2D8CA

Solution structure of the sam-domain of mouse phosphatidyl ceramidecholinephosphotransferase 1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
97
structure length
97
Chain Sequence
GSSGSSGMLSARTMKEVVYWSPKKVADWLLENAMPEYCEPLEHFTGQDLINLTQEDFKKPPLYRVSSDNGQRLLDMIETLKMEHHMEAHKNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the sam-domain of mouse phosphatidyl ceramidecholinephosphotransferase 1
rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Phosphatidylcholine:ceramide cholinephosphotransferase 1
total genus 11
structure length 97
sequence length 97
ec nomenclature ec 2.7.8.27: Sphingomyelin synthase.
pdb deposition date 2005-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2d8cA01
2EAPA 2FE9A 2K60A 2Y9TA 2GLEA 2E8MA 2E8NA 5J8YA 2F8KA 2EAMA 4PZOA 2E8OA 2LMRA 4NL9C 3TADA 5JU5A 3KKAA 1B4FA 2QB0A 1LKYA 1COKA 2EAOA 3TADC 4MHVA 1SXEA 1X40A 2DKXA 2QB1A 1SXDA 3BS5B 5J8YC 4NL9A 3SEIA 2JV3A 1V38A 2Y9UA 3BS5A 2ESEA 1KW4A 2DL0A 1UQVA 2EANA 3HILA 3IDWA 1X9XA 1OXJA 4PZNA 1WWVA 2LPEA 2F3NA 5KNIA 1SV4A 1RG6A 2K4PA 2KIVA 4IS7A 1F0MA 3BS7A 3TACB 1OW5A 1LKYB 1UCVA 1PK1B 2KE7A 1SGGA 1WWUA 1SV0A 2ES6A 5F3XB 2F44A 5JTIA 3H8MA 3SENA 2D8CA 2QKQA 1V85A 3BQ7A 2L5YA 4NJ8A 2QARB 2B6GA 1X66A 4RQNA 1PK1A 5JRTA 1JI7A 2D3DA 1PK3A 4RQMA 2KSOA 5L1MA 3KKAC 2QARA 1SV0C 1DXSA 2KG5A 2KSOB 2QB0B 2KMDA 2E8PA 2YTUA 1Z1VA 2DKZA 1B0XA 3K1RB
chains in the Genus database with same CATH superfamily
2M9NA 4NM2A 4ECUA 3N97B 2JRZA 5ALXA 4M6WB 7ICEA 2C22A 2KD1A 2F1HA 3PX6A 7ICPA 3E58A 8ICSA 4PZOA 2YMPA 7ICGA 4NL9C 4ECTA 1XSPA 4QZBA 4Z6DA 4YFKA 1U48A 4QIWC 5J0SA 3M6ZA 1B4FA 9ICLA 1D9FA 8ICVA 5KFRA 4C80A 4JV0A 1TAMA 4B6JA 3PMNA 2NRZA 1NKCA 2J6TA 3OJSA 2BQRA 2ESEA 4GXIA 4FE3A 4F2RA 1UQVA 2ZJAA 1KFSA 1S9FA 3AQEA 4DSKA 2ASDA 4NV0A 3C5GA 3SMVA 5E79U 1ZQCA 4B9NA 2J6SA 4CF4A 3TARA 4KLSA 4JK1A 2I1QA 9ICVA 4I2JA 2D6FC 3QEAZ 1J2NA 1L7PA 8ICLA 5AI6A 4QWDA 4KLJA 5AK5A 3WK8A 2PMZC 2KZMA 1L3TA 4MF2A 4F4XA 4I2DA 1RXWA 2OEHA 4ECVA 4K4IA 1UPHA 1Z4NA 1Z19A 4C8NA 4BGDA 3GIIA 2R18A 2E1EA 1FFVA 3RFAA 3PO5A 2BPGA 2AHOB 3O0FA 4QWCA 5ALOA 2W7OA 7ICLA 2KHQA 5DQHA 2RDIA 1YZ6A 4UB3A 4UAZA 3RB4A 3NVWA 2W8KA 3I1YA 9ICGA 4US9A 8ICUA 2E8PA 1COOA 3UMGA 4JB3A 4C4RA 3ISCA 2CN1A 1NKBA 2E8NA 2V4RA 5B66U 5CEHA 2F1IA 4US8A 4TQRA 5AM1A 5DGAA 3WK6A 7ICKA 1YZ7A 4O3OA 1BPDA 4OJ5A 4YR2A 9ICFA 4OJOA 5AKXA 4ELTA 4YXJA 1ZQOA 4CRXA 3ETRA 3MFIA 4J9MA 3BS5A 4Z6FA 3ZDAA 2MUTB 3SI8A 4UW9A 2ZIWB 5KFEA 1KRPA 1ZD4A 1RM6C 4EBEA 2KZZA 1SL2A 4Y2RA 1NZPA 1HUZA 3SAGA 1PVRA 8ICKA 2AH5A 5J29A 1X9MA 4F5RA 3EPGA 2ES6A 4KN7A 1PVPA 3V7LA 4NWIA 2HMXA 1ZQUA 3C28A 2ZIVB 3Q8LA 3WK5A 3PNCA 5KFIA 3TFRA 1XNSA 3F5EA 3RJJA 9ICQA 5IINA 3OSPA 3I28A 3GV5B 4MFCA 1P7DA 2H3IA 4X5VA 1SKRA 4R63A 4KLHA 2KSOA 2KJ5A 4F5PA 4GLXA 5HHIA 4JWMA 4ELUA 2JGAA 1RYRA 2JZBA 4EX6A 4RT2A 2A1AA 2BDPA 1Z1VA 3PW5A 3E0FA 3UM9A 2F2AB 3BQ1A 4KLUA 1U9LA 4PHAA 4FZMA 2YMLA 4QWEA 2UVWA 1SL0A 3V6JA 4UAYA 3THVA 2IBKA 5JU5A 1QQ7A 3KKAA 3KHLA 5DG8A 2JH1A 3C2KA 4XA5A 5DLFA 4KLDA 1X40A 5EWEA 5J2EA 3HJEA 5G5GA 4IQWA 4U7CA 3L3FX 1U4BA 5CP2A 7ICHA 5EWGA 4DFJA 4C4SA 4DL4A 3JPTA 1OXJA 1ZQKA 3JPRA 5KG3A 3RJKA 2F3NA 4KLGA 3NVVA 3PW4A 3CP8A 4I2GA 3F2DA 3AEVA 3D2QA 4TQSA 2KE7A 2K8BB 4F50A 2F8LA 2R8KA 1CRXA 2YY6A 5IIJA 4RPXA 4M6WA 2UVUA 2OYYA 2YB1A 4QZFA 3PR4A 2PFQA 4J9QA 1SL1A 4FZLA 2ASLA 1IIPA 5CJ7A 5J0OA 3RF9A 1JI7A 4NLZA 5KG5A 2W9BA 2Y0SF 2W03A 5H2FU 1QSYA 2K4IA 4C7YA 5KFGA 5AK6A 7ICUA 3OGUA 2IOHA 4Q8EA 5AKJA 3SYZA 1NK9A 5IIMA 4J9OA 3QUBA 2C2EA 2HI0A 1S0OA 2HSZA 4TUSA 3CRXA 1BPBA 1J97A 2K60A 4I2CA 5J8YA 2IOFA 3LDAA 5KL8B 2NRVA 3MR6A 1D9DA 5KFHA 3KBBA 4QZCA 2K4HA 2KIWA 4NLGA 1ZJNA 1NOMA 3NVYA 3H8WA 3RJEA 3BS5B 5J2DA 3SZ2A 2FPLA 5KG6A 5DKWA 4KLQA 2WF8A 3OHAA 5B5EU 2XCPA 4CE6A 4QW9A 2M0NA 2ZIUB 1TK0A 9ICAA 4I28A 2HHUA 1A6SA 5ALRA 4Q44A 1OUQA 4RPYA 3MABA 1N62A 5AK4A 1RG6A 2K4PA 2W9BB 2KK0A 1S97A 5EOZA 4I2FA 1Z3EB 3RAXA 1JN3A 1NK7A 2PFOA 4KITB 3AU2A 3H0MB 5BOMA 1ZQBA 4P4PA 3AM9A 4DQQA 4O3NA 1KTQA 1L7MA 4CDGA 4DO9A 3SV3A 2I6XA 3ETLA 2ZUDA 3VCBA 5DB7A 8ICPA 5KT7A 1ED1A 