2D8HA

Solution structure of the sh3 domain of hypothetical protein sh3yl1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
80
structure length
80
Chain Sequence
GSSGSSGHERVGNLNQPIEVTALYSFEGQQPGDLNFQAGDRITVISKTDSHFDWWEGKLRGQTGIFPANYVTMNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3YL1 protein
publication title Solution structure of the SH3 domain of Hypothetical protein SH3YL1
rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 8
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2d8hA00
4HXJA 4CC2A 1KJWA 2SEMA 1NEBA 3UATA 1FMKA 1NEGA 1T0HA 4GLMA 2LJ0A 2GBQA 3R6NA 3M0SA 2BZYA 1V1CA 1M3BA 1X6GA 1YCSB 1I1JA 2EYZA 1K4US 4AFQC 1AEYA 4LUDA 4AFUC 2GTJA 2W10A 3M0QA 1JXOA 1MV3A 1ARKA 1WFWA 2DX1A 1QCFA 4JJCA 3VRZA 3UA7A 2DLPA 1QKWA 2B86A 2K3BA 2MCNA 2AZVA 3PVLA 2J06A 3TSWA 4AG1C 4RTXA 4AFZC 1JO8A 4GBQA 1TUCA 1FYNA 2D8HA 2RPNA 2I0NA 5EC7A 1SRLA 2J7IA 1RUWA 1UE9A 1YN8A 2H8HA 1ZUYA 1B07A 2FO0A 2HEQA 4DEYA 2LNHB 1GFDA 2LQNA 2V1RA 3EG2A 2ED0A 1ZX6A 4OMNA 3VS0A 1PRMC 4OMOA 1SSHA 4LN2A 3JV3A 3VS7A 2DL7A 1GCPA 2DJQA 2JS2A 2MOXA 2FPEA 2XMFA 4J9GA 3H0HA 2VWFA 1T3LA 1G2BA 2DF6A 2E5KA 2A08A 2JS0A 1JQQA 3I5RA 2EQIA 2P4RA 4J9EA 2C0OA 1H3HA 1MUZA 2KYMA 3REBB 1IO6A 2O31A 4OMQA 2RQVA 5IHNA 1OPKA 1WX6A 1GRIA 2ECZA 2LP5A 4J9IA 2EYYA 1WYXA 2DL8A 2D8JA 1RLPC 1PKTA 3M0UA 4FSSA 3TSZA 2KR3A 2EGAA 1M30A 1JXMA 2PZ1A 4CC7A 1E6GA 3EG1A 3NGPA 2ENMA 3O5ZA 1X69A 2CUBA 1X2QA 1Y57A 4EIKA 2CDTA 1S1NA 1UECA 2JTEA 4J9BA 1NYFA 2KNBB 1SPKA 3GBQA 2D1XA 2DA9A 1OPLA 1GBQA 2HDAA 1AVZC 2JM9A 1SRMA 2C0IA 3A98A 4AG2C 3M0RA 1WIEA 1BU1A 5GJVB 2GGRA 1NM7A 4JZ4A 2EW3A 2DILA 2JT4A 3THKA 2YT6A 2PTKA 4X1VA 1WA7A 2AKKA 1A0NB 1NLPC 3KFVA 2DYBA 2J6KA 2O9VA 3H41A 3EHRA 1UG1A 2L3SA 2JMCA 3M0PA 4OMPA 1AOJA 1ZUUA 1KSWA 1K1ZA 3EHQA 2BZXA 2EKHA 3NMZC 3U23A 2F2VA 1PNJA 1PRLC 3I9QA 2J6FA 4Z89A 2EPDA 2JW4A 5IXBA 4JJBA 4RTZA 1UUEA 2DRMA 1X6BA 2DM1A 1U5SA 1WXBA 4HVWA 1VYTA 2HSPA 4A63B 2J6OA 2KE9A 3IQLA 4QT7A 1SEMA 1TUDA 1UFFA 1HSQA 4ESRA 1PHTA 2KGTA 1SHFA 1UHCA 4RUGA 1WDXA 2G6FX 2JM8A 2YUQA 2FPFA 4Z8AA 2CSQA 4OMMA 4Z88A 4CC4B 2KBTA 1WXTA 4AFSC 1J3TA 2RQWA 2DMOA 4CC3A 2ESWA 2DBKA 2DE0X 3EG0A 2EVRA 4M4ZA 4Y92A 4HVVA 4LE9A 1M3AA 1GL5A 1CKBA 4OMLA 2CH4A 4IIMA 1K76A 1M8MA 2O2OA 2D0NA 2AK5A 1PWTA 2K79A 1E7OA 1T3SA 2YDLA 3PE0A 1G83A 1VYUA 4RTYA 2DNUA 4J9CA 3SEMA 2FRWA 1CSKA 5IHIA 1RI9A 2HBWA 1K0SA 1UTIA 1X27A 4HVUA 4E6RA 4KRTA 2M51A 1UJ0A 3NHNA 1YWOA 2PNIA 1SHGA 2L2PA 2CT3A 4LUEA 2V1QA 1M3CA 2AZSA 2ED1A 2RQUA 1WLPB 5HCKA 3EGUA 1YNZA 1QKXA 2FPDA 2NUZA 4K11A 3VS1A 2AKLA 3I35A 3UA6A 2EYXA 3REAB 2GQIA 2CT4A 3QWXX 2KRMA 1AWJA 1UHFA 1W1FA 3LH5A 4JPBW 2A28A 1H92A 1YP5A 2OJ2A 4ORZA 1WI7A 1GBRA 1QWEA 2K9GA 2BTTA 2KYBA 4HCKA 4LNPA 1HJDA 1LCKA 2KT8A 2K6DA 2OI3A 2F2XA 2O88A 4F14A 1EFNA 2KT1A 2KRSA 1I07A 3ZL7C 5FW9A 4ZNXA 1CKAA 1PKSA 4RTWA 1UGVA 1BK2A 1GCQA 2DL3A 2YUNA 1XOVA 4RTVA 2EBPA 2HCKA 3NPFA 4JZ3A 4RTTA 2CUDA 1HD3A 3EG3A 1NYGA 3M0TA 1X2KA 1AZEA 4J9DA 1AD5A 1H8KA 5IXFA 2EGEA 2J05A 2ROTA 3TVTA 2DRKA 1ABQA 2RN8A 1VYVA 4F17A 1Z9ZA 2K2MA 2ABLA 4J9FA 4J9HA 4WCIA 2M0YA 2EYWA 5FWBA 1X43A 2C0TA 2BZ8A 2X3WD 2VKNA 2DVJA 4JJDA 3ULRB 1YWPA 2W0ZA 4RTUA 1BBZA 3I5SA 2JXBA 1U06A 2RMOA 2YSQA 1E6HA 1W6XA 1ZSGA 1AZGB 1ZBJA 1AWXA 4R0KA 5IHKA 1OEBA 4D8KA 1ZLMA 1K9AA 2MIOA 2YUOA 1W70A 2IIMA 5FWCA 1U3OA 2KEAA 1KIKA 2KRNA 2LJ1A 1VA7A 2CREA 2RQTA 1AWOA 2EGCA 1T0JA 2KXDA 1K0XA 2CSIA 2ROLA 1OOTA 1QLYA 2GTOA 1JEGA 4IIOA 1ABOA 3RBBB 1ZUKA 2LCSA 3VS4A 1Y0MA 2KXCA 3UF4A 2L3PA 3PVQA 4F16A 2A37A 5I11A 3FJ5A 3RNJA 3H0IA 2JMAA 2OAWA 2A36A 1NLOC 1MV0B 2VVKA 2LQWA 2L3QA 2FG0A 2SRCA 1GFCA 2LZ6B 5ECAA 4D8DA 1BB9A 2FEIA 1TG0A 2LMJA 3VRYA 4DEXA 1I0CA 1AWWA 5IH2A 3H0FA 3SHWA 3VS5A 2DBMA 2F2WA 1OV3A 5L23A 2NWMA 1M27C 3CQTA 1JU5C 1B3QA 3VS6A 1N5ZA 2CH4W 2GNCA 2LJ3A 1GCQC 2DL5A 1UJYA 2KROA 3VS2A 1UDLA 2RF0A 1RLQC 1NG2A 2K7AA 3QWYA 2X3XD 5GJWB 1KFZA 1Z9QA 2QDLA 2RQRA 2LX7A 2YUPA 2RNAA 1QWFA 2FRYA 2O9SA 2DL4A 3VS3A 5I22A 2L0AA 1WXUA 3C0CA
chains in the Genus database with same CATH superfamily
1NEBA 2XKOC 1FMKA 1YITT 1VQ8A 1T0HA 4M7DB 4GLMA 3M5AA 2LJ0A 2ZPGB 1YJWA 1I1JA 5GANj 1AEYA 2D6FA 2YLCA 4LUDA 1UB4A 1WNLA 2EQJA 4AFUC 1RI0A 4C92G 4HT9A 4N0AC 3M0QA 3TEEA 1IB8A 1ARKA 3VYHB 2DX1A 1YJ9Q 2FB7A 4PJOA 2DLPA 1FMWA 5C6SA 1QKWA 2B86A 4PFZA 4BY6B 5CKFA 1D1BA 2BKDN 4PJJA 4LDXA 5KCHA 1JO8A 5GAN2 1JB0E 2ZPIB 1D3BA 1OQKA 3CCSQ 1SRLA 1YN8A 1ZUYA 2RJEA 4QW2A 3OS1A 4OMNA 3VS0A 4KH0B 5KYXB 1TOVA 4JJNK 1KQSA 4NL3A 4J9GA 4DA4A 4KUIA 2VWFA 1D09B 2CYZB 4BE1A 2DF6A 2JS0A 5GAMj 4J9EA 4C8QG 3REBB 2BE7D 3EGXA 2RQVA 2DIQA 4JUVA 4P5NA 2RM4A 2ECZA 2LP5A 2X4JA 3CC2T 2OTJA 2DTOA 2D8JA 2Y4YA 5HK0A 1AHJB 4BE2A 4FSSA 1KHIA 2EGAA 4LDUA 3CC7Q 4M77F 2E4HA 4PLLA 1VQLT 2HKQB 3EG1A 2WSFE 3NGPA 2ENMA 3O5ZA 3QDRB 2L8DA 4EIKA 4BI4A 1UECA 4J9BA 2VB6A 2KNBB 1IREB 4FSXA 5CQYA 2JZ2A 1K8AU 4N4IA 5KCOA 3G4SA 1U8RA 3MHXA 3CMET 5GJVB 3G71Q 2GGRA 4JZ4A 2DILA 2M02A 4FYYB 1VQ7Q 3THKA 5GAOl 3LGFA 2YT6A 3A1PA 2ZPHB 1NBEB 1B34B 1M90C 2DYIA 4M75F 3JCMW 4C8QC 5D6YA 5IN1A 2J6KA 2O9VA 4ATOA 4OB2B 4M78E 2F5KA 5CQXA 1S72Q 1AOJA 3CCQT 3JB9H 5GAN7 1K1ZA 2LT4A 4L5GA 2QQAA 4QVZA 2XHCA 3I9QA 3PMIA 5GAN4 3FJPA 1WPYA 2EPDA 4M7DA 2JW4A 1XNIA 1UUEA 1RABB 3M54A 1M1KR 1YFNA 3QXEB 4BD3A 2E6NA 2XU8A 2HSPA 3CCVT 2VXFA 4ESRA 2L89A 2X51A 2KGTA 3CCJA 1WDXA 2G6FX 2YUQA 5GANd 5KH6A 3C94A 3QKJA 3QPHA 3S6WA 1VIFA 1WJQA 3OW2S 4KGZB 5GAOr 3VUBA 5CAIA 4M77G 4FL6A 2DMOA 3SWNB 2ZAEA 4M75D 4Y92A 4HVVA 2PVOB 1M3AA 3PGGA 1QVGA 3VKIA 4J83A 3UWNA 2PU9B 4IIMA 2GQVA 2O2OA 2AK5A 3BDLA 3CXCP 3V8LA 2K79A 2YDLA 2DNUA 2FRWA 5IHIA 2HBWA 4PK4A 1X27A 2M16A 4HVUA 2E10A 1UGRB 3SB2A 3CCEA 4R55A 2RK2A 3AT1B 4QQGA 3OBWA 4LUEA 2LRQA 2V1QA 1IGQA 1M3CA 2YRDA 1G8XA 2AZSA 2V26A 4PL6A 2DETA 4RG2A 1TWBA 5GAMd 4N4HA 3VS1A 2AKLA 2IVWA 3UA6A 3ZBDA 3QWXX 1VOMA 1ACMB 4PJOC 1TSFA 4XTZA 2PQWA 3UDCA 3Q1JA 5AYFA 3MJXA 4HCKA 1HJDA 1LCKA 2KT8A 2JOYA 2K6DA 2F2XA 1EFNA 2DAQA 2VC8A 1UGPB 3ZL7C 1M2OA 2CZ7B 2K4YA 2LT1A 2DEQA 4ZNXA 3URGA 4IUUA 4RTWA 2HL3A 3PIPA 1VQKT 1B34A 2KK4A 4C0GA 4C92E 3GIBA 1YIJA 2C06A 5GANg 1VQ5Q 2V8IA 3QJ6A 5GMKi 2V8JA 5GAN6 