2D8CA

Solution structure of the sam-domain of mouse phosphatidyl ceramidecholinephosphotransferase 1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
97
structure length
97
Chain Sequence
GSSGSSGMLSARTMKEVVYWSPKKVADWLLENAMPEYCEPLEHFTGQDLINLTQEDFKKPPLYRVSSDNGQRLLDMIETLKMEHHMEAHKNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphatidylcholine:ceramide cholinephosphotransferase 1
publication title Solution structure of the sam-domain of mouse phosphatidyl ceramidecholinephosphotransferase 1
rcsb
source organism Mus musculus
molecule tags Transferase
total genus 11
structure length 97
sequence length 97
ec nomenclature ec 2.7.8.27: Sphingomyelin synthase.
pdb deposition date 2005-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2d8cA01
2KMDA 2DKXA 2D8CA 2KSOA 5JTIA 1Z1VA 4PZOA 1WWVA 1SXEA 5L1MA 2D3DA 1JI7A 5JRTA 2DL0A 3IDWA 2KG5A 2Y9TA 1F0MA 1DXSA 1X66A 1OW5A 2QB1A 1B0XA 2JV3A 3BS5B 5J8YC 1RG6A 1X9XA 3SENA 1WWUA 1PK3A 2QARA 2EAPA 2QB0A 2YTUA 2DKZA 4NL9C 2ESEA 1KW4A 5J8YA 2Y9UA 1V38A 1PK1B 1COKA 2GLEA 2EANA 2KE7A 4PZNA 1V85A 1SV0C 3SEIA 4RQMA 2ES6A 3BS5A 2KSOB 1B4FA 3H8MA 2E8NA 2LPEA 2F44A 3TADC 2EAMA 5F3XB 2F3NA 2QKQA 2FE9A 2E8OA 2F8KA 3KKAC 3TADA 2LMRA 3TACB 3K1RB 2K60A 1LKYB 4RQNA 4NL9A 3KKAA 2K4PA 1OXJA 4MHVA 5KNIA 2QARB 2EAOA 2QB0B 1SXDA 3HILA 5JU5A 1X40A 1SV0A 1UCVA 2B6GA 4NJ8A 1SV4A 1PK1A 2L5YA 1LKYA 3BQ7A 2E8MA 2E8PA 3BS7A 4IS7A 1SGGA 1UQVA 2KIVA
chains in the Genus database with same CATH superfamily
4DLGA 4PJ0U 1Z1VA 3RJEA 1HJPA 4C4RA 3KHHA 5AKZA 5J2IA 4YMMA 4Y2YA 1KL9A 2PI4A 5L1MA 4XQ8A 2ZTEA 1DK2A 2W7OA 2VA8A 5J0OA 3OGUA 4DL3A 4R8UB 4RUCA 4O3OA 3RBDA 4IQTA 3IP4B 4P0PA 9ICBA 4I28A 2HI0A 1S76D 2VANA 4EBDA 5B5EU 3QNMA 2ESEA 1V97A 3QEBZ 8ICEA 1RYUA 2ZIVB 4B9SA 3N97B 1NK9A 3ZDBA 9ICTA 7ICPA 2W11A 1DGJA 5AKXA 2HBJA 1Z3EB 2PMZC 5L1LA 1BPBA 4DSEA 4KLQA 1L3UA 3C21A 3MR5A 2ZJ5A 2ASDA 2HW3A 2WF6A 5D4BA 2KHQA 3M9OB 4J9LA 3BQ0A 2PKEA 1AQ6A 2NRWA 4JWNA 2I1QA 2XC9A 3PSTA 4DOBA 4DQSA 5J2BA 3S6JA 3RJFA 3UMGA 1M6YA 4JUZA 3PVXA 5J2GA 2L5YA 5D46A 2ZG6A 5J0TA 1CEZA 2HHQA 7ICSA 1N63A 4DL2A 3MC1A 4HYKA 2OHFA 2BCRA 1A0PA 4XUSA 3N7PD 1ED1A 3PR5B 5KFXA 2P6UA 4DO9A 1T94A 1GO3F 1ZQKA 2D3DA 2VA2A 2R8JA 9ICVA 2DL0A 3EPGA 4I2AA 4UB8U 1L7OA 4O3QA 1RPLA 2YMLA 1A76A 4F72A 2OEHA 2FLLA 5J8YC 3GQCA 1C20A 1RG6A 4EEKA 4I2HA 7ICUA 3PSIA 5DG8A 1DGSA 3TAQA 3I76A 2ODGA 4LJXA 4QWCA 2PFNA 4PGYA 2KJ9A 4FZLA 4LZDA 5KFOA 5DB8A 5HR6A 2JRZA 3IRUA 2VIXA 3PX6A 1KEJA 8ICIA 4UB1A 3ISDA 1B4FA 3WK4A 2M9NA 1NK7A 4IRDA 4RNOA 4I2DA 4A8EA 4YP3A 4C4SA 4ECUA 1MSWD 3QUBA 5KG2A 1N60A 3NS1A 2EH9A 3WK5A 2MA1A 1QQ7A 5KFKA 5EE1A 1ZQNA 1SZPA 4RU9A 7ICFA 1D8BA 3WK8A 5TISU 1TV9A 1N48A 1Z4OA 1ZQMA 5KFWA 4UAUA 4KLMA 4OJPA 1TVAA 1XO1A 3ISCA 2R18A 2YY6A 3UQ2A 1CI4A 3SI8A 1PVRA 4TQSA 1KFDA 2AU0A 3WKDA 4ECTA 3BS7A 2QLTA 5KFVA 4J9MA 8ICCA 2IMWP 2I5HA 1B22A 3UMBA 3AM9A 3ONNA 8ICKA 3WK6A 5AKIA 1BPZA 3LK9A 4UB4A 9ICXA 1SXEA 5C0YA 4B6JA 3RRHA 4CGZA 5DLGA 2KICA 8ICVA 3TKAA 2FMQA 2F1JA 4QZ9A 4DL7A 1X66A 5HR7A 1ZETA 4YD2A 2W3SA 2JR5A 3SENA 1WWUA 4DQPA 5TZVA 1KRPA 2K8CB 2P6RA 1ZQDA 2G07A 2YTUA 3MFHA 3Q8QB 5DB9A 3C2KA 1ZQQA 3TFRA 1Z19A 1T8EA 2PMZF 2C2RA 4UB2A 1ZXIA 2Y1JA 2OH2A 5HMLA 4PL1A 1S97A 2R8HA 4DFJA 5IINA 2F44A 1ZQLA 4GXKA 4ECVA 1N5XA 2YMMA 4ECSA 2E8OA 4ZH4A 2GH1A 4G9BA 2BQRA 2F77X 1H38A 2IBKA 4JB3A 4ED1A 1SZHA 5J0XA 2MU2A 2G5HB 1KBUA 5AI8A 4NLBA 3SAGA 4BXOB 1L5UA 2J6SA 2K89A 1JALA 5DG7A 4GC7A 5DGAA 2W9BB 5KL8B 2W8LA 1T4GA 1J2NA 7ICEA 4RQ3A 2A1JB 3UQ0A 4R63A 2KKPA 4YVZA 4I2BA 5ALTA 4RZRA 2KMDA 2ZTDA 4EZ6A 1X9WA 2HBMA 4IQWA 2BKEA 3EW9A 1XS9D 2BQUA 2BZFA 4FO6A 2ZIXB 3IDWA 2AGQA 4KLJA 1WYGA 3TFSA 1KLNA 2KG5A 4NLGA 2XY5A 4Q8EA 2KJ5A 5AHXA 3LVWA 3B0XA 4UAVA 5DBBA 2BCQA 1COOA 1LB2B 1BGXT 2BPGA 5D49A 3MDAA 1V9PA 2QB0A 5KFEA 2AGPA 1N61A 2LYHA 4F91B 3RRGA 4PH5A 1SWWA 4GIBA 1URJA 1S8OA 3L5KA 3D6JA 2KE7A 3RBEA 2HMXA 4C8NA 4RNMA 4IR9A 3JPRA 3UPQA 3M6ZA 3RJIA 3BS5A 5HMMA 3N7SC 3TADC 3TANA 2E1EA 2C2DA 4YMOA 4EZ9A 4J9RA 2JMGA 4U6PA 2ALZA 2YB4A 3BDPA 1DOQA 1L7PA 5KFRA 3AL0B 2IOFK 2LM4A 1ZQUA 9ICGA 