4UAWA 4FO6A 2KN7A 1SB3C 4OJ6A 2HBJA 3H40A 1A77A 2G0AA 1KDHA 2PKEA 3HPOA 2HDOA 5AKHA 3MGIA 1MN8A 5HR7A 1FFUA 3HWTA 4ED7A 2HOQA 2KVSA 5HHHA 1NK4A 2HVHA 1XO1A 2CRXA 9ICSA 3N28A 3WKDA 4F2SA 4IC9A 4B9TA 2DKZA 2ZIVA 1DK2A 2O6KA 2KFNA 4YD2A 3JPOA 3QZ8A 3NS1A 2PI5A 4Y2TA 1JIHA 2BQ3A 4M47A 3Q8SB 5J2AA 1QTMA 4EZ6A 9ICOA 4GFJA 4DOCA 1RPLA 3FAHA 1L7OA 2BCUA 2Y1IA 2QB0A 3IM1A 3F5AA 5KFOA 4JV1A 2KKPA 1ZETA 2HBMA 3C5FA 2FPKA 5KFUA 1ZQJA 5J2KA 1KW4A 3K1ZA 3PR5B 1L8OA 7ICSA 1IV8A 1SWWA 2MRLA 4OJPA 2ASJA 4F5OA 1TKDA 4IS7A 5DG9A 4EBDA 4M9GA 4QZAA 1T94A 4IQVA 3QX7A 4IR1A 4RQ2A 1QQ5A 3ZDCA 1HUOA 4QZIA 4UBCA 3QE9Y 4DSJA 5L9XA 3K75D 4BWJA 3WU2U 5JRTA 4BXOB 2WHEA 4RT3A 3PW0A 2YB4A 4YN4A 4U6PA 4KLTA 1D8LA 4DS5A 1Q8KA 2A19A 1URJA 4F72A 5KFPA 1ZQIA 2IOFK 2JEJA 3RBEA 3PX4A 2KG5A 2YMQA 1XSLA 2IA6A 3CW2C 1BPXA 8ICMA 3QU7A 4F8RA 5J2CA 4JV2A 3HX0A 2NRXA 2DPJA 4O3QA 2P6RA 2OXOA 3PZPA 2XI9A 3KHHA 1O03A 4BDPA 3AU6A 1ZQSA 1JMSA 2DQNB 5AKIA 1ZQFA 2UVVA 4NLBA 3N7RC 4O5CA 2WTFA 1S77D 3MR3A 1UT8A 5KFQA 7ICIA 5KL1B 4NLKA 4Q8FA 2FLPA 2VANA 2ZXHA 2KZ3A 2DL0A 2LYAA 4UBBA 1B43A 2EQYA 8ICQA 4OJLA 4DLEA 2A1JB 3A0BU 4XQ8A 3UQ0A 2LPEA 3OPXA 4DF4A 1IG6A 2Y0SC 4RNOA 5HP4A 3AUOA 3PSPA 2KTQA 3UPQA 4I2HA 2FLLA 1HJPA 1WUDA 9ICMA 5DQGA 5KFCA 1WWUA 3IN5A 3MGVA 7ICNA 4KX5A 2YN4A 1V85A 1ZQPA 2B6GA 9ICKA 4ED3A 4GIBA 2D3DA 2H3FA 4K4GA 3RB6A 1TVAA 3QU2A 5IIIA 4O0IA 3EW9A 3WKEA 1RYUA 7ICRA 2RLTA 2W55A 4KLMA 3CYMA 1ZQNA 4O3SA 8ICRA 5J0XA 3M9NB 2GLEA 1ZD2P 3J81j 3G6YA 4J9LA 1LB2B 5T14A 3RR8A 2E8OA 3GIJA 3PMLA 1Z00A 1PZNA 2V4QA 2IMWP 2KJ9A 5KFKA 3QUCA 2DF4B 4BX9C 3QU5A 1U47A 2EZZA 1ZRMA 1BVSA 5AM2A 1ZQLA 4ECZA 4Y2YA 4MHVA 5D4BA 4RPZA 1FEZA 2QB1A 3JPPA 2AJQA 2ZXIA 3KHRA 2W3SA 1BNOA 3AL0B 5ALGA 9ICXA 1EXNA 1Q46A 3SAHA 4CGZA 2BR0A 2XICA 3ICXA 2EDUA 4XRHA 2VA8A 4TURA 1RYSA 5KFFA 2KEYA 4O5KA 7ICTA 1AQ6A 1QQ6A 5DG7A 4KMUA 4UB4A 4M9LA 3KOOA 8ICGA 2ZG6A 1S0VA 2NYVA 2FDRA 3D2SA 2W04A 1HEKA 1S0NA 1SZPA 3KZIU 5ALYA 3FDSA 2R8GA 1NK5A 5IIOA 3AN1A 1F44A 2H3VA 4M2YA 2QKQA 4NJ8A 3C1YA 3LK9A 2W8LA 2ZIUA 5BPCA 1ZQDA 2JZBB 4P0QB 3RH6A 4GXKA 4CF3A 4NXZA 3KZXA 1SV0C 3BZCA 3M1YA 2KSOB 3GU3A 5KG2A 8ICIA 3RB0A 1NJYA 3SD7A 1RQNA 2BZFA 4YMOA 3EPIA 1Z1BA 3UMCA 2XO7A 3PW7A 3DEEA 2F76X 5CA7A 4EELA 8ICNA 2GH1A 1BGXT 3QUTA 5J2HA 2WFAA 4Y2XA 2NO5A 4DL5A 5ALKA 2BCQA 1MQ3A 3KTQA 2K8AA 4FBTA 4UB5A 4AYBC 3V72A 1WCLA 1SXEA 1X6IA 1V38A 3CNHA 1N56A 3H0RB 1N2XA 2E1FA 4USAA 1J2MA 2LBOA 1X9XA 2ZTDA 5EE1A 3BQ2A 4O9MA 1WWVA 2MSNA 5KAFU 3ORYA 5L1LA 1U45A 5KNIA 2ZUCA 1T3QA 1N48A 4DQSA 9ICNA 3BS7A 1RDFA 4Z6CA 5K4LA 4MEYA 4ZH4A 3TQ1A 5CB1A 5F3XB 4C8MA 2WAQC 2KHVA 3QUQA 3T5JA 2HHXA 3WKBA 2L5YA 2DPIA 2OHFA 4RUCA 8ICEA 1N63A 4RQ8A 1DRGA 4I2BA 1JUDA 3V6KA 5J0YA 2AXTU 2K8CB 4OO1J 1N60A 3G6XA 1Z4OA 2P35A 5DBCA 4GXJA 7ICJA 1DK3A 2KICA 1N5XA 4PGYA 3HW8A 4P4OA 2KMDA 9ICCA 3V6HA 1CUKA 5L1IA 2WF9A 4F4ZA 1B0XA 4ECYA 4Q45A 3RR7A 1FIQA 4CNQA 4YR3A 2KFZA 5ALIA 2IHNA 4EYHB 3BZKA 2EAMA 4KLEA 4B9VA 2BQUA 2BHNA 4IQUA 1X6JA 4Y2QA 3D2NA 2KV2A 1KQQA 1N61A 3WKAA 2DKXA 1X9SA 1KN5A 4F71A 4QZ9A 1DOQA 4YG2A 3MR5A 3SEIA 3ISBA 8ICOA 5AI9A 4QIWF 1QH9A 4O3RA 5ALUA 5ALJA 4IRKA 1Q3UA 8ICCA 1ZQYA 4C0ZA 3B0XA 3HRDD 5L1KA 2I9GA 4DLGA 1DGJA 2DGZA 4I29A 3GZFA 1H38A 1XWLA 3L4PA 1SKWA 1SV4A 1PVQA 4YP3A 1F0MA 1JXEA 1QCKA 2HHQA 3KD3A 2G5HB 3BQTA 1SGGA 2ZTCA 3TKAA 1TFRA 2EZXA 4DQPA 5EE3A 4RQ3A 3K4GA 3H8MA 3H4DA 3SENA 4J9PA 3EWAA 3NRWA 4YCXA 4F4KA 1NK0A 2VJ5A 2WB1C 4F92B 3Q8QB 5ALEA 4DSIA 1QSLA 2JXJA 2YX8A 1ZD5A 3ONNA 1WCNA 4PL2A 2FMPA 8ICTA 3V7JA 5KT5A 2BDUA 5J0QA 4YVZA 2QB0B 5AI5A 4NLCA 1V9PA 2C2DA 4RZRA 2AU0A 5J0TA 5KFAA 5BOLA 1ZXIA 1ZD3A 3HP6A 1A76A 3M6KA 4F4YA 1D8YA 1ZQHA 4Z6EA 5DB8A 3MFHA 1ZQTA 4XUSA 1NK6A 4F5QA 3UMBA 1NNLA 1LKYA 4P0PB 3PO4A 3TADC 3Q8RB 5KFZA 2RQ5A 3C2LA 4J9SA 2XY7A 3WK9A 4ICAA 3JPNA 1C7YA 3T79A 2ZIWA 2OCEA 2KP7A 3LYSA 2HHTA 2MUTA 4DOAA 3IDWA 1BPEA 3GFKB 4G3IA 4EBCA 4IL6U 4B9MA 4OD0A 1VDVA 1L5UA 3LVVA 1ZQEA 3OTQA 2EH9A 3OSNA 2AGPA 2XCAA 4DFPA 1ZQMA 1TV9A 3ZD8A 4PHPA 4K4HA 5IIKA 3PSTA 9ICPA 1SV0A 3UXNA 2R8HA 3PW2A 4DF8A 3TAPA 4J9NA 4Q43A 5KFWA 5ALLA 