3A8OB 1AZEA 1AD5A 1H8KA 5GMKh 2ROTA 5CR2A 2FZCB 3TVTA 4E47A 3C95A 3RMQA 1VYVA 4LD9K 4M7AE 5A0DA 1WGSA 2BIVA 1RAEB 5IT9E 3CD6T 1V29B 3X26B 2HNIA 1FMVA 9ATCB 3OYFA 3QG1A 5FWBA 2BZ8A 2VKNA 1YWPA 4RTUA 4BI3A 1VQNA 5FU7B 5I2SA 1E6HA 1W6XA 1OZ3A 1AWXA 1N6AA 2YUOA 4IKFA 1W70A 5FWCA 2KSSA 1BCMA 2LJ1A 3L2WA 1VA7A 1ZA2B 1AWOA 2BUDA 2KXDA 1K0XA 1NJIR 3PT9A 2CSIA 2ROLA 1YI2A 4FYVB 1M1KC 1TTHB 5GAMg 3UF4A 3N5BB 1YHQA 1ZA1B 3SWNA 3EFOB 2HQHA 2JMAA 1YJ9T 1O9SA 2QAZA 2K57A 3X20B 3JB9G 2E3HA 2LZ6B 5ECAA 5FROA 4JRPA 1TG0A 3MCAB 1Q81R 4DEXA 3CCST 1M1KU 1VQ6A 5L23A 3V8KA 3I55Q 4M78D 2MYSA 3CQTA 3HFNA 2GNCA 4FW2A 4L6V5 4ANJA 4M7DC 3CC4A 1UDLA 3S3NA 1RADB 5CCAA 2K7AA 2X3XD 3LGLA 1K9MR 3GNFB 3WVDB 3S3MA 2KY9A 2FRYA 4L59A 3OW2A 4QKUA 6AT1B 2DL4A 3VS3A 3FIFA 4EMHA 4BY6C 1WXUA 2RHXA 3SD4A 2MAMA 2LX9A 4BB7A 3CXCS 3OYLA 3R6NA 3V7CA 1O75A 2HSEB 4PFOA 3CC7T 2GFUA 1K4US 4AFQC 2CS7A 4XU0A 4XK8E 1JXOA 1WFWA 1Q86C 3R6OA 2XDPA 1OX9A 1RAIB 3UA7A 2DERA 1IGUA 2K3BA 1OU9A 3PVLA 2M9UA 2RI2A 1H3ZA 1QMCA 1FYNA 3CPFA 2GFAA 1V76A 5GMKe 1RUWA 2GF7A 2H8HA 4XQ3A 3G71T 3HPWA 1VQ7T 1SSFA 4E7ZA 3OYCA 2CZ0B 4DEYA 5FLXE 1KK7A 3KUFA 4FYXB 4MDXA 3QZ9B 4M77E 4XU2A 5KE3A 4ME7A 1SSHA 2ZCFB 4OMOA 4YTLA 3RESA 2EQUA 2X4YA 1KC8R 2JS2A 3MP6A 3GNGA 1S72T 5CIUA 3H0HA 4RCBA 2JTFA 1G2BA 2E5KA 4M75B 3I5RA 1RAAB 1M8VA 5KE2A 2C0OA 5LJ5h 3JB9I 1SF9A 3V7SA 5IHNA 1OPKA 2E3IA 4VUBA 4QVDA 1WQWA 1IHWA 1YCYA 3MEWA 4J9IA 1WYXA 3EFRA 4NL2A 1JJ2A 4F7UB 2HD0A 3EAEA 2Y4XA 4HCCA 1M5Q1 4HA8A 1YITA 4LXCA 1JXMA 3EFOA 4PLIA 2CUBA 4C8QF 1X2QA 2NUTB 2XK0A 3E9GA 1BI1A 2JTEA 3EGDB 1NYFA 3MEAA 2QTVA 3GBQA 2NUPB 2X9HA 3SDZA 1NPRA 2DA9A 1NJIC 5LJ3h 2JM9A 3OYHA 3I56Q 5CKBA 4AG2C 3M0RA 2QQ9A 1BU1A 3OMGA 2CP6A 4EPCA 3RR6A 2LTOA 1I5OB 1WA7A 4OGEA 3JCMh 2AKKA 1KQ1A 1A0NB 3HP9A 1NJIU 1KD1R 4MMLA 4BDYA 3J7AF 3M0PA 1B7TA 5DLOA 3MO8A 3L2QA 1ZUUA 4Q5WA 5CK9A 5EG2A 2EKHA 4E7SA 2F2VA 3CMAA 1PNJA 4OMFB 1VQ4Q 2VUBA 4XU1A 1BYMA 5IXBA 4JJBA 4CI0C 3LH0A 2LQ8A 2B8AA 1D1AA 4J6XA 2F69A 2HQEA 4B9XA 4C8QD 1Y96B 3QYHB 2DM1A 4HVWA 3SWNC 1VYTA 2JN0A 3HL8A 3CC2A 1NPPA 2KE9A 4QT7A 3QJYA 1TUDA 1HSQA 4R56A 3RKWA 2K5FA 1Q82R 1LNXA 1VQLA 3MP8A 1BKBA 2COZA 2FYKA 4MDWA 1QCOA 1WQ7A 2JM8A 2FPFA 2QA4Q 2QG9B 4Z88A 5DM7R 4HCZA 5FRMA 2KBTA 1SG5A 3CMAT 1K9MU 4AFSC 3MP1A 1J3TA 3QIIA 1VQ9A 1WHMA 2ZPEB 4CC3A 2CZ6B 1D1CA 1VQOQ 3L42A 2QEXQ 5HK3A 2DE0X 3OYMA 3CMEA 3QO3A 3M4GA 3NTIA 3FB9A 4IUTA 3J80E 3JB9J 1P92A 1M8MA 1K8AC 1VQ5T 3UPUA 2R5MA 1E7OA 2FZKB 4M75A 2YXYA 1M1FA 4J9CA 1WJRA 1RI9A 4O6JA 1OX8A 1K0SA 1UTIA 5LJ5e 4KRTA 4F04B 2DK3A 3CCQA 1JJ2P 3NHNA 1YWOA 1QVFP 2PNIA 2L2PA 4XTYA 4EMKB 3JCMP 5J3BA 2XG8D 1ZHIA 2EAYA 3CCLQ 4F7UA 2ED1A 2RB6A 2DTHA 1WLPB 4PNOA 1VQ9T 4M78B 3EGUA 1MMAA 1QKXA 2FPDA 3ER0A 1U1SA 4KT0E 3KXTA 3I35A 1LOJA 1D0YA 1Q95G 4XTXA 2NUTA 2KRMA 4DOVA 1IRXA 4ZGEB 2JJ9A 3HHTB 3EGDA 2A28A 3LX7A 2NUPA 1MHNA 3CCMA 4Z02A 3CCVA 5LJ3e 1BI2A 3DKMA 1YJNQ 1SKUB 4LNPA 3TCJA 2E6ZA 2OI3A 4F14A 3EH2A 2KT1A 4J5YA 1I07A 5FW9A 4C5EA 3G6EQ 1CKAA 3JCMe 2QGFB 3A8LB 1IHVA 5HKCA 4M77D 4ELYC 3M0TA 1NYGA 3LW5E 1K73R 4KGXB 5FU7C 2O01E 3RDVA 2JUFA 2E64A 5IXFA 1QQJA 3I55T 1VUBA 2Y90A 2DRKA 2RN8A 4X34A 5L8RE 1XTDA 4XTWA 4OB1B 3CCMT 2K5LA 3CCUQ 4J9FA 3CPWA 4BACA 1Q7YR 4X9DA 3O8VA 2M0YA 4OB3B 4GY5A 1KD1C 2C0TA 2X3WD 1G3WA 4JJDA 5GAOm 1Y96A 1BIAA 1U06A 2RMOA 4PJOG 2YSQA 3T9NA 4KUDK 4R0KA 3PFSA 2MIOA 1K9AA 2IIMA 1U3OA 2KRNA 3L1AA 1KQSP 1OU8A 1W2BA 3RMSA 4RKUE 2CREA 2KQWA 2P4TA 3A8HB 1OI1A 5CO7A 5KYXA 3C12A 1T0JA 3OS5A 1MMNA 2CZ1B 1OOTA 1QLYA 2D9TA 2GTOA 1KD1U 2KI7A 4IIOA 1EX4A 1VQMQ 1QCNA 5LL6S 5D6WA 2L3PA 1ZBXA 3PVQA 2A37A 2XDDA 3OYNA 5I11A 4M7DF 1D0XA 3OYAA 1U1TA 3ASKA 2LQWA 2L3QA 2FG0A 1Y71A 1GFCA 3CCRQ 4HKEA 1BCOA 2LMJA 4PJNA 3J81E 4QQ6A 2RJDA 1VQKA 3HRSA 3VS5A 1TH7A 3CEYA 3D7SB 1OV3A 3JSCA 3BFMA 2OTLQ 1N5ZA 1GCQC 4IUQA 1VQPQ 1IXDA 5GMKl 4C92B 3JB9F 5GAOp 2RF0A 2LNVA 3QHSA 3QWYA 4M78A 3CD6A 1KFZA 2HMAA 1HK9A 2LCCA 1HXDA 4GLKA 3DLMA 3RKXA 4Y28E 3OQ5A 5M9OA 4M7AB 4J7FA 1VQ8Q 5I21A 4IUPA 1C1AA 2RO0A 1MGQA 4HXJA 2O4XB 1YBYA 1KJWA 1YJWQ 5IAYA 1N9SA 3QBYA 2QQSA 2QI2A 1V1CA 3H8ZA 1M3BA 1X6GA 2FVUA 2RA2A 2W10A 4ZTJA 2L3RA 3M59A 4AMCA 2R57A 4E7KA 4JJCA 4A4GA 1QVFS 2CP5A 2XD0A 4J7IA 2AZVA 1ZSZB 4QVCA 3L2UA 4OF1A 5GMKj 3TSWA 4AG1C 1YJ9A 4FYWB 2IG0A 2YRVA 4RTXA 1VIEA 3I56T 1TUCA 2DXTA 2D8HA 3QSUA 1PG5B 3LWHA 2RPNA 2I0NA 5EC7A 2J7IA 3UT1A 1UE9A 2DKGA 4M75C 1OYXA 3CPWP 2RI3A 2FO0A 4M7DG 3JB9D 3CCSA 3OYDA 2X35A 1FXXA 2LNHB 2KVQG 3WVEB 1ZX6A 3JRZA 2V8KA 3FC3A 2CP3A 4LDYA 3JV3A 2LQKA 2DL7A 1GCPA 4C0ZA 3KBGA 4MZPA 4ZTFA 2RI5A 2XICA 4C8QE 2MOXA 2FPEA 2E12A 2XMFA 5GAN5 1T3LA 4RCCA 2A08A 1JQQA 1QVGP 2EQIA 4ZN3A 2MMPA 5LJ5f 1NZ9A 2KYMA 2OTJQ 1VQ4T 2XIDA 1Q7YC 2RHZA 2XI9A 1WX6A 5CVIA 3EG9B 2MF2A 2DL8A 1K73U 1RLPC 3P8BB 1UGSB 3TSZA 1R8OB 3X28B 4CC7A 1E6GA 1WZOA 4DBHA 1X69A 3CC7A 2CDTA 1S1NA 4PJMA 2JNGA 4FIBA 3G4SQ 2I2LA 1Q7YU 2D1XA 2ZPBB 1OPLA 5LJ3f 3JCMJ 1GBQA 2HDAA 1AVZC 2QA4T 1SRMA 4O5VA 4JS4A 1R77A 2ZZDA 4C5HA 5KYWB 1HYOA 1WIEA 1X75C 3OBYA 2EJGA 3HRTA 1NM7A 3GOXA 2PUOB 3M9QA 2EW3A 3HSBA 2JT4A 2QEXT 1GXIE 2EKOA 2PTKA 4X1VA 5J26A 3JAME 1KQSS 4C92A 3JCMf 1D0ZA 3G71A 1WHGA 4TVRA 3OA6A 4JRQA 1VQ7A 2ZGWA 3KFVA 2DYBA 3EHRA 1XJWB 2L3SA 4OMPA 2YWWA 5CKDA 1KSWA 2K2VA 4M7AA 4FW1A 3NMZC 3U23A 1S72A 3OYKA 2O4XA 1PRLC 2KDSA 4Z89A 2AIRB 2D0QB 4M77B 1MMGA 2WSEE 1KQ2A 4RTZA 4B9WA 3CCLT 5FU6B 4JLIA 1X6BA 3AHUA 2VGMA 4A63B 4XAXB 3IQLA 1SEMA 3CCJQ 5C0MA 3NTHA 3M57A 3MKDA 3TU4K 1ZSZA 4PJOE 4E7IA 2PVDB 4RUGA 4II1A 3CCUA 1WHKA 2CSQA 2L5QA 1MNDA 2HQXA 1EZZB 4CC4B 4XTVA 4WTOB 1WXTA 3MEVA 5DY9A 5KYUB 2E5QA 2RQWA 3M56A 2ESWA 2DBKA 3G6ET 4MZTA 3EG0A 3C4SA 2R5AA 4M4ZA 3OS0A 4LE9A 4EMKC 1GL5A 1CKBA 4OMLA 1Y7XA 2CH4A 4KH1B 2D0NA 4M78C 4LD6A 1AT1B 5LJ5j 1BI3A 1T3SA 1G83A 4JRKA 3CCEQ 2WSCE 2COWA 3SEMA 2H3EB 1OULA 1PD1A 3CCUT 3BW1A 2K3XA 2M51A 1UJ0A 4A4KA 1M90R 1SHGA 1TXQA 2YHTA 2CT3A 1QVPA 3QZ5B 3EG9A 3OYYA 4PKCC 3RUXA 2EQKA 2PVGB 3L2VA 4KULA 3V7RA 1YNZA 2NUZA 2EYXA 3REAB 5GAOn 2CT4A 1UHFA 3LH5A 5LJ3j 4OGCA 1M1GA 2HKNA 2OJ2A 4ORZA 4JDSA 5I2MA 1WI7A 1Q81C 1WJSA 1PM3A 5KYWA 1VQMT 2KYBA 3OW2P 4XTUA 3JCMV 1QVGS 