2D7HA

Crystal structure of the ccc complex of the n-terminal domain of pria
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
102
structure length
102
Chain Sequence
b'AHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDASELPLNELKAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Primosomal protein N'
publication title Structural basis of the 3'-end recognition of a leading strand in stalled replication forks by PriA.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Hydrolase
total genus 16
structure length 102
sequence length 102
chains with identical sequence B, C, D
ec nomenclature ec 3.6.4.-:
pdb deposition date 2005-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17764 PriA_3primeBD 3â?² DNA-binding domain (3â?²BD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.630 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2d7hA01
2D7EA 2D7GA 2DWNA 2D7HA 4NL4H 2DWMA 2DWLA
chains in the Genus database with same CATH superfamily
2CFOA 3MHVC 4L4UA 1NV9A 3I4VA 3B89A 1DGBA 2C96A 1WGLA 1AUAA 4PDIA 3GO8A 1PJQA 1SXJE 4AQYM 1D0KA 1TH3A 2MJ5B 3KSXA 4LJ8A 2DWMA 1Q39A 2K9DA 3PVSA 4B3SM 4NC6A 4OX9M 4TUWA 3QYEA 4NRVA 3UK6A 3TQSA 1Q3CA 3E4RA 3KOYE 2L7IA 4AW4A 4FWGA 1IXSA 4WW0A 4OVZA 1Y8GA 3VKGA 3ILKA 3B74A 1NV8A 2XLJA 3UGJA 1DGHA 1W5SA 2J7OA 1E94E 4IJFA 1WHCA 1SXJC 2DZOB 3GPPA 2O01F 3NWLA 5FTKA 2XSZA 4CHTB 3GLFA 1T6OA 4GKKM 1R2YA 1IM2A 1G8PA 1N78A 1JQJC 1IQPA 1QZMA 2LTUA 1N34M 4LJ6A 3W68A 2WSCF 4FCTA 4IBCA 2F5SA 1D2NA 3GPYA 4UN2B 5ITTA 2KXEA 2MROB 1MX0A 2JY8A 2ZAOA 1XNQM 4XK8F 3C3EA 3QWLA 2KW0A 3LVVA 4NL4H 1HNXM 2R65A 1MU5A 3A98B 3B7ZA 3B9PA 1OJLA 4MGYE 4LRSA 2QBYB 3TWMA 2F5PA 3A42A 1T43A 4FWHA 1L1ZA 3ZC7B 2G8LA 3W67A 1VDLA 5JI3E 2JY7A 4DR7M 3B7NA 1TDZA 2QSFX 2DWZB 5EXTA 1HQCA 1Z5CA 2CWBA 4M0WA 3U60A 3IG5A 2DAEA 4L16A 3JR4A 1QAOA 2XF3A 1L2CA 3HHYA 2CHGA 4M9XA 3DA1A 2C99A 5KPRA 3VK8A 2VQEM 1OAOC 2JY6B 1IXZA 4K0KM 1GVNA 2EO2A 3L27A 1HT1E 4DR1M 5EXXA 2E5LM 3FUXA 4B3MM 1I4WA 2Y20A 5DYGA 2DI0A 1LV7A 3L29A 5EP3A 2DAGA 2D7GA 4Q7JA 1IN5A 3CTWB 1XXHB 2BJWA 3KP0E 3FTCA 1VG5A 2BNKA 3T38A 4LZZA 4DV6M 5LMUM 2K47A 4Z8XA 3H4MA 3RE8A 3LQRA 1OQYA 2FNAA 4RF1A 2EA0A 2Z4SA 2K0BX 2L2DA 3LMMA 1Z6TA 4DR5M 1VEKA 3FKEA 4KODA 5IT9S 1ZV1A 1A5TA 2P5TA 1V34A 3SYLA 1IN8A 3T6PA 4BLCA 3J7AS 2L6OA 3U5ZA 4LJ9A 2DWNA 1NNUC 3E46A 1WJ7A 2HHHM 2CRUA 1GABA 4S12A 3L26A 2R46A 3SAVA 2Y0QA 4JI0M 4B08A 3FUTA 4KT0F 4G3OA 2HKJA 3E9SA 2ERCA 3I51A 5ITXE 4M0DA 2Y21A 2OQ4A 3MJ5A 1N33M 4DV3M 1HR0M 1G3IA 4G4RA 2LVQD 1G59A 7CATA 2CV0A 3L25A 4BBAA 3ZCBB 4Z6YA 1K3XA 3GLHA 2MR9A 3H4JA 1EIJA 4REZA 3GPUA 4AI6A 3KS4A 1TDHA 2NQ8C 3RFWA 4LF4M 1GLNA 5IREB 1EE8A 3K92A 2XH9A 1YLAA 3FUVA 3AOGA 3LVWA 5EP1A 2WZJA 4MGKE 4AG6A 3AOEA 3D8LA 4JN6A 1N75A 2CHQA 2KA6B 3TPZA 4DBGB 2QP9X 4FWDA 4YY3M 2UXBM 3V76A 3WHLA 4GITA 1NSFA 2CEAA 2DKLA 1D0MA 1HT2E 3HGIA 3SBJA 1ORYB 1NNJA 3U61A 3FRIA 3Q8GA 4MGIE 2G3QA 2RGHA 3GPXA 3A46A 4JYAM 4GMQA 3E21A 3U6EA 2FE8A 2V6ZM 4GIPA 4B7GA 3KSJA 2BJVA 4LF8M 1QVRA 5C1BA 2DHYA 4LJ4A 2I7PA 3HU2A 1L8QA 1HQYE 2KDLA 4P16A 3AV0A 5ITUA 2CV2A 4DV1M 1IBKM 1OAIA 4LG2A 5BPVA 1UFZA 1WIVA 2QENA 1WR1B 2R4EA 4QHTA 3GQ5A 1QUTA 2JP7A 2VQFM 2DZLA 1TH4A 1OKSA 5EP2A 5DYIA 4A3VB 4AKHA 3W0LB 1FJGM 2F4VM 1PJIA 3KS8A 1DV0A 4NXMM 3TWLA 2DWLA 2EJSA 4ZPXA 3FTDA 4G4OA 4NRWA 3AL0C 3U6PA 4I8OA 4QHSA 3K8ZA 5FTJA 3KOXE 4PD2A 1MN3A 3OTOM 4B7FA 3GLGE 3JAMS 4LFBM 2ZTCA 1D0LA 1VEJA 2KNVA 2JNHA 2I7NA 5E26A 2WSEF 3KVWA 5BR8M 3FTFA 3W0FA 4G6ZA 4LJ5A 2F5OA 3UMMA 4JI4M 1L1TA 1NHWC 5KO3A 3PNVA 1TR8A 2OOAA 1J5EM 5ITYA 1RU3A 4QOSA 5EJCA 1JR3A 3T15A 3GLGB 1VEGA 