4ICAA 3AQEA 4MHVA 5KFIA 2XVTA 4ELTA 4EELA 2KZZA 3UXOA 2XCPA 5KG5A 2Q0ZX 3RF9A 4FS1A 1UCVA 3ZDCA 3C2MA 1NKBA 1SWVA 5KAFU 2HOQA 1NK6A 5CHGA 1RYSA 4JK1A 3R9KA 1U47A 2CXYA 2WF8A 4B9MA 2HHVA 3D2NA 2VKQA 8ICUA 3IV6A 2CPRA 3QUTA 1JI7A 3AU2A 4ECQA 1RXWA 2DF4B 3RAQA 3SQIA 8ICXA 5BOMA 1Q3VA 3CRXA 3K75D 1WCLA 2ZIUB 3BS5B 4DEZA 1YZ7A 4FFDA 4DQRA 4Z6DA 4ECZA 4O5CA 3HKZC 1Y88A 2ZUBA 3B0YA 3E58A 4KN4A 5KFNA 4B9LA 3MGHA 4ZOHC 1XU4A 3H7IA 4DQIA 2W3RA 4Q44A 9ICHA 4R65A 2A1AA 4Y2SA 5JUMA 1X6JA 2KD1A 4UB3A 2AXTU 2KSOB 1ZQSA 2E3TA 1NJWA 3MBYA 5GTHU 4QWAA 2EAMA 3KHRA 2PI5A 3G6YA 1ZQXA 4OO1J 8ICGA 5AI9A 3C1ZA 3TACB 3EWAA 3GV8B 2ZIWA 1JXLA 2BPCA 2O6KA 2NV3A 3WK7A 1TFRA 4R8UA 1ZQJA 1RZTA 3NRWA 5AKLA 2IOHA 4F2RA 4NLKA 2EAOA 1X9MA 1SXDA 8ICWA 8ICJA 9ICLA 4R66A 2KEYA 2H3QA 5ALZA 5ALQA 7ICNA 3KHLA 3FAHA 8ICFA 2ZIVA 2NO5A 4F4YA 3SD7A 1IXRA 2EZXA 2W04A 5KG3A 2R8IA 2ZXHA 1HEKA 2JEFA 8ICHA 4J9NA 2JEJA 5ALFA 5AIAA 2V4RA 4UBBA 2AGOA 1ZRMA 3H4BA 2DPIA 4Y2UA 3K1ZA 2PXIA 1VDVA 3CYMA 1EXNA 5HHHA 4RUAA 1DXSA 2YMQA 5L1IA 3KZXA 1X6IA 2LYAA 1B0XA 9ICMA 4KX3A 4DSFA 4ED7A 5KT7A 2JHDA 2AQ0A 2W9AA 1UA0A 3QX7A 5AK6A 5AM2A 1S0OA 3NVWA 2H3IA 1TAQA 5BOLA 1V38A 4RPXA 2YB1A 2ZIWB 1ZQ1C 1U45A 7ICHA 3CP8A 2AJQA 2KK0A 2Z7JA 8ICZA 4F3OA 2LHTA 3V7JA 3N28A 5CRXA 3ZD8A 4RT2A 4ELUA 3GIIA 1XSPA 1ZQCA 1Z00B 1JN3A 1Q46A 4BWJA 2ASLA 3JPTA 3PV8A 1U49A 3KOOA 5T14A 5KFLA 1S9FA 4J9SA 2XGQA 1N56A 2BQ3A 4YG2A 3H8WA 2DUYA 5KFUA 1NI3A 4F92B 2BCVA 2I6XA 8ICLA 2IOFA 4FBUA 3ZDAA 1CUKA 4CE6A 4JWMA 4MF2A 1SV4A 1SKWA 5CEHA 5B66U 2DPJA 3FM9A 2JH1A 5AKHA 3RJGA 4Y2PA 3BJYA 1IG6A 3M1YA 4NM1A 4RPYA 3T3FA 5KT3A 1J2MA 3LYSA 4UASA 5CJ7A 5KG1A 2H3FA 3WKBA 4O9MA 5ALUA 1LV5A 5EE0A 4AYBC 3PW7A 4OJ5A 3EPIA 2Y0SC 4RPZA 5ALIA 4ED8A 8ICMA 2JH7A 2W55A 4MFFA 2NO4A 5ALJA 1UT5A 2FI1A 3HKZF 1NKEA 2EDUA 5L1JA 5KFMA 5C5JA 4OD0A 3Q8MA 2F8LA 3FDSA 2EZZA 4OJ6A 2CN1A 3JPSA 3T5JA 3N7RC 1UT8A 1SL0A 5J0UA 9ICJA 3RJHA 4HAIA 4RQMA 3OHBA 1NK5A 8ICPA 1WG8A 4M9NA 3M8SA 3RH4A 4JV1A 5E79U 4ECYA 2A3VA 2FLNA 3QU7A 5F3XB 2HBKA 3AUOA 3WK9A 1DRGA 4J9PA 4ED0A 3F2DA 4RQ1A 4FBTA 4F5OA 5AKGA 5EWGA 4QWDA 2W03A 2WHEA 4DS5A 5F9LA 5AM3A 3HILA 4YXMA 2FMSA 2G09A 7ICGA 4O5KA 3GILA 4EBCA 3OSPA 4F5PA 3NVVA 5IILA 4ECXA 4KLEA 5J0PA 3E2EA 2HOFA 1S10A 8ICSA 4CRXA 3MABA 2KNJA 3OTQA 2ATLA 2OWOA 4B9NA 1MQ2A 3L3FX 5AK3A 4K4IA 1NZPA 4R64A 2K4IA 3NGDA 4ED6A 2FDRA 2K8AA 2C28A 4QZFA 2ISPA 4M47A 4DOCA 4KLFA 2P66A 2HBLA 2K4HA 1ZD5A 3Q8SB 1WUDA 4YCXA 5ALYA 4F8RA 1ZQIA 3RB4A 1HIWA 1A6SA 2N1RA 4Q8FA 2XY7A 2G5IB 2WAQC 3HRDD 4RQ6A 4G3IA 4BXOA 3FYHA 4NLZA 1Q8KA 4J9QA 1RQNA 3QUQA 4Y2JA 3QEAZ 4CNQA 2E1FA 4EYIB 4UQGA 2W9BA 4QIWC 4P4OA 1SB3C 2A1JA 4C7YA 4KLUA 1V85A 2G08A 4I29A 3H8SA 5AM1A 1O08A 4EENA 9ICCA 2UVUA 3T5HA 4QZGA 2FE9A 4M9JA 2ISOA 2ZIXA 4Y2QA 5KG7A 3SV3A 1L7NA 4FZMA 2RHFA 3NTUA 9ICOA 3F2CA 8ICQA 2H3ZA 1RXVA 3KKAA 3C23A 4BUGA 1OXJA 2W9MA 1F44A 1K1QA 2OXOA 2DQNB 2QARB 5CP2A 3RJJA 3T79A 1X40A 4CCHA 3T5LA 3NVYA 5CWRA 1P7DA 5HHIA 2BHNA 3QZ8A 4DF8A 2W8KA 1XSLA 2VA3A 2ZJAA 4BX9C 5ALOA 1S77D 5L9XA 1FFVA 4IS7A 2W43A 4RQ7A 4EBEA 4JV0A 5IIIA 3CW2C 3G6XA 3LVVA 3QUCA 4AYBF 3LWLA 2YQEA 7ICIA 5DLFA 5ALWA 1ZQTA 2Y0SF 1XNSA 5ALVA 4QZAA 4IRKA 4KN7A 5KG0A 3PX0A 1VJ5A 2WB1C 1N62A 4U7CA 3OJUA 4PL2A 1XO0A 3MFIA 4FS2A 5ALDA 3JPNA 2HVHA 2I9GA 1X2IA 1MN8A 3BQTA 9ICQA 1KW4A 4O3PA 1QSYA 2XO7A 4Y2VA 5KFDA 5DG9A 4O0IA 3D2SA 3V6KA 1L3SA 1Q3UA 5KFPA 5IIMA 3IG5A 1ZQPA 2ES6A 3ETRA 2WTFA 1ZJMA 4F93B 4F4WA 3AU6A 3MR3A 2LKYA 3PO5A 2LM1A 2QKQA 4DSJA 3QYPA 4DFDA 4PHAA 4PGXA 4DSLA 1VLBA 4YD1A 1D8YA 1QTMA 2HCFA 3PNCA 3QXGA 5AKEA 2HHUA 1UHUA 3RH6A 4UBCA 5KFZA 4F5RA 2ASJA 2HHWA 2ZIUA 2BR0A 3WU2U 4C8KA 1CRXA 3BZKA 2HDOA 8ICOA 1RQLA 2FJ6A 4B9TA 5J2FA 1ZD3A 3Q8LA 1PZNA 4F4KA 2YN4A 3SV4A 3IHQB 4F4ZA 4O3SA 3ETLA 4I2JA 4IL6U 2LI6A 4BDPA 4UARA 2IA6A 4O3NA 3WKAA 3UM9A 3F5EA 1L3VA 4XA5A 4RQ2A 2ZXIA 4EX6A 3B9JA 4C8OA 2KSOA 5JTIA 3C29A 2KIWA 5AM0A 3AQFA 1D9DA 3AEVA 2NRVA 3OHAA 5JRTA 2WAQF 2FPMA 3GV5B 4C4TA 5FP0A 4FZNA 1AROP 1XWLA 3K4GA 1BPEA 2OM6A 2Y1IA 2W7PA 1XSNA 2MSNA 3GIKA 4QIWF 5F9NA 2R8GA 2EAPA 2JZBA 5ALLA 3GIMA 