;  1AY5 A;  3FZ6 A;  2V1P A;  2BKW A;  4K2B A;  3B1E A;  1D7V A;  2RFV A;  2D64 A;  3FZ8 A;  3WLX A;  3A9X A;  2CJH A;  3JWB A;  4IW7 A;  3EIB A;  3RCH A;  1W23 A;  4P3M A;  4WP0 A;  2VMZ A;  5FT8 A;  4R2N A;  5LHA A;  1P3W A;  4MQR A;  1LS3 A;  3QHX A;  4JF0 A;  3EI9 A;  2OKK A;  4WLH A;  4OTL A;  3ASA A;  4Q31 A;  2E54 A;  1I43 A;  1S0A A;  1ARH A;  5EFS A;  4IXZ A;  2R2N A;  1LC8 A;  2AY7 A;  5HDM A;  1DJE A;  3AEM A;  3ZRP A;  1BJO A;  4ZLV A;  4A0R A;  3JWA A;  1ASB A;  2DGK A;  1OHW A;  1N31 A;  4EFF A;  4A0F A;  4ZDP A;  2OQX A;  1IVR A;  1WYV A;  5D5S A;  1BJW A;  4ZM3 A;  3NX3 A;  2R5C B;  2WK7 A;  1BQA A;  3MBB A;  3W1I A;  1SVV A;  1C7G A;  3AEN B;  3AEO A;  2NMP A;  1W3U A;  3PA9 A;  3EI5 A;  3WX9 A;  3QN6 A;  2VI9 A;  3P1T A;  2HP2 A;  3FRK A;  1GEY A;  4F5G A;  2ZC0 A;  3NNK A;  4WXG A;  3VK2 A;  4OYT A;  3AEJ A;  5M46 A;  1H0C A;  4R5F A;  1IX7 A;  4UHO A;  1S07 A;  3EI6 A;  2AY4 A;  2CTZ A;  1TPL A;  2WKA A;  4W5K A;  1BQD A;  2YHK A;  1GC3 A;  4W8I A;  3LG0 A;  1QIS A;  3I4J A;  5E3K A;  1V2F A;  3HVY A;  1BW0 A;  3B8X A;  1ELU A;  1SZS A;  3PD6 B;  4J5U A;  1KKP A;  3CAI A;  5G0A A;  1D7U A;  1SZU A;  1M7Y A;  3HT4 A;  4IY7 A;  3VK3 A;  2QBT A;  2CIN A;  1CZC A;  2Z9V A;  4W1X A;  3FD0 A;  4GRX A;  1QJ3 A;  4WYC A;  3MAD A;  1BJO B;  4J8L A;  1TAT A;  1RV4 A;  3BV0 A;  2YOB A;  2QLR A;  2DOU A;  4N0W A;  4WLJ A;  2GMU A;  4XQ2 A;  2ZY2 A;  1FG3 A;  1WYT B;  2BI5 A;  1DKA A;  1MLZ A;  2CJG A;  3FFR A;  3WZF A;  3KE3 A;  3JZL A;  2PB2 A;  3MC6 C;  1G4X A;  1ARG A;  1ZOB A;  2W7I A;  2VMW A;  4WXB A;  1AMQ A;  2W8V A;  4BQ0 A;  3LY1 A;  1YJY A;  1CS1 A;  2CH1 A;  2W8T A;  2VMQ A;  3E6G A;  3A2B A;  4F4E A;  1V2D A;  1GEW A;  1AHE A;  4ISY A;  2VMT A;  1LC5 A;  3UWC A;  4B98 A;  2ZUK A;  3HDO A;  1WYT A;  4WYG A;  3GBX A;  2CB1 A;  4GEB A;  5TF5 A;  4RJ0 A;  2FNU A;  2JG2 A;  3F9T A;  1DJ9 A;  3DC1 A;  3FKD A;  3CQ4 A;  2BIE A;  4WYE A;  4ZDL A;  7AAT A;  3AOV A;  2HUI A;  2X5D A;  3CBF A;  1V72 A;  1T3I A;  2OGA A;  4M2J A;  2X8U A;  3GSB A;  4ZDO A;  2VMY A;  2YCT A;  5F9S A;  3TAT A;  4GE7 A;  2EH6 A;  2QA3 A;  1KMJ A;  3COG A;  2C44 A;  3GZD A;  4A00 A;  2JJF A;  1B4X A;  1FC4 A;  1Z3Z A; 
#chains in the Genus database with same CATH homology