2HWJA 1ZMUA 2OO9A 4JI8M 4JI5M 4LRTA 4M9ZA 2KNAA 1Z5AA 4B7HA 2Q2EB 4LGYA 4XBOA 5EP4A 1XWIA 4IBFA 4R7GA 4XGIA 3IECA 4CISA 1R2ZA 1QQWA 3SASA 4X66M 3FRHA 3I04M 3TL4X 1N32M 4DV0M 2O5RA 1NVMA 2Z3XA 3LCVB 4ANRA 3I01M 4PCZA 1XXHE 5EQTA 3VLFB 4DR2M 2DXIA 4DR6M 1P3QQ 2BWEA 1J09A 3J27B 3CF6E 1IY2A 1PRBA 2RKOA 2X8AA 2EKKA 1HJPA 3T1HM 2CHVA 4RF0A 4CJ6A 1XC8A 2O25A 3GLIB 1G4AE 3SAUA 2ZTDA 3LW5F 3PFIA 4X64M 2CUZA 1N36M 2QCUA 1V92A 1AIPC 2M5ZA 3DOAA 5FTNA 4D81A 2CV1A 1GJTA 2QZ4A 3HJSA 5FSWA 4AKIA 3SMPA 4AG5A 4GC5A 3SMSA 3HWSA 1IY1A 4IBGA 1YUBA 4JI3M 2HL7A 2L4FA 2R6FA 2FH0A 5L8RF 2Z4RA 2WSFF 3EIHA 3VDPA 3U6CA 1OFHA 1DGFA 3WHKA 2FFJA 3L2AA 4RKUF 3GP1A 4JV5M 3NBIA 2APLA 1EFUB 1SXJA 5FTLA 1PJSA 3K2LA 2ZM6M 4QNMA 4HEOA 4KLNA 4IBJA 1C1KA 4AKGA 3AFHA 1L2BA 2JUJA 2JXNA 2W82A 5EXPA 4I5SA 1R7RA 2JZ1A 3GRRA 4OW0A 1XHBA 1TF0B 3R9XB 2XFTA 2X4AA 1NO1A 5KQDA 1NJGA 4NSRA 2F5QA 3J80S 8CATA 1WXQA 1ZMWA 2UXCM 4JI1M 4HL4A 4LJ7A 1IXSB 4OVZB 4JI6M 2QPAA 1IFYA 2LNHC 4L78A 1DGHB 4GRIA 2QBYA 5ITRA 1C7YA 4IJEA 3EIEA 1JB0F 1V33A 4EIWA 4LFCM 2L7HA 4FCWA 1IY0A 3KP1E 4P17A 3TWKA 4OU7A 3GLFB 4DR3M 3CF0A 4L15A 3CF2A 5GKNA 1R5LA 2LVAA 2XFSA 2UU9M 2JA2A 2ZAMA 3M7GA 3HHWA 3M6AA 2VIIA 1QZEA 3A45A 2DAMA 2YR0A 3U6MA 4II7A 2C9CA 5DNYA 1GJSA 2BWBA 2XZUA 1HNWM 1NY6A 3AKZA 1XMOM 1KSFX 2B3TA 4PT5A 4R71A 2EKFA 1PM5A 4LZJA 1XB2B 4MB7A 1IBMM 4GHAA 1T3TA 3FYCA 2KZSA 1XXHA 1ZQ9A 2DHRA 2H1RA 3FE3A 4NXNM 1MJGM 1SG9A 2H5XA 3SYKA 2K6BA 2DAKA 3GRVA 3B7QA 4NSOB 1IBLM 2KHHA 2KRUA 3J7BA 2KNZA 3U60B 3GQ4A 1DGGA 3PNYA 2JZ0A 4KO8A 5FTMA 2XSZD 1GO5A 3R8FA 1BVSA 4DR4M 1Q02A 1J7KA 4WP2A 3THGA 3KOZE 5EXSA 4AZFA 4HLQA 1E9SA 1QYRA 5IWAM 2ZANA 2ZBKB 3FUWA 4GC9A 2YQZA 3MMPA 3K9PA 3C58A 4LGMA 1XNRM 4LF6M 2DAIA 3FYDA 3IHPA 3DFZA 4L6V6 2R45A 2C9OA 3QYBA 1JR3D 2UUBM 3KOWE 3U6LA 1IXRC 2VF7A 1QANA 2Z8YM 4B3TM 4GHLA 5KPZA 4GH9A 2DENA 5KQ8A 1X37A 1Q3BA 3C3DA 4X65M 3LCUA 2Y0TA 2RGOA 2N35A 3RGPA 1G41A 2LHCA 2C5RA 2YFQA 3K9OA 4DUYM 4JI2M 3HX3A 1TTEA 1SXJB 2DZNB 2LH0A 4LY6A 5KPTA 3Q8XA 1S3SA 3HJQA 5ITXA 2VF8A 3U5ZB 2HAKA 2FOIC 4FVMA 3NBXX 3DZDA 5LMNM 4BB9A 1KFVA 3HHZA 2CE7A 2M60A 3GLIE 2D7EA 2GNOA 1LTMA 4JXJA 2J5YA 3GLHE 5E6JA 3J81S 1Z59A 4LF7M 3SARA 1Z5BA 2XGNA 3RGSA 4LFAM 4GKJM 4DV5M 2R18A 3AJIB 1DO0A 1I94M 2OOBA 1NHGC 3FUUA 1IN7A 3U6DA 4GEWA 1VDDA 2R62A 4KHPM 2JY5A 4I4LA 3VDUA 1QUSA 1E9RA 2R44A 3HKPA 1QAMA 5IZ7D 3GLHB 1QAQA 4IBEA 4QNRA 2LBCA 2MH8A 5H37D 3L28A 5C18A 3D8BA 2DNAA 1OFIA 3BXWA 4I81A 4MGHA 2MGWA 1PGYA 2XZFA 1SXJD 3ZH9B 3TE6A 1TGUA 1ZAEA 3VK7A 1DO2A 1N77A 4LF9M 3AOEC 1FNNA 3FD9A 3QAUA 1H6UA 2QHOB 3U61B 5F3WA 3LQQA 1NY5A 3KDSE 4M9SA 3C9PA 4QOZC 2G5GX 2XEPA 4IBBA 3VKHA 1OIZA 4JI7M 4L8RC 4NOOB 3KW6A 3BOSA 3HU3A 4LJAA 3T1YM 4CGYB 2GQFA 3CGWA 2LVOC 4MH0E 2L4EA 3F92A 2KEBA 3IG8A 2QQ8A 4ITQA 4RNAA 3HU1A 3GLFE 4IBKA 1YSYA 3KXEC 1G71A 3UJNA 3GLGA 2F5NA 4D82A 1IN6A 1E32A 1WGNA 3SAWA 5A2QS 4PDGA 2UUAM 2JWSA 1PJTA 2LVPC 3HZJA 3PXGA 4F2LA 3HJ8A 2LWXA 1YE9A 4F1IA 1HNZM 1GKIA 1R6BX 2Z7JA 3U6OA 1L2DA 4B3RM 3KFUG 3SFZA 2C98A 4G4NA 3FTEA 3SC3A 1K3WA 3MK6A 1JR3E 2A5YB 2AHMA 2V1CA 1ZMVA 3GRUA 2EUCA 2QNJA 3J2PB 4FD2A 3HHXA 4IBIA 3SHGB 3U6SA 3M0EA 4X62M 4YHHM 2D7HA 3I4YA 3SATA 1TH2A 5FLXS 4G4QA 1XMQM 4FW9A 2VDBB 3ZQJA 2V1UA 4MM3B 2DVWB 2KZUA 4IBDA 2L09A 2LHGA 2UXDM 3GLIA 4DV7M 2R0IA 1OIPA 2CP8A 5ITQA 2YNMD 1QDTA 3VFDA 3SHFA 4LCBA 3JR5A 2R4JA 4WURA 2KRKA 4IIWA 4MGZE 4CIZA 3GQ3A 2OPFA 3GRYA 4Y28F 2UUCM 3HY5A 5JI2E 4LF5M 1GL7A 1IN4A 2RRUA 4FCVA 2HCBA 4R3DA 1K82A 2LVNC 3U6QA 1QDRA 2LXEA 3UZUA 1W5TA 3BBZA 3K1JA 1PJJA 4DV4M 1CUKA 4D80A 2J7NA 1GL6A 4W5WA 5DFLA 1R4GA 1OTRA 1VQ1A 2X49A 4DUZM 2FS1A 4DV2M 1F4IA 1UM8A 1NJFA 1KYIA