2P0QA 3OYJA 1YIJQ 1PKSA 5GANh 2LCLA 1UGVA 1W4SA 1GCQA 2DL3A 2F1LA 4RMOA 2DXUA 3CCRT 1XOVA 4DBRA 2KMTA 2HCKA 3NPFA 1Q81U 2CUDA 1QP3A 3EG3A 4RG8A 1JRIA 4ZGDB 4AT1B 4J9DA 2EGEA 1K9MC 1VQ5A 2CP2A 1ABQA 2OTLT 3V8JA 4F17A 1Z9ZA 2K2MA 2QGGA 2QDYB 2QQBA 4E7HA 1VQPT 3A5ZB 4J9HA 5GAOq 4M77A 1VQNQ 2E65A 2EYWA 3BY7A 4QQDA 4M7DE 4M7AG 1X43A 5A0GA 2DVJA 2W0ZA 1BBZA 1H641 3I5SA 3L2ZA 4PJLA 3FDRA 3G1JA 1AZGB 2X4XA 2E41A 1VQ8T 2DD5A 1F1BB 2NYSA 2R58A 2KEAA 3JCMX 1YI2Q 1YJWT 3RKYA 2FZGB 4E7JA 2RQTA 1RAHB 5GAMh 2EGCA 1YHQQ 4FM4B 2JVVA 1LVKA 1JEGA 5KYNA 3VS4A 2LCSA 4PJOF 1Y0MA 5KYUA 1G3YA 3CXCA 3FJ5A 3H0IA 1Y07A 2A36A 2IPOB 4C92C 1MV0B 1BI0A 4FCYA 2SRCA 1TU0B 4D8DA 1VQ6Q 2QASA 1N8RR 5IH2A 1KC8C 3SHWA 1I4K1 2F2WA 4C0DB 4M7AC 8ATCB 2YRCA 1M27C 2DTIA 3CC4Q 3ZFJA 1B3QA 2CH4W 2GCXA 2KROA 3I55A 2JTMA 4ELZC 3VS2A 1G3TA 3G7ZA 1PCXA 5LJ5d 1NG2A 2RHYA 5GJWB 1KC8U 1Z9QA 2HZYA 2QDLA 2RQRA 2LX7A 4ZGJB 4KBMB 2OTJT 5I22A 2DD4A 1PC0A 1ZSZC 2DPPB 4XU3A 4CC2A 2SEMA 3UATA 2RD1A 1NEGA 5CKHA 4PJOD 2GBQA 3M0SA 2BZYA 4BDZA 1YCSB 2EYZA 3LWIA 1PSEA 4OB0B 3CBOA 2GTJA 5LJ3d 3E9FA 1TUGB 2WACA 3BE3A 3META 1JBMA 1MV3A 4A53A 1QCFA 5GANe 4F7UF 3VRZA 3G4ST 1M90U 2MCNA 2QXFA 1PD0A 2J06A 2AT1B 2BE9B 4E2FB 3QYGB 4AFZC 2LVMA 4GBQA 3JCMd 1I81A 4E7LA 1B07A 1G5VA 2G3RA 2HEQA 3VV0A 1GFDA 2LQNA 3FRNA 2V1RA 3EG2A 2OAUA 2ED0A 3VUZA 1PRMC 3LLRA 4LN2A 2Z0WA 3FEOA 3VS7A 3HRUA 2DJQA 4ZN1A 4C0FA 1IZ6A 4KGVB 5KYYB 3M4YA 2P4RA 5CKEA 4MMKA 1H3HA 1MUZA 1IO6A 3GF5A 2O31A 1Q82C 4OMQA 2M1HA 2CKKA 5GAMe 2DIGA 3OYBA 1MNEA 1YITQ 4B6MA 7AT1B 4V2SA 1GRIA 4NS5A 3JCMQ 2EYYA 2F5TX 5LJ5g 4BE0A 5D6XA 1X01A 2P0KA 1PKTA 3BDUA 3M0UA 2KR3A 1M30A 1M2VB 2PZ1A 2QTXA 3CCJT 3VYGA 1Y57A 2K5IA 4EDUA 1BIBA 1Q82U 1R0CB 1SPKA 2EYQA 3OS2A 4EMKA 4M75G 2RHIA 4JRIA 2C0IA 3A98A 3DLLA 2MWPA 3WXMB 4DOWA 5LJ3g 3I56A 4MZMA 2K3YA 3JCMb 1Q86R 3OYGA 4A4FA 4M77C 3HKSA 3QUIA 3A8GB 4F7UG 1WHLA 5GAN3 2PUKB 5FRNA 1RAGB 2A7YA 4A4EA 1N8RC 5FU6C 1NLPC 1LJOA 3H41A 3OMCA 3RERA 3QDFA 1KHCA 1UG1A 2VV5A 4M7DD 3JCMg 1RAFB 2JMCA 3OY9A 2DJZA 1R0BG 2CP0A 3CMAQ 3CCET 2DXCA 1UGQB 2VYTA 3PTAA 2ZPFB 4DBQA 1FWZA 3EHQA 2BZXA 2DXBA 3GLXA 4C5IA 2QK0A 1JJ2S 2J6FA 1FX7A 3CBMA 1RACB 1N8RU 2FL7A 3CC2Q 4C8QB 3S3OA 4BI8B 2DRMA 1VQ4A 3E2UA 2MWOA 1U5SA 5GMKm 1WXBA 1ZQ1A 1VQLQ 2J6OA 5D7UA 1UFFA 4M78F 1WHJA 3OB9A 3HFOA 1PHTA 1SHFA 1UHCA 2EWNA 1G3SA 2RJFA 4Z8AA 4OMMA 1K73C 1VQ9Q 8AT1B 1I8FA 3CMEQ 1W2BP 4N0AA 2QA4A 5J39A 3M55A 1YIJT 3LYIA 2EVRA 1XQHA 1VQOA 2QEXA 1K76A 4CRIA 1PWTA 3CBPA 2RK1A 3X25B 2OX7A 4JS5A 3M53A 5GAN8 2X4WA 5KYYA 3PE0A 3CCQQ 1VYUA 3NFCA 4RTYA 3EFSA 3EH1A 3A8MB 1CSKA 4WF2A 4OVAA 5AT1B 4E6RA 2P0PA 3NTKA 2VXEA 3INZA 1VQNT 3TREA 4J8OA 2A0FB 4J6YA 1EIFA 4OP0A 3H9NA 5A2QE 4HT8A 3P8HA 2RQUA 5HCKA 2E70A 2P84A 4K11A 4BUGA 2RHUA 5HY6A 1M2VA 3OYEA 2DFUA 2M0OA 4IUVA 3X24B 4C5GA 3CCLA 1UEBA 2GQIA 1VQOT 1AWJA 2RH2A 3CCMQ 1W1FA 3CCVQ 4JPBW 2MI6A 1YI2T 1H92A 1YP5A 3F70A 5A0LA 4LDWA 1TS9A 3FLGA 1YHQT 4DQ2A 2COYA 1GBRA 3DB3A 3DB4A 4D6WA 1QWEA 2K9GA 2BTTA 2EJFA 3HTRA 2O88A 1I5LA 4A4HA 4N4GA 1YJNA 2KRSA 2VASA 5GANf 3JCMc 1MMDA 4JLGA 2HL5C 3ME9A 2E1HA 2EJ9A 4PJOB 1BK2A 4M78G 2DO3A 2YUNA 4LDVA 4RTVA 1VQ6T 2EFIA 4HCBA 2EBPA 2QQRA 2DZ9A 3G6EA 4JZ3A 3OSSC 4FT2A 4RTTA 1HD3A 2H3JA 1X2KA 1QP2A 2A3LA 1D3BB 2DZCA 2J05A 1PSFA 2KAFA 3H6ZA 3MPUB 3CC4T 3M58A 1DJ7B 3ZEHA 2ABLA 1KG1A 1QW1A 2FHDA 4WCIA 1K8AR 4C8QA 3ULRB 1YJNT 2JXBA 4C92F 3PIOA 3RIRA 1ZSGA 1N9RA 1ZBJA 1X6OA 5IHKA 1OEBA 4D8KA 1M4ZA 1ZLMA 1Q86U 2YLBA 2DEUA 2HAXA 3P8DA 1KIKA 4A54A 3SFMA 3EGXB 5GAMf 3MEUA 4M7AF 3GPLA 3VU3C 1WHHA 1ABOA 3RBBB 1ZUKA 4C0DC 3E19A 2KXCA 4F16A 2ATCB 1LPLA 3RNJA 3GP8A 4X9CA 2OAWA 1VQMA 5DLQE 1NLOC 1M9SA 1VQKQ 2VVKA 2CGHA 2MK5A 1BB9A 3TQ7P 2FEIA 3PNWC 4UC4A 3VRYA 4NOYA 1I0CA 1AWWA 2DVEA 1QVFA 3H0FA 2VGNA 2DBMA 4FU6A 3E1SA 3CCRA 3VJPA 3OSVA 2NWMA 1OZ2A 3OYIA 2MPXC 3CPWS 2RJCA 1N27A 2AHJB 3L2RA 4M75E 1JU5C 3VS6A 2QYZA 2LJ3A 3PMTA 1C6VX 2DL5A 2NLUA 1UJYA 2XDBA 3CD6Q 1C0MA 4J6WA 2OTLA 2CP7A 2LDMA 2EIFA 1RLQC 4C92D 2EQMA 1VQPA 1NE8A 1RL2A 4F7UE 4EMGA 2YUPA 1W2BS 4Y91A 2RNAA 4DBFA 4FT4A 1QWFA 2O9SA 2HBPA 4IURA 2L0AA 2LC4A 4PFPA 4M7AD 3C0CA
chains in the Genus database with same CATH topology
4HXJA 4CC2A 1KJWA 2SEMA 1NEBA 3UATA 1FMKA 1NEGA 1T0HA 4GLMA 2LJ0A 2GBQA 3R6NA 3M0SA 2BZYA 1V1CA 1M3BA 1X6GA 1YCSB 1I1JA 2EYZA 1K4US 4AFQC 1AEYA 4LUDA 4AFUC 2GTJA 2W10A 3M0QA 1JXOA 1MV3A 1ARKA 1WFWA 2DX1A 1QCFA 4JJCA 3VRZA 3UA7A 2DLPA 1QKWA 2B86A 2K3BA 2MCNA 2AZVA 3PVLA 2J06A 3TSWA 4AG1C 4RTXA 4AFZC 1JO8A 4GBQA 1TUCA 1FYNA 2D8HA 2RPNA 2I0NA 5EC7A 1SRLA 2J7IA 1RUWA 1UE9A 1YN8A 2H8HA 1ZUYA 1B07A 2FO0A 2HEQA 4DEYA 2LNHB 1GFDA 2LQNA 2V1RA 3EG2A 2ED0A 1ZX6A 4OMNA 3VS0A 1PRMC 4OMOA 1SSHA 4LN2A 3JV3A 3VS7A 2DL7A 1GCPA 2DJQA 2JS2A 2MOXA 2FPEA 2XMFA 4J9GA 3H0HA 2VWFA 1T3LA 1G2BA 2DF6A 2E5KA 2A08A 2JS0A 1JQQA 3I5RA 2EQIA 2P4RA 4J9EA 2C0OA 1H3HA 1MUZA 2KYMA 3REBB 1IO6A 2O31A 4OMQA 2RQVA 5IHNA 1OPKA 1WX6A 1GRIA 2ECZA 2LP5A 4J9IA 2EYYA 1WYXA 2DL8A 2D8JA 1RLPC 1PKTA 3M0UA 4FSSA 3TSZA 2KR3A 2EGAA 1M30A 1JXMA 2PZ1A 4CC7A 1E6GA 3EG1A 3NGPA 2ENMA 3O5ZA 1X69A 2CUBA 1X2QA 1Y57A 4EIKA 2CDTA 1S1NA 1UECA 2JTEA 4J9BA 1NYFA 2KNBB 1SPKA 3GBQA 2D1XA 2DA9A 1OPLA 1GBQA 2HDAA 1AVZC 2JM9A 1SRMA 2C0IA 3A98A 4AG2C 3M0RA 1WIEA 1BU1A 5GJVB 2GGRA 1NM7A 4JZ4A 2EW3A 2DILA 2JT4A 3THKA 2YT6A 2PTKA 4X1VA 1WA7A 2AKKA 1A0NB 1NLPC 3KFVA 2DYBA 2J6KA 2O9VA 3H41A 3EHRA 1UG1A 2L3SA 2JMCA 3M0PA 4OMPA 1AOJA 1ZUUA 1KSWA 1K1ZA 3EHQA 2BZXA 2EKHA 3NMZC 3U23A 2F2VA 1PNJA 1PRLC 3I9QA 2J6FA 4Z89A 2EPDA 2JW4A 5IXBA 4JJBA 4RTZA 1UUEA 2DRMA 1X6BA 2DM1A 1U5SA 1WXBA 4HVWA 1VYTA 2HSPA 4A63B 2J6OA 2KE9A 3IQLA 4QT7A 1SEMA 1TUDA 1UFFA 1HSQA 4ESRA 1PHTA 2KGTA 1SHFA 1UHCA 4RUGA 1WDXA 2G6FX 2JM8A 2YUQA 2FPFA 4Z8AA 2CSQA 4OMMA 4Z88A 4CC4B 2KBTA 1WXTA 4AFSC 1J3TA 2RQWA 2DMOA 4CC3A 2ESWA 2DBKA 2DE0X 3EG0A 2EVRA 4M4ZA 4Y92A 4HVVA 4LE9A 1M3AA 1GL5A 1CKBA 4OMLA 2CH4A 4IIMA 1K76A 1M8MA 2O2OA 2D0NA 2AK5A 1PWTA 2K79A 1E7OA 1T3SA 2YDLA 3PE0A 1G83A 1VYUA 4RTYA 2DNUA 4J9CA 3SEMA 2FRWA 1CSKA 5IHIA 1RI9A 2HBWA 1K0SA 1UTIA 1X27A 4HVUA 4E6RA 4KRTA 2M51A 1UJ0A 3NHNA 1YWOA 2PNIA 1SHGA 