 2O1B A;  2HUF A;  5M4D A;  4F5L A;  3N0L A;  1LK9 A;  3VAX A;  3QGU A;  3DOD A;  4EB5 A;  4HF8 A;  5G2P A;  3VOM A;  4A72 A;  1E5F A;  4JEY A;  1IX6 A;  2CJD A;  3HL2 A;  1O62 A;  5BJ4 A;  2D7Y A;  1ARI A;  3ATH A;  3BWN C;  3H14 A;  1O69 A;  3NTJ A;  1PFF A;  4AH3 A;  2BWN A;  2VMU A;  3NRA A;  1QJ5 A;  1VP4 A;  2VI8 A;  4U1T A;  3BCB A;  3PD6 A;  3NYS A;  4E77 A;  1ASC A;  5G4I A;  4AO9 A;  1CQ6 A;  4XEW A;  5KTB A;  2HUU A;  3A8U X;  1SF2 A;  5BJ3 A;  1AMS A;  1UU0 A;  1X29 A;  2D7Z A;  4CXR A;  2CH2 A;  4JEW A;  2AY9 A;  4OC9 A;  4EU1 A;  1OHV A;  4UOY A;  4F5F A;  1AAM A;  3L44 A;  2HOZ A;  2PO3 A;  5FT5 A;  3G8M A;  1AY8 A;  4O6Z A;  1KKJ A;  1MDO A;  1ORD A;  2YCP A;  1AAW A;  1DJU A;  2G6W A;  3BCX A;  4XJM A;  4DGT A;  3QI6 A;  4W1V A;  3TFT A;  2VMP A;  3GZC A;  4ZAH A;  3II0 A;  2W8J A;  4E3Q A;  1N2T A;  3FFH A;  3RBF A;  1X2A A;  3EIA A;  3LVM A;  4FL0 A;  3E2Z B;  1CL2 A;  1X0M A;  1CZE A;  3ELE A;  2W7D A;  3B46 A;  1FG7 A;  2EZ1 A;  3FVX A;  2DKJ A;  3ASB A;  2FKI A;  2DGL A;  1AHY A;  3F0H A;  2AY5 A;  2BWP A;  2Z20 A;  1AJR A;  2FYF A;  1DTY A;  4E1O A;  2BI9 A;  2W7K A;  1D7R A;  4JEZ A;  2AY8 A;  1MDX A;  2VGT A;  1QIR A;  3A9Y A;  4Q76 A;  2HP1 A;  1JS6 A;  3FQ8 A;  3LVJ A;  3W1H A;  1ZOD A;  1S06 A;  1AMA A;  3DU4 A;  1J04 A;  3KGX A;  2R5E A;  1AJS B;  3PAA A;  1OXP A;  2FQ6 A;  4ZWV A;  2O0R A;  3EZS A;  2ZY5 A;  1WYU B;  1CJ0 A;  1GC4 A;  3E9K A;  8AAT A;  4ZWM A;  4ITG A;  1MAQ A;  5EQC A;  4EMY A;  1QIT A;  2VMR A;  1IAY A;  3FSL A;  3JU7 A;  1GBN A;  2KFP A;  3K7Y A;  1YNU A;  2BYJ A;  1G7X A;  2GQN A;  4W1W A;  4Y0H A;  3FZ7 A;  4GE9 A;  3RBL A;  1MGV A;  1W7M A;  4Q6R A;  1WST A;  2R5C A;  1SFF A;  4MKJ A;  3P6K A;  5C6U A;  1U08 A;  4ZSW A;  2Z61 A;  1OXO A;  3DR4 A;  1CL1 A;  3DZZ A;  3PDX A;  4UHM A;  1BT4 A;  2AY1 A;  3FTB A;  3K28 A;  3ZRQ A;  3E2Z A;  1AKC A;  4ADE A;  3MKJ A;  4JEV A;  3K40 A;  1BJN A;  1C0N A;  1SZK A;  3ISL A;  2A1V A;  2W7F A;  3QPG A;  4LW2 A;  2AY3 A;  4DBC A;  3GWP A;  1GEX A;  3GR9 A;  3HLM A;  4ITX A;  2ZSL A;  4JF1 A;  5DJ1 A;  3PJ0 A;  3JTX A;  1BKG A;  2BI3 A;  4MQQ A;  1RVU A;  2WK8 A;  3BWN A;  2E7U A;  3EZ1 A;  3BB8 A;  4Y0D A;  1M6S A;  1J32 A;  4OBU A;  1ASM A;  1AIB A;  4A0G A;  4AO4 A;  3PPL A;  3I16 A;  4K2M A;  4ADB