2CXYA 2FMQA 4DFDA 3ZD9A 2QARB 2PFNA 3PY8A 2H3QA 1X66A 3PV8A 3FM9A 4FS2A 1C20A 1GO3F 3QU4A 3H4BA 5AI0A 2ZTEA 4WJ3B 1TE2A 2G07A 4B9UA 5J2BA 3SV4A 3PX0A 4PH5A 5AM3A 4EEYA 2P66A 5KFJA 2RHFA 3N7SC 3C21A 4TUQA 2R8IA 4RNNA 4F93B 3ZDDA 4PGQA 1TAQA 4DFMA 2LYHA 3RJHA 4ED0A 5KFMA 4DL2A 4Y2PA 2LMRA 5AM5A 1Z00B 4O3PA 5KAIU 5D46A 2AGQA 2A1JA 1RQLA 2BCRA 3QZ7A 4FFDA 2RDJA 1ZJMA 2IHMA 5J0RA 1X2IA 4M9HA 9ICBA 2H3ZA 1SXDA 1KBUA 7ICVA 4NL9A 3MDAA 2FLNA 4DQIA 3E2EA 3HILA 1UA0A 5TISU 2A3VA 2PFPA 1XSNA 2VJ4A 2XGQA 4KTQA 2MA1A 1S76D 4UATA 5G5HA 3F2BA 2LI6A 4YMNA 4KN4A 4CF5A 1OW5A 2GOLA 1PK1B 4PHEA 3M9OB 4AP9A 4UB2A 2BCSA 3I76A 4B9LA 1KSPA 4KX3A 5KFNA 2Q4TA 4FBUA 3QEBZ 2XY6A 4QW8A 4EZ9A 2XC9A 3OHBA 2JR5A 2BPCA 2F1JA 4BWMA 3F53A 4P4MA 3RH4A 2G06A 3WK4A 4KLLA 5AICA 5KG7A 2XY5A 4DSEA 3IRUA 2XGPA 2FPMA 2WF6A 4LZGA 2NRTA 2HHSA 2Q0ZX 5DQIA 2WAQF 3GIMA 2XVTA 3NVZA 1KFDA 2W9CA 5AM0A 1XO0A 1NJXA 4TUPA 5HR6A 2JEGA 1DXSA 2HVIA 1MC8A 2LM1A 2PMZF 3GDXA 1ZQRA 4DL7A 1F5SA 3G6VA 3ALRA 4CCHA 2ZIXA 4DS4A 2P6UA 2AQ4A 5C0YA 3RRHA 1UHUA 5TZVA 2G08A 4Y2VA 3EYZA 4C8KA 2ZJ5A 1ZOLA 4I27A 1X42A 1MSWD 4UAVA 4NLNA 9ICJA 3M9MB 4DL6A 3WK7A 8ICXA 1MA7A 5DB9A 2ISOA 5J8YC 5KT4A 3M8RA 1KFTA 4UB8U 3RB3A 2QLTA 3IP4B 4UB6U 5KT2A 1BPYA 4C8OA 4P0PA 2JEIA 3V7KA 5J0PA 4DSLA 4PZNA 4ECRA 3TI0A 2FI1A 3IG5A 4C7ZA 2KIVA 2PI4A 2VA2A 1S5LU 3TACB 2E5SA 1YT3A 1ZQ1C 4QZHA 3ZDEA 3UQ2A 5AI4A 2W3RA 4GC6A 5HMMA 5KT6A 3RTVA 4KMOB 4ACOA 3ISDA 4RQ5A 3L5KA 2NV3A 1L6NA 4BJQA 2ZJ8A 1PK1A 4QWAA 2HOFA 4EENA 4O5EA 5AKLA 4F4WA 2JEFA 1SWVA 1CI4A 2HHWA 3UXOA 1RZTA 2LM4A 4FS1A 4DFKA 2N1RA 1L3VA 3OJUA 1N5WA 4IQTA 4OCZA 3DV9A 3T5LA 1ZYQA 2HW3A 1S0MA 1NK8A 1CEZA 2KVCA 3WKCA 1VJ5A 1ZQAA 4ED6A 5KG1A 4QZ8A 5GTHU 5J2FA 5KT3A 4R8UA 5AIBA 4KLIA 2JMGA 4PL1A 4DQRA 1NJZA 1JRPA 1UT5A 2K4EA 5KFSA 2EAOA 4ECSA 4UAUA 3QU9A 2F77X 3T3FA 2G09A 4ELVA 4I2IA 3MDCA 5KFVA 3NASA 4NY8A 3U26A 2W7PA 4MFFA 4NM1A 5AM4A 1BPZA 4IRCA 5ALWA 4KLFA 3H0LB 4MFAA 4R65A 4R66A 3NUQA 4DSFA 5J2IA 1LKYB 5AKKA 2FMSA 1JX4A 4YD1A 4IRDA 3GIKA 3MC1A 4UASA 4RQ4A 4J9RA 2K89A 4YMMA 5ALDA 1NJWA 4ECXA 3KFUF 1ZRNA 3BQ7A 2W9CB 1L7NA 2W54A 4RQNA 5KFTA 2AGOA 3AQFA 4RUAA 3H7IA 1PK3A 4UQGA 3HKZC 3NTUA 4RQ0A 4C8LA 3PSIA 1V97A 2YMMA 3KKAC 2BGWA 2R8JA 8ICBA 1JROA 9ICWA 2DBYA 5AI8A 2BKEA 3HKZF 3A0HU 5ALVA 3MGHA 4M9NA 1T7PA 2GWSA 2YTUA 4F91B 5FP0A 3K1RB 3HT3A 2FE9A 3T5KA 2Y9TA 2E8MA 3TAQA 4C4TA 5KFBA 3C29A 5GTIU 5C5JA 2Z7JA 2OM6A 2LHTA 3NRZA 1KLNA 3TADA 3NGDA 2W43A 5ALPA 8ICFA 4Y2JA 2WF7A 2KOBA 3RBDA 1K1QA 1VLBA 5EE0A 9ICRA 5AKGA 5L1JA 3T5HA 2B0CA 1Q3VA 9ICIA 4P2HA 4EYIB 1U49A 1K1SA 3ZI4A 2RP5A 1COKA 2ISPA 4B9SA 5J0UA 5KFXA 1ECWA 2KKVA 1TK8A 3MR2A 1JALA 4YQWA 2DWQA 2ZUBA 4DL3A 4ED8A 1KKXA 5ALZA 1NI3A 4ED2A 4JMUA 9ICEA 4QZDA 5ALSA 3BQ0A 1FO4A 2YQEA 3M7DA 5AKEA 2HBKA 3RJGA 1ZQWA 4LZDA 3C23A 7ICOA 1B22A 4GC7A 2BCVA 1WG8A 4F5NA 4QJFB 2CPRA 3RJIA 4RQ7A 2PXIA 2FJ6A 5ALHA 3Q8KA 2MU2A 2F44A 4LJXA 1XC9A 2EZYA 1ZQVA 5IILA 4DEZA 1BNPA 5DBBA 3FC4A 3ED5A 9ICTA 2HHVA 1O08A 1D8BA 4RU9A 8ICYA 4EX7A 1SZHA 7ICQA 1K5OA 5L1MA 4YXMA 5F9NA 3TANA 2QARA 5ALQA 3QNMA 1T3NA 3QXGA 4R64A 2VKQA 2LYBA 3LWMA 1JXLA 2VA3A 4R8UB 3EUB2 1SIJA 2EAPA 4EEKA 1QLNA 1IXRA 2JHDA 2LKYA 1PUZA 3BJYA 2F8KA 1AROP 4LVSA 2Y1JA 2E3TA 2GO7A 4RNMA 4PJ0U 3PVXA 1XU4A 4PGXA 3PSFA 5HMLA 3MBYA 4BUGA 1TAUA 5CRXA 4I2AA 1M6YA 4IR9A 4M0AA 5CR0A 1S10A 2XIDA 1X9WA 3C1ZA 2J6UA 1LVHA 3RAQA 2JH7A 1KEJA 2EANA 4RQ6A 3LWLA 2W9AA 1TK5A 4UARA 4AYBF 4DWIA 2RRDA 3GV7B 2V9WA 5AIAA 2VIXA 2MAXA 5DBAA 5KFLA 2ATLA 4G9BA 4BXOA 3DDHA 5DGBA 3RRGA 3VC8A 2KNJA 5AKZA 3KHGA 2C28A 3GILA 1WYGA 3BDPA 1L3SA 1MQ2A 4JWNA 4M04A 3SAFA 4E0DA 1SKSA 2OWOA 5JTIA 2HBLA 5DDYA 2HCFA 2WF5A 4J03A 1DGSA 3SR6A 2D8CA 1NKEA 1L3UA 5ALTA 1ZQQA 3N4MB 3GQCA 5JUMA 4DCCA 3IG8A 5DLGA 5AKYA 2HOIA 2G5IB 4ZOHC 5DB6A 4KLOA 4P0QA 7ICFA 3JPSA 3AMZA 1ZQZA 3N7PD 3C2MA 1T8EA 3ZDBA 8ICAA 3F2CA 4HAIA 3Q8PB 2DUYA 1NZBA 5EE9A 3M8SA 1T4GA 2ALZA 1IM4A 3B0YA 2W9MA 2W11A 1KL9A 8ICHA 5AK3A 2ODGA 3IHQB 5KFDA 5HNKA 4DOBA 3RH5A 4YR0A 3R9KA 5J2GA 3Q8MA 2ZIXB 3RJFA 1L8LA 4PHDA 4QZGA 4QWBA 5D49A 4JUZA 3TFSA 3S6JA 2H5XA 4ECQA 9ICUA 2DFLA 4MF8A 1UA1A 8ICWA 3IV6A 4J9KA 2JV3A 2Y9UA 3GV8B 5AHXA 3H8JA 5J2JA 5F9LA 2I5HA 2NRWA 9ICHA 5KFYA 5CHGA 5EWFA 1HIWA 4ECWA 3UXPA 8ICZA 2WB1F 2UVRA 4RQ1A 2C2RA 2BPFA 4M9JA 5CWRA 4UB1A 4I2EA 2B21A 5J0WA 1UCVA 4QZEA 4O3MA 1A0PA 2NO4A 1ZQXA 5ALMA 4HYKA 4FZNA 1LV5A 5KG4A 4Y2UA 4PPXA 4ED1A 1S8OA 3QYPA 3JPQA 3H8SA 4F3OA 4QNLA 1ZQGA 8ICJA 3EZ5A 1RXVA 7ICMA 2OH2A 5ALNA 5ALFA 2AQ0A 3LVWA 3FYHA 4RQMA 4MEXA 2KJ8A 1XS9D 5KG0A 5A0LA 4Y2SA 3SQIA 1Y88A 1QSSA 5KTQA 3B9JA 4A8EA 5DDMA 3D6JA