chains in the Genus database with same CATH topology
2CFOA 3MHVC 4L4UA 3I4VA 1DGBA 2C96A 4PDIA 3GO8A 4AQYM 1SXJE 1TH3A 3KSXA 4LJ8A 2DWMA 1Q39A 3PVSA 4B3SM 4OX9M 4TUWA 4NRVA 3UK6A 3TQSA 1Q3CA 3E4RA 3KOYE 2L7IA 4AW4A 4FWGA 4WW0A 4OVZA 3VKGA 3ILKA 2XLJA 3UGJA 1DGHA 1W5SA 2J7OA 1E94E 4IJFA 1SXJC 2DZOB 3GPPA 3NWLA 5FTKA 2XSZA 4CHTB 3GLFA 4GKKM 1R2YA 1IM2A 1G8PA 1N78A 1JQJC 1IQPA 1QZMA 1N34M 4LJ6A 4FCTA 4IBCA 2F5SA 1D2NA 3GPYA 5ITTA 2KXEA 1MX0A 2ZAOA 1XNQM 3QWLA 2KW0A 3LVVA 4NL4H 1HNXM 2R65A 1MU5A 3A98B 3B9PA 4MGYE 1OJLA 2QBYB 4LRSA 3TWMA 2F5PA 3A42A 4FWHA 1L1ZA 3ZC7B 2G8LA 5JI3E 4DR7M 1TDZA 2DWZB 5EXTA 1HQCA 1Z5CA 4M0WA 3U60A 3IG5A 4L16A 3JR4A 1QAOA 2XF3A 1L2CA 3HHYA 2CHGA 4M9XA 3DA1A 2C99A 5KPRA 3VK8A 2VQEM 1IXZA 4K0KM 1GVNA 2EO2A 3L27A 1HT1E 4DR1M 5EXXA 2E5LM 3FUXA 4B3MM 1I4WA 2Y20A 5DYGA 5EP3A 1LV7A 3L29A 2D7GA 1IN5A 3CTWB 1XXHB 2BJWA 3KP0E 3FTCA 2BNKA 3T38A 4LZZA 4DV6M 5LMUM 2K47A 4Z8XA 3H4MA 3RE8A 3LQRA 2FNAA 4RF1A 2EA0A 2Z4SA 3LMMA 1Z6TA 4DR5M 3FKEA 4KODA 5IT9S 2P5TA 3SYLA 1IN8A 4BLCA 3J7AS 2L6OA 3U5ZA 4LJ9A 2DWNA 1NNUC 2HHHM 4S12A 3L26A 2R46A 3SAVA 2Y0QA 4JI0M 4B08A 3FUTA 2HKJA 3E9SA 2ERCA 3I51A 5ITXE 4M0DA 2Y21A 2OQ4A 3MJ5A 1N33M 4DV3M 1HR0M 1G3IA 4G4RA 1G59A 7CATA 2CV0A 3L25A 4BBAA 3ZCBB 4Z6YA 1K3XA 3GLHA 4AI6A 4REZA 3GPUA 3KS4A 1TDHA 2NQ8C 3RFWA 4LF4M 1GLNA 5IREB 1EE8A 3K92A 2XH9A 3FUVA 5EP1A 3AOGA 3LVWA 4MGKE 4AG6A 3AOEA 3D8LA 4JN6A 1N75A 2CHQA 2KA6B 3TPZA 2QP9X 4FWDA 4YY3M 2UXBM 3WHLA 4GITA 1NSFA 2CEAA 1HT2E 3HGIA 3SBJA 1ORYB 1NNJA 3U61A 4MGIE 4JYAM 2RGHA 3GPXA 3A46A 4GMQA 3U6EA 2FE8A 2V6ZM 4GIPA 4B7GA 3KSJA 2BJVA 4LF8M 1QVRA 5C1BA 4LJ4A 2I7PA 3HU2A 1L8QA 1HQYE 4P16A 3AV0A 5ITUA 2CV2A 4DV1M 1IBKM 4LG2A 5BPVA 2QENA 2R4EA 4QHTA 3GQ5A 2VQFM 1TH4A 5EP2A 5DYIA 4A3VB 4AKHA 3W0LB 1FJGM 2F4VM 1PJIA 3KS8A 4NXMM 3TWLA 2DWLA 4ZPXA 3FTDA 4G4OA 4NRWA 3AL0C 3U6PA 4I8OA 4QHSA 3K8ZA 5FTJA 3KOXE 4PD2A 3OTOM 4B7FA 3JAMS 4LFBM 5E26A 5BR8M 2I7NA 3FTFA 3KVWA 3W0FA 4G6ZA 4LJ5A 2F5OA 3UMMA 4JI4M 1L1TA 1NHWC 5KO3A 3PNVA 1J5EM 5ITYA 4QOSA 5EJCA 1JR3A 3T15A 3GLGB 4JI8M 4JI5M 4LRTA 4M9ZA 4B7HA 1Z5AA 2Q2EB 4LGYA 4XBOA 5EP4A 1XWIA 4IBFA 4R7GA 4XGIA 4CISA 1R2ZA 1QQWA 3SASA 4X66M 3TL4X 1N32M 4DV0M 2O5RA 1NVMA 2Z3XA 4PCZA 5EQTA 3VLFB 4DR2M 2DXIA 4DR6M 1J09A 3J27B 3CF6E 1IY2A 2RKOA 2X8AA 3T1HM 2CHVA 4RF0A 1XC8A 3GLIB 1G4AE 3SAUA 3PFIA 1N36M 4X64M 2CUZA 2QCUA 3DOAA 2M5ZA 4D81A 5FTNA 2CV1A 3HJSA 2QZ4A 4AKIA 5FSWA 3SMPA 4AG5A 4GC5A 3SMSA 3HWSA 1IY1A 4IBGA 1YUBA 4JI3M 2HL7A 2Z4RA 3EIHA 3VDPA 3U6CA 1OFHA 1DGFA 3WHKA 2FFJA 3L2AA 3GP1A 4JV5M 3NBIA 1SXJA 5FTLA 3K2LA 2ZM6M 4QNMA 4KLNA 4IBJA 1C1KA 4AKGA 3AFHA 1L2BA 2W82A 5EXPA 4I5SA 1R7RA 3GRRA 4OW0A 1XHBA 3R9XB 2XFTA 2X4AA 5KQDA 1NJGA 4NSRA 2F5QA 3J80S 8CATA 1WXQA 2UXCM 4JI1M 4HL4A 4LJ7A 1IXSB 4OVZB 4JI6M 2QPAA 2LNHC 4L78A 1DGHB 4GRIA 2QBYA 5ITRA 4IJEA 3EIEA 4EIWA 4LFCM 2L7HA 4FCWA 1IY0A 3KP1E 3TWKA 4OU7A 3GLFB 4DR3M 3CF0A 4L15A 3CF2A 5GKNA 2XFSA 2UU9M 2JA2A 2ZAMA 3M7GA 3HHWA 3M6AA 2VIIA 3A45A 2YR0A 3U6MA 4II7A 2C9CA 5DNYA 2XZUA 1HNWM 1NY6A 3AKZA 1XMOM 1KSFX 4PT5A 1PM5A 4LZJA 1IBMM 4MB7A 4GHAA 1T3TA 3FYCA 2KZSA 1XXHA 1ZQ9A 2DHRA 2H1RA 3SYKA 4NXNM 3GRVA 4NSOB 1IBLM 2KRUA 3J7BA 3U60B 3GQ4A 1DGGA 3PNYA 4KO8A 5FTMA 2XSZD 3R8FA 4DR4M 1J7KA 3THGA 3KOZE 5EXSA 4AZFA 4HLQA 1E9SA 1QYRA 5IWAM 2ZANA 2ZBKB 3FUWA 4GC9A 2YQZA 3C58A 4LGMA 1XNRM 4LF6M 3FYDA 3DFZA 2R45A 2C9OA 1JR3D 2UUBM 3KOWE 3U6LA 1IXRC 1QANA 4B3TM 4GHLA 5KPZA 4GH9A 5KQ8A 1X37A 1Q3BA 4X65M 2Y0TA 2RGOA 3RGPA 1G41A 2C5RA 2YFQA 4DUYM 4JI2M 1SXJB 2DZNB 2LH0A 4LY6A 5KPTA 3Q8XA 