A;  1TOG A;  2JJH A;  3MC6 A;  5DX5 A;  1VJO A;  3VP6 A;  2WB6 A;  1JG8 A;  1UU1 A;  2FM1 A;  3NYU A;  3AV7 A;  1KL2 A;  1S09 A;  2VMX A;  2YKY A;  3AEP A;  2DR1 A;  2VGU A;  3DXV A;  2X5F A;  2AY2 A;  3USF A;  5K8B A;  4M2K A;  3AEL A;  1ASD A;  3EI7 A;  4A6T A;  5M49 A;  3GZD C;  3WKR A;  3GJU A;  1UU2 A;  3WCO A;  1TOE A;  3PGY A;  3EUC A;  1M0N A;  1TAS A;  3WGB A;  1CQ8 A;  3MAF B;  4B9B A;  1AKB A;  1DGD A;  1YOO A;  1WKG A;  3M5U A;  3MAU A;  1TAR A;  4H63 Q;  4A0H A;  4P7Y A;  4F5I A;  4ATQ A;  1V2E A;  5M4B A;  3N4S A;  2W8U A;  4WB0 A;  5EUN A;  5HXX A;  2Z67 A;  1ELQ A;  5FT4 A;  4OCA A;  3MAF A;  2FNI A;  2AAT A;  2YKU A;  2BI2 A;  3G0T A;  3TFU A;  4WBT A;  4GDY A;  2Z9X A;  2VMO A;  5E5I A;  5F8V A;  4LW4 A;  2C81 A;  3ZRR A;  1X28 A;  2E7J A;  3QM2 A;  1BS0 A;  3VK4 A;  3FVU A;  1PMO A;  1LW4 A;  3FVS A;  4XJO A;  1WKH A;  4F5H A;  1ASE A;  3ZZJ A;  1H1C A;  4ADC A;  2D63 A;  2FN6 A;  1QZ9 A;  3NUI A;  2ZP7 A;  5JAY A;  3GET A;  3ZZK A;  1YJS A;  2VLF A;  4IYO A;  2EPJ A;  4U2H A;  1TOK A;  3E2F A;  5FT6 A;  1JF9 A;  2W7M A;  2ZY3 A;  4GE4 A;  4BHD A;  2BWO A;  4UHN A;  3RCH B;  1ZC9 A;  5EAV A;  3NU7 A;  4BA5 A;  4A6R A;  4MY5 A;  4ZAS A;  3WKS A;  3BN1 A;  2G7J A;  1ASN A;  1GC0 A;  3DR7 A;  5I92 A;  1ASG A;  1D7S A;  3BCA A;  1ART A;  3E2Y A;  4IXS A;  1MAP A;  4JE5 D;  4RKC A;  5G4J A;  3N7N A;  2XBN A;  1YIY A;  4N0B A;  4K05 A;  1AJS A;  2W8W A;  4Q75 A;  4E3R A;  2VGV A;  1XEY A;  4RIZ A;  3RQ1 A;  2Z9U A;  4FFC A;  1ASF A;  2Z1Y A;  4M2M A;  1B9I A;  3H7F A;  4RM1 A;  2ORD A;  3PDB B;  4LC3 A;  1B8G A;  4OBV A;  3HMU A;  1AHG A;  1D2F A;  1YJZ A;  9AAT A;  3D6K A;  3BC8 A;  1ASA A;  1C9C A;  3HBX A;  3HQT A;  4PVF A;  4WD2 A;  5G09 A;  1O61 A;  3DRD A;  2AY6 A;  1GCK A;  5EIG B;  2VGW A;  2QB3 A;  4I8A A;  2HZP A;  4LNM A;  4PFN A;  3N4R A;  4IXO A;  4WB0 B;  2VLH A;  1CQ7 A;  2YKX A;  2Z9W A;  3CQ6 A;  3T32 A;  2XH1 A;  4EB7 A;  2BYL A;  1IJI A;  1IUG A;  3BS8 A;  4RKD A;  4KYO A;  5HHY A;  3ELP A;  4LNL A;  4ADD A;  4JEX A;  2HOR A;  4LNJ A;  2ZY4 A;  4L0O A;  1JS3 A;  3AEN A;  1N8P A;  3DYD A;  3UAK A;  4F5M A;  3WY7 A;  1AHX A;  4AOA A;  2GMS A;  1BJ4 A;  5EIG A;  3W1J A;  5EUD A;  3NYT A;  4WYA A;  4RIT A;  2AEU A;  2O7C A;  2OKJ A;  1G4V A;  3G7Q