chains in the Genus database with same CATH topology
2EAPA 2FE9A 2K60A 2Y9TA 2GLEA 2E8MA 2E8NA 5J8YA 2F8KA 2EAMA 4PZOA 2E8OA 2LMRA 4NL9C 3TADA 5JU5A 3KKAA 1B4FA 2QB0A 1LKYA 1COKA 2EAOA 3TADC 4MHVA 1SXEA 1X40A 2DKXA 2QB1A 1SXDA 3BS5B 5J8YC 4NL9A 3SEIA 2JV3A 1V38A 2Y9UA 3BS5A 2ESEA 1KW4A 2DL0A 1UQVA 2EANA 3HILA 3IDWA 1X9XA 1OXJA 4PZNA 1WWVA 2LPEA 2F3NA 5KNIA 1SV4A 1RG6A 2K4PA 2KIVA 4IS7A 1F0MA 3BS7A 3TACB 1OW5A 1LKYB 1UCVA 1PK1B 2KE7A 1SGGA 1WWUA 1SV0A 2ES6A 5F3XB 2F44A 5JTIA 3H8MA 3SENA 2D8CA 2QKQA 1V85A 3BQ7A 2L5YA 4NJ8A 2QARB 2B6GA 1X66A 4RQNA 1PK1A 5JRTA 1JI7A 2D3DA 1PK3A 4RQMA 2KSOA 5L1MA 3KKAC 2QARA 1SV0C 1DXSA 2KG5A 2KSOB 2QB0B 2KMDA 2E8PA 2YTUA 1Z1VA 2DKZA 1B0XA 3K1RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EAP A;  2FE9 A;  2K60 A;  2Y9T A;  2GLE A;  2E8M A;  2E8N A;  5J8Y A;  2F8K A;  2EAM A;  4PZO A;  2E8O A;  2LMR A;  4NL9 C;  3TAD A;  5JU5 A;  3KKA A;  1B4F A;  2QB0 A;  1LKY A;  1COK A;  2EAO A;  3TAD C;  4MHV A;  1SXE A;  1X40 A;  2DKX A;  2QB1 A;  1SXD A;  3BS5 B;  5J8Y C;  4NL9 A;  3SEI A;  2JV3 A;  1V38 A;  2Y9U A;  3BS5 A;  2ESE A;  1KW4 A;  2DL0 A;  1UQV A;  2EAN A;  3HIL A;  3IDW A;  1X9X A;  1OXJ A;  4PZN A;  1WWV A;  2LPE A;  2F3N A;  5KNI A;  1SV4 A;  1RG6 A;  2K4P A;  2KIV A;  4IS7 A;  1F0M A;  3BS7 A;  3TAC B;  1OW5 A;  1LKY B;  1UCV A;  1PK1 B;  2KE7 A;  1SGG A;  1WWU A;  1SV0 A;  2ES6 A;  5F3X B;  2F44 A;  5JTI A;  3H8M A;  3SEN A;  2D8C A;  2QKQ A;  1V85 A;  3BQ7 A;  2L5Y A;  4NJ8 A;  2QAR B;  2B6G A;  1X66 A;  4RQN A;  1PK1 A;  5JRT A;  1JI7 A;  2D3D A;  1PK3 A;  4RQM A;  2KSO A;  5L1M A;  3KKA C;  2QAR A;  1SV0 C;  1DXS A;  2KG5 A;  2KSO B;  2QB0 B;  2KMD A;  2E8P A;  2YTU A;  1Z1V A;  2DKZ A;  1B0X A;  3K1R B; 
#chains in the Genus database with same CATH topology
 2M9N A;  4NM2 A;  4ECU A;  3N97 B;  2JRZ A;  5ALX A;  4M6W B;  7ICE A;  2C22 A;  2KD1 A;  2F1H A;  3PX6 A;  7ICP A;  3E58 A;  8ICS A;  4PZO A;  2YMP A;  7ICG A;  4NL9 C;  4ECT A;  1XSP A;  4QZB A;  4Z6D A;  4YFK A;  1U48 A;  4QIW C;  5J0S A;  3M6Z A;  1B4F A;  9ICL A;  1D9F A;  8ICV A;  5KFR A;  4C80 A;  4JV0 A;  1TAM A;  4B6J A;  3PMN A;  2NRZ A;  1NKC A;  2J6T A;  3OJS A;  2BQR A;  2ESE A;  4GXI A;  4FE3 A;  4F2R A;  1UQV A;  2ZJA A;  1KFS A;  1S9F A;  3AQE A;  4DSK A;  2ASD A;  4NV0 A;  3C5G A;  3SMV A;  5E79 U;  1ZQC A;  4B9N A;  2J6S A;  4CF4 A;  3TAR A;  4KLS A;  4JK1 A;  2I1Q A;  9ICV A;  4I2J A;  2D6F C;  3QEA Z;  1J2N A;  1L7P A;  8ICL A;  5AI6 A;  4QWD A;  4KLJ A;  5AK5 A;  3WK8 A;  2PMZ C;  2KZM A;  1L3T A;  4MF2 A;  4F4X A;  4I2D A;  1RXW A;  2OEH A;  4ECV A;  4K4I A;  1UPH A;  1Z4N A;  1Z19 A;  4C8N A;  4BGD A;  3GII A;  2R18 A;  2E1E A;  1FFV A;  3RFA A;  3PO5 A;  2BPG A;  2AHO B;  3O0F A;  4QWC A;  5ALO A;  2W7O A;  7ICL A;  2KHQ A;  5DQH A;  2RDI A;  1YZ6 A;  4UB3 A;  4UAZ A;  3RB4 A;  3NVW A;  2W8K A;  3I1Y A;  9ICG A;  4US9 A;  8ICU A;  2E8P A;  1COO A;  3UMG A;  4JB3 A;  4C4R A;  3ISC A;  2CN1 A;  1NKB A;  2E8N A;  2V4R A;  5B66 U;  5CEH A;  2F1I A;  4US8 A;  4TQR A;  5AM1 A;  5DGA A;  3WK6 A;  7ICK A;  1YZ7 A;  4O3O A;  1BPD A;  4OJ5 A;  4YR2 A;  9ICF A;  4OJO A;  5AKX A;  4ELT A;  4YXJ A;  1ZQO A;  4CRX A;  3ETR A;  3MFI A;  4J9M A;  3BS5 A;  4Z6F A;  3ZDA A;  2MUT B;  3SI8 A;  4UW9 A;  2ZIW B;  5KFE A;  1KRP A;  1ZD4 A;  1RM6 C;  4EBE A;  2KZZ A;  1SL2 A;  4Y2R A;  1NZP A;  1HUZ A;  3SAG A;  1PVR A;  8ICK A;  2AH5 A;  5J29 A;  1X9M A;  4F5R A;  3EPG A;  2ES6 A;  4KN7 A;  1PVP A;  3V7L A;  4NWI A;  2HMX