3MDCA 1XC9A 2HHXA 5J2DA 1ZQGA 4UATA 1TK5A 2GLEA 1ZQVA 2EANA 2XGPA 1U9LA 4PZNA 4PGQA 4J9OA 5DBCA 4Y2TA 4DSIA 2KVSA 1SKRA 2B0CA 4TUSA 1BPDA 2E8NA 4QWBA 2AH5A 3H0MB 2J6TA 2D6FC 3H0LB 1T7PA 4DL6A 4P2HA 9ICFA 5J2AA 1ZQAA 5KT6A 4QZIA 2M0NA 5AI0A 5AIBA 4DLEA 3WKCA 9ICKA 2W54A 4F50A 2PFPA 5AM5A 5KFFA 3DV9A 2J6UA 2K4EA 1J97A 3GZFA 4CF3A 8ICNA 3SZ2A 3QU4A 3RTVA 5DDYA 2KHVA 4BWMA 2BPFA 1IV8A 4IQUA 1ZQWA 5KG4A 2ZTCA 5KFGA 4I2EA 1JROA 2D8CA 3M9MB 2LBOA 5H2FU 2JZBB 3PW2A 1JX4A 2V4QA 3CNHA 4EEYA 1KFTA 1WWVA 4QZ8A 2WB1F 1MC8A 1ZD2P 1Z00A 2KN7A 7ICQA 5ALMA 4B9UA 2RDJA 2C2EA 4M0AA 4UAWA 4KLIA 1T3QA 3OPXA 2G06A 2CRXA 1L7MA 4JMUA 3OSNA 3NUQA 2JGAA 4F5NA 2RDIA 3PSPA 1PK1B 4BGDA 1COKA 5GTIU 4Q45A 2KFZA 3V72A 4DF4A 4OCZA 3SEIA 5ALXA 5ALKA 2HOIA 5AM4A 3H8MA 1BPYA 4M9HA 2F1HA 2KJ8A 2AHOB 5CA7A 1MQ3A 4QJFB 3ICXA 3PSFA 4UAZA 4OJOA 4RQNA 2WFAA 7ICOA 3PW0A 1FFUA 4PPXA 3HPOA 1S5LU 4K4HA 4NM2A 4C8LA 4DL5A 5ALPA 3N4MB 4KLOA 4RNNA 1SL1A 1Z1BA 2BCSA 1C7YA 5KFHA 2F1IA 3ED5A 1HUZA 4P4PA 4GXIA 4ELVA 5J2CA 4QZHA 3NRZA 5KTQA 3ISBA 1BPXA 2V9WA 3UMCA 9ICWA 5IIKA 4I2FA 3L4PA 4DS4A 2KOBA 4C80A 3KTQA 4DSKA 1QSLA 5ALNA 1S0NA 9ICAA 1F0MA 2DGZA 3JPPA 5L1KA 3A0HU 4PHDA 2GO7A 4JV2A 2HHTA 1QQ5A 1U48A 1BNPA 5G5GA 4EX7A 4O5EA 3KHGA 1PK3A 2FLPA 3TARA 1NK8A 4NL9C 5KFAA 3BQ1A 3LWMA 5KT2A 2Y9UA 3M8RA 4ED3A 4M9GA 1HUOA 2B21A 4MFCA 4DFPA 4TQRA 3DDHA 4C8MA 2LYBA 1JUDA 1SV0C 2DBYA 4DFKA 2K8BB 1NJZA 9ICIA 5K4LA 5DKWA 4GFJA 7ICLA 1SKSA 1QCKA 3DEEA 4NLCA 4UW9A 2EZYA 1RDFA 3GU3A 2RRDA 1JIHA 7ICVA 3KKAC 1N2XA 1D9FA 2LMRA 3BZCA 5BPCA 2KV2A 9ICSA 5AI6A 3PR4A 4F5QA 1DK3A 4P0PB 1Z4NA 5KFBA 4KX5A 4US8A 2Q4TA 4NJ8A 3A0BU 5J2JA 5EE9A 4USAA 4LVSA 1LKYA 1UPHA 2H5XA 2E8PA 3KFUF 4Q43A 4KITB 2KIVA 2ZJ8A 1ZQHA 3RB3A 2W9CA 7ICTA 2BDPA 4YXJA 3QU5A 2OCEA 3RAXA 4UB5A 1ECWA 3D2QA 4RT3A 5KFYA 1KDHA 2F76X 8ICTA 2A19A 5J0RA 1ZQEA 2Y9TA 2P35A 4NY8A 7ICMA 4RQ5A 3HP6A 3J81j 3H8JA 1UA1A 7ICJA 3KD3A 3M6KA 4PHPA 3UXNA 1N5WA 1TK0A 1PVQA 2MAXA 2BCUA 2QARA 5EWEA 3F2BA 4GLXA 2DKZA 2GOLA 3H0RB 2NRZA 4E0DA 3MGVA 4US9A 2UVWA 4OJLA 3PW5A 8ICYA 3MR2A 1SIJA 4KLTA 3C1YA 4MEYA 5IIOA 2XCAA 2XI9A 2F3NA 2G0AA 3C28A 2F8KA 1NNLA 4QW9A 3UXPA 5AKJA 4J03A 4RQ8A 4GXJA 1BVSA 1LKYB 5KFTA 2EQYA 3FC4A 4NL9A 3HJEA 1NJYA 4IR1A 2W9CB 4CDGA 5ALGA 3KBBA 2NRXA 4C0ZA 9ICPA 2XICA 1QQ6A 1SV0A 1TKDA 5J29A 4P4MA 2B6GA 1QLNA 1LVHA 2ZUCA 4TURA 1F5SA 5DQHA 1RYRA 2PFOA 3C2LA 1KTQA 3F53A 2DWQA 2E8MA 5AI4A 1ZYQA 1L6NA 2HSZA 4C7ZA 4QZBA 1TAMA 2DKXA 8ICAA 2RQ5A 4DFMA 4DWIA 1ZRNA 4WJ3B 4KLLA 3G6VA 4DQQA 4ED2A 1L8OA 3SR6A 5DQIA 4QZEA 5DDMA 3HWTA 1TE2A 3QZ7A 3MR6A 5AKKA 5J0YA 4RQ0A 9ICEA 4DL4A 5J0SA 4ACOA 4DOAA 1X9XA 3T5KA 1JRPA 1OUQA 5G5HA 4KLSA 1KSPA 1ZQOA 5KFSA 5KFCA 5J8YA 1KKXA 3M9NB 5J0QA 3ZDDA 1MA7A 1ZJNA 3ORYA 3TQ1A 5ALHA 4MF8A 1K1SA 7ICKA 3SAHA 5AK5A 4YMNA 4Z6FA 4Z6CA 1S0MA 2LPEA 3C5GA 2XIDA 5AI5A 5ALEA 3U26A 2C22A 2VJ4A 3ALRA 2DFLA 4IRCA 3GDXA 4TUQA 2JEGA 3K1RB 5DB7A 5KT4A 2FPLA 3PZPA 3RFAA 3V7LA 5IIJA 1ZQRA 2K4PA 2KP7A 3C5FA 2UVVA 1NJXA 1QH9A 5JU5A 1ZQBA 4CF5A 3WKEA 5CR0A 2MRLA 4KLHA 1NK0A 1FIQA 2NYVA 4KLDA 1PVPA 3H40A 1X9SA 1NKCA 4J9KA 4YR0A 3EUB2 1D8LA 1FEZA 3ZDEA 3PX4A 9ICUA 3M7DA 1K5OA 5KAIU 1KQQA 4ECWA 4LZGA 3V6HA 2AQ4A 4PZOA 3RJKA 2KFNA 4B9VA 2OYYA 2WF9A 1L3TA 3O0FA 1NK4A 4F2SA 4M9LA 1OW5A 4IC9A 4I27A 2PFQA 4IQVA 2JV3A 3HX0A 2JXJA 5DBAA 1KFSA 4NV0A 3TAPA 1JXEA 4BJQA 2R8KA 2ZUDA 5J2KA 4I2CA 3MGIA 8ICRA 3V6JA 4YFKA 2KZ3A 3RH5A 4ECRA 4GC6A 3NASA 3IM1A 5DQGA 2MUTA 3RR8A 2F2AB 1TK8A 3GIJA 1FO4A 4M04A 1IIPA 4QZCA 1YZ6A 2BGWA 5DGBA 4MEXA 4Y2RA 1ZQYA 2K60A 1ZD4A 2VJ5A 1WCNA 2NRTA 4RQ4A 4KMOB 3AN1A 4AP9A 5DB6A 4YN4A 2XY6A 3I28A 4Y2XA 3Q8RB 1YT3A 3RR7A 4MFAA 5HNKA 4YR2A 5AICA 4Z6EA 5KNIA 5AKYA 2QB0B 3H4DA 4M6WA 2KVCA 4DCCA 3BQ2A 3IG8A 4QNLA 5J0WA 4QWEA 4F71A 8ICBA 1PK1A 5AK4A 3BQ7A 2H3VA 3VC8A 4KMUA 1ZQZA 4P0QA 4O3MA 3SYZA 1NZBA 5EOZA 3QU2A 1JMSA 3EZ5A 3I1YA 4QW8A 3EYZA 3SAFA 4EYHB 2IHNA 3E0FA 3RB0A 1PUZA 3OJSA 2FPKA 1S0VA 3QE9Y 1T3NA 4TUPA 4QZDA 5J2EA 4CF4A 3F5AA 2QB1A 5CB1A 1NOMA 2RP5A 5ALSA 4NLNA 1B43A 4FE3A 1L8LA 3IN5A 1ZOLA 7ICRA 3ZD9A 2UVRA 2MUTB 4NXZA 3NVZA 5EE3A 3VCBA 4I2IA 3SMVA 1SL2A 2BDUA 4KLGA 5A0LA 1BNOA 4F4XA 3PO4A 3PMNA 2WF7A 1X42A 2RLTA 4YQWA 4PHEA 3KZIU 1TAUA 2JEIA 3ZI4A 2HHSA 4UAYA 3PW4A 9ICRA 3JPOA 3JPQA 1RM6C 5ALRA 4M6WB 1U4BA 4O3RA 4NWIA 3PMLA 3THVA 1IM4A 1QSSA 1KN5A 9ICNA 3AMZA 3TADA 4YR3A 5KG6A 4KTQA 3LDAA 3HT3A 4I2GA 1ZQFA 2WF5A 3GFKB 1O03A 4X5VA 3RB6A 4P0QB 2KZMA 2YX8A 3Q8PB 3HW8A 2GWSA 2IHMA 2KTQA 3Q8KA 4M2YA 3GV7B 3QU9A 2FMPA 2KKVA 2E5SA 4K4GA 5EWFA 5KFJA 5KL1B 5HP4A 2HVIA 5KT5A 3PY8A 3V7KA 2YMPA 5J2HA 5KFQA 4UB6U 3TI0A 1A77A 4XRHA 1SGGA 1UQVA