1S3SA 3HJQA 5ITXA 3U5ZB 2FOIC 4FVMA 3DZDA 5LMNM 4BB9A 1KFVA 3HHZA 2CE7A 2M60A 2D7EA 4JXJA 5E6JA 3J81S 4LF7M 1Z59A 3SARA 1Z5BA 2XGNA 3RGSA 4LFAM 4GKJM 4DV5M 2R18A 3AJIB 1DO0A 1I94M 1NHGC 3FUUA 1IN7A 3U6DA 1VDDA 2R62A 4KHPM 4I4LA 3VDUA 1E9RA 3HKPA 1QAMA 5IZ7D 3GLHB 1QAQA 4IBEA 4QNRA 5H37D 3L28A 5C18A 3D8BA 1OFIA 4I81A 4MGHA 2XZFA 1SXJD 3ZH9B 3TE6A 1TGUA 1ZAEA 3VK7A 1DO2A 1N77A 4LF9M 3AOEC 1FNNA 3FD9A 3QAUA 1H6UA 3U61B 5F3WA 3LQQA 1NY5A 3KDSE 4M9SA 1KYIA 4QOZC 2G5GX 2XEPA 4IBBA 3VKHA 4JI7M 4L8RC 4NOOB 3KW6A 3BOSA 3HU3A 4LJAA 3T1YM 4CGYB 4MH0E 2KEBA 3IG8A 4ITQA 4RNAA 3HU1A 4IBKA 1YSYA 3KXEC 3UJNA 3GLGA 2F5NA 4D82A 1IN6A 1E32A 3SAWA 2UUAM 5A2QS 4PDGA 3PXGA 3HJ8A 1YE9A 2LWXA 1HNZM 1GKIA 1R6BX 3U6OA 1L2DA 4B3RM 3KFUG 3SFZA 2C98A 4G4NA 3FTEA 3SC3A 1K3WA 3MK6A 2A5YB 2AHMA 2V1CA 3GRUA 3J2PB 2EUCA 4FD2A 3HHXA 4IBIA 3SHGB 3U6SA 3M0EA 4X62M 4YHHM 2D7HA 3I4YA 3SATA 1TH2A 5FLXS 4G4QA 1XMQM 4FW9A 2V1UA 4MM3B 2DVWB 2KZUA 4IBDA 2L09A 2UXDM 3GLIA 4DV7M 5ITQA 2YNMD 3VFDA 3SHFA 4LCBA 3JR5A 2R4JA 4WURA 2KRKA 4IIWA 4MGZE 3GQ3A 2OPFA 3GRYA 2UUCM 5JI2E 4LF5M 1GL7A 1IN4A 4FCVA 2HCBA 4R3DA 1K82A 3U6QA 3UZUA 2LXEA 1W5TA 3K1JA 1PJJA 4DV4M 4D80A 2J7NA 1GL6A 4W5WA 2X49A 4DUZM 4DV2M 1UM8A 1NJFA 2Z7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D7E A;  2D7G A;  2DWN A;  2D7H A;  4NL4 H;  2DWM A;  2DWL A; 
#chains in the Genus database with same CATH topology
 2CFO A;  3MHV C;  4L4U A;  1NV9 A;  3I4V A;  3B89 A;  1DGB A;  2C96 A;  1WGL A;  1AUA A;  4PDI A;  3GO8 A;  1PJQ A;  1SXJ E;  4AQY M;  1D0K A;  1TH3 A;  2MJ5 B;  3KSX A;  4LJ8 A;  2DWM A;  1Q39 A;  2K9D A;  3PVS A;  4B3S M;  4NC6 A;  4OX9 M;  4TUW A;  3QYE A;  4NRV A;  3UK6 A;  3TQS A;  1Q3C A;  3E4R A;  3KOY E;  2L7I A;  4AW4 A;  4FWG A;  1IXS A;  4WW0 A;  4OVZ A;  1Y8G A;  3VKG A;  3ILK A;  3B74 A;  1NV8 A;  2XLJ A;  3UGJ A;  1DGH A;  1W5S A;  2J7O A;  1E94 E;  4IJF A;  1WHC A;  1SXJ C;  2DZO B;  3GPP A;  2O01 F;  3NWL A;  5FTK A;  2XSZ A;  4CHT B;  3GLF A;  1T6O A;  4GKK M;  1R2Y A;  1IM2 A;  1G8P A;  1N78 A;  1JQJ C;  1IQP A;  1QZM A;  2LTU A;  1N34 M;  4LJ6 A;  3W68 A;  2WSC F;  4FCT A;  4IBC A;  2F5S A;  1D2N A;  3GPY A;  4UN2 B;  5ITT A;  2KXE A;  2MRO B;  1MX0 A;  2JY8 A;  2ZAO A;  1XNQ M;  4XK8 F;  3C3E A;  3QWL A;  2KW0 A;  3LVV A;  4NL4 H;  1HNX M;  2R65 A;  1MU5 A;  3A98 B;  3B7Z A;  3B9P A;  1OJL A;  4MGY E;  4LRS A;  2QBY B;  3TWM A;  2F5P A;  3A42 A;  1T43 A;  4FWH A;  1L1Z A;  3ZC7 B;  2G8L A;  3W67 A;  1VDL A;  5JI3 E;  2JY7 A;  4DR7 M;  3B7N A;  1TDZ A;  2QSF X;  2DWZ B;  5EXT A;  1HQC A;  1Z5C A;  2CWB A;  4M0W A;  3U60 A;  3IG5 A;  2DAE A;  4L16 A;  3JR4 A;  1QAO A;  2XF3 A;  1L2C A;  3HHY A;  2CHG A;  4M9X A;  3DA1 A;  2C99 A;  5KPR A;  3VK8 A;  2VQE M;  1OAO C;  2JY6 B;  1IXZ A;  4K0K M;  1GVN A;  2EO2 A;  3L27 A;  1HT1 E;  4DR1 M;  5EXX A;  2E5L M;  3FUX A;  4B3M M;  1I4W A;  2Y20 A;  5DYG A;  2DI0 A;  1LV7 A;  3L29 A;  5EP3 A;  2DAG A;  2D7G A;  4Q7J A;  1IN5 A;  3CTW B;  1XXH B;  2BJW A;  3KP0 E;  3FTC A;  1VG5 A;  2BNK A;  3T38 A;  4LZZ A;  4DV6 M;  5LMU M;  2K47 A;  4Z8X A;  3H4M A;  3RE8 A;  3LQR A;  1OQY A;  2FNA A;  4RF1 A;  2EA0 A;  2Z4S A;  2K0B X;  2L2D A;  3LMM A;  1Z6T A;  4DR5 M;  1VEK A;  3FKE A;  4KOD A;  5IT9 S;  1ZV1 A;  1A5T A;  2P5T A;  1V34 A;  3SYL A;  1IN8 A;  3T6P A;  4BLC A;  3J7A S;  2L6O A;  3U5Z A;  4LJ9 A;  2DWN A;  1NNU C;  3E46 A;  1WJ7 A;  2HHH M;  2CRU A;  1GAB A;  4S12 A;  3L26 A;  2R46 A;  3SAV A;  2Y0Q A;  4JI0 M;  4B08 A;  3FUT A;  4KT0 F;  4G3O A;  2HKJ A;  3E9S A;  2ERC A;  3I51 A;  5ITX