A;  3RI6 A;  4Y0I A;  4RAE A;  3KGW A;  2D5Y A;  1XI9 A;  1C7O A;  2YKV A;  1AIA A;  2BIA A;  1TOI A;  2X3L A;  5D95 A;  3R4T A;  1ARS A;  3E77 A;  3N75 A;  3NDN A;  2EGY A;  1Z7D A;  1OHY A;  2HOY A;  1AMR A;  4K2I A;  4PFF A;  4BMK A;  1RV3 A;  3DXW A;  1EQB A;  3Q8N A;  2VIA A;  1RVY A;  1EJI A;  4CBS A;  5IWQ A;  1MDZ A;  4UQV A;  2W7E A;  3B1C A;  1UKJ A;  2BI1 A;  1ASL A;  4RJY A;  5LH9 A;  1WYV B;  3TQX A;  4XJP A;  2QMA A;  2W7L A;  2TPL A;  1G7W A;  3LV2 A;  2EYQ A;  5EUE A;  2ZYJ A;  3F6T A;  2EZ2 A;  1EG5 A;  3ACZ A;  1KL1 A;  4HVK A;  2Q7W A;  3PDB A;  2VYC A;  4WXF A;  3PIU A;  2ZJG A;  2JIS A;  2VIB A;  1YIZ A;  2Z1Z A;  4MQP A;  2OAT A;  2W7J A;  3FQ7 A;  4MGR A;  4KAM A;  1KMK A;  3EI8 A;  4GSA A;  4R8D A;  4F5K A;  4RLG A;  5EAA A;  5E4Z A;  1C4K A;  1O4S A;  1SPA A;  2C7T A;  2CAN A;  3B1D A;  3TCM A;  1W7N A;  3LVL B;  4ZM4 A;  3MEB A;  2W7G A;  3AEM C;  2BIG A;  3A9Z A;  2GSA A;  4ZSY A;  4CVQ A;  3OP7 A;  3RUY A;  1S08 A;  1LC7 A;  2VGS A;  2EO5 A;  4CBR A;  2E7I A;  1M0Q A;  2R0T A;  4XAU A;  4WYD A;  4DQ6 A;  4MKK A;  2VGZ A;  2PB0 A;  4NOG A;  4WYF A;  1VEF A;  3R9A A;  1IX8 A;  4IYO B;  1W7L A;  1IAX A;  2YRI A;  2V0Y A;  3AEJ C;  3BWO A;  1I41 A;  1OAT A;  4TMR A;  2ZSM A;  5J8Q A;  1AIC A;  3ECD A;  4W91 A;  2GB3 A;  3NUB A;  1M0O A;  2QSR A;  4OT8 A;  3I5T A;  1AHF A;  1PMM A;  3N5M A;  3AOW A;  1AY4 A;  1AKA A;  1ECX A;  3H9X A;  3NU8 A;  4R5Z A;  1GD9 A;  3FDD A;  3FDB A;  1M0P A;  1AX4 A;  1YAA A;  2CY8 A;  2BHX A;  1DFO A;  2F8J A;  1I29 A;  1LKC A;  2YRR A;  3QBO A;  4QGR A;  1B5P A;  1C7N A;  2CST A;  4TV7 A;  2D65 A;  1M4N A;  4XJL A;  2OGE A;  2WK9 A;  3CQ5 A;  4CXQ A;  1Y4I A;  3FCR A;  1TOJ A;  4AZJ A;  3LWS A;  5G2Q A;  2QB2 A;  2YCN A;  1QGN A;  4MSO A;  5DB5 A;  3KKI A;  4TN4 A;  3UE8 A;  2HOX A;  4A6U A;  3FQA A;  4AZK A;  4ATP A;  4BA4 A;  2DGM A;  4KXK A;  3JW9 A;  1I48 A;  2VMN A;  3IHJ A;  2W7H A;  1B9H A;  1IBJ A;  2D61 A;  3WGC A;  4H51 A;  4IX8 A;  5DJ9 A;  3N4X A;  1MLY A;  1GDE A;  4F5J A;  2VMS A;  2CFB A;  2JGT A;  1PG8 A;  4XK1 A;  2VMV A;  3OKS A;  2JJG A;  3L8A A;  1M32 A;  4PIW A;  1GC2 A;  4OMA A;  2JJE A;  2DKB A;  3IF2 A;  1LW5 A;  1B5O A;  3LVK A;  2D66 A;  3AAT A;  4JE5 A;  3WCN A;  1E5E A;  2C0R A;  1WYU A;  2AEV