chains in the Genus database with same CATH topology
2KMDA 2DKXA 2D8CA 2KSOA 5JTIA 1Z1VA 4PZOA 1WWVA 1SXEA 5L1MA 2D3DA 1JI7A 5JRTA 2DL0A 3IDWA 2KG5A 2Y9TA 1F0MA 1DXSA 1X66A 1OW5A 2QB1A 1B0XA 2JV3A 3BS5B 5J8YC 1RG6A 1X9XA 3SENA 1WWUA 1PK3A 2QARA 2EAPA 2QB0A 2YTUA 2DKZA 4NL9C 2ESEA 1KW4A 5J8YA 2Y9UA 1V38A 1PK1B 1COKA 2GLEA 2EANA 2KE7A 4PZNA 1V85A 1SV0C 3SEIA 4RQMA 2ES6A 3BS5A 2KSOB 1B4FA 3H8MA 2E8NA 2LPEA 2F44A 3TADC 2EAMA 5F3XB 2F3NA 2QKQA 2FE9A 2E8OA 2F8KA 3KKAC 3TADA 2LMRA 3TACB 3K1RB 2K60A 1LKYB 4RQNA 4NL9A 3KKAA 2K4PA 1OXJA 4MHVA 5KNIA 2QARB 2EAOA 2QB0B 1SXDA 3HILA 5JU5A 1X40A 1SV0A 1UCVA 2B6GA 4NJ8A 1SV4A 1PK1A 2L5YA 1LKYA 3BQ7A 2E8MA 2E8PA 3BS7A 4IS7A 1SGGA 1UQVA 2KIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KMD A;  2DKX A;  2D8C A;  2KSO A;  5JTI A;  1Z1V A;  4PZO A;  1WWV A;  1SXE A;  5L1M A;  2D3D A;  1JI7 A;  5JRT A;  2DL0 A;  3IDW A;  2KG5 A;  2Y9T A;  1F0M A;  1DXS A;  1X66 A;  1OW5 A;  2QB1 A;  1B0X A;  2JV3 A;  3BS5 B;  5J8Y C;  1RG6 A;  1X9X A;  3SEN A;  1WWU A;  1PK3 A;  2QAR A;  2EAP A;  2QB0 A;  2YTU A;  2DKZ A;  4NL9 C;  2ESE A;  1KW4 A;  5J8Y A;  2Y9U A;  1V38 A;  1PK1 B;  1COK A;  2GLE A;  2EAN A;  2KE7 A;  4PZN A;  1V85 A;  1SV0 C;  3SEI A;  4RQM A;  2ES6 A;  3BS5 A;  2KSO B;  1B4F A;  3H8M A;  2E8N A;  2LPE A;  2F44 A;  3TAD C;  2EAM A;  5F3X B;  2F3N A;  2QKQ A;  2FE9 A;  2E8O A;  2F8K A;  3KKA C;  3TAD A;  2LMR A;  3TAC B;  3K1R B;  2K60 A;  1LKY B;  4RQN A;  4NL9 A;  3KKA A;  2K4P A;  1OXJ A;  4MHV A;  5KNI A;  2QAR B;  2EAO A;  2QB0 B;  1SXD A;  3HIL A;  5JU5 A;  1X40 A;  1SV0 A;  1UCV A;  2B6G A;  4NJ8 A;  1SV4 A;  1PK1 A;  2L5Y A;  1LKY A;  3BQ7 A;  2E8M A;  2E8P A;  3BS7 A;  4IS7 A;  1SGG A;  1UQV A;  2KIV A; 
#chains in the Genus database with same CATH topology
 4DLG A;  4PJ0 U;  1Z1V A;  3RJE A;  1HJP A;  4C4R A;  3KHH A;  5AKZ A;  5J2I A;  4YMM A;  4Y2Y A;  1KL9 A;  2PI4 A;  5L1M A;  4XQ8 A;  2ZTE A;  1DK2 A;  2W7O A;  2VA8 A;  5J0O A;  3OGU A;  4DL3 A;  4R8U B;  4RUC A;  4O3O A;  3RBD A;  4IQT A;  3IP4 B;  4P0P A;  9ICB A;  4I28 A;  2HI0 A;  1S76 D;  2VAN A;  4EBD A;  5B5E U;  3QNM A;  2ESE A;  1V97 A;  3QEB Z;  8ICE A;  1RYU A;  2ZIV B;  4B9S A;  3N97 B;  1NK9 A;  3ZDB A;  9ICT A;  7ICP A;  2W11 A;  1DGJ A;  5AKX A;  2HBJ A;  1Z3E B;  2PMZ C;  5L1L A;  1BPB A;  4DSE A;  4KLQ A;  1L3U A;  3C21 A;  3MR5 A;  2ZJ5 A;  2ASD A;  2HW3 A;  2WF6 A;  5D4B A;  2KHQ A;  3M9O B;  4J9L A;  3BQ0 A;  2PKE A;  1AQ6 A;  2NRW A;  4JWN A;  2I1Q A;  2XC9 A;  3PST A;  4DOB A;  4DQS A;  5J2B A;  3S6J A;  3RJF A;  3UMG A;  1M6Y A;  4JUZ A;  3PVX A;  5J2G A;  2L5Y A;  5D46 A;  2ZG6 A;  5J0T A;  1CEZ A;  2HHQ A;  7ICS A;  1N63 A;  4DL2 A;  3MC1 A;  4HYK A;  2OHF A;  2BCR A;  1A0P A;  4XUS A;  3N7P D;  1ED1 A;  3PR5 B;  5KFX A;  2P6U A;  4DO9 A;  1T94 A;  1GO3 F;  1ZQK A;  2D3D A;  2VA2 A;  2R8J A;  9ICV A;  2DL0 A;  3EPG A;  4I2A A;  4UB8 U;  1L7O A;  4O3Q A;  1RPL A;  2YML A;  1A76 A;  4F72 A;  2OEH A;  2FLL A;  5J8Y C;  3GQC A;  1C20 A;  1RG6 A;  4EEK A;  4I2H A;  7ICU A;  3PSI A;  5DG8 A;  1DGS A;  3TAQ A;  3I76 A;  2ODG A;  4LJX A;  4QWC A;  2PFN A;  4PGY A;  2KJ9 A;  4FZL A;  4LZD A;  5KFO A;  5DB8 A;  5HR6 A;  2JRZ A;  3IRU A;  2VIX A;  3PX6 A;  1KEJ A;  8ICI A;  4UB1 A;  3ISD A;  1B4F A;  3WK4 A;  2M9N A;  1NK7 A;  4IRD A;  4RNO A;  4I2D A;  4A8E A;  4YP3 A;  4C4S A;  4ECU A;  1MSW D;  3QUB A;  5KG2 A;  1N60 A;  3NS1 A;  2EH9 A;  3WK5 A;  2MA1 A;  1QQ7 A;  5KFK A;  5EE1 A;  