2D6MA

Crystal structure of mouse galectin-9 n-terminal crd in complex with lactose
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
151
structure length
151
Chain Sequence
GSMALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Galectin-9 N-terminal Carbohydrate Recognition Domain from Mus musculus Reveals the Basic Mechanism of Carbohydrate Recognition
pubmed doi rcsb
molecule keywords lectin, galactose binding, soluble 9
source organism Mus musculus
molecule tags Sugar binding protein
total genus 34
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2d6mA00
2VW1A 3M2MA 4DRRA 1HQWA 3UJQA 4XBNA 2DTWA 2ZGTA 5JOZA 1ENSA 2WSUA 2ES3A 3OY8B 1BKZA 1JN2P 1WBLA 1G9CA 1MR5A 2VUAA 3FFZA 4WV8A 1HDKA 5GM0A 1DLLA 5JOWA 5GLTA 1QMJA 2EIGA 2ENRA 2BQPA 2ZGMA 5E8AA 2ZKNA 4P9WA 2A71A 1GZ9A 1VAVA 2D6OX 1A3KA 2DUOA 2P3KA 3ZPYA 5T52A 1Z78A 4IQPA 1RIRA 1PZ8A 1ULGA 1WLWA 1LU1A 1UPSA 1S0GA 1JW6A 1AX2A 2UU8A 5DG1A 2D7FA 1S0BA 4BOWA 1ULDA 1QOOA 3N3HA 4NOTA 5EYYA 4BMEA 2OVUA 5GZDA 1AX1A 3W59A 1CONA 1LGBA 3IPVB 3QCWA 3N35A 1LOFA 1G9AA 2ARXA 4FPCA 1ZM1A 3OBRA 4YW1A 4YGBA 4AGGA 1SLTA 1N47A 1QDOA 2AH2A 3ZYRA 1W6OB 4FVVA 3A0NA 1GZWA 4Q2FA 1HQLA 4JRAA 1LOBA 2NYYA 3AXEA 2ZMLA 5DZFA 5E88A 4AYUA 1YYNA 3ZXLA 2ZGKA 4AVVA 4L8QA 1QU0A 4M3CE 1DYKA 1JYIA 5KXDA 1LHUA 4FPFA 4FP2A 1IS3A 3WHUA 1GICA 1W6QA 3AP6A 3ZSKA 1UX6A 1WD3A 2CY6A 3SISA 3RMYA 1ONAA 3AYDA 1QOSA 4LBQA 2ZABA 3V0BB 4K1ZA 2VW0A 1HKDA 1LOAA 3ILFA 5CA6A 5T54A 1LHVA 4JC1A 5SV8A 4BLJA 1WLCA 4ATEA 4ZKTB 2DVGA 3DUIA 3MEPA 1GNZA 1DQ4A 1V6IA 1SBEA 1H9PA 2D6NA 5JOXA 4D69A 2GN3A 3V64A 2ZA9A 1LOEA 4I30A 1TEIA 1KDKA 3M3QA 5JLVA 4WVWA 1KDMA 2E51A 4AVTA 3WHTA 3NV1A 4FPLA 4XBQA 1QGLA 4XJWA 2DU0A 1DYPA 4FQZA 1DBNA 1F31A 4ZXKA 2DVBA 1LENA 1CPMA 2D6MA 2VU9A 1KITA 1PZ9A 3V65A 5KXBA 2PHXA 4HL0A 1GLHA 3B3QE 3LSDA 2A3YA 3C2UA 4GKYA 1UZYA 1WW7A 2DU1A 1A8DA 3FLPA 4YW2A 1BJQA 1CR7A 1HLCA 2Q5TA 4Y1ZA 3WOGA 2AUYA 2JE9A 3AP5A 2A70A 2GMMA 2UWAA 3OY8A 4MYEA 3T2TA 1W6MB 2AENA 1W0PA 2JJ6A 1LHWA 4DPNA 1AX0A 2ZHMA 3UK9A 1FNYA 5GLUA 1SFYA 4Q26A 5T55A 4YLZA 1V6KA 5LK5A 5IT6A 4Y20B 1N3PA 3SITA 3PVNA 2CL2A 4AVSA 4GXLA 2EXKA 3WZ1A 5GZCA 5T5PA 1N3OA 4XHBA 2GNDA 1IS5A 1BZWA 4F83A 2CYFA 4BLIA 4CRQA 5CBLA 1ULEA 1JOJA 1Y7BA 4XE9A 1S0IA 2VY0A 3AXDA 4FPKA 3N7LA 3V0AB 2CWMA 1IOAA 2G4IA 1MVEA 3TAYA 3OBTA 1DZQA 2A3WA 1GYKA 2GDFA 2ZHLA 3BODA 1ENRA 4YM3A 1DFQA 5JMCA 1C57A 2VW2A 1VAMA 1QKQA 2ZGPA 1AXZA 3GALA 3IMNA 4M01A 3N7KA 1ZA4A 2EXIA 2JE7A 3FUOA 2A7AA 3I8TA 3PJQA 1VIWB 1C1LA 2GMPA 1MZ6A 1G7YA 2DURA 4P9YA 2PHFA 4DFSA 5H9SA 4Z8BA 1JUIA 2ZHKA 5IK5A 5KXCA 5EYXA 2P3JA 2P37A 3CNAA 3VKFC 4WZFA 1H30A 1V6MA 3D6EA 3AX4A 2OW4A 5T5OA 3T1LA 1MS4A 1MZ5A 5KXEA 2W08A 1I3HA 3AYAA 4LBNA 4RA0A 4XXAA 1GZCA 3ZVXA 5EWSA 4CZSA 3V0BA 2WLQA 4WVVA 4UW4A 2D44A 3WDYA 3ZSLA 4BM8A 1DQ0A 1QNWA 4OZXA 2A6XA 1IS4A 1FATA 1WW4A 2H0BA 1N1YA 3A4UA 3WVJA 1LHOA 4YZ5A 1XQNA 4R9DA 2AR6A 1Q8VA 1DGLA 1Z0HA 4FP3A 2R1DA 1LEDA 1LHNA 2PHUA 4K1YA 1AXYA 2D3SA 2ZHNA 3BIWE 4Q1RA 4BQ1A 3PVOA 4PF5A 1CESA 3VKLA 5GJ6A 5IUQA 3LSEA 5JOYA 4M3CA 4PQ9A 2ZGOA 4Y1VA 4BMBA 4ISRA 4UW5A 5GLWA 2CWSA 1S0DA 1LGCA 1KJRA 1R1ZA 2D3RA 3VKMA 1YRZA 1MS8A 3INAA 1GBGA 4YZ4A 1U0AA 2FHRA 1MS3A 1W6PB 5CB7A 4PCRA 3O0XA 1LCLA 5GZGA 1S1AA 1W6NB 2DYCA 1LGNA 4LBMA 3R05A 3OGGA 1GANA 4Y1YA 3O0VA 1ENQA 1JHNA 5DUXA 1BQPA 3PMEA 3NV2A 2CTVA 2YMZA 3OYWB 2A6YA 2DVAA 1VLNA 1SACA 1LESA 1N1SA 4YZ3A 3SLIA 3UJOA 2JD4A 1MS5A 2DWRA 1BXHA 3WNXA 5F9TA 1CQ9A 5GZFA 1KQRA 1VALA 4Y20A 4FPOB 1URXA 3WCSA 1NXD1 4PBPA 2E7TA 1YXWA 1SBFA 4YM0A 4FOVA 1CVNA 3MW2A 4YFWA 3UL2A 4XMAA 4TYSA 3V0AA 2V5YA 2EXHA 1A78A 1SCSA 3WDUA 4FOQA 3M3OA 1FV2A 1C4RA 3MW3A 4Q1PA 2AGSA 1AJKA 3NV3A 4Q8KA 4YZ1A 2XG3A 3RG0A 1OQ1A 2ZGSA 1AF9A 4LBOA 4AWDA 3AZWA 1NLSA 5DUWA 1GV9A 4PBOA 4ISQA 3L2YA 1LECA 1SLCA 2DTYA 1QOTA 1ULFA 4XILA 2NMOA 3MW4A 3AZZA 1WD4A 3ATGA 4Y22B 1YI7A 2WSVA 1ULCA 4LBJA 3WG3A 5EXOA 5BYNA 1AXKA 4GWNA 5CAZA 1Q8SA 1RITA 2I2SA 3POYA 4XOGA 4XIOA 4XIKA 4XXPA 2PELA 4GKXA 4Y24A 3KQRA 3BTAA 3POSA 4R9CA 2ZGRA 5T5JA 2NZ9A 5T50A 3LCPA 2ZGQA 4YG3A 4JCKA 4KBBA 4XJ8A 2KM2A 2YXSA 1LJ7A 3POWA 4AGVA 1GZWB 3AP4A 3N7JA 4R9BA 3WDXA 3ZXEA 1JYCA 3AZVA 2PHRA 3H0OA 2R0HA 1N1TA 2R0FA 2A6VA 5DZEA 2ZMKA 1G86A 4XJ9A 3ZSJA 2Z42A 4XMIA 1Q56A 1IKQA 1S0FA 3IPVA 4P14A 1JXNA 4YW4A 3WDVA 5IK8A 2AYHA 3SH4A 4LBQB 3O12A 3R4SA 4FPYA 1W0OA 3WDTA 2E7QA 3IN9A 2NMNA 1W6OA 1OFSA 4SLIA 3ZSMA 2DV9A 1W6PA 4YW3A 1F9KA 2ZGLA 5HCFA 1W6NA 3AZYA 3I4IA 1LTEA 3RS6A 2CNAA 3N36A 2ARBA 1C1FA 2UWBA 3N7MA 3HN1A 2P3IA 1BYHA 1DQ2A 2GNTA 2ZMNA 3GNEA 3RSJA 2PHTA 2V73A 3AJZA 3OJBA 3WG4A 1G9FA 1WBFA 2VH9A 3SNMA 3WV6A 4GA9A 3ASIA 1LEMA 2ZGNA 5IK4A 3ILRA 1KRIA 1UN1A 4NO4A 1O4YA 4XTMA 2D6LX 3RQ0A 1OKQA 1X50A 2GALA 2WT2A 2ZZJA 4YGEA 1AZDA 1UL9A 1WCSA 1S0JA 4Q8LA 5H9QA 2LTNA 5H9PA 3ZYPA 5HCAA 2PHWA 3JU9A 3FUQA 2D43A 3USUB 4DRVA 2SLIA 3B00A 3M1HA 3O5SA 1D0HA 4XDQA 3ZXKA 1IKPA 1FNZA 3RMXA 3M3EA 2NN8A 3SH5A 1WW6A 1MS1A 2ZACA 2R1BA 3IM0A 4LBQD 3TB0A 4FPJA 2VXRA 1LOCA 1LU2A 2EF6A 1FYUA 1AJOA 2A6WA 3AP7A 4Q27A 4RL7A 2A75A 2GMEA 3WUCA 3ZXJA 5DUVA 1LOGA 