E;  4M0D A;  2Y21 A;  2OQ4 A;  3MJ5 A;  1N33 M;  4DV3 M;  1HR0 M;  1G3I A;  4G4R A;  2LVQ D;  1G59 A;  7CAT A;  2CV0 A;  3L25 A;  4BBA A;  3ZCB B;  4Z6Y A;  1K3X A;  3GLH A;  2MR9 A;  3H4J A;  1EIJ A;  4REZ A;  3GPU A;  4AI6 A;  3KS4 A;  1TDH A;  2NQ8 C;  3RFW A;  4LF4 M;  1GLN A;  5IRE B;  1EE8 A;  3K92 A;  2XH9 A;  1YLA A;  3FUV A;  3AOG A;  3LVW A;  5EP1 A;  2WZJ A;  4MGK E;  4AG6 A;  3AOE A;  3D8L A;  4JN6 A;  1N75 A;  2CHQ A;  2KA6 B;  3TPZ A;  4DBG B;  2QP9 X;  4FWD A;  4YY3 M;  2UXB M;  3V76 A;  3WHL A;  4GIT A;  1NSF A;  2CEA A;  2DKL A;  1D0M A;  1HT2 E;  3HGI A;  3SBJ A;  1ORY B;  1NNJ A;  3U61 A;  3FRI A;  3Q8G A;  4MGI E;  2G3Q A;  2RGH A;  3GPX A;  3A46 A;  4JYA M;  4GMQ A;  3E21 A;  3U6E A;  2FE8 A;  2V6Z M;  4GIP A;  4B7G A;  3KSJ A;  2BJV A;  4LF8 M;  1QVR A;  5C1B A;  2DHY A;  4LJ4 A;  2I7P A;  3HU2 A;  1L8Q A;  1HQY E;  2KDL A;  4P16 A;  3AV0 A;  5ITU A;  2CV2 A;  4DV1 M;  1IBK M;  1OAI A;  4LG2 A;  5BPV A;  1UFZ A;  1WIV A;  2QEN A;  1WR1 B;  2R4E A;  4QHT A;  3GQ5 A;  1QUT A;  2JP7 A;  2VQF M;  2DZL A;  1TH4 A;  1OKS A;  5EP2 A;  5DYI A;  4A3V B;  4AKH A;  3W0L B;  1FJG M;  2F4V M;  1PJI A;  3KS8 A;  1DV0 A;  4NXM M;  3TWL A;  2DWL A;  2EJS A;  4ZPX A;  3FTD A;  4G4O A;  4NRW A;  3AL0 C;  3U6P A;  4I8O A;  4QHS A;  3K8Z A;  5FTJ A;  3KOX E;  4PD2 A;  1MN3 A;  3OTO M;  4B7F A;  3GLG E;  3JAM S;  4LFB M;  2ZTC A;  1D0L A;  1VEJ A;  2KNV A;  2JNH A;  2I7N A;  5E26 A;  2WSE F;  3KVW A;  5BR8 M;  3FTF A;  3W0F A;  4G6Z A;  4LJ5 A;  2F5O A;  3UMM A;  4JI4 M;  1L1T A;  1NHW C;  5KO3 A;  3PNV A;  1TR8 A;  2OOA A;  1J5E M;  5ITY A;  1RU3 A;  4QOS A;  5EJC A;  1JR3 A;  3T15 A;  3GLG B;  1VEG A;  2HWJ A;  1ZMU A;  2OO9 A;  4JI8 M;  4JI5 M;  4LRT A;  4M9Z A;  2KNA A;  1Z5A A;  4B7H A;  2Q2E B;  4LGY A;  4XBO A;  5EP4 A;  1XWI A;  4IBF A;  4R7G A;  4XGI A;  3IEC A;  4CIS A;  1R2Z A;  1QQW A;  3SAS A;  4X66 M;  3FRH A;  3I04 M;  3TL4 X;  1N32 M;  4DV0 M;  2O5R A;  1NVM A;  2Z3X A;  3LCV B;  4ANR A;  3I01 M;  4PCZ A;  1XXH E;  5EQT A;  3VLF B;  4DR2 M;  2DXI A;  4DR6 M;  1P3Q Q;  2BWE A;  1J09 A;  3J27 B;  3CF6 E;  1IY2 A;  1PRB A;  2RKO A;  2X8A A;  2EKK A;  1HJP A;  3T1H M;  2CHV A;  4RF0 A;  4CJ6 A;  1XC8 A;  2O25 A;  3GLI B;  1G4A E;  3SAU A;  2ZTD A;  3LW5 F;  3PFI A;  4X64 M;  2CUZ A;  1N36 M;  2QCU A;  1V92 A;  1AIP C;  2M5Z A;  3DOA A;  5FTN A;  4D81 A;  2CV1 A;  1GJT A;  2QZ4 A;  3HJS A;  5FSW A;  4AKI A;  3SMP A;  4AG5 A;  4GC5 A;  3SMS A;  3HWS A;  1IY1 A;  4IBG A;  1YUB A;  4JI3 M;  2HL7 A;  2L4F A;  2R6F A;  2FH0 A;  5L8R F;  2Z4R A;  2WSF F;  3EIH A;  3VDP A;  3U6C A;  1OFH A;  1DGF A;  3WHK A;  2FFJ A;  3L2A A;  4RKU F;  3GP1 A;  4JV5 M;  3NBI A;  2APL A;  1EFU B;  1SXJ A;  5FTL A;  1PJS A;  3K2L A;  2ZM6 M;  4QNM A;  4HEO A;  4KLN A;  4IBJ A;  1C1K A;  4AKG A;  3AFH A;  1L2B A;  2JUJ A;  2JXN A;  2W82 A;  5EXP A;  4I5S A;  1R7R A;  2JZ1 A;  3GRR A;  4OW0 A;  1XHB A;  1TF0 B;  3R9X B;  2XFT A;  2X4A A;  1NO1 A;  5KQD A;  1NJG A;  4NSR A;  2F5Q A;  3J80 S;  8CAT A;  1WXQ A;  1ZMW A;  2UXC M;  4JI1 M;  4HL4 A;  4LJ7 A;  1IXS B;  4OVZ B;  4JI6 M;  2QPA A;  1IFY A;  2LNH C;  4L78 A;  1DGH B;  4GRI A;  2QBY A;  5ITR A;  1C7Y A;  4IJE A;  3EIE A;  1JB0 F;  1V33 A;  4EIW A;  4LFC M;  2L7H A;  4FCW A;  1IY0 A;  3KP1 E;  4P17 A;  3TWK A;  4OU7 A;  3GLF B;  4DR3 M;  3CF0 A;  4L15 A;  3CF2 A;  5GKN A;  1R5L A;  2LVA A;  2XFS A;  2UU9 M;  2JA2 A;  2ZAM A;  3M7G A;  3HHW A;  3M6A A;  2VII A;  1QZE A;  3A45 A;  2DAM A;  2YR0 A;  3U6M A;  4II7 A;  2C9C A;  5DNY A;  1GJS A;  