1ZQN A;  1SZP A;  4RU9 A;  7ICF A;  1D8B A;  3WK8 A;  5TIS U;  1TV9 A;  1N48 A;  1Z4O A;  1ZQM A;  5KFW A;  4UAU A;  4KLM A;  4OJP A;  1TVA A;  1XO1 A;  3ISC A;  2R18 A;  2YY6 A;  3UQ2 A;  1CI4 A;  3SI8 A;  1PVR A;  4TQS A;  1KFD A;  2AU0 A;  3WKD A;  4ECT A;  3BS7 A;  2QLT A;  5KFV A;  4J9M A;  8ICC A;  2IMW P;  2I5H A;  1B22 A;  3UMB A;  3AM9 A;  3ONN A;  8ICK A;  3WK6 A;  5AKI A;  1BPZ A;  3LK9 A;  4UB4 A;  9ICX A;  1SXE A;  5C0Y A;  4B6J A;  3RRH A;  4CGZ A;  5DLG A;  2KIC A;  8ICV A;  3TKA A;  2FMQ A;  2F1J A;  4QZ9 A;  4DL7 A;  1X66 A;  5HR7 A;  1ZET A;  4YD2 A;  2W3S A;  2JR5 A;  3SEN A;  1WWU A;  4DQP A;  5TZV A;  1KRP A;  2K8C B;  2P6R A;  1ZQD A;  2G07 A;  2YTU A;  3MFH A;  3Q8Q B;  5DB9 A;  3C2K A;  1ZQQ A;  3TFR A;  1Z19 A;  1T8E A;  2PMZ F;  2C2R A;  4UB2 A;  1ZXI A;  2Y1J A;  2OH2 A;  5HML A;  4PL1 A;  1S97 A;  2R8H A;  4DFJ A;  5IIN A;  2F44 A;  1ZQL A;  4GXK A;  4ECV A;  1N5X A;  2YMM A;  4ECS A;  2E8O A;  4ZH4 A;  2GH1 A;  4G9B A;  2BQR A;  2F77 X;  1H38 A;  2IBK A;  4JB3 A;  4ED1 A;  1SZH A;  5J0X A;  2MU2 A;  2G5H B;  1KBU A;  5AI8 A;  4NLB A;  3SAG A;  4BXO B;  1L5U A;  2J6S A;  2K89 A;  1JAL A;  5DG7 A;  4GC7 A;  5DGA A;  2W9B B;  5KL8 B;  2W8L A;  1T4G A;  1J2N A;  7ICE A;  4RQ3 A;  2A1J B;  3UQ0 A;  4R63 A;  2KKP A;  4YVZ A;  4I2B A;  5ALT A;  4RZR A;  2KMD A;  2ZTD A;  4EZ6 A;  1X9W A;  2HBM A;  4IQW A;  2BKE A;  3EW9 A;  1XS9 D;  2BQU A;  2BZF A;  4FO6 A;  2ZIX B;  3IDW A;  2AGQ A;  4KLJ A;  1WYG A;  3TFS A;  1KLN A;  2KG5 A;  4NLG A;  2XY5 A;  4Q8E A;  2KJ5 A;  5AHX A;  3LVW A;  3B0X A;  4UAV A;  5DBB A;  2BCQ A;  1COO A;  1LB2 B;  1BGX T;  2BPG A;  5D49 A;  3MDA A;  1V9P A;  2QB0 A;  5KFE A;  2AGP A;  1N61 A;  2LYH A;  4F91 B;  3RRG A;  4PH5 A;  1SWW A;  4GIB A;  1URJ A;  1S8O A;  3L5K A;  3D6J A;  2KE7 A;  3RBE A;  2HMX A;  4C8N A;  4RNM A;  4IR9 A;  3JPR A;  3UPQ A;  3M6Z A;  3RJI A;  3BS5 A;  5HMM A;  3N7S C;  3TAD C;  3TAN A;  2E1E A;  2C2D A;  4YMO A;  4EZ9 A;  4J9R A;  2JMG A;  4U6P A;  2ALZ A;  2YB4 A;  3BDP A;  1DOQ A;  1L7P A;  5KFR A;  3AL0 B;  2IOF K;  2LM4 A;  1ZQU A;  9ICG A;  4ICA A;  3AQE A;  4MHV A;  5KFI A;  2XVT A;  4ELT A;  4EEL A;  2KZZ A;  3UXO A;  2XCP A;  5KG5 A;  2Q0Z X;  3RF9 A;  4FS1 A;  1UCV A;  3ZDC A;  3C2M A;  1NKB A;  1SWV A;  5KAF U;  2HOQ A;  1NK6 A;  5CHG A;  1RYS A;  4JK1 A;  3R9K A;  1U47 A;  2CXY A;  2WF8 A;  4B9M A;  2HHV A;  3D2N A;  2VKQ A;  8ICU A;  3IV6 A;  2CPR A;  3QUT A;  1JI7 A;  3AU2 A;  4ECQ A;  1RXW A;  2DF4 B;  3RAQ A;  3SQI A;  8ICX A;  5BOM A;  1Q3V A;  3CRX A;  3K75 D;  1WCL A;  2ZIU B;  3BS5 B;  4DEZ A;  1YZ7 A;  4FFD A;  4DQR A;  4Z6D A;  4ECZ A;  4O5C A;  3HKZ C;  1Y88 A;  2ZUB A;  3B0Y A;  3E58 A;  4KN4 A;  5KFN A;  4B9L A;  3MGH A;  4ZOH C;  1XU4 A;  3H7I A;  4DQI A;  2W3R A;  4Q44 A;  9ICH A;  4R65 A;  2A1A A;  4Y2S A;  5JUM A;  1X6J A;  2KD1 A;  4UB3 A;  2AXT U;  2KSO B;  1ZQS A;  2E3T A;  1NJW A;  3MBY A;  5GTH U;  4QWA A;  2EAM A;  3KHR A;  2PI5 A;  3G6Y A;  1ZQX A;  4OO1 J;  8ICG A;  5AI9 A;  3C1Z A;  3TAC B;  3EWA A;  3GV8 B;  2ZIW A;  1JXL A;  2BPC A;  2O6K A;  2NV3 A;  3WK7 A;  1TFR A;  4R8U A;  1ZQJ A;  1RZT A;  3NRW A;  5AKL A;  2IOH A;  4F2R A;  4NLK A;  2EAO A;  1X9M A;  1SXD A;  8ICW A;  8ICJ A;  9ICL A;  4R66 A;  2KEY A;  2H3Q A;  5ALZ A;  5ALQ A;  7ICN A;  3KHL A;  3FAH A;  8ICF A;  2ZIV A;  2NO5 A;  4F4Y A;  3SD7 A;  1IXR A;  2EZX A;  2W04 A;  5KG3 A;  2R8I A;  2ZXH A;  1HEK A;  2JEF A;  8ICH A;  4J9N A;  2JEJ A;  5ALF A;  5AIA A;  2V4R A;  4UBB A;  2AGO A;  1ZRM A;  3H4B A;  2DPI A;  4Y2U A;  3K1Z A;  2PXI A;  1VDV A;  3CYM A;  1EXN A;  5HHH A;  4RUA A;  1DXS A;  2YMQ A;  5L1I A;  3KZX A;  1X6I A;  2LYA A;  1B0X A;  9ICM A;  4KX3 A;  4DSF A;  4ED7 A;  5KT7 A;  2JHD A;  2AQ0 A;  2W9A A;  1UA0 A;  3QX7 A;  5AK6 A;  5AM2 A;  1S0O A;  3NVW A;  2H3I A;  1TAQ A;  5BOL A;  1V38 A;  4RPX A;  2YB1 A;  2ZIW B;  1ZQ1 C;  1U45 A;  7ICH A;  3CP8 A;  2AJQ A;  2KK0 A;  2Z7J A;  8ICZ A;  4F3O A;  2LHT A;  3V7J A;  3N28 A;  5CRX A;  3ZD8 A;  