2NM1A 3PVEA 1QF3A 4Y22A 4AGRA 3WG1A 2A3XA 1LULA 2RHPA 3WDWA 1D2SA 2EAKA 2ZAAA 3AFKA 1EPWA 4Y26A 1O4ZA 4U36A 1CPNA 1W6MA 3D4KA 3A0KA 4XTPA 3FLRA 1SLLA 3DGTA 5GLVA 1SCRA 3B01A 1SLAA 4GWMA 4XHXA 4Y1UA 4XJUA 1UMZA 4XJAA 1DIWA 1LOFC 1Q8QA 1SLBA 2WT1A 2EALA 5HCBA 1SLIA 1JBCA 3NV4A 1G8WA 1CN1A 1UAIA 4XBLA 4XZPA 1AVBA 4YG6A 1GNHA 2WKKA 2ZBJA 3AZXA 3VKOA 2UWCA 2JECA 3O0WA 4UW6A 2D6KA 4YGCA 4K21A 5DXDA 1DQ5A 1APNA 2EXJA 4TZDA 2ZGUA 3AYCA 2AREA 2DUPA 1S0CA 2YZ4A 1V00A 3D5OA 4FQ4A 4U2AA 1H9WA 1N1VA 2SBAA 4BPZA 4ASMB 4M3CF 3T1MA 2NP0A 3QLQA 2P34A 3VKNA 1QNYA 5JDBA 1MS9A 4FPHA 3AJYA 3WCRA 2XB6C 3R4UA 2YY1A 3OPZA 4YM2A 1B09A 2A6ZA 5DG2A 5F5QA 1Q8PA 2DVDA 4XJZA 4CTEA 4K20A 1YO8A 2YROA 2YV8A 5IK7A 4HANA 4FOYA 3BOPA 2OUHA 4M3CB 4GALA 1V6NA 4M00A 4ITCA 1YIFA 2E53A 1CJPA 1DQ6A 1V6OA 4FOWA 4YG0A 4YM1A 4FPEA 2GN7A 1MACA 4C1WA 1MVQA 4YW5A 2GNMA 5FRAA 1MS0A 4LBKA 4W65A 1FX5A 4UW3A 1J1TA 2B7YA 2D3PA 3AP9A 3WUDA 1WLDA 1GSLA 2R16A 1I1EA 3AYEA 5H9RA 5CNAA 2W52A 2TEPA 5T5LA 5GALA 1UZZA 2OUJA 1V6LA 2P2KA 1DHKB 5DZGA 2DVFA 1KJLA 3KM5A 3USUA 1G9BA 5GLZA 4DS0A 3WLUA 2WNEA 1W6QB 3HR9A 2JDZA 5FREA 3RRDA 5AVAA 2A5ZA 2D6PA 4XYXA 1CIWA 4YFZA 3B69A 3W58A 4P9XA 4C1XA 3NWKA 4DQAA 3JUUA 4FPGA 2E6VA 3VV1A 4Y1XA 3Q9OA 1IS6A 3ZXFA 2FMDA 3MPPG 2ERFA 4YGDA 5JVVA 2WQZC 3ILNA 3ENRA 1FAYA 1G9DA 3HMYA 4LBLA 1S0EA 1N3QA 1QDCA 2JKBA 1WW5A 2C9AA 3APBA 1GKBA 1DQ1A 3OYWA 3FBYA 3WG2A 3IKWA 3U4XA 2C5DA 2R49A 3FLTA 3B9CA 1F5FA 1PZ7A 1WUVA 2UURA 1RINA 2WJSA 4R9AA 1FV3A 5GZEA 2W68A 1V6JA 1SBDA 5DUUA 4H55A 2GNBA 4YZ2A 2LALA 1LODA 1Q8OA 1UKGA 5L73A 5E89A 3AK0A 2DUQA 4ATFA 3VUOA 2WT0A 3M3CA 2HYKA 2W39A 3SH3A
chains in the Genus database with same CATH superfamily
3AMQA 3O1UA 2QQPA 3AKPA 3FBMA 3JQXA 4XFFA 5DPNA 5JOZA 1NG0A 2VZTA 4B3NA 1EP0A 4LHSA 1ENSA 3J7NA 4A6SA 1UU6A 3ZDSA 5I0TA 4KWJA 4YVSB 2Z79A 5GM0A 1IZ3A 2JB4A 5F32A 5GLTA 5JDBA 3DV8A 2EIGA 3D82A 2DF7A 1ZBE2 2ZKNA 5FQ0A 4G9SB 4OHXA 1VAVA 1COV1 1PM7A 2P3KA 4OLLA 5IAVA 2BVBA 1WLWA 4BOWA 3DPRC 4BQ4A 3AM2A 4PQQA 4TSVA 1QOOA 3Q8AA 4YVWC 5EYYA 5C6CA 1RXFA 2MEV2 5GZDA 1D4M2 4CCCA 1FOD2 1QH7A 2VECA 5A70A 3ZFFA 4AI8A 3QCWA 4BZ4A 2R042 4GMP3 4CDWC 4COWA 1PGL2 1G9AA 2ARXA 1S2BA 3CZJA 4GQ7A 4N53A 2RR13 1UWWA 4YGBA 1VBC1 2JIGA 4AGGA 5FUPA 3ZYRA 1WZXA 2AEYA 2BNMA 4XDPA 1TNFA 2RDNA 4FVVA 2HWB1 5AFBA 2CHHA 4JV4A 1HQLA 3PUIA 3A7QA 4Q4X1 1UO9A 3M70A 3GF6A 1JZ3A 4IGOA 4NIAA 3ZXLA 3MIDA 2ZGKA 3OEAA 4M3CE 5T3NA 1GP5A 1O3QA 2FQPA 2Z69A 3WINE 3WHUA 1UX6A 3WXPA 4JGZB 4QGNA 3AYDA 2FDHA 5LY2A 1AR91 1HKDA 3ILFA 3I59A 2GP5A 1X36A 1W9SA 4F7ZA 3PTYA 3B94A 3PNAA 2XVGA 4YARA 3M7AA 2YC2A 1FMD1 4QQOA 1XNAA 1WLTA 1GNZA 4C90A 3MICA 4CCOA 2VZ3A 4NRPA 4D69A 1RUJ2 4NWWA 5AC92 1ZRIA 1OC1A 1RHI2 1PO22 1L7QA 3SCFA 5JLVA 1KDMA 5A7WA 2FZ2A 2E51A 5IAXA 5D8AB 4AVTA 2Y34A 5A1FA 4LKSA 4NIHA 5JPMB 1QGLA 4XJWA 1QJX1 4CCJA 4OHYA 4BXSV 5FXXA 4B1LA 1Z7S1 2QQMA 1ND2C 2V5DA 4IV3B 4V1PA 4HSLA 1F31A 1YJKA 3ME2A 4EROA 5JSRA 1CPMA 3FL7A 3TYJA 4GWIA 4BWOA 4Q0VA 5KXBA 4V2WA 2QQKA 1XE8A 4LE4A 3NSTA 3CZUA 1C5IA 4P5HA 3ABZA 1ZZ7A 3JD71 1W0NA 3RYKA 1BJQA 1PIV1 1SG3A 1XE0A 3BPZA 3WP6A 5K9YA 5KR7A 2JE9A 1ULOA 3OY8A 4PLMA 4W6XA 5LBBA 5ABJB 1W6MB 3KCYA 1ASJ3 2B39A 3J8F1 1NQDA 2MHFA 2ZHMA 4KNCA 4QGMA 1OH3A 2W46A 3A22A 3ZN6A 4Q26A 5BNQA 1V0AA 4OMDA 1CIYA 1MEC2 2R043 1A8MA 5F3GA 1QHDA 1F5JA 2WS91 3VLBB 1DGRA 1NOVA 1NE6A 4ZU5A 3AFGA 4DY5A 4BLIA 1RUH3 2RDQA 1ULEA 4YPJA 1RUG2 1KEXA 1ALYA 4OFGA 4XE9A 3S7EA 5FOBB 3V0AB 5L9RA 2Z5WA 4A42A 3TAYA 3OBTA 2H6BA 4HLTA 5FJKA 3LA7A 5M0TA 2WFF3 4UBHA 1W99A 5IHRA 1GP4A 1QKQA 4IGQA 1C8M1 3IMNA 1AUYA 2Q1MA 1OOPA 4HG6B 5FBJA 1QH6A 2EXIA 3HT2A 5JI9A 1PNGA 1RUI1 1VIWB 1RUF1 3MV01 1MZ6A 4CSWA 4LA2A 3ZYJB 3P3NA 4DFSA 4JAAA 1UXZA 3OUJA 3ETPA 3VKFC 2EA7A 3ZM8A 4WZFA 4QM9A 1V6MA 1BMV1 3AX4A 1EV12 2RE9A 3GJAA 2IZWA 1MZ5A 4CPBA 5KXEA 2W08A 4K3UA 1VRBA 4WZCA 3ACGA 4P08A 5HBAA 5EP9A 1GZCA 3ZVXA 3RYPA 3U1XA 2WLQA 4WVVA 1UYYA 4UW4A 3MHZA 4BM8A 4JGZC 2W1SA 3I2GA 4OZXA 5FP8A 2J1UA 2N7GA 4XUOA 5F5CA 2QVSB 1N1YA 4DXRA 1LHOA 1US2A 2AR6A 3LWCA 4FP3A 2VOTA 1R1A1 2PHUA 5K0UA 1AXYA 2D3SA 1X33A 3AMHA 2VVDA 3BIWE 2X05A 5JIUA 4QQPA 2O8QA 4OHVA 4N43B 5FMDA 4PF5A 3VBFB 3VKLA 3DL3A 5IUQA 4RSUA 1O3TA 1YFXA 3ES4A 4BJ0A 4AAXA 1K45A 4ZZ8A 1RGSA 4Q4Y1 5GLWA 4WVMB 2X5IA 1PVXA 1KFUL 1PO11 4NAOA 4CUBA 5FMBA 1GBGA 4I0WB 3NL1A 3WT3A 4GH4B 4PDWB 5I91A 2ZEXA 3BI3A 5A32A 5FO9B 4PCRA 3T4VA 2OIIA 5GZGA 4RQPB 1S1AA 2RM22 1BEV1 4MGZE 4KGGA 2HYXA 3OGGA 3R05A 1GANA 2LUWA 1JTZX 1ENQA 5F5IA 4AHXA 1BLZA 2YDEA 2CTVA 2QE3A 3NV2A 4B4PA 5IYYA 4DOUA 5CISA 1RUG3 3H8UA 2YC0A 1ZBA2 3DCQA 3S30A 2E63A 3BTXA 4YZ3A 2ATFA 2GAUA 3SLIA 2BPA2 2DWRA 4QPGB 1BXHA 1QXRA 1YQ5A 5ABJC 1CQ9A 1V9U3 3RYRA 5GZFA 4Y20A 1IHMA 4A45A 1NXD1 2VUJA 4PBPA 3HQRA 2IXIA 2VNOA 1YXWA 4TTGA 2XUEA 4K40A 3ST7A 3J26N 4YFWA 3UL2A 1TME2 1CX4A 4AI3A 4TYSA 4HN1A 1DF0A 4OUEA 3WF2A 5C5UA 1UD1A 2XJTA 3T0BA 1SCSA 2XWJB 1NY72 3IAPA 4YW7A 2PAEA 5FPLA 4XW3A 3V56A 4BH9A 4N8MA 4O7XA 3MGUA 4Q8KA 3CO2A 4QXBA 3ZDVA 2BFUS 3MYXA 3WF4A 4LBOA 3ZO0B 1GWKA 1NLSA 1GV9A 1UF2C 1VBB1 4HT1T 4ISQA 5JUVA 