2L2PA 2CT3A 4LUEA 2V1QA 1M3CA 2AZSA 2ED1A 2RQUA 1WLPB 5HCKA 3EGUA 1YNZA 1QKXA 2FPDA 2NUZA 4K11A 3VS1A 2AKLA 3I35A 3UA6A 2EYXA 3REAB 2GQIA 2CT4A 3QWXX 2KRMA 1AWJA 1UHFA 1W1FA 3LH5A 4JPBW 2A28A 1H92A 1YP5A 2OJ2A 4ORZA 1WI7A 1GBRA 1QWEA 2K9GA 2BTTA 2KYBA 4HCKA 4LNPA 1HJDA 1LCKA 2KT8A 2K6DA 2OI3A 2F2XA 2O88A 4F14A 1EFNA 2KT1A 2KRSA 1I07A 3ZL7C 5FW9A 4ZNXA 1CKAA 1PKSA 4RTWA 1UGVA 1BK2A 1GCQA 2DL3A 2YUNA 1XOVA 4RTVA 2EBPA 2HCKA 3NPFA 4JZ3A 4RTTA 2CUDA 1HD3A 3EG3A 1NYGA 3M0TA 1X2KA 1AZEA 4J9DA 1AD5A 1H8KA 5IXFA 2EGEA 2J05A 2ROTA 3TVTA 2DRKA 1ABQA 2RN8A 1VYVA 4F17A 1Z9ZA 2K2MA 2ABLA 4J9FA 4J9HA 4WCIA 2M0YA 2EYWA 5FWBA 1X43A 2C0TA 2BZ8A 2X3WD 2VKNA 2DVJA 4JJDA 3ULRB 1YWPA 2W0ZA 4RTUA 1BBZA 3I5SA 2JXBA 1U06A 2RMOA 2YSQA 1E6HA 1W6XA 1ZSGA 1AZGB 1ZBJA 1AWXA 4R0KA 5IHKA 1OEBA 4D8KA 1ZLMA 1K9AA 2MIOA 2YUOA 1W70A 2IIMA 5FWCA 1U3OA 2KEAA 1KIKA 2KRNA 2LJ1A 1VA7A 2CREA 2RQTA 1AWOA 2EGCA 1T0JA 2KXDA 1K0XA 2CSIA 2ROLA 1OOTA 1QLYA 2GTOA 1JEGA 4IIOA 1ABOA 3RBBB 1ZUKA 2LCSA 3VS4A 1Y0MA 2KXCA 3UF4A 2L3PA 3PVQA 4F16A 2A37A 5I11A 3FJ5A 3RNJA 3H0IA 2JMAA 2OAWA 2A36A 1NLOC 1MV0B 2VVKA 2LQWA 2L3QA 2FG0A 2SRCA 1GFCA 2LZ6B 5ECAA 4D8DA 1BB9A 2FEIA 1TG0A 2LMJA 3VRYA 4DEXA 1I0CA 1AWWA 5IH2A 3H0FA 3SHWA 3VS5A 2DBMA 2F2WA 1OV3A 5L23A 2NWMA 1M27C 3CQTA 1JU5C 1B3QA 3VS6A 1N5ZA 2CH4W 2GNCA 2LJ3A 1GCQC 2DL5A 1UJYA 2KROA 3VS2A 1UDLA 2RF0A 1RLQC 1NG2A 2K7AA 3QWYA 2X3XD 5GJWB 1KFZA 1Z9QA 2QDLA 2RQRA 2LX7A 2YUPA 2RNAA 1QWFA 2FRYA 2O9SA 2DL4A 3VS3A 5I22A 2L0AA 1WXUA 3C0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HXJ A;  4CC2 A;  1KJW A;  2SEM A;  1NEB A;  3UAT A;  1FMK A;  1NEG A;  1T0H A;  4GLM A;  2LJ0 A;  2GBQ A;  3R6N A;  3M0S A;  2BZY A;  1V1C A;  1M3B A;  1X6G A;  1YCS B;  1I1J A;  2EYZ A;  1K4U S;  4AFQ C;  1AEY A;  4LUD A;  4AFU C;  2GTJ A;  2W10 A;  3M0Q A;  1JXO A;  1MV3 A;  1ARK A;  1WFW A;  2DX1 A;  1QCF A;  4JJC A;  3VRZ A;  3UA7 A;  2DLP A;  1QKW A;  2B86 A;  2K3B A;  2MCN A;  2AZV A;  3PVL A;  2J06 A;  3TSW A;  4AG1 C;  4RTX A;  4AFZ C;  1JO8 A;  4GBQ A;  1TUC A;  1FYN A;  2D8H A;  2RPN A;  2I0N A;  5EC7 A;  1SRL A;  2J7I A;  1RUW A;  1UE9 A;  1YN8 A;  2H8H A;  1ZUY A;  1B07 A;  2FO0 A;  2HEQ A;  4DEY A;  2LNH B;  1GFD A;  2LQN A;  2V1R A;  3EG2 A;  2ED0 A;  1ZX6 A;  4OMN A;  3VS0 A;  1PRM C;  4OMO A;  1SSH A;  4LN2 A;  3JV3 A;  3VS7 A;  2DL7 A;  1GCP A;  2DJQ A;  2JS2 A;  2MOX A;  2FPE A;  2XMF A;  4J9G A;  3H0H A;  2VWF A;  1T3L A;  1G2B A;  2DF6 A;  2E5K A;  2A08 A;  2JS0 A;  1JQQ A;  3I5R A;  2EQI A;  2P4R A;  4J9E A;  2C0O A;  1H3H A;  1MUZ A;  2KYM A;  3REB B;  1IO6 A;  2O31 A;  4OMQ A;  2RQV A;  5IHN A;  1OPK A;  1WX6 A;  1GRI A;  2ECZ A;  2LP5 A;  4J9I A;  2EYY A;  1WYX A;  2DL8 A;  2D8J A;  1RLP C;  1PKT A;  3M0U A;  4FSS A;  3TSZ A;  2KR3 A;  2EGA A;  1M30 A;  1JXM A;  2PZ1 A;  4CC7 A;  1E6G A;  3EG1 A;  3NGP A;  2ENM A;  3O5Z A;  1X69 A;  2CUB A;  1X2Q A;  1Y57 A;  4EIK A;  2CDT A;  1S1N A;  1UEC A;  2JTE A;  4J9B A;  1NYF A;  2KNB B;  1SPK A;  3GBQ A;  2D1X A;  2DA9 A;  1OPL A;  1GBQ A;  2HDA A;  1AVZ C;  2JM9 A;  1SRM A;  2C0I A;  3A98 A;  4AG2 C;  3M0R A;  1WIE A;  1BU1 A;  5GJV B;  2GGR A;  1NM7 A;  4JZ4 A;  2EW3 A;  2DIL A;  2JT4 A;  3THK A;  2YT6 A;  2PTK A;  4X1V A;  1WA7 A;  2AKK A;  1A0N B;  1NLP C;  3KFV A;  2DYB A;  2J6K A;  2O9V A;  3H41 A;  3EHR A;  1UG1 A;  2L3S A;  2JMC A;  3M0P A;  4OMP A;  1AOJ A;  1ZUU A;  1KSW A;  1K1Z A;  3EHQ A;  2BZX A;  2EKH A;  3NMZ C;  3U23 A;  2F2V A;  1PNJ A;  1PRL C;  3I9Q A;  2J6F A;  4Z89 A;  2EPD A;  2JW4 A;  5IXB A;  4JJB A;  4RTZ A;  1UUE A;  2DRM A;  1X6B A;  2DM1 A;  1U5S A;  1WXB A;  4HVW A;  1VYT A;  2HSP A;  4A63 B;  2J6O A;  2KE9 A;  3IQL A;  4QT7 A;  1SEM A;  1TUD A;  1UFF A;  1HSQ A;  4ESR A;  1PHT A;  2KGT A;  1SHF A;  1UHC A;  4RUG A;  1WDX A;  2G6F X;  2JM8 A;  2YUQ A;  2FPF A;  4Z8A A;  2CSQ A;  4OMM A;  4Z88 A;  4CC4 B;  2KBT A;  1WXT A;  4AFS C;  1J3T A;  2RQW A;  2DMO A;  4CC3 A;  2ESW A;  2DBK A;  2DE0 X;  3EG0 A;  2EVR A;  4M4Z A;  4Y92 A;  4HVV A;  4LE9 A;  1M3A A;  1GL5 A;  1CKB A;  4OML A;  2CH4 A;  4IIM A;  1K76 A;  1M8M A;  2O2O A;  2D0N A;  2AK5 A;  1PWT A;  2K79 A;  1E7O A;  1T3S A;  2YDL A;  3PE0 A;  1G83 A;  1VYU A;  4RTY A;  2DNU A;  4J9C A;  3SEM A;  2FRW A;  1CSK A;  5IHI A;  1RI9 A;  2HBW A;  1K0S A;  1UTI A;  1X27 A;  4HVU A;  4E6R A;  4KRT A;  2M51 A;  1UJ0 A;  3NHN A;  1YWO A;  2PNI A;  1SHG A;  2L2P A;  2CT3 A;  4LUE A;  2V1Q A;  1M3C A;  2AZS A;  2ED1 A;  2RQU A;  1WLP B;  5HCK A;  3EGU A;  1YNZ A;  1QKX A;  2FPD A;  2NUZ A;  4K11 A;  3VS1 A;  2AKL A;  3I35 A;  3UA6 A;  2EYX A;  3REA B;  2GQI A;  2CT4 A;  3QWX X;  2KRM A;  1AWJ A;  1UHF A;  1W1F A;  3LH5 A;  4JPB W;  2A28 A;  1H92 A;  1YP5 A;  2OJ2 A;  4ORZ A;  1WI7 A;  1GBR A;  1QWE A;  2K9G A;  2BTT A;  2KYB A;  4HCK A;  4LNP A;  1HJD A;  1LCK A;  2KT8 A;  2K6D A;  2OI3 A;  2F2X A;  2O88 A;  4F14 A;  1EFN A;  2KT1 A;  2KRS A;  1I07 A;  3ZL7 C;  5FW9 A;  4ZNX A;  1CKA A;  1PKS A;  4RTW A;  1UGV A;  1BK2 A;  1GCQ A;  2DL3 A;  2YUN A;  1XOV A;  4RTV A;  2EBP A;  2HCK A;  3NPF A;  4JZ3 A;  4RTT A;  2CUD A;  1HD3 A;  3EG3 A;  1NYG A;  3M0T A;  1X2K A;  1AZE A;  4J9D A;  1AD5 A;  1H8K A;  5IXF A;  2EGE A;  2J05 A;  2ROT A;  3TVT A;  2DRK A;  1ABQ A;  2RN8 A;  1VYV A;  4F17 A;  1Z9Z A;  2K2M A;  2ABL A;  4J9F A;  4J9H A;  4WCI A;  2M0Y A;  2EYW A;  5FWB A;  1X43 A;  2C0T A;  2BZ8 A;  2X3W D;  2VKN A;  2DVJ A;  4JJD A;  3ULR B;  1YWP A;  2W0Z A;  4RTU A;  1BBZ A;  3I5S A;  2JXB A;  1U06 A;  2RMO A;  2YSQ A;  1E6H A;  1W6X A;  1ZSG A;  1AZG B;  1ZBJ A;  1AWX A;  4R0K A;  5IHK A;  1OEB A;  4D8K A;  1ZLM A;  1K9A A;  2MIO A;  2YUO A;  1W70 A;  2IIM A;  5FWC A;  1U3O A;  2KEA A;  1KIK A;  2KRN A;  2LJ1 A;  1VA7 A;  2CRE A;  2RQT A;  1AWO A;  2EGC A;  1T0J A;  2KXD A;  1K0X A;  2CSI A;  2ROL A;  1OOT A;  1QLY A;  2GTO A;  1JEG A;  4IIO A;  1ABO A;  3RBB B;  1ZUK A;  2LCS A;  3VS4 A;  1Y0M A;  2KXC A;  3UF4 A;  2L3P A;  3PVQ A;  4F16 A;  2A37 A;  5I11 A;  3FJ5 A;  3RNJ A;  3H0I A;  2JMA A;  2OAW A;  2A36 A;  1NLO C;  1MV0 B;  2VVK A;  2LQW A;  2L3Q A;  2FG0 A;  2SRC A;  1GFC A;  2LZ6 B;  5ECA A;  4D8D A;  1BB9 A;  2FEI A;  1TG0 A;  2LMJ A;  3VRY A;  4DEX A;  1I0C A;  1AWW A;  5IH2 A;  3H0F A;  3SHW A;  3VS5 A;  2DBM A;  2F2W A;  1OV3 A;  5L23 A;  2NWM A;  1M27 C;  3CQT A;  1JU5 C;  1B3Q A;  3VS6 A;  1N5Z A;  2CH4 W;  2GNC A;  2LJ3 A;  1GCQ C;  2DL5 A;  1UJY A;  2KRO A;  3VS2 A;  1UDL A;  2RF0 A;  1RLQ C;  1NG2 A;  2K7A A;  3QWY A;  2X3X D;  5GJW B;  1KFZ A;  1Z9Q A;  2QDL A;  2RQR A;  2LX7 A;  2YUP A;  2RNA A;  1QWF A;  2FRY A;  2O9S A;  2DL4 A;  3VS3 A;  5I22 A;  2L0A A;  1WXU A;  3C0C A; 