4RT2 A;  4ELU A;  3GII A;  1XSP A;  1ZQC A;  1Z00 B;  1JN3 A;  1Q46 A;  4BWJ A;  2ASL A;  3JPT A;  3PV8 A;  1U49 A;  3KOO A;  5T14 A;  5KFL A;  1S9F A;  4J9S A;  2XGQ A;  1N56 A;  2BQ3 A;  4YG2 A;  3H8W A;  2DUY A;  5KFU A;  1NI3 A;  4F92 B;  2BCV A;  2I6X A;  8ICL A;  2IOF A;  4FBU A;  3ZDA A;  1CUK A;  4CE6 A;  4JWM A;  4MF2 A;  1SV4 A;  1SKW A;  5CEH A;  5B66 U;  2DPJ A;  3FM9 A;  2JH1 A;  5AKH A;  3RJG A;  4Y2P A;  3BJY A;  1IG6 A;  3M1Y A;  4NM1 A;  4RPY A;  3T3F A;  5KT3 A;  1J2M A;  3LYS A;  4UAS A;  5CJ7 A;  5KG1 A;  2H3F A;  3WKB A;  4O9M A;  5ALU A;  1LV5 A;  5EE0 A;  4AYB C;  3PW7 A;  4OJ5 A;  3EPI A;  2Y0S C;  4RPZ A;  5ALI A;  4ED8 A;  8ICM A;  2JH7 A;  2W55 A;  4MFF A;  2NO4 A;  5ALJ A;  1UT5 A;  2FI1 A;  3HKZ F;  1NKE A;  2EDU A;  5L1J A;  5KFM A;  5C5J A;  4OD0 A;  3Q8M A;  2F8L A;  3FDS A;  2EZZ A;  4OJ6 A;  2CN1 A;  3JPS A;  3T5J A;  3N7R C;  1UT8 A;  1SL0 A;  5J0U A;  9ICJ A;  3RJH A;  4HAI A;  4RQM A;  3OHB A;  1NK5 A;  8ICP A;  1WG8 A;  4M9N A;  3M8S A;  3RH4 A;  4JV1 A;  5E79 U;  4ECY A;  2A3V A;  2FLN A;  3QU7 A;  5F3X B;  2HBK A;  3AUO A;  3WK9 A;  1DRG A;  4J9P A;  4ED0 A;  3F2D A;  4RQ1 A;  4FBT A;  4F5O A;  5AKG A;  5EWG A;  4QWD A;  2W03 A;  2WHE A;  4DS5 A;  5F9L A;  5AM3 A;  3HIL A;  4YXM A;  2FMS A;  2G09 A;  7ICG A;  4O5K A;  3GIL A;  4EBC A;  3OSP A;  4F5P A;  3NVV A;  5IIL A;  4ECX A;  4KLE A;  5J0P A;  3E2E A;  2HOF A;  1S10 A;  8ICS A;  4CRX A;  3MAB A;  2KNJ A;  3OTQ A;  2ATL A;  2OWO A;  4B9N A;  1MQ2 A;  3L3F X;  5AK3 A;  4K4I A;  1NZP A;  4R64 A;  2K4I A;  3NGD A;  4ED6 A;  2FDR A;  2K8A A;  2C28 A;  4QZF A;  2ISP A;  4M47 A;  4DOC A;  4KLF A;  2P66 A;  2HBL A;  2K4H A;  1ZD5 A;  3Q8S B;  1WUD A;  4YCX A;  5ALY A;  4F8R A;  1ZQI A;  3RB4 A;  1HIW A;  1A6S A;  2N1R A;  4Q8F A;  2XY7 A;  2G5I B;  2WAQ C;  3HRD D;  4RQ6 A;  4G3I A;  4BXO A;  3FYH A;  4NLZ A;  1Q8K A;  4J9Q A;  1RQN A;  3QUQ A;  4Y2J A;  3QEA Z;  4CNQ A;  2E1F A;  4EYI B;  4UQG A;  2W9B A;  4QIW C;  4P4O A;  1SB3 C;  2A1J A;  4C7Y A;  4KLU A;  1V85 A;  2G08 A;  4I29 A;  3H8S A;  5AM1 A;  1O08 A;  4EEN A;  9ICC A;  2UVU A;  3T5H A;  4QZG A;  2FE9 A;  4M9J A;  2ISO A;  2ZIX A;  4Y2Q A;  5KG7 A;  3SV3 A;  1L7N A;  4FZM A;  2RHF A;  3NTU A;  9ICO A;  3F2C A;  8ICQ A;  2H3Z A;  1RXV A;  3KKA A;  3C23 A;  4BUG A;  1OXJ A;  2W9M A;  1F44 A;  1K1Q A;  2OXO A;  2DQN B;  2QAR B;  5CP2 A;  3RJJ A;  3T79 A;  1X40 A;  4CCH A;  3T5L A;  3NVY A;  5CWR A;  1P7D A;  5HHI A;  2BHN A;  3QZ8 A;  4DF8 A;  2W8K A;  1XSL A;  2VA3 A;  2ZJA A;  4BX9 C;  5ALO A;  1S77 D;  5L9X A;  1FFV A;  4IS7 A;  2W43 A;  4RQ7 A;  4EBE A;  4JV0 A;  5III A;  3CW2 C;  3G6X A;  3LVV A;  3QUC A;  4AYB F;  3LWL A;  2YQE A;  7ICI A;  5DLF A;  5ALW A;  1ZQT A;  2Y0S F;  1XNS A;  5ALV A;  4QZA A;  4IRK A;  4KN7 A;  5KG0 A;  3PX0 A;  1VJ5 A;  2WB1 C;  1N62 A;  4U7C A;  3OJU A;  4PL2 A;  1XO0 A;  3MFI A;  4FS2 A;  5ALD A;  3JPN A;  2HVH A;  2I9G A;  1X2I A;  1MN8 A;  3BQT A;  9ICQ A;  1KW4 A;  4O3P A;  1QSY A;  2XO7 A;  4Y2V A;  5KFD A;  5DG9 A;  4O0I A;  3D2S A;  3V6K A;  1L3S A;  1Q3U A;  5KFP A;  5IIM A;  3IG5 A;  1ZQP A;  2ES6 A;  3ETR A;  2WTF A;  1ZJM A;  4F93 B;  4F4W A;  3AU6 A;  3MR3 A;  2LKY A;  3PO5 A;  2LM1 A;  2QKQ A;  4DSJ A;  3QYP A;  4DFD A;  4PHA A;  4PGX A;  4DSL A;  1VLB A;  4YD1 A;  1D8Y A;  1QTM A;  2HCF A;  3PNC A;  3QXG A;  5AKE A;  2HHU A;  1UHU A;  3RH6 A;  4UBC A;  5KFZ A;  4F5R A;  2ASJ A;  2HHW A;  2ZIU A;  2BR0 A;  3WU2 U;  4C8K A;  1CRX A;  3BZK A;  2HDO A;  8ICO A;  1RQL A;  2FJ6 A;  4B9T A;  5J2F A;  1ZD3 A;  3Q8L A;  1PZN A;  4F4K A;  2YN4 A;  3SV4 A;  3IHQ B;  4F4Z A;  4O3S A;  3ETL A;  4I2J A;  4IL6 U;  2LI6 A;  4BDP A;  4UAR A;  2IA6 A;  4O3N A;  3WKA A;  3UM9 A;  3F5E A;  1L3V A;  4XA5 A;  4RQ2 A;  2ZXI A;  4EX6 A;  3B9J A;  4C8O A;  2KSO A;  5JTI A;  3C29 A;  2KIW A;  5AM0 A;  3AQF A;  1D9D A;  3AEV A;  2NRV A;  3OHA A;  5JRT A;  2WAQ F;  2FPM A;  3GV5 B;  4C4T A;  5FP0 A;  4FZN A;  1ARO P;  1XWL A;  3K4G A;  1BPE A;  2OM6 A;  2Y1I