2D8CA

Solution structure of the sam-domain of mouse phosphatidyl ceramidecholinephosphotransferase 1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
97
structure length
97
Chain Sequence
b'GSSGSSGMLSARTMKEVVYWSPKKVADWLLENAMPEYCEPLEHFTGQDLINLTQEDFKKPPLYRVSSDNGQRLLDMIETLKMEHHMEAHKNSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphatidylcholine:ceramide cholinephosphotransferase 1
publication title Solution structure of the sam-domain of mouse phosphatidyl ceramidecholinephosphotransferase 1
rcsb
source organism Mus musculus
molecule tags Transferase
total genus 11
structure length 97
sequence length 97
ec nomenclature ec 2.7.8.27: Sphingomyelin synthase.
pdb deposition date 2005-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2d8cA01
1SV4A 2LPEA 5JRTA 1DXSA 1PK1A 1UCVA 1UQVA 4PZOA 1PK1B 1SXEA 1JI7A 2KE7A 3HILA 2KG5A 4NL9A 5J8YA 1SXDA 2QB1A 4NJ8A 2F3NA 1B4FA 2K60A 2Y9TA 2QKQA 1SGGA 2E8MA 3IDWA 2K4PA 1SV0C 2LMRA 1WWVA 2ES6A 2DL0A 1COKA 2QB0A 2YTUA 2DKXA 2L5YA 4PZNA 3KKAC 3TACB 2QB0B 4RQNA 4IS7A 3BS7A 3H8MA 5KNIA 1PK3A 2KMDA 1LKYA 2D8CA 2Y9UA 2EAPA 4MHVA 4RQMA 2EAMA 3K1RB 1LKYB 1KW4A 5JU5A 3BQ7A 1OXJA 2EANA 1X9XA 5F3XB 1WWUA 1SV0A 2F44A 5L1MA 2E8PA 1F0MA 2DKZA 1B0XA 3TADC 3SENA 2QARA 2FE9A 3BS5A 2F8KA 1OW5A 2KSOB 2D3DA 1X66A 2QARB 3BS5B 2EAOA 2JV3A 2GLEA 1X40A 1Z1VA 2E8OA 4NL9C 5J8YC 2ESEA 5JTIA 2B6GA 2E8NA 1RG6A 2KSOA 3SEIA 2KIVA 3KKAA 3TADA 1V38A 1V85A
chains in the Genus database with same CATH superfamily
2AU0A 2F8LA 3AL0B 4Q45A 3N7PD 5EE0A 3MR6A 2V4QA 3H4DA 9ICMA 5DDYA 1H38A 4IRKA 1J2MA 5AIBA 3TQ1A 3D2NA 2BGWA 4P4OA 3VC8A 4PH5A 9ICQA 1ZETA 1FIQA 3PX0A 1U45A 3T5JA 3NVWA 1Z4OA 2E8MA 4MF8A 1SV0C 1S77D 2EZXA 2KHQA 5ALMA 2IMWP 2VKQA 5AM4A 2LYHA 4NV0A 4RQ2A 3TI0A 5AHXA 3PSTA 2OWOA 1MN8A 2DWQA 3V7JA 3TAQA 9ICAA 5TISU 3UMBA 3C2MA 5F3XB 5KFVA 4F5PA 4Q44A 4B9LA 1QSSA 3Q8MA 1FFVA 4PHDA 2ISOA 4TQRA 2W03A 4Q8EA 5EE9A 2Q4TA 1ZD5A 4C4TA 2IOFK 4QWCA 4P0QA 3KD3A 5ALZA 3Q8LA 2M0NA 1GO3F 2PMZF 4NL9C 2WAQF 3M8SA 1LV5A 2DPJA 1T3NA 2ESEA 1MA7A 2R8GA 5EE3A 4Y2TA 2PI5A 1HEKA 2ASJA 1RG6A 3C23A 5L1KA 2H3IA 1SV4A 2KKVA 2LPEA 4O3OA 3NVVA 4KMUA 1PK1A 5ALFA 2BCRA 3MC1A 4YCXA 2K89A 2A1JB 5DBBA 5H2FU 4F5OA 4TQSA 9ICFA 5CWRA 1SWWA 1SIJA 4O9MA 1AROP 1B4FA 1TE2A 4FE3A 4TUQA 1M6YA 1KN5A 4I2HA 5J0WA 1SKWA 7ICLA 4YP3A 5ALHA 1JX4A 4EX6A 1HIWA 5KFRA 4PPXA 2R8KA 4QZEA 2DKXA 4B9VA 3RH6A 4IC9A 3RJKA 5ALTA 3H0RB 4ECYA 3C2LA 1D8LA 3H8MA 3JPSA 4I2AA 1LKYB 2LYBA 4UB1A 4P0QB 3IV6A 5J0RA 4YMMA 5BOLA 4NM1A 3NRWA 4XUSA 4QW8A 4JB3A 4NLNA 4OJ6A 5J0UA 2QARA 3N7SC 3PVXA 1ZQEA 3G6XA 3KBBA 1Q8KA 3R9KA 2JV3A 3RFAA 3JPNA 3PMLA 1MQ3A 5L1LA 2E8OA 5IIIA 2FPKA 1TK0A 5J0YA 3EPGA 3M7DA 1PVRA 4R65A 3CYMA 5A0LA 1ZOLA 3FAHA 4QZHA 5KT5A 1TAUA 9ICJA 3U26A 4KLOA 3ZD9A 1N56A 2D6FC 1X6JA 2HOQA 3QU4A 3PX4A 4Z6CA 2AJQA 4R66A 2JH7A 1UA0A 1TAMA 2C2DA 3V72A 4KLIA 1D9FA 5KT3A 4R64A 1BNOA 3WKDA 2K4PA 2ASLA 5IINA 3JPOA 7ICOA 2G06A 4Y2RA 4QZDA 2W11A 1U48A 3LWLA 1QSYA 1C20A 1Q3VA 5KFDA 3H8JA 4PHEA 3Q8PB 5KNIA 9ICEA 5KFNA 2XGPA 3MGIA 4Y2PA 2AQ4A 2K8CB 1AQ6A 1K1QA 4P2HA 1NI3A 4PGQA 1NJXA 5ALLA 5DB8A 5J0PA 4KLLA 5ALGA 5HMLA 5L1MA 4KLQA 3D2QA 4DF8A 4ECQA 3T79A 4C4RA 1WUDA 4F4WA 1ZYQA 5AI6A 4J9NA 1BPEA 2W8LA 5KFAA 3PW7A 4TURA 3BS5B 3AEVA 2BQ3A 2JGAA 2WHEA 2KIWA 2W8KA 4Z6EA 1ZQ1C 2ZIVB 2R8JA 1HUOA 4KLSA 8ICBA 2B6GA 4MEYA 2F1JA 5AM1A 1BPYA 5DG8A 5AM5A 3KHHA 3UXNA 4X5VA 4FBTA 4FZNA 4UB6U 1Z19A 4GXKA 3J81j 1QTMA 4DWIA 2IOFA 1JROA 4FZLA 3SI8A 2PKEA 5KL1B 2Y1IA 2E5SA 4ED2A 8ICNA 1UQVA 1ZQFA 2I5HA 2WF7A 1JALA 4DL5A 3ZDDA 1ZD4A 2Y1JA 3QEBZ 1QQ5A 1ZQIA 5KG2A 1ZQRA 3F2DA 2OH2A 3ETLA 4M9HA 3SAFA 3RJJA 2JEGA 2BKEA 4GXJA 1L3SA 1NJZA 2HMXA 3PX6A 5B5EU 4NLZA 2EH9A 3RJHA 4RQ1A 4I2FA 7ICIA 1N62A 1ZQKA 4Y2UA 4C7YA 2KP7A 4IR1A 5G5HA 5AI9A 2QB0B 4RQNA 4IS7A 2MA1A 3PY8A 3HRDD 2KZMA 1DRGA 3KHLA 3SYZA 1X9SA 1EXNA 5CA7A 4QW9A 2EZYA 5AK4A 4QIWF 3F2BA 3JPTA 3WK8A 4QWAA 4I2DA 5AKJA 4ED7A 1L7OA 5AM0A 5KT2A 3PR5B 3MR2A 3OHBA 3ONNA 3NVZA 2XO7A 3ZD8A 2GOLA 7ICVA 3C1ZA 4I2JA 4RQ3A 3OHAA 3OTQA 4KITB 2W7PA 2A1AA 5C5JA 2GLEA 