A;  1ZQU A;  3C28 A;  2ZIV B;  3Q8L A;  3WK5 A;  3PNC A;  5KFI A;  3TFR A;  1XNS A;  3F5E A;  3RJJ A;  9ICQ A;  5IIN A;  3OSP A;  3I28 A;  3GV5 B;  4MFC A;  1P7D A;  2H3I A;  4X5V A;  1SKR A;  4R63 A;  4KLH A;  2KSO A;  2KJ5 A;  4F5P A;  4GLX A;  5HHI A;  4JWM A;  4ELU A;  2JGA A;  1RYR A;  2JZB A;  4EX6 A;  4RT2 A;  2A1A A;  2BDP A;  1Z1V A;  3PW5 A;  3E0F A;  3UM9 A;  2F2A B;  3BQ1 A;  4KLU A;  1U9L A;  4PHA A;  4FZM A;  2YML A;  4QWE A;  2UVW A;  1SL0 A;  3V6J A;  4UAY A;  3THV A;  2IBK A;  5JU5 A;  1QQ7 A;  3KKA A;  3KHL A;  5DG8 A;  2JH1 A;  3C2K A;  4XA5 A;  5DLF A;  4KLD A;  1X40 A;  5EWE A;  5J2E A;  3HJE A;  5G5G A;  4IQW A;  4U7C A;  3L3F X;  1U4B A;  5CP2 A;  7ICH A;  5EWG A;  4DFJ A;  4C4S A;  4DL4 A;  3JPT A;  1OXJ A;  1ZQK A;  3JPR A;  5KG3 A;  3RJK A;  2F3N A;  4KLG A;  3NVV A;  3PW4 A;  3CP8 A;  4I2G A;  3F2D A;  3AEV A;  3D2Q A;  4TQS A;  2KE7 A;  2K8B B;  4F50 A;  2F8L A;  2R8K A;  1CRX A;  2YY6 A;  5IIJ A;  4RPX A;  4M6W A;  2UVU A;  2OYY A;  2YB1 A;  4QZF A;  3PR4 A;  2PFQ A;  4J9Q A;  1SL1 A;  4FZL A;  2ASL A;  1IIP A;  5CJ7 A;  5J0O A;  3RF9 A;  1JI7 A;  4NLZ A;  5KG5 A;  2W9B A;  2Y0S F;  2W03 A;  5H2F U;  1QSY A;  2K4I A;  4C7Y A;  5KFG A;  5AK6 A;  7ICU A;  3OGU A;  2IOH A;  4Q8E A;  5AKJ A;  3SYZ A;  1NK9 A;  5IIM A;  4J9O A;  3QUB A;  2C2E A;  2HI0 A;  1S0O A;  2HSZ A;  4TUS A;  3CRX A;  1BPB A;  1J97 A;  2K60 A;  4I2C A;  5J8Y A;  2IOF A;  3LDA A;  5KL8 B;  2NRV A;  3MR6 A;  1D9D A;  5KFH A;  3KBB A;  4QZC A;  2K4H A;  2KIW A;  4NLG A;  1ZJN A;  1NOM A;  3NVY A;  3H8W A;  3RJE A;  3BS5 B;  5J2D A;  3SZ2 A;  2FPL A;  5KG6 A;  5DKW A;  4KLQ A;  2WF8 A;  3OHA A;  5B5E U;  2XCP A;  4CE6 A;  4QW9 A;  2M0N A;  2ZIU B;  1TK0 A;  9ICA A;  4I28 A;  2HHU A;  1A6S A;  5ALR A;  4Q44 A;  1OUQ A;  4RPY A;  3MAB A;  1N62 A;  5AK4 A;  1RG6 A;  2K4P A;  2W9B B;  2KK0 A;  1S97 A;  5EOZ A;  4I2F A;  1Z3E B;  3RAX A;  1JN3 A;  1NK7 A;  2PFO A;  4KIT B;  3AU2 A;  3H0M B;  5BOM A;  1ZQB A;  4P4P A;  3AM9 A;  4DQQ A;  4O3N A;  1KTQ A;  1L7M A;  4CDG A;  4DO9 A;  3SV3 A;  2I6X A;  3ETL A;  2ZUD A;  3VCB A;  5DB7 A;  8ICP A;  5KT7 A;  1ED1 A;  4UAW A;  4FO6 A;  2KN7 A;  1SB3 C;  4OJ6 A;  2HBJ A;  3H40 A;  1A77 A;  2G0A A;  1KDH A;  2PKE A;  3HPO A;  2HDO A;  5AKH A;  3MGI A;  1MN8 A;  5HR7 A;  1FFU A;  3HWT A;  4ED7 A;  2HOQ A;  2KVS A;  5HHH A;  1NK4 A;  2HVH A;  1XO1 A;  2CRX A;  9ICS A;  3N28 A;  3WKD A;  4F2S A;  4IC9 A;  4B9T A;  2DKZ A;  2ZIV A;  1DK2 A;  2O6K A;  2KFN A;  4YD2 A;  3JPO A;  3QZ8 A;  3NS1 A;  2PI5 A;  4Y2T A;  1JIH A;  2BQ3 A;  4M47 A;  3Q8S B;  5J2A A;  1QTM A;  4EZ6 A;  9ICO A;  4GFJ A;  4DOC A;  1RPL A;  3FAH A;  1L7O A;  2BCU A;  2Y1I A;  2QB0 A;  3IM1 A;  3F5A A;  5KFO A;  4JV1 A;  2KKP A;  1ZET A;  2HBM A;  3C5F A;  2FPK A;  5KFU A;  1ZQJ A;  5J2K A;  1KW4 A;  3K1Z A;  3PR5 B;  1L8O A;  7ICS A;  1IV8 A;  1SWW A;  2MRL A;  4OJP A;  2ASJ A;  4F5O A;  1TKD A;  4IS7 A;  5DG9 A;  4EBD A;  4M9G A;  4QZA A;  1T94 A;  4IQV A;  3QX7 A;  4IR1 A;  4RQ2 A;  1QQ5 A;  3ZDC A;  1HUO A;  4QZI A;  4UBC A;  3QE9 Y;  4DSJ A;  5L9X A;  3K75 D;  4BWJ A;  3WU2 U;  5JRT A;  4BXO B;  2WHE A;  4RT3 A;  3PW0 A;  2YB4 A;  4YN4 A;  4U6P A;  4KLT A;  1D8L A;  4DS5 A;  1Q8K A;  2A19 A;  1URJ A;  4F72 A;  5KFP A;  1ZQI A;  2IOF K;  2JEJ A;  3RBE A;  3PX4 A;  2KG5 A;  2YMQ A;  1XSL A;  2IA6 A;  3CW2 C;  1BPX A;  8ICM A;  3QU7 A;  4F8R A;  5J2C A;  4JV2 A;  3HX0 A;  2NRX A;  2DPJ A;  4O3Q A;  2P6R A;  2OXO A;  3PZP A;  2XI9 A;  3KHH A;  1O03 A;  4BDP A;  3AU6 A;  1ZQS A;  1JMS A;  2DQN B;  5AKI A;  1ZQF A;  2UVV A;  4NLB A;  3N7R C;  4O5C A;  2WTF A;  1S77 D;  3MR3 A;  1UT8 A;  5KFQ A;  7ICI A;  5KL1 B;  4NLK A;  4Q8F A;  2FLP A;  2VAN A;  2ZXH A;  2KZ3 A;  2DL0 A;  2LYA A;  4UBB A;  1B43 A;  2EQY A;  8ICQ A;  4OJL A;  4DLE A;  2A1J B;  3A0B U;  4XQ8 A;  3UQ0 A;  2LPE A;  3OPX A;  4DF4 A;  1IG6 A;  2Y0S C;  4RNO A;  5HP4 A;  3AUO A;  3PSP A;  2KTQ A;  3UPQ A;  4I2H A;  2FLL A;  1HJP A;  1WUD A;  9ICM A;  5DQG A;  5KFC