#chains in the Genus database with same CATH topology
 1NEB A;  2XKO C;  1FMK A;  1YIT T;  1VQ8 A;  1T0H A;  4M7D B;  4GLM A;  3M5A A;  2LJ0 A;  2ZPG B;  1YJW A;  1I1J A;  5GAN j;  1AEY A;  2D6F A;  2YLC A;  4LUD A;  1UB4 A;  1WNL A;  2EQJ A;  4AFU C;  1RI0 A;  4C92 G;  4HT9 A;  4N0A C;  3M0Q A;  3TEE A;  1IB8 A;  1ARK A;  3VYH B;  2DX1 A;  1YJ9 Q;  2FB7 A;  4PJO A;  2DLP A;  1FMW A;  5C6S A;  1QKW A;  2B86 A;  4PFZ A;  4BY6 B;  5CKF A;  1D1B A;  2BKD N;  4PJJ A;  4LDX A;  5KCH A;  1JO8 A;  5GAN 2;  1JB0 E;  2ZPI B;  1D3B A;  1OQK A;  3CCS Q;  1SRL A;  1YN8 A;  1ZUY A;  2RJE A;  4QW2 A;  3OS1 A;  4OMN A;  3VS0 A;  4KH0 B;  5KYX B;  1TOV A;  4JJN K;  1KQS A;  4NL3 A;  4J9G A;  4DA4 A;  4KUI A;  2VWF A;  1D09 B;  2CYZ B;  4BE1 A;  2DF6 A;  2JS0 A;  5GAM j;  4J9E A;  4C8Q G;  3REB B;  2BE7 D;  3EGX A;  2RQV A;  2DIQ A;  4JUV A;  4P5N A;  2RM4 A;  2ECZ A;  2LP5 A;  2X4J A;  3CC2 T;  2OTJ A;  2DTO A;  2D8J A;  2Y4Y A;  5HK0 A;  1AHJ B;  4BE2 A;  4FSS A;  1KHI A;  2EGA A;  4LDU A;  3CC7 Q;  4M77 F;  2E4H A;  4PLL A;  1VQL T;  2HKQ B;  3EG1 A;  2WSF E;  3NGP A;  2ENM A;  3O5Z A;  3QDR B;  2L8D A;  4EIK A;  4BI4 A;  1UEC A;  4J9B A;  2VB6 A;  2KNB B;  1IRE B;  4FSX A;  5CQY A;  2JZ2 A;  1K8A U;  4N4I A;  5KCO A;  3G4S A;  1U8R A;  3MHX A;  3CME T;  5GJV B;  3G71 Q;  2GGR A;  4JZ4 A;  2DIL A;  2M02 A;  4FYY B;  1VQ7 Q;  3THK A;  5GAO l;  3LGF A;  2YT6 A;  3A1P A;  2ZPH B;  1NBE B;  1B34 B;  1M90 C;  2DYI A;  4M75 F;  3JCM W;  4C8Q C;  5D6Y A;  5IN1 A;  2J6K A;  2O9V A;  4ATO A;  4OB2 B;  4M78 E;  2F5K A;  5CQX A;  1S72 Q;  1AOJ A;  3CCQ T;  3JB9 H;  5GAN 7;  1K1Z A;  2LT4 A;  4L5G A;  2QQA A;  4QVZ A;  2XHC A;  3I9Q A;  3PMI A;  5GAN 4;  3FJP A;  1WPY A;  2EPD A;  4M7D A;  2JW4 A;  1XNI A;  1UUE A;  1RAB B;  3M54 A;  1M1K R;  1YFN A;  3QXE B;  4BD3 A;  2E6N A;  2XU8 A;  2HSP A;  3CCV T;  2VXF A;  4ESR A;  2L89 A;  2X51 A;  2KGT A;  3CCJ A;  1WDX A;  2G6F X;  2YUQ A;  5GAN d;  5KH6 A;  3C94 A;  3QKJ A;  3QPH A;  3S6W A;  1VIF A;  1WJQ A;  3OW2 S;  4KGZ B;  5GAO r;  3VUB A;  5CAI A;  4M77 G;  4FL6 A;  2DMO A;  3SWN B;  2ZAE A;  4M75 D;  4Y92 A;  4HVV A;  2PVO B;  1M3A A;  3PGG A;  1QVG A;  3VKI A;  4J83 A;  3UWN A;  2PU9 B;  4IIM A;  2GQV A;  2O2O A;  2AK5 A;  3BDL A;  3CXC P;  3V8L A;  2K79 A;  2YDL A;  2DNU A;  2FRW A;  5IHI A;  2HBW A;  4PK4 A;  1X27 A;  2M16 A;  4HVU A;  2E10 A;  1UGR B;  3SB2 A;  3CCE A;  4R55 A;  2RK2 A;  3AT1 B;  4QQG A;  3OBW A;  4LUE A;  2LRQ A;  2V1Q A;  1IGQ A;  1M3C A;  2YRD A;  1G8X A;  2AZS A;  2V26 A;  4PL6 A;  2DET A;  4RG2 A;  1TWB A;  5GAM d;  4N4H A;  3VS1 A;  2AKL A;  2IVW A;  3UA6 A;  3ZBD A;  3QWX X;  1VOM A;  1ACM B;  4PJO C;  1TSF A;  4XTZ A;  2PQW A;  3UDC A;  3Q1J A;  5AYF A;  3MJX A;  4HCK A;  1HJD A;  1LCK A;  2KT8 A;  2JOY A;  2K6D A;  2F2X A;  1EFN A;  2DAQ A;  2VC8 A;  1UGP B;  3ZL7 C;  1M2O A;  2CZ7 B;  2K4Y A;  2LT1 A;  2DEQ A;  4ZNX A;  3URG A;  4IUU A;  4RTW A;  2HL3 A;  3PIP A;  1VQK T;  1B34 A;  2KK4 A;  4C0G A;  4C92 E;  3GIB A;  1YIJ A;  2C06 A;  5GAN g;  1VQ5 Q;  2V8I A;  3QJ6 A;  5GMK i;  2V8J A;  5GAN 6;  3A8O B;  1AZE A;  1AD5 A;  1H8K A;  5GMK h;  2ROT A;  5CR2 A;  2FZC B;  3TVT A;  4E47 A;  3C95 A;  3RMQ A;  1VYV A;  4LD9 K;  4M7A E;  5A0D A;  1WGS A;  2BIV A;  1RAE B;  5IT9 E;  3CD6 T;  1V29 B;  3X26 B;  2HNI A;  1FMV A;  9ATC B;  3OYF A;  3QG1 A;  5FWB A;  2BZ8 A;  2VKN A;  1YWP A;  4RTU A;  4BI3 A;  1VQN A;  5FU7 B;  5I2S A;  1E6H A;  1W6X A;  1OZ3 A;  1AWX A;  1N6A A;  2YUO A;  4IKF A;  1W70 A;  5FWC A;  2KSS A;  1BCM A;  2LJ1 A;  3L2W A;  1VA7 A;  1ZA2 B;  1AWO A;  2BUD A;  2KXD A;  1K0X A;  1NJI R;  3PT9 A;  2CSI A;  2ROL A;  1YI2 A;  4FYV B;  1M1K C;  1TTH B;  5GAM g;  3UF4 A;  3N5B B;  1YHQ A;  1ZA1 B;  3SWN A;  3EFO B;  2HQH A;  2JMA A;  1YJ9 T;  1O9S A;  2QAZ A;  2K57 A;  3X20 B;  3JB9 G;  2E3H A;  2LZ6 B;  5ECA A;  5FRO A;  4JRP A;  1TG0 A;  3MCA B;  1Q81 R;  4DEX A;  3CCS T;  1M1K U;  1VQ6 A;  5L23 A;  3V8K A;  3I55 Q;  4M78 D;  2MYS A;  3CQT A;  3HFN A;  2GNC A;  4FW2 A;  4L6V 5;  4ANJ A;  4M7D C;  3CC4 A;  1UDL A;  3S3N A;  1RAD B;  5CCA A;  2K7A A;  2X3X D;  3LGL A;  1K9M R;  3GNF B;  3WVD B;  3S3M A;  2KY9 A;  2FRY A;  4L59 A;  3OW2 A;  4QKU A;  6AT1 B;  2DL4 A;  3VS3 A;  3FIF A;  4EMH A;  4BY6 C;  1WXU A;  2RHX A;  3SD4 A;  2MAM A;  2LX9 A;  4BB7 A;  3CXC S;  3OYL A;  3R6N A;  3V7C A;  1O75 A;  2HSE B;  4PFO A;  3CC7 T;  2GFU A;  1K4U S;  4AFQ C;  2CS7 A;  4XU0 A;  4XK8 E;  1JXO A;  1WFW A;  1Q86 C;  3R6O A;  2XDP A;  1OX9 A;  1RAI B;  3UA7 A;  2DER A;  1IGU A;  2K3B A;  1OU9 A;  3PVL A;  2M9U A;  2RI2 A;  1H3Z A;  1QMC A;  1FYN A;  3CPF A;  2GFA A;  1V76 A;  5GMK e;  1RUW A;  2GF7 A;  2H8H A;  4XQ3 A;  3G71 T;  3HPW A;  1VQ7 T;  1SSF A;  4E7Z A;  3OYC A;  2CZ0 B;  4DEY A;  5FLX E;  1KK7 A;  3KUF A;  4FYX B;  4MDX A;  3QZ9 B;  4M77 E;  4XU2 A;  5KE3 A;  4ME7 A;  1SSH A;  2ZCF B;  4OMO A;  4YTL A;  3RES A;  2EQU A;  2X4Y A;  1KC8 R;  2JS2 A;  3MP6 A;  3GNG A;  1S72 T;  5CIU A;  3H0H A;  4RCB A;  2JTF A;  1G2B A;  2E5K A;  4M75 B;  3I5R A;  1RAA B;  1M8V A;  5KE2 A;  2C0O A;  5LJ5 h;  3JB9 I;  1SF9 A;  3V7S A;  5IHN A;  1OPK A;  2E3I A;  4VUB A;  4QVD A;  1WQW A;  1IHW A;  1YCY A;  3MEW A;  4J9I A;  1WYX A;  3EFR A;  4NL2 A;  1JJ2 A;  4F7U B;  2HD0 A;  3EAE A;  2Y4X A;  4HCC A;  1M5Q 1;  4HA8 A;  1YIT A;  4LXC A;  1JXM A;  3EFO A;  4PLI A;  2CUB