5KFUA 2PMZC 4ED1A 4ZOHC 4M04A 2YMPA 4GXIA 5DQHA 1L7MA 1ZQDA 1DGSA 5J8YC 2XY6A 2ZXIA 3ETRA 3MDAA 3I1YA 5D49A 4F2RA 4CNQA 4NLBA 3T5HA 4F4ZA 2PI4A 3EZ5A 4DQIA 1BGXT 4PGXA 1N5XA 4FFDA 1RYRA 4U7CA 9ICCA 4US9A 2XI9A 4UAUA 1T94A 4PGYA 4U6PA 8ICGA 1U47A 2HVHA 5DQGA 4I2IA 5KFTA 4O0IA 3C5FA 1BPBA 1ZQBA 2HHQA 3F2CA 3QUTA 1SZPA 4JWNA 4HYKA 3SD7A 3M8RA 2ASDA 4RPZA 2LHTA 3JPPA 5AKYA 5IIOA 3BZCA 4UATA 2RQ5A 3PW0A 4O5EA 2AHOB 2JXJA 5DBAA 1PK3A 1XSNA 3PO4A 3B0YA 2HHTA 2Y9UA 4A8EA 5AM3A 3PSFA 5ALXA 5JU5A 3RRHA 5J0QA 4RZRA 3HP6A 5IIMA 4E0DA 3BJYA 3QEAZ 2W43A 2BZFA 4QNLA 3AU2A 3GFKB 4UB2A 4AYBF 5DB9A 2VJ4A 3HKZF 5ALDA 1RQNA 3BDPA 5J2AA 7ICUA 2R8HA 3H4BA 2EZZA 8ICCA 4RQ4A 3AMZA 3TARA 1X9MA 2GH1A 1XNSA 5JTIA 4BWMA 5HR7A 2BDUA 2ZIXB 1X2IA 1QQ6A 2G5HB 4RU9A 5J0XA 3OJUA 4ED8A 1NK7A 8ICOA 2Q0ZX 7ICGA 4KLMA 5J29A 3T5LA 1QSLA 1XU4A 3N7RC 1PVPA 1L3UA 2YY6A 7ICPA 3FM9A 2G5IB 3A0BU 1S76D 1XC9A 2IHMA 4DL6A 1BVSA 3V6JA 3Q8QB 4MF2A 2FPLA 1L8LA 9ICXA 2ZUDA 4I2EA 2FLNA 2QB1A 2PXIA 3RAQA 4BXOB 3FYHA 1J97A 3CW2C 5F9LA 3IDWA 3RH4A 2F2AB 2HHSA 5C0YA 1NJYA 4MFFA 4C4SA 1ZQJA 1NK0A 2V4RA 3PW5A 3IN5A 4O3QA 5KFKA 3TACB 2NRVA 3S6JA 4ELTA 1L5UA 3AU6A 4LZDA 4EBCA 1TVAA 2JHDA 4DFMA 5IILA 8ICHA 4Y2XA 4IQWA 4WJ3B 2DPIA 3OGUA 2FDRA 1XO0A 1J2NA 4C8OA 1CUKA 1ZQLA 4R63A 5HP4A 3M6KA 2W9CB 4BWJA 5AIAA 4QJFB 1QCKA 1MC8A 1ZQAA 2ISPA 3T3FA 3I28A 2HBMA 5KFMA 4TUPA 2E3TA 4NLGA 1RPLA 2KICA 2G09A 1DOQA 4P0PB 4I29A 3MGHA 1UT5A 5L1JA 1ZQWA 4LZGA 4QWDA 3GDXA 4RT3A 4J03A 4HAIA 1UCVA 5DB7A 2HI0A 4B6JA 3Q8SB 1LVHA 2YX8A 4EBEA 4C8KA 1KEJA 2XVTA 5F9NA 2C22A 1F5SA 1S0NA 3G6VA 1S97A 4FBUA 2K4EA 2G08A 2ZTDA 4NY8A 1S0OA 1L3VA 1IIPA 1SGGA 5J2CA 1ED1A 1RXVA 2DL0A 3WKEA 2BCQA 5KFSA 8ICPA 4EEYA 2ODGA 2O6KA 1TK5A 7ICSA 2XY7A 4J9RA 3C21A 2W7OA 9ICPA 2WTFA 3RJIA 3QUBA 2KTQA 3IM1A 1K1SA 3WKCA 4QIWC 5EOZA 2EAMA 2KFZA 3CNHA 3MR5A 7ICHA 4B9SA 2MAXA 3I76A 1SV0A 7ICEA 2VJ5A 3PW2A 4GLXA 2E8PA 3WK4A 4M6WA 2W3RA 4C7ZA 2CN1A 4JK1A 3TADC 5DGBA 3MFHA 5KFXA 2MU2A 4GC6A 3BQ2A 3NGDA 5KG5A 4UB3A 3H8WA 5ALWA 4ECSA 4G3IA 5AI4A 2EQYA 3BQTA 4P4PA 9ICVA 1TK8A 4RPXA 2HW3A 5EWGA 4LVSA 4I27A 3V7KA 4UBBA 1WCNA 4KN7A 2KN7A 3HWTA 1UHUA 1Z00A 3KKAA 4Y2VA 2MUTA 4MEXA 4BUGA 1XWLA 3M9MB 8ICEA 3NVYA 2BQUA 4CGZA 1PK1B 1JI7A 3TAPA 8ICZA 1N63A 3HILA 4J9LA 4NM2A 3MGVA 3B9JA 4NL9A 1XSPA 3QXGA 3RBDA 3CRXA 1KQQA 5DQIA 5KG6A 3MDCA 2B21A 2A19A 2YN4A 3TFSA 3M9NB 2NRWA 2LMRA 1KDHA 2JZBA 3UPQA 4ECVA 4BX9C 4QWBA 1KLNA 5HR6A 4Y2JA 4DO9A 5D46A 2WB1F 3BS7A 4DL4A 5ALQA 4DEZA 1V97A 2G0AA 3AQFA 3KHRA 4KLFA 4K4HA 1XO1A 2AGOA 2AGPA 4DLGA 1L6NA 5KL8B 1ECWA 3BQ0A 4KLDA 4UBCA 4F5RA 3HKZC 4J9MA 2MRLA 4DS5A 5DG9A 4RPYA 3C29A 1QLNA 3WKAA 5J0TA 3QU9A 2F8KA 2B0CA 1NJWA 5AI0A 1U9LA 4YR2A 2QARB 3NTUA 3TKAA 8ICTA 3ALRA 4J9PA 4JV1A 2A3VA 1PVQA 1BPZA 5J2HA 2ZIUA 1ZQHA 2LI6A 4C80A 1N48A 3ZDCA 3TFRA 8ICIA 5ALEA 5BPCA 3RF9A 7ICMA 7ICRA 8ICLA 4USAA 2XC9A 2PFPA 2I1QA 4PL2A 2KVSA 1SL0A 5ALSA 1FO4A 8ICXA 3QU7A 9ICBA 3OPXA 5FP0A 2ALZA 1Z3EB 1ZRMA 5KFFA 4P4MA 2QLTA 4DS4A 3OSNA 2Y0SF 3QYPA 4F93B 4DL2A 2K60A 3H0MB 4UB5A 1A76A 3ED5A 3LVVA 2FJ6A 4NLCA 2UVWA 4O3MA 4YMOA 5AKHA 5AI5A 1IXRA 1JN3A 3O0FA 3ISCA 3RB6A 3IG8A 2JEJA 1TV9A 2OHFA 4O3NA 4DQRA 4EENA 2KHVA 3OSPA 4M9GA 2YMLA 1URJA 4RNMA 2UVVA 5J2KA 4YFKA 2VA3A 3EW9A 2W9AA 2ZG6A 5CHGA 4QZAA 3M1YA 4C8NA 3QU5A 3PR4A 2ATLA 1JXLA 3ICXA 4BGDA 4O5KA 3PV8A 1OXJA 4Z6DA 3QE9Y 4IQUA 2BPGA 3C5GA 5HMMA 5E79U 3H0LB 4C8MA 1N5WA 2J6UA 3LDAA 4OD0A 2XCAA 2Z7JA 5KFHA 3UXPA 1L7NA 4OJOA 1NOMA 4JV0A 4UQGA 2R18A 2D3DA 1FFUA 1L7PA 2C2EA 3LK9A 4O3SA 4IL6U 2HOFA 4M9JA 4CE6A 2I9GA 1XS9D 1NKCA 3GV5B 5T14A 3F53A 1SB3C 1N2XA 3GQCA 4RUAA 2E8NA 3PNCA 1BPDA 5KFOA 7ICFA 2NRTA 7ICNA 1VLBA 2FMPA 4R8UA 2HBKA 4IRDA 5ALOA 5D4BA 1T4GA 1PUZA 1IM4A 1KFSA 3GIIA 2WAQC 1WYGA 4IRCA 4FS1A 2ZJAA 4QWEA 9ICNA 4ECRA 4M2YA 4KX3A 4DL3A 2ZTEA 2VA2A 4ELVA 4KTQA 4DQQA 2BR0A 5GTHU 1D9DA 2F3NA 3PZPA 4QZIA 2Y9TA 5K4LA 5J2EA 3HW8A 3GIMA 3THVA 1NK9A 4DFJA 2LKYA 1WWVA 2KVCA 3GIJA 1S9FA 5AICA 2KNJA 3KFUF 2L5YA 2KKPA 3C2KA 5AKIA 1WCLA 3AQEA 4ECXA 5KG1A 2CXYA 2LM1A 2ZIWA 1KTQA 4DOBA 5AI8A 4DF4A 