3H8OA 4LORA 4NRQA 4MHRA 2NMOA 3I2FA 3MW4A 3BKZA 3ATGA 2VBBA 4KG0A 1YI7A 1JZ8A 1ULCA 4FTBA 3WG3A 2VMFA 2R072 1AXKA 2JG9A 4GWNA 5C4WA 5CAZA 1XU2A 2TNFA 2I2SA 4XOGA 3CMGA 4GWJA 2PELA 3GM8A 4GKXA 3PLQA 3DF0A 5FP3A 4IEOA 2VOKA 3W21A 3BTAA 4L11A 4LKDA 4R9CA 5J48A 2XJRA 3ZFEA 2UYAA 4UAPA 3CEWA 5C8CC 4JCKA 2XKPA 2RR11 3E97A 3POWA 4LLFA 4LULA 3RJRA 4AGVA 5L36A 1VRH2 2RJ2A 1YLLA 1EAH2 2FCVA 1W2OA 3AP4A 4LOSA 4R9BA 3ZXEA 5CADA 4NR1A 5A6XA 4W8JA 5FZDA 2RS52 1N1TA 4B1MA 1LAJA 1WMDA 1X82A 2RM23 2VVEA 4WBBA 5FPBA 3ZSJA 3SXWA 2Z42A 4YW4A 3IPVA 1S0FA 5IK8A 3WDVA 3VBFC 4E4DX 4LR4A 3SH4A 4IE4A 4OMCA 3R4SA 4OQ9A 4CYDA 3UV9A 3D0JA 4JTOA 4XF3A 2NMNA 1W6OA 4AQ6A 4YW3A 2ZGLA 3JCIA 1J3RA 4EN7B 1NCRA 4FT8A 2P1BA 4IV1B 2OA2A 4XAEA 1YUDA 5HCFA 2Q30A 3WQ1A 1XRUA 2QUOA 3KV9A 3N36A 1QXJA 4GH4C 1SQ4A 2XKOA 4PDWC 1C1FA 2UWBA 4RGKA 3UGGA 2BNOA 4COUA 1REDA 2GNTA 1YFUA 1W06A 3UKVA 3MI8A 5LA9A 4BDVB 3AJZA 3OJBA 5F2SA 2HWF3 3SKJE 1HRV2 1QEXA 5CYYA 5EIYB 3LDKA 1DGWX 2YU2A 1ND3B 4QQ2A 2VCCA 4Q5OA 2V4VA 4TLGA 4BQ2A 4LTAA 4QPGC 2D6LX 1VB4A 4B7EA 1JH5A 4UWDA 1G6NA 1ZBE1 1UCXA 3K46A 5HCAA 1SZBA 2PHWA 3USUB 2D43A 2F4PA 4NRMA 4R52A 1UNBA 5FDBA 1CWPA 1QJY2 2ET1A 3WR0A 3NQHA 5C9AA 2R073 1ZZ6A 1XPWA 4MUVA 1UOJA 3U10A 3RMXA 3HNBM 3M3EA 2O8OA 2NN8A 4XAAA 1QJZA 3OBZA 3IM0A 5FXWA 2Q1FA 4E4SA 2VXRA 4IEQA 3WNPA 3RG0A 1FOD1 2VQTA 3WNNA 3WUCA 2GMEA 4KWKA 3TN92 5FZ8A 3ZXJA 4NE9A 2NM1A 2R041 4Y22A 4AGRA 1PGL1 5KHJA 1UY1A 1HJFA 5FZCA 1PNFA 2ZAAA 4NIDA 1AHSA 1EAH3 3I2HA 3GBGA 1O4ZA 2FDGA 4CDUB 4CP9B 2XHNA 3EJKA 4Z07A 3HQXA 2VOWA 4HETA 4AEJA 1SCRA 1SLAA 4ONUA 4Y1UA 1CGPA 1XC6A 4XJUA 5A6QA 1UMZA 4S2HA 4XJAA 4CUGA 5IFPA 5HCHA 3O1PA 1LOFC 2VZ1A 2WT1A 2X5IC 3BALA 3EHKA 2QKDA 3LOBA 2HBTA 5A3WA 1UY0A 3BGAA 1NCQB 1ENXA 4GAZA 4XF9A 3BU0A 1OA2A 5J98B 3VKOA 2JX9A 4QX3A 4Y5Z0 1W39A 3K2OA 4KGQA 1NYWA 4IEVA 1DQ5A 3GYDA 3S5AA 5KC5A 3H9AA 2AREA 5AC91 4M0NA 4NPLA 2W1QA 1HIXA 1N1VA 1RVF2 1AYM2 1PO21 2SBAA 3I2KA 3LEMA 4ASMB 4E8DA 1ZRRA 2JWPA 4M3CF 2PQQA 4CDXB 4E8CA 4AEDC 1HRV3 1QNYA 3VKNA 2YB7A 1W8NA 4FPHA 2BDRA 2YY1A 3ZX7A 4D6QA 5F5QA 3KHBA 1IQDC 2Y0IA 1O4TA 2YV8A 5C7GA 3VBSA 3K4DA 4HANA 3FMGA 1GQHA 3BOPA 4D7TA 2Y33A 4M3CB 3KS7A 4O9GA 1YIFA 1UZ0A 4EQVA 4FOWA 4CCKA 1QJY3 1C3HA 4IESA 5A7QA 3FZ3A 3I3EA 1COV3 4UYBA 2BP6A 2XGXA 4AG4A 5BNNB 4Q0QA 1J58A 1MS0A 4LBKA 3VBRC 4BQ5A 1FX5A 5I0SA 1J1TA 2PQSA 2D3PA 2IUWA 3AP9A 1JU4A 4OI0A 2VULA 1UZZA 2VJXA 2DVFA 3KM5A 1H2MA 2AACA 3KT4A 1WCKA 3UETA 1UMIA 2VG9A 2X8KA 1W6QB 1Y3TA 5FREA 3TNQA 4IETA 1LR5A 4QKDA 2JG9C 2WWUA 5AVAA 2D6PA 1H8VA 1CIWA 4YFZA 2JKXA 4CPBD 2BV4A 4XACA 1RUG1 1UQXA 4XEZA 3W58A 4I09A 2ZPXA 1YFYA 3VV1A 1T2XA 2R6QA 2HEYF 4KBZA 3VL9A 1CAXA 1V9U1 2DDUA 3ENRA 3DN7A 2GC3A 2XJUA 3MUY1 1S0EA 5KC6A 5FK7A 4NN0A 5FY4A 4KWUA 5FYUA 4PJYA 2VO5A 2C9AA 2WQ4A 2R32A 3MPBA 5ANNA 3GZEA 3OD0A 5IVCA 2QTWB 1DQ1A 5DAVA 3LF7A 3CBNA 2D98A 4AL9A 3NAPA 3U4XA 2C5DA 5JXIA 4UI9L 2PMWB 4QQHA 3T0AA 2WJSA 1EV11 3RDIA 1FI2A 4HZFA 4AF9A 2W68A 1FMD3 3M4FA 2VOXA 3TEYA 4H55A 2GNBA 1NX9A 4QGLA 4YZ2A 1LODA 1Q8OA 1UKGA 2W9XA 1YC61 3M3CA 1PHMA 2HYKA 2W39A 5CFDA 3AB0A 2JDYA 3H1MA 3SH3A 2R7EB 2DCYA 4XBNA 2WNVB 1NCRC 2DTWA 2VMCA 4XQDA 1GP6A 1NLQA 5IFTA 3IAQA 3VBOB 1BKZA 2WDBA 1MR5A 1K5JA 2JDMA 3FFZA 3WNLA 1HDKA 5DAXA 2IXLA 2C1FA 5FZBA 1SFNA 2ENRA 5E8AA 4A6OA 3MIBA 4HXCA 2IVIB 2QQNA 1A3KA 2WBKA 1K5MB 1UIJA 4OUSA 3ZPYA 2UY9A 5T52A 1RIRA 1ULGA 1UPSA 3JD73 4UT5A 1JW6A 5FYYA 5I8SA 2D7FA 4UFLA 4QX7A 2I74A 3CKHA 4NOTA 3VDDB 2HWE3 3HJRA 4BMEA 2OVUA 2VMIA 4R4XA 3H3LA 3W59A 1CONA 1KXGA 2RM21 3WNKA 5KBFA 1WMEA 4AOCA 3GXUA 3O1OA 1DG6A 2VZQA 2VUCA 2WZR2 3K4AA 3WNOA 2WA4A 1SLTA 3ZFGA 4EE2A 2ZX2A 2WS93 4KL1A 4MX3A 1XXNA 2XLFA 1ZBA1 3PDQA 3A0NA 3N9OA 4COVA 1GZWA 3PJYA 1AL22 4LUKA 1MQTC 1X7NA 4HK9A 4P9IA 5DZFA 2V4AA 4M0HA 2IWGB 4L0PA 3DKQA 4D6SA 1JYIA 1DLCA 1DYKA 3ES1A 1LHUA 1JODA 1VJ2A 4FP2A 3LIGA 4FPFA 1H8TC 1WD3A 2Q8CA 3SISA 4ES9A 4MGSA 2V72A 4N7UA 1NZCA 3RMYA 5L7OA 5LY1A 4LBQA 1PK6B 5CFCA 1NA1B 5FYTA 4K1ZA 1LOAA 2HWF1 1NY71 2X10A 1OPMA 4JC1A 4BLJA 2WNOA 3IZOA 1WLCA 3KF3A 3OD4A 5EFUA 4LIVA 4ATEA 4AI0A 4ZKTB 3DUIA 2BUKA 3MLKA 4YVWB 4AE2A 4Z2AA 1DQ4A 3AVSA 1ZNPA 5CVRA 1H9PA 5A7OA 2NLRA 3HWJA 3ZN5A 5JOXA 5F6LB 4L2NA 3ZN4A 1LOEA 4CP1A 2Q4SA 5C33A 4CDWB 4AHYA 4WVWA 1OKOA 2YBSA 3KMHA 1JZ2A 3NV1A 1RJ7A 4FPLA 3D0SA 4XBQA 5SV5A 3TRSB 2R071 1OA3A 1XOYA 2CV6A 3BU7A 2DU0A 3H1YA 2GC0A 1DYPA 4NJ4A 1D2QA 1VBA2 4CDQA 5A33B 2QZ3A 4QB2A 4ZXKA 1CAWA 2ADEA 3HVDA 2VU9A 2D6MA 4WM7A 4ZU7A 3T2OA 1PZ9A 1BK1A 4MGIE 5LRRA 5A1AA 3O7OA 1PGW2 2PHXA 2V09A 1GLHA 4E2QA 3C2UA 5KHHA 4EV0A 1UZYA 2DU1A 3FLPA 4YW2A 2VBPA 3WW4A 1NAEA 3VBUB 4XFBA 4CCLA 2AUYA 3AP5A 2A70A 3T2TA 1EAH1 4Q4Y3 2VMGA 2WNVC 3EB7A 5FK8A 5FO8B 1LHWA 1NT0A 1PO13 4BQXA 1AX0A 2RS51 4BISA 1PVC3 1SFYA 5T55A 5LK5A 3VZOA 2Z2SB 4QD2A 2IXJA 2XBO3 3C8XA 3OGJA 2CL2A 1LKNA 5FOJB 1BEV3 4EWAA 5C8WA 1XYOA 3RZLA 2WZR3 5GZCA 1UYZA 4XHBA 5T5PA 1IS5A 4X6QB 3CJIB 4F83A 4IERA 2CYFA 1ZZ8A 4JQTA 2RMU2 3RPQA 1Y7BA 3AXDA 2ARCA 4FPKA 2WZPP 2JXAA 2D5HA 1KS5A 3P5BA 3NKGA 2G4IA 3WEZA 2QQLA 5FO7B 1DZQA 2HWC2 5GKAC 1RUD3 