A;  4C8Q F;  1X2Q A;  2NUT B;  2XK0 A;  3E9G A;  1BI1 A;  2JTE A;  3EGD B;  1NYF A;  3MEA A;  2QTV A;  3GBQ A;  2NUP B;  2X9H A;  3SDZ A;  1NPR A;  2DA9 A;  1NJI C;  5LJ3 h;  2JM9 A;  3OYH A;  3I56 Q;  5CKB A;  4AG2 C;  3M0R A;  2QQ9 A;  1BU1 A;  3OMG A;  2CP6 A;  4EPC A;  3RR6 A;  2LTO A;  1I5O B;  1WA7 A;  4OGE A;  3JCM h;  2AKK A;  1KQ1 A;  1A0N B;  3HP9 A;  1NJI U;  1KD1 R;  4MML A;  4BDY A;  3J7A F;  3M0P A;  1B7T A;  5DLO A;  3MO8 A;  3L2Q A;  1ZUU A;  4Q5W A;  5CK9 A;  5EG2 A;  2EKH A;  4E7S A;  2F2V A;  3CMA A;  1PNJ A;  4OMF B;  1VQ4 Q;  2VUB A;  4XU1 A;  1BYM A;  5IXB A;  4JJB A;  4CI0 C;  3LH0 A;  2LQ8 A;  2B8A A;  1D1A A;  4J6X A;  2F69 A;  2HQE A;  4B9X A;  4C8Q D;  1Y96 B;  3QYH B;  2DM1 A;  4HVW A;  3SWN C;  1VYT A;  2JN0 A;  3HL8 A;  3CC2 A;  1NPP A;  2KE9 A;  4QT7 A;  3QJY A;  1TUD A;  1HSQ A;  4R56 A;  3RKW A;  2K5F A;  1Q82 R;  1LNX A;  1VQL A;  3MP8 A;  1BKB A;  2COZ A;  2FYK A;  4MDW A;  1QCO A;  1WQ7 A;  2JM8 A;  2FPF A;  2QA4 Q;  2QG9 B;  4Z88 A;  5DM7 R;  4HCZ A;  5FRM A;  2KBT A;  1SG5 A;  3CMA T;  1K9M U;  4AFS C;  3MP1 A;  1J3T A;  3QII A;  1VQ9 A;  1WHM A;  2ZPE B;  4CC3 A;  2CZ6 B;  1D1C A;  1VQO Q;  3L42 A;  2QEX Q;  5HK3 A;  2DE0 X;  3OYM A;  3CME A;  3QO3 A;  3M4G A;  3NTI A;  3FB9 A;  4IUT A;  3J80 E;  3JB9 J;  1P92 A;  1M8M A;  1K8A C;  1VQ5 T;  3UPU A;  2R5M A;  1E7O A;  2FZK B;  4M75 A;  2YXY A;  1M1F A;  4J9C A;  1WJR A;  1RI9 A;  4O6J A;  1OX8 A;  1K0S A;  1UTI A;  5LJ5 e;  4KRT A;  4F04 B;  2DK3 A;  3CCQ A;  1JJ2 P;  3NHN A;  1YWO A;  1QVF P;  2PNI A;  2L2P A;  4XTY A;  4EMK B;  3JCM P;  5J3B A;  2XG8 D;  1ZHI A;  2EAY A;  3CCL Q;  4F7U A;  2ED1 A;  2RB6 A;  2DTH A;  1WLP B;  4PNO A;  1VQ9 T;  4M78 B;  3EGU A;  1MMA A;  1QKX A;  2FPD A;  3ER0 A;  1U1S A;  4KT0 E;  3KXT A;  3I35 A;  1LOJ A;  1D0Y A;  1Q95 G;  4XTX A;  2NUT A;  2KRM A;  4DOV A;  1IRX A;  4ZGE B;  2JJ9 A;  3HHT B;  3EGD A;  2A28 A;  3LX7 A;  2NUP A;  1MHN A;  3CCM A;  4Z02 A;  3CCV A;  5LJ3 e;  1BI2 A;  3DKM A;  1YJN Q;  1SKU B;  4LNP A;  3TCJ A;  2E6Z A;  2OI3 A;  4F14 A;  3EH2 A;  2KT1 A;  4J5Y A;  1I07 A;  5FW9 A;  4C5E A;  3G6E Q;  1CKA A;  3JCM e;  2QGF B;  3A8L B;  1IHV A;  5HKC A;  4M77 D;  4ELY C;  3M0T A;  1NYG A;  3LW5 E;  1K73 R;  4KGX B;  5FU7 C;  2O01 E;  3RDV A;  2JUF A;  2E64 A;  5IXF A;  1QQJ A;  3I55 T;  1VUB A;  2Y90 A;  2DRK A;  2RN8 A;  4X34 A;  5L8R E;  1XTD A;  4XTW A;  4OB1 B;  3CCM T;  2K5L A;  3CCU Q;  4J9F A;  3CPW A;  4BAC A;  1Q7Y R;  4X9D A;  3O8V A;  2M0Y A;  4OB3 B;  4GY5 A;  1KD1 C;  2C0T A;  2X3W D;  1G3W A;  4JJD A;  5GAO m;  1Y96 A;  1BIA A;  1U06 A;  2RMO A;  4PJO G;  2YSQ A;  3T9N A;  4KUD K;  4R0K A;  3PFS A;  2MIO A;  1K9A A;  2IIM A;  1U3O A;  2KRN A;  3L1A A;  1KQS P;  1OU8 A;  1W2B A;  3RMS A;  4RKU E;  2CRE A;  2KQW A;  2P4T A;  3A8H B;  1OI1 A;  5CO7 A;  5KYX A;  3C12 A;  1T0J A;  3OS5 A;  1MMN A;  2CZ1 B;  1OOT A;  1QLY A;  2D9T A;  2GTO A;  1KD1 U;  2KI7 A;  4IIO A;  1EX4 A;  1VQM Q;  1QCN A;  5LL6 S;  5D6W A;  2L3P A;  1ZBX A;  3PVQ A;  2A37 A;  2XDD A;  3OYN A;  5I11 A;  4M7D F;  1D0X A;  3OYA A;  1U1T A;  3ASK A;  2LQW A;  2L3Q A;  2FG0 A;  1Y71 A;  1GFC A;  3CCR Q;  4HKE A;  1BCO A;  2LMJ A;  4PJN A;  3J81 E;  4QQ6 A;  2RJD A;  1VQK A;  3HRS A;  3VS5 A;  1TH7 A;  3CEY A;  3D7S B;  1OV3 A;  3JSC A;  3BFM A;  2OTL Q;  1N5Z A;  1GCQ C;  4IUQ A;  1VQP Q;  1IXD A;  5GMK l;  4C92 B;  3JB9 F;  5GAO p;  2RF0 A;  2LNV A;  3QHS A;  3QWY A;  4M78 A;  3CD6 A;  1KFZ A;  2HMA A;  1HK9 A;  2LCC A;  1HXD A;  4GLK A;  3DLM A;  3RKX A;  4Y28 E;  3OQ5 A;  5M9O A;  4M7A B;  4J7F A;  1VQ8 Q;  5I21 A;  4IUP A;  1C1A A;  2RO0 A;  1MGQ A;  4HXJ A;  2O4X B;  1YBY A;  1KJW A;  1YJW Q;  5IAY A;  1N9S A;  3QBY A;  2QQS A;  2QI2 A;  1V1C A;  3H8Z A;  1M3B A;  1X6G A;  2FVU A;  2RA2 A;  2W10 A;  4ZTJ A;  2L3R A;  3M59 A;  4AMC A;  2R57 A;  4E7K A;  4JJC A;  4A4G A;  1QVF S;  2CP5 A;  2XD0 A;  4J7I A;  2AZV A;  1ZSZ B;  4QVC A;  3L2U A;  4OF1 A;  5GMK j;  3TSW A;  4AG1 C;  1YJ9 A;  4FYW B;  2IG0 A;  2YRV A;  4RTX A;  1VIE A;  3I56 T;  1TUC A;  2DXT A;  2D8H A;  3QSU A;  1PG5 B;  3LWH A;  2RPN A;  2I0N A;  5EC7 A;  2J7I A;  3UT1 A;  1UE9 A;  2DKG A;  4M75 C;  1OYX A;  3CPW P;  2RI3 A;  2FO0 A;  4M7D G;  3JB9 D;  3CCS A;  3OYD A;  2X35 A;  1FXX A;  2LNH B;  2KVQ G;  3WVE B;  1ZX6 A;  3JRZ A;  2V8K A;  3FC3 A;  2CP3 A;  4LDY A;  3JV3 A;  2LQK A;  2DL7 A;  1GCP A;  4C0Z A;  3KBG A;  4MZP A;  4ZTF A;  2RI5 A;  2XIC A;  4C8Q E;  2MOX A;  2FPE A;  2E12 A;  2XMF A;  5GAN 5;  1T3L A;  4RCC A;  2A08 A;  1JQQ A;  1QVG P;  2EQI A;  4ZN3 A;  2MMP A;  5LJ5 f;  1NZ9 A;  2KYM A;  2OTJ Q;  1VQ4 T;  2XID A;  1Q7Y C;  2RHZ A;  2XI9 A;  1WX6 A;  5CVI A;  3EG9 B;  2MF2 A;  2DL8 A;  1K73 U;  1RLP C;  3P8B B;  1UGS B;  3TSZ A;  1R8O B;  3X28 B;  4CC7 A;  1E6G A;  1WZO A;  4DBH A;  1X69 A;  3CC7 A;  2CDT A;  1S1N A;  4PJM A;  2JNG A;  4FIB A;  3G4S Q;  2I2L A;  1Q7Y U;  2D1X A;  2ZPB B;  1OPL A;  5LJ3 f;  3JCM J;  1GBQ A;  2HDA A;  1AVZ C;  2QA4 T;  1SRM A;  4O5V A;  4JS4 A;  1R77 A;  2ZZD A;  4C5H A;  5KYW B;  1HYO A;  1WIE A;  1X75 C;  3OBY A;  2EJG A;  3HRT A;  1NM7 A;  3GOX A;  2PUO B;  3M9Q A;  2EW3 A;  3HSB A;  2JT4 A;  2QEX T;  1GXI E;  2EKO A;  2PTK A;  4X1V A;  5J26 A;  3JAM E;  1KQS S;  4C92 A;  3JCM f;  1D0Z A;  3G71 A;  1WHG A;  4TVR A;  3OA6 A;  4JRQ A;  1VQ7 A;  2ZGW A;  3KFV A;  2DYB A;  3EHR A;  1XJW B;  2L3S A;  4OMP A;  2YWW A;  5CKD A;  1KSW A;  2K2V A;  4M7A A;  4FW1 A;  3NMZ C;  3U23 A;  1S72 A;  3OYK A;  2O4X A;  1PRL C;  2KDS A;  4Z89 A;  2AIR B;  2D0Q B;  4M77 B;  1MMG A;  2WSE E;  1KQ2 A;  4RTZ A;  4B9W A;  3CCL T;  5FU6 B;  4JLI A;  1X6B A;  3AHU A;  2VGM A;  4A63 B;  4XAX B;  3IQL A;  1SEM A;  3CCJ Q;  5C0M A;  3NTH A;  3M57 A;  3MKD A;  3TU4 K;  1ZSZ A;  4PJO E;  4E7I A;  2PVD B;  4RUG A;  4II1 A;  3CCU A;  1WHK A;  2CSQ A;  2L5Q A;  1MND A;  2HQX A;  1EZZ B;  4CC4 B;  4XTV A;  4WTO B;  1WXT A;  3MEV A;  5DY9 A;  5KYU B;  2E5Q A;  2RQW A;  3M56 A;  2ESW A;  2DBK A;  3G6E T;  4MZT