3ISDA 3D6JA 1A0PA 2V9WA 3NS1A 1MSWD 2HHVA 7ICKA 4Y2SA 4IQTA 4G9BA 2FMQA 1WWUA 3DV9A 1ZQVA 3HPOA 2FPMA 4CF4A 1ZQQA 1K5OA 3RH5A 2IOHA 3JPRA 2JEFA 9ICIA 1ZQPA 2RLTA 5KTQA 2NYVA 4B9UA 4DOCA 3KTQA 2W9BA 3IRUA 3K75D 5DGAA 3UMGA 1N60A 1T7PA 3UQ0A 5KFLA 3AN1A 5AKZA 3QUCA 4B9NA 9ICKA 9ICTA 2NO4A 4Y2QA 2DFLA 2H5XA 3T5KA 1SZHA 2IA6A 5KFEA 1CI4A 2BCVA 2IHNA 5EE1A 2BPCA 1KRPA 5KFCA 4JWMA 4YMNA 9ICOA 2BDPA 1PZNA 3GZFA 2KE7A 3ZI4A 5J8YA 4F50A 4JUZA 5L1IA 8ICKA 4K4IA 2JR5A 3WK9A 3PO5A 3WKBA 1IV8A 2ZJ8A 3DDHA 4YXMA 5AM2A 4OJ5A 1NK4A 2K8AA 4OCZA 3MBYA 4PHPA 2J6SA 1RZTA 2YQEA 2ZUBA 2WB1C 4ELUA 4B9TA 1U4BA 5ALVA 4F92B 4DQSA 4JV2A 2ZXHA 5ALIA 2OEHA 5AKLA 4JMUA 5KFYA 3SAGA 4ECZA 5DDMA 1D8BA 3KHGA 3N97B 8ICJA 2GWSA 1D8YA 2P6RA 4KLUA 2WF9A 1ZQXA 5J2GA 1KL9A 3SR6A 5J2BA 8ICQA 4F8RA 2XY5A 3BQ1A 3MFIA 3RR7A 4J9QA 4DSEA 1WG8A 1ZQYA 3WK6A 2WF8A 3SAHA 2FLLA 2NV3A 5HHHA 1B43A 4F72A 3PW4A 2KV2A 1NK5A 1Q3UA 4NLKA 1KSPA 1DK2A 1TAQA 4O3PA 5KFZA 1ZQOA 4YD1A 8ICMA 2DUYA 4CRXA 1DXSA 2KZZA 5KFQA 4ICAA 1RQLA 2A1JA 4QZGA 4BDPA 4KX5A 1HUZA 1JIHA 3SMVA 3SV3A 3N28A 4YVZA 4YG2A 3GIKA 2Y0SC 7ICTA 1YZ7A 2KJ9A 5DG7A 1SXDA 2AXTU 4F71A 3IG5A 8ICSA 1ZQSA 2PFOA 3GU3A 1CEZA 2ES6A 4KLEA 3V7LA 4M47A 5EWEA 4EEKA 4K4GA 5J2JA 3KKAC 5KFBA 5DLGA 3WK5A 2UVUA 4B9MA 4F3OA 2HOIA 1SL2A 1LKYA 4DSKA 1VDVA 8ICVA 2XCPA 2EANA 1RDFA 2ZUCA 2FI1A 3K1ZA 1TFRA 1T3QA 4DOAA 3H40A 2WF5A 5ALUA 3SZ2A 5AKKA 3E2EA 3IP4B 4UAZA 4Z6FA 3RBEA 2VANA 5HHIA 4F5NA 5DLFA 2EAOA 2RDIA 4XRHA 3EUB2 4RNOA 1RXWA 1OUQA 5CB1A 1DGJA 1UT8A 5KFIA 4FZMA 3L4PA 2J6TA 2F1IA 2OM6A 9ICRA 1S5LU 4NWIA 4DSFA 2HDOA 2I6XA 3AM9A 4CDGA 3LVWA 4XA5A 3ZDAA 3C1YA 4KN4A 1ZD2P 1QH9A 4EYHB 1SXEA 4M9NA 4US8A 2N1RA 2W04A 4O3RA 8ICWA 4OO1J 4ACOA 3H7IA 4QZBA 2EDUA 3UMCA 2BPFA 4J9KA 2YB1A 1X6IA 5ALRA 1NNLA 4F4XA 1JRPA 2C2RA 5BOMA 5AK5A 4ED6A 2WFAA 4DL7A 2YTUA 2JRZA 3L3FX 5ALNA 1ZRNA 1NZBA 9ICWA 5B66U 4IR9A 1BNPA 3NRZA 4GIBA 2F77X 3RJGA 4QZ9A 4F2SA 3OJSA 3QUQA 1UPHA 3BZKA 3BQ7A 2ZJ5A 4Y2YA 3C28A 5KT6A 3ORYA 5KT4A 4I2CA 5KG7A 4UB8U 1B0XA 5KT7A 3SENA 2BCUA 4M6WB 3BS5A 5JUMA 5KG3A 3G6YA 3E58A 4C0ZA 2ZIVA 2WF6A 2BHNA 5KFGA 4YR0A 2HHWA 4AYBC 3Q8KA 2E1FA 4RQ8A 3V6HA 5ALKA 2K4IA 3H8SA 3LWMA 8ICUA 1SWVA 1ZJNA 4ECUA 2ZTCA 4ECWA 3TADA 3QZ7A 2BQRA 3RB0A 5HNKA 1XSLA 1Z00B 2XICA 2MUTB 3ISBA 2LBOA 4MFCA 4DFDA 4QZFA 5ALJA 3Q8RB 1QQ7A 4DFPA 4YXJA 2CPRA 4DSIA 1NKBA 2HBJA 3RAXA 4UB4A 4CF3A 2HVIA 4XQ8A 2YMQA 4PJ0U 4J9OA 2H3ZA 9ICGA 4F91B 4UAWA 1VJ5A 4PHAA 1O08A 4CCHA 4O5CA 1IG6A 2P6UA 1SKSA 5KAFU 2AH5A 5AK6A 2JZBB 2QB0A 3F5EA 1ZJMA 3NASA 4YQWA 5ALPA 2DF4B 5GTIU 2F1HA 4YD2A 1ZQMA 2P66A 4Q43A 2KMDA 4OJLA 2D8CA 9ICHA 2YMMA 5CJ7A 2NRXA 2EAPA 4RQMA 3MR3A 9ICUA 3RTVA 5AKEA 3FDSA 1Q46A 3B0XA 2HSZA 1X9XA 4BJQA 1S0MA 5DKWA 1KKXA 2F44A 4F4YA 3TANA 1U49A 3SQIA 2JH1A 1BPXA 3RB3A 3RR8A 2H3QA 4GFJA 5J0SA 3UXOA 4RNNA 1RYSA 3D2SA 3F5AA 1S0VA 1X66A 2RRDA 4RT2A 5J0OA 3M6ZA 1KFTA 2K4HA 2DQNB 1Z1VA 2JEIA 1YT3A 5DBCA 5CEHA 7ICQA 4OJPA 1NZPA 2HCFA 4ED3A 2F76X 2ZIUB 5KFWA 5AKGA 1V38A 3PSPA 3K4GA 3QZ8A 1RM6C 1A6SA 3ZDBA 3QU2A 1RYUA 4PZOA 4UASA 2XGQA 2AGQA 7ICJA 1Y88A 1O03A 3UQ2A 5CP2A 1JXEA 4KMOB 3L5KA 2LM4A 5DB6A 1KBUA 1TKDA 5KG4A 5KFJA 2W54A 2QKQA 1YZ6A 2KFNA 4MFAA 5IIJA 1ZQUA 4GC7A 1COKA 1COOA 1B22A 4PZNA 4YR3A 3M9OB 1MQ2A 1ZXIA 1L3TA 2BCSA 1ZQGA 2W55A 1S10A 5CR0A 4MHVA 2LYAA 4C8LA 1KW4A 4RQ0A 3A0HU 2OXOA 4ECTA 5L9XA 3EYZA 1X42A 4I28A 4IQVA 5ALYA 3KZXA 3HJEA 5TZVA 1F0MA 2PFQA 2DKZA 3IHQB 3RB4A 1A77A 3WU2U 4UAVA 1KFDA 2R8IA 3N4MB 5KFPA 1DK3A 2VA8A 4QZCA 2KD1A 3CP8A 4AP9A 2DBYA 4PL1A 1T8EA 8ICAA 3NUQA 2ZIXA 3FC4A 8ICFA 2H3FA 3ZDEA 1HJPA 5KAIU 4DSJA 3VCBA 5CRXA 2W9MA 4M9LA 4ED0A 4RQ7A 2DGZA 1NK8A 2KSOA 2OYYA 2UVRA 2KIVA 1LB2B 3GV7B 5AK3A 1SKRA 2KEYA 5JRTA 3PMNA 4DSLA 1NKEA 3RJEA 4R8UB 3RJFA 4KLJA 1Z1BA 2KK0A 2IBKA 2XIDA 4EX7A 2HBLA 2CRXA 3UM9A 2RHFA 5J2DA 4UARA 3DEEA 2KG5A 4EZ6A 3KZIU 8ICRA 2FMSA 2GO7A 1P7DA 2FLPA 4RQ5A 3SV4A 1NK6A 4BXOA 3HT3A 4NJ8A 3EPIA 4KLTA 4J9SA 3LYSA 5J2IA 2HHXA 4DQPA 1X9WA 2NO5A 4NXZA 1JMSA 2AQ0A 2W3SA 2NRZA 2K8BB 2P35A 4QZ8A 2E1EA 4RUCA 4EZ9A 8ICYA 2YB4A 4DFKA 1ZQTA 3HX0A 4ZH4A 1F44A 4I2BA 9ICSA 3KOOA 4KLGA 3JPQA 1ZD3A 4Q8FA 4CF5A 1Z4NA 2ZIWB 3K1RB 4LJXA 4YN4A 4DLEA 2JMGA 2PFNA 1S8OA 3MABA 1FEZA 5J2FA 2KJ5A 4TUSA 5EWFA 2VIXA 3QNMA 2KJ8A 3E0FA 3RRGA 4RQ6A 3PSIA 2HHUA 3GILA 3GV8B 2MSNA 3QX7A 2W9CA 1CRXA 1N61A 4FO6A 2M9NA 4UW9A 2C28A 1UA1A 1JUDA 2RP5A 4DCCA 4F5QA 2RDJA 2FE9A 1OW5A 4FS2A 1SL1A 2KSOB 2G07A 4EELA 3WK7A 3AUOA 5AKXA 4UAYA 4M0AA 5KG0A 2W9BB 2KZ3A 1ZQCA 1V9PA 1ZQZA 5IIKA 1X40A 1L8OA 4I2GA 9ICLA 2KOBA 4P0PA 2OCEA 4KLHA 3V6KA 4F4KA 4EYIB 3EWAA 1C7YA 3SEIA 1ZQNA 2H3VA 4EBDA 5G5GA 1V85A
