2D7HA

Crystal structure of the ccc complex of the n-terminal domain of pria
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
102
structure length
102
Chain Sequence
AHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDASELPLNELKAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Primosomal protein N'
publication title Structural basis of the 3'-end recognition of a leading strand in stalled replication forks by PriA.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Hydrolase
total genus 16
structure length 102
sequence length 102
chains with identical sequence B, C, D
ec nomenclature ec 3.6.4.-:
pdb deposition date 2005-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17764 PriA_3primeBD 3â?² DNA-binding domain (3â?²BD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.630 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2d7hA01
2D7GA 2DWNA 2DWLA 2DWMA 2D7HA 4NL4H 2D7EA
chains in the Genus database with same CATH superfamily
4LRTA 3T38A 3ZQJA 3DA1A 3FKEA 4AQYM 4LJAA 1W5TA 3B89A 1WJ7A 3TWKA 2ZM6M 3AOEC 1OTRA 2R4EA 4CJ6A 1OFIA 5KO3A 3A98B 2C96A 1IN8A 1IY2A 2J7NA 4B7GA 5BPVA 3L26A 3KOZE 2UXBM 2WSFF 4KHPM 5EP1A 1VDDA 4IBIA 5IWAM 1JR3E 2LVNC 1GJTA 3UGJA 1QZEA 4L16A 2LHCA 4PT5A 3TWMA 1IXRC 3CF0A 4IIWA 4D82A 5EXPA 4GHLA 3K92A 3A45A 5EP4A 3OTOM 4M0WA 2LH0A 1VQ1A 2O01F 1HQYE 1G71A 3RE8A 2MR9A 4P17A 3W0LB 3UJNA 4NRVA 2QCUA 1GL7A 2EJSA 3JAMS 1IBLM 4B3SM 2C99A 1HNWM 4IBGA 4FW9A 1IN4A 4HL4A 4LJ6A 3GLFB 4NOOB 1L8QA 1N33M 1OKSA 2L6OA 1HQCA 1PJTA 2I7NA 2MROB 2HAKA 1PM5A 2Z4SA 1G8PA 2F5OA 4BBAA 4PD2A 5FTLA 3GQ5A 2UU9M 1ZQ9A 2F5QA 1SG9A 3U6CA 2JZ0A 2QNJA 4NRWA 1YUBA 5FTNA 4IBDA 3SYKA 1NO1A 2DNAA 4ITQA 5A2QS 2VQEM 3PXGA 4F2LA 2QENA 2YQZA 1ZMWA 5DYIA 1TF0B 3D8LA 4LGYA 2APLA 4FWGA 2E5LM 8CATA 2CV1A 4DR5M 2XSZA 2O5RA 1AUAA 1VEJA 1D2NA 3TWLA 1DO0A 5KPRA 2QSFX 4OVZB 2R0IA 1L2CA 3TPZA 4LF9M 1IM2A 4DR3M 3LCVB 4DR1M 1XMOM 4DV3M 2KA6B 3I4YA 1DGBA 3KP0E 1OJLA 3J2PB 4JN6A 5LMUM 3U60B 3TQSA 4GH9A 4NL4H 1Z5CA 7CATA 4ANRA 1YSYA 2CUZA 1G59A 5EP2A 2FS1A 2KRUA 4KLNA 1J7KA 3AOEA 1HT1E 2BWEA 3PNYA 3VKGA 2JNHA 3M7GA 1GVNA 3U6DA 2QP9X 2P5TA 3GLGE 2UUCM 3U6EA 1TH2A 1QUTA 3HHWA 3K9PA 4R3DA 4I8OA 3J7AS 2XEPA 3RGPA 3E4RA 2Z3XA 2DVWB 2XSZD 3T1YM 2DAGA 1F4IA 3GPUA 2JXNA 1MU5A 4IJEA 1NSFA 4G4QA 1OIPA 3HHXA 1G41A 1HR0M 3AJIB 2D7HA 1Q3BA 3RFWA 4LG2A 1NJFA 3SC3A 4NXMM 2L7IA 4Q7JA 2J7OA 1OFHA 2Q2EB 3U5ZA 2CWBA 2UXCM 1MX0A 2C5RA 2JY5A 3SMSA 2R18A 4YY3M 1R6BX 1PJJA 5IT9S 3LVVA 1JQJC 2B3TA 2JY8A 2RRUA 1JB0F 4LF5M 3BXWA 4LGMA 3CGWA 4JI5M 2ZBKB 3IECA 2NQ8C 1E9RA 2X49A 2QPAA 3QYBA 2M5ZA 4LFAM 3FUVA 3DOAA 3L2AA 5E26A 1EIJA 1MJGM 1NNUC 2DAMA 1T6OA 4B7HA 4CGYB 3LQQA 3NBXX 2QBYA 3KVWA 1P3QQ 4RF0A 4B7FA 5ITUA 2VDBB 2KNVA 2DZNB 2CHGA 4I4LA 2N35A 4ZPXA 3GQ3A 5DFLA 2OPFA 4LJ5A 1WGLA 4DV2M 1N78A 2I7PA 4M9XA 2RGOA 4I5SA 4W5WA 4JI6M 5ITXA 3SFZA 3LMMA 1R4GA 1V34A 4FCTA 4UN2B 3KOYE 1PJSA 3K8ZA 4II7A 5BR8M 1IXZA 1NVMA 3QYEA 4DR7M 1N75A 1NJGA 4LY6A 4XK8F 5IZ7D 3VLFB 1QUSA 4AKIA 1E32A 2JUJA 1DV0A 1DGHA 4JI0M 3M0EA 3GPPA 2DWLA 1HNXM 3LQRA 2K9DA 1ZAEA 2HWJA 2L4EA 2VF7A 3NWLA 4AG5A 3VKHA 1GL6A 3B7NA 1UFZA 5FTKA 3M6AA 1OAIA 2GQFA 3FYCA 1QDTA 3VFDA 2H1RA 2R46A 3U61A 2DWZB 4QHSA 2YNMD 2K6BA 2C98A 2K0BX 2RKOA 4HLQA 1A5TA 3SYLA 1H6UA 3TL4X 4LJ7A 4GIPA 2KHHA 3GRRA 4L6V6 4WURA 4LRSA 1QYRA 2JA2A 1N77A 1WR1B 3BBZA 3GLHA 3IG8A 4DV1M 2OOBA 4LJ4A 1TR8A 3DFZA 1Q02A 1G4AE 2Y0TA 4YHHM 3PNVA 2BJWA 4D80A 4GMQA 2DKLA 4X64M 4GRIA 5KPZA 4LF8M 1SXJC 3C9PA 3U5ZB 4M0DA 5KPTA 4NXNM 3GRYA 4PDGA 2A5YB 3QWLA 3HHYA 3VDPA 4JI2M 2DWMA 1R2YA 1XWIA 3KP1E 3KSXA 