2BWB A;  2XZU A;  1HNW M;  1NY6 A;  3AKZ A;  1XMO M;  1KSF X;  2B3T A;  4PT5 A;  4R71 A;  2EKF A;  1PM5 A;  4LZJ A;  1XB2 B;  4MB7 A;  1IBM M;  4GHA A;  1T3T A;  3FYC A;  2KZS A;  1XXH A;  1ZQ9 A;  2DHR A;  2H1R A;  3FE3 A;  4NXN M;  1MJG M;  1SG9 A;  2H5X A;  3SYK A;  2K6B A;  2DAK A;  3GRV A;  3B7Q A;  4NSO B;  1IBL M;  2KHH A;  2KRU A;  3J7B A;  2KNZ A;  3U60 B;  3GQ4 A;  1DGG A;  3PNY A;  2JZ0 A;  4KO8 A;  5FTM A;  2XSZ D;  1GO5 A;  3R8F A;  1BVS A;  4DR4 M;  1Q02 A;  1J7K A;  4WP2 A;  3THG A;  3KOZ E;  5EXS A;  4AZF A;  4HLQ A;  1E9S A;  1QYR A;  5IWA M;  2ZAN A;  2ZBK B;  3FUW A;  4GC9 A;  2YQZ A;  3MMP A;  3K9P A;  3C58 A;  4LGM A;  1XNR M;  4LF6 M;  2DAI A;  3FYD A;  3IHP A;  3DFZ A;  4L6V 6;  2R45 A;  2C9O A;  3QYB A;  1JR3 D;  2UUB M;  3KOW E;  3U6L A;  1IXR C;  2VF7 A;  1QAN A;  2Z8Y M;  4B3T M;  4GHL A;  5KPZ A;  4GH9 A;  2DEN A;  5KQ8 A;  1X37 A;  1Q3B A;  3C3D A;  4X65 M;  3LCU A;  2Y0T A;  2RGO A;  2N35 A;  3RGP A;  1G41 A;  2LHC A;  2C5R A;  2YFQ A;  3K9O A;  4DUY M;  4JI2 M;  3HX3 A;  1TTE A;  1SXJ B;  2DZN B;  2LH0 A;  4LY6 A;  5KPT A;  3Q8X A;  1S3S A;  3HJQ A;  5ITX A;  2VF8 A;  3U5Z B;  2HAK A;  2FOI C;  4FVM A;  3NBX X;  3DZD A;  5LMN M;  4BB9 A;  1KFV A;  3HHZ A;  2CE7 A;  2M60 A;  3GLI E;  2D7E A;  2GNO A;  1LTM A;  4JXJ A;  2J5Y A;  3GLH E;  5E6J A;  3J81 S;  1Z59 A;  4LF7 M;  3SAR A;  1Z5B A;  2XGN A;  3RGS A;  4LFA M;  4GKJ M;  4DV5 M;  2R18 A;  3AJI B;  1DO0 A;  1I94 M;  2OOB A;  1NHG C;  3FUU A;  1IN7 A;  3U6D A;  4GEW A;  1VDD A;  2R62 A;  4KHP M;  2JY5 A;  4I4L A;  3VDU A;  1QUS A;  1E9R A;  2R44 A;  3HKP A;  1QAM A;  5IZ7 D;  3GLH B;  1QAQ A;  4IBE A;  4QNR A;  2LBC A;  2MH8 A;  5H37 D;  3L28 A;  5C18 A;  3D8B A;  2DNA A;  1OFI A;  3BXW A;  4I81 A;  4MGH A;  2MGW A;  1PGY A;  2XZF A;  1SXJ D;  3ZH9 B;  3TE6 A;  1TGU A;  1ZAE A;  3VK7 A;  1DO2 A;  1N77 A;  4LF9 M;  3AOE C;  1FNN A;  3FD9 A;  3QAU A;  1H6U A;  2QHO B;  3U61 B;  5F3W A;  3LQQ A;  1NY5 A;  3KDS E;  4M9S A;  3C9P A;  4QOZ C;  2G5G X;  2XEP A;  4IBB A;  3VKH A;  1OIZ A;  4JI7 M;  4L8R C;  4NOO B;  3KW6 A;  3BOS A;  3HU3 A;  4LJA A;  3T1Y M;  4CGY B;  2GQF A;  3CGW A;  2LVO C;  4MH0 E;  2L4E A;  3F92 A;  2KEB A;  3IG8 A;  2QQ8 A;  4ITQ A;  4RNA A;  3HU1 A;  3GLF E;  4IBK A;  1YSY A;  3KXE C;  1G71 A;  3UJN A;  3GLG A;  2F5N A;  4D82 A;  1IN6 A;  1E32 A;  1WGN A;  3SAW A;  5A2Q S;  4PDG A;  2UUA M;  2JWS A;  1PJT A;  2LVP C;  3HZJ A;  3PXG A;  4F2L A;  3HJ8 A;  2LWX A;  1YE9 A;  4F1I A;  1HNZ M;  1GKI A;  1R6B X;  2Z7J A;  3U6O A;  1L2D A;  4B3R M;  3KFU G;  3SFZ A;  2C98 A;  4G4N A;  3FTE A;  3SC3 A;  1K3W A;  3MK6 A;  1JR3 E;  2A5Y B;  2AHM A;  2V1C A;  1ZMV A;  3GRU A;  2EUC A;  2QNJ A;  3J2P B;  4FD2 A;  3HHX A;  4IBI A;  3SHG B;  3U6S A;  3M0E A;  4X62 M;  4YHH M;  2D7H A;  3I4Y A;  3SAT A;  1TH2 A;  5FLX S;  4G4Q A;  1XMQ M;  4FW9 A;  2VDB B;  3ZQJ A;  2V1U A;  4MM3 B;  2DVW B;  2KZU A;  4IBD A;  2L09 A;  2LHG A;  2UXD M;  3GLI A;  4DV7 M;  2R0I A;  1OIP A;  2CP8 A;  5ITQ A;  2YNM D;  1QDT A;  3VFD A;  3SHF A;  4LCB A;  3JR5 A;  2R4J A;  4WUR A;  2KRK A;  4IIW A;  4MGZ E;  4CIZ A;  3GQ3 A;  2OPF A;  3GRY A;  4Y28 F;  2UUC M;  3HY5 A;  5JI2 E;  4LF5 M;  1GL7 A;  1IN4 A;  2RRU A;  4FCV A;  2HCB A;  4R3D A;  1K82 A;  2LVN C;  3U6Q A;  1QDR A;  2LXE A;  3UZU A;  1W5T A;  3BBZ A;  3K1J A;  1PJJ A;  4DV4 M;  1CUK A;  4D80 A;  2J7N A;  1GL6 A;  4W5W A;  5DFL A;  1R4G A;  1OTR A;  1VQ1 A;  2X49 A;  4DUZ M;  2FS1 A;  4DV2 M;  1F4I A;  1UM8 A;  1NJF A;  1KYI A; 
#chains in the Genus database with same CATH homology