chains in the Genus database with same CATH topology
1SV4A 2LPEA 5JRTA 1DXSA 1PK1A 1UCVA 1UQVA 4PZOA 1PK1B 1SXEA 1JI7A 2KE7A 3HILA 2KG5A 4NL9A 5J8YA 1SXDA 2QB1A 4NJ8A 2F3NA 1B4FA 2K60A 2Y9TA 2QKQA 1SGGA 2E8MA 3IDWA 2K4PA 1SV0C 2LMRA 1WWVA 2ES6A 2DL0A 1COKA 2QB0A 2YTUA 2DKXA 2L5YA 4PZNA 3KKAC 3TACB 2QB0B 4RQNA 4IS7A 3BS7A 3H8MA 5KNIA 1PK3A 2KMDA 1LKYA 2D8CA 2Y9UA 2EAPA 4MHVA 4RQMA 2EAMA 3K1RB 1LKYB 1KW4A 5JU5A 3BQ7A 1OXJA 2EANA 1X9XA 5F3XB 1WWUA 1SV0A 2F44A 5L1MA 2E8PA 1F0MA 2DKZA 1B0XA 3TADC 3SENA 2QARA 2FE9A 3BS5A 2F8KA 1OW5A 2KSOB 2D3DA 1X66A 2QARB 3BS5B 2EAOA 2JV3A 2GLEA 1X40A 1Z1VA 2E8OA 4NL9C 5J8YC 2ESEA 5JTIA 2B6GA 2E8NA 1RG6A 2KSOA 3SEIA 2KIVA 3KKAA 3TADA 1V38A 1V85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SV4 A;  2LPE A;  5JRT A;  1DXS A;  1PK1 A;  1UCV A;  1UQV A;  4PZO A;  1PK1 B;  1SXE A;  1JI7 A;  2KE7 A;  3HIL A;  2KG5 A;  4NL9 A;  5J8Y A;  1SXD A;  2QB1 A;  4NJ8 A;  2F3N A;  1B4F A;  2K60 A;  2Y9T A;  2QKQ A;  1SGG A;  2E8M A;  3IDW A;  2K4P A;  1SV0 C;  2LMR A;  1WWV A;  2ES6 A;  2DL0 A;  1COK A;  2QB0 A;  2YTU A;  2DKX A;  2L5Y A;  4PZN A;  3KKA C;  3TAC B;  2QB0 B;  4RQN A;  4IS7 A;  3BS7 A;  3H8M A;  5KNI A;  1PK3 A;  2KMD A;  1LKY A;  2D8C A;  2Y9U A;  2EAP A;  4MHV A;  4RQM A;  2EAM A;  3K1R B;  1LKY B;  1KW4 A;  5JU5 A;  3BQ7 A;  1OXJ A;  2EAN A;  1X9X A;  5F3X B;  1WWU A;  1SV0 A;  2F44 A;  5L1M A;  2E8P A;  1F0M A;  2DKZ A;  1B0X A;  3TAD C;  3SEN A;  2QAR A;  2FE9 A;  3BS5 A;  2F8K A;  1OW5 A;  2KSO B;  2D3D A;  1X66 A;  2QAR B;  3BS5 B;  2EAO A;  2JV3 A;  2GLE A;  1X40 A;  1Z1V A;  2E8O A;  4NL9 C;  5J8Y C;  2ESE A;  5JTI A;  2B6G A;  2E8N A;  1RG6 A;  2KSO A;  3SEI A;  2KIV A;  3KKA A;  3TAD A;  1V38 A;  1V85 A; 
#chains in the Genus database with same CATH topology
 2AU0 A;  2F8L A;  3AL0 B;  4Q45 A;  3N7P D;  5EE0 A;  3MR6 A;  2V4Q A;  3H4D A;  9ICM A;  5DDY A;  1H38 A;  4IRK A;  1J2M A;  5AIB A;  3TQ1 A;  3D2N A;  2BGW A;  4P4O A;  3VC8 A;  4PH5 A;  9ICQ A;  1ZET A;  1FIQ A;  3PX0 A;  1U45 A;  3T5J A;  3NVW A;  1Z4O A;  2E8M A;  4MF8 A;  1SV0 C;  1S77 D;  2EZX A;  2KHQ A;  5ALM A;  2IMW P;  2VKQ A;  5AM4 A;  2LYH A;  4NV0 A;  4RQ2 A;  3TI0 A;  5AHX A;  3PST A;  2OWO A;  1MN8 A;  2DWQ A;  3V7J A;  3TAQ A;  9ICA A;  5TIS U;  3UMB A;  3C2M A;  5F3X B;  5KFV A;  4F5P A;  4Q44 A;  4B9L A;  1QSS A;  3Q8M A;  1FFV A;  4PHD A;  2ISO A;  4TQR A;  2W03 A;  4Q8E A;  5EE9 A;  2Q4T A;  1ZD5 A;  4C4T A;  2IOF K;  4QWC A;  4P0Q A;  3KD3 A;  5ALZ A;  3Q8L A;  2M0N A;  1GO3 F;  2PMZ F;  4NL9 C;  2WAQ F;  3M8S A;  1LV5 A;  2DPJ A;  1T3N A;  2ESE A;  1MA7 A;  2R8G A;  5EE3 A;  4Y2T A;  2PI5 A;  1HEK A;  2ASJ A;  1RG6 A;  3C23 A;  5L1K A;  2H3I A;  1SV4 A;  2KKV A;  2LPE A;  4O3O A;  3NVV A;  4KMU A;  1PK1 A;  5ALF A;  2BCR A;  3MC1 A;  4YCX A;  2K89 A;  2A1J B;  5DBB A;  5H2F U;  4F5O A;  4TQS A;  9ICF A;  5CWR A;  1SWW A;  1SIJ A;  4O9M A;  1ARO P;  1B4F A;  1TE2 A;  4FE3 A;  4TUQ A;  1M6Y A;  1KN5 A;  4I2H A;  5J0W A;  1SKW A;  7ICL A;  4YP3 A;  5ALH A;  1JX4 A;  4EX6 A;  1HIW A;  5KFR A;  4PPX A;  2R8K A;  4QZE A;  2DKX A;  4B9V A;  3RH6 A;  4IC9 A;  3RJK A;  5ALT A;  3H0R B;  4ECY A;  3C2L A;  1D8L A;  3H8M A;  3JPS A;  4I2A A;  1LKY B;  2LYB A;  4UB1 A;  4P0Q B;  3IV6 A;  5J0R A;  4YMM A;  5BOL A;  4NM1 A;  3NRW A;  4XUS A;  4QW8 A;  4JB3 A;  4NLN A;  4OJ6 A;  5J0U A;  2QAR A;  3N7S C;  3PVX A;  1ZQE A;  3G6X A;  3KBB A;  1Q8K A;  3R9K A;  2JV3 A;  3RFA A;  3JPN A;  3PML A;  