4JV5M 1FNNA 5KQDA 2M60A 3LCUA 4L15A 3IHPA 3VK7A 2X4AA 4CISA 4DR4M 4GC9A 4JI8M 2KNZA 1D0KA 1R2ZA 3J81S 2BWBA 1VG5A 2JP7A 4OX9M 3W0FA 3E9SA 3HX3A 1EFUB 3AV0A 4LFCM 2V6ZM 4I81A 1IQPA 2QBYB 1NV8A 2Y0QA 3FTCA 1QZMA 2C9OA 3ZC7B 1XNQM 5JI2E 1TGUA 2KXEA 3E21A 1NHGC 2FNAA 3NBIA 1GLNA 4GC5A 1MN3A 4EIWA 2KW0A 4X62M 4JXJA 3GPXA 2HHHM 3SAVA 3KFUG 4DUZM 3EIEA 5EXXA 2DHYA 2CHVA 3HWSA 2GNOA 3KS4A 1DGFA 1G3IA 1ZMUA 2HL7A 3ZCBB 2DAKA 2LVQD 1IN5A 3K9OA 3GLFE 3R9XB 1K3XA 2ZTDA 4IBEA 1BVSA 2ZAOA 3I51A 4MGIE 3W67A 4IBKA 4QOZC 1DGHB 4G4RA 2CP8A 2YFQA 1VEGA 4AKHA 1IXSA 3B7ZA 4WP2A 2V1CA 5E6JA 2DZLA 2L2DA 1NV9A 3U61B 1IFYA 3L29A 4FWDA 3MMPA 4DV7M 3V76A 3D8BA 3KS8A 1TDHA 3IG5A 1XC8A 2JY7A 1C1KA 2OOAA 1TDZA 1QAMA 2XFSA 2KRKA 3KSJA 4G3OA 2D7EA 2L09A 4L4UA 5EXTA 3JR5A 3TE6A 4GKKM 4NSOB 3GLHB 4B08A 2G5GX 1CUKA 1XXHA 1SXJA 4QNMA 3WHKA 2XFTA 3HY5A 3KDSE 1V92A 3L28A 3GLGA 2CRUA 3MHVC 1AIPC 2CEAA 4DV0M 3SBJA 1C7YA 1WXQA 2L7HA 3K2LA 1N34M 3AL0C 5ITXE 3U6PA 2DXIA 3U6SA 2CFOA 4MH0E 2Z8YM 2ERCA 3T1HM 2WSCF 3DZDA 3FE3A 3GRVA 1NY6A 1EE8A 2LNHC 4CHTB 2LVPC 2MGWA 2R6FA 2Y20A 5H37D 4XBOA 1NY5A 3U6OA 4FWHA 1D0LA 2EKFA 3T6PA 5EQTA 3ILKA 3FUXA 3LVWA 5L8RF 3UMMA 5LMNM 1YLAA 2DZOB 3J80S 4OU7A 2OQ4A 2H5XA 5JI3E 2KNAA 3KOXE 4IBCA 2LBCA 4L78A 5ITRA 2KZSA 3AOGA 3HU2A 3SHFA 4P16A 4LZJA 2QZ4A 3GRUA 3Q8XA 4Z8XA 3UZUA 4RNAA 2OO9A 1RU3A 1J09A 1SXJD 3ZH9B 1NNJA 2DENA 3HGIA 4MB7A 3WHLA 2DWNA 1QQWA 3I04M 3FRIA 4MGZE 1T3TA 4JI7M 2W82A 4LJ9A 2K47A 3B74A 1E9SA 4G4OA 3FUTA 3HJQA 4MGYE 2DI0A 1J5EM 1HJPA 2CE7A 3FTEA 4HEOA 1WGNA 3GLIA 1N32M 2F5SA 1IN6A 1Z6TA 2WZJA 3CF6E 4KO8A 5GKNA 5FSWA 1Z5BA 4M9SA 2FE8A 2LTUA 3HJ8A 4RF1A 1IBMM 1TH4A 4FVMA 5ITYA 4DV5M 4JI1M 4S12A 5C1BA 3SATA 2G8LA 3PFIA 2FOIC 4JI4M 2UXDM 1IXSB 4LZZA 2JWSA 3VDUA 4BB9A 1ZMVA 1PRBA 4GITA 4BLCA 3FD9A 5FTJA 3JR4A 5FLXS 4B3TM 1IY0A 1IY1A 4G6ZA 3GO8A 3I01M 2FFJA 4B3MM 3HU1A 2KDLA 2KEBA 1XMQM 2LVAA 1ZV1A 4JI3M 1KFVA 1LV7A 1PJQA 3PVSA 1OAOC 4LCBA 4IBJA 3GP1A 3QAUA 1PGYA 4KT0F 2XLJA 4IBFA 2CV0A 2V1UA 3HHZA 1JR3A 4AW4A 3CF2A 5F3WA 4AKGA 1XXHB 1Q39A 4MM3B 1UM8A 1YE9A 2UUAM 1SXJB 4Y28F 5IREB 1PJIA 4TUWA 4MGKE 2VIIA 3GLGB 2XZFA 1TTEA 3KXEC 1K82A 2Y21A 2AHMA 3EIHA 4PCZA 3A42A 3MJ5A 3SASA 1V33A 2Z4RA 3HZJA 1NHWC 4QHTA 2VF8A 3SMPA 4X65M 2YR0A 3UK6A 1QDRA 3FYDA 1FJGM 1OIZA 2J5YA 3RGSA 4K0KM 1Z59A 2G3QA 3T15A 4CIZA 1X37A 2C9CA 4GEWA 4REZA 1I4WA 1N36M 3R8FA 4FD2A 5KQ8A 3SAUA 2MH8A 2JZ1A 4DBGB 3AKZA 2BNKA 2EKKA 3K1JA 3THGA 4F1IA 4DR2M 2ZANA 2XZUA 4XGIA 3AFHA 2FH0A 2LVOC 2JY6B 4D81A 4L8RC 1WHCA 3A46A 1GJSA 1DO2A 3C58A 2XGNA 4WW0A 3FRHA 1JR3D 4B3RM 3HKPA 4DUYM 4LF6M 5ITQA 1XNRM 2VQFM 4R7GA 4G4NA 2ZTCA 2R45A 1XHBA 1R7RA 3C3EA 2LHGA 3FTDA 1Y8GA 3FUUA 3Q8GA 4RKUF 4LF7M 4NSRA 1LTMA 3B7QA 3KOWE 2O25A 1K3WA 1I94M 1KSFX 1QAOA 2R62A 1IBKM 1DGGA 3L27A 2R65A 2UUBM 4FCVA 1HT2E 1ORYB 1XXHE 3HU3A 3LW5F 4LJ8A 5DNYA 4LF4M 1SXJE 1VEKA 2DHRA 3H4JA 4GKJM 2QQ8A 3GLIB 2F4VM 2DAEA 4Z6YA 1XB2B 4AZFA 1D0MA 4X66M 1L1ZA 1KYIA 1OQYA 1QANA 1R5LA 1WIVA 3BOSA 1L1TA 3SAWA 3L25A 3E46A 3J7BA 1E94E 2EO2A 2XH9A 1GABA 3GLFA 3SHGB 2ZAMA 1Q3CA 1GKIA 2LXEA 2MJ5B 2DAIA 4A3VB 4NC6A 5ITTA 4DV6M 3U6LA 1L2BA 1IN7A 4FCWA 2CV2A 4OW0A 2X8AA 5DYGA 3W68A 4R71A 4JYAM 4IBBA 1L2DA 3C3DA 2D7GA 4AG6A 5EP3A 2EA0A 4DR6M 5FTMA 1QVRA 2QHOB 3U6QA 2HKJA 2L4FA 4AI6A 3F92A 2WSEF 1HNZM 4DV4M 2KZUA 2CHQA 1VDLA 3CTWB 4KODA 3B9PA 1W5SA 3H4MA 2XF3A 4LFBM 3FUWA 5C18A 4QNRA 3GPYA 3MK6A 1T43A 4MGHA 1QAQA 2BJVA 3GQ4A 4OVZA 3VK8A 4M9ZA 4IJFA 3U6MA 4PDIA 5EJCA 3SARA 2RGHA 2F5PA 2R4JA 3GLIE 4QOSA 2LWXA 3HJSA 3FTFA 3U60A 2Z7JA 3I4VA 2HCBA 2R44A 1TH3A 4GHAA 2EUCA 3J27B 3GLHE 5EXSA 2F5NA 1Z5AA 1GO5A 1S3SA 3KW6A