A;  3EG0 A;  3C4S A;  2R5A A;  4M4Z A;  3OS0 A;  4LE9 A;  4EMK C;  1GL5 A;  1CKB A;  4OML A;  1Y7X A;  2CH4 A;  4KH1 B;  2D0N A;  4M78 C;  4LD6 A;  1AT1 B;  5LJ5 j;  1BI3 A;  1T3S A;  1G83 A;  4JRK A;  3CCE Q;  2WSC E;  2COW A;  3SEM A;  2H3E B;  1OUL A;  1PD1 A;  3CCU T;  3BW1 A;  2K3X A;  2M51 A;  1UJ0 A;  4A4K A;  1M90 R;  1SHG A;  1TXQ A;  2YHT A;  2CT3 A;  1QVP A;  3QZ5 B;  3EG9 A;  3OYY A;  4PKC C;  3RUX A;  2EQK A;  2PVG B;  3L2V A;  4KUL A;  3V7R A;  1YNZ A;  2NUZ A;  2EYX A;  3REA B;  5GAO n;  2CT4 A;  1UHF A;  3LH5 A;  5LJ3 j;  4OGC A;  1M1G A;  2HKN A;  2OJ2 A;  4ORZ A;  4JDS A;  5I2M A;  1WI7 A;  1Q81 C;  1WJS A;  1PM3 A;  5KYW A;  1VQM T;  2KYB A;  3OW2 P;  4XTU A;  3JCM V;  1QVG S;  2P0Q A;  3OYJ A;  1YIJ Q;  1PKS A;  5GAN h;  2LCL A;  1UGV A;  1W4S A;  1GCQ A;  2DL3 A;  2F1L A;  4RMO A;  2DXU A;  3CCR T;  1XOV A;  4DBR A;  2KMT A;  2HCK A;  3NPF A;  1Q81 U;  2CUD A;  1QP3 A;  3EG3 A;  4RG8 A;  1JRI A;  4ZGD B;  4AT1 B;  4J9D A;  2EGE A;  1K9M C;  1VQ5 A;  2CP2 A;  1ABQ A;  2OTL T;  3V8J A;  4F17 A;  1Z9Z A;  2K2M A;  2QGG A;  2QDY B;  2QQB A;  4E7H A;  1VQP T;  3A5Z B;  4J9H A;  5GAO q;  4M77 A;  1VQN Q;  2E65 A;  2EYW A;  3BY7 A;  4QQD A;  4M7D E;  4M7A G;  1X43 A;  5A0G A;  2DVJ A;  2W0Z A;  1BBZ A;  1H64 1;  3I5S A;  3L2Z A;  4PJL A;  3FDR A;  3G1J A;  1AZG B;  2X4X A;  2E41 A;  1VQ8 T;  2DD5 A;  1F1B B;  2NYS A;  2R58 A;  2KEA A;  3JCM X;  1YI2 Q;  1YJW T;  3RKY A;  2FZG B;  4E7J A;  2RQT A;  1RAH B;  5GAM h;  2EGC A;  1YHQ Q;  4FM4 B;  2JVV A;  1LVK A;  1JEG A;  5KYN A;  3VS4 A;  2LCS A;  4PJO F;  1Y0M A;  5KYU A;  1G3Y A;  3CXC A;  3FJ5 A;  3H0I A;  1Y07 A;  2A36 A;  2IPO B;  4C92 C;  1MV0 B;  1BI0 A;  4FCY A;  2SRC A;  1TU0 B;  4D8D A;  1VQ6 Q;  2QAS A;  1N8R R;  5IH2 A;  1KC8 C;  3SHW A;  1I4K 1;  2F2W A;  4C0D B;  4M7A C;  8ATC B;  2YRC A;  1M27 C;  2DTI A;  3CC4 Q;  3ZFJ A;  1B3Q A;  2CH4 W;  2GCX A;  2KRO A;  3I55 A;  2JTM A;  4ELZ C;  3VS2 A;  1G3T A;  3G7Z A;  1PCX A;  5LJ5 d;  1NG2 A;  2RHY A;  5GJW B;  1KC8 U;  1Z9Q A;  2HZY A;  2QDL A;  2RQR A;  2LX7 A;  4ZGJ B;  4KBM B;  2OTJ T;  5I22 A;  2DD4 A;  1PC0 A;  1ZSZ C;  2DPP B;  4XU3 A;  4CC2 A;  2SEM A;  3UAT A;  2RD1 A;  1NEG A;  5CKH A;  4PJO D;  2GBQ A;  3M0S A;  2BZY A;  4BDZ A;  1YCS B;  2EYZ A;  3LWI A;  1PSE A;  4OB0 B;  3CBO A;  2GTJ A;  5LJ3 d;  3E9F A;  1TUG B;  2WAC A;  3BE3 A;  3MET A;  1JBM A;  1MV3 A;  4A53 A;  1QCF A;  5GAN e;  4F7U F;  3VRZ A;  3G4S T;  1M90 U;  2MCN A;  2QXF A;  1PD0 A;  2J06 A;  2AT1 B;  2BE9 B;  4E2F B;  3QYG B;  4AFZ C;  2LVM A;  4GBQ A;  3JCM d;  1I81 A;  4E7L A;  1B07 A;  1G5V A;  2G3R A;  2HEQ A;  3VV0 A;  1GFD A;  2LQN A;  3FRN A;  2V1R A;  3EG2 A;  2OAU A;  2ED0 A;  3VUZ A;  1PRM C;  3LLR A;  4LN2 A;  2Z0W A;  3FEO A;  3VS7 A;  3HRU A;  2DJQ A;  4ZN1 A;  4C0F A;  1IZ6 A;  4KGV B;  5KYY B;  3M4Y A;  2P4R A;  5CKE A;  4MMK A;  1H3H A;  1MUZ A;  1IO6 A;  3GF5 A;  2O31 A;  1Q82 C;  4OMQ A;  2M1H A;  2CKK A;  5GAM e;  2DIG A;  3OYB A;  1MNE A;  1YIT Q;  4B6M A;  7AT1 B;  4V2S A;  1GRI A;  4NS5 A;  3JCM Q;  2EYY A;  2F5T X;  5LJ5 g;  4BE0 A;  5D6X A;  1X01 A;  2P0K A;  1PKT A;  3BDU A;  3M0U A;  2KR3 A;  1M30 A;  1M2V B;  2PZ1 A;  2QTX A;  3CCJ T;  3VYG A;  1Y57 A;  2K5I A;  4EDU A;  1BIB A;  1Q82 U;  1R0C B;  1SPK A;  2EYQ A;  3OS2 A;  4EMK A;  4M75 G;  2RHI A;  4JRI A;  2C0I A;  3A98 A;  3DLL A;  2MWP A;  3WXM B;  4DOW A;  5LJ3 g;  3I56 A;  4MZM A;  2K3Y A;  3JCM b;  1Q86 R;  3OYG A;  4A4F A;  4M77 C;  3HKS A;  3QUI A;  3A8G B;  4F7U G;  1WHL A;  5GAN 3;  2PUK B;  5FRN A;  1RAG B;  2A7Y A;  4A4E A;  1N8R C;  5FU6 C;  1NLP C;  1LJO A;  3H41 A;  3OMC A;  3RER A;  3QDF A;  1KHC A;  1UG1 A;  2VV5 A;  4M7D D;  3JCM g;  1RAF B;  2JMC A;  3OY9 A;  2DJZ A;  1R0B G;  2CP0 A;  3CMA Q;  3CCE T;  2DXC A;  1UGQ B;  2VYT A;  3PTA A;  2ZPF B;  4DBQ A;  1FWZ A;  3EHQ A;  2BZX A;  2DXB A;  3GLX A;  4C5I A;  2QK0 A;  1JJ2 S;  2J6F A;  1FX7 A;  3CBM A;  1RAC B;  1N8R U;  2FL7 A;  3CC2 Q;  4C8Q B;  3S3O A;  4BI8 B;  2DRM A;  1VQ4 A;  3E2U A;  2MWO A;  1U5S A;  5GMK m;  1WXB A;  1ZQ1 A;  1VQL Q;  2J6O A;  5D7U A;  1UFF A;  4M78 F;  1WHJ A;  3OB9 A;  3HFO A;  1PHT A;  1SHF A;  1UHC A;  2EWN A;  1G3S A;  2RJF A;  4Z8A A;  4OMM A;  1K73 C;  1VQ9 Q;  8AT1 B;  1I8F A;  3CME Q;  1W2B P;  4N0A A;  2QA4 A;  5J39 A;  3M55 A;  1YIJ T;  3LYI A;  2EVR A;  1XQH A;  1VQO A;  2QEX A;  1K76 A;  4CRI A;  1PWT A;  3CBP A;  2RK1 A;  3X25 B;  2OX7 A;  4JS5 A;  3M53 A;  5GAN 8;  2X4W A;  5KYY A;  3PE0 A;  3CCQ Q;  1VYU A;  3NFC A;  4RTY A;  3EFS A;  3EH1 A;  3A8M B;  1CSK A;  4WF2 A;  4OVA A;  5AT1 B;  4E6R A;  2P0P A;  3NTK A;  2VXE A;  3INZ A;  1VQN T;  3TRE A;  4J8O A;  2A0F B;  4J6Y A;  1EIF A;  4OP0 A;  3H9N A;  5A2Q E;  4HT8 A;  3P8H A;  2RQU A;  5HCK A;  2E70 A;  2P84 A;  4K11 A;  4BUG A;  2RHU A;  5HY6 A;  1M2V A;  3OYE A;  2DFU A;  2M0O A;  4IUV A;  3X24 B;  4C5G A;  3CCL A;  1UEB A;  2GQI A;  1VQO T;  1AWJ A;  2RH2 A;  3CCM Q;  1W1F A;  3CCV Q;  4JPB W;  2MI6 A;  1YI2 T;  1H92 A;  1YP5 A;  3F70 A;  5A0L A;  4LDW A;  1TS9 A;  3FLG A;  1YHQ T;  4DQ2 A;  2COY A;  1GBR A;  3DB3 A;  3DB4 A;  4D6W A;  1QWE A;  2K9G A;  2BTT A;  2EJF A;  3HTR A;  2O88 A;  1I5L A;  4A4H A;  4N4G A;  1YJN A;  2KRS A;  2VAS A;  5GAN f;  3JCM c;  1MMD A;  4JLG A;  2HL5 C;  3ME9 A;  2E1H A;  2EJ9 A;  4PJO B;  1BK2 A;  4M78 G;  2DO3 A;  2YUN A;  4LDV A;  4RTV A;  1VQ6 T;  2EFI A;  4HCB A;  2EBP A;  2QQR A;  2DZ9 A;  3G6E A;  4JZ3 A;  3OSS C;  4FT2 A;  4RTT A;  1HD3 A;  2H3J A;  1X2K A;  1QP2 A;  2A3L A;  1D3B B;  2DZC A;  2J05 A;  1PSF A;  2KAF A;  3H6Z A;  3MPU B;  3CC4 T;  3M58 A;  1DJ7 B;  3ZEH A;  2ABL A;  1KG1 A;  1QW1 A;  2FHD A;  4WCI A;  1K8A R;  4C8Q A;  3ULR B;  1YJN T;  2JXB A;  4C92 F;  3PIO A;  3RIR A;  1ZSG A;  1N9R A;  1ZBJ A;  1X6O A;  5IHK A;  1OEB A;  4D8K A;  1M4Z A;  1ZLM A;  1Q86 U;  2YLB A;  2DEU A;  2HAX A;  3P8D A;  1KIK A;  4A54 A;  3SFM A;  3EGX B;  5GAM f;  3MEU A;  4M7A F;  3GPL A;  3VU3 C;  1WHH A;  1ABO A;  3RBB B;  1ZUK A;  4C0D C;  3E19 A;  2KXC A;  4F16 A;  2ATC B;  1LPL A;  3RNJ A;  3GP8 A;  4X9C A;  2OAW A;  1VQM A;  5DLQ E;  1NLO C;  1M9S A;  1VQK Q;  2VVK A;  2CGH A;  2MK5 A;  1BB9 A;  3TQ7 P;  2FEI A;  3PNW C;  4UC4 A;  3VRY A;  4NOY A;  1I0C A;  1AWW A;  2DVE A;  1QVF A;  3H0F A;  2VGN A;  2DBM A;  4FU6 A;  3E1S A;  3CCR A;  3VJP A;  3OSV A;  2NWM A;  1OZ2 A;  3OYI A;  2MPX C;  3CPW S;  2RJC A;  1N27 A;  2AHJ B;  3L2R A;  4M75 E;  1JU5 C;  3VS6 A;  2QYZ A;  2LJ3 A;  3PMT A;  1C6V X;  2DL5 A;  2NLU A;  1UJY A;  2XDB A;  3CD6 Q;  1C0M A;  4J6W A;  2OTL A;  2CP7 A;  2LDM A;  2EIF A;  1RLQ C;  4C92 D;  2EQM A;  1VQP A;  1NE8 A;  1RL2 A;  4F7U E;  4EMG A;  2YUP A;  1W2B S;  4Y91 A;  2RNA A;  4DBF A;  4FT4 A;  1QWF A;  2O9S A;  2HBP A;  4IUR A;  2L0A A;  2LC4 A;  4PFP A;  4M7A D;  3C0C A; 