1ND2B 4JGYA 3VDDC 1ENRA 4XFIA 1DFQA 4YM3A 1C57A 4XABA 1VAMA 3GALA 4M01A 4RR3A 3ZYGA 1O5UA 2JE7A 1XNBA 2K0GA 3NJXA 3RZZA 3MIHA 3VBHA 1G7YA 5BV6A 1JUIA 2ZHKA 2CGOA 1HRV1 3F95A 4DXSA 5C3SA 3L2HA 5IK5A 1RB8G 3WF0A 4LA3A 2IXHA 3POGA 3B02A 2VZRA 5EYXA 1JYWA 2P3JA 5FZ4A 5IVEA 4OULA 1H30A 3D6EA 2BVVA 3OCPA 4Z82A 3T1LA 3AYAA 4JDMA 4RA0A 4QMAA 1VBB3 3KV5A 5FYCA 4AHWA 4MGYE 3P3PA 4IE7A 2YU1A 1QJY1 5FPUA 1HJGA 2A6XA 4D7SA 1WW4A 1PK6C 2H0BA 2P6HA 1NA1C 1R092 3WVJA 4HPKB 4WM8A 4YZ5A 1AR62 3ZR5A 1IG3A 5CKMA 1VBA3 2E26A 5L19A 2R1DA 3HNMA 2W95A 1LEDA 1LHNA 2A1XA 5FYIA 3VD7A 3S57A 3K3NA 4WVZA 3HN3A 3CLPA 4META 1RL3A 3O1MA 3TN91 4A44A 5EHDA 3H3ZA 1O8PA 5I93A 3IIAA 1W8TA 3I49A 2VC9A 2B8MA 4ISRA 3ZYIB 1QIQA 1S0DA 1LGCA 1KJRA 1R1ZA 4IV3A 3VKMA 1YRZA 1MS8A 5IVBA 4JKLA 3T2PA 5JZGA 3VHPA 4QPIA 4YZ4A 4AI9A 1Y9GA 1IGOA 1MS3A 3KLSA 4HKOA 1A34A 1W6NB 2PFWA 2XHKA 2DYCA 1J83A 4LBMA 2GU9A 1ACCA 3LFIA 3NNLA 4Y1YA 3O0VA 2JDUA 5EPAA 1JHNA 5DUXA 1BQPA 4LO8A 5F5AA 3BTZA 2CAUA 3PUSA 4IGPA 4XFAA 1HN0A 4A3XA 1REEA 3E5UA 1LESA 4OI1A 3UJOA 1L3JA 5FIXA 1W8UA 1MS5A 3VBUC 3S5QA 1SPPB 3A21A 4D0QA 1GWMA 1VALA 3VDAA 3WCSA 1URXA 2NQYA 1FPN2 4INDA 3U78A 2WO1A 3J9SA 5FZ6A 2VQ0A 2D5FA 1CVNA 3MW2A 4RN5A 4D8MA 3KB5A 1W2NA 2WUHA 1AYM1 2GC1A 5A1LA 3V0AA 4LUMA 3AC0A 2PAMA 5CKQA 3AKTA 4JZRA 3WDUA 3CJIC 4HBNA 3EYPA 3ZYHA 2K2SA 1OPOA 2G19A 5FUNA 3MW3A 1FV2A 1C4RA 4Q1PA 1U5XA 3C7OA 3KV4A 3W9AA 3RGBA 4YZ1A 1WGPA 4A2UA 3RZMA 1UYPA 2PLV2 3ZXGA 4QHOA 5FQ0B 4QX8A 5BNOC 1E5IA 3L2YA 2DTYA 1QOTA 3FN9A 3KWVA 4W4ZA 1ZBE3 3GJBA 3AZZA 2IFWA 3LAGA 4F3JA 2JDNA 3PUHA 1L7RA 5JAXA 5EXOA 3RNSA 5BYNA 1AR63 4H2AA 4AQSA 1Q8SA 3LB9A 4CP2A 4XIKA 1W8OA 4LOTA 3KQRA 2HWE1 3IDEA 2ORXA 4B7KA 3GZUC 2GSYA 2MEV3 4MZUA 4XQWA 5AVPA 1O5LA 1D4M3 2VQAA 1RMU2 1FOD3 3JBG2 4J1WA 4J25A 1OD5A 4LO4B 4N53B 5T5JA 1JYTA 2ZX1A 4JVAA 4XJ8A 1CD3G 1H1AA 2KM2A 1LJ7A 2FDJA 4CEWC 3AMNA 1US3A 1VP6A 3A23A 3WDXA 3AZVA 3K48A 4AEMA 1UOGA 1B35C 2A6VA 3O1RA 4I3GA 3PVBB 5E1RA 3DXTA 3WNMA 1IKQA 4P14A 1SMVA 1UX7A 5A3PA 3FHQA 4WVMA 1FXZA 1I5ZA 1TMF2 5JR7B 4BIFA 1TE1B 4GZ9A 1W0OA 5DAQA 5C3OA 2ID4A 5EZWA 5FMOS 2JENA 3NVCA 1OH4A 1RUE2 3T4HB 3ZSMA 2DV9A 4FBFA 1F9KA 3NNMA 3NJYA 5K7PA 3KGLA 3I4IA 4RFT0 2Y60A 3RS6A 2CNAA 2QQJA 4EJRA 2ARBA 4QPWA 1C8NA 2XPJA 3HN1A 5A7SA 3EXUA 1BYHA 4IW3A 2WAAA 5FFOC 3VZLA 3FHIB 5G05L 5A7WB 2JB8A 3RSJA 2PHTA 1U5IA 1WA6X 1RUJ3 5AC93 1RHI3 5C8CB 4MHUA 3R0RA 1WBFA 1PO23 1H6XA 5FY9A 1Q43A 4AXOA 1QWRA 4GA9A 1H1IA 2QNKA 5IK4A 3ILRA 1UN1A 1W9FA 2F6BA 4NO4A 1Q3EA 3G7DA 2ZZJA 4YGEA 2PLV3 1AZDA 4HVRA 1S0JA 2LTNA 4Y4RA 2E31A 5H9PA 1CAUA 3ZYPA 3DXUA 4Q4V2 3JU9A 3WW3A 4FFFA 4JDNA 1D0HA 2RJLA 4XDQA 1JZ5A 2KD7A 4CEYA 5AFEA 2WRAA 2Y26A 2LM3A 5FZ0A 1OVPA 1WW6A 5F6KA 2ZACA 3ZN6B 4LBQD 5FY1A 1ZRFA 1FYUA 4G4FA 1PVC1 4MGKE 4HONA 4RL7A 4QQLA 3HIFA 3PU8A 1LOGA 2XBO1 3PIGA 4MXWA 4A7YA 1MEC3 3WG1A 2A3XA 2WZR1 2BBVA 3WDWA 2RJKA 1D2SA 2YFZA 2EAKA 3AFKA 1EPWA 5IWFA 4E4ZA 4LE3A 3AMPA 2QJVA 4Y5TA 2J1EA 2OPKA 3OUHA 4BQYA 1DDLA 1W8WA 2YBPA 3ZXAC 3K51A 1RUD1 3PHMA 4URAA 4GJYA 3ZFFC 1OOPB 5JCTA 2Y38A 5CG8A 1TMF3 1SLBA 2XXZA 4CU8A 4N53C 3WW1A 3ZPOA 5C5TA 4DUXA 1GR3A 1ZREA 4XBLA 2JD9A 3VDCA 2WAOA 4YG6A 2ZBJA 3U07A 2K46A 4D3WA 2JECA 2J1AA 3O0WA 4DEQA 1GQGA 3VD4A 1APNA 4TZDA 3E1F1 3AYCA 1OQDA 2QDRA 4YRDA 2DUPA 1EV13 1S0CA 1XJAA 4FQ4A 3NJVA 4P9GA 4AVCA 1YEWA 2C26A 4KU7A 4PI0A 2J7MA 3QLQA 2HJIA 2EIBA 4IV1A 4H7MA 1HB1A 2KR2A 3WCRA 2A6ZA 1OLMA 3GHNA 3ZIXA 2WO7A 4XJZA 1VBA1 4K20A 5FZMA 4BA6A 4P9JA 5F7UA 1AR82 4PHZA 5F3CA 3JQWA 1AYN2 4KG8A 5FAXA 4AFAA 4CA9A 5LA0A 3LOIA 5F2WA 1PGW1 4M00A 2ZAHA 4ITCA 3I3BA 3UNPA 4FPEA 4Y5SA 2X5IB 1MVQA 5ERLA 2W1WA 2XJVA 4QX0A 5FRAA 3T30A 2WYFA 4QDQA 4UW3A 3VHRA 1VB2A 4I3PA 1WLDA 3WUDA 3H3UA 3AYEA 2DFBA 2W52A 5CNAA 2TEPA 5T5LA 1ZVFA 4QHBA 2Y6JA 1DHKB 3SMHA 4HFSA 3MUZ1 3USUA 1DGWA 4BE3A 1G9BA 2F4LA 4CXYA 1HRI2 2Y6GA 4EZHA 3J7HA 3POJA 3LPGA 2WNEA 3FWEA 5APAA 5BUVA 3OPTA 3L9JT 4ES8A 3B93A 3B69A 2RMU1 4P9XA 4AEDB 4DQAA 3JUUA 4R8HA 4FPGA 1ZBA3 2RDRA 1IS6A 1HB3A 2ERFA 1OLRA 5JVVA 2HWC1 2GH2A 4AQTA 3U11A 5BPXA 2ZEYA 3UESA 1NE4A 1N3QA 4GB32 3WSOA 5JXGA 4PIYA 2Q8DA 1WW5A 3APBA 5F39A 1GU3A 1TME3 3ZKYA 2ZJCA 3OYWA 4JDOA 2YYOA 4CDUA 1OF4A 4Q0SA 2R49A 3ROUA 2HWD2 3VBRB 3B9CA 3ZR6A 1PZ7A 1WUVA 1EPZA 4R9AA 1FV3A 5GZEA 2KA3A 2RDSA 1V6JA 1SBDA 5DUUA 3IDAA 2B9UA 5L73A 4E9KA 1I6XA 5C3QA 3MBWA 3FX3A 2WT0A 4UF0B 1OOPC 2OX0A 1ZRDA 1NCQA 3KVAA 4EN8B 2VW1A 3NJZA 1HQWA 1F4HA 2ORZA 3J7MA 3UJQA 4B29A 4DRRA 3TEZA 2JG9B 3RZGA 4DMIA 2GP3A 2WIIB 1R091 3ACIA 3H1WA 4HKWA 1AR61 1JN2P 3WP5A 1WBLA 4C0BA 1G9CA 4FTEA 2VUAA 1HN1A 5JOWA 2YFUA 4ZZ5A 1AR83 1DLLA 3N4MA 1O3RA 1AYN3 1QMJA 3TWIA 4DUVA 1BK0A 4CCMA 3LA2A 2MEV1 3ZFEB 2ZGMA 1D4M1 2VVFA 2X53S 2A71A 1GZ9A 4P9WA 4CDXA 1R082 4EYUA 2DUOA 1OSGA 2BWAA 2ZXQA 5FPAA 1PZ8A 2CGNA 1LU1A 1S0GA 3ITQA 4QKBA 1S0BA 4XUTA 2B5HA 2JDPA 1ULDA 1VRH3 3ETQA 4IE5A 2UY8A 4QHZA 5EJ1B 1AX1A 4FAGA 5K0UC 5HV4A 1R64A 5TSWA 1LGBA 1BHGA 2RS53 3IPVB 2Y8KA 1H1MA 2Y6LA 4DXTA 3KCXA 4FPCA 1ZM1A 3QBQA 4YW1A 5BNNA 3LE0A 2AH2A 3LQCA 4IEZA 1W6OB 1JYNA 1NCRB 2TUNA 2UYBA 