chains in the Genus database with same CATH topology
4LRTA 3T38A 3DA1A 3FKEA 4AQYM 4LJAA 1W5TA 3TWKA 2ZM6M 3AOEC 2R4EA 1OFIA 5KO3A 3A98B 2C96A 1IN8A 1IY2A 2J7NA 4B7GA 5BPVA 3L26A 3KOZE 2UXBM 4KHPM 5EP1A 1VDDA 4IBIA 5IWAM 3UGJA 4L16A 4PT5A 3TWMA 1IXRC 3CF0A 4IIWA 4D82A 5EXPA 4GHLA 3K92A 3A45A 5EP4A 3OTOM 4M0WA 2LH0A 1HQYE 3RE8A 3W0LB 3UJNA 4NRVA 2QCUA 1GL7A 3JAMS 1IBLM 4B3SM 2C99A 1HNWM 4IBGA 4FW9A 1IN4A 4HL4A 4LJ6A 3GLFB 4NOOB 1L8QA 1N33M 2L6OA 1HQCA 2I7NA 1PM5A 2Z4SA 1G8PA 2F5OA 4BBAA 4PD2A 5FTLA 3GQ5A 2UU9M 1ZQ9A 2F5QA 3U6CA 4NRWA 1YUBA 5FTNA 4IBDA 3SYKA 4ITQA 5A2QS 2VQEM 3PXGA 2QENA 2YQZA 5DYIA 3D8LA 4LGYA 4FWGA 2E5LM 8CATA 2CV1A 4DR5M 2XSZA 2O5RA 1D2NA 3TWLA 1DO0A 5KPRA 4OVZB 1L2CA 3TPZA 4LF9M 1IM2A 4DR3M 4DR1M 1XMOM 4DV3M 2KA6B 3I4YA 1DGBA 3KP0E 1OJLA 3J2PB 4JN6A 5LMUM 3U60B 3TQSA 4GH9A 4NL4H 1Z5CA 7CATA 1G59A 1YSYA 2CUZA 5EP2A 2KRUA 4KLNA 1J7KA 3AOEA 1HT1E 3PNYA 3VKGA 3M7GA 1GVNA 3U6DA 2QP9X 2P5TA 2UUCM 3U6EA 1TH2A 3HHWA 4R3DA 3J7AS 4I8OA 2XEPA 3RGPA 3E4RA 2Z3XA 2DVWB 2XSZD 3T1YM 3GPUA 1MU5A 4IJEA 1NSFA 4G4QA 3HHXA 1G41A 1HR0M 3AJIB 2D7HA 1Q3BA 3RFWA 4LG2A 1NJFA 3SC3A 4NXMM 2L7IA 2J7OA 1OFHA 2Q2EB 3U5ZA 2UXCM 1MX0A 2C5RA 4YY3M 3SMSA 2R18A 5IT9S 1R6BX 1PJJA 3LVVA 1JQJC 4LF5M 4LGMA 4JI5M 2ZBKB 2HHHM 2NQ8C 1E9RA 2X49A 2QPAA 4LFAM 2M5ZA 3FUVA 3DOAA 3L2AA 5E26A 1NNUC 4CGYB 4B7HA 3LQQA 2QBYA 3KVWA 4RF0A 4B7FA 5ITUA 2DZNB 2CHGA 4I4LA 4ZPXA 3GQ3A 2OPFA 4LJ5A 4DV2M 1N78A 2I7PA 4M9XA 2RGOA 4I5SA 4W5WA 4JI6M 5ITXA 3SFZA 3LMMA 4FCTA 3KOYE 3K8ZA 4II7A 5BR8M 1IXZA 1NVMA 4DR7M 1N75A 1NJGA 4LY6A 5IZ7D 4AKIA 3VLFB 1E32A 1DGHA 4JI0M 3M0EA 3GPPA 2DWLA 1HNXM 3LQRA 1ZAEA 4AG5A 3VKHA 3NWLA 1GL6A 3VFDA 5FTKA 3M6AA 3FYCA 3U61A 2H1RA 2R46A 2DWZB 4QHSA 2YNMD 2C98A 2RKOA 4HLQA 3SYLA 1H6UA 3TL4X 4LJ7A 4GIPA 3GRRA 4WURA 4LRSA 1QYRA 2JA2A 1N77A 4DV1M 3GLHA 3IG8A 4LJ4A 3DFZA 1G4AE 2Y0TA 4YHHM 3PNVA 2BJWA 4D80A 4GMQA 4X64M 4GRIA 5KPZA 4LF8M 1SXJC 3U5ZB 4M0DA 5KPTA 4NXNM 3GRYA 4PDGA 2A5YB 3QWLA 3HHYA 3VDPA 4JI2M 2DWMA 1R2YA 1XWIA 3KP1E 3KSXA 4JV5M 1FNNA 5KQDA 2M60A 4L15A 3VK7A 2X4AA 4CISA 4DR4M 4GC9A 4JI8M 1R2ZA 3J81S 4OX9M 3W0FA 3E9SA 3AV0A 4LFCM 2V6ZM 4I81A 1IQPA 2QBYB 2Y0QA 3FTCA 1QZMA 2C9OA 3ZC7B 1XNQM 5JI2E 1TGUA 2KXEA 1NHGC 2FNAA 3NBIA 1GLNA 4GC5A 4EIWA 2KW0A 4X62M 4JXJA 3GPXA 3KFUG 3SAVA 4DUZM 3EIEA 5EXXA 2CHVA 3HWSA 3KS4A 1DGFA 1G3IA 2HL7A 3ZCBB 1IN5A 3R9XB 1K3XA 4IBEA 2ZAOA 3I51A 4MGIE 4IBKA 4QOZC 1DGHB 4G4RA 2YFQA 4AKHA 2V1CA 5E6JA 3U61B 3L29A 4FWDA 4DV7M 3D8BA 3KS8A 1TDHA 3IG5A 1XC8A 1C1KA 1TDZA 1QAMA 2XFSA 2KRKA 3KSJA 4L4UA 2D7EA 2L09A 5EXTA 3JR5A 3TE6A 4GKKM 4NSOB 3GLHB 4B08A 2G5GX 1XXHA 1SXJA 4QNMA 3WHKA 2XFTA 3KDSE 3L28A 3GLGA 3MHVC 2CEAA 4DV0M 3SBJA 1WXQA 2L7HA 3K2LA 1N34M 3AL0C 5ITXE 3U6PA 2DXIA 3U6SA 2CFOA 4MH0E 3T1HM 2ERCA 3DZDA 3GRVA 1NY6A 1EE8A 2LNHC 4CHTB 2Y20A 5H37D 3U6OA 4XBOA 1NY5A 4FWHA 3UMMA 5LMNM 5EQTA 3ILKA 3FUXA 3LVWA 2DZOB 3J80S 4OU7A 2OQ4A 5JI3E 3KOXE 4IBCA 4L78A 5ITRA 2KZSA 3AOGA 3HU2A 3SHFA 4P16A 4LZJA 2QZ4A 3GRUA 3Q8XA 4Z8XA 3UZUA 4RNAA 1J09A 1SXJD 3ZH9B 1NNJA 3HGIA 4MB7A 3WHLA 2DWNA 1QQWA 4MGZE 1T3TA 4JI7M 2W82A 4LJ9A 2K47A 4G4OA 1E9SA 3FUTA 3HJQA 4MGYE 1J5EM 2CE7A 3FTEA 3GLIA 1N32M 2F5SA 1IN6A 1Z6TA 3CF6E 4KO8A 5GKNA 5FSWA 1Z5BA 4M9SA 2FE8A 3HJ8A 4RF1A 1IBMM 1TH4A 4FVMA 5ITYA 4DV5M 4JI1M 4S12A 5C1BA 3SATA 2G8LA 3PFIA 2FOIC 4JI4M 2UXDM 1IXSB 4LZZA 3VDUA 4BB9A 4GITA 4BLCA 3FD9A 5FTJA 3JR4A 5FLXS 4B3TM 1IY0A 1IY1A 4G6ZA 3GO8A 2FFJA 4B3MM 3HU1A 2KEBA 1XMQM 1KFVA 4JI3M 1LV7A 3PVSA 4LCBA 3GP1A 4IBJA 3QAUA 2XLJA 4IBFA 2CV0A 2V1UA 3HHZA 