 2CFO A;  3MHV C;  4L4U A;  3I4V A;  1DGB A;  2C96 A;  4PDI A;  3GO8 A;  4AQY M;  1SXJ E;  1TH3 A;  3KSX A;  4LJ8 A;  2DWM A;  1Q39 A;  3PVS A;  4B3S M;  4OX9 M;  4TUW A;  4NRV A;  3UK6 A;  3TQS A;  1Q3C A;  3E4R A;  3KOY E;  2L7I A;  4AW4 A;  4FWG A;  4WW0 A;  4OVZ A;  3VKG A;  3ILK A;  2XLJ A;  3UGJ A;  1DGH A;  1W5S A;  2J7O A;  1E94 E;  4IJF A;  1SXJ C;  2DZO B;  3GPP A;  3NWL A;  5FTK A;  2XSZ A;  4CHT B;  3GLF A;  4GKK M;  1R2Y A;  1IM2 A;  1G8P A;  1N78 A;  1JQJ C;  1IQP A;  1QZM A;  1N34 M;  4LJ6 A;  4FCT A;  4IBC A;  2F5S A;  1D2N A;  3GPY A;  5ITT A;  2KXE A;  1MX0 A;  2ZAO A;  1XNQ M;  3QWL A;  2KW0 A;  3LVV A;  4NL4 H;  1HNX M;  2R65 A;  1MU5 A;  3A98 B;  3B9P A;  4MGY E;  1OJL A;  2QBY B;  4LRS A;  3TWM A;  2F5P A;  3A42 A;  4FWH A;  1L1Z A;  3ZC7 B;  2G8L A;  5JI3 E;  4DR7 M;  1TDZ A;  2DWZ B;  5EXT A;  1HQC A;  1Z5C A;  4M0W A;  3U60 A;  3IG5 A;  4L16 A;  3JR4 A;  1QAO A;  2XF3 A;  1L2C A;  3HHY A;  2CHG A;  4M9X A;  3DA1 A;  2C99 A;  5KPR A;  3VK8 A;  2VQE M;  1IXZ A;  4K0K M;  1GVN A;  2EO2 A;  3L27 A;  1HT1 E;  4DR1 M;  5EXX A;  2E5L M;  3FUX A;  4B3M M;  1I4W A;  2Y20 A;  5DYG A;  5EP3 A;  1LV7 A;  3L29 A;  2D7G A;  1IN5 A;  3CTW B;  1XXH B;  2BJW A;  3KP0 E;  3FTC A;  2BNK A;  3T38 A;  4LZZ A;  4DV6 M;  5LMU M;  2K47 A;  4Z8X A;  3H4M A;  3RE8 A;  3LQR A;  2FNA A;  4RF1 A;  2EA0 A;  2Z4S A;  3LMM A;  1Z6T A;  4DR5 M;  3FKE A;  4KOD A;  5IT9 S;  2P5T A;  3SYL A;  1IN8 A;  4BLC A;  3J7A S;  2L6O A;  3U5Z A;  4LJ9 A;  2DWN A;  1NNU C;  2HHH M;  4S12 A;  3L26 A;  2R46 A;  3SAV A;  2Y0Q A;  4JI0 M;  4B08 A;  3FUT A;  2HKJ A;  3E9S A;  2ERC A;  3I51 A;  5ITX E;  4M0D A;  2Y21 A;  2OQ4 A;  3MJ5 A;  1N33 M;  4DV3 M;  1HR0 M;  1G3I A;  4G4R A;  1G59 A;  7CAT A;  2CV0 A;  3L25 A;  4BBA A;  3ZCB B;  4Z6Y A;  1K3X A;  3GLH A;  4AI6 A;  4REZ A;  3GPU A;  3KS4 A;  1TDH A;  2NQ8 C;  3RFW A;  4LF4 M;  1GLN A;  5IRE B;  1EE8 A;  3K92 A;  2XH9 A;  3FUV A;  5EP1 A;  3AOG A;  3LVW A;  4MGK E;  4AG6 A;  3AOE A;  3D8L A;  4JN6 A;  1N75 A;  2CHQ A;  2KA6 B;  3TPZ A;  2QP9 X;  4FWD A;  4YY3 M;  2UXB M;  3WHL A;  4GIT A;  1NSF A;  2CEA A;  1HT2 E;  3HGI A;  3SBJ A;  1ORY B;  1NNJ A;  3U61 A;  4MGI E;  4JYA M;  2RGH A;  3GPX A;  3A46 A;  4GMQ A;  3U6E A;  2FE8 A;  2V6Z M;  4GIP A;  4B7G A;  3KSJ A;  2BJV A;  4LF8 M;  1QVR A;  5C1B A;  4LJ4 A;  2I7P A;  3HU2 A;  1L8Q A;  1HQY E;  4P16 A;  3AV0 A;  5ITU A;  2CV2 A;  4DV1 M;  1IBK M;  4LG2 A;  5BPV A;  2QEN A;  2R4E A;  4QHT A;  3GQ5 A;  2VQF M;  1TH4 A;  5EP2 A;  5DYI A;  4A3V B;  4AKH A;  3W0L B;  1FJG M;  2F4V M;  1PJI A;  3KS8 A;  4NXM M;  3TWL A;  2DWL A;  4ZPX A;  3FTD A;  4G4O A;  4NRW A;  3AL0 C;  3U6P A;  4I8O A;  4QHS A;  3K8Z A;  5FTJ A;  3KOX E;  4PD2 A;  3OTO M;  4B7F A;  3JAM S;  4LFB M;  5E26 A;  5BR8 M;  2I7N A;  3FTF A;  3KVW A;  3W0F A;  4G6Z A;  4LJ5 A;  2F5O A;  3UMM A;  4JI4 M;  1L1T A;  1NHW C;  5KO3 A;  3PNV A;  1J5E M;  5ITY A;  4QOS A;  5EJC A;  1JR3 A;  3T15 A;  3GLG B;  4JI8 M;  4JI5 M;  4LRT A;  4M9Z A;  4B7H A;  1Z5A A;  2Q2E B;  4LGY A;  4XBO A;  5EP4 A;  1XWI A;  4IBF A;  4R7G A;  4XGI A;  4CIS A;  1R2Z A;  1QQW A;  3SAS A;  4X66 M;  3TL4 X;  1N32 M;  4DV0 M;  2O5R A;  1NVM A;  2Z3X A;  4PCZ A;  5EQT A;  3VLF B;  4DR2 M;  2DXI A;  4DR6 M;  1J09 A;  3J27 B;  3CF6 E;  1IY2 A;  2RKO A;  2X8A A;  3T1H M;  2CHV A;  4RF0 A;  1XC8 A;  3GLI B;  1G4A E;  3SAU A;  3PFI A;  1N36 M;  4X64 M;  2CUZ A;  2QCU A;  3DOA A;  2M5Z A;  4D81 A;  5FTN A;  2CV1 A;  3HJS A;  2QZ4 A;  4AKI A;  5FSW A;  