A;  1WWU A;  3IN5 A;  3MGV A;  7ICN A;  4KX5 A;  2YN4 A;  1V85 A;  1ZQP A;  2B6G A;  9ICK A;  4ED3 A;  4GIB A;  2D3D A;  2H3F A;  4K4G A;  3RB6 A;  1TVA A;  3QU2 A;  5III A;  4O0I A;  3EW9 A;  3WKE A;  1RYU A;  7ICR A;  2RLT A;  2W55 A;  4KLM A;  3CYM A;  1ZQN A;  4O3S A;  8ICR A;  5J0X A;  3M9N B;  2GLE A;  1ZD2 P;  3J81 j;  3G6Y A;  4J9L A;  1LB2 B;  5T14 A;  3RR8 A;  2E8O A;  3GIJ A;  3PML A;  1Z00 A;  1PZN A;  2V4Q A;  2IMW P;  2KJ9 A;  5KFK A;  3QUC A;  2DF4 B;  4BX9 C;  3QU5 A;  1U47 A;  2EZZ A;  1ZRM A;  1BVS A;  5AM2 A;  1ZQL A;  4ECZ A;  4Y2Y A;  4MHV A;  5D4B A;  4RPZ A;  1FEZ A;  2QB1 A;  3JPP A;  2AJQ A;  2ZXI A;  3KHR A;  2W3S A;  1BNO A;  3AL0 B;  5ALG A;  9ICX A;  1EXN A;  1Q46 A;  3SAH A;  4CGZ A;  2BR0 A;  2XIC A;  3ICX A;  2EDU A;  4XRH A;  2VA8 A;  4TUR A;  1RYS A;  5KFF A;  2KEY A;  4O5K A;  7ICT A;  1AQ6 A;  1QQ6 A;  5DG7 A;  4KMU A;  4UB4 A;  4M9L A;  3KOO A;  8ICG A;  2ZG6 A;  1S0V A;  2NYV A;  2FDR A;  3D2S A;  2W04 A;  1HEK A;  1S0N A;  1SZP A;  3KZI U;  5ALY A;  3FDS A;  2R8G A;  1NK5 A;  5IIO A;  3AN1 A;  1F44 A;  2H3V A;  4M2Y A;  2QKQ A;  4NJ8 A;  3C1Y A;  3LK9 A;  2W8L A;  2ZIU A;  5BPC A;  1ZQD A;  2JZB B;  4P0Q B;  3RH6 A;  4GXK A;  4CF3 A;  4NXZ A;  3KZX A;  1SV0 C;  3BZC A;  3M1Y A;  2KSO B;  3GU3 A;  5KG2 A;  8ICI A;  3RB0 A;  1NJY A;  3SD7 A;  1RQN A;  2BZF A;  4YMO A;  3EPI A;  1Z1B A;  3UMC A;  2XO7 A;  3PW7 A;  3DEE A;  2F76 X;  5CA7 A;  4EEL A;  8ICN A;  2GH1 A;  1BGX T;  3QUT A;  5J2H A;  2WFA A;  4Y2X A;  2NO5 A;  4DL5 A;  5ALK A;  2BCQ A;  1MQ3 A;  3KTQ A;  2K8A A;  4FBT A;  4UB5 A;  4AYB C;  3V72 A;  1WCL A;  1SXE A;  1X6I A;  1V38 A;  3CNH A;  1N56 A;  3H0R B;  1N2X A;  2E1F A;  4USA A;  1J2M A;  2LBO A;  1X9X A;  2ZTD A;  5EE1 A;  3BQ2 A;  4O9M A;  1WWV A;  2MSN A;  5KAF U;  3ORY A;  5L1L A;  1U45 A;  5KNI A;  2ZUC A;  1T3Q A;  1N48 A;  4DQS A;  9ICN A;  3BS7 A;  1RDF A;  4Z6C A;  5K4L A;  4MEY A;  4ZH4 A;  3TQ1 A;  5CB1 A;  5F3X B;  4C8M A;  2WAQ C;  2KHV A;  3QUQ A;  3T5J A;  2HHX A;  3WKB A;  2L5Y A;  2DPI A;  2OHF A;  4RUC A;  8ICE A;  1N63 A;  4RQ8 A;  1DRG A;  4I2B A;  1JUD A;  3V6K A;  5J0Y A;  2AXT U;  2K8C B;  4OO1 J;  1N60 A;  3G6X A;  1Z4O A;  2P35 A;  5DBC A;  4GXJ A;  7ICJ A;  1DK3 A;  2KIC A;  1N5X A;  4PGY A;  3HW8 A;  4P4O A;  2KMD A;  9ICC A;  3V6H A;  1CUK A;  5L1I A;  2WF9 A;  4F4Z A;  1B0X A;  4ECY A;  4Q45 A;  3RR7 A;  1FIQ A;  4CNQ A;  4YR3 A;  2KFZ A;  5ALI A;  2IHN A;  4EYH B;  3BZK A;  2EAM A;  4KLE A;  4B9V A;  2BQU A;  2BHN A;  4IQU A;  1X6J A;  4Y2Q A;  3D2N A;  2KV2 A;  1KQQ A;  1N61 A;  3WKA A;  2DKX A;  1X9S A;  1KN5 A;  4F71 A;  4QZ9 A;  1DOQ A;  4YG2 A;  3MR5 A;  3SEI A;  3ISB A;  8ICO A;  5AI9 A;  4QIW F;  1QH9 A;  4O3R A;  5ALU A;  5ALJ A;  4IRK A;  1Q3U A;  8ICC A;  1ZQY A;  4C0Z A;  3B0X A;  3HRD D;  5L1K A;  2I9G A;  4DLG A;  1DGJ A;  2DGZ A;  4I29 A;  3GZF A;  1H38 A;  1XWL A;  3L4P A;  1SKW A;  1SV4 A;  1PVQ A;  4YP3 A;  1F0M A;  1JXE A;  1QCK A;  2HHQ A;  3KD3 A;  2G5H B;  3BQT A;  1SGG A;  2ZTC A;  3TKA A;  1TFR A;  2EZX A;  4DQP A;  5EE3 A;  4RQ3 A;  3K4G A;  3H8M A;  3H4D A;  3SEN A;  4J9P A;  3EWA A;  3NRW A;  4YCX A;  4F4K A;  1NK0 A;  2VJ5 A;  2WB1 C;  4F92 B;  3Q8Q B;  5ALE A;  4DSI A;  1QSL A;  2JXJ A;  2YX8 A;  1ZD5 A;  3ONN A;  1WCN A;  4PL2 A;  2FMP A;  8ICT A;  3V7J A;  5KT5 A;  2BDU A;  5J0Q A;  4YVZ A;  2QB0 B;  5AI5 A;  4NLC A;  1V9P A;  2C2D A;  4RZR A;  2AU0 A;  5J0T A;  5KFA A;  5BOL A;  1ZXI A;  1ZD3 A;  3HP6 A;  1A76 A;  3M6K A;  4F4Y A;  1D8Y A;  1ZQH A;  4Z6E A;  5DB8 A;  3MFH A;  1ZQT A;  4XUS A;  1NK6 A;  4F5Q A;  3UMB A;  1NNL A;  1LKY A;  4P0P B;  3PO4 A;  3TAD C;  3Q8R B;  5KFZ A;  2RQ5 A;  3C2L A;  4J9S A;  2XY7 A;  3WK9 A;  4ICA A;  3JPN A;  1C7Y A;  3T79 A;  2ZIW A;  2OCE A;  2KP7 A;  3LYS A;  2HHT A;  2MUT A;  4DOA A;  3IDW A;  1BPE A;  3GFK B;  4G3I A;  4EBC A;  4IL6 U;  4B9M A;  4OD0 A;  1VDV A;  1L5U A;  3LVV A;  1ZQE A;  3OTQ A;  2EH9 A;  3OSN A;  2AGP A;  2XCA A;  4DFP A;  1ZQM A;  1TV9 A;  3ZD8 