1JR3A 4AW4A 3CF2A 5F3WA 4AKGA 1XXHB 1Q39A 4MM3B 1UM8A 1YE9A 2UUAM 1SXJB 5IREB 1PJIA 4TUWA 4MGKE 2VIIA 3GLGB 2XZFA 1K82A 3KXEC 2Y21A 2AHMA 3EIHA 4PCZA 3A42A 3MJ5A 3SASA 4QHTA 2Z4RA 1NHWC 4X65M 3SMPA 2YR0A 3UK6A 3FYDA 1FJGM 3RGSA 4K0KM 1Z59A 3T15A 1X37A 2C9CA 4REZA 1N36M 1I4WA 3R8FA 4FD2A 5KQ8A 3SAUA 3AKZA 2BNKA 3THGA 3K1JA 4DR2M 2XZUA 2ZANA 4XGIA 3AFHA 4L8RC 4D81A 3A46A 1DO2A 3C58A 2XGNA 4WW0A 4B3RM 1JR3D 3HKPA 4DUYM 4LF6M 5ITQA 1XNRM 2VQFM 4R7GA 4G4NA 2R45A 1XHBA 1R7RA 3FTDA 3FUUA 4LF7M 4NSRA 3KOWE 1K3WA 1I94M 1KSFX 1QAOA 2R62A 1IBKM 1DGGA 3L27A 2R65A 2UUBM 4FCVA 1HT2E 1ORYB 3HU3A 4LJ8A 5DNYA 4LF4M 1SXJE 2DHRA 4GKJM 3GLIB 2F4VM 4Z6YA 4AZFA 4X66M 1L1ZA 1KYIA 1QANA 3BOSA 1L1TA 3SAWA 3L25A 3J7BA 1E94E 2EO2A 2XH9A 3GLFA 3SHGB 2ZAMA 1Q3CA 1GKIA 2LXEA 4A3VB 5ITTA 4DV6M 3U6LA 1L2BA 1IN7A 4FCWA 2CV2A 4OW0A 2X8AA 5DYGA 4JYAM 4IBBA 1L2DA 2D7GA 4AG6A 5EP3A 2EA0A 4DR6M 5FTMA 1QVRA 3U6QA 2HKJA 4AI6A 1HNZM 4DV4M 2KZUA 2CHQA 3CTWB 4KODA 3B9PA 1W5SA 3H4MA 2XF3A 4LFBM 3FUWA 5C18A 4QNRA 3GPYA 3MK6A 4MGHA 1QAQA 2BJVA 3GQ4A 4OVZA 3VK8A 4M9ZA 4IJFA 3U6MA 4PDIA 5EJCA 3SARA 2RGHA 2F5PA 2R4JA 4QOSA 2LWXA 3HJSA 3FTFA 3U60A 2Z7JA 3I4VA 2HCBA 1TH3A 4GHAA 2EUCA 3J27B 5EXSA 2F5NA 1Z5AA 1S3SA 3KW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D7G A;  2DWN A;  2DWL A;  2DWM A;  2D7H A;  4NL4 H;  2D7E A; 
#chains in the Genus database with same CATH topology
 4LRT A;  3T38 A;  3ZQJ A;  3DA1 A;  3FKE A;  4AQY M;  4LJA A;  1W5T A;  3B89 A;  1WJ7 A;  3TWK A;  2ZM6 M;  3AOE C;  1OTR A;  2R4E A;  4CJ6 A;  1OFI A;  5KO3 A;  3A98 B;  2C96 A;  1IN8 A;  1IY2 A;  2J7N A;  4B7G A;  5BPV A;  3L26 A;  3KOZ E;  2UXB M;  2WSF F;  4KHP M;  5EP1 A;  1VDD A;  4IBI A;  5IWA M;  1JR3 E;  2LVN C;  1GJT A;  3UGJ A;  1QZE A;  4L16 A;  2LHC A;  4PT5 A;  3TWM A;  1IXR C;  3CF0 A;  4IIW A;  4D82 A;  5EXP A;  4GHL A;  3K92 A;  3A45 A;  5EP4 A;  3OTO M;  4M0W A;  2LH0 A;  1VQ1 A;  2O01 F;  1HQY E;  1G71 A;  3RE8 A;  2MR9 A;  4P17 A;  3W0L B;  3UJN A;  4NRV A;  2QCU A;  1GL7 A;  2EJS A;  3JAM S;  1IBL M;  4B3S M;  2C99 A;  1HNW M;  4IBG A;  4FW9 A;  1IN4 A;  4HL4 A;  4LJ6 A;  3GLF B;  4NOO B;  1L8Q A;  1N33 M;  1OKS A;  2L6O A;  1HQC A;  1PJT A;  2I7N A;  2MRO B;  2HAK A;  1PM5 A;  2Z4S A;  1G8P A;  2F5O A;  4BBA A;  4PD2 A;  5FTL A;  3GQ5 A;  2UU9 M;  1ZQ9 A;  2F5Q A;  1SG9 A;  3U6C A;  2JZ0 A;  2QNJ A;  4NRW A;  1YUB A;  5FTN A;  4IBD A;  3SYK A;  1NO1 A;  2DNA A;  4ITQ A;  5A2Q S;  2VQE M;  3PXG A;  4F2L A;  2QEN A;  2YQZ A;  1ZMW A;  5DYI A;  1TF0 B;  3D8L A;  4LGY A;  2APL A;  4FWG A;  2E5L M;  8CAT A;  2CV1 A;  4DR5 M;  2XSZ A;  2O5R A;  1AUA A;  1VEJ A;  1D2N A;  3TWL A;  1DO0 A;  5KPR A;  2QSF X;  4OVZ B;  2R0I A;  1L2C A;  3TPZ A;  4LF9 M;  1IM2 A;  4DR3 M;  3LCV B;  4DR1 M;  1XMO M;  4DV3 M;  2KA6 B;  3I4Y A;  1DGB A;  3KP0 E;  1OJL A;  3J2P B;  4JN6 A;  5LMU M;  3U60 B;  3TQS A;  4GH9 A;  4NL4 H;  1Z5C A;  7CAT A;  4ANR A;  1YSY A;  2CUZ A;  1G59 A;  5EP2 A;  2FS1 A;  2KRU A;  4KLN A;  1J7K A;  3AOE A;  1HT1 E;  2BWE A;  3PNY A;  3VKG A;  2JNH A;  3M7G A;  1GVN A;  3U6D A;  2QP9 X;  2P5T A;  3GLG E;  2UUC M;  3U6E A;  1TH2 A;  1QUT A;  3HHW A;  3K9P A;  4R3D A;  4I8O A;  3J7A S;  2XEP A;  3RGP A;  3E4R A;  2Z3X A;  2DVW B;  2XSZ D;  3T1Y M;  2DAG A;  1F4I A;  3GPU A;  2JXN A;  1MU5 A;  4IJE A;  1NSF A;  4G4Q A;  1OIP A;  3HHX A;  1G41 A;  1HR0 M;  3AJI B;  2D7H A;  1Q3B A;  3RFW A;  4LG2 A;  1NJF A;  3SC3 A;  4NXM M;  2L7I A;  4Q7J A;  2J7O A;  1OFH A;  2Q2E B;  3U5Z A;  2CWB A;  2UXC M;  1MX0 A;  2C5R A;  2JY5 A;  3SMS