A;  2W7P A;  1XSN A;  2MSN A;  3GIK A;  4QIW F;  5F9N A;  2R8G A;  2EAP A;  2JZB A;  5ALL A;  3GIM A;  3MDC A;  1XC9 A;  2HHX A;  5J2D A;  1ZQG A;  4UAT A;  1TK5 A;  2GLE A;  1ZQV A;  2EAN A;  2XGP A;  1U9L A;  4PZN A;  4PGQ A;  4J9O A;  5DBC A;  4Y2T A;  4DSI A;  2KVS A;  1SKR A;  2B0C A;  4TUS A;  1BPD A;  2E8N A;  4QWB A;  2AH5 A;  3H0M B;  2J6T A;  2D6F C;  3H0L B;  1T7P A;  4DL6 A;  4P2H A;  9ICF A;  5J2A A;  1ZQA A;  5KT6 A;  4QZI A;  2M0N A;  5AI0 A;  5AIB A;  4DLE A;  3WKC A;  9ICK A;  2W54 A;  4F50 A;  2PFP A;  5AM5 A;  5KFF A;  3DV9 A;  2J6U A;  2K4E A;  1J97 A;  3GZF A;  4CF3 A;  8ICN A;  3SZ2 A;  3QU4 A;  3RTV A;  5DDY A;  2KHV A;  4BWM A;  2BPF A;  1IV8 A;  4IQU A;  1ZQW A;  5KG4 A;  2ZTC A;  5KFG A;  4I2E A;  1JRO A;  2D8C A;  3M9M B;  2LBO A;  5H2F U;  2JZB B;  3PW2 A;  1JX4 A;  2V4Q A;  3CNH A;  4EEY A;  1KFT A;  1WWV A;  4QZ8 A;  2WB1 F;  1MC8 A;  1ZD2 P;  1Z00 A;  2KN7 A;  7ICQ A;  5ALM A;  4B9U A;  2RDJ A;  2C2E A;  4M0A A;  4UAW A;  4KLI A;  1T3Q A;  3OPX A;  2G06 A;  2CRX A;  1L7M A;  4JMU A;  3OSN A;  3NUQ A;  2JGA A;  4F5N A;  2RDI A;  3PSP A;  1PK1 B;  4BGD A;  1COK A;  5GTI U;  4Q45 A;  2KFZ A;  3V72 A;  4DF4 A;  4OCZ A;  3SEI A;  5ALX A;  5ALK A;  2HOI A;  5AM4 A;  3H8M A;  1BPY A;  4M9H A;  2F1H A;  2KJ8 A;  2AHO B;  5CA7 A;  1MQ3 A;  4QJF B;  3ICX A;  3PSF A;  4UAZ A;  4OJO A;  4RQN A;  2WFA A;  7ICO A;  3PW0 A;  1FFU A;  4PPX A;  3HPO A;  1S5L U;  4K4H A;  4NM2 A;  4C8L A;  4DL5 A;  5ALP A;  3N4M B;  4KLO A;  4RNN A;  1SL1 A;  1Z1B A;  2BCS A;  1C7Y A;  5KFH A;  2F1I A;  3ED5 A;  1HUZ A;  4P4P A;  4GXI A;  4ELV A;  5J2C A;  4QZH A;  3NRZ A;  5KTQ A;  3ISB A;  1BPX A;  2V9W A;  3UMC A;  9ICW A;  5IIK A;  4I2F A;  3L4P A;  4DS4 A;  2KOB A;  4C80 A;  3KTQ A;  4DSK A;  1QSL A;  5ALN A;  1S0N A;  9ICA A;  1F0M A;  2DGZ A;  3JPP A;  5L1K A;  3A0H U;  4PHD A;  2GO7 A;  4JV2 A;  2HHT A;  1QQ5 A;  1U48 A;  1BNP A;  5G5G A;  4EX7 A;  4O5E A;  3KHG A;  1PK3 A;  2FLP A;  3TAR A;  1NK8 A;  4NL9 C;  5KFA A;  3BQ1 A;  3LWM A;  5KT2 A;  2Y9U A;  3M8R A;  4ED3 A;  4M9G A;  1HUO A;  2B21 A;  4MFC A;  4DFP A;  4TQR A;  3DDH A;  4C8M A;  2LYB A;  1JUD A;  1SV0 C;  2DBY A;  4DFK A;  2K8B B;  1NJZ A;  9ICI A;  5K4L A;  5DKW A;  4GFJ A;  7ICL A;  1SKS A;  1QCK A;  3DEE A;  4NLC A;  4UW9 A;  2EZY A;  1RDF A;  3GU3 A;  2RRD A;  1JIH A;  7ICV A;  3KKA C;  1N2X A;  1D9F A;  2LMR A;  3BZC A;  5BPC A;  2KV2 A;  9ICS A;  5AI6 A;  3PR4 A;  4F5Q A;  1DK3 A;  4P0P B;  1Z4N A;  5KFB A;  4KX5 A;  4US8 A;  2Q4T A;  4NJ8 A;  3A0B U;  5J2J A;  5EE9 A;  4USA A;  4LVS A;  1LKY A;  1UPH A;  2H5X A;  2E8P A;  3KFU F;  4Q43 A;  4KIT B;  2KIV A;  2ZJ8 A;  1ZQH A;  3RB3 A;  2W9C A;  7ICT A;  2BDP A;  4YXJ A;  3QU5 A;  2OCE A;  3RAX A;  4UB5 A;  1ECW A;  3D2Q A;  4RT3 A;  5KFY A;  1KDH A;  2F76 X;  8ICT A;  2A19 A;  5J0R A;  1ZQE A;  2Y9T A;  2P35 A;  4NY8 A;  7ICM A;  4RQ5 A;  3HP6 A;  3J81 j;  3H8J A;  1UA1 A;  7ICJ A;  3KD3 A;  3M6K A;  4PHP A;  3UXN A;  1N5W A;  1TK0 A;  1PVQ A;  2MAX A;  2BCU A;  2QAR A;  5EWE A;  3F2B A;  4GLX A;  2DKZ A;  2GOL A;  3H0R B;  2NRZ A;  4E0D A;  3MGV A;  4US9 A;  2UVW A;  4OJL A;  3PW5 A;  8ICY A;  3MR2 A;  1SIJ A;  4KLT A;  3C1Y A;  4MEY A;  5IIO A;  2XCA A;  2XI9 A;  2F3N A;  2G0A A;  3C28 A;  2F8K A;  1NNL A;  4QW9 A;  3UXP A;  5AKJ A;  4J03 A;  4RQ8 A;  4GXJ A;  1BVS A;  1LKY B;  5KFT A;  2EQY A;  3FC4 A;  4NL9 A;  3HJE A;  1NJY A;  4IR1 A;  2W9C B;  4CDG A;  5ALG A;  3KBB A;  2NRX A;  4C0Z A;  9ICP A;  2XIC A;  1QQ6 A;  1SV0 A;  1TKD A;  5J29 A;  4P4M A;  2B6G A;  1QLN A;  1LVH A;  2ZUC A;  4TUR A;  1F5S A;  5DQH A;  1RYR A;  2PFO A;  3C2L A;  1KTQ A;  3F53 A;  2DWQ A;  2E8M A;  5AI4 A;  1ZYQ A;  1L6N A;  2HSZ A;  4C7Z A;  4QZB A;  1TAM A;  2DKX A;  8ICA A;  2RQ5 A;  4DFM A;  4DWI A;  1ZRN A;  4WJ3 B;  4KLL A;  3G6V A;  4DQQ A;  4ED2 A;  1L8O A;  3SR6 A;  5DQI A;  4QZE A;  5DDM A;  3HWT A;  1TE2 A;  3QZ7 A;  3MR6 A;  5AKK A;  5J0Y A;  4RQ0 A;  9ICE A;  4DL4 A;  5J0S A;  4ACO A;  4DOA A;  1X9X A;  