4JRAA 1LOBA 2L9LA 4RGGA 3CHXA 3AXEA 2ZMLA 5E88A 1YYNA 4NROA 4KU8A 2CDPA 4IEXA 1CZSA 2PYTA 1QU0A 4AVVA 1FPN1 2YHJA 5KHGA 2H0VA 1W6QA 2VTXJ 4K9SA 4ZONA 3AP6A 2CY6A 2XOMA 3D8CA 2AZ5A 3I3QA 1UZWA 1ONAA 3V0BB 2ZABA 1E5RA 1RUJ1 5LA2A 1ODMA 2ET7A 1RHI1 2VW0A 4AQ2A 1OA4A 5CA6A 1LHVA 3BCWA 4O61A 4E2GA 1UU4A 2QQVA 3B5LB 1VMFA 5FJHA 5JSPA 3MEPA 3MLLA 2QQOA 4IE0A 2JG8A 1OQEA 2D6NA 3VGIA 2PLV1 4TWTA 3EMRA 1AR92 2GN3A 2QQWA 1QJEA 1KDKA 2WC2A 4QM8A 1KFXL 5LZ6A 5C9AB 3WHTA 1D0GA 4LIUA 4QU2A 2W91A 5IVFA 2P6CA 5DQ0A 4FQZA 1MQTB 1XBFA 1YQ6A 2EIEA 2R062 2LROA 3WF1A 3GBWA 4FFHA 4L99A 5FUIA 5JWPA 3LGRA 5I8TA 1LENA 2HLEA 4MGQA 1KITA 3PL0A 3V65A 2B9VA 1RMU1 3JBG1 2HEVF 1R083 3B3QE 1H8TB 3LSDA 4HL0A 1GWLA 4GKYA 3TN93 1WW7A 1MEC1 2OPWA 4MO3M 2Y6HA 1HLCA 4W6WA 4Y1ZA 3WOGA 3VBOA 2ZS6B 4MYEA 4UFIA 3I7DA 1W0PA 3KSCA 4SBVA 5A7PA 3UYJA 5C4WC 2LS6A 4DPNA 3POEA 1JZ7A 2CU5A 3UK9A 1W8ZA 5LATA 4D94A 3D3AA 5A3LA 4LHKA 2WNUA 2QDNA 1OVSA 1K5MA 1OXCA 3PVNA 4XETA 5FXZA 4XUNA 3SITA 4S2GA 4GXLA 3I3MA 2EXKA 3WZ1A 3ZFEC 4QXKA 4G3YC 2GNDA 1I9RA 2OQ6A 1TMF1 5DABA 4YNIA 1YFWA 3UT0A 3I54A 2XONA 4CRQA 5CBLA 2YG0A 5IATA 5FZOA 4M4PA 2CWMA 1HX6A 3U14A 2VAUA 1MVEA 3ZOIA 1PM4A 4NPRA 4Q0PA 3VDBA 4X6RB 3BODA 3THDA 5ANQA 5KWRA 1HQNA 1E57A 4RS5A 3R6SA 1AXZA 2B4KA 2E9QA 4QB6A 4OHZA 3N7KA 5BY5A 1ZA4A 2WQ8A 4PIXA 3THTA 4K7JA 4BXFA 3PJQA 1S4CA 1C1LA 2GMPA 4ARXA 4P9YA 2B42B 2DURA 3T3YA 1RVF3 1AYM3 2PHFA 5H9SA 3FC0A 4Q4W2 2P4EA 1Y43B 2Y64A 5FLJA 5KXCA 2DCKA 1GQPA 1SHWB 4GIQA 1TZOA 1UY4A 1M4WA 2P37A 3CNAA 3LIHA 4XC9A 5ACA2 5BNPC 3AL5A 4NUBA 3W5MA 1C8M2 5F1RA 5IVYA 2ZX0A 1RUI2 4XCAA 2PA7A 5FV3A 4BB3A 5K4LA 4CUCA 1IQAA 5FZAA 3ZSLA 4UOJA 1QNWA 3KT7A 5F37A 3DPRA 1HB2A 1FATA 3A4UA 2VBDA 2NPIA 2ZX4A 3LFMA 4YVWA 2YPJA 2R063 4L92A 1Z0HA 4CU9A 2IVJA 2FCUA 4BQ1A 2ZHNA 1FT9A 3PVOA 2BFUL 3RZJA 1UKRA 4CDWA 1A6CA 5GJ6A 5BNPA 3BB6A 1OHFA 1Q5OA 2AC1A 3DEMA 4PQ9A 4AFCA 4NMIA 4BMBA 3OBAA 3ZXDA 4UW5A 3O14A 2CWSA 2TBVA 5C9AC 2D3RA 2QCSB 1XYPA 5IJRA 4D6RA 1U0AA 2FHRA 1W6PB 4F8AA 2DBIA 2XJQA 5FY5A 4XUQA 2VZOA 1LGNA 2C4XA 4Z1VA 2VMEA 4Q29A 1JHJA 3HT1A 2BNNA 4RHV2 1POQA 3SC7X 2JIJA 2Q8EA 4MGTA 4LO5B 3PMEA 3OGSA 2DVAA 4FXKB 4XDOA 5A7NA 1TME1 1SACA 4ZU4A 2VD7A 4GJZA 1QQP2 4QXCA 4C0HA 5JIAA 1HXS2 4Y33A 4LKFA 1RUC2 3M3IA 5FY8A 2X29A 3DECA 3N9LA 2FMYA 4YM0A 3RZKA 4X8PA 4FOVA 2RS32 1XYNA 2PN5A 4XMAA 5CFDB 4N7IA 2OXBA 2V5YA 1W2AX 2EXHA 4NHMA 5A3OA 4XF1A 4FOQA 1VMJA 4LMFA 1CAVA 1O8SA 1ND2A 3KZ4C 3IB3A 1PMIA 3MF9A 2AGSA 1AJKA 3NV3A 1KGYA 4URTA 2XG3A 3ELNA 4ZY9A 4AZZA 3N9MA 1ZZBA 2ZTNA 1AF9A 4AWDA 3AZWA 1AR81 1CZVA 2J42A 1AYN1 1JYXA 5FZEA 3NNFA 1LECA 3PMSA 1GMMA 1ULFA 3WP3A 2WO3A 2MPFA 4QDSA 4I01A 1LB2A 3S7IA 4AVBA 2WSVA 2O14A 2VZSA 4FTSA 4GULA 1X9TA 2WABA 1JOBA 5L9BA 1CJDA 2JG8C 3POYA 5FY7A 2BYVE 4LO6B 1VBE2 1VRH1 2VGDA 3H50A 4S2FA 4Y24A 5KHIA 4YVSA 4OI4A 4EZ4A 4K6BA 3C7GA 3MIGA 3THCA 1QJFA 3VBSC 4IE6A 5T50A 3WY6A 3LCPA 2BERA 3WQBA 5DMYA 4KBBA 2YXSA 4MH0E 1OLME 1DYOA 4JTNA 3HBKA 1QXPA 2PTMA 3NRUA 1GZWB 2ADDA 3AKSA 1ODNA 3N7JA 2HEWF 2CDOA 3LEKA 4QKNA 1JYCA 1RUNA 2PHRA 3H0OA 1W2UA 2ZKLA 4QPYA 1IPKA 1AL23 5FPZA 2R0FA 3FE5A 2FDKA 5CIRA 3RWKX 4AFDA 3U0ZA 1G86A 2B46X 5J96B 4XJ9A 1UZVA 2RR12 1JXNA 4CP0A 4NHLA 5BNOB 1BBT2 4AR2A 4QXHA 3E6CC 4LBQB 3O12A 5CFCB 3CJXA 1WMFA 5CU1A 2E7QA 5F8PA 5JPNB 1ZX5A 1OFSA 1QQP3 3OTFA 2WR9A 2HWD1 1W6NA 1HXS3 1DU3D 2BZDA 1LTEA 1RUC3 5FPXA 3IWZA 1W9WA 3ALQA 3N7MA 4DINB 2P3IA 4EWDA 3OOXA 3H8XA 1IPJA 2XJSA 2ZMNA 2QQIA 3GNEA 4JGZA 1V70A 1J84A 1WMXA 5A3MA 4OYUA 1G9FA 3MV11 5LEKA 2VH9A 2CSGA 3SNMA 4CEWB 3CF6E 3NAPC 1BVP1 1LEMA 3R4DB 4CDQB 2C9KA 2ETEA 4XTMA 1O4YA 3HBZA 2G9GA 3POIA 3RQ0A 4Z92B 2WT2A 1DGRN 1UL9A 1B35B 2Y0OA 3J4UH 2EVXA 4ASLA 3FUQA 1R081 3O5SA 5CFDC 3MDPA 1XB9A 4LK7A 5D8AA 3OF1A 2VR4A 1FNZA 4GD4A 2Z4FA 2P5BA 1X8MA 1VBE3 3FHAA 1QJU2 3SH5A 1UPIA 1DZTA 2JDHA 4FPJA 1JU3A 1WCUA 2P3YA 1LU2A 2EF6A 2A6WA 3AP7A 1J59A 4Q27A 5IW0A 2A75A 2H6CA 2VUDA 3BN6A 5DUVA 1ST8A 3WX5A 2VTXA 1QF3A 3PVEA 3DYPA 3NMBA 3PUQA 4JX0A 4BK4A 1DCSA 3WD5A 1LULA 2RHPA 2WZ8A 4XUPA 4EWEA 3SEEA 1ASJ2 1ULPA 1YCIA 2DCTA 4NWVA 4IL7A 2MNGA 1WCQA 3Q8BA 5ABJA 1CPNA 1RC6A 1JOPA 1W6MA 1YQCA 2RMU3 2YUEA 1OUXA 3A0KA 4XTPA 5FP4A 4AFMA 1O91A 4JGYB 4AVAA 5GLVA 4NIIA 5HXMA 3IBMA 4DO0A 3B01A 4GWMA 2IC1A 3ZYBA 2HWC3 2WWJA 2BRTA 4HK8A 3E6DA 2VZPA 1BBT3 1DIWA 1JI6A 4RR3B 4J1XA 1Q8QA 3DKWA 1RUH2 1GNYA 2EALA 4N90A 5HCBA 5C3RA 3VBHB 5K8SA 3I2IA 3MFCA 3NV4A 1G8WA 1CN1A 4H7LA 4LK6A 3ZFGC 2GC2A 5A3UA 1UU5A 3WQ0A 1RVF1 4KH9A 5D1IA 1W90A 2YGMA 1W3VA 1XSRA 2WKKA 3AZXA 2UWCA 5EQUA 2WFF2 2D6KA 2WWSA 5DXDA 4D7YA 5FCCA 3UGFA 2EXJA 3I3DA 2ZGUA 2YPDA 4LHNA 4LNVA 3NKTA 3P1IA 3D5OA 5KHKA 1VPHA 1H9WA 4NPMA 5L7OC 2NP0A 4DNYA 5CG9A 2WL1A 3N9NA 2J1VA 1MS9A 5CFCC 1W28A 3AJYA 2XQRA 4WM8B 2XB6C 5FZLA 4LO7A 3OPZA 4X8NA 5J36A 1W8FA 1OI6A 5A3TA 1MPXA 3W5NA 1R093 2DVDA 1C5HA 2R061 1ZYBA 4FO9A 1YO8A 1W2TA 2FZ1A 5FBZA 4FXGB 2YROA 4RD7A 3RZHA 4COZA 3GCXA 4J6GA 4FOYA 3S6PA 4W6YA 1V6NA 1RYYA 3FFQA 2E53A 3I2JA 1CJPA 4YG0A 1V6OA 3ZFFB 5C8CA 4YM1A 2GN7A 1H2NA 3LDRA 1MACA 3LPFA 4Q0UA 3VHNA 4YW5A 4A41A 