3SMP A;  4AG5 A;  4GC5 A;  3SMS A;  3HWS A;  1IY1 A;  4IBG A;  1YUB A;  4JI3 M;  2HL7 A;  2Z4R A;  3EIH A;  3VDP A;  3U6C A;  1OFH A;  1DGF A;  3WHK A;  2FFJ A;  3L2A A;  3GP1 A;  4JV5 M;  3NBI A;  1SXJ A;  5FTL A;  3K2L A;  2ZM6 M;  4QNM A;  4KLN A;  4IBJ A;  1C1K A;  4AKG A;  3AFH A;  1L2B A;  2W82 A;  5EXP A;  4I5S A;  1R7R A;  3GRR A;  4OW0 A;  1XHB A;  3R9X B;  2XFT A;  2X4A A;  5KQD A;  1NJG A;  4NSR A;  2F5Q A;  3J80 S;  8CAT A;  1WXQ A;  2UXC M;  4JI1 M;  4HL4 A;  4LJ7 A;  1IXS B;  4OVZ B;  4JI6 M;  2QPA A;  2LNH C;  4L78 A;  1DGH B;  4GRI A;  2QBY A;  5ITR A;  4IJE A;  3EIE A;  4EIW A;  4LFC M;  2L7H A;  4FCW A;  1IY0 A;  3KP1 E;  3TWK A;  4OU7 A;  3GLF B;  4DR3 M;  3CF0 A;  4L15 A;  3CF2 A;  5GKN A;  2XFS A;  2UU9 M;  2JA2 A;  2ZAM A;  3M7G A;  3HHW A;  3M6A A;  2VII A;  3A45 A;  2YR0 A;  3U6M A;  4II7 A;  2C9C A;  5DNY A;  2XZU A;  1HNW M;  1NY6 A;  3AKZ A;  1XMO M;  1KSF X;  4PT5 A;  1PM5 A;  4LZJ A;  1IBM M;  4MB7 A;  4GHA A;  1T3T A;  3FYC A;  2KZS A;  1XXH A;  1ZQ9 A;  2DHR A;  2H1R A;  3SYK A;  4NXN M;  3GRV A;  4NSO B;  1IBL M;  2KRU A;  3J7B A;  3U60 B;  3GQ4 A;  1DGG A;  3PNY A;  4KO8 A;  5FTM A;  2XSZ D;  3R8F A;  4DR4 M;  1J7K A;  3THG A;  3KOZ E;  5EXS A;  4AZF A;  4HLQ A;  1E9S A;  1QYR A;  5IWA M;  2ZAN A;  2ZBK B;  3FUW A;  4GC9 A;  2YQZ A;  3C58 A;  4LGM A;  1XNR M;  4LF6 M;  3FYD A;  3DFZ A;  2R45 A;  2C9O A;  1JR3 D;  2UUB M;  3KOW E;  3U6L A;  1IXR C;  1QAN A;  4B3T M;  4GHL A;  5KPZ A;  4GH9 A;  5KQ8 A;  1X37 A;  1Q3B A;  4X65 M;  2Y0T A;  2RGO A;  3RGP A;  1G41 A;  2C5R A;  2YFQ A;  4DUY M;  4JI2 M;  1SXJ B;  2DZN B;  2LH0 A;  4LY6 A;  5KPT A;  3Q8X A;  1S3S A;  3HJQ A;  5ITX A;  3U5Z B;  2FOI C;  4FVM A;  3DZD A;  5LMN M;  4BB9 A;  1KFV A;  3HHZ A;  2CE7 A;  2M60 A;  2D7E A;  4JXJ A;  5E6J A;  3J81 S;  4LF7 M;  1Z59 A;  3SAR A;  1Z5B A;  2XGN A;  3RGS A;  4LFA M;  4GKJ M;  4DV5 M;  2R18 A;  3AJI B;  1DO0 A;  1I94 M;  1NHG C;  3FUU A;  1IN7 A;  3U6D A;  1VDD A;  2R62 A;  4KHP M;  4I4L A;  3VDU A;  1E9R A;  3HKP A;  1QAM A;  5IZ7 D;  3GLH B;  1QAQ A;  4IBE A;  4QNR A;  5H37 D;  3L28 A;  5C18 A;  3D8B A;  1OFI A;  4I81 A;  4MGH A;  2XZF A;  1SXJ D;  3ZH9 B;  3TE6 A;  1TGU A;  1ZAE A;  3VK7 A;  1DO2 A;  1N77 A;  4LF9 M;  3AOE C;  1FNN A;  3FD9 A;  3QAU A;  1H6U A;  3U61 B;  5F3W A;  3LQQ A;  1NY5 A;  3KDS E;  4M9S A;  1KYI A;  4QOZ C;  2G5G X;  2XEP A;  4IBB A;  3VKH A;  4JI7 M;  4L8R C;  4NOO B;  3KW6 A;  3BOS A;  3HU3 A;  4LJA A;  3T1Y M;  4CGY B;  4MH0 E;  2KEB A;  3IG8 A;  4ITQ A;  4RNA A;  3HU1 A;  4IBK A;  1YSY A;  3KXE C;  3UJN A;  3GLG A;  2F5N A;  4D82 A;  1IN6 A;  1E32 A;  3SAW A;  2UUA M;  5A2Q S;  4PDG A;  3PXG A;  3HJ8 A;  1YE9 A;  2LWX A;  1HNZ M;  1GKI A;  1R6B X;  3U6O A;  1L2D A;  4B3R M;  3KFU G;  3SFZ A;  2C98 A;  4G4N A;  3FTE A;  3SC3 A;  1K3W A;  3MK6 A;  2A5Y B;  2AHM A;  2V1C A;  3GRU A;  3J2P B;  2EUC A;  4FD2 A;  3HHX A;  4IBI A;  3SHG B;  3U6S A;  3M0E A;  4X62 M;  4YHH M;  2D7H A;  3I4Y A;  3SAT A;  1TH2 A;  5FLX S;  4G4Q A;  1XMQ M;  4FW9 A;  2V1U A;  4MM3 B;  2DVW B;  2KZU A;  4IBD A;  2L09 A;  2UXD M;  3GLI A;  4DV7 M;  5ITQ A;  2YNM D;  3VFD A;  3SHF A;  4LCB A;  3JR5 A;  2R4J A;  4WUR A;  2KRK A;  4IIW A;  4MGZ E;  3GQ3 A;  2OPF A;  3GRY A;  2UUC M;  5JI2 E;  4LF5 M;  1GL7 A;  1IN4 A;  4FCV A;  2HCB A;  4R3D A;  1K82 A;  3U6Q A;  3UZU A;  2LXE A;  1W5T A;  3K1J A;  1PJJ A;  4DV4 M;  4D80 A;  2J7N A;  1GL6 A;  4W5W A;  2X49 A;  4DUZ M;  4DV2 M;  1UM8 A;  1NJF A;  2Z7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...