1MQ3 A;  5L1L A;  2E8O A;  5III A;  2FPK A;  1TK0 A;  5J0Y A;  3EPG A;  3M7D A;  1PVR A;  4R65 A;  3CYM A;  5A0L A;  1ZOL A;  3FAH A;  4QZH A;  5KT5 A;  1TAU A;  9ICJ A;  3U26 A;  4KLO A;  3ZD9 A;  1N56 A;  2D6F C;  1X6J A;  2HOQ A;  3QU4 A;  3PX4 A;  4Z6C A;  2AJQ A;  4R66 A;  2JH7 A;  1UA0 A;  1TAM A;  2C2D A;  3V72 A;  4KLI A;  1D9F A;  5KT3 A;  4R64 A;  1BNO A;  3WKD A;  2K4P A;  2ASL A;  5IIN A;  3JPO A;  7ICO A;  2G06 A;  4Y2R A;  4QZD A;  2W11 A;  1U48 A;  3LWL A;  1QSY A;  1C20 A;  1Q3V A;  5KFD A;  3H8J A;  4PHE A;  3Q8P B;  5KNI A;  9ICE A;  5KFN A;  2XGP A;  3MGI A;  4Y2P A;  2AQ4 A;  2K8C B;  1AQ6 A;  1K1Q A;  4P2H A;  1NI3 A;  4PGQ A;  1NJX A;  5ALL A;  5DB8 A;  5J0P A;  4KLL A;  5ALG A;  5HML A;  5L1M A;  4KLQ A;  3D2Q A;  4DF8 A;  4ECQ A;  3T79 A;  4C4R A;  1WUD A;  4F4W A;  1ZYQ A;  5AI6 A;  4J9N A;  1BPE A;  2W8L A;  5KFA A;  3PW7 A;  4TUR A;  3BS5 B;  3AEV A;  2BQ3 A;  2JGA A;  2WHE A;  2KIW A;  2W8K A;  4Z6E A;  1ZQ1 C;  2ZIV B;  2R8J A;  1HUO A;  4KLS A;  8ICB A;  2B6G A;  4MEY A;  2F1J A;  5AM1 A;  1BPY A;  5DG8 A;  5AM5 A;  3KHH A;  3UXN A;  4X5V A;  4FBT A;  4FZN A;  4UB6 U;  1Z19 A;  4GXK A;  3J81 j;  1QTM A;  4DWI A;  2IOF A;  1JRO A;  4FZL A;  3SI8 A;  2PKE A;  5KL1 B;  2Y1I A;  2E5S A;  4ED2 A;  8ICN A;  1UQV A;  1ZQF A;  2I5H A;  2WF7 A;  1JAL A;  4DL5 A;  3ZDD A;  1ZD4 A;  2Y1J A;  3QEB Z;  1QQ5 A;  1ZQI A;  5KG2 A;  1ZQR A;  3F2D A;  2OH2 A;  3ETL A;  4M9H A;  3SAF A;  3RJJ A;  2JEG A;  2BKE A;  4GXJ A;  1L3S A;  1NJZ A;  2HMX A;  3PX6 A;  5B5E U;  4NLZ A;  2EH9 A;  3RJH A;  4RQ1 A;  4I2F A;  7ICI A;  1N62 A;  1ZQK A;  4Y2U A;  4C7Y A;  2KP7 A;  4IR1 A;  5G5H A;  5AI9 A;  2QB0 B;  4RQN A;  4IS7 A;  2MA1 A;  3PY8 A;  3HRD D;  2KZM A;  1DRG A;  3KHL A;  3SYZ A;  1X9S A;  1EXN A;  5CA7 A;  4QW9 A;  2EZY A;  5AK4 A;  4QIW F;  3F2B A;  3JPT A;  3WK8 A;  4QWA A;  4I2D A;  5AKJ A;  4ED7 A;  1L7O A;  5AM0 A;  5KT2 A;  3PR5 B;  3MR2 A;  3OHB A;  3ONN A;  3NVZ A;  2XO7 A;  3ZD8 A;  2GOL A;  7ICV A;  3C1Z A;  4I2J A;  4RQ3 A;  3OHA A;  3OTQ A;  4KIT B;  2W7P A;  2A1A A;  5C5J A;  2GLE A;  5KFU A;  2PMZ C;  4ED1 A;  4ZOH C;  4M04 A;  2YMP A;  4GXI A;  5DQH A;  1L7M A;  1ZQD A;  1DGS A;  5J8Y C;  2XY6 A;  2ZXI A;  3ETR A;  3MDA A;  3I1Y A;  5D49 A;  4F2R A;  4CNQ A;  4NLB A;  3T5H A;  4F4Z A;  2PI4 A;  3EZ5 A;  4DQI A;  1BGX T;  4PGX A;  1N5X A;  4FFD A;  1RYR A;  4U7C A;  9ICC A;  4US9 A;  2XI9 A;  4UAU A;  1T94 A;  4PGY A;  4U6P A;  8ICG A;  1U47 A;  2HVH A;  5DQG A;  4I2I A;  5KFT A;  4O0I A;  3C5F A;  1BPB A;  1ZQB A;  2HHQ A;  3F2C A;  3QUT A;  1SZP A;  4JWN A;  4HYK A;  3SD7 A;  3M8R A;  2ASD A;  4RPZ A;  2LHT A;  3JPP A;  5AKY A;  5IIO A;  3BZC A;  4UAT A;  2RQ5 A;  3PW0 A;  4O5E A;  2AHO B;  2JXJ A;  5DBA A;  1PK3 A;  1XSN A;  3PO4 A;  3B0Y A;  2HHT A;  2Y9U A;  4A8E A;  5AM3 A;  3PSF A;  5ALX A;  5JU5 A;  3RRH A;  5J0Q A;  4RZR A;  3HP6 A;  5IIM A;  4E0D A;  3BJY A;  3QEA Z;  2W43 A;  2BZF A;  4QNL A;  3AU2 A;  3GFK B;  4UB2 A;  4AYB F;  5DB9 A;  2VJ4 A;  3HKZ F;  5ALD A;  1RQN A;  3BDP A;  5J2A A;  7ICU A;  2R8H A;  3H4B A;  2EZZ A;  8ICC A;  4RQ4 A;  3AMZ A;  3TAR A;  1X9M A;  2GH1 A;  1XNS A;  5JTI A;  4BWM A;  5HR7 A;  2BDU A;  2ZIX B;  1X2I A;  1QQ6 A;  2G5H B;  4RU9 A;  5J0X A;  3OJU A;  4ED8 A;  1NK7 A;  8ICO A;  2Q0Z X;  7ICG A;  4KLM A;  5J29 A;  3T5L A;  1QSL A;  1XU4 A;  3N7R C;  1PVP A;  1L3U A;  2YY6 A;  7ICP A;  3FM9 A;  2G5I B;  3A0B U;  1S76 D;  1XC9 A;  2IHM A;  4DL6 A;  1BVS A;  3V6J A;  3Q8Q B;  4MF2 A;  2FPL A;  1L8L A;  9ICX A;  2ZUD A;  4I2E A;  2FLN A;  2QB1 A;  2PXI A;  3RAQ A;  4BXO B;  3FYH A;  1J97 A;  3CW2 C;  5F9L A;  3IDW A;  3RH4 A;  2F2A B;  2HHS A;  5C0Y A;  1NJY A;  4MFF A;  4C4S A;  1ZQJ A;  1NK0 A;  2V4R A;  3PW5 A;  3IN5 A;  4O3Q A;  5KFK A;  3TAC B;  2NRV A;  3S6J A;  4ELT A;  1L5U A;  3AU6 A;  4LZD A;  4EBC A;  1TVA A;  2JHD A;  4DFM A;  5IIL A;  8ICH A;  4Y2X A;  4IQW A;  4WJ3 B;  2DPI A;  3OGU A;  2FDR A;  1XO0 A;  1J2N A;  4C8O A;  1CUK A;  1ZQL A;  4R63 