A;  2R18 A;  4YY3 M;  1R6B X;  1PJJ A;  5IT9 S;  3LVV A;  1JQJ C;  2B3T A;  2JY8 A;  2RRU A;  1JB0 F;  4LF5 M;  3BXW A;  4LGM A;  3CGW A;  4JI5 M;  2ZBK B;  3IEC A;  2NQ8 C;  1E9R A;  2X49 A;  2QPA A;  3QYB A;  2M5Z A;  4LFA M;  3FUV A;  3DOA A;  3L2A A;  5E26 A;  1EIJ A;  1MJG M;  1NNU C;  2DAM A;  1T6O A;  4B7H A;  4CGY B;  3LQQ A;  3NBX X;  2QBY A;  3KVW A;  1P3Q Q;  4RF0 A;  4B7F A;  5ITU A;  2VDB B;  2KNV A;  2DZN B;  2CHG A;  4I4L A;  2N35 A;  4ZPX A;  3GQ3 A;  5DFL A;  2OPF A;  4LJ5 A;  1WGL A;  4DV2 M;  1N78 A;  2I7P A;  4M9X A;  2RGO A;  4I5S A;  4W5W A;  4JI6 M;  5ITX A;  3SFZ A;  3LMM A;  1R4G A;  1V34 A;  4FCT A;  4UN2 B;  3KOY E;  1PJS A;  3K8Z A;  4II7 A;  5BR8 M;  1IXZ A;  1NVM A;  3QYE A;  4DR7 M;  1N75 A;  1NJG A;  4LY6 A;  4XK8 F;  5IZ7 D;  3VLF B;  1QUS A;  4AKI A;  1E32 A;  2JUJ A;  1DV0 A;  1DGH A;  4JI0 M;  3M0E A;  3GPP A;  2DWL A;  1HNX M;  3LQR A;  2K9D A;  1ZAE A;  2HWJ A;  2L4E A;  2VF7 A;  3NWL A;  4AG5 A;  3VKH A;  1GL6 A;  3B7N A;  1UFZ A;  5FTK A;  3M6A A;  1OAI A;  2GQF A;  3FYC A;  1QDT A;  3VFD A;  2H1R A;  2R46 A;  3U61 A;  2DWZ B;  4QHS A;  2YNM D;  2K6B A;  2C98 A;  2K0B X;  2RKO A;  4HLQ A;  1A5T A;  3SYL A;  1H6U A;  3TL4 X;  4LJ7 A;  4GIP A;  2KHH A;  3GRR A;  4L6V 6;  4WUR A;  4LRS A;  1QYR A;  2JA2 A;  1N77 A;  1WR1 B;  3BBZ A;  3GLH A;  3IG8 A;  4DV1 M;  2OOB A;  4LJ4 A;  1TR8 A;  3DFZ A;  1Q02 A;  1G4A E;  2Y0T A;  4YHH M;  3PNV A;  2BJW A;  4D80 A;  4GMQ A;  2DKL A;  4X64 M;  4GRI A;  5KPZ A;  4LF8 M;  1SXJ C;  3C9P A;  3U5Z B;  4M0D A;  5KPT A;  4NXN M;  3GRY A;  4PDG A;  2A5Y B;  3QWL A;  3HHY A;  3VDP A;  4JI2 M;  2DWM A;  1R2Y A;  1XWI A;  3KP1 E;  3KSX A;  4JV5 M;  1FNN A;  5KQD A;  2M60 A;  3LCU A;  4L15 A;  3IHP A;  3VK7 A;  2X4A A;  4CIS A;  4DR4 M;  4GC9 A;  4JI8 M;  2KNZ A;  1D0K A;  1R2Z A;  3J81 S;  2BWB A;  1VG5 A;  2JP7 A;  4OX9 M;  3W0F A;  3E9S A;  3HX3 A;  1EFU B;  3AV0 A;  4LFC M;  2V6Z M;  4I81 A;  1IQP A;  2QBY B;  1NV8 A;  2Y0Q A;  3FTC A;  1QZM A;  2C9O A;  3ZC7 B;  1XNQ M;  5JI2 E;  1TGU A;  2KXE A;  3E21 A;  1NHG C;  2FNA A;  3NBI A;  1GLN A;  4GC5 A;  1MN3 A;  4EIW A;  2KW0 A;  4X62 M;  4JXJ A;  3GPX A;  2HHH M;  3SAV A;  3KFU G;  4DUZ M;  3EIE A;  5EXX A;  2DHY A;  2CHV A;  3HWS A;  2GNO A;  3KS4 A;  1DGF A;  1G3I A;  1ZMU A;  2HL7 A;  3ZCB B;  2DAK A;  2LVQ D;  1IN5 A;  3K9O A;  3GLF E;  3R9X B;  1K3X A;  2ZTD A;  4IBE A;  1BVS A;  2ZAO A;  3I51 A;  4MGI E;  3W67 A;  4IBK A;  4QOZ C;  1DGH B;  4G4R A;  2CP8 A;  2YFQ A;  1VEG A;  4AKH A;  1IXS A;  3B7Z A;  4WP2 A;  2V1C A;  5E6J A;  2DZL A;  2L2D A;  1NV9 A;  3U61 B;  1IFY A;  3L29 A;  4FWD A;  3MMP A;  4DV7 M;  3V76 A;  3D8B A;  3KS8 A;  1TDH A;  3IG5 A;  1XC8 A;  2JY7 A;  1C1K A;  2OOA A;  1TDZ A;  1QAM A;  2XFS A;  2KRK A;  3KSJ A;  4G3O A;  2D7E A;  2L09 A;  4L4U A;  5EXT A;  3JR5 A;  3TE6 A;  4GKK M;  4NSO B;  3GLH B;  4B08 A;  2G5G X;  1CUK A;  1XXH A;  1SXJ A;  4QNM A;  3WHK A;  2XFT A;  3HY5 A;  3KDS E;  1V92 A;  3L28 A;  3GLG A;  2CRU A;  3MHV C;  1AIP C;  2CEA A;  4DV0 M;  3SBJ A;  1C7Y A;  1WXQ A;  2L7H A;  3K2L A;  1N34 M;  3AL0 C;  5ITX E;  3U6P A;  2DXI A;  3U6S A;  2CFO A;  4MH0 E;  2Z8Y M;  2ERC A;  3T1H M;  2WSC F;  3DZD A;  3FE3 A;  3GRV A;  1NY6 A;  1EE8 A;  2LNH C;  4CHT B;  2LVP C;  2MGW A;  2R6F A;  2Y20 A;  5H37 D;  4XBO A;  1NY5 A;  3U6O A;  4FWH A;  1D0L A;  2EKF A;  3T6P A;  5EQT A;  3ILK A;  3FUX A;  3LVW A;  5L8R F;  3UMM A;  5LMN M;  1YLA A;  2DZO B;  3J80 S;  4OU7 A;  2OQ4 A;  2H5X A;  5JI3 E;  2KNA A;  3KOX E;  4IBC A;  2LBC A;  