A;  4PHP A;  4K4H A;  5IIK A;  3PST A;  9ICP A;  1SV0 A;  3UXN A;  2R8H A;  3PW2 A;  4DF8 A;  3TAP A;  4J9N A;  4Q43 A;  5KFW A;  5ALL A;  2CXY A;  2FMQ A;  4DFD A;  3ZD9 A;  2QAR B;  2PFN A;  3PY8 A;  2H3Q A;  1X66 A;  3PV8 A;  3FM9 A;  4FS2 A;  1C20 A;  1GO3 F;  3QU4 A;  3H4B A;  5AI0 A;  2ZTE A;  4WJ3 B;  1TE2 A;  2G07 A;  4B9U A;  5J2B A;  3SV4 A;  3PX0 A;  4PH5 A;  5AM3 A;  4EEY A;  2P66 A;  5KFJ A;  2RHF A;  3N7S C;  3C21 A;  4TUQ A;  2R8I A;  4RNN A;  4F93 B;  3ZDD A;  4PGQ A;  1TAQ A;  4DFM A;  2LYH A;  3RJH A;  4ED0 A;  5KFM A;  4DL2 A;  4Y2P A;  2LMR A;  5AM5 A;  1Z00 B;  4O3P A;  5KAI U;  5D46 A;  2AGQ A;  2A1J A;  1RQL A;  2BCR A;  3QZ7 A;  4FFD A;  2RDJ A;  1ZJM A;  2IHM A;  5J0R A;  1X2I A;  4M9H A;  9ICB A;  2H3Z A;  1SXD A;  1KBU A;  7ICV A;  4NL9 A;  3MDA A;  2FLN A;  4DQI A;  3E2E A;  3HIL A;  1UA0 A;  5TIS U;  2A3V A;  2PFP A;  1XSN A;  2VJ4 A;  2XGQ A;  4KTQ A;  2MA1 A;  1S76 D;  4UAT A;  5G5H A;  3F2B A;  2LI6 A;  4YMN A;  4KN4 A;  4CF5 A;  1OW5 A;  2GOL A;  1PK1 B;  4PHE A;  3M9O B;  4AP9 A;  4UB2 A;  2BCS A;  3I76 A;  4B9L A;  1KSP A;  4KX3 A;  5KFN A;  2Q4T A;  4FBU A;  3QEB Z;  2XY6 A;  4QW8 A;  4EZ9 A;  2XC9 A;  3OHB A;  2JR5 A;  2BPC A;  2F1J A;  4BWM A;  3F53 A;  4P4M A;  3RH4 A;  2G06 A;  3WK4 A;  4KLL A;  5AIC A;  5KG7 A;  2XY5 A;  4DSE A;  3IRU A;  2XGP A;  2FPM A;  2WF6 A;  4LZG A;  2NRT A;  2HHS A;  2Q0Z X;  5DQI A;  2WAQ F;  3GIM A;  2XVT A;  3NVZ A;  1KFD A;  2W9C A;  5AM0 A;  1XO0 A;  1NJX A;  4TUP A;  5HR6 A;  2JEG A;  1DXS A;  2HVI A;  1MC8 A;  2LM1 A;  2PMZ F;  3GDX A;  1ZQR A;  4DL7 A;  1F5S A;  3G6V A;  3ALR A;  4CCH A;  2ZIX A;  4DS4 A;  2P6U A;  2AQ4 A;  5C0Y A;  3RRH A;  1UHU A;  5TZV A;  2G08 A;  4Y2V A;  3EYZ A;  4C8K A;  2ZJ5 A;  1ZOL A;  4I27 A;  1X42 A;  1MSW D;  4UAV A;  4NLN A;  9ICJ A;  3M9M B;  4DL6 A;  3WK7 A;  8ICX A;  1MA7 A;  5DB9 A;  2ISO A;  5J8Y C;  5KT4 A;  3M8R A;  1KFT A;  4UB8 U;  3RB3 A;  2QLT A;  3IP4 B;  4UB6 U;  5KT2 A;  1BPY A;  4C8O A;  4P0P A;  2JEI A;  3V7K A;  5J0P A;  4DSL A;  4PZN A;  4ECR A;  3TI0 A;  2FI1 A;  3IG5 A;  4C7Z A;  2KIV A;  2PI4 A;  2VA2 A;  1S5L U;  3TAC B;  2E5S A;  1YT3 A;  1ZQ1 C;  4QZH A;  3ZDE A;  3UQ2 A;  5AI4 A;  2W3R A;  4GC6 A;  5HMM A;  5KT6 A;  3RTV A;  4KMO B;  4ACO A;  3ISD A;  4RQ5 A;  3L5K A;  2NV3 A;  1L6N A;  4BJQ A;  2ZJ8 A;  1PK1 A;  4QWA A;  2HOF A;  4EEN A;  4O5E A;  5AKL A;  4F4W A;  2JEF A;  1SWV A;  1CI4 A;  2HHW A;  3UXO A;  1RZT A;  2LM4 A;  4FS1 A;  4DFK A;  2N1R A;  1L3V A;  3OJU A;  1N5W A;  4IQT A;  4OCZ A;  3DV9 A;  3T5L A;  1ZYQ A;  2HW3 A;  1S0M A;  1NK8 A;  1CEZ A;  2KVC A;  3WKC A;  1VJ5 A;  1ZQA A;  4ED6 A;  5KG1 A;  4QZ8 A;  5GTH U;  5J2F A;  5KT3 A;  4R8U A;  5AIB A;  4KLI A;  2JMG A;  4PL1 A;  4DQR A;  1NJZ A;  1JRP A;  1UT5 A;  2K4E A;  5KFS A;  2EAO A;  4ECS A;  4UAU A;  3QU9 A;  2F77 X;  3T3F A;  2G09 A;  4ELV A;  4I2I A;  3MDC A;  5KFV A;  3NAS A;  4NY8 A;  3U26 A;  2W7P A;  4MFF A;  4NM1 A;  5AM4 A;  1BPZ A;  4IRC A;  5ALW A;  4KLF A;  3H0L B;  4MFA A;  4R65 A;  4R66 A;  3NUQ A;  4DSF A;  5J2I A;  1LKY B;  5AKK A;  2FMS A;  1JX4 A;  4YD1 A;  4IRD A;  3GIK A;  3MC1 A;  4UAS A;  4RQ4 A;  4J9R A;  2K89 A;  4YMM A;  5ALD A;  1NJW A;  4ECX A;  3KFU F;  1ZRN A;  3BQ7 A;  2W9C B;  1L7N A;  2W54 A;  4RQN A;  5KFT A;  2AGO A;  3AQF A;  4RUA A;  3H7I A;  1PK3 A;  4UQG A;  3HKZ C;  3NTU A;  4RQ0 A;  4C8L A;  3PSI A;  1V97 A;  2YMM A;  3KKA C;  2BGW A;  2R8J A;  8ICB A;  1JRO A;  9ICW A;  2DBY A;  5AI8 A;  2BKE A;  3HKZ F;  3A0H U;  5ALV A;  3MGH A;  4M9N A;  1T7P A;  2GWS A;  2YTU A;  4F91 B;  5FP0 A;  3K1R B;  3HT3 A;  2FE9 A;  3T5K A;  2Y9T A;  2E8M A;  3TAQ A;  4C4T A;  5KFB A;  3C29 A;  5GTI U;  5C5J A;  2Z7J A;  2OM6 A;  2LHT A;  3NRZ A;  1KLN A;  3TAD A;  3NGD A;  2W43 A;  5ALP A;  8ICF A;  4Y2J A;  2WF7 A;  2KOB A;  3RBD A;  1K1Q A;  1VLB A;  5EE0 A;  9ICR A;  5AKG A;  5L1J A;  3T5H A;  2B0C A;  1Q3V A;  9ICI A;  4P2H A;  4EYI B;  1U49 A;  1K1S A;  3ZI4 A;  2RP5 A;  1COK A;  2ISP A;  4B9S