A;  5HP4 A;  3M6K A;  2W9C B;  4BWJ A;  5AIA A;  4QJF B;  1QCK A;  1MC8 A;  1ZQA A;  2ISP A;  3T3F A;  3I28 A;  2HBM A;  5KFM A;  4TUP A;  2E3T A;  4NLG A;  1RPL A;  2KIC A;  2G09 A;  1DOQ A;  4P0P B;  4I29 A;  3MGH A;  1UT5 A;  5L1J A;  1ZQW A;  4LZG A;  4QWD A;  3GDX A;  4RT3 A;  4J03 A;  4HAI A;  1UCV A;  5DB7 A;  2HI0 A;  4B6J A;  3Q8S B;  1LVH A;  2YX8 A;  4EBE A;  4C8K A;  1KEJ A;  2XVT A;  5F9N A;  2C22 A;  1F5S A;  1S0N A;  3G6V A;  1S97 A;  4FBU A;  2K4E A;  2G08 A;  2ZTD A;  4NY8 A;  1S0O A;  1L3V A;  1IIP A;  1SGG A;  5J2C A;  1ED1 A;  1RXV A;  2DL0 A;  3WKE A;  2BCQ A;  5KFS A;  8ICP A;  4EEY A;  2ODG A;  2O6K A;  1TK5 A;  7ICS A;  2XY7 A;  4J9R A;  3C21 A;  2W7O A;  9ICP A;  2WTF A;  3RJI A;  3QUB A;  2KTQ A;  3IM1 A;  1K1S A;  3WKC A;  4QIW C;  5EOZ A;  2EAM A;  2KFZ A;  3CNH A;  3MR5 A;  7ICH A;  4B9S A;  2MAX A;  3I76 A;  1SV0 A;  7ICE A;  2VJ5 A;  3PW2 A;  4GLX A;  2E8P A;  3WK4 A;  4M6W A;  2W3R A;  4C7Z A;  2CN1 A;  4JK1 A;  3TAD C;  5DGB A;  3MFH A;  5KFX A;  2MU2 A;  4GC6 A;  3BQ2 A;  3NGD A;  5KG5 A;  4UB3 A;  3H8W A;  5ALW A;  4ECS A;  4G3I A;  5AI4 A;  2EQY A;  3BQT A;  4P4P A;  9ICV A;  1TK8 A;  4RPX A;  2HW3 A;  5EWG A;  4LVS A;  4I27 A;  3V7K A;  4UBB A;  1WCN A;  4KN7 A;  2KN7 A;  3HWT A;  1UHU A;  1Z00 A;  3KKA A;  4Y2V A;  2MUT A;  4MEX A;  4BUG A;  1XWL A;  3M9M B;  8ICE A;  3NVY A;  2BQU A;  4CGZ A;  1PK1 B;  1JI7 A;  3TAP A;  8ICZ A;  1N63 A;  3HIL A;  4J9L A;  4NM2 A;  3MGV A;  3B9J A;  4NL9 A;  1XSP A;  3QXG A;  3RBD A;  3CRX A;  1KQQ A;  5DQI A;  5KG6 A;  3MDC A;  2B21 A;  2A19 A;  2YN4 A;  3TFS A;  3M9N B;  2NRW A;  2LMR A;  1KDH A;  2JZB A;  3UPQ A;  4ECV A;  4BX9 C;  4QWB A;  1KLN A;  5HR6 A;  4Y2J A;  4DO9 A;  5D46 A;  2WB1 F;  3BS7 A;  4DL4 A;  5ALQ A;  4DEZ A;  1V97 A;  2G0A A;  3AQF A;  3KHR A;  4KLF A;  4K4H A;  1XO1 A;  2AGO A;  2AGP A;  4DLG A;  1L6N A;  5KL8 B;  1ECW A;  3BQ0 A;  4KLD A;  4UBC A;  4F5R A;  3HKZ C;  4J9M A;  2MRL A;  4DS5 A;  5DG9 A;  4RPY A;  3C29 A;  1QLN A;  3WKA A;  5J0T A;  3QU9 A;  2F8K A;  2B0C A;  1NJW A;  5AI0 A;  1U9L A;  4YR2 A;  2QAR B;  3NTU A;  3TKA A;  8ICT A;  3ALR A;  4J9P A;  4JV1 A;  2A3V A;  1PVQ A;  1BPZ A;  5J2H A;  2ZIU A;  1ZQH A;  2LI6 A;  4C80 A;  1N48 A;  3ZDC A;  3TFR A;  8ICI A;  5ALE A;  5BPC A;  3RF9 A;  7ICM A;  7ICR A;  8ICL A;  4USA A;  2XC9 A;  2PFP A;  2I1Q A;  4PL2 A;  2KVS A;  1SL0 A;  5ALS A;  1FO4 A;  8ICX A;  3QU7 A;  9ICB A;  3OPX A;  5FP0 A;  2ALZ A;  1Z3E B;  1ZRM A;  5KFF A;  4P4M A;  2QLT A;  4DS4 A;  3OSN A;  2Y0S F;  3QYP A;  4F93 B;  4DL2 A;  2K60 A;  3H0M B;  4UB5 A;  1A76 A;  3ED5 A;  3LVV A;  2FJ6 A;  4NLC A;  2UVW A;  4O3M A;  4YMO A;  5AKH A;  5AI5 A;  1IXR A;  1JN3 A;  3O0F A;  3ISC A;  3RB6 A;  3IG8 A;  2JEJ A;  1TV9 A;  2OHF A;  4O3N A;  4DQR A;  4EEN A;  2KHV A;  3OSP A;  4M9G A;  2YML A;  1URJ A;  4RNM A;  2UVV A;  5J2K A;  4YFK A;  2VA3 A;  3EW9 A;  2W9A A;  2ZG6 A;  5CHG A;  4QZA A;  3M1Y A;  4C8N A;  3QU5 A;  3PR4 A;  2ATL A;  1JXL A;  3ICX A;  4BGD A;  4O5K A;  3PV8 A;  1OXJ A;  4Z6D A;  3QE9 Y;  4IQU A;  2BPG A;  3C5G A;  5HMM A;  5E79 U;  3H0L B;  4C8M A;  1N5W A;  2J6U A;  3LDA A;  4OD0 A;  2XCA A;  2Z7J A;  5KFH A;  3UXP A;  1L7N A;  4OJO A;  1NOM A;  4JV0 A;  4UQG A;  2R18 A;  2D3D A;  1FFU A;  1L7P A;  2C2E A;  3LK9 A;  4O3S A;  4IL6 U;  2HOF A;  4M9J A;  4CE6 A;  2I9G A;  1XS9 D;  1NKC A;  3GV5 B;  5T14 A;  3F53 A;  1SB3 C;  1N2X A;  3GQC A;  4RUA A;  2E8N A;  3PNC A;  1BPD A;  5KFO A;  7ICF A;  2NRT A;  7ICN A;  1VLB A;  2FMP A;  4R8U A;  2HBK A;  4IRD A;  5ALO A;  5D4B A;  1T4G A;  1PUZ A;  1IM4 A;  1KFS A;  3GII A;  2WAQ C;  1WYG A;  4IRC A;  4FS1 A;  2ZJA A;  4QWE A;  9ICN A;  4ECR A;  4M2Y A;  4KX3 A;  4DL3 A;  2ZTE A;  2VA2 A;  4ELV A;  4KTQ A;  4DQQ A;  2BR0 A;  5GTH U;  1D9D A;  2F3N A;  3PZP A;  4QZI A;  2Y9T A;  5K4L A;  5J2E A;  3HW8 A;  3GIM A;  3THV A;  1NK9 A;  4DFJ A;  2LKY A;  1WWV A;  2KVC A;  3GIJ A;  1S9F A;  5AIC A;  2KNJ A;  3KFU F;  2L5Y A;  2KKP A;  3C2K A;  5AKI A;  1WCL