4L78 A;  5ITR A;  2KZS A;  3AOG A;  3HU2 A;  3SHF A;  4P16 A;  4LZJ A;  2QZ4 A;  3GRU A;  3Q8X A;  4Z8X A;  3UZU A;  4RNA A;  2OO9 A;  1RU3 A;  1J09 A;  1SXJ D;  3ZH9 B;  1NNJ A;  2DEN A;  3HGI A;  4MB7 A;  3WHL A;  2DWN A;  1QQW A;  3I04 M;  3FRI A;  4MGZ E;  1T3T A;  4JI7 M;  2W82 A;  4LJ9 A;  2K47 A;  3B74 A;  1E9S A;  4G4O A;  3FUT A;  3HJQ A;  4MGY E;  2DI0 A;  1J5E M;  1HJP A;  2CE7 A;  3FTE A;  4HEO A;  1WGN A;  3GLI A;  1N32 M;  2F5S A;  1IN6 A;  1Z6T A;  2WZJ A;  3CF6 E;  4KO8 A;  5GKN A;  5FSW A;  1Z5B A;  4M9S A;  2FE8 A;  2LTU A;  3HJ8 A;  4RF1 A;  1IBM M;  1TH4 A;  4FVM A;  5ITY A;  4DV5 M;  4JI1 M;  4S12 A;  5C1B A;  3SAT A;  2G8L A;  3PFI A;  2FOI C;  4JI4 M;  2UXD M;  1IXS B;  4LZZ A;  2JWS A;  3VDU A;  4BB9 A;  1ZMV A;  1PRB A;  4GIT A;  4BLC A;  3FD9 A;  5FTJ A;  3JR4 A;  5FLX S;  4B3T M;  1IY0 A;  1IY1 A;  4G6Z A;  3GO8 A;  3I01 M;  2FFJ A;  4B3M M;  3HU1 A;  2KDL A;  2KEB A;  1XMQ M;  2LVA A;  1ZV1 A;  4JI3 M;  1KFV A;  1LV7 A;  1PJQ A;  3PVS A;  1OAO C;  4LCB A;  4IBJ A;  3GP1 A;  3QAU A;  1PGY A;  4KT0 F;  2XLJ A;  4IBF A;  2CV0 A;  2V1U A;  3HHZ A;  1JR3 A;  4AW4 A;  3CF2 A;  5F3W A;  4AKG A;  1XXH B;  1Q39 A;  4MM3 B;  1UM8 A;  1YE9 A;  2UUA M;  1SXJ B;  4Y28 F;  5IRE B;  1PJI A;  4TUW A;  4MGK E;  2VII A;  3GLG B;  2XZF A;  1TTE A;  3KXE C;  1K82 A;  2Y21 A;  2AHM A;  3EIH A;  4PCZ A;  3A42 A;  3MJ5 A;  3SAS A;  1V33 A;  2Z4R A;  3HZJ A;  1NHW C;  4QHT A;  2VF8 A;  3SMP A;  4X65 M;  2YR0 A;  3UK6 A;  1QDR A;  3FYD A;  1FJG M;  1OIZ A;  2J5Y A;  3RGS A;  4K0K M;  1Z59 A;  2G3Q A;  3T15 A;  4CIZ A;  1X37 A;  2C9C A;  4GEW A;  4REZ A;  1I4W A;  1N36 M;  3R8F A;  4FD2 A;  5KQ8 A;  3SAU A;  2MH8 A;  2JZ1 A;  4DBG B;  3AKZ A;  2BNK A;  2EKK A;  3K1J A;  3THG A;  4F1I A;  4DR2 M;  2ZAN A;  2XZU A;  4XGI A;  3AFH A;  2FH0 A;  2LVO C;  2JY6 B;  4D81 A;  4L8R C;  1WHC A;  3A46 A;  1GJS A;  1DO2 A;  3C58 A;  2XGN A;  4WW0 A;  3FRH A;  1JR3 D;  4B3R M;  3HKP A;  4DUY M;  4LF6 M;  5ITQ A;  1XNR M;  2VQF M;  4R7G A;  4G4N A;  2ZTC A;  2R45 A;  1XHB A;  1R7R A;  3C3E A;  2LHG A;  3FTD A;  1Y8G A;  3FUU A;  3Q8G A;  4RKU F;  4LF7 M;  4NSR A;  1LTM A;  3B7Q A;  3KOW E;  2O25 A;  1K3W A;  1I94 M;  1KSF X;  1QAO A;  2R62 A;  1IBK M;  1DGG A;  3L27 A;  2R65 A;  2UUB M;  4FCV A;  1HT2 E;  1ORY B;  1XXH E;  3HU3 A;  3LW5 F;  4LJ8 A;  5DNY A;  4LF4 M;  1SXJ E;  1VEK A;  2DHR A;  3H4J A;  4GKJ M;  2QQ8 A;  3GLI B;  2F4V M;  2DAE A;  4Z6Y A;  1XB2 B;  4AZF A;  1D0M A;  4X66 M;  1L1Z A;  1KYI A;  1OQY A;  1QAN A;  1R5L A;  1WIV A;  3BOS A;  1L1T A;  3SAW A;  3L25 A;  3E46 A;  3J7B A;  1E94 E;  2EO2 A;  2XH9 A;  1GAB A;  3GLF A;  3SHG B;  2ZAM A;  1Q3C A;  1GKI A;  2LXE A;  2MJ5 B;  2DAI A;  4A3V B;  4NC6 A;  5ITT A;  4DV6 M;  3U6L A;  1L2B A;  1IN7 A;  4FCW A;  2CV2 A;  4OW0 A;  2X8A A;  5DYG A;  3W68 A;  4R71 A;  4JYA M;  4IBB A;  1L2D A;  3C3D A;  2D7G A;  4AG6 A;  5EP3 A;  2EA0 A;  4DR6 M;  5FTM A;  1QVR A;  2QHO B;  3U6Q A;  2HKJ A;  2L4F A;  4AI6 A;  3F92 A;  2WSE F;  1HNZ M;  4DV4 M;  2KZU A;  2CHQ A;  1VDL A;  3CTW B;  4KOD A;  3B9P A;  1W5S A;  3H4M A;  2XF3 A;  4LFB M;  3FUW A;  5C18 A;  4QNR A;  3GPY A;  3MK6 A;  1T43 A;  4MGH A;  1QAQ A;  2BJV A;  3GQ4 A;  4OVZ A;  3VK8 A;  4M9Z A;  4IJF A;  3U6M A;  4PDI A;  5EJC A;  3SAR A;  2RGH A;  2F5P A;  2R4J A;  3GLI E;  4QOS A;  2LWX A;  3HJS A;  3FTF A;  3U60 A;  2Z7J A;  3I4V A;  2HCB A;  2R44 A;  1TH3 A;  4GHA A;  2EUC A;  3J27 B;  3GLH E;  5EXS A;  2F5N A;  1Z5A A;  1GO5 A;  1S3S A;  3KW6 A; 
#chains in the Genus database with same CATH homology