2GNMA 4C1WA 1SFPA 5FLIA 5F3EA 1NXMA 4W65A 5JZGB 2B7YA 1QJU3 3QACA 4QPIB 4XVHA 4YWAA 1GSLA 5I0UA 4B4RA 1I1EA 3VD9A 3OB8A 5FLHA 5H9RA 3PTRB 2VXJA 4CDQC 2P2KA 1V6LA 1JYVA 1YWKA 4A3ZA 5DZGA 2O1QA 4COYA 1KJLA 4WM7C 2FD8A 4N43A 1DZRA 3VBFA 4B4QA 5GLZA 1XU1A 3WLUA 3LD8A 3PUAA 5D21A 3RRDA 3U37A 1TVGA 1GUIA 1ZA7A 2R30A 3EO6A 4BCUA 1Y9QA 4JQRA 4C1XA 3NWKA 3O1SA 2E6VA 2IXKA 1NQJA 3RI9A 1UY2A 3FJSA 4YVSC 5LW9A 2XJPA 3I59B 3Q9OA 4Z2WA 2FMDA 3MPPG 1RXGA 2RVAA 4GH4A 4PDWA 5C70A 2WQZC 5J7MA 2RS12 4RQPA 4HOOA 3WW2A 3HMYA 4LBLA 5JXHA 1FPN3 1I5PA 1UMHA 1VR3A 2BEOA 2JKBA 3GBFA 3LZZA 2EICA 2VPVA 3N9QA 4FCAA 4PLOA 5FWEA 3SEPA 1GKBA 4UXAA 4MLOA 3FBYA 1YHFA 2K9ZA 4Q4W1 4KQ7A 4L9BA 5E6HA 4AFBA 1V9U2 4C8DA 5FYSA 3BYWA 5FY0A 4A7ZA 1TQ5A 3S0MA 5ACA1 2W3JA 2UURA 4H3WA 4QPGA 1RINA 2FDIA 3MF6A 4JGYC 2QFEA 1F8VA 2LALA 2PHDA 2XDVA 2W47A 3AK0A 4ATFA 1PGSA 2FCTA 5HV0A 4LPLA 3VUOA 4RR3C 3M2MA 3RFRA 2ZGTA 3VBHC 2XR4A 5B2GB 1UOBA 3H7JA 1XSQA 2WSUA 1L7LA 4JKMA 2ES3A 4B8EA 3OY8B 5LA1A 4QDRA 4WV8A 1X9PA 1WKYA 2VNGA 2W0XA 3RJ2X 2WN3A 2XVLA 2BQPA 5FTTC 4QX5A 4RGAA 2D6OX 4NHXA 4BK5A 1RMU3 3JBG3 3JZVA 3IIIA 5BXXA 1Z78A 1XNDA 4IQPA 5FZIA 4JKKA 2JDKA 2C0ZA 1AX2A 2UU8A 5DG1A 5I8YA 5JSOA 4WM8C 3N3HA 3ORJA 1REFA 2G1MA 1UXXX 5DAWA 1TNRA 2VM9A 2WA3A 1AL21 1J3PA 3CDZB 5FXVA 5LBEA 3MFAA 1SDDB 5E16A 2VNRA 3T0DA 3N35A 4RHV1 4ASKA 1LOFA 2P17A 4JHTA 1NLRA 4K8FA 4DB5A 3LDBA 3OBRA 5D8AC 1N47A 1QDOA 2IXCA 3SHRA 2BOIA 4Q2FA 1POV0 4IV3C 3ACLA 5FWJA 1QQP1 2NYYA 5HPOA 5I0DA 1RUE3 2W1UA 5JZGC 4AYUA 4QPIC 1F2NA 1HXS1 2Q1ZB 5FZ9A 2VCMA 4QU1A 1OF3A 2RS13 4L8QA 1RUC1 1U5YA 2OZJA 4N9IA 4LITA 5KXDA 1IS3A 4EN9B 1GICA 3AL6A 2OT7A 3ECQA 5FYHA 3ZSKA 4FI9A 2RS31 5HXVA 3O1VA 1W9TA 1XNTA 1QOSA 4AEDA 1D4VB 1WWYA 5T54A 1VBD2 5SV8A 4W50A 5JI7A 2DVGA 1H6YA 2LRPA 4BYYA 4CU6A 1V6IA 1S55A 1SBEA 4XURA 3CU7A 5A80A 4CXXA 5K0UB 2G9ZA 1CAUB 3H8RA 3BUCA 3IMMA 3V64A 2ZA9A 2OZ6A 2HWF2 4I30A 1TEIA 3M3QA 2DCJA 3N9PA 3KGZA 4BQ3A 3HOBA 2VCAA 1O6UA 4Q4V3 4CEYB 4PF1A 3VBRA 2PAKA 3TEXA 4UBGA 4AI2A 4JRLA 4LEJA 3E5QA 1ND3A 3BIEA 2VTFA 4QKFA 4CUAA 1DBNA 4OVEA 1VBE1 4IEWA 4XFGA 2WINB 2DVBA 5FZGA 2CGPA 4HVQA 2E32A 5A32B 4AEKA 4UF0A 1ZRCA 3AKRA 2QQUA 4MXWB 4KMQA 2A3YA 3SQOA 3GZTB 3IDBB 4HN0A 4NHKA 5LEJA 3THPA 1A8DA 1IG0A 3OG2A 1CR7A 4ZS3A 4XF4A 5EV7A 2KXLA 2Q5TA 2GMMA 2UWAA 4RFRB 2AENA 2JJ6A 4H14A 4XQ4A 4TN7A 1SEFA 1FNYA 5GLUA 1WCDJ 5C3PA 3NO8A 4GMP1 2VZUA 4YLZA 1V6KA 5IT6A 4Y20B 1N3PA 3RI8A 1JMUB 3GDBA 4MG2A 1EY2A 2VNVA 4AVSA 4DIQA 1BBT1 1N3OA 3VN4A 2GH8A 3BOWA 1HW5A 5FYVA 1BZWA 3ZSEA 5DN2A 1HV1A 1JOJA 1S0IA 2VY0A 3NW4A 1EUUA 3N7LA 3I97A 2VZVA 1PMJX 4XF0A 4AAPA 4EN0A 1IOAA 2XLGA 3Q8CA 4CE8A 1ZZCA 3I2OA 4CP9A 5FYZA 2A3WA 1GYKA 2GDFA 2ZHLA 4N43C 5JXJA 5JMCA 1AR72 2VW2A 4LT5A 2ZGPA 2ZCWA 1OUSA 3RWNA 5DDJ2 2ARAA 2VMDA 3FUOA 4QX1A 3KHCA 4E4HA 2A7AA 2VMHA 3I8TA 3GGLA 1PX3A 2GZWA 4MV2A 1QY4A 4Z8BA 5FYMA 2XUMA 2BGPA 1VBD3 2YC4A 5FMCA 3QH6A 3C7HA 1CX1A 5L9VA 4OZOA 1JS9A 1S2EA 4RQPC 1RTVA 5C4WB 3MIEA 2OW4A 4ARYA 1WA4A 5T5OA 1MS4A 1EUTA 1H4GA 1O59A 1UIKA 1I3HA 4M4RA 3BTYA 4LBNA 4XXAA 3URFA 3V0BA 1RUOA 5EWSA 1RJ8A 1K12A 4CZSA 4ZHNA 2D44A 3WDYA 4ORFA 1DQ0A 3SCHA 4Y3OA 1GOHA 1IS4A 1YQ2A 2CAVA 3TNPB 3HAGA 1XQNA 2D97A 4R9DA 1Q8VA 3KVBA 1DGLA 1NKGA 3KV6A 1QJU1 3AMMA 4Y4YA 4K1YA 4Q1RA 2BU9A 3PURA 4PLNA 4YW6A 5FZFA 5FKCA 3MIFA 4XCBA 3UGHA 2OQ7A 2RV9A 1F35A 1CESA 2DFCA 1KD7A 3K4ZA 4O65A 3LSEA 5JOYA 4M3CA 1COV2 3TEWA 2ZGOA 4Y1VA 1HRI3 3GHMA 2BGCA 1H2LA 1W3XA 4LKEA 4CCEA 1ASJ1 2JICA 3HPNA 1MQTA 3J7LA 4P9LA 4CEYC 1M06G 3C3VA 3BPSA 4MSVA 3INAA 3K75B 1H4HA 3QD6A 5CB7A 3O0XA 5FZ3A 3CIHA 1LCLA 2D93A 5BNPB 2C24A 3E5XA 1UY3A 1H8TA 2BOJA 1NZIA 3X29B 3VHOA 4QT6A 1YIPA 1BVVA 3OUIA 4IEUA 1VE0A 4ZPIA 1U5ZA 4UFMA 1F4AA 1RUH1 1LNSA 5FPVA 1VBC2 3SKVA 2YMZA 4GB33 4NVPA 4MVTA 4OCTA 1OURA 2A6YA 3OYWB 4HVOA 3ZLIA 4LQRA 1NUKA 1VLNA 5IVJA 5JMOA 1N1SA 2HWB2 2JD4A 4FSJA 2G9FA 4Q4X2 3WNXA 2WFF1 2XLAA 5F9TA 1K42A 1KQRA 4FPOB 2HWD3 3KT1A 1AR73 3VD3A 2E7TA 2BWCA 1SBFA 5DDJ3 5LB6A 4LHLA 4DY3A 3K3OA 1OMIA 4LJHA 5ISLA 3VZMA 5FP7A 3IT8A 1VAKA 1A78A 2VCBA 3OPWA 1IPSA 3BVCA 3T08A 4MXVA 2FDFA 5FMOL 3M3OA 1FMD2 3USSA 3VD5A 2PHLA 4YSFA 1OQ1A 2ZEWA 2ZGSA 1GZTA 1H2KA 3H7YA 5DUWA 4I02A 4PBOA 5J1XA 1SLCA 2I07B 2BGOA 4XILA 3HNYM 1POV3 3VZNA 1WD4A 4JHZA 4Y22B 2JE8A 4LBJA 2WNVA 4IV1C 1QJX2 3HQUA 1RITA 2LW8A 2W94A 1Z7S2 4XIOA 4XXPA 2VQUA 2WO2A 3DYMA 3T2QA 5LASA 4DEVA 3UKNA 2J1SA 4IEYA 1PX4A 5CEHA 2XMLA 3POSA 2ZGRA 1YQ8A 2NZ9A 2ZGQA 2O0OA 2J1RA 3ACHA 3JD72 4YG3A 1Y4WA 5A3NA 2ZX3A 1PIV2 5CKNA 5FP9A 1ND3C 3W20A 4E27A 4MOAA 2HWE2 3VL8A 2JDAA 2QBXA 3J8F2 4A7KA 4C91A 2R0HA 3VDDA 1RUE1 5DZEA 2EIDA 2ZMKA 4DUWA 2W5FA 2RS11 2HH9A 5FKBA 4XMIA 1Q56A 3HD8B 3F2ZA 4CVUA 2WS92 2AYHA 3WQ7A 1VBC3 2BBAA 4HKLA 2W2IA 4FPYA 4CCDA 1W9YA 2DBNA 2W92A 4PIZA 1YNAA 5LBCA 2HWB3 3WDTA 3IN9A 5J37A 3KQ4B 4SLIA 1W03A 4CCNA 4I2OA 1W6PA 5LCWL 3C7FA 3JXSA 4AI1A 2B45X 4Q4X3 4XFCA 3MZHA 2ILMA 3AZYA 1TG7A 3P6BA 2ZEZA 2W87A 2JG8B 3NNJA 4KI5M 2RG4A 3GCWA 3KF5A 2WZEA 2Y6FA 2EAAA 1DQ2A 3MLJA 5CZKA 3VBSB 5J09A 5F3IA 4V2VA 1XNCA 3Q8FA 4LXLA 2V73A 