A;  3AQE A;  4ECX A;  5KG1 A;  2CXY A;  2LM1 A;  2ZIW A;  1KTQ A;  4DOB A;  5AI8 A;  4DF4 A;  3ISD A;  3D6J A;  1A0P A;  2V9W A;  3NS1 A;  1MSW D;  2HHV A;  7ICK A;  4Y2S A;  4IQT A;  4G9B A;  2FMQ A;  1WWU A;  3DV9 A;  1ZQV A;  3HPO A;  2FPM A;  4CF4 A;  1ZQQ A;  1K5O A;  3RH5 A;  2IOH A;  3JPR A;  2JEF A;  9ICI A;  1ZQP A;  2RLT A;  5KTQ A;  2NYV A;  4B9U A;  4DOC A;  3KTQ A;  2W9B A;  3IRU A;  3K75 D;  5DGA A;  3UMG A;  1N60 A;  1T7P A;  3UQ0 A;  5KFL A;  3AN1 A;  5AKZ A;  3QUC A;  4B9N A;  9ICK A;  9ICT A;  2NO4 A;  4Y2Q A;  2DFL A;  2H5X A;  3T5K A;  1SZH A;  2IA6 A;  5KFE A;  1CI4 A;  2BCV A;  2IHN A;  5EE1 A;  2BPC A;  1KRP A;  5KFC A;  4JWM A;  4YMN A;  9ICO A;  2BDP A;  1PZN A;  3GZF A;  2KE7 A;  3ZI4 A;  5J8Y A;  4F50 A;  4JUZ A;  5L1I A;  8ICK A;  4K4I A;  2JR5 A;  3WK9 A;  3PO5 A;  3WKB A;  1IV8 A;  2ZJ8 A;  3DDH A;  4YXM A;  5AM2 A;  4OJ5 A;  1NK4 A;  2K8A A;  4OCZ A;  3MBY A;  4PHP A;  2J6S A;  1RZT A;  2YQE A;  2ZUB A;  2WB1 C;  4ELU A;  4B9T A;  1U4B A;  5ALV A;  4F92 B;  4DQS A;  4JV2 A;  2ZXH A;  5ALI A;  2OEH A;  5AKL A;  4JMU A;  5KFY A;  3SAG A;  4ECZ A;  5DDM A;  1D8B A;  3KHG A;  3N97 B;  8ICJ A;  2GWS A;  1D8Y A;  2P6R A;  4KLU A;  2WF9 A;  1ZQX A;  5J2G A;  1KL9 A;  3SR6 A;  5J2B A;  8ICQ A;  4F8R A;  2XY5 A;  3BQ1 A;  3MFI A;  3RR7 A;  4J9Q A;  4DSE A;  1WG8 A;  1ZQY A;  3WK6 A;  2WF8 A;  3SAH A;  2FLL A;  2NV3 A;  5HHH A;  1B43 A;  4F72 A;  3PW4 A;  2KV2 A;  1NK5 A;  1Q3U A;  4NLK A;  1KSP A;  1DK2 A;  1TAQ A;  4O3P A;  5KFZ A;  1ZQO A;  4YD1 A;  8ICM A;  2DUY A;  4CRX A;  1DXS A;  2KZZ A;  5KFQ A;  4ICA A;  1RQL A;  2A1J A;  4QZG A;  4BDP A;  4KX5 A;  1HUZ A;  1JIH A;  3SMV A;  3SV3 A;  3N28 A;  4YVZ A;  4YG2 A;  3GIK A;  2Y0S C;  7ICT A;  1YZ7 A;  2KJ9 A;  5DG7 A;  1SXD A;  2AXT U;  4F71 A;  3IG5 A;  8ICS A;  1ZQS A;  2PFO A;  3GU3 A;  1CEZ A;  2ES6 A;  4KLE A;  3V7L A;  4M47 A;  5EWE A;  4EEK A;  4K4G A;  5J2J A;  3KKA C;  5KFB A;  5DLG A;  3WK5 A;  2UVU A;  4B9M A;  4F3O A;  2HOI A;  1SL2 A;  1LKY A;  4DSK A;  1VDV A;  8ICV A;  2XCP A;  2EAN A;  1RDF A;  2ZUC A;  2FI1 A;  3K1Z A;  1TFR A;  1T3Q A;  4DOA A;  3H40 A;  2WF5 A;  5ALU A;  3SZ2 A;  5AKK A;  3E2E A;  3IP4 B;  4UAZ A;  4Z6F A;  3RBE A;  2VAN A;  5HHI A;  4F5N A;  5DLF A;  2EAO A;  2RDI A;  4XRH A;  3EUB 2;  4RNO A;  1RXW A;  1OUQ A;  5CB1 A;  1DGJ A;  1UT8 A;  5KFI A;  4FZM A;  3L4P A;  2J6T A;  2F1I A;  2OM6 A;  9ICR A;  1S5L U;  4NWI A;  4DSF A;  2HDO A;  2I6X A;  3AM9 A;  4CDG A;  3LVW A;  4XA5 A;  3ZDA A;  3C1Y A;  4KN4 A;  1ZD2 P;  1QH9 A;  4EYH B;  1SXE A;  4M9N A;  4US8 A;  2N1R A;  2W04 A;  4O3R A;  8ICW A;  4OO1 J;  4ACO A;  3H7I A;  4QZB A;  2EDU A;  3UMC A;  2BPF A;  4J9K A;  2YB1 A;  1X6I A;  5ALR A;  1NNL A;  4F4X A;  1JRP A;  2C2R A;  5BOM A;  5AK5 A;  4ED6 A;  2WFA A;  4DL7 A;  2YTU A;  2JRZ A;  3L3F X;  5ALN A;  1ZRN A;  1NZB A;  9ICW A;  5B66 U;  4IR9 A;  1BNP A;  3NRZ A;  4GIB A;  2F77 X;  3RJG A;  4QZ9 A;  4F2S A;  3OJS A;  3QUQ A;  1UPH A;  3BZK A;  3BQ7 A;  2ZJ5 A;  4Y2Y A;  3C28 A;  5KT6 A;  3ORY A;  5KT4 A;  4I2C A;  5KG7 A;  4UB8 U;  1B0X A;  5KT7 A;  3SEN A;  2BCU A;  4M6W B;  3BS5 A;  5JUM A;  5KG3 A;  3G6Y A;  3E58 A;  4C0Z A;  2ZIV A;  2WF6 A;  2BHN A;  5KFG A;  4YR0 A;  2HHW A;  4AYB C;  3Q8K A;  2E1F A;  4RQ8 A;  3V6H A;  5ALK A;  2K4I A;  3H8S A;  3LWM A;  8ICU A;  1SWV A;  1ZJN A;  4ECU A;  2ZTC A;  4ECW A;  3TAD A;  3QZ7 A;  2BQR A;  3RB0 A;  5HNK A;  1XSL A;  1Z00 B;  2XIC A;  2MUT B;  3ISB A;  2LBO A;  4MFC A;  4DFD A;  4QZF A;  5ALJ A;  3Q8R B;  1QQ7 A;  4DFP A;  4YXJ A;  2CPR A;  4DSI A;  1NKB A;  2HBJ A;  3RAX A;  4UB4 A;  4CF3 A;  2HVI A;  4XQ8 A;  2YMQ A;  4PJ0 U;  4J9O A;  2H3Z A;  9ICG A;  4F91 B;  4UAW A;  1VJ5 A;  4PHA A;  1O08 A;  4CCH A;  4O5C A;  1IG6 A;  2P6U A;  1SKS A;  5KAF U;  2AH5 A;  5AK6 A;  2JZB B;  2QB0 A;  3F5E A;  1ZJM A;  3NAS A;  4YQW A;  5ALP A;  2DF4 B;  5GTI U;  2F1H A;  4YD2 A;  1ZQM A;  2P66 A;  4Q43 A;  2KMD A;  4OJL A;  2D8C A;  9ICH A;  2YMM A;  5CJ7 A;  2NRX A;  