A;  5J0U A;  5KFX A;  1ECW A;  2KKV A;  1TK8 A;  3MR2 A;  1JAL A;  4YQW A;  2DWQ A;  2ZUB A;  4DL3 A;  4ED8 A;  1KKX A;  5ALZ A;  1NI3 A;  4ED2 A;  4JMU A;  9ICE A;  4QZD A;  5ALS A;  3BQ0 A;  1FO4 A;  2YQE A;  3M7D A;  5AKE A;  2HBK A;  3RJG A;  1ZQW A;  4LZD A;  3C23 A;  7ICO A;  1B22 A;  4GC7 A;  2BCV A;  1WG8 A;  4F5N A;  4QJF B;  2CPR A;  3RJI A;  4RQ7 A;  2PXI A;  2FJ6 A;  5ALH A;  3Q8K A;  2MU2 A;  2F44 A;  4LJX A;  1XC9 A;  2EZY A;  1ZQV A;  5IIL A;  4DEZ A;  1BNP A;  5DBB A;  3FC4 A;  3ED5 A;  9ICT A;  2HHV A;  1O08 A;  1D8B A;  4RU9 A;  8ICY A;  4EX7 A;  1SZH A;  7ICQ A;  1K5O A;  5L1M A;  4YXM A;  5F9N A;  3TAN A;  2QAR A;  5ALQ A;  3QNM A;  1T3N A;  3QXG A;  4R64 A;  2VKQ A;  2LYB A;  3LWM A;  1JXL A;  2VA3 A;  4R8U B;  3EUB 2;  1SIJ A;  2EAP A;  4EEK A;  1QLN A;  1IXR A;  2JHD A;  2LKY A;  1PUZ A;  3BJY A;  2F8K A;  1ARO P;  4LVS A;  2Y1J A;  2E3T A;  2GO7 A;  4RNM A;  4PJ0 U;  3PVX A;  1XU4 A;  4PGX A;  3PSF A;  5HML A;  3MBY A;  4BUG A;  1TAU A;  5CRX A;  4I2A A;  1M6Y A;  4IR9 A;  4M0A A;  5CR0 A;  1S10 A;  2XID A;  1X9W A;  3C1Z A;  2J6U A;  1LVH A;  3RAQ A;  2JH7 A;  1KEJ A;  2EAN A;  4RQ6 A;  3LWL A;  2W9A A;  1TK5 A;  4UAR A;  4AYB F;  4DWI A;  2RRD A;  3GV7 B;  2V9W A;  5AIA A;  2VIX A;  2MAX A;  5DBA A;  5KFL A;  2ATL A;  4G9B A;  4BXO A;  3DDH A;  5DGB A;  3RRG A;  3VC8 A;  2KNJ A;  5AKZ A;  3KHG A;  2C28 A;  3GIL A;  1WYG A;  3BDP A;  1L3S A;  1MQ2 A;  4JWN A;  4M04 A;  3SAF A;  4E0D A;  1SKS A;  2OWO A;  5JTI A;  2HBL A;  5DDY A;  2HCF A;  2WF5 A;  4J03 A;  1DGS A;  3SR6 A;  2D8C A;  1NKE A;  1L3U A;  5ALT A;  1ZQQ A;  3N4M B;  3GQC A;  5JUM A;  4DCC A;  3IG8 A;  5DLG A;  5AKY A;  2HOI A;  2G5I B;  4ZOH C;  5DB6 A;  4KLO A;  4P0Q A;  7ICF A;  3JPS A;  3AMZ A;  1ZQZ A;  3N7P D;  3C2M A;  1T8E A;  3ZDB A;  8ICA A;  3F2C A;  4HAI A;  3Q8P B;  2DUY A;  1NZB A;  5EE9 A;  3M8S A;  1T4G A;  2ALZ A;  1IM4 A;  3B0Y A;  2W9M A;  2W11 A;  1KL9 A;  8ICH A;  5AK3 A;  2ODG A;  3IHQ B;  5KFD A;  5HNK A;  4DOB A;  3RH5 A;  4YR0 A;  3R9K A;  5J2G A;  3Q8M A;  2ZIX B;  3RJF A;  1L8L A;  4PHD A;  4QZG A;  4QWB A;  5D49 A;  4JUZ A;  3TFS A;  3S6J A;  2H5X A;  4ECQ A;  9ICU A;  2DFL A;  4MF8 A;  1UA1 A;  8ICW A;  3IV6 A;  4J9K A;  2JV3 A;  2Y9U A;  3GV8 B;  5AHX A;  3H8J A;  5J2J A;  5F9L A;  2I5H A;  2NRW A;  9ICH A;  5KFY A;  5CHG A;  5EWF A;  1HIW A;  4ECW A;  3UXP A;  8ICZ A;  2WB1 F;  2UVR A;  4RQ1 A;  2C2R A;  2BPF A;  4M9J A;  5CWR A;  4UB1 A;  4I2E A;  2B21 A;  5J0W A;  1UCV A;  4QZE A;  4O3M A;  1A0P A;  2NO4 A;  1ZQX A;  5ALM A;  4HYK A;  4FZN A;  1LV5 A;  5KG4 A;  4Y2U A;  4PPX A;  4ED1 A;  1S8O A;  3QYP A;  3JPQ A;  3H8S A;  4F3O A;  4QNL A;  1ZQG A;  8ICJ A;  3EZ5 A;  1RXV A;  7ICM A;  2OH2 A;  5ALN A;  5ALF A;  2AQ0 A;  3LVW A;  3FYH A;  4RQM A;  4MEX A;  2KJ8 A;  1XS9 D;  5KG0 A;  5A0L A;  4Y2S A;  3SQI A;  1Y88 A;  1QSS A;  5KTQ A;  3B9J A;  4A8E A;  5DDM A;  3D6J A; 
#chains in the Genus database with same CATH homology
 2EAP A;  2FE9 A;  2K60 A;  2Y9T A;  2GLE A;  2E8M A;  2E8N A;  5J8Y A;  2F8K A;  2EAM A;  4PZO A;  2E8O A;  2LMR A;  4NL9 C;  3TAD A;  5JU5 A;  3KKA A;  1B4F A;  2QB0 A;  1LKY A;  1COK A;  2EAO A;  3TAD C;  4MHV A;  1SXE A;  1X40 A;  2DKX A;  2QB1 A;  1SXD A;  3BS5 B;  5J8Y C;  4NL9 A;  3SEI A;  2JV3 A;  1V38 A;  2Y9U A;  3BS5 A;  2ESE A;  1KW4 A;  2DL0 A;  1UQV A;  2EAN A;  3HIL A;  3IDW A;  1X9X A;  1OXJ A;  4PZN A;  1WWV A;  2LPE A;  2F3N A;  5KNI A;  1SV4 A;  1RG6 A;  2K4P A;  2KIV A;  4IS7 A;  1F0M A;  3BS7 A;  3TAC B;  1OW5 A;  1LKY B;  1UCV A;  1PK1 B;  2KE7 A;  1SGG A;  1WWU A;  1SV0 A;  2ES6 A;  5F3X B;  2F44 A;  5JTI A;  3H8M A;  3SEN A;  2D8C A;  2QKQ A;  1V85 A;  3BQ7 A;  2L5Y A;  4NJ8 A;  2QAR B;  2B6G A;  1X66 A;  4RQN A;  1PK1 A;  5JRT A;  1JI7 A;  2D3D A;  1PK3 A;  4RQM A;  2KSO A;  5L1M A;  3KKA C;  2QAR A;  1SV0 C;  1DXS A;  2KG5 A;  2KSO B;  2QB0 B;  2KMD A;  2E8P A;  2YTU A;  1Z1V A;  2DKZ A;  1B0X A;  3K1R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...