5EJZB 1AL0G 1AR93 1RUF2 3I2DA 3WG4A 3K77A 1PK6A 1NA1A 1HB4A 4GMP0 1PMHX 1STMA 1OD3A 4Q4V1 3ZMNA 4CDUC 2F17A 3WV6A 1YI9A 3G6JB 3OSDA 3ASIA 1DP0A 2ZGNA 5FZKA 3SCGA 1KRIA 1HV0A 1BMV2 1E5HA 4BHPA 2C6SA 1OKQA 2XL9A 1X50A 2GALA 5C71A 4HSJA 1WCSA 4Q8LA 5H9QA 4UFHA 1U12A 1XE7A 4NIGA 5J3UA 4FFIA 3H42B 4DRVA 1J3QA 2SLIA 3B00A 3M1HA 1NCQC 3ZXKA 4L97A 1IKPA 1QJX3 1T6BX 2ZOEB 1MZEA 2XH6A 3E6BA 2OYZA 1Z7S3 2VOVA 3KD4A 4TXWA 5B4NA 4BU2A 4QWNA 2WFPA 2BW8A 1MS1A 1R1A2 2R1BA 3TB0A 3WP4A 4XPVA 1LOCA 2WNUB 5A33A 1K3IA 1AJOA 4AW7A 1JZ4A 4A4AA 1CAXB 4UFJA 2WN2A 4ZXEA 1X8EA 2QZ2A 3QOPA 2DCZA 4CDXC 1LRHA 1PIV3 2AEZA 2Y6KA 2Q0AA 5FYBA 3VB9A 4Q4Y2 4RYDA 3HEIA 1PO12 5FZOB 4Y26A 3OGRA 3VBUA 5HI0A 3OGVA 2PXJA 4U36A 3J8F3 1XNKA 4XFHA 1GOFA 1PVC2 3D4KA 5A6ZA 2I45A 3NAPB 3JB4C 2VE1A 3FLRA 1SLLA 3C7EA 2XBO2 3DGTA 1EYBA 3ON7A 4IEPA 4RS5B 1BEV2 4O9EA 4XHXA 5FZ7A 2YGLA 4QX2A 1T6GC 4P00B 2VL4A 3PIJA 3ZYFA 4CU7A 5FZ1A 4NAMA 3T09A 1SLIA 1JBCA 5BNNC 1UAIA 2J22A 3B9IA 3CJIA 3EQEA 4IDZA 1J1LA 4XZPA 1AVBA 1OFNA 1VBD1 4OUMA 1GNHA 4DXZA 2HBUA 1RUD2 4Q4W3 3LKJA 1E5SA 4UW6A 4YGCA 4K21A 4PT6A 1GFF2 3POBA 4I0BA 5ACA3 1O7FA 4OI2A 5BNOA 1C8M3 2YZ4A 2WLPA 1V00A 4S2DA 5LWBA 3NNGA 3O1TA 4FAHA 3CQOA 4U2AA 1RUI3 3LEIA 1RUF3 4NHYA 4BQWA 4XZUG 4BPZA 2BJSA 4P02B 3T1MA 2FBEA 3DPRB 1CZTA 2P34A 3DYOA 2YBKA 5D2AA 2E33A 1P8JA 1OT5A 2XVKA 4PI2A 4YYOA 2A73B 3KCCA 3R4UA 4YM2A 2XWBB 1B09A 5A6YA 5G04L 1GOGA 1UYXA 5DG2A 5FZHA 1Q8PA 4P5YA 1W04A 3POFA 1JUHA 3WF3A 4CTEA 1O3SA 3JB8A 1F15A 3GZAA 5LK7B 3LA3A 3ZMOA 5IVVA 1VBB2 3EBRA 5IK7A 4OQ8A 2OUHA 5FR3A 4GALA 4AHZA 1DQ6A 4EN6B 4E2SA 2Q8OA 4CEWA 1HRI1 5LRSA 3ZKUA 4TLFA 5DAPA 3ZFGB 3OEBA 3RVHA 2XL7A 4HPKA 4K8RB 1C28A 4N9HA 1D7PM 1R1A3 2R16A 5JR2A 1B35A 4HMZA 1UOFA 2BTVC 4OHWA 2OUJA 5GALA 4I0AA 1OBNA 1BCXA 1UW8A 4BIOA 1MZFA 4IXLA 5B4XA 4DS0A 3M8LA 3TBDA 3HR9A 1YJLA 3AKQA 4RHV3 2JDZA 3U4SA 2X09A 1H0BA 2WYSA 1Y9MA 2A5ZA 4GB31 4XYXA 2OKXA 5L7OB 2E7AA 1VMHA 4KWLA 3MO4A 3VBOC 4Y1XA 3ACFA 3ZXFA 4YGDA 1JZ6A 1SDWA 5EJ3A 3ILNA 1FAYA 3LEGA 4LLOA 2XQXA 4UFKA 1AR71 1G9DA 3B7MA 2WNUC 3ZIWA 1W8HA 4MADA 3UKTA 1QDCA 1K5MC 5DDJ1 4QAWA 2J1TA 4R4ZA 4AK3A 5I0RA 2HKXA 3TOJA 1ZZ9A 1OLQA 2RS33 4DZGA 4IUGA 3AVRA 4FFGA 3VZKA 3WG2A 1CAVB 3VZJA 3PU3A 3U75A 1KS4A 3IKWA 1W05A 3IDCB 2ZZQA 3FLTA 1F5FA 1SPPA 2D40A 5LBFA 4QB1A 3QH7A 4ZS2A 4CXWA 2IFRA 4ET7A 3CL1A 2JEMA 4RS5C 5E89A 1CAWB 4WM7B 2DUQA 3Q8EA 1S2KA 2OS2A 1POV1
chains in the Genus database with same CATH topology
3AMQA 2QQPA 3AKPA 3FBMA 3JQXA 4XFFA 5JOZA 1NG0A 4B3NA 1EP0A 1ENSA 1UU6A 3ZDSA 5I0TA 4KWJA 4YVSB 2Z79A 5GM0A 1IZ3A 5GLTA 3DV8A 2EIGA 3D82A 2DF7A 1ZBE2 2ZKNA 5FQ0A 4G9SB 4OHXA 1VAVA 1COV1 1PM7A 2P3KA 4OLLA 2BVBA 1WLWA 4BOWA 3DPRC 3AM2A 4TSVA 1QOOA 4YVWC 5EYYA 5C6CA 2MEV2 5GZDA 1D4M2 1FOD2 1QH7A 2VECA 3ZFFA 3QCWA 4BZ4A 2R042 4GMP3 4CDWC 4COWA 1PGL2 1G9AA 2ARXA 1S2BA 4GQ7A 4N53A 2RR13 4YGBA 4AGGA 1VBC1 3ZYRA 2BNMA 1TNFA 4FVVA 5AFBA 2HWB1 4JV4A 1HQLA 4Q4X1 3M70A 3GF6A 3ZXLA 3MIDA 2ZGKA 4M3CE 5T3NA 1O3QA 2FQPA 2Z69A 3WINE 3WHUA 1UX6A 3WXPA 4JGZB 4QGNA 3AYDA 1AR91 1HKDA 3ILFA 3I59A 1X36A 4F7ZA 3PTYA 3B94A 3PNAA 2XVGA 4YARA 3M7AA 1FMD1 4QQOA 1WLTA 1GNZA 4C90A 3MICA 4D69A 1RUJ2 4NWWA 5AC92 1RHI2 1PO22 3SCFA 5JLVA 1KDMA 2FZ2A 2E51A 5D8AB 4AVTA 5JPMB 1QGLA 4XJWA 1QJX1 4OHYA 1Z7S1 4V1PA 1ND2C 4IV3B 4HSLA 1F31A 1YJKA 3ME2A 4EROA 5JSRA 1CPMA 3TYJA 4BWOA 4Q0VA 5KXBA 1XE8A 4LE4A 3NSTA 1C5IA 4P5HA 1ZZ7A 3JD71 3RYKA 1BJQA 1PIV1 3BPZA 3WP6A 5K9YA 2JE9A 3OY8A 4PLMA 4W6XA 5ABJB 1W6MB 3KCYA 1ASJ3 2B39A 3J8F1 1NQDA 2MHFA 2ZHMA 4KNCA 4QGMA 3ZN6A 4Q26A 5BNQA 1MEC2 2R043 1A8MA 1QHDA 1F5JA 2WS91 3VLBB 1DGRA 1NOVA 1NE6A 4ZU5A 3AFGA 4DY5A 4BLIA 1RUH3 1ULEA 1RUG2 4XE9A 1ALYA 4OFGA 3S7EA 5FOBB 3V0AB 2Z5WA 3TAYA 3OBTA 2H6BA 4HLTA 3LA7A 2WFF3 4UBHA 1QKQA 1C8M1 3IMNA 1AUYA 2Q1MA 1OOPA 1QH6A 2EXIA 3HT2A 5JI9A 1PNGA 1RUI1 1VIWB 1RUF1 1MZ6A 4LA2A 3ZYJB 3P3NA 4DFSA 4JAAA 3VKFC 2EA7A 4WZFA 4QM9A 1V6MA 1BMV1 3AX4A 1EV12 2RE9A 2IZWA 1MZ5A 5KXEA 2W08A 4K3UA 4WZCA 5HBAA 1GZCA 3ZVXA 3RYPA 2WLQA 4WVVA 4UW4A 4BM8A 4JGZC 4OZXA 2N7GA 2QVSB 1N1YA 1LHOA 2AR6A 3LWCA 4FP3A 5K0UA 1R1A1 2PHUA 1AXYA 2D3SA 1X33A 3AMHA 2VVDA 3BIWE 5JIUA 4QQPA 2O8QA 4OHVA 4N43B 3VBFB 4PF5A 3VKLA 3DL3A 5IUQA 4RSUA 1O3TA 1YFXA 3ES4A 1RGSA 4Q4Y1 5GLWA 4WVMB 2X5IA 1PVXA 1KFUL 1PO11 1GBGA 4I0WB 3NL1A 3WT3A 4GH4B 4PDWB 5I91A 5A32A 5FO9B 4PCRA 2OIIA 5GZGA 4RQPB 1S1AA 2RM22 1BEV1 4MGZE 4KGGA 3R05A 3OGGA 1GANA 2LUWA 1JTZX 1ENQA 4AHXA 3NV2A 2YDEA 2CTVA 2QE3A 4B4PA 4DOUA 1RUG3 3H8UA 2YC0A 1ZBA2 3S30A 2E63A 4YZ3A 2ATFA 2GAUA 3SLIA 2BPA2 2DWRA 4QPGB 1BXHA 1QXRA 5ABJC 1CQ9A 1V9U3 3RYRA 5GZFA 4Y20A 1IHMA 1NXD1 2VUJA 4PBPA 2IXIA 2VNOA 1YXWA 4K40A 3ST7A 3J26N 4YFWA 3UL2A 1TME2 1CX4A 4AI3A 4TYSA 4HN1A 1DF0A 1UD1A 2XJTA 1SCSA 2XWJB 1NY72 2PAEA 4XW3A 3V56A 4BH9A 3MGUA 4Q8KA 3CO2A 2BFUS 3MYXA 4LBOA 3ZO0B 1NLSA 1UF2C 1GV9A 1VBB1 4HT1T 4ISQA 2NMOA 3MW4A 3ATGA 4KG0A 1YI7A 1ULCA 4FTBA 3WG3A 2R072 1AXKA 2JG9A 4GWNA 5C4WA 5CAZA 1XU2A 2TNFA 2I2SA 4XOGA 2PELA 4GKXA 3PLQA 3DF0A 4IEOA 2VOKA 3BTAA 4L11A 4R9CA 5J48A 2XJRA 3ZFEA 2UYAA 