#chains in the Genus database with same CATH homology
 4HXJ A;  4CC2 A;  1KJW A;  2SEM A;  1NEB A;  3UAT A;  1FMK A;  1NEG A;  1T0H A;  4GLM A;  2LJ0 A;  2GBQ A;  3R6N A;  3M0S A;  2BZY A;  1V1C A;  1M3B A;  1X6G A;  1YCS B;  1I1J A;  2EYZ A;  1K4U S;  4AFQ C;  1AEY A;  4LUD A;  4AFU C;  2GTJ A;  2W10 A;  3M0Q A;  1JXO A;  1MV3 A;  1ARK A;  1WFW A;  2DX1 A;  1QCF A;  4JJC A;  3VRZ A;  3UA7 A;  2DLP A;  1QKW A;  2B86 A;  2K3B A;  2MCN A;  2AZV A;  3PVL A;  2J06 A;  3TSW A;  4AG1 C;  4RTX A;  4AFZ C;  1JO8 A;  4GBQ A;  1TUC A;  1FYN A;  2D8H A;  2RPN A;  2I0N A;  5EC7 A;  1SRL A;  2J7I A;  1RUW A;  1UE9 A;  1YN8 A;  2H8H A;  1ZUY A;  1B07 A;  2FO0 A;  2HEQ A;  4DEY A;  2LNH B;  1GFD A;  2LQN A;  2V1R A;  3EG2 A;  2ED0 A;  1ZX6 A;  4OMN A;  3VS0 A;  1PRM C;  4OMO A;  1SSH A;  4LN2 A;  3JV3 A;  3VS7 A;  2DL7 A;  1GCP A;  2DJQ A;  2JS2 A;  2MOX A;  2FPE A;  2XMF A;  4J9G A;  3H0H A;  2VWF A;  1T3L A;  1G2B A;  2DF6 A;  2E5K A;  2A08 A;  2JS0 A;  1JQQ A;  3I5R A;  2EQI A;  2P4R A;  4J9E A;  2C0O A;  1H3H A;  1MUZ A;  2KYM A;  3REB B;  1IO6 A;  2O31 A;  4OMQ A;  2RQV A;  5IHN A;  1OPK A;  1WX6 A;  1GRI A;  2ECZ A;  2LP5 A;  4J9I A;  2EYY A;  1WYX A;  2DL8 A;  2D8J A;  1RLP C;  1PKT A;  3M0U A;  4FSS A;  3TSZ A;  2KR3 A;  2EGA A;  1M30 A;  1JXM A;  2PZ1 A;  4CC7 A;  1E6G A;  3EG1 A;  3NGP A;  2ENM A;  3O5Z A;  1X69 A;  2CUB A;  1X2Q A;  1Y57 A;  4EIK A;  2CDT A;  1S1N A;  1UEC A;  2JTE A;  4J9B A;  1NYF A;  2KNB B;  1SPK A;  3GBQ A;  2D1X A;  2DA9 A;  1OPL A;  1GBQ A;  2HDA A;  1AVZ C;  2JM9 A;  1SRM A;  2C0I A;  3A98 A;  4AG2 C;  3M0R A;  1WIE A;  1BU1 A;  5GJV B;  2GGR A;  1NM7 A;  4JZ4 A;  2EW3 A;  2DIL A;  2JT4 A;  3THK A;  2YT6 A;  2PTK A;  4X1V A;  1WA7 A;  2AKK A;  1A0N B;  1NLP C;  3KFV A;  2DYB A;  2J6K A;  2O9V A;  3H41 A;  3EHR A;  1UG1 A;  2L3S A;  2JMC A;  3M0P A;  4OMP A;  1AOJ A;  1ZUU A;  1KSW A;  1K1Z A;  3EHQ A;  2BZX A;  2EKH A;  3NMZ C;  3U23 A;  2F2V A;  1PNJ A;  1PRL C;  3I9Q A;  2J6F A;  4Z89 A;  2EPD A;  2JW4 A;  5IXB A;  4JJB A;  4RTZ A;  1UUE A;  2DRM A;  1X6B A;  2DM1 A;  1U5S A;  1WXB A;  4HVW A;  1VYT A;  2HSP A;  4A63 B;  2J6O A;  2KE9 A;  3IQL A;  4QT7 A;  1SEM A;  1TUD A;  1UFF A;  1HSQ A;  4ESR A;  1PHT A;  2KGT A;  1SHF A;  1UHC A;  4RUG A;  1WDX A;  2G6F X;  2JM8 A;  2YUQ A;  2FPF A;  4Z8A A;  2CSQ A;  4OMM A;  4Z88 A;  4CC4 B;  2KBT A;  1WXT A;  4AFS C;  1J3T A;  2RQW A;  2DMO A;  4CC3 A;  2ESW A;  2DBK A;  2DE0 X;  3EG0 A;  2EVR A;  4M4Z A;  4Y92 A;  4HVV A;  4LE9 A;  1M3A A;  1GL5 A;  1CKB A;  4OML A;  2CH4 A;  4IIM A;  1K76 A;  1M8M A;  2O2O A;  2D0N A;  2AK5 A;  1PWT A;  2K79 A;  1E7O A;  1T3S A;  2YDL A;  3PE0 A;  1G83 A;  1VYU A;  4RTY A;  2DNU A;  4J9C A;  3SEM A;  2FRW A;  1CSK A;  5IHI A;  1RI9 A;  2HBW A;  1K0S A;  1UTI A;  1X27 A;  4HVU A;  4E6R A;  4KRT A;  2M51 A;  1UJ0 A;  3NHN A;  1YWO A;  2PNI A;  1SHG A;  2L2P A;  2CT3 A;  4LUE A;  2V1Q A;  1M3C A;  2AZS A;  2ED1 A;  2RQU A;  1WLP B;  5HCK A;  3EGU A;  1YNZ A;  1QKX A;  2FPD A;  2NUZ A;  4K11 A;  3VS1 A;  2AKL A;  3I35 A;  3UA6 A;  2EYX A;  3REA B;  2GQI A;  2CT4 A;  3QWX X;  2KRM A;  1AWJ A;  1UHF A;  1W1F A;  3LH5 A;  4JPB W;  2A28 A;  1H92 A;  1YP5 A;  2OJ2 A;  4ORZ A;  1WI7 A;  1GBR A;  1QWE A;  2K9G A;  2BTT A;  2KYB A;  4HCK A;  4LNP A;  1HJD A;  1LCK A;  2KT8 A;  2K6D A;  2OI3 A;  2F2X A;  2O88 A;  4F14 A;  1EFN A;  2KT1 A;  2KRS A;  1I07 A;  3ZL7 C;  5FW9 A;  4ZNX A;  1CKA A;  1PKS A;  4RTW A;  1UGV A;  1BK2 A;  1GCQ A;  2DL3 A;  2YUN A;  1XOV A;  4RTV A;  2EBP A;  2HCK A;  3NPF A;  4JZ3 A;  4RTT A;  2CUD A;  1HD3 A;  3EG3 A;  1NYG A;  3M0T A;  1X2K A;  1AZE A;  4J9D A;  1AD5 A;  1H8K A;  5IXF A;  2EGE A;  2J05 A;  2ROT A;  3TVT A;  2DRK A;  1ABQ A;  2RN8 A;  1VYV A;  4F17 A;  1Z9Z A;  2K2M A;  2ABL A;  4J9F A;  4J9H A;  4WCI A;  2M0Y A;  2EYW A;  5FWB A;  1X43 A;  2C0T A;  2BZ8 A;  2X3W D;  2VKN A;  2DVJ A;  4JJD A;  3ULR B;  1YWP A;  2W0Z A;  4RTU A;  1BBZ A;  3I5S A;  2JXB A;  1U06 A;  2RMO A;  2YSQ A;  1E6H A;  1W6X A;  1ZSG A;  1AZG B;  1ZBJ A;  1AWX A;  4R0K A;  5IHK A;  1OEB A;  4D8K A;  1ZLM A;  1K9A A;  2MIO A;  2YUO A;  1W70 A;  2IIM A;  5FWC A;  1U3O A;  2KEA A;  1KIK A;  2KRN A;  2LJ1 A;  1VA7 A;  2CRE A;  2RQT A;  1AWO A;  2EGC A;  1T0J A;  2KXD A;  1K0X A;  2CSI A;  2ROL A;  1OOT A;  1QLY A;  2GTO A;  1JEG A;  4IIO A;  1ABO A;  3RBB B;  1ZUK A;  2LCS A;  3VS4 A;  1Y0M A;  2KXC A;  3UF4 A;  2L3P A;  3PVQ A;  4F16 A;  2A37 A;  5I11 A;  3FJ5 A;  3RNJ A;  3H0I A;  2JMA A;  2OAW A;  2A36 A;  1NLO C;  1MV0 B;  2VVK A;  2LQW A;  2L3Q A;  2FG0 A;  2SRC A;  1GFC A;  2LZ6 B;  5ECA A;  4D8D A;  1BB9 A;  2FEI A;  1TG0 A;  2LMJ A;  3VRY A;  4DEX A;  1I0C A;  1AWW A;  5IH2 A;  3H0F A;  3SHW A;  3VS5 A;  2DBM A;  2F2W A;  1OV3 A;  5L23 A;  2NWM A;  1M27 C;  3CQT A;  1JU5 C;  1B3Q A;  3VS6 A;  1N5Z A;  2CH4 W;  2GNC A;  2LJ3 A;  1GCQ C;  2DL5 A;  1UJY A;  2KRO A;  3VS2 A;  1UDL A;  2RF0 A;  1RLQ C;  1NG2 A;  2K7A A;  3QWY A;  2X3X D;  5GJW B;  1KFZ A;  1Z9Q A;  2QDL A;  2RQR A;  2LX7 A;  2YUP A;  2RNA A;  1QWF A;  2FRY A;  2O9S A;  2DL4 A;  3VS3 A;  5I22 A;  2L0A A;  1WXU A;  3C0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...