A;  5AX8 A;  1DGE A;  1AY5 A;  3FZ6 A;  2V1P A;  2BKW A;  4K2B A;  3B1E A;  1D7V A;  2RFV A;  2D64 A;  3FZ8 A;  3WLX A;  3A9X A;  2CJH A;  3JWB A;  4IW7 A;  3EIB A;  3RCH A;  1W23 A;  4P3M A;  4WP0 A;  2VMZ A;  5FT8 A;  4R2N A;  5LHA A;  1P3W A;  4MQR A;  1LS3 A;  3QHX A;  4JF0 A;  3EI9 A;  2OKK A;  4WLH A;  4OTL A;  3ASA A;  4Q31 A;  2E54 A;  1I43 A;  1S0A A;  1ARH A;  5EFS A;  4IXZ A;  2R2N A;  1LC8 A;  2AY7 A;  5HDM A;  1DJE A;  3AEM A;  3ZRP A;  1BJO A;  4ZLV A;  4A0R A;  3JWA A;  1ASB A;  2DGK A;  1OHW A;  1N31 A;  4EFF A;  4A0F A;  4ZDP A;  2OQX A;  1IVR A;  1WYV A;  5D5S A;  1BJW A;  4ZM3 A;  3NX3 A;  2R5C B;  2WK7 A;  1BQA A;  3MBB A;  3W1I A;  1SVV A;  1C7G A;  3AEN B;  3AEO A;  2NMP A;  1W3U A;  3PA9 A;  3EI5 A;  3WX9 A;  3QN6 A;  2VI9 A;  3P1T A;  2HP2 A;  3FRK A;  1GEY A;  4F5G A;  2ZC0 A;  3NNK A;  4WXG A;  3VK2 A;  4OYT A;  3AEJ A;  5M46 A;  1H0C A;  4R5F A;  1IX7 A;  4UHO A;  1S07 A;  3EI6 A;  2AY4 A;  2CTZ A;  1TPL A;  2WKA A;  4W5K A;  1BQD A;  2YHK A;  1GC3 A;  4W8I A;  3LG0 A;  1QIS A;  3I4J A;  5E3K A;  1V2F A;  3HVY A;  1BW0 A;  3B8X A;  1ELU A;  1SZS A;  3PD6 B;  4J5U A;  1KKP A;  3CAI A;  5G0A A;  1D7U A;  1SZU A;  1M7Y A;  3HT4 A;  4IY7 A;  3VK3 A;  2QBT A;  2CIN A;  1CZC A;  2Z9V A;  4W1X A;  3FD0 A;  4GRX A;  1QJ3 A;  4WYC A;  3MAD A;  1BJO B;  4J8L A;  1TAT A;  1RV4 A;  3BV0 A;  2YOB A;  2QLR A;  2DOU A;  4N0W A;  4WLJ A;  2GMU A;  4XQ2 A;  2ZY2 A;  1FG3 A;  1WYT B;  2BI5 A;  1DKA A;  1MLZ A;  2CJG A;  3FFR A;  3WZF A;  3KE3 A;  3JZL A;  2PB2 A;  3MC6 C;  1G4X A;  1ARG A;  1ZOB A;  2W7I A;  2VMW A;  4WXB A;  1AMQ A;  2W8V A;  4BQ0 A;  3LY1 A;  1YJY A;  1CS1 A;  2CH1 A;  2W8T A;  2VMQ A;  3E6G A;  3A2B A;  4F4E A;  1V2D A;  1GEW A;  1AHE A;  4ISY A;  2VMT A;  1LC5 A;  3UWC A;  4B98 A;  2ZUK A;  3HDO A;  1WYT A;  4WYG A;  3GBX A;  2CB1 A;  4GEB A;  5TF5 A;  4RJ0 A;  2FNU A;  2JG2 A;  3F9T A;  1DJ9 A;  3DC1 A;  3FKD A;  3CQ4 A;  2BIE A;  4WYE A;  4ZDL A;  7AAT A;  3AOV A;  2HUI A;  2X5D A;  3CBF A;  1V72 A;  1T3I A;  2OGA A;  4M2J A;  2X8U A;  3GSB A;  4ZDO A;  2VMY A;  2YCT A;  5F9S A;  3TAT A;  4GE7 A;  2EH6 A;  2QA3 A;  1KMJ A;  3COG A;  2C44 A;  3GZD A;  4A00 A;  2JJF A;  1B4X A;  1FC4 A;  1Z3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...