3CEWA 5C8CC 4JCKA 2XKPA 2RR11 3E97A 3POWA 4LLFA 4LULA 3RJRA 4AGVA 5L36A 1VRH2 1YLLA 1EAH2 3AP4A 4R9BA 5CADA 3ZXEA 4NR1A 2RS52 1N1TA 1WMDA 1X82A 2RM23 2VVEA 4WBBA 3ZSJA 3SXWA 2Z42A 4YW4A 3IPVA 1S0FA 5IK8A 3WDVA 3VBFC 4E4DX 4LR4A 3SH4A 3R4SA 4CYDA 3UV9A 3D0JA 4JTOA 4XF3A 2NMNA 1W6OA 4AQ6A 4YW3A 2ZGLA 3JCIA 1J3RA 4EN7B 1NCRA 4FT8A 4IV1B 5HCFA 2OA2A 5BNPA 1YUDA 3WQ1A 2Q30A 1XRUA 2QUOA 3N36A 1QXJA 4GH4C 1SQ4A 2XKOA 4PDWC 1C1FA 2UWBA 4COUA 2BNOA 1REDA 2GNTA 1YFUA 3UKVA 3MI8A 3AJZA 3OJBA 2HWF3 1HRV2 1DGWX 1ND3B 4QQ2A 4LTAA 4QPGC 2D6LX 1VB4A 4B7EA 1JH5A 1G6NA 1ZBE1 1UCXA 5HCAA 2PHWA 3USUB 2D43A 2F4PA 4R52A 5FDBA 1QJY2 2ET1A 3WR0A 5C9AA 2R073 1ZZ6A 4MUVA 3U10A 3RMXA 3M3EA 2O8OA 2NN8A 1QJZA 3IM0A 4E4SA 2VXRA 4IEQA 3RG0A 1FOD1 3WUCA 2GMEA 4KWKA 3TN92 3ZXJA 2NM1A 2R041 4Y22A 4AGRA 1PGL1 5KHJA 1PNFA 2ZAAA 1AHSA 1EAH3 3GBGA 1O4ZA 4CDUB 3EJKA 4Z07A 3HQXA 2VOWA 4HETA 4AEJA 1SCRA 1SLAA 4ONUA 4Y1UA 1CGPA 4XJUA 1UMZA 4S2HA 4XJAA 1LOFC 3BALA 2WT1A 2X5IC 3EHKA 2QKDA 3LOBA 1NCQB 1ENXA 4XF9A 1OA2A 5J98B 3VKOA 2JX9A 4Y5Z0 1W39A 4KGQA 1NYWA 4IEVA 1DQ5A 3GYDA 5KC5A 3H9AA 2AREA 5AC91 4M0NA 1HIXA 1N1VA 1RVF2 1AYM2 1PO21 2SBAA 4ASMB 1ZRRA 4M3CF 4CDXB 2PQQA 4AEDC 1HRV3 1QNYA 3VKNA 4FPHA 2YY1A 3ZX7A 5F5QA 2Y0IA 1O4TA 2YV8A 3VBSA 4HANA 3FMGA 1GQHA 3BOPA 4D7TA 4M3CB 3KS7A 4O9GA 1YIFA 4FOWA 1QJY3 1C3HA 4IESA 3FZ3A 1COV3 2XGXA 4AG4A 5BNNB 4Q0QA 1J58A 1MS0A 4LBKA 3VBRC 1FX5A 5I0SA 1J1TA 3AP9A 2D3PA 4OI0A 2VULA 1UZZA 2DVFA 3KM5A 1H2MA 3KT4A 1WCKA 2VG9A 2X8KA 1W6QB 1Y3TA 5FREA 3TNQA 4IETA 1LR5A 2JG9C 5AVAA 2D6PA 1H8VA 1CIWA 4YFZA 3W58A 1RUG1 4XEZA 4I09A 2ZPXA 1YFYA 3VV1A 2R6QA 2HEYF 3VL9A 1CAXA 1V9U1 3ENRA 3DN7A 2GC3A 2XJUA 1S0EA 5KC6A 4NN0A 4PJYA 2WQ4A 2C9AA 3MPBA 2R32A 3OD0A 1DQ1A 2D98A 3NAPA 3U4XA 2C5DA 4QQHA 2WJSA 1EV11 3RDIA 1FI2A 4HZFA 4AF9A 2W68A 1FMD3 3M4FA 2VOXA 4H55A 2GNBA 4QGLA 4YZ2A 1LODA 1Q8OA 1UKGA 3M3CA 1PHMA 2HYKA 2W39A 5CFDA 3AB0A 3SH3A 3H1MA 2DCYA 4XBNA 2WNVB 1NCRC 2DTWA 4XQDA 3VBOB 1BKZA 1MR5A 3FFZA 1HDKA 2IXLA 2C1FA 1SFNA 2ENRA 5E8AA 3MIBA 1A3KA 1K5MB 1UIJA 4OUSA 3ZPYA 2UY9A 5T52A 1RIRA 1ULGA 1UPSA 3JD73 1JW6A 5I8SA 2D7FA 2I74A 4NOTA 3VDDB 2HWE3 4BMEA 2OVUA 2VMIA 4R4XA 3W59A 1CONA 1KXGA 2RM21 5KBFA 1WMEA 1DG6A 2WZR2 2WA4A 1SLTA 3ZFGA 2ZX2A 2WS93 4KL1A 4MX3A 1XXNA 2XLFA 1ZBA1 3A0NA 4COVA 1GZWA 3PJYA 1AL22 4LUKA 1MQTC 1X7NA 4HK9A 4P9IA 5DZFA 4M0HA 2IWGB 1JYIA 1DYKA 3ES1A 1LHUA 1VJ2A 4FPFA 4FP2A 1H8TC 1WD3A 3SISA 4ES9A 3RMYA 4N7UA 1NZCA 5L7OA 4LBQA 1PK6B 5CFCA 1NA1B 4K1ZA 1LOAA 2HWF1 1NY71 4JC1A 1OPMA 4BLJA 5EFUA 1WLCA 3OD4A 4ATEA 4ZKTB 4AI0A 3DUIA 2BUKA 3MLKA 4YVWB 4AE2A 1DQ4A 1ZNPA 5CVRA 1H9PA 2NLRA 3HWJA 3ZN5A 5JOXA 5F6LB 4L2NA 3ZN4A 1LOEA 4CP1A 2Q4SA 5C33A 4CDWB 4AHYA 4WVWA 3KMHA 3NV1A 1RJ7A 4FPLA 3D0SA 4XBQA 5SV5A 3TRSB 2R071 1OA3A 2CV6A 3BU7A 2DU0A 3H1YA 2GC0A 1DYPA 1D2QA 1VBA2 4CDQA 5A33B 2QZ3A 4ZXKA 1CAWA 4WM7A 2VU9A 2D6MA 4ZU7A 1PZ9A 1BK1A 4MGIE 5LRRA 3O7OA 1PGW2 2PHXA 2V09A 1GLHA 4E2QA 3C2UA 5KHHA 4EV0A 1UZYA 2DU1A 3FLPA 4YW2A 3WW4A 3VBUB 4XFBA 2AUYA 3AP5A 2A70A 3T2TA 1EAH1 4Q4Y3 2VMGA 2WNVC 5FO8B 1LHWA 1PO13 1AX0A 2RS51 1PVC3 1SFYA 5T55A 5LK5A 3VZOA 2Z2SB 4QD2A 2IXJA 2XBO3 3OGJA 2CL2A 1LKNA 5FOJB 1BEV3 4EWAA 5C8WA 1XYOA 2WZR3 5GZCA 5T5PA 4XHBA 1IS5A 4X6QB 3CJIB 4F83A 4IERA 2CYFA 1ZZ8A 2RMU2 3RPQA 1Y7BA 3AXDA 2WZPP 4FPKA 2JXAA 2D5HA 1KS5A 3NKGA 2G4IA 5FO7B 1DZQA 2HWC2 5GKAC 1RUD3 1ND2B 4JGYA 3VDDC 1ENRA 4XFIA 1DFQA 4YM3A 1C57A 1VAMA 3GALA 4M01A 4RR3A 3ZYGA 1O5UA 2JE7A 1XNBA 2K0GA 3RZZA 3MIHA 3VBHA 1G7YA 5BV6A 1JUIA 2ZHKA 2CGOA 1HRV1 5IK5A 1RB8G 3L2HA 4LA3A 2IXHA 5EYXA 3B02A 2P3JA 4OULA 1H30A 3D6EA 2BVVA 3OCPA 4Z82A 3T1LA 3AYAA 4JDMA 4RA0A 4QMAA 1VBB3 4AHWA 4MGYE 3P3PA 1QJY1 2A6XA 4D7SA 1WW4A 1PK6C 2H0BA 1NA1C 1R092 3WVJA 4HPKB 4WM8A 4YZ5A 1AR62 1VBA3 5L19A 2R1DA 1LEDA 1LHNA 4WVZA 3CLPA 4META 1RL3A 3TN91 3H3ZA 5I93A 3IIAA 2B8MA 4ISRA 3ZYIB 1S0DA 1LGCA 1KJRA 1R1ZA 4IV3A 3VKMA 1YRZA 1MS8A 5JZGA 3VHPA 4QPIA 4YZ4A 1IGOA 1MS3A 3KLSA 4HKOA 1W6NB 2PFWA 2XHKA 2DYCA 4LBMA 2GU9A 4Y1YA 3O0VA 1JHNA 5DUXA 1BQPA 4LO8A 2CAUA 4XFAA 4A3XA 1REEA 3E5UA 1LESA 4OI1A 3UJOA 1L3JA 3VBUC 1MS5A 1VALA 3WCSA 1URXA 2NQYA 1FPN2 4INDA 3J9SA 2VQ0A 2D5FA 1CVNA 3MW2A 3KB5A 1AYM1 2GC1A 3V0AA 4LUMA 2PAMA 3AKTA 3WDUA 3CJIC 4HBNA 2K2SA 1OPOA 3MW3A 1FV2A 1C4RA 4Q1PA 1U5XA 3W9AA 4YZ1A 1WGPA 4A2UA 2PLV2 3ZXGA 5FQ0B 5BNOC 3L2YA 2DTYA 1QOTA 1ZBE3 3AZZA 2IFWA 3LAGA 4F3JA 5JAXA 5EXOA 3RNSA 5BYNA 1AR63 4AQSA 1Q8SA 3LB9A 4CP2A 4XIKA 3KQRA 2HWE1 3IDEA 4B7KA 3GZUC 2GSYA 2MEV3 4MZUA 4XQWA 5AVPA 1O5LA 1D4M3 2VQAA 1RMU2 1FOD3 3JBG2 4J1WA 4LO4B 1OD5A 5T5JA 4N53B 2ZX1A 4JVAA 4XJ8A 1CD3G 1H1AA 2KM2A 1LJ7A 4CEWC 3AMNA 1VP6A 3WDXA 3AZVA 3K48A 4AEMA 1B35C 2A6VA 4I3GA 3PVBB 5E1RA 1IKQA 4P14A 1SMVA 4WVMA 1FXZA 1I5ZA 1TMF2 5JR7B 4BIFA 1TE1B 1W0OA 5EZWA 5FMOS 2JENA 3NVCA 1RUE2 3ZSMA 2DV9A 4FBFA 1F9KA 5K7PA 3KGLA 3I4IA 4RFT0 3RS6A 2CNAA 4EJRA 2ARBA 1C8NA 2XPJA 3HN1A 3VZLA 3EXUA 1BYHA 5FFOC 3FHIB 3RSJA 2PHTA 1U5IA 1RUJ3 5AC93 1RHI3 5C8CB 3R0RA 1WBFA 1PO23 1Q43A 4AXOA 1QWRA 4GA9A 1H1IA 2QNKA 5IK4A 3ILRA 1UN1A 2F6BA