3T5K A;  1JRP A;  1OUQ A;  5G5H A;  4KLS A;  1KSP A;  1ZQO A;  5KFS A;  5KFC A;  5J8Y A;  1KKX A;  3M9N B;  5J0Q A;  3ZDD A;  1MA7 A;  1ZJN A;  3ORY A;  3TQ1 A;  5ALH A;  4MF8 A;  1K1S A;  7ICK A;  3SAH A;  5AK5 A;  4YMN A;  4Z6F A;  4Z6C A;  1S0M A;  2LPE A;  3C5G A;  2XID A;  5AI5 A;  5ALE A;  3U26 A;  2C22 A;  2VJ4 A;  3ALR A;  2DFL A;  4IRC A;  3GDX A;  4TUQ A;  2JEG A;  3K1R B;  5DB7 A;  5KT4 A;  2FPL A;  3PZP A;  3RFA A;  3V7L A;  5IIJ A;  1ZQR A;  2K4P A;  2KP7 A;  3C5F A;  2UVV A;  1NJX A;  1QH9 A;  5JU5 A;  1ZQB A;  4CF5 A;  3WKE A;  5CR0 A;  2MRL A;  4KLH A;  1NK0 A;  1FIQ A;  2NYV A;  4KLD A;  1PVP A;  3H40 A;  1X9S A;  1NKC A;  4J9K A;  4YR0 A;  3EUB 2;  1D8L A;  1FEZ A;  3ZDE A;  3PX4 A;  9ICU A;  3M7D A;  1K5O A;  5KAI U;  1KQQ A;  4ECW A;  4LZG A;  3V6H A;  2AQ4 A;  4PZO A;  3RJK A;  2KFN A;  4B9V A;  2OYY A;  2WF9 A;  1L3T A;  3O0F A;  1NK4 A;  4F2S A;  4M9L A;  1OW5 A;  4IC9 A;  4I27 A;  2PFQ A;  4IQV A;  2JV3 A;  3HX0 A;  2JXJ A;  5DBA A;  1KFS A;  4NV0 A;  3TAP A;  1JXE A;  4BJQ A;  2R8K A;  2ZUD A;  5J2K A;  4I2C A;  3MGI A;  8ICR A;  3V6J A;  4YFK A;  2KZ3 A;  3RH5 A;  4ECR A;  4GC6 A;  3NAS A;  3IM1 A;  5DQG A;  2MUT A;  3RR8 A;  2F2A B;  1TK8 A;  3GIJ A;  1FO4 A;  4M04 A;  1IIP A;  4QZC A;  1YZ6 A;  2BGW A;  5DGB A;  4MEX A;  4Y2R A;  1ZQY A;  2K60 A;  1ZD4 A;  2VJ5 A;  1WCN A;  2NRT A;  4RQ4 A;  4KMO B;  3AN1 A;  4AP9 A;  5DB6 A;  4YN4 A;  2XY6 A;  3I28 A;  4Y2X A;  3Q8R B;  1YT3 A;  3RR7 A;  4MFA A;  5HNK A;  4YR2 A;  5AIC A;  4Z6E A;  5KNI A;  5AKY A;  2QB0 B;  3H4D A;  4M6W A;  2KVC A;  4DCC A;  3BQ2 A;  3IG8 A;  4QNL A;  5J0W A;  4QWE A;  4F71 A;  8ICB A;  1PK1 A;  5AK4 A;  3BQ7 A;  2H3V A;  3VC8 A;  4KMU A;  1ZQZ A;  4P0Q A;  4O3M A;  3SYZ A;  1NZB A;  5EOZ A;  3QU2 A;  1JMS A;  3EZ5 A;  3I1Y A;  4QW8 A;  3EYZ A;  3SAF A;  4EYH B;  2IHN A;  3E0F A;  3RB0 A;  1PUZ A;  3OJS A;  2FPK A;  1S0V A;  3QE9 Y;  1T3N A;  4TUP A;  4QZD A;  5J2E A;  4CF4 A;  3F5A A;  2QB1 A;  5CB1 A;  1NOM A;  2RP5 A;  5ALS A;  4NLN A;  1B43 A;  4FE3 A;  1L8L A;  3IN5 A;  1ZOL A;  7ICR A;  3ZD9 A;  2UVR A;  2MUT B;  4NXZ A;  3NVZ A;  5EE3 A;  3VCB A;  4I2I A;  3SMV A;  1SL2 A;  2BDU A;  4KLG A;  5A0L A;  1BNO A;  4F4X A;  3PO4 A;  3PMN A;  2WF7 A;  1X42 A;  2RLT A;  4YQW A;  4PHE A;  3KZI U;  1TAU A;  2JEI A;  3ZI4 A;  2HHS A;  4UAY A;  3PW4 A;  9ICR A;  3JPO A;  3JPQ A;  1RM6 C;  5ALR A;  4M6W B;  1U4B A;  4O3R A;  4NWI A;  3PML A;  3THV A;  1IM4 A;  1QSS A;  1KN5 A;  9ICN A;  3AMZ A;  3TAD A;  4YR3 A;  5KG6 A;  4KTQ A;  3LDA A;  3HT3 A;  4I2G A;  1ZQF A;  2WF5 A;  3GFK B;  1O03 A;  4X5V A;  3RB6 A;  4P0Q B;  2KZM A;  2YX8 A;  3Q8P B;  3HW8 A;  2GWS A;  2IHM A;  2KTQ A;  3Q8K A;  4M2Y A;  3GV7 B;  3QU9 A;  2FMP A;  2KKV A;  2E5S A;  4K4G A;  5EWF A;  5KFJ A;  5KL1 B;  5HP4 A;  2HVI A;  5KT5 A;  3PY8 A;  3V7K A;  2YMP A;  5J2H A;  5KFQ A;  4UB6 U;  3TI0 A;  1A77 A;  4XRH A;  1SGG A;  1UQV A; 
#chains in the Genus database with same CATH homology
 2KMD A;  2DKX A;  2D8C A;  2KSO A;  5JTI A;  1Z1V A;  4PZO A;  1WWV A;  1SXE A;  5L1M A;  2D3D A;  1JI7 A;  5JRT A;  2DL0 A;  3IDW A;  2KG5 A;  2Y9T A;  1F0M A;  1DXS A;  1X66 A;  1OW5 A;  2QB1 A;  1B0X A;  2JV3 A;  3BS5 B;  5J8Y C;  1RG6 A;  1X9X A;  3SEN A;  1WWU A;  1PK3 A;  2QAR A;  2EAP A;  2QB0 A;  2YTU A;  2DKZ A;  4NL9 C;  2ESE A;  1KW4 A;  5J8Y A;  2Y9U A;  1V38 A;  1PK1 B;  1COK A;  2GLE A;  2EAN A;  2KE7 A;  4PZN A;  1V85 A;  1SV0 C;  3SEI A;  4RQM A;  2ES6 A;  3BS5 A;  2KSO B;  1B4F A;  3H8M A;  2E8N A;  2LPE A;  2F44 A;  3TAD C;  2EAM A;  5F3X B;  2F3N A;  2QKQ A;  2FE9 A;  2E8O A;  2F8K A;  3KKA C;  3TAD A;  2LMR A;  3TAC B;  3K1R B;  2K60 A;  1LKY B;  4RQN A;  4NL9 A;  3KKA A;  2K4P A;  1OXJ A;  4MHV A;  5KNI A;  2QAR B;  2EAO A;  2QB0 B;  1SXD A;  3HIL A;  5JU5 A;  1X40 A;  1SV0 A;  1UCV A;  2B6G A;  4NJ8 A;  1SV4 A;  1PK1 A;  2L5Y A;  1LKY A;  3BQ7 A;  2E8M A;  2E8P A;  3BS7 A;  4IS7 A;  1SGG A;  1UQV A;  2KIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...