 4LRT A;  3T38 A;  3DA1 A;  3FKE A;  4AQY M;  4LJA A;  1W5T A;  3TWK A;  2ZM6 M;  3AOE C;  2R4E A;  1OFI A;  5KO3 A;  3A98 B;  2C96 A;  1IN8 A;  1IY2 A;  2J7N A;  4B7G A;  5BPV A;  3L26 A;  3KOZ E;  2UXB M;  4KHP M;  5EP1 A;  1VDD A;  4IBI A;  5IWA M;  3UGJ A;  4L16 A;  4PT5 A;  3TWM A;  1IXR C;  3CF0 A;  4IIW A;  4D82 A;  5EXP A;  4GHL A;  3K92 A;  3A45 A;  5EP4 A;  3OTO M;  4M0W A;  2LH0 A;  1HQY E;  3RE8 A;  3W0L B;  3UJN A;  4NRV A;  2QCU A;  1GL7 A;  3JAM S;  1IBL M;  4B3S M;  2C99 A;  1HNW M;  4IBG A;  4FW9 A;  1IN4 A;  4HL4 A;  4LJ6 A;  3GLF B;  4NOO B;  1L8Q A;  1N33 M;  2L6O A;  1HQC A;  2I7N A;  1PM5 A;  2Z4S A;  1G8P A;  2F5O A;  4BBA A;  4PD2 A;  5FTL A;  3GQ5 A;  2UU9 M;  1ZQ9 A;  2F5Q A;  3U6C A;  4NRW A;  1YUB A;  5FTN A;  4IBD A;  3SYK A;  4ITQ A;  5A2Q S;  2VQE M;  3PXG A;  2QEN A;  2YQZ A;  5DYI A;  3D8L A;  4LGY A;  4FWG A;  2E5L M;  8CAT A;  2CV1 A;  4DR5 M;  2XSZ A;  2O5R A;  1D2N A;  3TWL A;  1DO0 A;  5KPR A;  4OVZ B;  1L2C A;  3TPZ A;  4LF9 M;  1IM2 A;  4DR3 M;  4DR1 M;  1XMO M;  4DV3 M;  2KA6 B;  3I4Y A;  1DGB A;  3KP0 E;  1OJL A;  3J2P B;  4JN6 A;  5LMU M;  3U60 B;  3TQS A;  4GH9 A;  4NL4 H;  1Z5C A;  7CAT A;  1G59 A;  1YSY A;  2CUZ A;  5EP2 A;  2KRU A;  4KLN A;  1J7K A;  3AOE A;  1HT1 E;  3PNY A;  3VKG A;  3M7G A;  1GVN A;  3U6D A;  2QP9 X;  2P5T A;  2UUC M;  3U6E A;  1TH2 A;  3HHW A;  4R3D A;  3J7A S;  4I8O A;  2XEP A;  3RGP A;  3E4R A;  2Z3X A;  2DVW B;  2XSZ D;  3T1Y M;  3GPU A;  1MU5 A;  4IJE A;  1NSF A;  4G4Q A;  3HHX A;  1G41 A;  1HR0 M;  3AJI B;  2D7H A;  1Q3B A;  3RFW A;  4LG2 A;  1NJF A;  3SC3 A;  4NXM M;  2L7I A;  2J7O A;  1OFH A;  2Q2E B;  3U5Z A;  2UXC M;  1MX0 A;  2C5R A;  4YY3 M;  3SMS A;  2R18 A;  5IT9 S;  1R6B X;  1PJJ A;  3LVV A;  1JQJ C;  4LF5 M;  4LGM A;  4JI5 M;  2ZBK B;  2HHH M;  2NQ8 C;  1E9R A;  2X49 A;  2QPA A;  4LFA M;  2M5Z A;  3FUV A;  3DOA A;  3L2A A;  5E26 A;  1NNU C;  4CGY B;  4B7H A;  3LQQ A;  2QBY A;  3KVW A;  4RF0 A;  4B7F A;  5ITU A;  2DZN B;  2CHG A;  4I4L A;  4ZPX A;  3GQ3 A;  2OPF A;  4LJ5 A;  4DV2 M;  1N78 A;  2I7P A;  4M9X A;  2RGO A;  4I5S A;  4W5W A;  4JI6 M;  5ITX A;  3SFZ A;  3LMM A;  4FCT A;  3KOY E;  3K8Z A;  4II7 A;  5BR8 M;  1IXZ A;  1NVM A;  4DR7 M;  1N75 A;  1NJG A;  4LY6 A;  5IZ7 D;  4AKI A;  3VLF B;  1E32 A;  1DGH A;  4JI0 M;  3M0E A;  3GPP A;  2DWL A;  1HNX M;  3LQR A;  1ZAE A;  4AG5 A;  3VKH A;  3NWL A;  1GL6 A;  3VFD A;  5FTK A;  3M6A A;  3FYC A;  3U61 A;  2H1R A;  2R46 A;  2DWZ B;  4QHS A;  2YNM D;  2C98 A;  2RKO A;  4HLQ A;  3SYL A;  1H6U A;  3TL4 X;  4LJ7 A;  4GIP A;  3GRR A;  4WUR A;  4LRS A;  1QYR A;  2JA2 A;  1N77 A;  4DV1 M;  3GLH A;  3IG8 A;  4LJ4 A;  3DFZ A;  1G4A E;  2Y0T A;  4YHH M;  3PNV A;  2BJW A;  4D80 A;  4GMQ A;  4X64 M;  4GRI A;  5KPZ A;  4LF8 M;  1SXJ C;  3U5Z B;  4M0D A;  5KPT A;  4NXN M;  3GRY A;  4PDG A;  2A5Y B;  3QWL A;  3HHY A;  3VDP A;  4JI2 M;  2DWM A;  1R2Y A;  1XWI A;  3KP1 E;  3KSX A;  4JV5 M;  1FNN A;  5KQD A;  2M60 A;  4L15 A;  3VK7 A;  2X4A A;  4CIS A;  4DR4 M;  4GC9 A;  4JI8 M;  1R2Z A;  3J81 S;  4OX9 M;  3W0F A;  3E9S A;  3AV0 A;  4LFC M;  2V6Z M;  4I81 A;  1IQP A;  2QBY B;  2Y0Q A;  3FTC A;  1QZM A;  2C9O A;  3ZC7 B;  1XNQ M;  5JI2 E;  1TGU A;  2KXE A;  1NHG C;  2FNA A;  3NBI A;  1GLN A;  4GC5 A;  4EIW A;  2KW0 A;  4X62 M;  4JXJ A;  3GPX A;  3KFU G;  3SAV A;  4DUZ M;  3EIE A;  5EXX A;  2CHV A;  3HWS A;  3KS4 A;  1DGF A;  1G3I A;  2HL7 A;  3ZCB B;  1IN5 A;  3R9X B;  1K3X A;  4IBE A;  2ZAO A;  3I51 A;  4MGI E;  4IBK A;  4QOZ C;  1DGH B;  4G4R