2EAP A;  4RQM A;  3MR3 A;  9ICU A;  3RTV A;  5AKE A;  3FDS A;  1Q46 A;  3B0X A;  2HSZ A;  1X9X A;  4BJQ A;  1S0M A;  5DKW A;  1KKX A;  2F44 A;  4F4Y A;  3TAN A;  1U49 A;  3SQI A;  2JH1 A;  1BPX A;  3RB3 A;  3RR8 A;  2H3Q A;  4GFJ A;  5J0S A;  3UXO A;  4RNN A;  1RYS A;  3D2S A;  3F5A A;  1S0V A;  1X66 A;  2RRD A;  4RT2 A;  5J0O A;  3M6Z A;  1KFT A;  2K4H A;  2DQN B;  1Z1V A;  2JEI A;  1YT3 A;  5DBC A;  5CEH A;  7ICQ A;  4OJP A;  1NZP A;  2HCF A;  4ED3 A;  2F76 X;  2ZIU B;  5KFW A;  5AKG A;  1V38 A;  3PSP A;  3K4G A;  3QZ8 A;  1RM6 C;  1A6S A;  3ZDB A;  3QU2 A;  1RYU A;  4PZO A;  4UAS A;  2XGQ A;  2AGQ A;  7ICJ A;  1Y88 A;  1O03 A;  3UQ2 A;  5CP2 A;  1JXE A;  4KMO B;  3L5K A;  2LM4 A;  5DB6 A;  1KBU A;  1TKD A;  5KG4 A;  5KFJ A;  2W54 A;  2QKQ A;  1YZ6 A;  2KFN A;  4MFA A;  5IIJ A;  1ZQU A;  4GC7 A;  1COK A;  1COO A;  1B22 A;  4PZN A;  4YR3 A;  3M9O B;  1MQ2 A;  1ZXI A;  1L3T A;  2BCS A;  1ZQG A;  2W55 A;  1S10 A;  5CR0 A;  4MHV A;  2LYA A;  4C8L A;  1KW4 A;  4RQ0 A;  3A0H U;  2OXO A;  4ECT A;  5L9X A;  3EYZ A;  1X42 A;  4I28 A;  4IQV A;  5ALY A;  3KZX A;  3HJE A;  5TZV A;  1F0M A;  2PFQ A;  2DKZ A;  3IHQ B;  3RB4 A;  1A77 A;  3WU2 U;  4UAV A;  1KFD A;  2R8I A;  3N4M B;  5KFP A;  1DK3 A;  2VA8 A;  4QZC A;  2KD1 A;  3CP8 A;  4AP9 A;  2DBY A;  4PL1 A;  1T8E A;  8ICA A;  3NUQ A;  2ZIX A;  3FC4 A;  8ICF A;  2H3F A;  3ZDE A;  1HJP A;  5KAI U;  4DSJ A;  3VCB A;  5CRX A;  2W9M A;  4M9L A;  4ED0 A;  4RQ7 A;  2DGZ A;  1NK8 A;  2KSO A;  2OYY A;  2UVR A;  2KIV A;  1LB2 B;  3GV7 B;  5AK3 A;  1SKR A;  2KEY A;  5JRT A;  3PMN A;  4DSL A;  1NKE A;  3RJE A;  4R8U B;  3RJF A;  4KLJ A;  1Z1B A;  2KK0 A;  2IBK A;  2XID A;  4EX7 A;  2HBL A;  2CRX A;  3UM9 A;  2RHF A;  5J2D A;  4UAR A;  3DEE A;  2KG5 A;  4EZ6 A;  3KZI U;  8ICR A;  2FMS A;  2GO7 A;  1P7D A;  2FLP A;  4RQ5 A;  3SV4 A;  1NK6 A;  4BXO A;  3HT3 A;  4NJ8 A;  3EPI A;  4KLT A;  4J9S A;  3LYS A;  5J2I A;  2HHX A;  4DQP A;  1X9W A;  2NO5 A;  4NXZ A;  1JMS A;  2AQ0 A;  2W3S A;  2NRZ A;  2K8B B;  2P35 A;  4QZ8 A;  2E1E A;  4RUC A;  4EZ9 A;  8ICY A;  2YB4 A;  4DFK A;  1ZQT A;  3HX0 A;  4ZH4 A;  1F44 A;  4I2B A;  9ICS A;  3KOO A;  4KLG A;  3JPQ A;  1ZD3 A;  4Q8F A;  4CF5 A;  1Z4N A;  2ZIW B;  3K1R B;  4LJX A;  4YN4 A;  4DLE A;  2JMG A;  2PFN A;  1S8O A;  3MAB A;  1FEZ A;  5J2F A;  2KJ5 A;  4TUS A;  5EWF A;  2VIX A;  3QNM A;  2KJ8 A;  3E0F A;  3RRG A;  4RQ6 A;  3PSI A;  2HHU A;  3GIL A;  3GV8 B;  2MSN A;  3QX7 A;  2W9C A;  1CRX A;  1N61 A;  4FO6 A;  2M9N A;  4UW9 A;  2C28 A;  1UA1 A;  1JUD A;  2RP5 A;  4DCC A;  4F5Q A;  2RDJ A;  2FE9 A;  1OW5 A;  4FS2 A;  1SL1 A;  2KSO B;  2G07 A;  4EEL A;  3WK7 A;  3AUO A;  5AKX A;  4UAY A;  4M0A A;  5KG0 A;  2W9B B;  2KZ3 A;  1ZQC A;  1V9P A;  1ZQZ A;  5IIK A;  1X40 A;  1L8O A;  4I2G A;  9ICL A;  2KOB A;  4P0P A;  2OCE A;  4KLH A;  3V6K A;  4F4K A;  4EYI B;  3EWA A;  1C7Y A;  3SEI A;  1ZQN A;  2H3V A;  4EBD A;  5G5G A;  1V85 A; 
#chains in the Genus database with same CATH homology
 1SV4 A;  2LPE A;  5JRT A;  1DXS A;  1PK1 A;  1UCV A;  1UQV A;  4PZO A;  1PK1 B;  1SXE A;  1JI7 A;  2KE7 A;  3HIL A;  2KG5 A;  4NL9 A;  5J8Y A;  1SXD A;  2QB1 A;  4NJ8 A;  2F3N A;  1B4F A;  2K60 A;  2Y9T A;  2QKQ A;  1SGG A;  2E8M A;  3IDW A;  2K4P A;  1SV0 C;  2LMR A;  1WWV A;  2ES6 A;  2DL0 A;  1COK A;  2QB0 A;  2YTU A;  2DKX A;  2L5Y A;  4PZN A;  3KKA C;  3TAC B;  2QB0 B;  4RQN A;  4IS7 A;  3BS7 A;  3H8M A;  5KNI A;  1PK3 A;  2KMD A;  1LKY A;  2D8C A;  2Y9U A;  2EAP A;  4MHV A;  4RQM A;  2EAM A;  3K1R B;  1LKY B;  1KW4 A;  5JU5 A;  3BQ7 A;  1OXJ A;  2EAN A;  1X9X A;  5F3X B;  1WWU A;  1SV0 A;  2F44 A;  5L1M A;  2E8P A;  1F0M A;  2DKZ A;  1B0X A;  3TAD C;  3SEN A;  2QAR A;  2FE9 A;  3BS5 A;  2F8K A;  1OW5 A;  2KSO B;  2D3D A;  1X66 A;  2QAR B;  3BS5 B;  2EAO A;  2JV3 A;  2GLE A;  1X40 A;  1Z1V A;  2E8O A;  4NL9 C;  5J8Y C;  2ESE A;  5JTI A;  2B6G A;  2E8N A;  1RG6 A;  2KSO A;  3SEI A;  2KIV A;  3KKA A;  3TAD A;  1V38 A;  1V85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...