A;  2YFQ A;  4AKH A;  2V1C A;  5E6J A;  3U61 B;  3L29 A;  4FWD A;  4DV7 M;  3D8B A;  3KS8 A;  1TDH A;  3IG5 A;  1XC8 A;  1C1K A;  1TDZ A;  1QAM A;  2XFS A;  2KRK A;  3KSJ A;  4L4U A;  2D7E A;  2L09 A;  5EXT A;  3JR5 A;  3TE6 A;  4GKK M;  4NSO B;  3GLH B;  4B08 A;  2G5G X;  1XXH A;  1SXJ A;  4QNM A;  3WHK A;  2XFT A;  3KDS E;  3L28 A;  3GLG A;  3MHV C;  2CEA A;  4DV0 M;  3SBJ A;  1WXQ A;  2L7H A;  3K2L A;  1N34 M;  3AL0 C;  5ITX E;  3U6P A;  2DXI A;  3U6S A;  2CFO A;  4MH0 E;  3T1H M;  2ERC A;  3DZD A;  3GRV A;  1NY6 A;  1EE8 A;  2LNH C;  4CHT B;  2Y20 A;  5H37 D;  3U6O A;  4XBO A;  1NY5 A;  4FWH A;  3UMM A;  5LMN M;  5EQT A;  3ILK A;  3FUX A;  3LVW A;  2DZO B;  3J80 S;  4OU7 A;  2OQ4 A;  5JI3 E;  3KOX E;  4IBC A;  4L78 A;  5ITR A;  2KZS A;  3AOG A;  3HU2 A;  3SHF A;  4P16 A;  4LZJ A;  2QZ4 A;  3GRU A;  3Q8X A;  4Z8X A;  3UZU A;  4RNA A;  1J09 A;  1SXJ D;  3ZH9 B;  1NNJ A;  3HGI A;  4MB7 A;  3WHL A;  2DWN A;  1QQW A;  4MGZ E;  1T3T A;  4JI7 M;  2W82 A;  4LJ9 A;  2K47 A;  4G4O A;  1E9S A;  3FUT A;  3HJQ A;  4MGY E;  1J5E M;  2CE7 A;  3FTE A;  3GLI A;  1N32 M;  2F5S A;  1IN6 A;  1Z6T A;  3CF6 E;  4KO8 A;  5GKN A;  5FSW A;  1Z5B A;  4M9S A;  2FE8 A;  3HJ8 A;  4RF1 A;  1IBM M;  1TH4 A;  4FVM A;  5ITY A;  4DV5 M;  4JI1 M;  4S12 A;  5C1B A;  3SAT A;  2G8L A;  3PFI A;  2FOI C;  4JI4 M;  2UXD M;  1IXS B;  4LZZ A;  3VDU A;  4BB9 A;  4GIT A;  4BLC A;  3FD9 A;  5FTJ A;  3JR4 A;  5FLX S;  4B3T M;  1IY0 A;  1IY1 A;  4G6Z A;  3GO8 A;  2FFJ A;  4B3M M;  3HU1 A;  2KEB A;  1XMQ M;  1KFV A;  4JI3 M;  1LV7 A;  3PVS A;  4LCB A;  3GP1 A;  4IBJ A;  3QAU A;  2XLJ A;  4IBF A;  2CV0 A;  2V1U A;  3HHZ A;  1JR3 A;  4AW4 A;  3CF2 A;  5F3W A;  4AKG A;  1XXH B;  1Q39 A;  4MM3 B;  1UM8 A;  1YE9 A;  2UUA M;  1SXJ B;  5IRE B;  1PJI A;  4TUW A;  4MGK E;  2VII A;  3GLG B;  2XZF A;  1K82 A;  3KXE C;  2Y21 A;  2AHM A;  3EIH A;  4PCZ A;  3A42 A;  3MJ5 A;  3SAS A;  4QHT A;  2Z4R A;  1NHW C;  4X65 M;  3SMP A;  2YR0 A;  3UK6 A;  3FYD A;  1FJG M;  3RGS A;  4K0K M;  1Z59 A;  3T15 A;  1X37 A;  2C9C A;  4REZ A;  1N36 M;  1I4W A;  3R8F A;  4FD2 A;  5KQ8 A;  3SAU A;  3AKZ A;  2BNK A;  3THG A;  3K1J A;  4DR2 M;  2XZU A;  2ZAN A;  4XGI A;  3AFH A;  4L8R C;  4D81 A;  3A46 A;  1DO2 A;  3C58 A;  2XGN A;  4WW0 A;  4B3R M;  1JR3 D;  3HKP A;  4DUY M;  4LF6 M;  5ITQ A;  1XNR M;  2VQF M;  4R7G A;  4G4N A;  2R45 A;  1XHB A;  1R7R A;  3FTD A;  3FUU A;  4LF7 M;  4NSR A;  3KOW E;  1K3W A;  1I94 M;  1KSF X;  1QAO A;  2R62 A;  1IBK M;  1DGG A;  3L27 A;  2R65 A;  2UUB M;  4FCV A;  1HT2 E;  1ORY B;  3HU3 A;  4LJ8 A;  5DNY A;  4LF4 M;  1SXJ E;  2DHR A;  4GKJ M;  3GLI B;  2F4V M;  4Z6Y A;  4AZF A;  4X66 M;  1L1Z A;  1KYI A;  1QAN A;  3BOS A;  1L1T A;  3SAW A;  3L25 A;  3J7B A;  1E94 E;  2EO2 A;  2XH9 A;  3GLF A;  3SHG B;  2ZAM A;  1Q3C A;  1GKI A;  2LXE A;  4A3V B;  5ITT A;  4DV6 M;  3U6L A;  1L2B A;  1IN7 A;  4FCW A;  2CV2 A;  4OW0 A;  2X8A A;  5DYG A;  4JYA M;  4IBB A;  1L2D A;  2D7G A;  4AG6 A;  5EP3 A;  2EA0 A;  4DR6 M;  5FTM A;  1QVR A;  3U6Q A;  2HKJ A;  4AI6 A;  1HNZ M;  4DV4 M;  2KZU A;  2CHQ A;  3CTW B;  4KOD A;  3B9P A;  1W5S A;  3H4M A;  2XF3 A;  4LFB M;  3FUW A;  5C18 A;  4QNR A;  3GPY A;  3MK6 A;  4MGH A;  1QAQ A;  2BJV A;  3GQ4 A;  4OVZ A;  3VK8 A;  4M9Z A;  4IJF A;  3U6M A;  4PDI A;  5EJC A;  3SAR A;  2RGH A;  2F5P A;  2R4J A;  4QOS A;  2LWX A;  3HJS A;  3FTF A;  3U60 A;  2Z7J A;  3I4V A;  2HCB A;  1TH3 A;  4GHA A;  2EUC A;  3J27 B;  5EXS A;  2F5N A;  1Z5A A;  1S3S A;  3KW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...